3STWA

Crystal structure of tomato methylketone synthase i complexed with 2-tridecanone
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
258
structure length
258
Chain Sequence
FVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDHVTMMSKPQQLFTTLLSIANKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylketone synthase 1
publication title Emergent Decarboxylase Activity and Attenuation of alpha/beta-Hydrolase Activity during the Evolution of Methylketone Biosynthesis in Tomato.
pubmed doi rcsb
source organism Lycopersicon hirsutum f. glabratum
molecule tags Hydrolase
total genus 88
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3stwA00
1JJFA 4WDRA 5LKAA 3VKFA 3WL5A 4G1FA 1PJAA 1JU4A 4W1RA 4ETWA 3ZWQA 3B3QA 4KYVA 4Y2VA 2WFLA 4IH1A 5JANA 2W6CX 4E15A 4DYHA 1JT2A 4EY7A 1Q0ZA 5HF6A 3VJKA 4MQMA 5CURA 3B5EA 1EX9A 2WTNA 2OQIA 4J0JA 2BUAA 4ZV7A 4CIBA 3ZV7A 3C45A 3G0DA 1WB4A 1VA4A 1T2NA 5ALRA 2DR0A 3E0XA 3H2JA 3RLIA 3FSGA 3H17A 5D3ZA 5JAOA 2JGFA 3ICVA 1XLVA 4UPDA 4MQLA 2WIDA 4U2DA 3HLKA 4CG3A 1YA8A 1W76A 2FJPA 5LKRA 5D3KA 3H1AA 5ALJA 1UXOA 1HKHA 3ANTA 5AI0A 2VA9A 4J7AA 4GEGA 2W22A 5JIBA 4J3JA 1JI3A 3R3UA 3IVMA 3H2HA 3QM1A 2WKWA 4HVTA 1XRMA 1ZD5A 1H2WA 2XB6A 3MUOA 4UHDA 5JD6A 3DLTA 3WK9A 1THGA 1W75A 2CMFA 5LZ7A 4Y2SA 4GECA 3CCBA 1U8EA 1CLEA 1P0MA 4UBIA 4N5IX 5JATA 3WWDA 3PDCA 4CG1A 3FOBA 1JMKC 3RM3A 2PSDA 2C0QA 1BROA 5A6VA 4BBZA 4E46A 3T52A 1FSSA 3BF7A 5AM4A 4J03A 5LZ4A 5FPPA 1AGYA 2WHPA 1USWA 1GQSA 4G9GA 2HIHA 4GXNA 3FLBA 1WCYA 4OB8A 5JZSA 4M0EA 5AKEA 3WL6A 1JFRA 4Y2UA 3V48A 1XZEA 2GZRA 3EQ8A 5CH3A 1XZCA 1BEZA 2PSHA 1FFBA 3R40A 4AQDA 4OYYA 1ZJ4A 4C4YA 4GDMA 3QPAA 4G8DA 4PF1A 2FX5A 4H7FA 1LNSA 2HA3A 3KXPA 1YB7A 3LCRA 5D6OA 1TIBA 3IIIA 5SYMA 3AIOA 4G4JA 4BP8A 1TRHA 2DCMA 2LIPA 4YPVA 1YA4A 3FAKA 1EDBA 2XUHA 3QBJA 1MX9A 5JARA 2BKLA 1TCAA 5C7YA 4WCVA 3L1HA 1MU0A 2J4FA 4FNMA 4P92A 3WJ1A 4UBNA 3VVLA 3NUZA 1VZ3A 1GPLA 3GFFA 4C4XA 1VOTA 1TCBA 5F4ZA 3AUKA 1DWOA 5JYCA 2XQKA 4B85A 3D5EA 4EZIA 1D07A 1XZIA 1QO7A 4BTLA 2WUGA 4EHBA 2G5PA 4Y2JA 4YX9A 2XMSA 4H7JA 4X90A 2HU5A 4DNPA 5IKXA 3PUHA 5HFAA 3FLAA 1HDEA 3H0CA 4C6HA 1EDEA 4KJXA 4RGYA 4UBMA 3R3ZA 5CMLA 5ALMA 1XKTA 3WQHA 5JD4A 3JW8A 1ZIYA 3QMMA 1QFMA 4N8SA 1E5TA 3I28A 1L7AA 4UHHA 2I03A 3R3WA 4DM7A 5ALSA 1C7IA 2HRRA 3C5WP 1UK7A 4H7DA 4DNQA 1LBSA 3FSGD 5CT5A 2VF2A 1NU6A 4S0XA 2V98A 1UZAA 1OXMA 1F8UA 5SYNA 1DWQA 1BU8A 2XI4A 3DEAA 3DOIA 1MAHA 4BATA 1QIJA 3ZPXA 4MYSA 2ONCA 3DKRA 1CUXA 5ALTA 4DSZA 1SFRA 2VATA 4X00A 4JNCA 4G8CA 3BDIA 4BE4A 2YASA 3YASA 4BE9A 3K9BA 1R50A 1J2EA 1GKLA 5CW2A 2R8BA 4M0FA 2HADA 5AIAA 3I2KA 1CUCA 3WA7A 1CUGA 5J3JA 1ISPA 2G63A 2Y1KA 5K3EA 4K2AA 1W52X 1CUJA 4RE5A 5IVKA 5A7HA 4B9EA 5DNWA 2HA2A 3CN9A 1QZ3A 3HACA 4F60A 1GGVA 5LZ2A 1QLWA 2V96A 2B4KA 2H9YA 1H23A 5C8VA 4W63A 1UT6A 4QWWA 4K6KA 4UFNA 1G4HA 2HA5A 3ESAA 2JGMA 3IA2A 4Y2QA 1GZ7A 4N8DA 7YASA 4H7KA 5AKGA 1CUVA 3C6YA 1LZKA 2RAUA 4FHZA 1EH5A 5D7BA 2C7BA 1CUAA 3H04A 2HDWA 3IUJA 3WKBA 4J0DA 5HQ3A 2QTBA 2OGTA 2VT7A 2HRQA 4FLMA 4PSUA 4WDQA 4W1QA 2PUJA 4QE3A 1LPMA 4WY5A 2CZQA 1I6WA 4OYLA 1U2EA 3EQ9A 3CN7A 3L1JA 5FPQA 4WFJA 2Y2VA 4LXGA 1LPOA 5AK3A 2E3JA 1GXSA 4QA9A 4X91A 1YS1X 2O2HA 4V2IA 5JZ9A 2J3DA 1XQWA 1FJ2A 3BL8A 3ESBA 3STYA 3AZQA 2B20A 5AH0A 5ALVA 3WJ2A 1C4XA 3FBWA 3WKCA 4QLAA 1WPXA 2C4HA 1AURA 3V1MA 1H2YA 2QM0A 5E4JA 4TPKA 3A2MA 3EIOA 2CB9A 3I6MA 3UMJA 1YASA 5C8ZA 1TCCA 2BCEA 2XUFA 4OU5A 2XUAA 3H2GA 5JZBA 3CCCA 4CCYB 2HL6A 2XMBA 1N8SA 5AI8A 2ZJ7A 1H2ZA 4ZV9A 1UOPA 2Z8ZA 4G4IA 2P8SA 1MNQA 2QZPA 3LIPA 2CEKA 5DWDA 1XLUA 2WHRA 3PI6A 5KBYA 4Q3LA 2FJ0A 2H1IA 3GROA 1NU8A 2ACKA 3DKKA 5BWCA 4ARAA 1XRQA 3DYVA 2J4CA 1O6GA 1SOMA 1A8SA 3DQZA 5I7UA 3GBSA 4C4ZA 4XJVA 1XZFA 2QUBA 3TGLA 5E2IA 4HS9A 5FRDA 4U2GA 5HCUA 2WLSA 4QDOA 2YH2A 3D0KA 5C8XA 2RGUA 3IUMA 4FDMA 1WB6A 2Y2UA 4E14A 2Z3WA 1QO9A 1MAAA 1ZI8A 4H0CA 2B9VA 1CRLA 1ZI6A 2QJRA 1B6GA 1YB6A 1ETHA 2WJ4A 4BTVA 5IH7A 1IZ8A 1QIHA 2XMDA 2QRUA 3STXA 3HC7A 1XLWA 3IB3A 4Y2RA 3STUA 1QIDA 5I9IA 2AJCA 5ALIA 2GYWA 3FNBA 3Q8WA 4HZGA 1UKAA 2XUOA 2CBGA 2BUBA 3PE6A 4XIIA 5FLKA 1XZDA 3I6YA 2ES4A 3G02A 2RHWA 1SCQA 4BB0A 2AJ8A 3QMVA 1XRPA 2VQ6A 5LZ8A 3M3DA 5E4YA 3OG9A 5FV4A 1BRTA 2PSJA 3DDUA 2ZJFA 1IUOA 3JYHA 4AO7A 1CEXA 1ZGCA 4J0HA 3JWEA 3F96A 1MN6A 4NMWA 2GZSA 3GA7A 3O4JA 4AMYA 4KE8A 2J3QA 3QH4A 4GI1A 5FP0A 1EXWA 4QDUA 3DNMA 3IUNA 4X6XA 2B61A 4Y2PA 1CUZA 4MEAA 2WIKA 3AIMA 4INZA 4UHFA 4ROTA 4ITVA 2ZYIA 3A6ZA 5AM0A 2O7RA 5BV7A 4ZRDA 3PF8A 4I4CA 2WJ3A 4NS4A 5K3FB 1RP1A 2WFZA 3V1KA 1QIGA 4UBJA 3BDVA 1XFDA 2PPLA 5LLSA 3SX4A 2I78A 4Y2XA 5HKAA 3PUIA 1Y37A 3V1LA 1SC9A 4Z49A 3FCYA 2XLCA 3G0CA 4FWBA 3KD2A 1FFEA 4Q1VA 2PU7A 2O2GA 3SK0A 3HYSA 4B7ZA 1UK6A 4BAGA 1CUHA 2WM2A 1ZGBA 2WHQA 1UKCA 1B41A 1R9MA 4ARBA 1DT5A 2WIFA 5AKKA 5K5EA 4A5SA 1K63A 1VJ5A 4DNFA 3ICWA 4FBLA 2NW6A 2PM8A 5AO9A 3NOXA 3D59A 3G9ZA 1Y7IA 5DTIA 2XUPA 4K6HA 3FVRA 1P0PA 4MXDA 1BS9A 4C89A 5CRIA 5DNVA 3IDAA 3WZLA 3S8YA 3R3VA 2IITA 2VEOA 2Y6VA 3UUFA 1XRNA 5LZ5A 2JIDA 5CT8A 1AUOA 1XZKA 2EDCA 2XQFA 4X85A 2H7YA 4QWMA 1BN6A 2O7VA 2QOEA 3G0GA 3CXUA 2Z3ZA 2WJ6A 