3STWA

Crystal structure of tomato methylketone synthase i complexed with 2-tridecanone
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
258
structure length
258
Chain Sequence
FVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDHVTMMSKPQQLFTTLLSIANKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Emergent Decarboxylase Activity and Attenuation of alpha/beta-Hydrolase Activity during the Evolution of Methylketone Biosynthesis in Tomato.
pubmed doi rcsb
source organism Lycopersicon hirsutum f. glabratum
molecule tags Hydrolase
molecule keywords Methylketone synthase 1
total genus 88
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3stwA00
1MNQA 1ZD5A 5JANA 4XJVA 4AO7A 1PJAA 3KSRA 5AM5A 4G4IA 1XFDA 2G5PA 2Z3ZA 5ALEA 1N5MA 1TQHA 3ICWA 5AICA 2YXPX 1Y7HA 4OUKX 1R4ZA 3R41A 1NU6A 3HRHA 2LIPA 5LZ8A 3P2MA 5AO9A 2Z8ZA 2JGEA 4AB1A 1UT6A 2CMFA 1EI9A 3WMRA 2ACEA 4NMWA 1U4NA 5T4HA 1AUOA 1LLFA 3AJAA 1W6RA 3FVTA 5ALDA 3KDAA 5EIHA 2IITA 1CUWA 5AM3A 4PO3X 3WYNA 1FFCA 3AINA 5HQ3B 1W75A 5ALWA 5LZ4A 1BS9A 5ALKA 1ZGCA 3HACA 4ZV9A 3U1TA 2O7VA 5AI4A 4DMCA 1KU6A 3E4DA 3LLCA 2GYVA 1M33A 1QJ4A 5C7YA 3S2ZA 3N2ZB 1THGA 5ISMA 2DR0A 3G9XA 1JT2A 1XQWA 2HA3A 4BB0A 2QJRA 2ECFA 1BCSA 4J03A 3G0GA 4ARBA 1ZI9A 2OXEA 3PUIA 4FWBA 4BRSA 2OAEA 3LCRA 4NZZA 4P92A 4INZA 4HXFB 3GELA 1TCCA 4IO0A 4X97A 5IH7A 3ZWQA 1LPNA 4ZREA 3I1YA 1FFEA 4KRYA 3FBWA 2VJBA 5ALLA 2HRQA 4UHFA 1GGVA 4UBMA 5E4TA 1WPXA 5A2GA 2XQGA 4EHBA 5K3EA 2GBGA 3C43A 2W22A 2AJBA 2WJ4A 2HADA 4H35A 1GPLA 3WYDA 5AK5A 4X95A 4MYSA 2C5FA 5JASA 1AGYA 3M3DA 2XMDA 2AJDA 3QPDA 4QZVA 1UKBA 4FBMA 3WKCA 3WKEA 1HPLA 2QXTA 5ALZA 5SYNA 4LXHA 4WFJA 1VZ2A 3FCXA 3WL6A 5CT9A 1XZDA 3OC0A 1DINA 4Q3LA 1YAHA 2RHTA 5CH8A 1LBTA 1DU4A 3L1HA 4C87A 2C58A 5C8ZA 1H23A 1QIIA 5AI6A 4Q82A 4W1QA 3G0DA 1MNAA 2WUEA 3VVLA 2XDWA 4QDOA 2G5TA 2H9YA 1P0PA 1JFRA 2VTVA 1MT3A 1IUPA 4B85A 4EA6A 2QKYA 2QVBA 2Q0XA 4CG3A 1QIGA 5HK9A 4UBKA 5AI5A 1QONA 2OCGA 4L72A 3TEJA 4CIBA 4ITVA 5LZ7A 4FMPA 1BRTA 5JARA 2XLBA 3LP5A 5DYWA 2Z8XA 2I03A 5FRDA 1CUBA 3DS8A 5FV4A 1ZIXA 4GXNA 3C5WP 2WLSA 4CI9A 1G4HA 4NVRA 3MUOA 4FLEA 4DGQA 4E11A 3ANSA 3NGMA 4UHBA 4KE6A 5C8XA 3Q8WA 1UOOA 3WL7A 5CT6A 2JIDA 1QIFA 2WG2A 1IVYA 1QFSA 4DM7A 3R3WA 4KE8A 5A62A 2AXEA 3WQHA 4EZIA 1DTEA 4BVKA 2ZJ7A 2ZJ6A 5HCUA 2Y2UA 2FUKA 2XUFA 3CCBA 5EIEA 2JBWA 2IX9A 1XQVA 3STTA 2P8SA 4WY5A 4OB8A 4FDMA 4BC0A 4Y2JA 1QIDA 3HXKA 4HZGA 4PV7A 2XMQA 4AO6A 1LPOA 3B12A 3GFFA 2XMZA 3DQZA 4A16A 1S8OA 3H19A 3OOSA 4OB6A 1X2BA 1XZCA 2JGFA 2WTNA 2OCIA 3C45A 4X7BA 3GUUA 5DWDA 1R9NA 1UK6A 1Z68A 2OCKA 5JADA 2XUPA 1DQYA 4X93A 5ALHA 5DTIA 1JJIA 4QDTA 4RGYA 4UHHA 4LYDA 3E1GA 4GWLA 3KWJA 3H0CA 4H18A 3F8SA 2HA0A 4IHAA 4I3FA 5CW2A 3BL8A 3BWXA 5HF6A 2OLEA 4UFPA 3G9UA 2OG1A 2ZSIA 2ROQA 3FVRA 3I2JA 4MJ3A 4Y2TA 4G9EA 1ORWA 1XRMA 1K63A 2YYSA 2XUJA 3LIPA 1ACJA 4OYYA 5F4ZA 4UHDA 3BJMA 1QGED 5C8VA 1T4MA 1OCEA 4DMKA 3CN7A 1F6WA 1QE3A 3DD5A 3IDAA 2JGLA 5DNWA 4FFVA 1XLWA 4BDTA 5AOCA 2WU4A 5I7UA 3GBSA 2X76A 5IKXA 3C6YA 4Y2QA 5AH0A 2O7RA 3VXKA 3R3XA 5JYCA 1JJFA 3ZLVA 2JGMA 4EB0A 4UBNA 5BWBA 1MAHA 3MUNA 1EX9A 3IVMA 4W9RA 1ODSA 4BZWA 5CTAA 1EHYA 5JD4A 1A7UA 3IUJA 5FP0A 2RGUA 4Y2PA 2C7BA 2RIPA 1L7QA 5CURA 4B84A 4PSDA 4K6GA 4WDRA 3M81A 1ODCA 1ZJ4A 4G9GA 4J3JA 1CIJA 4CCYA 1J1IA 2OGSA 2XUHA 4CCYB 4F0JA 2BUAA 4U2CA 3BJRA 5AK3A 1AQLA 1WB4A 2WIFA 4KRXA 4J0HA 3LS2A 3ZI7A 1K8QA 3NOXA 2WUGA 4I4CA 2JGIA 5BOVA 2OQIA 2HA4A 4Q3OA 5CXXA 1U65A 4FLMA 3IUMA 5FDFA 2EDAA 4DSZA 1TCBA 1TAHA 4G5XA 5AIBA 2PSJA 4JNCA 1R1DA 2BUCA 4AN1A 2H7YA 4OCZA 3MGAA 5KWIA 5HZGA 1CFJA 4Y2VA 2HM7A 2FJPA 5D3KA 1LPAB 4CG1A 1UK7A 5K3BA 2BGRA 3WI7A 1QIKA 2OPHA 2JGKA 3IURA 4H77A 4ZWNA 3A2LA 4MWSA 3RKSA 3G7NA 1THTA 5T4BA 2WG0A 4YX9A 3A2NA 5EHNA 2WILA 2VSQA 3WK6A 4H0CA 3QMVA 1XZHA 5ALIA 3I1IA 3UUFA 4CG2A 1MAAA 4UBJA 4DMFA 3BXPA 3D7RA 3I2HA 3WJ2A 1HL7A 3HJUA 2C5GA 1CUSA 3V1LA 1A8SA 3T4UA 1YS1X 3O95A 3HLKA 4OSEA 1G42A 1CUDA 5EIAA 1USWA 2WFLB 3B5EA 3ZLTA 1J07A 3H2IA 3M82A 1PFQA 5IVKA 3X3HA 5AKJA 2R11A 3TRDA 4GECA 4BVLA 3ZLUA 2YASA 3JWEA 3F96A 5H3HA 1WOMA 3R40A 4B9AA 1GQSA 4BE4A 4UFNA 4UPDA 4G8BA 4H7FA 4ZRDA 3I2KA 5JAOA 3BIXA 5AKHA 1ODTC 2XMCA 1A8QA 4GEGA 3IA2A 3T52A 4BZZA 3WK9A 5ALQA 3O4GA 4EY5A 1CUYA 2VEOA 3DOHA 5ALFA 5J3JA 3BIWA 1AKNA 1KEZA 4LKOA 1EDDA 1ZD2P 2WTMA 4LYEA 5HF5A 1VOTA 4EY4A 3ANTA 4X90A 5AK6A 3FNBA 3HI4A 5A6VA 2XT0A 1UK9A 1W1IA 2O2GA 3R3YA 5JATA 2ZSHA 1EH5A 3GZJA 5CRIA 3DNMA 3E3AA 4DMHA 4D9JA 2WG1A 2C0PA 4E14A 2AJ8A 1MPXA 5FPQA 2QZPA 1R3DA 4BP8A 2WJ6A 5AK4A 2J3DA 1RYYA 2JEZA 3QBJA 2RHWA 4OYLA 1IUNA 4A23A 1GQRA 4PNZA 5E4JA 2I3ZA 1AC5A 4X3CA 4XVCA 4B82A 5EGNA 1JI3A 4J0IA 4LXGA 5ALMA 1XROA 3QPAA 4UBLA 2HDWA 2QTBA 2WIJA 2XI4A 4BCCA 3VJKA 3BF7A 3A2MA 4MXDA 4KE7A 3QMMA 1CRLA 4IQ4A 1QFMA 2CZQA 4M0FA 1A8UA 1XZIA 4WY8A 4ARAA 1UXOA 4PQEA 3W05A 1P0IA 4IH1A 1K5PA 3A70A 1JKMA 3EQ9A 1K6EA 2WIGA 4HS9A 5HFNA 2VT7A 2PUJA 5AI8A 3O9VA 1IZ7A 3PF9A 4E46A 4C6HA 2Y1KA 3WK8A 4TGLA 3C5VA 3FYUA 3DOIA 2UZ0A 4H7JA 4CFSA 1CUCA 1B6GA 1XKLA 4L3WA 1RP1A 1ISPA 5K3CA 1SFRA 3D2AA 1ZOIA 4AMZA 1P0QA 4ZXFA 3O4JA 1VE7A 