3STWA

Crystal structure of tomato methylketone synthase i complexed with 2-tridecanone
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
258
structure length
258
Chain Sequence
FVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDHVTMMSKPQQLFTTLLSIANKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methylketone synthase 1
publication title Emergent Decarboxylase Activity and Attenuation of alpha/beta-Hydrolase Activity during the Evolution of Methylketone Biosynthesis in Tomato.
pubmed doi rcsb
source organism Lycopersicon hirsutum f. glabratum
total genus 88
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3stwA00
3LIIA 1BU8A 1OCEA 1QFSA 5CH8A 4WFIA 5AI6A 1MNAA 4QZVA 1Q0RA 2IX9A 5ALSA 5BV7A 4K6KA 3WLAA 4DYHA 5EIEA 5AKHA 2XMSA 3G0BA 4J0DA 4X6UA 2PUHA 2WLSA 3HYSA 5A2GA 3QITA 1HL7A 1JMYA 5AKYA 5KBYA 5A7GA 2GYVA 4N5IX 1XRPA 2BUAA 4QWWA 5DNWA 3QMWA 3WQHA 1K63A 2WFMA 3O95A 3HABA 1GKKA 4J3JA 5LIPA 4UUQA 4ZREA 2XT0A 1EDEA 1X2EA 5JZ9A 4RGYA 4A5SA 2JGKA 2BUCA 3L1IA 4KACA 1E66A 5AKIA 3DKKA 1QIKA 2PSEA 3FLBA 2J3DA 1BN7A 1IUNA 5FPPA 5JATA 3B5EA 2JEZA 3RKSA 3C70A 4DNFA 5ALYA 4ZV7A 3P2MA 2NW6A 5AI5A 4U2EA 2HU8A 4DMCA 4A16A 2HA3A 3RARA 1YAJA 2C0QA 3RK4A 4WJLA 2DFPA 4H7HA 2P8SA 1W1IA 3JWEA 5DNUA 1XQWA 5A71A 2DQYA 4MEAA 2PPLA 4F5ZA 3NWOA 3WL7A 4IH9A 6YASA 3LLCA 2QRUA 2XUPA 4AO6A 4LXHA 4B82A 2OG1A 2PU7A 5FPQA 5KWIA 4DM7A 4KE9A 5FOQA 5AHXA 3HEAA 3I28A 4CCYB 5ALWA 4B83A 3BIWA 1C4XA 2WHQA 4EBBA 1VXRA 2GBCA 5LP1A 4MYSA 1RYYA 2X5XA 4BZWA 4E14A 5JYCA 1XQYA 1XQXA 4FNMA 3LCRA 1CRLA 2WG1A 2WTNA 3LS2A 1N1MA 4G8DA 3BDIA 1T2NA 4U2GA 3TJMA 4EY8A 5IKXA 1LGYA 3ILSA 2ES4A 3BE8A 4DMFA 1XZEA 3Q0TA 3ESCA 3UUFA 4B0PA 4X3CA 1EH5A 3ICVA 1EHYA 4J03A 2IIVA 3LP5A 4BYMA 1MAAA 4IQ4A 1ZD4A 3KWJA 2C5GA 3H18A 4JYMA 3F98A 2EEPA 3GA7A 5CT9A 5JADA 5LZ5A 4KE7A 2HA0A 2AJBA 5ALHA 3JW8A 5DYTA 2IITA 2R11A 4AN0A 2GZSA 7YASA 3PF9A 5DTJA 1ZGBA 3A6ZA 4BATA 1GKLA 2OGZA 4C4ZA 4PSUA 1MT3A 4PSDA 4Y2UA 2WQZA 1Y7HA 1CUGA 4QLOA 