2H7XA 2Y6UA 5I8PA 1ODSA 4F21A 1U65A 3KWJA 1QIIA 4DMFA 5ALQA 3PF9A 2OGZA 3RKSA 4LXIA 5CT6A 1WM1A 3OM8A 1ACLA 1MX1A 4TVKA 1CUEA 2PBLA 3E1GA 3IBTA 4N5HX 4HXGA 2ZYSA 3M81A 5AKIA 1CR6A 2RHTA 2XQGA 2XUKA 1CUYA 4Y2YA 3C6ZA 4CI9A 4CFSA 5EFZA 1QONA 1EB8A 1U4NA 5CH5A 5ALXA 3S2ZA 4W1SA 5ALNA 1EK2A 4J0KA 4G4GA 4B0OA 4BCDA 2C5GA 3I6ZA 3BE8A 1ODCA 3AFIA 1CUFA 1IMJA 3F9CA 4Q34A 4OSEA 3WYDA 3BIXA 1G42A 3D3NA 4AX4A 2AJBA 3F67A 2ECFA 4NVRA 1CUWA 1AX9A 2V97A 5K3CA 4IH9A 1DTEA 5DNUA 5ALLA 4UBKA 1WPRA 3O4HA 2AXEA 2DHCA 2OCKA 5A7FA 2X8BA 4EA6A 3E4DA 4PNZA 1MX5A 3R41A 4QLOA 1BCSA 4ZREA 2VAVA 3MUNA 4FOLA 4AN1A 2HFKA 4KE9A 5HF5A 4UHBA 1ACJA 3MVEA 4DMCA 4DTCA 1CIJA 2DHEA 1LPPA 4UBOA 1FFAA 3DJYA 4GHWA 1CQWA 4I3FA 3EQ7A 4UBLA 3BJMA 1JU3A 5EIHA 4K5QA 4B6GA 4KACA 2OXEA 2IIVA 3ZLUA 5K3FA 1OCEA 1DX6A 3D7RA 1VA5A 4DGQA 4IO0A 2DHDA 1XRRA 2X5XA 4AZ3A 4JEIA 3SC2A 3K2IA 4AN0A 2QS9A 4BP9A 5K3AA 1F0PA 1BEEA 3T4UA 1QIFA 2AJLI 4FFVA 1XZJA 3HJUA 3GZJA 5AHXA 5A71A 3D2AA 3TRDA 4EB0A 1MNAA 4EY5A 4MWSA 1LPSA 1K4YA 4LKOA 2OLEA 3ZLVA 4AB1A 2RIPA 4IQ4A 1E3QA 1F6WA 3HRHA 3WKDA 2WIJA 1QIMA 1EVEA 1M33A 2ORYA 2ZSHA 3FCXA 4G8BA 1UOQA 5ALKA 5EGNA 1RWQA 5T4BA 4WFIA 5IVDA 3L1IA 4CCWA 1WHTA 5DYYA 4OU4A 4Q82A 1QIKA 3LP5A 1L7QA 4BAZA 2WIGA 2PVSA 4F5ZA 1XZBA 3DCNA 4HRXA 4L0CA 4AXBA 2JGLA 2VSQA 1QE3A 2HA7A 4JYMA 5ALDA 2PSEA 4B84A 1CUBA 5AI5A 1UKBA 4JUIA 2HU7A 1MO2A 4OPMA 5DYWA 3O9VA 4P9NA 1ODTC 4AO8A 2WSLA 4X6YA 1UFOA 4IHAA 3C8DA 1YR2A 1CUUA 2GYUA 3IULA 4QDZA 1BN7A 4KR0A 4BAUA 4X92A 4EBBA 5ESRA 2ACEA 3P2MA 1BCRA 5ALEA 4BCBA 1H2XA 1W1IA 3C43A 3FVTA 2XLBA 2WFMA 2RONA 2C58A 3HI4A 4KE6A 1THTA 2BUCA 4FMPA 3STVA 2XUIA 5AICA 1AC5A 3WWOA 2VJBA 4X7BA 1QOZA 2HM7A 2ZYRA 3GELA 4MWTA 5HF8A 1YCDA 1TAHA 3C8HA 3WL7A 5EHZA 3PFBA 1LGYA 4FLFA 3WK7A 1SCKA 4OB7A 1MJ5A 3VJLA 5HZGA 2OQVA 4M0MA 3SWWA 2PSFA 4IH4A 3OPMA 4N8EA 3AZOA 4C88A 3I2GA 3PFCA 3VJMA 2GBCA 1HPLA 1E8NA 4E11A 2WQZA 3WKAA 4UHEA 4AO6A 4B81A 3QPCA 3U1TA 1IZ7A 3LIIA 4U2FA 1KEZA 3AZPA 2QXTA 1QIEA 5JD5A 3VXKA 1WOMA 2JBWA 5ALZA 4LIPD 1XZGA 1Q0RA 1Y7HA 5AK6A 1HBJA 4DIUA 2HA4A 3RARA 2VT6A 4FBMA 2QJWA 2BAGA 3FYUB 3C6XA 3OTQA 4L3WA 5AI9A 4FFWA 3A2LA 5CT4A 2XUGA 1XZHA 4O08A 1AZWA 3BWXA 5CH8A 4W9RA 5AOBA 3VISA 3HZOA 2QT9A 1N5RA 2WU4A 1Z68A 3D2CA 2WTMA 2OAEA 3RK4A 4QNNA 4KRYA 1Q83A 3ILSA 3VVMA 3H18A 1F0NA 2ZVDA 3DD5A 4MJ3A 4ZI5A 5FOQA 5JALA 5K3BA 1GPNA 3F97A 1A7UA 2FUKA 3LS2A 1MPXA 5AM1A 3DS8A 3WWPA 1EI9A 3M82A 5EHQA 5K3DA 1ZICA 5AKJA 3KDAA 4H7IA 4I19A 3PICA 5HKBA 5A2GA 5E4TA 4FLEA 1ZJ5A 2DQYA 5ISMA 2PKYX 3ED1A 3N2ZB 4L9AA 4X93A 1UK9A 4KAJA 2I3DA 1VE6A 2XMQA 1FFDA 1UOOA 4BRZA 1X2EA 3ESDA 3V9AA 4F0JA 1CUIA 1G66A 1YSCA 5AM3A 4JH0A 1DU4A 3WK6A 2XQJA 5IVHA 1LZLA 4YASA 1GT6A 3W2TA 3FYUC 2XMCA 1ZI9A 4ZGBA 5AOCA 4KRXA 4FKBA 1ZD4A 1W6RA 2CJPA 2RI6A 1TQHA 4G9EA 4H35A 4LYEA 4QEKA 4X94A 1C7JA 1NX9A 1A8UA 3G9XA 3KOOA 3QPDA 1EB9A 3HABA 3WKEA 4A16A 4BYMA 2XUQA 3WZMA 1VXOA 4LYDA 1TKRA 3QZUA 1QTRA 5AM2A 3O4GA 4EY6A 1H22A 5HFNA 5A7GA 2OGSA 4KE7A 2VJCA 1A88A 3WWEA 4HXFB 2JEYA 4WJLA 5ALUA 2VJAA 4GWLA 2O2IA 2Z5GA 4H7EA 1G5FA 1EHYA 5LYYA 4B9AA 1EK1A 3Q0TA 1RYYA 1KU6A 3G7NA 4DSAA 1X2BA 1XROA 4J0CA 1A8QA 3R0VA 4AMZA 1DWPA 1J1IA 5YASA 4CCYA 4GLBA 3OOSA 4JYPA 1DQYA 3O0DA 3WYNA 3OURA 1J06A 4U2EA 1K6EA 4PV7A 5ALWA 1FFCA 3C5VA 3E3AA 4FTWA 3QYJA 5ALHA 3O9MA 4PSCA 3QMWA 2QR5A 5ALGA 5JAUA 4BZZA 5BWBA 2XUDA 2XUJA 4UFPA 4NZZA 4BVKA 3MGAA 2WG2A 2YYSA 4MEBA 4ZWNA 2G5TA 5ALFA 2HU8A 4DLNA 3A70A 4UUQA 1R1DA 3W9BA 1CPYA 2D0DA 1HQDA 1DINA 1CQZA 3FYUA 5AKXA 4BC1A 5DTJA 4TGLA 1LPNA 4K6GA 2XE4A 1R9NA 2C0PA 5HQ3B 1DT3A 3N0TA 5EHNA 3WK8A 1EDDA 1VLQA 4OUKX 1EVQA 3LLCA 2Z8XA 5T4HA 4BZWA 3VDXA 1HL7A 1BE0A 1JJIA 5AIBA 3I2IA 2PX6A 4KAAA 4LHEA 2G4LA 1XRLA 2BFNA 3H2IA 4OB6A 3BF8A 4BVLA 4C87A 5AK4A 3B12A 4DNOA 3H19A 2OPHA 1IUPA 5DJ5A 4PO3X 2WUDA 4RE6A 3A2NA 3W05A 1LBTA 1P0QA 3BXPA 1DX4A 3I1IA 3NGMA 1W4LA 3EF3A 3AJAA 4Q3KA 1AMNA 4Y7DA 2WILA 3KWFA 1CV2A 5LZ9A 2I3ZA 3WA6A 2UZ0A 2JGKA 3QVMA 3WIBA 5AM5A 3STTA 4L72A 3F98A 1XZMA 4XWGA 5T4EA 3WK5A 3DL7A 5FDFA 2DQZA 1WB5A 1CUSA 4B80A 1GKKA 5FUMA 4H18A 1VXRA 5AK5A 3R3XA 3F8SA 1N5MA 4X3CA 4KAFA 2BJHA 1K5PA 1VZ2A 4H7HA 1HLGA 2ZSIA 6YASA 5JAHA 4WY8A 4A23A 5A62A 2JGJA 5DYTA 1ZIXA 1PV1A 5CT9A 3FYTA 4EY4A 5C81A 5CXUA 4B83A 1J07A 4RPCA 5EI5A 4Y2TA 2ROQA 3G0IA 2XDWA 1IUNA 3DYIA 3ZI7A 4GW3A 2WU3A 3WI7A 1CVLA 1YAHA 2GBGA 3G9TA 1QGED 2HA0A 2HHAA 2V9ZA 3KSRA 4UFOA 3DL4A 5JAPA 1SCIA 4BC0A 4PSDA 3WLAA 4J0IA 5IVIA 3M83A 4QZVA 1IVYA 4YK7A 3G0BA 5ALOA 2Q0XA 3IUQA 2IX9A 3I1YA 4U2CA 3QITA 4G5XA 2OCIA 4FNGA 1GQRA 2OAGA 3I2FA 4P08A 1JKMA 4MYDA 2GBFA 1R3DA 5BOVA 4Y9SA 1N1MA 2CUTA 4WFKA 4UHCA 3C6BA 2CKMA 1LPAB 2WUEA 4ZXFA 4EY8A 5LP1A 1R88A 2QUAA 2BGNA 5AP9A 1LPBB 2HFJA 2QXUA 3AIKA 3UUEA 5CBKA 4X95A 1JJBA 5FKJA 1T4MA 3O4IA 3WK4A 3C87A 1AKNA 5ALYA 1WHSA 1YS2X 2OCLA 1XQYA 2WFLB 2GBIA 4BDSA 5CTAA 5JADA 1KU0A 3D2BA 4D9JA 5ALPA 3HEAA 5HF9A 4DMKA 4W1PA 2WG1A 2R11A 1L7RA 3W06A 1ZD2P 4GBGA 4DMHA 2GYVA 2ZYHA 3OC0A 2JGIA 1UK8A 4P93A 1K8QA 1UWCA 2OG1A 2WUFA 3WMRA 2JF0A 5DLPA 2JEZA 4C01A 3NWOA 2BGRA 4BRSA 1X70A 2JGEA 1VKHA 