4KJXA 1XZJA 4BCDA 4X6YA 4W1RA 1ZD4A 1MX1A 5CMLA 2BJHA 5FXMA 2AJLI 5AHXA 2PSEA 4MEAA 3WK7A 2VAVA 3DL4A 2CJPA 3D2CA 5ALOA 1G5FA 3WK4A 1E5TA 1EVQA 3WWOA 1LPMA 4U2DA 2QXUA 2H7XA 2XE4A 3V9AA 2CB9A 4FFWA 1ZGBA 2HU5A 3WLAA 2XQFA 3QYJA 2XLCA 5ESRA 2HFKA 4WDQA 4Y2UA 2XUKA 3RM3A 2V98A 2IIVA 3QVMA 3D0KA 4KACA 4B0OA 1EXWA 2XMBA 1TIBA 2WHPB 5IVDA 3W9BA 4L9AA 3ESAA 4U2FA 1UOPA 2XMGA 1YS2X 3Q0TA 1O6GA 4BVJA 3FLBA 1LNSA 5HFAA 3DL7A 4HXEB 1XQXA 1Q0RA 5T4FA 1XLUA 4KE9A 5CT5A 1UZAA 4Y2XA 5AM4A 5AOAA 3STWA 3W9UA 4J0CA 2X8BA 3VKFA 5CBKA 2AJCA 3DKRA 1K4YA 4G8CA 1FFBA 1FFAA 3RARA 3O0DA 3HYSA 1LBSA 2XB6A 4OB7A 2J4CA 2GZRA 5FPPA 1E8NA 4N5IX 5IVIA 1EK2A 2E3JA 4TPKA 1H2YA 1YA4A 1LPBB 3H04A 4MQMA 5SYMA 4DNPA 1ZICA 1TRHA 2DHDA 2BCEA 1CEXA 4FBLA 2QM0A 1JMKC 1UKAA 3WWEA 4BAUA 4X91A 4BDSA 3BF8A 4GW3A 5FKJA 1XZLA 1UKCA 1QOZA 3W2TA 3TJMA 1NX9A 1DWPA 5ALYA 3ILSA 1QIHA 1TCAA 5BV7A 4LIPD 4MYDA 1X2EA 2Y2VA 1VA4A 4LHEA 1CUZA 4KAAA 2GBFA 3O4HA 3OURA 4N5HX 4PF1A 3W06A 4QNNA 3K6KA 1E3QA 2WU3A 5A71A 1GPKA 4ZI5A 3KOOA 4B7ZA 5LZ5A 1QTIA 2EDCA 1CUUA 4U2GA 5ALRA 1YR2A 4AQDA 2ZVDA 4WFKA 2PM8A 2PBLA 4DNFA 3H1AA 3STVA 5LIPA 1WM1A 4EBBA 1FJ2A 4Y7DA 5AKLA 3RK4A 4JUIA 5JAHA 3G9ZA 3H2KA 1DQZA 5JAPA 5DJ5A 5JD5A 1QIMA 1QIEA 2XMSA 1SC9A 5EHXA 3H2JA 4FNGA 5AKKA 3EQ8A 5AKZA 1JU3A 1ZI8A 4KAJA 3C6XA 1XKTA 5LYYA 1IMJA 1F8UA 1SCIA 3STYA 1ZIYA 3AZOA 4C4YA 3N0TA 1F0PA 1AZWA 4JH0A 2ZYHA 1CUAA 4UHEA 1YCDA 4ZV7A 3DLTA 3YASA 1XRNA 1AURA 3CCCA 5HKBA 4N8SA 4HRXA 2GZSA 4FHZA 1DX4A 3BDVA 2O2IA 3C6BA 4G4JA 4XWGA 3L1JA 3R0VA 4E15A 3PF8A 1RWQA 2B9VA 5DYTA 1LPPA 3QZUA 3R3UA 4QWWA 5AOBA 4FKBA 1UK8A 2J4FA 3IBTA 3AUKA 5LZ9A 3STXA 2RONA 4B81A 4P9NA 4B80A 1MTZA 1ETHA 1HDEA 4OD0A 3C70A 1E8DA 1VXOA 3MVEA 4K2AA 2HHAA 3FSGD 2DHCA 4WFIA 3FSGA 1XZEA 2BUBA 2B4KA 2PVSA 3ESCA 1BROA 3EF3A 4QDUA 1WCYA 1AX9A 4HRYA 2WUDA 3IB3A 5ALTA 4X00A 1CUJA 5JAUA 4ETWA 1ZD3A 1MU0A 5ALPA 4HTAA 3G0CA 3BE8A 1CUGA 1HKHA 1XZFA 1N5RA 3V1KA 1C7IA 4X71A 3H2GA 2C0QA 3FCYA 5CT8A 2JEYA 4Y2YA 4S0XA 3WK5A 3D4LA 4DTCA 2OGTA 1Q83A 4JYMA 4QLAA 3VDXA 2XQIA 4ROTA 2I78A 4ZGBA 1EK1A 4B6GA 2DSNA 4H7IA 4H7KA 4RE6A 1VKHA 2CBGA 3FYTA 1SOMA 2H1IA 4HAIA 2NW6A 3IIIA 2HA2A 3F67A 4W1SA 5EI5A 5JZBA 3BDIA 5ALUA 5EHZA 4C89A 1CUEA 5E4YA 2GYWA 2QUAA 2Y6VA 1GT6A 2QT9A 2VT6A 1GZ7A 2O2HA 5AI0A 4PSCA 1Q84A 4RE5A 5ALNA 4XIIA 1WB5A 1EA5A 5K5EA 2B61A 4G1FA 1XRPA 3G9TA 4K6KA 1R9MA 3FOBA 4CCWA 4DYHA 1XRLA 2VAXA 3UMJA 5ALVA 2GBIA 5AP9A 5KREA 2WQZA 2BGNA 2Y6UA 3WA7A 4UBOA 1H22A 1HLGA 3FWHA 1CR6A 2ES4A 4YK7A 2QJWA 3DYIA 5FLKA 3I2GA 4UUQA 3H18A 1BEZA 2K2QB 2WJ3A 4BATA 5HQ3A 4F21A 5A7GA 1XRQA 4Q1VA 1SCQA 3KD2A 1GKLA 1OXMA 1QIJA 4KEAA 3RLIA 5AM1A 4DSAA 2I3DA 1BN7A 4HVTA 1VA5A 1J2EA 1JU4A 1PV1A 2VJAA 2C4HA 1H2ZA 4A5SA 4QE3A 5LLSA 2OCLA 3NWOA 2OAGA 2ZYIA 5K3FA 1BU8A 1QZ3A 4C01A 3ZPXA 2RAUA 4BRZA 4KAFA 1UOQA 1A88A 4HXGA 5KBYA 2XUQA 3ESBA 2XUAA 4Q34A 1LGYA 3OG9A 5JZ9A 2VATA 5IVHA 3JYHA 3AFIA 4GLBA 6YASA 4QA9A 5DNUA 2BFNA 5JZSA 5T4EA 2GBCA 3WJ1A 2WFLA 2XUDA 3ICVA 4WCVA 4QLOA 4OU5A 2HL6A 4GI1A 1SCKA 1ORVA 1YASA 2QS9A 4X85A 3LIIA 1LZLA 4C4ZA 2HA6A 4DLNA 2CKMA 5DLPA 3C8HA 1FSSA 1TK3A 2ACKA 1P0MA 3I2IA 2WIKA 5LZ2A 1MJ5A 3FLAA 5ALSA 4EUSA 2WSLA 2QOEA 1C7JA 2WM2A 5C81A 3VVMA 4BTLA 2VF2A 2VA9A 2HRRA 1XZAA 5AIAA 4BYMA 4J0KA 5ALGA 3AZQA 2HA7A 3AIOA 1T2NA 1VLQA 1IUOA 1BN6A 1H2XA 2RI6A 4F60A 1NU8A 2XQKA 5CT4A 5CH5A 2EEPA 1FFDA 1UWCA 3D59A 4X92A 4MWTA 2W6CX 2BAGA 1CUIA 3SC2A 2ZYRA 2DCMA 4L0CA 4PW0A 4Z49A 1CQZA 1XRRA 2HU8A 5EFZA 1U8EA 4FLFA 3NUZA 2PU7A 1YAJA 1DT3A 4MEBA 1JMYA 3S8YA 2WFMA 4AMYA 4OPMA 1CUXA 3L1IA 1OILA 3WL8A 4RNCA 3GROA 3AILA 3G8YA 5AKEA 4QDXA 1YB7A 4UBIA 3EQ7A 4AO8A 4EY6A 5A7FA 4H7DA 2XQJA 3KXPA 5LP1A 3GA7A 2ZJFA 5LKAA 1IZ8A 3K9BA 2WUFA 3PDCA 4BE9A 5D3ZA 3OTQA 3AIMA 1KU0A 4FNMA 5K3DA 3QITA 4Y9SA 3WIBA 1VXRA 1O6FA 1W76A 2QMQA 1EB9A 4M0MA 4Q05A 3CN9A 1DT5A 3WKBA 1GKKA 2Z3WA 1BE0A 2Z5GA 3C6ZA 3WKAA 1HQDA 3DDUA 2WIDA 4DIUA 2ZYSA 3STUA 4W63A 2V97A 2WFZA 3HABA 4JYPA 1XZBA 4V2IA 1B41A 3I6ZA 1VZ3A 4B83A 4X6UA 5I9IA 2OGZA 5E2IA 3U0VA 2QR5A 1EDBA 3IUNA 5AKIA 4G8DA 1CUHA 3K2IA 3IUQA 4DNOA 3QMWA 5DYYA 4FOLA 2JGJA 3C87A 4AZ3A 3WWPA 5D7BA 2FX5A 3I28A 1F0NA 5HKAA 1BEEA 3KWFA 1W52X 2WHQA 4KR0A 3SX4A 3H2HA 3H17A 1XZKA 2VQ6A 2XMRA 3DCNA 4P93A 1CPYA 1CVLA 2OQVA 4J0JA 4CIAA 3UUEA 5HF8A 3FYUC 5DNVA 2PL5A 1MX5A 3HSSA 3EIOA 1R88A 3OM8A 4J7AA 3V1MA 3I6YA 2XUIA 3QH4A 4BBZA 3D3NA 2WHPA 3EBLA 4B9EA 3AIKA 1UFOA 3F9CA 3R3VA 2WKWA 1R50A 3PUHA 4GHWA 5DTJA 1CLEA 4GBGA 2ORYA 4YPVA 1CV2A 2YH2A 1YA8A 3W04A 1CQWA 3DJYA 3D5EA 1H2WA 1QTRA 1U2EA 2V9ZA 2HIHA 3SK0A 5AKGA 2FJ0A 3FAKA 4H7EA 4M0EA 3G0IA 4B0PA 4K6HA 1I6WA 1E89A 4KYVA 1L7RA 2XUOA 3WIOA 1EVEA 1LZKA 3V1NA 1WHSA 1DWOA 4AX4A 3VJMA 4AXBA 2BKLA 4Y2SA 1MN6A 5CXUA 2ONCA 2PPLA 4EY8A 1Y7IA 1XZGA 4XX1A 4H7HA 3PE6A 4Q3KA 1CUVA 3ZV7A 1GXSA 2PUHA 4QWMA 1WB6A 5AKYA 4TVKA 3QM1A 4AN0A 3DKKA 3ESDA 4U2BA 2HA5A 2G4LA 4K5QA 3PI6A 4BAGA 5A7HA 3V48A 1ACLA 1CUFA 2QUBA 2D0DA 1ZI6A 2HU7A 3C8DA 1XQYA 2VJDA 2J3QA 3HEAA 3IULA 7YASA 5HF9A 3WWCA 4UHCA 2PSFA 1Y37A 5FUMA 3CXUA 2CEKA 4MQLA 2DQYA 2PKYX 4Y2RA 