2XMGA 3C70A 4X97A 4U2BA 1TK3A 2DSNA 3WWCA 2EDAA 3AILA 2ZJ6A 5AI4A 4Q05A 1Q84A 4RNCA 3G8YA 1E8MA 1XKLA 2EEPA 3I2JA 2OCGA 1E89A 3WL8A 3DOHA 4X6UA 1ORWA 3FWHA 3TJMA 4PW0A 2PUHA 5HK9A 4J0GA 5KWIA 1ZOIA 4BDTA 3ESCA 4CIAA 2D5LA 5AI6A 5T4FA 1XQVA 5AKLA 3TEJA 4LXHA 2QVBA 3STWA 3HXKA 5AOAA 3I2HA 5CXXA 1XQXA 2XQIA 3AINA 4B82A 5FXMA 5AKZA 1MT3A 3BJRA 3D4LA 4XX1A 1QJ4A 2QKYA 1PFQA 2AJDA 1JMYA 1GPKA 1QFSA 2WHPB 1P0IA 3HSSA 4XVCA 2VTVA 3V1NA 1OILA 4X71A 2DFPA 5EHXA 3WIOA 2PL5A 1QTIA 1E66A 1EA5A 1XZAA 1R4ZA 4CG2A 2XMZA 5AKHA 5KREA 1LLFA 4QDTA 1AQLA 4BCCA 3GUUA 2QMQA 1MTZA 4HXEB 2XMRA 3ZLTA 5LIPA 4KEAA 2K2QB 2PU5A 1ZD3A 2YXPX 3EBLA 5EIAA 1DQZA 1O6FA 5HK8A 4OD0A 1CFJA 2X76A 3H1BA 3G9UA 4AZ0A 4HAIA 3FLEA 4HRYA 2H7CA 3W04A 3BIWA 2WG0A 1E8DA 2VJDA 1YAJA 3W9UA 1EINA 2XT0A 2HA6A 5JASA 3IURA 4EUSA 4H77A 5EIEA 1ORVA 4HTAA 5KWJA 4PQEA 3H2KA 5AKYA 3U0VA 1CUDA 3O95A 2VAXA 4OCZA 3X3HA 1S8OA 4QDXA 5H3HA 5AJHA 3ANSA 3R3YA 1VE7A 3K6KA 4B0PA 4Q3OA 1XZLA 4BVJA 2C5FA
chains in the Genus database with same CATH superfamily
5BW4A 2WNIA 1N2JA 1QORA 1JJFA 4BZXA 2G1JA 3ORYA 4KI0A 5LKAA 4Q9JA 2UZIR 1N4DA 3QKRB 1AT1A 1PDWA 2IY9A 3KKOA 4G6ZA 3L7DA 1F38A 4O4IB 3VSAA 2C96A 5EMMA 2OCPA 2OSBA 3GEPA 2PAAA 5K2OA 2O2EA 1RPJA 4OM7A 1JYSA 2AQKA 4RY8A 1N5DA 2P62A 4Q4JA 1AVTA 4U7HA 5DI3B 4DHWA 4U9HS 1NUAA 2MYUA 1VSUA 3L40A 4ZCRA 5I47A 4N01A 4WXMA 2OHFA 4IH1A 4BX8A 2HIAA 4LGCA 1F7VA 1E9RA 2EWMA 2W6CX 4YRCA 1KY4A 1QQTA 3UT6A 4E15A 1T8SA 1A71A 1Y4AE 4RXUA 5GJBA 2WT9A 4RV4A 2IH5A 1KMNA 1CP3A 1NUSA 1XYGA 2OQIA 4S3MA 4ZV4A 2GK4A 3MIIA 2ZSFA 1WV0A 3C45A 4RBNA 4OGWA 2XNDD 2A0XA 3QU5A 5FLXA 5ALRA 1DRKA 4L57A 1BGXT 4COOA 2DR0A 1NQ5A 4L4SA 3H2JA 3IAS6 2CN1A 4LDRA 5B64A 1S1MA 1GPUA 1UMKA 2FSFA 1WNFA 4W7SA 4AY6A 3K9QO 5JCJD 4AZTA 3VPHA 4DR5B 3H17A 1KO1A 2YHAA 1KEUA 3K6JA 3WGQA 2KHZA 1RQXA 5DIZA 3IKTA 3FBGA 1QGDA 4HQFA 4NMHA 2JFHA 2DFDA 2JGFA 3RC2A 2QN3A 3FF4A 1T24A 2E87A 2GRAA 4MROA 4DQ0A 2J5XA 1JNXX 1XLVA 3ICVA 4IXTA 3MW8A 3ER8A 3L7JA 2HWKA 2VTKA 4IQFA 4RK0A 4RM3A 3VR5A 2WIDA 4U2DA 3THYB 1HE5A 4N0PA 1A9XB 1JIQA 5HUHA 1BYUA 2NXJA 3FIUA 3KHKA 4JU9A 3EIHA 3PVSA 4X84A 2RGBA 5EJ9A 1G3RA 1XP5A 2GTPA 3FZYA 3T5AA 3FHLA 3H1AA 5EERA 5AOVA 1OAOC 1DKQA 4AULA 4K88A 1LFDB 3N76A 3L8HA 4FB4A 1HKHA 2I99A 2I54A 1TC1A 4RD3A 4EG6A 5ES4B 4A36A 5AI0A 1QGUA 1N34B 3FJ1A 4BPBA 1RWOA 2Z6VA 3QYPA 1W47A 2X9QA 3I0NA 1UBFA 4J7AA 1KEVA 2FOIA 3SYTA 3ZBTA 4BWYA 2O8EB 1QH1A 4BGUA 4GEGA 2W22A 1EDZA 5KHOC 1JFSA 1PX2A 4J3JA 3AFHA 5JY1A 4E7OA 5JSZB 3QXSA 1IEXA 1P4RA 1J22A 4YT8A 3QM1A 1EXVA 5BN5B 1E62A 3ADDA 1P3JA 3OA0A 1XRMA 4G65A 5DHFA 3EAGA 4C20A 4NZOA 4MYHA 4AN4A 5KTSA 5M34A 1ABEA 1BQ4A 2DKFA 3EGWA 4UHDA 3DV2A 4CM8A 2GCIA 4HGOA 3AERB 5EJ6A 1B74A 4AU1A 2BHLA 2RHCA 3AFMA 1K88A 1H4SA 4K81B 5DCLA 2VQDA 1CLEA 1P0MA 3AEQB 3TPFA 1H6CA 3A27A 3K5HA 3SQNA 1KDPA 5BRJA 1H5QA 3PDCA 2ZT5A 5K0ZA 2B1IA 3BA1A 1GP2A 2YQ5A 2I7TA 3GJ0A 4MPTA 4WLVA 4OX9B 2LCIA 1FFHA 4ZQFA 3OD1A 5K0BA 2XDAA 5KCZA 2HSWA 1TZMA 1HO3A 3TCNA 4JP8A 3WP1B 1IZYA 1V5IA 3ROXA 2C61A 2F43A 4F8JA 1XVTA 3BF7A 5AM4A 5K0LA 2X1VA 2B4AA 2O4CA 1JVNA 1QCDA 1GUAA 2BMVA 2XHEA 3E1SA 5D3MA 1AGYA 4GX0A 5FPPA 2JKZA 2NTEA 3TFWA 1TCUA 1PR9A 2PHZA 3KYCA 3ZHYA 1JFTA 1UINA 2VOJA 2W6ZA 3OQJA 2C94A 3OPYI 4YJHA 3GCXA 3JQDA 1CY2A 3P5SA 4IUCS 3REGA 2XXAB 5H3CA 3EXIB 1XD2A 1USKA 2Q2VA 2ZJOA 4LJYA 4P36A 2DR3A 2Q6TA 4M0EA 4XCVA 3SLRA 3TLGB 3T1TA 4LYJA 3HDHA 2YS6A 2PZLA 3WL6A 5CDFE 3BZBA 3H6KA 2XCOA 3AYZB 3H4IA 1YUMA 2JHPA 4YAEA 4OI0A 2RH9B 4XASA 3S1AA 3V48A 4COKA 5AVQA 1CHNA 2JIZA 1XZEA 1F2UB 5IAAA 5IJAA 2F3UA 1S2MA 1ZVJA 1MB9A 3EQ8A 4KDRA 3EZFA 2F64A 2YZ2A 5TDHA 1XZCA 3QU4A 4XVUA 1FFBA 1AF4A 4FYJA 3WWZA 5IF9A 1R8QA 1Z0KA 1V0JA 4TMFA 3SFVA 4ZYWA 1OH7A 3EIFA 2BMAA 1OPXA 2PRKA 2E4VA 4IZHA 2VZEA 1WLSA 1X7YB 3BHNA 4GDMA 4B1FA 4C4YA 1RABA 2DEUA 3PNYA 1T1JA 3O26A 2Y9MB 3S44A 4DCTA 1U7DA 3GJSA 1Q3HA 1LNSA 3OEED 4PG8A 1J1ZA 4H1TA 1AO3A 1JG7A 4XYMA 3KXPA 5JNVA 1UT8A 2P6UA 2AUMA 4ID3A 1JHXA 3LCRA 4L50A 3ZE6A 5D6OA 1UBSB 2IYEA 4IJKA 3M4ZA 5SYMA 1MC8A 1U0OC 3FZGA 3Q15C 4IDOA 3WHKA 3F7TA 4RPGA 3K2EA 3TLMA 1JEYB 5AUQA 3ECAA 3DVAA 1OMOA 2PSSA 3A4TA 4LDZA 5JSUA 2W4IA 5ICFA 1YI0A 4RKRA 4AL4A 4GMDA 1CR2A 1P8AA 1YCFA 3EHDA 2QPLA 2QLNA 1T9CA 1VJ1A 3D8UA 2JKVA 3SS9X 2LZ0A 3T7DA 2HBQA 1NMZA 1RM3A 4KQ1A 2BRUA 1C4OA 4AAYA 3NMUF 4I8DA 4PYNA 5J2TF 2DBQA 3X1KA 5ILOA 1T91A 5C46F 2H51A 3IPRA 1KP9A 4DQLA 1SR8A 4CMCA 5FWNA 4RVOA 2O9JA 4EYQA 1IVSA 3GJYA 1ZVQA 1GARA 2GK6A 2IELA 1RBYA 1RW4A 4TUYF 1QBKC 4URYR 3VVLA 1ECJA 1ILWA 3MINA 4P98A 1NMXA 5C31A 3LW8A 3SF8B 1VZ3A 4DMUB 3I83A 1C8BA 2C5LA 4FYPA 1D1PA 4BNZA 1VOTA 3V55A 5AFSA 1NLUA 1WUKS 3DLIA 3KPYA 2Y1EA 3R0JA 3CX3A 5T6BA 4LJLA 3AUKA 4BGIA 1DWOA 2C9OA 4OLAA 3S29A 3C1OA 2BJWA 1L6IA 2G9ZA 4OLJA 5JNSA 3SHQA 1SXQA 2EAUA 3ILHA 2DFVA 4RENA 5FFFA 3AR4A 5FULA 3VQTA 3WL4A 3X0DA 3F6PA 5C52B 3A2KA 3BREA 4ND3A 1TQ8A 3RF6A 1Z2NX 3OFVA 4EFLA 1RQLA 2IHUA 1UJ5A 2M6LA 3BCRA 1AS2A 1QMPA 3V4RA 2RGYA 1MO5A 2GXQA 4TKVA 4YVFA 4YX9A 1BTOA 3SQWA 2HU5A 1DIRA 2VRNA 1PR6A 1EFAA 2AYXA 1LVGA 3LC0A 4YJ2A 4E2XA 3DAHA 4W4TA 4R7TA 2IT1A 5A4IS 5BSWA 2AEFA 2R6ZA 3JQGA 1PK9A 1BW9A 1TJ5A 3PUHA 3K1TA 4OBWA 3A1SA 3MNFA 1I4EB 1RCUA 2KB0A 4Y1RB 3O92A 3W1EA 1XTRA 4ASUA 4AROA 3A10A 1ZOPA 1CLUA 2VDOB 1GNQA 5BR1A 3FNFA 1R9JA 2R62A 3OE1A 3DZCA 4RHCA 3WLHA 1PW5A 2ZSKA 3H1EA 4FU0A 2J3EA 2QRNA 3BL5A 1P44A 2J6CA 3UW1A 4KJXA 4RGYA 4UBMA 3R3ZA 4TL7A 5ALMA 1XKTA 3SP1A 3V00A 1G18A 3ZCSA 5JD4A 1IOLA 5E3HA 3I4FA 2C9ZA 4IHJA 3ZI4A 3PFIA 4BUCA 2H1HA 1ADJA 2EIHA 2H16A 3DZDA 1QHHA 1ZIYA 2Q9BA 2GLTA 3ODPA 2PYZA 4A03A 5E1BA 1DSSG 3I28A 3V3KA 1K5DA 4EGAA 1TQ4A 1AQYA 3EW9A 3QVLA 1IB0A 3G2JA 4DM7A 5ALSA 1VB3A 2B83A 2YXLA 1M6NA 1SXHA 2GO1A 2GPAA 2ZTUA 1OBCA 1WD5A 4HSEA 1SXPA 3ZDCA 4MKGA 1MB0A 4DNQA 4I8XA 3PT9A 4YACA 3VKGA 4UW9A 5LP6A 1TM5E 1PQWA 3U7QA 5CT5A 2QMUA 4X1IA 2FPIB 1TMGE 2HCJB 2IPNA 3A36A 1NU6A 3LLUA 3LY8A 3QI2A 1K98A 3DXYA 3BWVA 4UUPA 1Z6ZA 1VKNA 2HJSA 4YMTA 1QU2A 3BL6A 1SXIA 2HBZA 1CTQA 1NI3A 3G8CA 3BM5A 3F5DA 4WKOA 3R77A 3IPLA 1O9GA 5KQMA 2NOAA 1JH8A 1W1UA 5M29A 4LF5B 3MTDA 1NVWQ 1ISGA 5A0TA 3KUCA 1QZTA 3EAQA 5EJMA 1P5RA 1T6NA 2DBZA 4L8FA 4WKCA 4FKZA 7AT1A 4O3FA 1K2WA 2NU6A 4DSZA 3C5EA 1NM5C 3P9QA 4EP1A 2AT1A 2YNMD 1BX3A 3WIUA 5JYBA 1JG3A 3SXPA 5IK2D 4REQB 3GA5A 3TCXB 1TLLA 4CGYA 2ZR0A 1WSBA 3LWNA 5B7QA 1HEYA 3LXMA 1H2AS 1LK5A 1QRTA 1STOA 3BDIA 1U7UA 2X4LA 5B36A 1W88A 3R6GA 4I4TA 2AZTA 4X20A 4BE4A 2IYUA 2P90A 3O74A 4LBVA 3EFOA 3KHTA 4GPD1 4AKTA 4RKFA 4CIVA 1JPJA 1WU7A 5CHEA 3GI1A 1Q7GA 3DBOB 2PGNA 2XD9A 3O75A 3RAPR 1MQAA 5JRJA 3AF6A 3B9PA 3SF0A 5CIWA 1KBOA 1Y6GA 4CR7A 5B7NA 1JALA 1GUFA 2XKKA 1Z7GA 3MWDA 4HEHA 3VNQA 2VNHA 2VF8A 2WUVA 3DE7X 4MA4A 5CW2A 4MVJI 1P3DA 3U9LA 2HADA 2VZ0A 3HCEA 1YI1A 4QREA 1LRJA 4GRAA 4UXHA 5DK6A 4F5YA 1CUGA 3PTZA 1MB2A 3WA7A 5IWAB 1XF9A 2G63A 1NJ8A 3U37A 2PL3A 3O8BA 3NXSA 5EOVA 3VZRA 2XB9A 4WNAB 1M2HA 1Z06A 1ZOLA 1Z26A 4RE5A 2QTMA 3WB1A 1DNPA 1H1LB 1UFKA 3PFWO 3LFUA 4UJ3A 5A7HA 3KLNA 1UKZA 4PZAA 2I2FA 5TMDA 3DLHA 4AK9A 1TKCA 1E3JA 3WMXA 1Y5MA 3H3JA 2ZM6B 1WXQA 3HACA 3FFBA 4NE7A 3NEYA 2FX2A 3WRXA 2Z6AA 1YZKA 5LZ2A 5GM1A 1IQUA 5JS7A 1JIXA 1KEEB 4H3HB 4DV2B 5DMHA 2B4KA 2H9YA 4IV5A 4YCAA 4BO4A 4RLSA 2CNWD 2B3DA 4LECA 4LUCA 2KSQA 3DC7A 3CNBA 4BKOA 2QI9C 4BBJA 4PNHA 1ZCZA 2M6SA 2E4WA 2HA5A 4RADA 1U2GC 1XTZA 2AI1A 2GD0A 1DIOB 4RV5A 2PRJA 4D57A 5K9ZA 1PO7A 3DLAA 4Y2QA 3BFXA 1CS0B 3EXHA 3HSYA 4I3GA 4FE7A 9ATCA 1PZFA 5FO1A 4Z4EA 1CIVA 1P2SA 3CWZA 1W4AA 3GRKA 4M7RA 5LYJF 1W49A 1E7RA 3LY7A 1Z5VA 3O1JC 1YZFA 1W59A 1AKMA 4FX5A 3AL0C 1K3TA 3O8QB 4N8DA 4XAQA 3RC9A 1XRSB 3ZGZA 5KHLB 3HXQA 4JITA 4KDCA 5LBTA 4U6SA 2OHGA 4YCLA 3G8BA 2OBMA 4PICA 1LZKA 5C7IO 4LTDA 3EWNA 4PR0A 1MTOA 2NYRA 2OGUA 3EF0A 3L8FA 3QOWA 3H04A 1CUAA 4ZVNA 3T4PA 1M5TA 1D04A 1T5LA 3WNDA 2C2OA 5HQ3A 4JJ8A 4XE5A 2G17A 2VFAA 1XN1A 2HF2A 5LXTA 1K75A 2BEUA 1RT9A 2Q6OA 3KAPA 1VB5A 5LLDA 2HRQA 4B6EA 3IMEA 3SJAA 4CIXA 1OLXA 3EFHA 4D8XA 2F9MA 4EW1A 1YB2A 2PUJA 2ONJA 3TL2A 5C35A 3CF0A 4L2IB 1D2MA 1VMKA 1LPMA 1MOZA 4RMHA 1Z7BA 1C3XA 4WY5A 4TRMA 1RYMA 1I6WA 2NU7A 2AFHB 1ZD8A 1TA4A 1PD1A 1NNLA 2BFOA 3WNVA 4A26A 2JGRA 4B5KA 1GRCA 4O4LF 8GPBA 5FPQA 4WFJA 2Y2VA 4LXGA 4LJSA 1JIVA 4PCLA 1NZDA 4HPXB 1FNSA 2JLWA 4ZFNA 1YVRA 2ZJ0A 1PSWA 1PT7A 1W4ZA 4N7MA 3GO4A 2IZ0A 2ZTHA 3KZMA 4V2IA 2I4OA 3ULKA 4J4TA 2QSZA 1XCOA 3OBBA 2ZI3A 1SHTX 3GGJA 3OLXA 5BN1A 4FM9A 4DVJA 3H0KA 2Z09A 1U0BB 2QUJA 3H2SA 3C3JA 3D3WB 3ASYA 1TCVA 5E7QA 4O59O 2GPSA 3TECE 1UKVY 1UQUA 3LVQE 4JVLA 1AOXA 3ECCA 4K9QA 5AH0A 3PXCX 3T0FA 4B31A 5ICEA 2HT1A 4PYMA 2ARKA 1R74A 2W2MA 3WJ2A 3WIDA 4RK7A 1JMVA 2ERYA 3T5TA 1UBTS 4R2KA 1NBEA 3VC2A 1V6AA 3WGMA 2P9GA 2FEXA 3H87A 2P9QA 2ZRJA 4E33A 3ZGYA 1XDZA 4HUTA 1J56A 1TVEA 4AZSA 3Q10A 4IMPA 3KQUA 5E6RB 2DLCX 1I10A 4YQZA 4K9NA 5FBHA 3RWBA 4EPRA 1ESCA 2VOEA 1I9CA 3RVDA 3UWDA 5C8ZA 5K09A 1FDRA 1KH3A 2XNHA 3EDQA 5FR2A 5JXJA 4KO8A 1HG1A 5JH7F 3AY6A 3D7LA 4C6TB 3F90A 2WD7A 3RVNA 4X66B 1NFRA 1YZHA 2D7CA 2XUAA 4Z1OA 3H2GA 1FP7A 4TTJA 1VJGA 1YGPA 3O8CA 4NJMA 4LV5B 2DRIA 1E4YA 4XJTA 2PTGA 3CZMA 3DP9A 3KM0A 5EAIA 4NOJA 4YYZA 1IJEA 5BOSA 4JXXA 1DJQA 3SQDA 4RQBA 3B8HA 1CERA 1H94A 3U4QA 3ZV6A 3FVWA 4YRLA 1OX4A 2BGKA 3HA7A 4U00A 4CCYB 4TYWA 5T8KC 3OCZA 1ZK3A 3QPVA 2YWHA 4XB2A 4BMXA 2NUTB 4NJOA 4D9CA 1IEQA 3HDTA 4N0DA 4ETMA 4JBNA 3CISA 4ZKEA 3IT0A 2B4QA 4WL0A 4ZV9A 1EAMA 2Q4RA 1JKFA 2W58A 3DOCA 4QDJA 1ECPA 3V8QA 3U62A 3IJPA 1PDVA 2EJBA 5JY6A 4KODA 2VDWB 2LKCA 5ADVA 3K0EA 1Q1NA 3GVCA 1PT5A 1UEIA 5ECWA 4KO3S 2ZIFA 1ZK4A 3JYQA 4HADA 4Q3BA 4KR3A 2O19A 5JOQA 4Q93A 2CWDA 2NNLD 3I58A 1ACMA 1W5AA 3ZWOA 1Z33A 3NHRA 2GJAA 2FSPA 3BE6A 3SEAA 3QU2A 4H16A 1Z29A 2EIXA 3A1CA 2H1IA 1UBLS 2PS1A 3JARA 2CZCA 2PY6A 5BWCA 2ACKA 3U13A 4Y7CA 5KKNB 1KJJA 4LCJA 2QZJA 1RAEA 3DZ8A 1KKUA 2YY6A 1BS1A 2O0KA 2Y1FA 3E22A 1NIJA 2DH5A 2BONA 2QLBA 3LQFA 2QMZA 4DJJA 1Y4SA 1ONPA 3FWPA 5K0GA 2A0WA 1MJNA 2H4ZA 5DW3A 1CQIA 5I7UA 3KE9A 5BR4A 2BDEA 1W94A 5JO9A 3KKLA 5JSKA 4NHEA 1XZFA 4PZDA 3DDWA 3GFQA 3TGLA 4P83A 4BN0A 4WK4B 4QGBA 1DDIA 4B8WA 1FP2A 4LDPA 5CX1A 5FRDA 4F9TA 1KAOA 1V9LA 4Q37A 4B47A 2V54A 3GARA 1MHPA 4J1TC 4ZHQB 2QQFA 2YH2A 1RXWA 2NMVA 2Q0HA 5KSWB 3TNYA 1VLVA 2XY4A 2RE8A 1BDBA 