1JJBA 3AZPA 4BCBA 3I6MA 3WWDA 3G0BA 4X6XA 5AJHA 1DWQA 3HC7A 3O9MA 5LKRA 1QO9A 1Q0ZA 1WHTA 4FTWA 4U2EA 2GYUA 1MO2A 4W1PA 4BP9A 4GDMA 1L7AA 2PSDA 4OU4A 5K3FB 1C4XA 4J0GA 1EDEA 3I2FA 1DX6A 4N8EA 3PICA 1MX9A 3A6ZA 3F98A 1ZJ5A 4RPCA 2DHEA 4IH4A 4LXIA 5AM2A 5ALXA 3QPCA 3VJLA 4C88A 2HFJA 1BCRA 4J0DA 3B3QA 4AZ0A 5EHQA 4G4GA 1N1MA 1VJ5A 3TGLA 2PSHA 5D6OA 4IH9A 2WHRA 5BWCA 4DNQA 1AMNA 1XLVA 3O4IA 5YASA 4BAZA 3FYUB 4PSUA 3SWWA 2D5LA 2CUTA 1E66A 3H1BA 1E8MA 4I19A 4NS4A 1HBJA 5AI9A 2X5XA 1J06A 1YB6A 1QLWA 1YSCA 3G02A 5JALA 2QRUA 2PU5A 3PFBA 3ED1A 4QEKA 1GPNA 2H7CA 1G66A 3M83A 2R8BA 2DQZA 3F97A 5JD6A 5ALJA 1LPSA 3FLEA 5AKXA 3E0XA 4X94A 1TKRA 4WJLA 1QO7A 3WA6A 3D2BA 4UFOA 2VJCA 3DYVA 4QDZA 1EINA 2XUGA 3VISA 1VE6A 2JF0A 5CH3A 1N8SA 5JIBA 4O08A 5I8PA 5HK8A 1X70A 2DFPA 2PX6A 4F5ZA 5FOQA 3PFCA 4C4XA 3R3ZA 3WZLA 3WZMA 5KWJA 1D07A 3WL5A 4P08A 4YASA 5K3AA 4BC1A 2V96A 3DEAA 2G63A 4BTVA 3HZOA 3JW8A 4EY7A 1WPRA 3OPMA 1XZMA 2B20A 1EB8A 1W4LA 5AM0A 4JEIA 3WKDA 4N8DA
chains in the Genus database with same CATH superfamily
2Q8NA 1TO1E 3ZI4A 4U9IS 3GCGA 1EQ2A 4HFJA 3RSOA 5ICSA 5C0OE 4XJVA 1U0HC 4QXQA 4A1FA 4TMTA 1GG9A 2Y1XA 3NOQA 4YRFA 2WJPA 2PYZA 3BGWA 1GD1O 4EYEA 2HU2A 4PYMA 1RJDA 5CVEA 1XFDA 1Z6TA 4EYQA 4MP3A 4B3TB 1T24A 3LPMA 2Z3ZA 1TM2A 2B4QA 4PLGA 1VG0B 1R6DA 3D0RA 4OBXA 5CITA 1TQHA 4C0HA 3VAYA 3O26A 2YXPX 2WABA 3AB3A 5H5JA 1TA4A 4O4HF 1U2GA 2Q6VA 3GZTB 4MGEA 3RANA 4M0CA 3DEIA 2YWFA 3Q0IA 4GZMA 3I34X 4NAHA 4OUKX 5COBA 3W6ZA 4R2IA 3P0JA 2BGWA 3OZIA 1B3RA 4PC2A 2WJYA 2OBMA 3BFVA 3ZWNA 1U0GA 2LIPA 2RBGA 3B6KA 4JA0A 3GPLA 1DPFA 3PWKA 1M2GA 4PFKA 2VBFA 2O2ZA 4MR7A 4CJXA 4X84A 4PHTA 2PUCA 2JGEA 4EHHA 2CMFA 2EJCA 3D3WA 3VC1A 4DR2B 3ZEAA 1TMKA 2D1YA 1F2UA 1X1AA 2AJTA 3DZIA 1Z4IA 2JAXA 2ENWA 3KVYA 2FMXA 3KXIA 2R6AA 3EVGA 3L4SO 4IEFB 4ROSA 3DDCA 4WK4B 3V6MA 3WBKA 5B3LA 5T4HA 1AUOA 1LLFA 2IZ7A 3KTAA 3ORRA 4RK5A 2A4KA 1R4MB 1W6RA 2IQ5A 2ZSAA 3G7UA 4NFHA 4YAFA 1VPDA 1Y7LA 2XEXA 3IVXA 4OJTA 1GV1A 2K5UA 4EP1A 2V74B 4CLXA 4WQMA 4EWLA 5AM3A 1KI2A 4PO3X 3L0BA 4RKRA 3VC3A 1VCMA 1UBCA 1NWCA 2CVPA 2RFLA 3CONA 4JCCA 3WYNA 1ICIA 3B2NA 4G1MB 4YA6A 4ER7A 1Z4KA 5IAOA 4EB3A 2VHJA 3UM9A 8ADHA 3AINA 5KHOC 4EVQA 5D86A 2QU8A 2ZJ2A 2OYCA 4G0PA 3IUEA 2GYYA 2Z83A 1SCUA 3U37A 4B3CA 3MMPA 5I7EA 3EGCA 1YFKA 5LZ4A 1J33A 1GL3A 2XW6A 4MLZA 5FUWA 2H5IA 1TEXA 4LMAA 4FPXA 4AU1A 2NT3A 1L9KA 1F2TA 5HMMA 4IDEA 1KDZA 3T7AA 3ZU6A 3A6HA 5FPYA 1HDIA 1CJMA 1M2OB 1UT5A 1XTUA 2IEBA 3EIUA 3I0NA 5D5HA 3THSA 4JC8A 1LI5A 1TIPA 2P0EA 1NNSA 4RHFA 3VA7A 2RD2A 2ISQA 3I52A 4Y6GB 1Y9AA 1HDYA 1KU6A 3ANYB 4Z3OA 4JVLA 4YI3A 2VQFB 5L51A 3IPYA 1Y82A 2WA1A 3FPLA 1RPNA 3R0JA 1M33A 3TE7A 4DT1B 3KT8A 2R6ZA 2ZWPA 1E2IA 1O95A 4C0QC 5BVHB 1V41E 1E6LA 4PGAA 3S2ZA 1IPHA 2G9RA 2KYRA 5ELMA 4O6VA 3NP9A 4Q1DA 4UDYX 3ZYCA 2VQEB 1K5GA 1QV9A 3QENA 1CBUA 1JT2A 4DIBA 3PL5A 3KDSE 2IELA 2WTXA 5EQDA 2O9JA 1XCOA 1JZSA 2A0YA 2HA3A 4C0BA 2FTKE 3M4XA 2EJBA 2F62A 5HM6A 4MQBA 2ECFA 4EHFA 2H1RA 2BGJA 1BJTA 2GCGA 1OAKA 2WJZB 4Y6OA 4JC5A 5FOUA 5H0IA 5T6BA 1N3LA 2BKVA 3IB6A 4H2DA 3V8RA 4IAOA 1GRCA 3PI7A 4IDBA 5FLEX 1ZI9A 2GN8A 3BDAA 4XB1A 5AJUA 2OXEA 3DPUA 2Q49A 4AD8A 2OAEA 2FW0A 3PNYA 2Z56A 5TPZD 1YA6A 2F8MA 5FYDA 1E6UA 5K8IA 1N5IA 3K1YA 4P92A 4BKQA 5BNZA 5LFAA 2B4TO 1YONA 1ZQ9A 1ESZA 1X15A 3AU9A 3AVWA 4INZA 2ARKA 2PZKA 1FU7A 3TJRA 2QE7D 1TCCA 1AQIA 1FQWA 1U3CA 2CJWA 4MRMB 5KSPA 5CBPB 5I8WA 3HVIA 3SEQA 1TRKA 5BN4A 3IX7A 1LPNA 1AV7A 3Q7EA 3X1MA 2YRFA 4RCVA 4KRYA 4RA9A 1ZKDA 1BYIA 4XDGA 2Z4TA 4DV1B 2C9MA 3H3JA 2LE0A 4HGOA 5A3JA 1NJ1A 3H3FA 2GEDA 2OD7A 3G3EA 4JOSA 1K5HA 3S1SA 4EHBA 2O52A 1BDHA 5CK5A 1L3IA 2COUA 2FPGA 3C43A 1ZH2A 2J7KA 3KIPA 4NBVA 2I87A 4CQMD 5JVDF 1RI4A 1U1DA 4X7MA 1X3SA 1UJ6A 3E7WA 2ZRJA 3I4CA 2HADA 2HPVA 1NFRA 4H35A 3FSRA 1G55A 4NPAA 2R47A 4UAGA 1G0OA 3OJLA 4E5SA 1U9YA 4X95A 1ND6A 1WO8A 5KDOA 2Y66A 4B7AA 1GCGA 2VWGA 3M3DA 2O23A 3VDRA 2EZUA 3UWKA 1AMUA 1OJLA 1A7JA 1KMQA 2AJDA 5DMHA 1PKEA 2P3OA 3EB9A 5HIMA 1NXTA 3BHJA 5I5GA 4DUGD 3HWSA 4WINA 3WKCA 3WKEA 1E2HA 5C46F 2V7BA 1S1MA 1O87A 3ASYA 4AYTA 3MWLA 1KJ8A 1W96A 4UUOA 1DJMA 2CZCA 2XCUA 4NK5A 3QX9A 3ZWOA 1XPJA 2BFPA 4MVJM 4TTTS 4BN0A 1RVV1 3DR5A 2V7QA 2HCRA 3KV1A 3PNQA 4LQDA 2PK3A 1FTNA 2AN5A 2YJ3A 2ZYDA 1MIOB 3DDZX 4LWQA 4M99A 2EQAA 3WL6A 1U3GA 3QVGA 2Q1YA 1EK0A 4RQAA 1DINA 1G5PA 3TLMA 1FP4B 5CJJA 4D42A 4EO7A 1EGAA 3Q11A 4DM3A 3ZV6A 2POQX 1C3OA 5EUBA 4F9TA 3HCPA 4TWZA 3S1LA 3EIWA 2H4HA 3DXXA 3L1HA 4K6MA 2C58A 4DLKA 2UAGA 4XH9B 4RTSA 4TKVB 3KQVA 3WQRA 1I3LA 1KPGA 4JUBA 3AEYA 4PFSA 4S1TA 1Q1EA 1H23A 2O50A 2R9VA 2XGSA 4JT2A 1Y4SA 2QVLA 1WMSA 4MO9A 1MW8X 5GTDA 1RDFA 4MYUA 3SXJA 2B2CA 5EQFA 4QDKA 2PZ8A 3LLSA 4R05A 5JPIA 5KYUA 3R20A 3L6EA 1IN6A 2ZE8A 3RTCA 2DWQA 1WW8A 1QP8A 4YAOA 5C8YF 2JD2A 1FZTA 5L7TA 1M1ZA 1FP7A 2IEGA 2XA2A 3LF2A 2Z6UA 3C6QA 1QPZA 5EKTA 4M89A 1Y5IA 5IFKA 4LVUA 4B85A 3HU2A 2QV0A 4KX5A 3UMRA 4PX2A 2QVBA 3PHJA 1BE8A 1PEDA 3TKAA 3K4QA 2R68A 1KIFA 3VPBA 4CG3A 2AN1A 5J2TB 5HK9A 1BJRE 1SCAA 3OEYA 4QECA 5L6LB 1JDJA 3LKVA 1TVCA 3FMOB 4M46A 5AI5A 2RHOA 4ASUA 1UP7A 5CCEA 3M33A 5EIFA 3LHFA 3TEJA 4CIBA 