4CM4A 4PXSA 1PFKA 3FSEA 3D31A 2RGUA 2Y2UA 3LD9A 3GUVA 5J2TB 2VVTA 4FR2A 2Z3WA 2H2WA 1LDGA 4Y6OA 1XQ6A 4EVIA 4NK5A 2D1QA 2Q5LA 1NW5A 2BFWA 3H7AA 1OFGA 3I64A 2HSDA 4B2YA 4D96A 1ZI8A 4X41A 1QAOA 2XCLA 4OI2A 4G85A 1NGSA 2Y99A 3EB9A 3OP4A 2RHLA 2OAP1 5IBRA 2H2FA 4CQJA 2H57A 1HMYA 3KKMA 1I2MA 1KC3A 4IDCA 1YB6A 4JUDX 1M1ZA 1JJ7A 1PLLA 5A0FA 4N3NA 4BE7B 4EKDA 2GLUA 1G17A 2UZ1B 3HYNA 4G0PA 1LBHA 1E2JA 2XMDA 3S2FA 1HV8A 3SZRA 3STXA 1N9ZA 4OO3A 2HNAA 1O6ZA 1EP2B 1XLWA 4NJEB 1HEIA 3E5NA 3IB3A 3OQ1A 4HR7A 5AJYA 3OIGA 3GJ6A 4E31A 3K71B 4WEQA 1QIDA 1RPAA 1U98A 5ALIA 1NTRA 3KC2A 1NAHA 1RM4A 1QAQA 3FNBA 4X7RA 4BJ6A 3DMNA 1PK8A 1QFJA 1UKAA 1HE8B 2DBYA 2GHRA 2FY8A 5GZ6A 3WFIA 3PPIA 1KAHA 2PKRA 3E03A 3P96A 4U5QA 1XR3A 2BEKA 1D1QA 2BUBA 4UOZA 4IRXA 4XIIA 5DLDA 4MRRA 2F4VB 5FLKA 5LMUB 3DAYA 3OM9A 1NLZA 5AJUA 1E20A 3OBIA 4JC4A 3ZGNA 5A5GA 2AOUA 5K0SA 3AM3A 3N2LA 1E2DA 3H1TA 3QV2A 5FX2A 1RU3A 4TL6A 3Q87B 3LXRA 4LJKA 2I9PA 1L3CA 3SG0A 1I30A 4MV5A 4RY0A 4BB0A 1K8RA 1MA3A 4IIVA 4PX5A 3RTDA 5CVDA 4FI3F 3S2YA 4CMIA 4ZI7A 1XRPA 2KX7A 2JL1A 2WF6A 3M3DA 3QBDA 1XA0A 2OMEA 1AU9A 1F06A 2DH6A 3H5OA 3OG9A 3P9NA 4FEYA 4WKGA 2GZMA 5FV4A 1WZ2A 3RG8A 4KXNA 2BFCA 3OLZA 3PJGA 4XSGA 3RS8A 5MGBA 3OJLA 4QICA 2TMYA 2D2IA 3G2OA 2IV7A 5HPYB 1TGYA 1CXZA 1R00A 3JYHA 2IPMA 1B0PA 1CEXA 3IV6A 4EW3A 3GQVA 2O2ZA 1YFLA 4C3OB 2C88A 1PV4A 1YZYA 3MSXA 4JVMA 3BMXA 3IUSA 3EPKA 4G1BA 3KPJA 3I9V1 2JLXA 4JLVA 1SZCA 4O2BF 1R8YA 4U0KA 2LD4A 4QUKA 2GZSA 4YXFA 4TLAA 3DTVA 1I6LA 1N0VC 3CT6A 1YHZA 4Q7QA 4S04A 1T13A 3O4JA 1J5XA 4AMYA 2HOQA 1QG2A 1H3FA 1WJGA 2DPYA 1BOFA 2BMFA 3MS7A 1Z07A 2J3QA 4GI1A 4YXWA 4XVQA 4QU5A 3K09A 5DEOA 4RLFA 4TLCA 2WWIA 3QU7A 2WVAA 3LOUA 4GMHA 4Q24A 5CPBA 4JP3A 4YCBA 4EKNB 4F1WA 4ZU1X 2ZE8A 1VM6A 1LVHA 5A4MS 1QK3A 4KZKA 4U9IS 1UPCA 2UXDB 3EDYA 4TMTA 3OJCA 2B82A 2HJWA 3B13B 4AYTA 1DUVG 2VHYA 3OT5A 1ZPDA 2XWBF 4ISBA 4FK8A 4CE6A 4E22A 3PJRA 2W2LA 3A6ZA 3G5AA 3K9NA 4MW0A 3ZQ6A 4V1CB 1M6WA 2WOOA 4ZRDA 5EFOA 2RHJA 5T41A 2N1MA 4NF2A 1TJNA 4Y6GB 4LJ7A 1R6XA 3BORA 4NS4A 5CYFA 4EZEA 5K3FB 1Z36A 1RP1A 3SIRA 3B53X 1Q3KA 2ZAOA 2WFZA 3HFGA 1E99A 1FSGA 1Q2XA 3IELA 4ND8A 3K8YA 5BUCA 2P2SA 1J1UA 3UF0A 3PUWA 3BDVA 1DEOA 1HQKA 1XFDA 3SX4A 3WG9A 4EVRA 2B35A 2O0MA 3DUFA 3SC2B 1Z8DA 1G8KA 3JRWA 1J70A 1FP1D 1SBIA 4J2HA 2DETA 1R6UA 3PUIA 1JSZA 3AVQA 1WZUA 4Y6LA 2UXBB 4BV3A 4CUKA 2XZTA 3RI3A 3ZQ4A 1SC9A 2PGXA 3G0CA 3HXTA 4BNNA 3PKIA 1BH6A 4Z8XA 4E5VA 3BD8A 4HP8A 2H3EA 4F9GA 1A76A 4RYDA 3IEUA 1T9DA 1V4NA 5B12A 2CV2A 1HEUA 2EFDB 2YYAA 3OFSA 1AKYA 5FI1B 2PU7A 4GQIA 4IHKA 3SK0A 4YR7A 1DKLA 1KRHA 4CEJA 1JAXA 1KI1A 2ACVA 2V5AA 4CQLA 3DW1X 3F2IA 5HG0A 4KVZA 3UFBA 1IN5A 4NFHA 3TEFA 4FYHA 1H2FA 1UXKA 4KXYA 2YRXA 1K4KA 1ZGBA 1G0NA 3HUDA 2IDJA 3RC8A 4GLLA 5C9ZA 1DT5A 1TU0A 3M5WA 3NUQA 3PGVA 5AKKA 2VJOA 4A5SA 4M0LA 1QS0B 5CVCA 2OVBA 3ICWA 2H85A 4BO6A 4DR7B 2NW6A 3BGOS 4CQMA 3KUUA 1XCPA 3WDKA 2PM8A 4GE0A 2P6PA 4WH0A 2QUIA 2VXYA 4KW7A 3W3ZB 3O1IC 5AW5A 1KAMA 1KPIA 3QWBA 1XAHA 3BAFA 3EVDA 3GMSA 2BPOA 4YRDA 3G9ZA 1IWBB 2WJIA 1E64A 4L9RA 4NZNA 5DTIA 3TW0A 1XTQA 1WHTB 3TXYA 2ZIXB 3CE9A 5BSGA 4CV2A 3F3YA 1GFWA 1V8DA 1WMAA 2OBBA 1P0PA 2HH9A 4MXDA 4MVYA 3T38A 3V5NA 5CRIA 3AEXA 1P1JA 1NNEA 4G23A 4GKAA 1DJLA 1ODFA 3AUXA 1RLOA 1V3TA 1M2WA 3I5XA 3M6XA 1NJ5A 2CWWA 2GM4A 1YRBA 5ARDA 5FWYA 2O3SA 3T1HB 1U2ZA 4FSDA 2X86A 1G3QA 4D4IA 1QF9A 5B7GA 4YV7A 1NBMD 2IUTA 1XRNA 4UTOA 5DBFA 3U4MA 2JIDA 5H70A 2XW6A 2ZAMA 3T1QA 5A3QA 4RVNA 5KPDA 3NIFB 2YWBA 4IIJA 3L41A 2YWGA 2PQ6A 1TM2A 1IZ9A 1KGDA 4TZ6A 4XXHA 1OFIA 1XELA 4JROA 4TXHA 3ZBQA 3ZJ5A 4EEXA 2XQFA 4MPRA 4J4HA 2X8JA 1F2TA 3H5IA 3ZWKA 5H9VA 3AJEA 2OZPA 3UH0A 1T8RA 5GONA 3G0GA 2IP4A 3CXUA 1TT5B 1JQAA 1XZQA 2GCGA 2VA8A 1N6KA 3WQRA 5B2ZA 2R8OA 4ZYZA 5CFZA 3CEJA 3LT5A 4UD6A 4KFSA 1ODSA 1D2HA 4XD7A 4IRMA 4EI8A 4EO9A 1MDFA 2AMYA 4Z0NA 4NEQA 3GRCA 4Z3DA 2ZU6A 3GP3A 1K1EA 3OQMA 5ALQA 2F3SA 3C4QA 1ZXBA 2OGZA 1EFHA 1E2KA 1YR9A 3LX6A 4FOSA 2WI8A 3IO5A 4RK4A 4RTNA 1RYDA 3WDMA 5B1DA 3S68A 2C8KA 4TZ0A 5CT6A 2UDPA 1BWRA 1ACLA 2P9HA 1X0XA 2DUWA 4TVKA 4F4HA 2PBLA 1XALA 3E1GA 3IBTA 4N7BA 4N5HX 4CDRA 4HXGA 2ZT7A 5DEIA 2ZYSA 3R9WA 3TPZA 4JLSA 4EHJA 4U7DA 3BHMA 2CUNA 2P3QA 3FMVA 1PZEA 4TYNA 1XNHA 5HIMA 1CUYA 2I2WA 4P53A 5DXJA 1K9SA 1BCRB 5DGXA 2P6NA 1W0KA 2GRJA 2IDZA 5EFZA 3DT9A 1JHPA 2IYRA 3DHNA 3N86A 4QFMA 3KJXA 3O83A 4RW0A 4XYGA 2Q7OE 5ALXA 4LF9B 2X40A 1R6TA 4MICA 3EUFA 3EVEA 2HSGA 3KNZA 3L0ZA 4R2HA 4W1SA 1AXEA 3URMA 4BGEA 4CMKA 1FMCA 1JL3A 3ET4A 4MWCA 5J40A 3PBKA 1RR6A 3KXLA 1MEOA 3QV1A 3VU8A 2WSBA 3PIRA 2Q29A 2C5GA 3L8CA 4R2XA 4V2UA 5CNJA 1VBKA 1LWNA 1Y1TA 2H1CA 4L0QA 2VZLA 3GH3A 4NBTA 1SVOA 3NIWA 3SE7A 3FPBA 1NRIA 3ZIAD 1QR6A 1IMJA 2VEDA 3C24A 2RGCA 3F9CA 4IAOA 4JJ4A 4M60A 4OJTA 3WYDA 2HYIC 4UULA 3G1WA 1NVBA 4JWTA 1X9GA 2NUPA 5EEGA 2P9CA 4EA8A 3U4AA 1RHKA 3UENA 3BMOA 5JH7B 5EMJA 1BHO1 1XXHB 1IU9A 5F2KA 1KVRA 2CK3A 2X8WA 3C14C 1T2DA 2ZTLA 3NPAA 4JNKA 5JSFA 1Y5IA 2OPBA 1GPJA 3DQPA 4Y8VA 1RM5A 2Z58A 1CUWA 1I8TA 4KQHA 1I1NA 1E3MA 1ZN9A 1VYTA 1DAEA 4V0OA 3TQOA 2P35A 4WVFA 4JJEA 2Z43A 3FWNA 4HQLA 2C92A 1RHRA 1M1YB 