5KU1A 5CP8A 1UCFA 3Q6NA 1UMBA 1NJ8A 4JR2A 4A26A 5TPWB 4ITVA 1WXDA 3F1LA 5JZOA 1Y8RA 4X9XA 2W2PA 1XCPA 2XR1A 3M6IA 3M4YA 1A9RA 4M6WB 3VU9B 2CE2X 5CU7A 2GNPA 5JARA 4N7JA 4Q93A 2I03A 4F4IA 7ABPA 3BJEA 1BA2A 1T2EA 1ZIXA 4JEUA 4YAJA 4P0PB 1DCTA 5BR4A 3GU3A 4WV3A 3TTVA 1LH0A 2ODTX 3VR0A 5BW4A 1PUXA 4MICA 2ZI9A 5SYAA 2R1VA 1AG9A 3I6QA 1D6JA 3DVSX 4N01A 4NBSA 3KTOA 5CD1A 2XNHA 1ZCJA 3RGGA 3FJYA 5M04A 3CKYA 4JI3B 1XO1A 5KAPA 2GQ0A 3ANSA 8LDHA 1ECCA 4ZP1A 3Q8WA 4DJJA 1CCWA 1M2HA 2QRQA 1ESEA 2IHJA 3WHLA 4DEXA 3L0SA 5CT6A 4TWJA 2O2YA 2PNFA 1KJJA 4ZDJA 5J23A 1WXGA 1BEUB 2DUUA 1USGA 2AI1A 4KXMA 4G41A 1YUBA 2WG2A 4URUR 2D2VA 5DYGA 3EZLA 1HNZB 2VJNA 5ECGC 3KSAC 4EITA 1Q0QA 2IXEA 3R3WA 3B1JA 4KE8A 5HR5A 1SQSA 2EVWX 1AHNA 2XSZD 2BC9A 2AXEA 4MRMA 5A62A 1RKUA 4S1OA 1R8QA 4MR9B 5JYDA 3ILXA 1DTEA 2WYHA 4QTTB 4URZR 4BVKA 4LNHA 2ZJ7A 1JKJB 4MV8A 3N8KA 2Y0BA 1N2CE 4K7JA 2XHZA 1NULA 2OHVA 1PNQA 3MOIA 3TVDA 2HSZA 1JQAA 1UWLA 3W7AA 4E33A 1JP7A 3E22A 1WMEA 3R5KA 2EZ9A 3KFVA 1QUFA 1RIIA 3RS9A 1NY6A 3ACBA 2IX9A 3GUHA 3R2JA 2HT6A 1BXKA 1JSCA 1L4YA 1URPA 2QUZA 4YCLA 1C0PA 1V5EA 4ISBA 3MSXA 3IGFA 4US0R 4TLBA 4BQRA 3GLKA 1U8FO 1ZH4A 2B4AA 3KQWA 3PRYA 4FDMA 1N9GB 4LGCA 5E7IA 1D3AA 3I8XA 4Q9LA 3HYLA 3NC1C 4K81B 4R81A 5FAKA 4Y2JA 3CMMA 4NOLA 1C0KA 3GJ3A 4BKPA 1U5BA 2GAJA 2C07A 4YMLA 2K7FA 2F8TA 2AYYA 1KK2A 3N0WA 4UUPA 1KJYA 4B7XA 3EOAI 1OPXA 1QH9A 2CK3D 2FA9A 2PS9A 1UANA 1VIVA 3H0KA 4P6VF 1O6CA 1VL1A 4UTNA 3FOZA 5IK2A 2QL9A 5JFGA 4ZPJA 5F2EA 4R41A 3DQZA 2NSDA 3KOYA 5FFNA 2BFCA 2ZJ1A 3WXMA 1RYDA 2FWRA 3DFKA 1V8ZA 2ZSUA 3NOOA 4OB6A 4YP9A 3WLRA 1XZCA 4HXYA 5KMGA 2WTNA 2ZZNA 4K0KB 5HHTA 2YBDA 3OM9A 5DWDA 4NCXA 1R9NA 2GNOA 1POXA 1Z68A 3AHEA 2NO7A 3BWVA 3IAUA 3OMLA 4U63A 1KEKA 1VSVA 1X9IA 4JYBA 4X7RA 2WT4A 3ZZ0A 2OCKA 3SZMA 3CLRC 2CBZA 5JADA 3KE8A 2H1FA 3GEBA 2GD2A 1RM3A 4O59O 3ZW8A 2XUPA 4K9NA 4M0KA 5PGMA 1BHSA 2A14A 4NJMA 1EFPB 5ALHA 2VHZA 2C3PA 2APJA 4IZHA 2W58A 4FSXA 5DTIA 1J00A 3TFOA 1INLA 1T9AA 4K87A 4DHEA 1WD7A 2W42A 3N2KA 3GDHA 3C16C 4RGYA 2PCLA 4BBAA 3H9BA 1QPBA 3O2JA 3P2KA 1CZKA 4NEGA 3VO8A 1Y5MA 5MN4A 2DKOA 5LA6A 2PQ2A 2GAIA 3P9ZA 4UHHA 3EGXB 4LYDA 5IYZB 3IAHA 1MAWA 2A3RA 3F9IA 3I37X 3PQ7A 1NXVA 1VBMA 2O06A 1GAWA 3FUCA 3KWJA 4CMAA 4ZFNA 1OLXB 4V38A 4QOJA 2JFFA 4B3JA 4BX9A 1ZJZA 3H0CA 2VYCA 4S2EA 1P62B 3BZBA 4EPTA 2ET6A 2PBZA 1SEVA 1VKOA 3I9V1 3OY2A 3TJZA 2HA0A 1EG7A 1ZGGA 3K0AB 4KFUA 4CF5A 1XVLA 2YXLA 3BWXA 3EY9A 5HKLA 1PGQA 1Y9DA 5LM3A 1IY9A 1X7WB 5TX7A 2NXCA 4G5FA 4MRAA 1JF8A 2ZSIA 3H86A 1JDBC 1ABFA 2GM3A 2ROQA 3TIGA 4YDQA 2CLKB 2QGFA 3I2JA 1CY2A 4QQKA 3PC7A 1R0CA 1YB5A 3W6OA 4Y2TA 4QYTA 2OP1A 4MP6A 5JEDA 3IP6A 3IR5A 1NJ2A 4AM8A 1ECLA 1P19A 2GR9A 3MJFA 1E3IA 1H0HA 4AURA 4NZNA 2H57A 3OCVA 1GZDA 2CDBA 4LBYA 5AW1A 1XZNA 4QBIA 1KYVA 1QGED 3TUJC 2H9AA 4DLPA 1P9OA 2QBYA 4RESA 4ZMSA 4KJZA 2NPOA 2P62A 5C8YB 3V1YA 1RZRD 5ELLA 3M6FA 3TINA 1J39A 2O1EA 4YHBA 4BNZA 3TNFA 1S4QA 1T3LA 3UUWA 1FC0A 3TS1A 3OOWA 5KTPA 1CJKC 4O2RA 1K9SA 1F6WA 1M83A 2BGUA 4FZRA 1C4KA 2P9YA 2C83A 4RD4A 4MCHA 4KIFA 1YJ8A 5K0LA 4FONA 5B2ZA 4YAEA 4CM9A 4WXMA 3BYZA 5D8DA 3UXHA 4WZBB 2ZS9A 4G1BA 5CLQA 2B7LA 3GRRA 3E27A 4NCJA 3LUFA 1RM4A 2O2SA 3G85A 3PUKA 3RRNA 3IKJA 4J0EA 3VAAA 1I9CA 2IH4A 1AHHA 2R6GA 5J47A 3VXKA 1E3WA 2AQHA 3IS3A 1SUSA 2FJUA 5KX5B 1B2RA 2JGMA 1VRCA 1RVDA 3V32A 4KIWA 4BOYA 2Q2WA 1IMOA 3KYDB 1I3OA 3MUNA 5EZ5A 4FMBB 5IAJA 1X6VA 1P5FA 1P3DA 2RGEA 2VXOA 2FPWA 5C1OA 1NVTA 1W35A 4P54A 4W9RA 2GAFA 2LCQA 3F3MA 1GG5A 5CTAA 5JD4A 1YI8A 5HJ5A 2ECOA 4WLVA 1LUAA 5TQVA 2QM3A 2DFTA 4Y2PA 5FP0A 1IBSA 3D7KA 2MTBA 2W70A 1CZOA 4WW0A 4E32A 3P71T 2ZWMA 2RIPA 3TXAA 6AT1A 1DOHA 1KMNA 2P9JA 3M49A 3OFJA 1L7QA 5J2UF 3L93A 4N03A 4B84A 3RVLA 1HOXA 2CNWA 1XJ0A 4D4GA 2Q62A 2BW0A 3MEQA 4F3KA 5KQPA 4PSDA 5FTLA 2F1JA 2JI8A 3CUUA 3KQSA 5GQSA 4TLCA 3EDCA 4J3JA 4N39A 3SQLA 5CEEA 4EA7A 1CIJA 3GRKA 4PO8A 4RMNA 1J1IA 4BMCA 1PQWA 1QGAA 3W5HA 3AM5A 1SUAA 4E5DA 3B9QA 5IBPA 2WSYB 3RV3A 5JNRA 2B69A 5AXBA 3MBOA 3AL0C 2PTGA 3W5JA 1Q16A 4U2CA 4XLLA 3T15A 2VWPA 3N8HA 4CU2A 4HQNA 1AQLA 1UXIA 1WB4A 2V4UA 1UKYA 1JTEA 1GUDA 4KRXA 3UG7A 2G5CA 4EGFA 2YC2C 4NJMB 5KB3A 1CU1A 1TK9A 4ZEWA 3RT1A 2J09A 2XAAA 1DO2A 1JBKA 3OHPA 4JJ6A 3ZGXA 8GPBA 3H9UA 3N53A 5GGYA 5AVSA 2OQIA 2C5BA 2HA4A 1NA5A 1MRSA 2P0AA 2HJHA 3AVTA 5K51A 3TDKA 1U80A 3WTCA 2DQ4A 2ORIA 3I83A 1ILEA 2SCUA 3IQHX 1W4BA 2E87A 4LPKA 5AIBA 2ZBFA 1OHHA 5EGSA 4BP1A 4ZOQI 3IQGX 3JASB 1QMPA 3A1TA 2O8EA 1S9HA 5C52B 621PA 2R87A 3HPQA 1H3FA 1VBNA 2EBFX 2H7YA 2IUYA 3PC2A 1FS4A 3MGAA 4HK4A 4MKXA 3U9TA 4B3XA 4F4DA 4YXFA 4F4HA 1ZN9A 2I6XA 2UYHA 1DTWA 3D0QA 4Y2VA 2V7QD 4U6NA 5IRCD 1NY5A 5FFMA 1NDUA 2O05A 4FGKA 2OCAA 2HM7A 2YWHA 2QQGA 3FB1A 4K9DA 3SYTA 5C1PA 3CRNA 4C29A 1LPAB 3WYAA 3T3MB 3GLQA 1UK7A 2NU7B 4B1FA 3FCEA 3EA5A 3TMYA 5K3BA 2BGRA 3MA0A 4DMCA 4LJRA 3WOVA 2ZRMA 4BJ5A 4L22A 2P3SA 4H77A 1RC1A 1PHRA 2I71A 3GJRA 4XB2A 2C2XA 1SKBA 4ZPXA 3N5CA 3SEFA 5CIYA 1SXJA 1GPJA 5G3ZA 5KSYA 4B3GA 2FMKA 3RKSA 3GRZA 3F7MA 2WG0A 3AR3A 3A2NA 5KQMA 1C7RA 3WLKX 2WILA 1TMOA 1ZA1A 5COQA 1JQLB 2J3LA 2RGWA 1J25A 2WM3A 3GPBA 3N8IA 2FWAA 4H0CA 4ZAFA 5CNJA 5ALIA 1SHZA 3KJHA 3OA0A 2O8FB 4D9GA 2G1KA 4IW3B 1MAAA 2A4MA 4Y9TA 2P30A 5BMVF 1CYDA 2P4UA 3B2QA 5DDIP 5HIKA 4RKWA 2PXXA 4Q9JA 1ZVVA 1LDYA 3CUVA 1QDUA 4WJZA 4B6RA 4LCJA 1TVKA 2FEAA 2GF0A 2AVDA 3DXYA 1SZPA 2SCUB 5BSUA 2YWEA 3HFRA 5HYVA 1H6DA 2OBBA 3LQFA 2RKOA 2Z2XA 3OICA 2IOFA 2P2NA 5HVNA 3W9YA 4OGLA 2ZWAA 4EJSC 3PPWA 4JSRA 4WKGA 3OZBA 3H5AA 5IYZF 1P2BA 4MUXA 3ZLTA 5JQGF 1KDRA 1VYTA 1DOAA 1JL3A 1UBEA 2OHOA 3H2IA 4EM6A 5IF9A 3M82A 2WKSA 4D8WA 1JG3A 1DEXA 4AUKA 4JB0A 4LYGA 2Q9BA 5C4GB 1JHUA 1DJNA 4W5NA 1OGIA 1G4AE 1EVLA 3TRDA 4GECA 5JO0A 1A82A 1R6VA 2WF8A 2YASA 1P1FA 5JECA 3G2MA 4YJFB 3D6FA 4B2IA 2I34A 4M1KA 1D1TA 4WLOA 2VA8A 3S1AB 4BE4A 1CULC 4MUNA 3MJTA 4UFNA 1FRVA 4BJ6A 2XWQA 3QMPA 2V1UA 3ENKA 2HYIC 3MWKA 3LY7A 4FBGA 4H1HA 5T57A 2Y68A 5KQSA 4GIBA 4FWIB 4U1RA 5JZMA 3J80A 4O1MA 1I2MA 1UADA 4TV9A 5ENVA 4W7HA 2BMAA 3S2UA 3UENA 3A9SA 3GFVA 2W6OA 2BMWA 2JLSA 3AL3A 4H7FA 4P4TA 1GDTA 2OC9A 2OFWA 4LJAA 4E94A 5K6AC 2O8BB 3V3KA 3W79A 2ANBA 3SIPA 2O3UA 3W1WA 2QUJA 2HF2A 1GTG1 1QGOA 2I0FA 3BIXA 3G6KA 4JUFA 5AKHA 4DPLA 4NBLA 1YS4A 4K26A 1D2AA 1FU8A 5F12A 4RLFA 2Y99A 1A8QA 3T52A 4BZZA 3E9ZA 1KRHA 3WK9A 1TZBA 1E64A 5ALQA 1X8KA 4MB6A 4S24A 1DJOA 2YFYA 3CZCA 2PJDA 5IM4F 4YAWA 1CUYA 1SEPA 2DHQA 2VEOA 5ALFA 4R7GA 1H8ED 1KZGB 3A4MA 3HKDB 4B71A 4E21A 1UBUS 3JQDA 3NHPA 1I36A 1HDGO 2A67A 1TI7A 1WF3A 3S7ZA 1KI8A 5LUAA 3O74A 2BHLA 5IT4A 3HI4A 3OLZA 4D7AA 5EMNA 4F6RB 3NTXA 3ZGNA 4QO7A 1W1IA 3BM5A 1AOXA 1EDZA 3CNQS 4KBGA 3LKBA 3OPNA 5ANRB 1Y6ZA 1U2QA 3C3YA 5AW4A 3HCDA 5F4BA 2QV7A 1KKLA 1CJUC 3DNMA 4YPOA 4RELA 4S2UA 3OWXA 1LX7A 3U40A 4L7VA 1YQDA 2RG7A 3TG2A 3UB3A 4LF7B 1EP2B 1P2GA 3R9KA 1TZ2A 2C0PA 5AW0A 3Q5GA 5FPQA 4ZYZA 3MERA 2B25A 2HCBA 2QZPA 3BH0A 3R23A 4Z7OB 3HNPA 4NAVA 3HXMA 1D03A 1E69A 4YT4A 5K9ZA 3DZDA 2JLBA 2NN3C 4M98A 3SP1A 2WJ6A 2DKFA 3UT5B 2J3DA 3A10A 1EUQA 3F6YA 3GDGA 3K1ZA 3ABSB 2GFIA 3W8NA 3RH0A 5KYNA 2O8VA 2VAMA 1O77A 4O4JA 2KQUA 2P1RA 1N3IA 1HXHA 3PFIA 4HN2A 4UVDA 3RDPA 4E2XA 2BFEA 4LY6A 1XT6A 2A78A 4LCEA 4A23A 3HR7A 1GQRA 5EE1A 1HH4A 3IEIA 4N4AA 4YMWA 4ZZ3A 3T4EA 1HZJA 2JD0A 4QT4A 5LMUB 4MTLA 3GGOA 5B6IA 4G5YA 1VQ1A 5EJAA 1AC5A 1QDLB 1TB4A 1M7GA 4XVCA 4Y1GA 2HQSA 4AL4A 2NQ2C 3B5JA 1ZW1A 4OXKA 1JI3A 5EGNA 2YIMA 4J0IA 3AI1A 2I99A 2QMZA 4JXKA 3BXZA 2GTHA 3B9PA 4US1R 4LXGA 5EFOA 1VPWA 3NCTA 3HO6A 1JV2B 1HEYA 4WUVA 1ADJA 3HB4X 3U26A 3Q3IA 1OD6A 2HDWA 4BHTA 2EERA 2QTBA 4ND8B 2ONJA 4BCCA 1FNBA 3ZCTA 2WWRA 2ECQA 4MVJA 4WWHA 2Q7XA 1G6HA 5ALDA 4C0KA 2XNCA 2D0PB 3A2MA 2E48A 1DC4A 4NICA 3NEJA 1DCKA 1CRLA 5FL7A 3F7NA 2BP7A 5REQB 4YI5A 3H6HA 1ULZA 4IUCS 1WDWB 2OZLA 2A7XA 3ROKA 4DVJA 1GWNA 1SELA 3GMTA 5AW7A 1IQUA 2BTQB 3TLBA 9ABPA 1N77A 5L4LA 5HZKA 1RMYA 1NBME 1DBWA 3ZE8A 2BEWB 1U11A 1Y3HA 2JVKA 5CA1F 1HWYA 3HA5A 2IZ5A 3K5IA 4Z9FA 2P11A 2VF8A 1E6EA 5K8LA 3MYRA 1JKMA 1K6EA 2F9MA 1J42A 3INTA 1DG3A 2AFIE 4GPTA 5BRAA 3V7NA 3L6RA 1OXBB 3CPEA 5JSFA 1QRUA 1C8KA 4LGVA 2PUJA 2C3UA 4UDOA 4C6TB 4KXNA 1Z2EA 4Y3UA 3WGYA 2JVJA 1QP7A 1VLJA 1T0IA 5AI8A 1V9SA 1AH2A 1P2UA 2CK3A 2I62A 3NR2A 4ITUA 3O9VA 4URXR 1IZ7A 3PF9A 2G7ZA 1E9AA 2EGGA 4TGLA 2Z08A 5GM1A 2CLCX 2DFVA 4OV6B 5CB8A 5M7EA 5GJBA 4P3XA 1A8HA 5A9SB 2BKUA 1N25A 3E7PA 4P83A 3NBMA 1LKZA 3BMNB 1B6GA 4IIXA 4P7JA 1O0SA 1J9EA 4XXHA 1I7QB 2GPTA 4JVSB 3T95A 3OZXA 4K9SA 3G88A 4IZ6A 1OYVA 1P4JA 1U0SY 3IE2A 4QDJA 3CH6A 2G9UA 2BI7A 2Q4BA 3I73A 3TQCA 4BWYA 1V43A 2XGJA 1E3TA 5C7OO 2EGUA 2H54A 1GT91 3GG2A 3I9NA 3MJHA 4AMZA 4ZI2A 2C78A 5CHEA 1ZU5A 1LJ8A 1S8NA 1VRWA 5HOQA 4BMOB 3SIXA 5SZIA 1KE1A 1XF1A 1IE3A 1S3GA 2NU7A 5ITVA 3NTOA 1HT0A 2PR7A 4X6YA 5CJ2A 4W1RA 5ER6A 4S1WA 4UEJA 5JCXA 2VDOB 4R1NA 1KIMA 3GVIA 3IPXA 1XIVA 3DEFA 5JVDA 4F3TA 2ZRHA 4I1VA 1CB7A 2IZ0A 4I99A 5CMLA 1P0CA 5FBLB 5FXMA 1F5NA 3UMYA 3NHAA 5AHXA 2PJRA 3G0HA 5EPOA 5UKDA 1UJBA 1GAXA 3FUVA 1KJNA 4MEAA 2VP3A 5E1OA 4B6EA 5KTOA 5C1DA 2Q5EA 2CJPA 4F84A 3FF4A 4R3NA 1W2WB 3P4YA 1V71A 2OLKA 3O3OB 1LPMA 3AG6A 4EG3A 1YNSA 4ZOLF 1T2VA 1RYNA 3ZU4A 2GEVA 4DADA 3T1HB 4XOIA 3NHWA 2H7XA 2WF9A 3QUCA 2XE4A 2GHQA 3TW6A 4XR4A 3V9AA 2R96A 2R1VB 4MVJE 4YFYA 4X8HA 4PPQA 3SVLA 3ADBA 4DZZA 4MHTA 3CRQA 3TTYA 3DQPA 3T94A 2YHIB 2XB2A 4FFWA 1ZGBA 2EW2A 2HK6A 1XWWA 1P9NA 3K16A 4D8VA 4TUYA 3ZN2A 2IPNA 1AA9A 5HILA 5DI3B 4WDQA 5HW0A 2ZB3A 3D9QX 3E5HA 1UBFA 1OF1A 3HUEA 1TEVA 2Q5JA 4KXQA 4Y2UA 1QQBA 1NNUA 1XVUA 3D6NB 1JZQA 1Y42X 3RM3A 3W5AA 2UU9B 1DKQA 4MITA 1PZFA 3U17A 1QR2A 4MGZR 4YO7A 3V4LA 3VUFA 3ZZNA 4B2LA 2PGNA 4WXHA 3SS9X 4TZ0A 3ZDRA 1RXYA 1DQRA 4FHEA 4KYUA 1NGSA 2B7BA 4Z51A 3KQLA 4EG1A 5DOVA 2P90A 2FW1A 3NAGA 3H4IA 3DEHA 3UK0A 3R76A 5K0BA 4YHHB 1T2DA 1YE5A 2GSWA 4U5QA 5K09A 1SHJA 1SCBA 2V54A 1FRZA 4Z4EA 4L9AA 2C2YA 3ESAA 3GGDA 4U2FA 4ZYTA 2YJTD 2CUZA 1PTJC 4KKXB 1UOPA 1G9TA 2XMGA 1QMGA 2IJGX 1I7LA 1WPQA 2G0NA 4OBBA 4OM8A 1TW3A 1Z0SA 5IDVA 5F7OA 1YS2X 4RZXA 5HJ2A 3CF4G 4O4JB 5AFSA 2DCUA 3MS2A 5SICE 3FCAA 1O6GA 4ZYVA 3D1VA 4BVJA 3FLBA 3MT7A 1LNSA 1NZFA 4K8RB 4WCFC 3M4JA 3PHLA 1HE1C 5BUQA 5AVVA 3L0CA 2HBYA 2R8RA 1N0UA 3DBHA 3DL7A 2IYQA 4BO7A 1CZUA 3EHDA 2EKLA 2QNRA 1K68A 2JKVA 2Q8PA 