3EUWA 3MMZA 4RIFA 2DCUA 1X74A 3TNFA 2V1UA 3NRBA 1QVZA 4J2TA 2ILTA 3I37X 3KWMA 4BNDB 5KYVA 1YRQA 4E2ZA 1CZHA 2J46A 5HZHA 4IQ8A 2Q6KA 3EJ6A 4E1BA 1U1CA 4HGNA 4C30A 5DWQA 4M21A 3RC1A 3HS3A 3C4VA 4HWSA 1IZZA 1JN0A 2ZVPX 4Y18A 1XTVA 4B32A 2Q0SA 3U2QA 2OFWA 1L5WA 2BFMA 3V8PA 1QWSA 5JLJA 2WM3A 3GIDA 1BCSA 4X1OA 4QOIA 4EG1A 2QP3A 4GI2A 2JLRA 1J8YF 3ZX5A 1QK4A 3URKA 3FI9A 4M4SA 2PV0A 3COJA 1CDZA 1WVMA 3QVJA 3G2NA 5I5GA 4PGMA 3DBLA 1QV9A 1FX0B 1JKJA 1OYOA 2RHGB 2W6NA 4FOLA 5EWMB 5FV7A 4PAQA 1JA1A 2AFHE 4G1MB 4NZMA 5HF5A 4D46A 3BFKA 2VBFA 4PBSA 1OVGA 2J85A 5IDWA 3MA0A 4B4WA 5LMNB 2EW8A 3KOXA 1ONNA 3TQFA 1T9GS 2FW7A 4MV8A 4FYXA 4D5GA 3LC2O 4LSWA 1G291 5CM8B 4ZT2A 4UBOA 5BWNA 3BXHA 1XE3A 4TSFA 2MTBA 1MUUA 4LMBA 4WBNB 1W85B 5BSRA 4B2IA 1UP7A 2EEZA 4GLJA 3GPCA 2X6RA 4UU1A 3TKLA 2AKAB 3VR5D 2J3MA 2QY9A 1JU3A 2GUGA 3OEHD 2VBIA 3O21A 5EIHA 4K5QA 3ABZA 4XGIA 2ZK7A 4KACA 4B6GA 3U61B 2JS7A 4UVGA 4EG0A 2XNSA 2WM8A 1OCEA 1DX6A 1YB4A 1DBIA 5I6DA 3DBHA 2Q5IA 2GBLC 1KYTA 1G16A 1VA5A 2PT9A 3VVBA 4IO0A 1GA6A 4HEQA 2DHDA 5F77A 1E2IA 1Y6RA 1JDBB 4LOKA 4XLTA 2IHNA 1G8YA 4GM1A 1MABB 2P6RA 3CJQA 4GF5A 1C7QA 2QF7A 4EKIA 4LXQA 4Z4HA 2Q1XA 2BHRA 3LDFA 1LI4A 5E6SB 1A95A 4YCJA 1I0LA 5LOVF 2CYCA 4BJ1A 1F0PA 1BEEA 1UZUA 1C3OA 1PHRA 1CEEA 2ZS7A 3HN7A 3VFDA 1NZFA 3BH0A 3NPMA 3FJOA 1MC1A 3HJUA 6AT1A 1MC5A 3OY7A 1U90A 4LX0A 2H00A 4P8RA 3D2AA 4R1MA 2I6GA 5AHXA 1FJHA 4KH0A 3CLSD 4XQEA 2PCJA 3W2HA 3Q3HA 4M1TA 4E4RA 5A1TA 5BMVF 5K8CA 1LSOA 3VSCA 1OX6A 3ASUA 4FOOA 4ZDKA 1A72A 1LPSA 1GVHA 3FR8A 1YBHA 3JALA 4MUAA 3FYCA 1E61A 5KYXA 5FAKA 2BMWA 3Q3CA 4B6PA 5JJ5A 3OCUA 3K32A 5FOTA 1CSEE 5P8WA 1REQA 3H3FA 3INTA 5LQSA 2RIPA 4AB1A 5DNCA 5FH9A 3FDXA 1T0IA 1R64A 4XUCA 2GEJA 3C6QA 2HV8A 3L02A 3H4MA 4URFA 4CV1A 1BG6A 1P81A 1V37A 3GLIB 1I0IA 1F6WA 3VDNB 4WUTA 4WZAA 1ZH0A 4NHOA 4QVGA 1QIMA 4QUHA 1R8SA 4TROA 3T9AA 1M33A 4AP6A 4PYLA 3RVJA 3T7EA 3NASA 1A04A 1P1IA 2Q6IA 1TADA 2X1MA 3CZRA 4QATA 1QO0A 1RQGA 1RXIA 4KNWA 4YMIA 3JD3A 1WXWA 1WETA 1HQYE 1P7YA 3HR7A 4KV9A 5LN1A 2GD1O 3VPSA 1FTGA 5FNZA 5K99A 3EIQA 3RYHA 1K7CA 1M1UA 1AQ6A 2FHSA 1GNSA 3FVQA 2NO7A 4FFDA 1ZX1A 4OHXA 3U31A 4MW2A 4HAOA 3MLAA 4DDMA 5GINE 1UEJA 3IMCA 4R40A 2BZ1A 2A7XA 3WGJA 1B7GO 3CSUA 2JZOA 4Y9DA 3O4RA 2FOLA 4JOQA 4BQEA 2FF5A 1E0JA 2YRWA 3DAFA 4Y6RA 4PTLA 3W2IA 2GQ0A 1WD7A 2P3LA 4QYSA 3PUZA 4EW2A 2WTAA 3CUSA 1JG1A 3G5UA 4DCCA 1K7FB 5IXSA 1L7QA 4M1KA 1L5NA 1RQNA 2ZETA 2C57A 2WIGA 3O1LA 4Z7OB 2DTXA 2N9UA 4L0CA 4DABA 5I7VA 1DZIA 2NU9A 3BTSA 2VSQA 3QEMA 2MU1A 4MV7A 3NAMA 1JIKA 1JLLB 4B3FX 4D6YA 5A3RA 4RX1A 2FEAA 5AW1A 3WGKA 4Q00A 3WV5A 4JYMA 3NORA 1VI2A 1YOVA 1QE5A 3BGSA 3AF2A 1CUBA 1FP4A 4B84A 2AI2A 1QH8A 3DC2A 5KPJA 1UPXA 4JUIA 5K0CA 2O2JA 4YPOA 3N39C 2O5EA 5IN5A 1MO2A 2BIFA 3OMWA 4C7OA 5IAKA 3DH0A 1ODTC 3ZK8A 5CJJA 4HUQB 4Y2GA 5AM2A 2WSLA 5HOQA 4NZYA 1UFOA 5CJ2A 3ZWAA 4WMLA 2CXHA 1SVLA 2FW1A 3ZY4A 4MHTA 3B51X 3GLFA 3C8DA 2AFIA 2ZPUA 1NNSA 1O87A 4TLEA 1JILA 4TT3A 4UEOA 1ENZA 4HDSA 3ZE9A 4G0QA 3F74A 4DTIA 3JQRA 3C48A 4KR0A 4QDZA 3T99A 2ODPA 3BBPA 3OFND 4XIJA 4NABA 1FBTA 2R6R1 4XPIA 5ESRA 5BUQA 1J09A 1GZHB 3WXMA 1SA0A 2HWYA 1A69A 2RHDA 3NHMA 1GCGA 4Q47A 4JENA 2AHRA 3PEWA 4IJWA 3L49A 2DYKA 5TRTA 2M98A 2O7NA 4BCBA 1NULA 5CCEA 1W1IA 2IHVA 4LEIA 4D26A 1LDEA 2D06A 3C43A 3KXKA 3UH1A 1SKUA 5HDBB 1KI3A 2WYIA 3N28A 4IY1A 2Z5FA 4RIGA 3MZ0A 2XTJA 1RRMA 5CA0F 3GN2A 1A9SA 1Q0LA 1UM9A 3GOQA 3HI4A 5CVEA 2PR7A 4ZO8A 4WGGA 4C1BA 2GNPA 3KB1A 4GSLA 4QRHA 1ZGAA 3WGTA 1PJQA 1B3RA 1KXJA 2NTNA 3J7TA 2AKEA 1YDEA 4H59A 4FMPA 2F1HA 2XUIA 5AICA 3WWOA 4DXAA 2VJBA 4FOTA 4DA7A 1AG9A 3OQBA 1RVDA 2PZGA 4R1LA 3BMNB 4WKPA 2GFQA 1IHYA 2Q3MA 2W2OA 3MJTA 3GEGA 1OFHA 4U39A 5J5CA 3TK1A 2FPWA 1PL8A 3VNAA 4MDEA 2FE1A 4PRYA 2JASA 4FYYA 1YIOA 4RCYA 1E7QA 2VHQA 4MWTA 1NVMB 3ICQB 1H8ED 3CRZA 2O3JA 4EJ0A 5HF8A 3S7ZA 1T5DX 3SHVA 3SNHA 4D9BA 2VTBB 3LBFA 4ZAYA 2X1HA 4IDDA 2ZYTX 4XR4A 3WL7A 2C84A 4QGFA 5EHZA 1V71A 1ZQ9A 3P2EA 2GNOA 3C6MA 3ETDA 2XF8A 3IE2A 3UB3A 1N2ZA 4FLFA 2DKOA 3NJ8A 3ZHBA 5MN6A 5K4AA 2FPPB 2VF4X 3VJLA 3CPEA 2OQVA 3ZDBA 3Q9UA 1P1CA 3IKJA 1KFCB 3COPA 4LMPA 5H4GA 1Q7RA 2RI0A 4DEXA 2QA5A 3A9UA 1OC2A 5CVTA 4S1TA 3I34X 2EF1A 4IH4A 4PRLA 3ERCA 2ECQA 1UKEA 3I01A 1JLSA 3JWGA 4MMXB 3EQZA 1NYRA 5DW0A 1PWHA 5KOYA 4V1CI 1Z2OX 3PFCA 2CY0A 5AJZA 4IMIB 5I7EA 3OF3A 5GJCA 1WMSA 4Q3DA 4U3JB 5DP1A 4QPNA 5GPBA 4RTRA 4O2AB 3KTDA 3WYBA 3MRXA 2PMWB 1ENPA 2WQZA 3T7AA 4A0QA 2ON6A 4H08A 4TKMA 5HGJA 3QPCA 1RXYA 1E2PA 1NR1A 2I4TA 3U1TA 9LDBA 5IXJA 3SSAA 2QRPA 2GUWA 2XTZA 3DWEX 1EMDA 3KLOA 3ONDA 5BVGB 2PKQO 7REQB 1UBHS 1NDQA 2A1UA 3AZPA 1NFQA 1E1NA 3MOSA 1DV1A 4NDAA 5ER6A 2WOJA 5JPIA 4EYEA 4PONA 3UXMA 1R66A 3ROPA 4UNNA 2XODA 3W9SA 4LRUA 1P2FA 5KYYB 5E9WA 2QXTA 4JJFA 5H5JA 5HHTA 2YUTA 2IH2A 1GAJA 1VIVA 3D02A 3PXDA 2J0UA 3RIYA 1P4GA 2ZRLA 4YUAA 4Z4QA 3C98A 1OQAA 3JQ7A 3KQPA 2XPCA 2A7QA 5F2EA 3EY9A 3HB4X 1T4DA 1Q44A 2FCAA 2H4FA 5AUNB 4F46A 5FBKA 3VXKA 1LLUA 3ABQB 3TOXA 1KFKB 3P9RA 5AK6A 2PPVA 3LTNC 3RBVA 3FNIA 2CUZA 3MFQA 4D0LB 4QG3A 4KB5A 1CY0A 2Z9DA 2EKZA 1M2EA 3UPTA 4UM5A 4AM8A 3AU9A 5HEKA 3L04A 1TD9A 