3RW9A 2R3SA 2JHAA 4M22A 1MA0A 1JVSA 1R6TA 4KVZA 1PT8A 1VKNA 4DRZA 3KC2A 4YJKA 2ANCA 4UAUA 2FE4A 3F2IA 2HBRA 5BSRA 1P1JA 3KQYA 2Q7DA 1KHTA 2FB9A 4QD3A 1TM7E 4F96A 1C29B 5AM4A 4E2YA 2HBZA 1PYOA 5AR1A 1ZPDA 2FRDA 4GOND 1RPJA 3MTJA 1QQ6A 1J8FA 3ZUGA 3EE6A 2HSJA 2CB0A 1DL5A 2VJMB 4LDRA 3PNMA 5KNDH 3DKRA 1OR8A 4Z4FA 4EENA 2DF8A 4EMSA 2XCSB 3PKIA 3MCZA 4KLAA 3ECCA 1PJ2A 1VLHA 1XKQA 1M8KA 2FPKA 2IHBA 2W6IA 3DV0A 4HD8A 1PS8A 1U2SA 3K0CA 4MRPA 4CT5A 1LDGA 4MJXA 1BWRA 2JGNA 4TLMB 1FFAA 2ZRGA 1SUPA 2FEMA 3PQ4A 4OATA 1NBEA 1U8UA 1W29A 2EJUA 3M5DA 4WRRA 1FDIA 3LUCA 2EP5A 2QMEA 4M0PA 4D4IA 5IDQA 5KYUB 3K05A 4JLKA 4N5DA 3OQIB 5A0VA 2J4CA 4ZTZB 1GPUA 4EG0A 4P3YA 4HN9A 4UMEA 1RU3A 4WZAB 2PUBA 1RJ9A 4XGNA 2GZRA 3LWNA 1ADYA 1MR3F 4RHCA 3ZDCA 3VZDA 5KC9A 1IN5A 5FBHA 1WQ1R 3FGOA 3PD1A 4LMPA 4MUMA 1VE3A 3DZJA 2R751 2IDZA 1XR3A 3AERB 3NIBA 5DYIA 5LD2B 4MI3A 5C51B 2JCSA 3EEOA 1NQAO 1C8VB 2Q46A 2V45A 3EULA 3LUGA 4JQSA 5D3MB 5JBNA 1T3TA 1K08A 1QR6A 5K8CA 1YA4A 3SYMA 4R3UC 2ORED 4JROA 4MQMA 4CGYA 3CH5A 2EJTA 1AQUA 3EEIA 4D5EA 5BYKA 4Q4LA 3G5LA 4H31A 4R1MA 3FZQA 4MJ7A 4DNPA 1HI9A 3LYLA 4E07A 3WGKA 3WLFA 3I9FA 4D79A 4E6PA 1V1MB 2VP4A 2PYDA 3UWOA 3VYWA 3UHJA 3VU0A 3VNRA 2NQ8A 3TLXA 4ZT7A 1HQKA 1E2KA 2KX7A 1JWAB 3W1EA 3ZUPA 4AKEA 4BDSA 4YCSA 4WD3A 5JV5A 3ROQA 1FUKA 2PZMA 5G0VA 1KDYA 3UW3A 4BV3A 1OKKD 1XZLA 3WVNA 1NW7A 4BNGA 2A1UB 1M2JA 1D0SA 1NJGA 5L95A 1NX9A 4JVOA 5E9JA 1NI3A 4RKQA 1DWPA 2OPBA 3P4XA 5H81A 4HCJA 5LDHA 3I5XA 5ALYA 4QOHA 4YV0A 4XARA 3EZYA 4R9UC 2HLPA 1UR5A 3EZ6A 1DUSA 2IYUA 3RS8A 2Y2VA 3I45A 2NNWB 3CVJA 4XKJA 2JJ8A 2NO1A 3O4HA 2ZRKA 4N5HX 1KI1A 1WG8A 1U0LA 1L8XA 4WK2B 3NAZA 4IDCA 4IZOA 2N42A 5E3HA 2IDJA 5KCZA 3GLGE 3KOOA 4B7ZA 3CQ9A 5B55A 1QTIA 2EDCA 4LSZA 1VYHA 4PZEA 1CUUA 3DF9A 3ZY2A 4U2GA 4UJ5A 4JSTA 1A9QA 2BMEA 3GNSA 4CUJA 2WAOA 4ZEVA 3T61A 4KWHA 2VJKA 3RHSA 2PMBA 3MGBA 1ONNA 1OZFA 2FXIA 1TMYA 1FF9A 2QP9X 3IDZA 2QRGA 4BRWA 3KCQA 2R8EA 3WHPA 4PNPA 2HQRA 1UPFA 3B70A 1QYVA 2X1LA 3V9PA 4TSKA 5EL0A 5D84A 3K35A 5IKEA 3L7JA 2HMVA 3STVA 5J2TA 2ZAIA 1QTNA 2JBAB 3AG5A 3MYYA 3EPLA 1WM1A 4DMLA 1OJ7A 1RWMA 3SJAA 1FJ2A 4PXYA 3UWPA 3RK4A 1RAAA 1H3EA 4RLSA 2NADA 2Q5OA 2HPAA 3EJWA 5AW6A 3G9ZA 4F6CA 2PUGA 3EGEA 1XA0A 2ZG6A 3JZMA 3L92A 3LV8A 4KMSA 3TH5A 4U39A 3IAS1 5KUTA 2XD4A 2VH2A 1U2TA 1DKMA 2XMSA 3ISTA 4Q47A 4QGSA 2AC4A 4QASA 4A2WA 2CNBA 4FNGA 1AU9A 1HYQA 1Y33E 4MW5A 3F7TA 3HKEB 5E3JA 1LVUA 2W2NA 4C2UA 1L4EA 2H8GA 4KLNA 1E18A 4PLTA 1GYQA 5FI3A 2WIAA 2IVFA 1SZDA 2NAFA 4UVHA 1ZJYA 4XD7D 1XKTA 3Q0EA 2X7JA 4QSHA 3NCHA 1TUBA 2WBLC 3TB6A 4A03A 5TC4A 4QL3A 3WNCA 3TQRA 3G59A 2CLFB 4NBUA 1JFLA 4KK4A 1G98A 5G41A 2W2OA 2Z30A 4NJEB 3DWFA 2FZEA 3STYA 4A91A 3AZOA 1L6RA 1B42A 2GZMA 2AEJA 3HJFA 1F0PA 4XUDA 2X0IA 1F48A 3B51X 3DLPX 2LDBA 1CUAA 1K3TA 1O95D 4UHEA 4W9NC 4NBRA 4YT8A 2D3TA 3II6X 3F8TA 1M1UA 3QFSA 4KQKA 4W5RA 2VWHA 1XB2A 3T7CA 4YRIA 4HMPA 2J4DA 2Y0EA 1P91A 5E1DA 4IKEA 2Z57A 1Z18A 2C8VA 2D00A 3F5SA 3K9WA 5A4AA 3WAJA 4CMCA 3DBOB 2GZSA 3G2JA 1NLMA 1DIBA 1T4BA 3JQCA 4CMHA 4FDAA 3LVFO 1BO6A 2COKA 4B87A 4G4JA 4XWGA 1GNVA 3Q9SA 5BQXA 2C9BA 1SQ5A 1YKSA 1ULTA 1EGHA 3WGMA 4MQ6A 2X1VA 1RWQA 1F0KA 1VI5A 1J8DA 4A8JB 3TLGA 3PGMA 4H0FA 4Q9NA 5AQEA 5GOTA 2BZGA 2HWKA 4CM7A 3FMFA 1ZXLA 2Q5CA 3DONA 1NW8A 2HH9A 3R3UA 1JDSA 3LQRA 4QWWA 2O0JA 1VBKA 3UJHA 4ENVA 4UTRA 3K9FC 4ATNA 4CEHB 2J4FA 2VUUA 1U7HA 2RIRA 4R2HA 2VPWA 3L49A 1HLDA 3M70A 3QLEA 3IBTA 2BHSA 4G1EB 4I3GA 3NHYA 4DV0B 1YL7A 2A9QA 4EW6A 2DU8A 2C9CA 1SD1A 1ZNWA 1QKKA 2PAAA 3AR2A 1HFWA 3G7SA 3T4XA 5LMNB 3DMRA 3MXTA 4FE3A 4B80A 4MQ5A 1T29A 2V6FA 3SDZA 3AHDA 4TWRA 4P34A 2ODNA 1XCLA 4FUTA 1VL2A 1KBQA 1P2FA 4INOA 4JITA 1HDEA 4S3MA 4ZICA 1YR9A 4PS0A 4E3WA 1FQKA 3D8BA 1OX4B 3GMIA 2D4HA 2JNWA 1N2GA 1RYEA 1DC8A 1E1LA 2V6BA 3AETB 3MVEA 2QK4A 2E4WA 5C34B 4IJMA 2FEWB 4PRLA 4D5GA 3OEWA 2QZJA 3FSGA 4D82A 1EVYA 4DA4A 4EHJA 1V47A 1C1YA 2PVSA 1VMAA 5DGHA 4OUDA 1EJBA 3CMCO 4AWAA 4IICA 3IB3A 3FNRA 4BPRA 4FFMA 2O54A 3DOUA 3AEQB 4M36A 3CFYA 2HKIA 2VWQA 3QKSB 4BX2A 1MU0A 3AH8A 1WSWA 2C97A 1T0UA 1REQB 3I39X 3L06A 7ADHA 5J58A 5KMGB 2GVZC 4B3FX 1KQFA 3ADDA 3SDBA 1WEHA 5L9AA 1ATIA 3UB2A 1F60A 1XZFA 3OE5A 1SR8A 4KG7A 4QRIA 3U2QA 2ZJ8A 3UUGA 1P9RA 3EFOB 1JILA 1NN0A 1U3TA 2FUEA 4IWYA 3BGSA 4NBWA 5T8KA 5IS2A 1KP2A 1I33A 3HTXA 2VZ9A 4HX5A 2VPXA 2JEYA 3LT5A 4WKNA 5DP2A 4A5OA 5TRTA 4NV0A 4JC0A 3OTHA 2MMGA 4EA9A 3TRIA 1R8SA 3WDLA 4S0XA 1BX3A 2H0RA 3CIFA 4TTQA 2PWAA 1JHXA 4B34A 4CW7A 2IRWA 1UPAA 5HX7A 2FDXA 2YMLA 1A1SA 3D4LA 4MGIR 5BW8A 3LMKA 1E5XA 3OHSX 3QWFA 4DWVA 2YW2A 3I01M 1CF4A 3G2PA 1JSZA 4G84A 3RYTC 2XQIA 1GL6A 2I78A 4ZGBA 4LXQA 2X8JB 4FDVA 1KAOA 2FYTA 2PXCA 4ENPA 4PX5A 1WAMA 5HA5A 3RJZA 5JMWA 4B6GA 2YCLA 3R75A 4R5MA 4H7IA 3ICEA 1U1IA 2HF9A 2PWYA 2PZLA 1D4AA 1LF0A 4OMCA 4IHKA 2Q5HA 4Q7MB 4E13A 1GPDG 4K9QA 1JS1X 3FNEA 4L9SA 4CLRA 5GADl 3VKHA 2VLBA 3JX9A 3K0FB 2D4AA 4CDMA 5A4KA 4UM9B 5DO9A 4HAIA 5IW8A 2CL7X 1Z5PA 1H93A 2OB2A 4MWCA 1OT3A 4TKLA 2J3MA 4EPXA 1YJ5A 1AKEA 3C41J 3E4CA 3VVCA 4B09A 1XN1A 2C3MA 4P2GA 5CVTA 3QU4A 5FWNA 2NTYC 2D5AA 2J9FB 3B6EA 4QUAA 1M8FA 3SLKA 3F67A 5CXQA 1MJGM 1QVAA 2DUJA 4NSNA 4W1SA 4ZHQA 1U8AA 2VIIA 3K15A 3Q3JB 5K0NA 1WBJB 4R51A 4F71A 1G9SA 3BDIA 2I7TA 4Q39A 2ZXEA 3A1CA 4YJ2A 2DUMA 4IHJB 2W90A 2YDYA 3HSKA 2GERA 1CUEA 2DH6A 5E4YA 3LTEA 4Y67A 1BVRA 3M5WA 1CY6A 2MYUA 3S5UA 1N6IA 2DPXA 3VZCA 2OZLB 4HDMB 2HRZA 1M10A 3E61A 3VYTB 4HO1X 5ADHA 1KR2A 4R8KA 3VO1A 2NUAB 1GT6A 2ZYVX 5A5VA 4OKIA 1P7PA 5AW5A 1GZ7A 2DVMA 4PAWA 1CC1S 4F9GA 3TUZC 1IEQA 1QAMA 2QY9A 1MJHA 4C3UA 1SBHA 4RE5A 2Q99A 1CVIA 3H1FA 4O2AB 4IMIB 3LUKA 3BL6A 1TCUA 1U5BB 3X2FA 1VHWA 1O8CA 1MIHA 4N0DA 4HC4A 1XRPA 3MTDA 2B7CA 2JL1A 4FGWA 4RZHA 4A3SA 3QWHA 4ZXPA 4A73A 2HWXA 3C3DA 1G2IA 4I6JA 2GO7A 2WJVA 7AT1A 1JBQA 3VDQA 4AC9A 3O1JC 1L5OA 4DYHA 3BFJA 2ORWA 2YIJA 4LF8B 1XRLA 4QU5A 3RVNA 4KYTA 2HPHA 1SUCA 4ZAGA 3TCNA 5AP9A 4E08A 2EJWA 1NVDA 2J5BA 2RJOA 4YQYA 2BGNA 2Y6UA 3GH1A 4TWIA 4UBOA 3W2HA 4R98A 1ZS9A 1DB3A 1R0SA 2MR6A 5AESA 2Q29A 4UKDA 4V0ME 5GVSA 1MH9A 2IE0A 1CR6A 1NW4A 3CNNA 2ES4A 1KOGA 1K06A 2WSBA 3OVMA 2MSNA 4FUQA 2OAQ1 4UU0A 4ZEMA 3C74A 1HT1E 1I13A 2O6LA 4LRWA 5FLKA 4Q3BA 2L17A 3AOEA 1YRWA 4E09A 1SVMA 2WB2A 4UUQA 3QOYA 3O31A 3EUFA 2PZEA 1DUIA 2GHIA 3LKDA 3Q15C 2CHEA 3AVOA 3L18A 2K4MA 3B20A 3VR2D 4TVOA 1P2TA 1R0XA 3GDFA 4UZSA 1HDZA 1K9VF 1N2CB 1ORDA 3I61A 1OIVA 3K2BA 4KIUA 4B43A 4DIKA 3KYIB 2B94A 4JJZA 3NDBB 1YVDA 1M2VB 4DGSA 2G17A 2FX2A 1KY3A 1QANA 4G07A 4DXHA 3DWEX 2HAEA 3K1JA 5JRJA 2QX4A 1MD9A 4HPXB 2V6IA 4U7TB 4Z6KA 3KD2A 1GKLA 1OXMA 1QIJA 3NBAA 4KEAA 3O47A 2CEAA 3W1VA 4E30A 3ECSA 5CDFA 2I3DA 5CHYA 5HRCA 4KODA 4L3VA 2ZQZA 1P1RA 3EODA 3R9IA 3D0OA 1XJCA 4Y9UA 4QICA 5H82A 3ROEA 2YRWA 13PKA 4QNMA 4M21A 4YR9A 4DZTA 3L0YA 1LTHR 3PG5A 2YNMA 3HKCA 2IZOA 2NSYA 4QKQA 4YCAA 1CLUA 1RHMA 1FXWA 3V42A 2VHUA 1H2ZA 3G5AA 5JSHA 3ENWA 4FT4A 3SSMA 3GARA 2OCLA 3NWOA 2ZU0C 5K3FA 2ONZA 3AF4A 3BKWA 3F0TA 3MCUA 2X41A 5AUOB 3QTLA 4JQYA 4CUKA 4II7A 1H0RA 1QHEA 4Z9AA 1SQ6A 1W1UA 2QB5A 2A1TS 2QX6A 4JR0A 4D0SA 2OQRA 1G1MA 3GJZA 3ON5A 4TZKA 1EAMA 2VG8A 4HF7A 2KJQA 4AECA 3J7AC 1Y4UA 3ESBA 1NVVQ 2B5WA 4HUTA 1FRFS 2XOEA 5FO1A 5C5EA 1KSGA 3SYRA 1MORA 1O94D 3AUTA 3IBSA 1PK9A 3Q7QA 3UMSA 4TYYA 2VATA 3GP8A 4RX1A 2R8XA 3T5GA 1MO6A 3FCOA 5B57C 6YASA 2CXUA 4GLBA 2AUNA 2PD3A 4JBXA 3DKVA 2IW1A 2X5NA 1P8AA 2XVMA 1R00A 2HXSA 2QLFA 2ACWA 3S7TA 4GNRA 1YQWA 1E6MA 4XCQA 1NBMA 4RPKA 4RENA 3LBHA 3QXCA 4OHXA 2A0UA 5BSVA 4Z4IA 1GSAA 2GS9A 2PPVA 4U00A 4C7XA 3FTDA 4IIBA 3TLJA 3RYCB 2GUWA 4I55F 3RVSA 1IM5A 1EHIA 1PX2A 3SLRA 4WBNA 1FFGA 2AFIA 1SCKA 4GI1A 1G38A 1YASA 2QMYA 5KYKA 1LZLA 1KK3A 1DRVA 4OLJA 3KL4A 4YUVA 4GMFA 5ED4A 3K31A 4I2NA 1YQTA 1KRXA 2CKMA 5DLPA 3I30X 1XQ9A 4P32A 2QP3A 4B8ZA 2ZUDA 3C8HA 3FHTA 3U3DA 4QATA 4J8PA 1B0ZA 4BGVA 3JWGA 3OSZA 4JNKA 3VPCA 2LP4Y 4QGAA 2VDRB 5LZ2A 3GYBA 3VR6D 2R6FA 3QLVA 1XMPA 2ASEA 3H5NA 5ALSA 3DNPA 4WXRA 4JENA 4Y1FA 2R6JA 2FAXA 1NFQA 1NT4A 2NU9A 3OOEA 3I72A 3GI1A 3HRKA 4IIJF 1C9KA 1Y6FA 2WM2A 1WKVA 3DMFA 1J0CA 3RSZA 2C98A 3GJ7A 3VR2A 1EE1A 2EQBA 1N8TA 3F5QA 3EG9A 4EI2A 5HDQA 4AN4A 4JBYA 5FEMA 1RM0A 1MH1A 5E0OA 2P69A 4F5WA 3EZ7A 1JSRA 4JZYA 2HRRA 3PSHA 2HSWA 5AIAA 3V46A 2XNDA 1F1JA 4J75A 1TGYA 4BYMA 3GCZA 4YLEA 4DCOA 3NT4A 3T9BA 3F46A 5KJFA 3AZQA 3IIKA 4EKIA 1MFZA 4OQNA 5L3SB 3UXEA 1M75A 2P4HX 4PN7A 3GLFE 3CZAA 3A1SA 1H2XA 4JLWA 4F60A 1NU8A 3L7NA 3PQDA 4XIYA 1EZ1A 1TKBA 4GI2A 3LBNA 3UQZA 3D7MA 5CA1A 5IWCA 3HU3A 3LXXA 4F93B 2M1XA 2QWXA 3WLPA 1UWCA 3OIUA 4HRAA 3DNFA 3D59A 3H13A 5ESDA 1B1CA 4X92A 2EFJA 2CZGA 1DRKA 2Y1OA 5KI6A 1BFKA 1E2QA 4BS9A 5AVRA 4NDAA 3GFRA 2FMFA 3EG5A 2IZZA 4LA4A 1NNEA 2DCMA 1JR2A 2C20A 2IDMA 5EFZA 4MPJA 3CZ9A 3PC8C 1JLKA 2J45A 5DHTA 5TXGA 3NUZA 1JJ7A 1TAUA 3G89A 1ZY2A 4I8IA 1R8JA 4YB8A 3R7LA 2QMOA 4GU5A 3S8YA 1M5UA 4NOKA 4JX8A 3BD7A 1PQYA 1TEHA 5IF3A 1Z6XA 5GMOA 4DLSA 1WRBA 2X8AA 3RO7A 1A77A 2CY0A 2XA9A 4RK0A 3ZY5A 5I5EA 4RNCA 4ZJYA 2NNLD 2NQTA 4MKGA 2Y1WA 4O2AF 1XD2A 1YS7A 3GVPA 4UBIA 1C30A 4GC9A 4AO8A 4AUEA 1YQEA 3BVPA 5A7FA 2FRDC 3QE2A 4ZTBA 2XF8A 2JFZA 5HDBB 1A7AA 4MMXB 5LP1A 3BH6A 3ZWYA 5F3WB 1WSAA 4PANA 5DNDA 3UJPA 2FGKA 1K88A 1UKZA 5JYEA 1LA2A 2XNJA 4DBZA 3QNWA 3CNEA 4PPNA 1NF9A 1YE3A 2YICA 4WCFA 1IZ8A 3DHEA 5MFPA 5IDXA 1I30A 2ZBQA 3AIMA 3LT1A 5DVZA 3B8HA 4ACBA 3GFOA 1FBNA 1KU0A 4FNMA 4OM7A 1WP4A 3KWLA 4LXXA 4XD7A 3PRKE 3JAKA 3GLIE 1M34E 2VBGA 3QITA 3RUEA 4R40A 4QUJA 2Q3FA 2YUTA 1TYBE 2CDNA 4G81A 4CQMA 1GQQA 4LISA 2J5RA 2OD9A 1P6UA 2IYLD 1VXRA 4MZDA 3V8PA 4E3ZA 1O6FA 3VQTA 1ZBDA 5I3ZA 3U16A 1DV1A 1Z45A 5F7ZA 1WZNA 1IATA 1XELA 4D0GA 1EB9A 1G8KA 2IP2A 3CJQA 1GKKA 3OETA 5U4QA 2MR5A 3TZEA 2Z5GA 1USUA 2X9NA 2BF4A 1ONBA 4L50A 1C81A 1JECA 1KMHB 1ZGZA 1DO8A 2WIDA 1CNFA 2ZVQX 3EVCA 2ZYSA 1AS0A 4HBGA 1OHHD 4Y6QA 3JATA 1EXVA 4TL9A 1M2OA 2Q6OA 1UINA 4W63A 3PDIA 3WZ2A 4JYPA 1POWA 2RSLA 5TGDA 4F5DA 1SXJB 4JJKA 3A6KA 4C3ZA 5KQGA 4K8OA 1RHQA 4L73A 2HMSA 3LDUA 4E03A 1B41A 5JS6A 1P1KA 1PR0A 3KSBC 1XRJA 1O03A 1E1RA 4PAGA 1NMSA 2PH5A 4FYMA 2HMYB 2D1SA 1FX1A 5FPKA 3O5AA 2DE0X 2GRJA 1Z4JA 4JJEA 3W4IA 3EMKA 2HR1A 2OGZA 3FKSA 3H4MA 4BXOB 5AVZA 1FJXA 1QP4A 1J7JA 3FDFA 1TJ5A 1EDBA 3SBXA 3WLEA 4G8DA 2W43A 1G3UA 1JQ5A 1V3UA 5DYYA 5BSTA 2JGJA 