4WJZA 3OTQA 4QFDA 1O5OA 3AB8A 3L8ZA 2J6BA 4HHEA 4MV0A 4AJ1A 4DIDA 4QO8A 4FMDB 3LBHA 2PLRA 3THSA 2YIMA 3UBMA 2AJTA 4RCVA 5CH8A 4W9RA 3NBAA 4RFSB 3UWOA 3VISA 3DWIA 2WWVD 4F2PA 2JA2A 3EFEA 3L0PA 2WDPA 4MUXA 4OA5A 2B5WA 5CLQA 1C4WA 3A9WA 2WU4A 4XARA 1QC5B 3PE3A 4JI6B 4R8MA 4FGKA 3ZEIA 3NBUA 1JDPA 4HGZA 1HT3A 4PHGA 1EDOA 1OD6A 2M32A 2WTMA 2GYYA 3H13A 3PX3A 3S1LA 3U3XA 1ECFA 5HNKA 1DKMA 3ROEA 1XOIA 4QNNA 5DYIA 1UQRA 2BGGA 3DFFA 1ZVKA 1Z2DA 4KRYA 3A6DA 2ZT6A 1NY5A 3HVRA 1M66A 2YCBA 3TYXA 1E6CA 3KOWA 5GGYA 3GDWA 8ADHA 2VP6A 2OHVA 4OP1A 2JATA 1Q14A 1OFUA 4EG3A 1NW6A 4MJ3A 4ZI5A 3CVVA 3E7FA 4FS8A 2A8YA 2ESRA 1IXSB 2QRKA 2ZS9A 1DO2A 3IT2A 4XCQA 5HTKA 4BGDA 5JS6A 1AHPA 1VHQA 2FRDA 4TV8F 1E5DA 2D59A 1A7UA 1IHDA 3HA5A 5LQMA 3HCOA 4TZKA 1MPXA 1OHHD 3N75A 2P9TA 3DS8A 3PLRA 4MAFA 4E08A 1L4NA 3ADPA 3M82A 3A6PC 1U8ZA 3GWZA 4B3XA 4IWYA 4DA9A 5AKJA 1NAIA 1C1XA 1P18A 2QENA 2WDZA 4EDFA 4H7IA 5I3ZA 1E2UA 1E77A 3ZVMA 3R7AA 4CVNA 3A9CA 1ZJ5A 2DQYA 3K72B 4BB9A 5FA8A 4HMOA 1P62B 1VMEA 4MIYA 1H2EA 4RWZA 3LC7O 1N2IA 4RHEA 1K0FA 4CFYA 1OUMA 1KI9A 1C0IA 4X93A 3VGPA 4PZEA 2ZOSA 1UZLA 3HSKA 4M36A 4MVXA 1KHTA 2CB0A 4EUHA 1Z5PA 2HF7A 5JCXA 1N3LA 1VE6A 2ASEA 2XMQA 5H9WA 1IN1A 2QM7A 5LA6A 4B75A 2CXPA 2RJ3A 1UP6A 2H06A 5EN4A 1GSAA 2R66A 5JAIA 5HKKA 4JEHA 4BNMA 1EBBA 1ZM3A 1U3FA 1XAIA 4F0JA 2V6FA 2QVLA 4K1XA 1CUIA 1G66A 2H1SA 4JU8A 4OHCA 4R51A 1YSCA 4ZK2A 1OI4A 1AB5A 2DWPA 4DLVA 2F48A 3QELA 4AS1A 3TLCA 2JBHA 3ZXIA 3GVXA 2C9YA 2PZKA 4IKPA 4M9RA 3RNLA 3A3YA 3VPCA 3W2TA 4GE3A 1C9YA 4CETA 1X6VA 1LF0A 1V9CA 2BTOA 2XMCA 1GCOA 2IOFK 1HDXA 3WBJA 3WOHA 3WNQA 4E7PA 1VC2A 3SXUA 3PE4A 4ZAZA 2AWOA 2H59A 5JXHA 2NO9A 1ZD4A 1T4CB 2QLFA 4EO7A 4CIYA 1IPEA 2O8DB 1OXTA 2G9UA 2CJPA 4G9EA 3KP1A 1KK3A 4H35A 3W5DA 4ZCIA 4BLOA 2QJTA 4Z4GA 4QEKA 4RVSA 3HR4A 3LECA 3O94A 2G8LA 3WMWA 1C7JA 2OYCA 1H2BA 4PLCA 3VHQA 1X87A 2A57A 2B0JA 3ZD6A 2FHPA 1GZ6A 2FFHA 4RHUA 2IYQA 2QGNA 3LX4A 1Y82A 4LHXA 3ETJA 4PIPA 3GJTA 1ZEJA 5DCUA 1CY6A 4MP8A 5EWLA 1M2OA 1ZL2A 5AW6A 3Q9LA 4EOGA 2AXNA 3HH8A 1MQ9A 1V6CA 4FZJA 4LJAA 1GTMA 5EQFA 5BUZA 4BYMA 2I29A 5JYDA 2ENUA 2GN6A 2H1FA 4AQYB 2JJ2A 4OL0A 5JC8A 4FSHA 1U8UA 1J2JA 1JHMA 2WJGA 4CMAA 3EXG1 2YFKA 4BUZA 5E2BA 2PEYA 1OYYA 3P4YA 3ZNNA 4L1KA 3O8DA 3T7CA 2VJCA 3AL2A 5AHWA 3MD9A 4DT1A 1A88A 1KZYC 3WWEA 2CCGA 4HXFB 5K2MA 4MH0R 3UQZA 4B3BA 1XXHE 2ZIEA 3WGOA 4G1CA 1UM8A 3WHIA 4AJHA 3WGVA 4WJLA 1HNZB 4N6OA 4GR9A 4PANA 4NOMA 1V1MB 1TFRA 2R1VA 2IPLA 2VDUE 4NONA 1L8XA 2IUUA 5D1HA 3TUIC 4D9KA 3W5AA 2VRCD 2XHZA 2WF7A 3HKEA 2O2IA 2WMOB 3PWZA 4DJEC 3JCZA 3PR2B 1U9CA 4IR7A 4Z9BA 2Z2IA 4AW9A 4DLSA 1M1YE 2UV8A 2A5JA 3B70A 3HVJA 2QLTA 4L8LA 2WLTA 4KIUA 5E38A 1LLDA 2BTEA 3IR6A 1XDDA 1L7BA 1C9KA 3N05A 3P1JA 4DYHA 1I24A 3H7IA 4J3NA 5B3JC 3W90A 3VNRA 4P4TA 2EHJA 1A8QA 3A9SA 3NTQA 2DQKA 4F5WA 4E07A 1Z8FA 2XXBA 2Z56A 4I4LA 3CVOA 4L28A 1LW7A 2BI7A 1ADYA 1BXRA 2AFVA 3PQ2A 3SBDA 4DFDA 4JI2B 5DM1A 5L3ZA 4JYPA 1QK5A 3UYLA 1PUXA 3BPSA 3QLVC 1ZO8A 1KBQA 1G64A 5KIAA 2L69A 4QPJC 4I1PA 2XSZA 4U2EA 1IB6A 2PZFA 3ZU2A 4WXPA 1RYBA 2Q3CA 3HKCB 2Q7XA 2FPLA 2H08A 4EHDA 5HUJA 2RGDA 3PD7A 3CT4A 3LT0A 4HAVA 1ML3A 1YZVA 3COSA 4CKCA 1VRCA 4R5HA 4R68A 2CNOA 3E3AA 3GRZA 4FTWA 3RHTA 3U0BA 1G6HA 3U1BA 3D7NA 3CZ4A 3R7BA 3I5AA 4IOMA 3M4JA 3O9MA 4L6CA 1LRKA 4OK3A 2O8VA 1DJMA 4A8JB 1H3EA 4C0JA 1NVGA 1THZA 4Q1CA 4KVGA 5CLGA 1Y98A 2EZ9A 4UAVA 3DMDA 5BNTA 4IJMA 1FTQA 2PMDA 2GKOA 1OREA 2C2YA 1XDWA 4R9NA 2QV7A 1L5YA 4DUGA 4MYCA 1UC9A 4ZWNA 1XPUA 4RZ2A 2NQ8A 4HNTA 1GRNA 1M34B 4MR8A 5SY4A 3KYJB 3BWYA 1GG8A 4NCIA 3HWX1 2DLNA 3DE5X 1PAUA 4B8YA 4G24A 3KYDB 4UNSA 1FE8A 2J59A 3RYFB 1DAMA 3IQHX 3K30A 2B8TA 1P2DA 4TWJA 1V5EA 3GB9A 2JGAA 3FKQA 4BFYA 3GLGA 3IP1A 4UATA 5DHRA 4IUDS 2VTEA 3P8ZA 1H0HA 1E6LA 3DMYA 1CR0A 3D54D 4NDZA 4E3ZA 1T1SA 1Q7EA 3ER6A 1TYDE 3BE5A 4LY3A 3D6HA 3AQ4A 5AKXA 1HFEL 4Q1FA 4ZA2A 4J8PA 4JL8A 5DTJA 5DCYA 3C16C 1J8DA 2VPTA 5J58A 3EUAA 3HXOA 2ALJA 2HJHA 3EZYA 3JD2A 4L6IA 5SY9A 2EZTA 2XE4A 2V8OA 3VC3A 4DNOA 5L8VA 2OWDA 2H54A 4PPNA 2QE6A 3IDQA 4IVRA 1YZLA 1E96A 1Y34E 2C0PA 1U2TA 2EZ4A 4JGIA 3OPVA 1DT3A 2GVDC 4F2DA 3ISJA 3N0TA 4N9QA 1CQJB 3H42B 3ME5A 1OROA 5HIJA 4D8YA 2KMLA 4B6QA 1HLPA 1VLQA 3S2IA 4XYLA 2W2KB 3D0RA 4OUKX 1E1MA 4C6RA 4EK9A 1CWUA 3LLCA 3AVPA 5IH3A 3VR5H 5FBVB 3GLIE 3KRTA 1VLMA 1YMQA 2JFGA 1DO8A 1SB8A 2FPMA 2QTWB 2Z8XA 4PSAA 4QEDA 4XH9B 4BZWA 4DIOA 2CLKB 4GOJA 4WD3A 1I2AA 4XQCA 3WSTA 1DRWA 1WSDA 2X19A 3U80A 1JGTA 1MRSA 1RE0A 4BNJA 2BYTA 4OQ4A 1U5CA 3RUCA 1S3IA 4KAAA 4V39A 2Y77A 4LHEA 1VL8A 1ZIDA 1ZUNA 1CF2O 3TIGA 4AIRA 3UMCA 3SZOA 2PUCA 1P5FA 3HGTA 2KI5A 5CBPA 1YS9A 1P8JA 1NP7A 2YCLA 4H15A 4EJSA 2G4LA 1XRLA 1TJ4A 4OB6A 5BYAA 3BF8A 3OT1B 5D01A 3EGXB 2Y05A 1TU4A 3A3KA 1A5TA 3L1VA 4PFJA 2Z08A 3ZGOA 2CVHA 5ITZA 4Q7JB 2ODTX 2OHHA 4KXQA 4AJOA 3RAJA 3H19A 1D6SA 1ORIA 1VG1A 4Q01A 1WOYA 2JPDA 1QWOA 1FQOA 2PD4A 2H63A 3QWHA 1FUYB 4JBWA 3U39A 4D3XA 5IMBA 1YQGA 5KB3A 2CJWB 3VDQA 1CFZA 3CUWA 3HKBA 4HWTA 3D9QX 5CP8A 4ZZ0A 3BXPA 4Q4HB 2Z2XA 1JR6A 3SSOA 4A8PA 2Q3JA 1PGNA 4HZIA 4RY9A 3VSEA 4YUWA 2AC4A 2QTVA 1HMPA 1WVGA 3BB1A 3JD0A 2IK8A 1R4MA 9MHTA 2LDBA 3AVTA 3ZCRA 3PDHA 2DPMA 3OFKA 3T8YA 1EK5A 1P29A 1T36A 4ZZ2A 1WB9A 3BRWA 3G0OA 3TRFA 1PNOA 3UJ3X 4DVGA 2IHYA 1NW9B 1XHEA 3ORSA 4W7HA 2R1ZA 4Q9LA 3H97A 4I1VA 1V8OA 2OWEA 2C3PA 1GTG1 5BW6B 5KTPA 2RHHA 4FX2A 5J2UA 2YXNA 4CM3A 4IO1A 2F7SA 2JGKA 3A25A 2OV2A 4TV9A 3L6RA 1UF9A 2GAJA 3RGGA 3WIBA 3GN1A 4DSTA 4WOJA 4F71A 2XGMA 4KTTE 3V97A 1V95A 2HMAA 2QJOA 1Y89A 2V7BA 3DTVD 2DOKA 3F98A 3MN1A 4HWGA 4RF5A 3ZHVA 2AW5A 3N6XA 3QF7A 2JJMA 4YJ3B 5E2AA 1YACA 2TRSB 4F4UA 2NYAA 1WP9A 2PKQP 2I4IA 4WCFC 2ZUWA 4DQDA 3DL7A 5FDFA 4IUBS 4PG4A 1O6BA 1QYXA 1E0KA 1VHWA 4KPGA 3LY9A 4JYBA 3DBVO 4DF3A 1M0SA 1U2DA 1EXMA 1GQ2A 3PPXA 3OIUA 3V7UA 4Y1EA 3DCIA 2QYOA 4UAUA 1TD1A 3KZXA 1CUSA 4B80A 5F9MA 3OETA 3PFKA 1N8NA 1TTQB 5FA6A 4RDCA 2BWJA 1VXRA 1PQUA 3NT4A 4H18A 1DG1G 1AN0A 2CFCA 1EWTA 4FOPA 5AK5A 3SZGA 3KSBC 1OI3A 2ZYAA 3TLXA 1SU8A 4IHJF 4L5IA 2QORA 2UVPA 2Y68A 2YV5A 1YQWA 3CA8A 3MSCA 3LUBA 4L07A 3TX6A 3HJTA 1LBQA 1PL6A 3D4BA 4PAOA 2A88A 4BQQA 3KEQA 2W6JA 2Q1SA 3N0WA 5U4QA 1KOFA 4J9VA 1X3SA 2GEKA 1K7XB 1OI7A 3JPYA 2JB9A 4QEZA 3W5SA 5AUPB 1W93A 3CF4G 5AT1A 1NA5A 4GGOA 5DYTA 4E4TA 3HYCA 4QYXA 5LP6F 1X3LA 2XOKD 3HLYA 1COWD 3HRKA 5LB2A 1TRKA 1H9CA 5ECDA 2QN6A 5EQJB 1W1WA 1WW3A 2XT9A 3EODA 3ID6C 4UNQA 2B34A 3TTXA 1E6UA 5FB3A 1T9BA 2I4LA 3K9HA 5LDHA 1Z4KA 4N3AA 1HNXB 4ACBA 2XDWA 2IC5A 1NG9A 1VIYA 1IUNA 1HF3A 1II8B 1FFXB 2XTMA 2HMSA 3FY4A 3ZI7A 1S7GA 1A7KA 4GW3A 1CT9A 1OXUA 2H9IA 4FGJA 4QRDA 2WAOA 2RD2A 4F4FA 2XEDA 1L3BA 1JHRA 1JWBB 1G9TA 2H48A 2FSHA 1CVLA 3M5CA 4MCAA 4LHSA 2OV6A 3IR5A 1FU8A 4OOFA 1X42A 2HQBA 1XN4A 3G9TA 1QGED 2HA0A 2HHAA 3E3NA 3GFBA 4GH5A 4D3FA 5LU9A 3R8FA 2V4MA 1ULUA 2EYQA 1OLSA 2AR0A 1XF1A 1EGAA 2YFQA 3CLVA 4UFOA 1CVIA 1JZTA 2DFTA 1BX1A 1ZXXA 1T34A 1X1CA 2QLLA 4O4JA 5JAPA 4CLOB 4PSDA 2FSVC 2PGIA 2IRWA 3BD9A 3WLAA 2AQ8A 3ZKAA 5EZYB 4CM9D 4M0KA 4RD6A 4TN5A 3HPQA 2H1VA 4LJ9A 2C82A 3GH1A 4M76B 4B4VA 4I50B 1NW4A 3BJIC 1ZCAA 4AVYA 4QZVA 1YZTA 1NUUA 1LC0A 1LBEA 1MV5A 5DBEX 2Q0XA 4LCBA 4BFZA 2PVPA 3ZQUA 3IUQA 3TNDA 4PC7A 1I4LD 4CF6A 2UAGA 3FUWA 1WQ1R 2ZYVX 4J7UA 1ZIOA 2Q41A 2I2DA 5A05A 3OICA 2ZEJA 2PV7A 1TFUA 2OM2A 4L5AA 4PAMA 1DARA 2UZ4A 4EFDA 2OAGA 3PC2A 4NCAA 2IZZA 3M6UA 1DXOA 4P08A 2ZZNA 3KELA 2KBEA 1LS1A 2QDXA 1V45E 1PT9A 3TTUA 4QOGA 3IQZA 4MYDA 2GBFA 3S81A 3D6FA 2DERA 4Y9SA 4XUDA 5KOJA 3B3FA 1N2SA 1WRBA 2GEUA 3B82A 4M86A 4OHWA 4UASA 4WFKA 5E7MA 2QR2A 3QMPA 4MCHA 4UHCA 1L4MA 4MI6A 4MPJA 3ZV5A 3ZZNA 1TZJA 4EY8A 5LP1A 2BHNA 2QUAA 1J9GA 2BGNA 2NSHA 2JGDB 2P2DA 2I8AA 2QXUA 2W2VA 1O7JA 2XB8A 3UUEA 4EY3A 5CBKA 4X95A 4C1NA 1W4BA 1GILA 1Y3HA 2FWBA 4O6VA 3UJNA 4QTUB 3Q11A 4OK6A 1SKYE 2X4IA 3FPLA 4PS0A 1O97C 3JVEA 4BVHA 4ZO7A 3C87A 3KX2A 1P75A 2FP3A 1OAKA 1E5QA 2AGVA 2OCLA 1XQYA 2FW8A 4Q4JB 3KZKA 3TLBA 1R0KA 1WMDA 1Z2CA 2RKOA 2IDKA 1ISMA 5CTAA 3ZGXA 1E7WA 4UOEA 1V11A 5JFOA 3O93A 1PQ4A 1EWRA 4FJ0A 3BX1A 3PUJA 4RQTA 2VCYA 5KJEA 1EJ6A 1KU0A 3D43A 5I4CA 3PC3A 5I51A 5EUQB 2X42A 2OCAA 3HEAA 3K9LA 4N7JA 2OV4A 5BQ5A 2PRIA 1X9HA 4LI0A 1FPQA 1VQ1A 2NN3C 3C3AA 1L7RA 1CNEA 3GZ4A 1DFHA 4NG5A 4C06A 1HDZA 1ZD2P 1E79D 3RTEA 3SVZA 3I72A 1YVUA 5CCDA 3FPFA 2XX3A 4DMHA 4QGHA 1DPGA 1W0KD 1YHYA 1ZONA 1Q20A 2FX3A 2X4GA 1L7DA 1X92A 2G6TA 5LXTF 2QD2A 3AT1A 4JGGA 1UK8A 2VNSA 2Z1NA 4GM0A 4C4TA 4W5NA 3ELBA 3DO5A 2WUFA 5E9AA 3WMRA 1YU9A 5TVGA 1RWKA 2W71A 3IP9A 1KO4A 3F6SA 1IPFA 2VNIA 3LXXA 4N40A 3NTVA 4OBXA 5T67A 5THXA 2JGEA 1VKHA 1JEJA 1DRJA 1ZYUA 3ZDQA 5F73A 3IB6A 2Y1GA 3M2PA 5EJFA 4X97A 1CCWA 5JCOA 1FDOA 2W2QA 3K73O 4U2BA 3V8VA 4MUKA 5I4KA 4AY2A 2JI4A 1CF9A 1IXRC 4QYTA 3UMFA 5A5FA 2EDAA 2ZTVA 3N8NA 3R4VA 5FOWA 3VU3A 3AKCA 2ZJ6A 3GRUA 3IQWA 4D4HA 1Q84A 3IEVA 4IXMA 4D4LA 1E8MA 5A4AA 2EEPA 3I2JA 4MGEA 1DUSA 1G21A 5KU7A 3HUUA 4ZANA 2Q3EA 1V5GA 1VCIA 1K5GA 1JSRA 1P6UA 2PE5A 1XNQB 5IC4A 4XDHA 4F3YA 1A4XA 4WLOA 1QDUA 2WF9A 3DM5A 2D2FA 2LDXA 1IXYA 2ZT8A 4HB2A 1QH1B 2B4YA 2O0JA 4Z2YA 2O23A 1XEWX 4HPWA 4JR2A 1PR2A 1E1QA 1OTYA 1T5HX 2C9MA 2AFRA 3BXZA 4DRZA 4J0GA 2HWUA 2VJQA 3QG5A 1YE8A 4M0DA 2D5LA 2YMMA 3D8TA 3PNBA 4ZICA 4GPTA 3DWFA 4K6CA 5T4FA 4AY3A 4BOYA 8ATCA 1QHYA 1CQPA 1I5EA 2QVBA 1FLDA 2JGNA 2VPYA 4FFLA 2VPXA 3G68A 4O33A 1BZYA 3WDLA 1IHOA 5CJPA 5CVJA 3STWA 1P1BA 3AV0B 1FVHA 4OATA 1U3CA 5AOAA 2XGSA 1QHSA 2XE7A 3JYLA 5G02A 4C29A 3MMNA 1BJRE 5BWMA 2V7QA 1THMA 3AINA 1CNMA 3PJFA 4WOCA 1I4WA 4D2IA 4EHFA 2COEA 4BMVA 4EEKA 2PMBA 2B3TA 1XTUA 2LRHA 2VJYA 4TMWA 3BJRA 3WC4A 1KJNA 1M8KA 1N0WA 3FZNA 1L5QA 2WYVA 2CFOA 3RVKA 2BZ0A 4ZEXA 3S3TA 5JPDA 1YZQA 1LA2A 4DW8A 5J1TB 2D4HA 3PCXA 4IV8A 2RHOA 1NBIA 2F43B 1QJ4A 1T10A 2ZULA 4M1OA 1PFQA 5K7SA 4X9XA 3O2QB 2GCEA 3VZBA 1NDUA 1GPKA 1VL6A 1T2UA 1W48A 2H4WA 3QIVA 3SMQA 4RUKA 1QFSA 3JAMA 1KK1A 3HM2A 1NJ2A 3KYCB 1WAMA 2CJYA 3CR3C 3IHKA 3LDAA 3O7MA 1FTYA 2XYQA 3GFRA 1R4NA 3R44A 1SJ9A 4FUTA 4YRKA 4ZOLB 3ZCUA 2ZZMA 4EDHA 1YQEA 1ZH8A 1P39A 2FUCA 3DE3X 3PEUA 1P1RA 2E2WA 1XD2B 1ZN7A 2VBGA 4CL0A 3A9RA 3KJNA 3GWGA 1ENOA 2GCNA 2WWTA 4KQMA 4WBXC 5H59A 3SZUA 3GCGA 3U7HB 2DFPA 4QSMA 4CLRA 4CLHA 3M6LA 5BNWA 1T8WA 1KARA 3EG9A 4ZCLA 2OYRA 5I7SA 3RJ5A 1KZGB 1ZAKA 1X7DA 2WMDA 1WMEA