2X6TA 4FGUA 4FFNA 4KGXA 2GCIA 4H6WA 4AZ3A 3WR5A 5A0TA 1RW4A 4KVFA 2IXGA 5MN5A 2K7ZA 4PBTA 4R68A 4XE5A 3BHIA 4M9XA 3WDMA 5DHPA 3OFVA 5D7BA 4NQZA 3I28A 4GYKA 3FY4A 1M0EA 1XL1A 2DPYA 3ZE0B 4CQJA 1A9YA 1LX6A 2C92A 3NYWA 4FFPA 2RI0A 3QJ5A 1ZD8A 2BKAA 2WHQA 4LY9A 1GKYA 1Y3CE 1M1YE 3BSWA 3T1VA 3SX4A 1DFHA 4W5HA 2M1ZA 2EKBA 2I6UA 5REQA 3T3NA 3EZGA 2DG2A 2O8BA 3K9GA 4B5LA 1OFGA 1CJVC 3CBGA 4RS4A 3H99A 2E5WA 2AD1A 5F9MA 3RHTA 2QTCA 2PX3A 2WD7B 4HNAB 5LOVB 3GLSA 121PA 5JW6A 2BHNA 1NXSA 3F6EX 2I55A 4FS8A 5DNVA 3ZV5A 3VJRA 2OTCA 2VYQA 4NBNA 1QVZA 1O0CA 1G60A 2O1WA 2OOSA 1NVUQ 3CJRA 3G8CA 1QZTA 4ZVQA 3U4GA 4RFLA 2Y1LA 2ZJ5A 2JJQA 3L41A 4LV5B 4OP1A 1NIJA 1P31A 1UMCB 2NUPB 1QHGA 5TJ9A 2BBSA 3V1MA 4CI0B 1MG5A 4XYEA 4YH1A 1IXSB 3I6YA 4GKVA 5DM2A 3CEMA 3TRFA 1JR3A 1N2ZA 3LQ1A 3TIFA 2XUIA 5FA5A 1SXJE 2J33A 3R6GA 4WXPA 4MTCA 4ZMRA 1VC2A 1NW3A 1YB1A 3AUYA 3KBOA 3QLUC 2WZBA 4FR0A 4J1TA 5D2CA 5FWYA 3DTVA 4XWAA 2GK4A 1N92A 1SB8A 4M1YA 1L5KA 2XZLA 3F9CA 3RSSA 3R3VA 3ZWAA 2HOQA 2WKWA 5IUNC 1GCOA 1DMSA 3TB4A 4GHWA 2YY6A 4KHPB 2QJTA 1A2BA 2VDJA 4OOFA 4GBGA 3H2YA 3LYUA 1JHVA 1Y34E 2JAUA 3PIIA 5F1PA 5FF9A 4G86A 4LV6A 5CAEA 2VP9A 1UZNA 5G53C 4RH3A 4Q3EA 3W04A 2I9PA 5BN4B 1EZZA 1QGUB 5BUZA 4BLQA 1Z62A 2ZXUA 2IXFA 2DMRA 3NAQA 4RK4A 2GMWA 5AUQA 4MO2A 2AKYA 2W6PA 4REQA 1DQNA 2EL9A 1IBCA 2REQB 2V9ZA 2ZTMA 2AZ4A 4HNHA 4TYMA 3ZD9A 4C04A 1P8JA 2MSWA 4J76A 2FJ0A 3ZH2A 2BFCB 3FAKA 3KSZO 4BQEA 1GOTA 2JIZA 1R2QA 3SX2A 2FH5B 1B1AA 3C1OA 4H7EA 1QG4A 1NPYA 3LQ4A 4FI3F 4Z0TA 3VNAA 3X0DA 1Y4DE 1T9BA 3JQ8B 5IHXA 2VCEA 5DNAA 2ZBDA 2PQMA 4Y1RA 1SD5A 1PO7A 3NHRA 1HM5A 1LI4A 2I2FA 3A0UA 2AK2A 3MWFA 1HEIA 2JLRA 3O4RA 4TMWA 1Z16A 4TLDA 4Z53A 4IR7A 4AJ2A 1Y8AA 2QHXA 1QYXA 2QRZA 1MHTA 5JHGB 2XXBA 1B4DA 3SIWA 5I7FA 2FPLA 2P65A 3FKSD 1U7ZA 2WEKA 3AFGA 3Q7IA 1TW2A 1K2VN 2Q6KA 2GVDC 3WIOA 3SGLA 4LHSA 1HRDA 1J2JA 3E84A 4GUDA 4BU1A 3R7WA 3P2EA 1NI5A 2YTZA 4CV3A 4OJQA 2JVIA 5I7WA 4MA5A 3VJMA 3PIDA 4RSGA 2PAFA 4AXBA 2BKLA 3M6VA 1TKCA 3NNDA 4I9FA 1N3YA 3LHKA 3K4PA 4OXNA 4XIJA 5ELXA 3ZWMA 4C6SA 3P0EA 5EWMB 4EY8A 3ISJA 1O8BA 5AK0A 2ZOSA 2IWHA 4IG9A 4O8ZA 1Z4OA 4H7HA 3HBJA 1TAQA 1PR3A 1DBIA 3H8VA 1BG6A 4Q3KA 2ZANA 4M7PA 3E1KA 2PUHA 4DY4A 1Z28A 4QWMA 9LDBA 1NI4A 2PCJA 2OO5A 2ZCVA 2ZJYA 4HFNA 3K9LA 4E1AA 2FV8A 4AN0A 2FQQA 4JB3A 1FDRA 4QJIA 2G28A 3RBAA 3VKVA 1AQNA 2PQ0A 2UZAA 4F2GA 5I4BA 4WFQA 1IB6A 4UM9D 4L08A 2OWDA 3IP9A 5DKFA 2HT1A 4C0WA 3HVRA 5A7HA 2JFWA 2P2DA 2RGCA 4OL9A 4UOQA 2Z6AA 3T06B 4GQBA 1P9WA 2JHCA 2P1DA 3H2SA 2JGDA 2HU7A 1L1QA 1X39A 4LKRA 5KSZA 2HW8A 1XQYA 5ES3A 2RHCA 4CLRB 1C4OA 3M8KA 3OUUA 4RDCA 2TS1A 4RNDB 1SC3A 3HEAA 3USCS 1S2OA 5KVQA 3KLBA 7YASA 5HF9A 3KALA 3EF1A 4E6EA 2IYEA 3OQJA 3EX7C 2PSFA 5FUMA 1PNVA 1XP5A 1KI6B 1X7ZA 4BLSA 1W4CA 3MWGA 1D0IA 3L5KA 5KX5F 4J1SA 3PT5A 5LD2C 1XDBA 2PWPA 4QO8A 1YDFA 2PKYX 1T1IA 3PTZA 2X0RA 4ZAWA 3UTDA 1TUIA 4TMZA 1UJMA 2YWGA 4L6IA 2BM1A 2OO5C 2LXNA 3OCUA 3EA4A 1TZMA 4ME6A 1LBHA 3JD2A 4DSOA 4YRSA 1IQRA 3PB3A 3TX2A 1QV6A 4FKZA 4BFYA 5FL7D 3DE1X 3HCWA 1MOZA 1S3IA 1D5CA 2FLKA 3BGVA 3IE1A 2WIBA 1G8MA 2HB6A 3Q4GA 1FNSA 1VIDA 1PWHA 4HHEA 3HL0A 4ZC1A 4JD5A 4GP6A 3GLUA 4BP9A 3IPCA 4GDMA 4PRYA 1Q7RA 4NYMQ 1E4EB 4KWCA 5IASA 1J9GA 2BEUB 2VRWA 3CNLA 4NOJA 3VU1A 2V7PA 3JTEA 4ENTA 4AK9A 5A9SA 4KDEA 3L1UA 1BOFA 4B31A 5K3FB 1GPBA 4J0GA 3CX7A 1EDEA 1W25A 5KNBH 3ZJUA 1FMTA 3WISA 1X8LA 3NJ4A 2UXBB 4L4SA 1ENPA 2Y0DA 2XCQA 2B8NA 4L28A 3IC5A 4LOIA 4YREA 2QN6A 2CWWA 1ADFA 1NRIA 2HNBA 2PVPA 3B8EA 4FEYA 3PS9A 5LMCA 4ETMA 3P9XA 5EP4A 2YZKA 1LNQA 1Q91A 4J4HA 521PA 4K9KA 3ACDA 4W5OA 1HDOA 1PR9A 3VC7A 4GS5A 1MX9A 4X65B 1I4DD 1WQ4A 4FSDA 4RPCA 4Z1MD 3T7SA 4LXIA 4YAGA 3HXQA 3KPUA 4NYMR 1PCXA 2A57A 4DLLA 2YMQA 3HHEA 3GB9A 3UGJA 5GAJA 1R12A 4RV4A 5EYPA 3VJLA 1U5CA 4AWXA 1CJCA 1Y9EA 4DBVO 2PV7A 2HMAA 4IOJA 1R37A 1QNFA 2BGKA 1Z08A 3IP8A 4FMCF 4DQVA 3B3QA 3DAGA 3FNQA 2JRLA 3ND5A 5G0TA 5BSMA 2HC9A 3SHOA 3KZKA 1GVHA 1KAQA 5DSZA 5BUSA 4L02A 4JLOA 1N1MA 3DP7A 4HH4A 2FWPA 2EG5A 2JIMA 4I7EA 4JL6A 3PQ8A 3DTVD 4E7PA 3LLUA 2POCA 3BGOS 3C7TA 4NECA 5D6OA 4RWZA 5A04A 4RZIA 3BXFA 1L8LA 5HKBA 3EAQA 4IH9A 1BJKA 1SBNE 3BCSA 4UOZA 4HX2A 3QG5A 5T3UA 3UHFA 1J5XA 1XLVA 3O4IA 1X80B 3SC3A 1U8TA 4AKTA 4J29A 4RTKA 2LUOA 1MW9X 4B74A 4EELA 5BOSB 5DK4A 3GLIA 2WPDA 5ICGA 1DKUA 1SRQA 4PYJA 2XKJE 4UPVA 1AK9A 1XU9A 1JEDA 3QA9A 5EIBD 2F9FA 3OT4A 4HDRB 3ZE6A 2CMHA 3ZQUA 5I48A 1H9BA 4Q4HA 1E8MA 3F6RA 2H92A 1HBJA 3JXEA 4I9UA 1VG8A 3EAFA 4RLQA 5AI9A 1J06A 1YIAA 2WYWA 1I0IA 5E1MA 1E77A 1V45E 3MILA 4LGYA 1ILWA 1FXSA 5H80A 4D9NA 2Y67A 4UD6A 3PFBA 1E1CB 1USVA 2I2CA 2BDEA 2CXTA 3ED1A 1GPNA 4QEKA 1N6HA 1G66A 2GPNA 3M83A 4L4UA 4N3CA 4H27A 1LLQA 1KVQA 2V6GA 1GDHA 1B43A 5IT5A 1ISSA 1O95C 1UMDA 2WD7A 5JD6A 4ITRC 1YJQA 2X0EA 3FTCA 4KN8A 3SE0A 4CMEA 3ZI0A 4HQLA 4BFVA 1SXPA 2IVZA 2M32A 4FD2A 1ULUA 3E0XA 1VLMA 4RABA 1WW3A 4O4IB 1KVRA 1V96A 3F6CA 3TVYA 4BFZA 4YP6A 2AZDA 3FFXA 2W2KA 3G1TA 5JXGA 2UZIR 1QQAA 3Q5EA 2PKQP 1RE0A 3EDRA 3VH1A 1T8TA 1FCJA 4PYLA 1P75A 5K4HA 2BN4A 1U8XX 4LVNA 3JVVA 4R1LA 1RKXA 5FHQA 4Q1EA 3ZKAA 3THOA 5JPCA 2UZ4A 2IYWA 4CMIB 1LY1A