4EY6A 2XQGA 1R3DA 1F0NA 1VA4A 1YR2A 1HLGA 4WDQA 3QH4A 3ZLTA 1ACJA 1CUYA 3IA2A 3WI7A 4CG1A 1DT3A 5D3ZA 1TCCA 1E8MA 4ZXFA 2ECFA 1DQZA 4QDXA 2CEKA 4HXGA 5AKLA 5IVHA 1A88A 4P08A 1X2BA 1AQLA 2QS9A 3AILA 4OYYA 3UMJA 3MVEA 3WK7A 4X91A 4CIAA 3H2GA 4LYEA 1U65A 2VTVA 3D4LA 5LZ7A 2H9YA 3WKCA 4YK7A 2DQZA 2AJ8A 2QZPA 3E3AA 2XUHA 2XMDA 5IVDA 3C8DA 4QWMA 4INZA 2HU7A 4DGQA 1FFCA 4XVCA 4K6GA 2OLEA 2QR5A 4BRZA 5ALVA 2AJLI 2BUBA 3KOOA 2XB6A 4S0XA 5ALFA 1CUJA 2Z3WA 4Y2RA 1LPMA 3VVMA 3DD5A 3R40A 4OU4A 1ZICA 1ODSA 3D0KA 5FDFA 3M83A 3BJMA 4U2BA 5ESRA 4EY5A 4OPMA 5K3EA 4Y2YA 3PF8A 3HACA 4NVRA 5LKRA 2XQJA 3MUNA 2WJ3A 4I3FA 5ALTA 4AMZA 4BE9A 2J3QA 2VJAA 1UZAA 1XZMA 4KYVA 1WHTA 2RAUA 4OUKX 4G8CA 2WUEA 2C0PA 4UFPA 1CV2A 5AI4A 1S8OA 1JU3A 3IULA 5HF6A 2OCKA 2WFLA 3HZOA 2XUOA 3WIBA 1XZHA 3GBSA 3O4IA 5E2IA 3D59A 3PUIA 1F8UA 1UOQA 5LZ9A 4BAGA 3DQZA 5KREA 4J0CA 3F67A 1L7AA 3EF3A 1FFAA 5BOVA 3WK6A 4G9EA 3RLIA 4GDMA 4BCBA 4OB8A 2XUQA 1XZJA 1U8EA 2GZRA 1ZIXA 2VEOA 1CIJA 3C5WP 1Q83A 5AM0A 3N2ZB 1QIDA 4C4YA 2DHDA 4ZWNA 1MU0A 3PI6A 1J07A 3WKEA 4AO8A 1XLWA 5AKEA 3STWA 1SFRA 3H2KA 2OQIA 4DSZA 5ALEA 4G4GA 4EY4A 3FYUB 3G0DA 1TIBA 4C87A 1RWQA 2D0DA 2XMGA 4QEKA 4QNNA 3WWOA 1H23A 2BFNA 3F8SA 1CUEA 1XZAA 4JUIA 4FLMA 4H7IA 1LBSA 3G0IA 3WK8A 1BE0A 2JBWA 4OCZA 3T4UA 2XDWA 4FWBA 1H2ZA 3D2AA 4FTWA 1ETHA 4ITVA 1JMKC 1XZKA 1QIIA 2GBGA 3STYA 2B61A 3CCBA 5CMLA 3O0DA 3Q8WA 2QOEA 2HHAA 4WCVA 1G42A 2ZJFA 4GECA 1N5RA 2VATA 4BZZA 1ORVA 3PFCA 4BCCA 3KXPA 1XROA 3H1BA 3WZLA 5T4EA 2OCLA 4P92A 5SYNA 1IUPA 1CUBA 2O2IA 3ESBA 3FVTA 5HFAA 1GT6A 1NX9A 4KJXA 4PW0A 2FJ0A 2HA4A 2K2QB 4H77A 5CRIA 4CCYA 1EK1A 1AX9A 2ROQA 2AXEA 3WYDA 5AOCA 3K9BA 3AUKA 5AKXA 5AOAA 3IVMA 2HA7A 3HSSA 1JKMA 5EFZA 1LZKA 2XMRA 4GW3A 3FAKA 3A70A 5ALIA 2WKWA 1ORWA 4U2CA 4I19A 3H2JA 2ZYSA 1R9MA 1VA5A 2PU5A 5EHXA 4ZGBA 3OG9A 3WK4A 2JGJA 1JU4A 1EVQA 4PNZA 4CG3A 4Y2SA 2YXPX 1EX9A 3M82A 3OURA 1SCIA 2B9VA 2GBFA 5DYWA 1MX9A 3D2BA 3G9ZA 1LPAB 3QVMA 2J4FA 3K6KA 5JAUA 3FYUC 5C8XA 5CXUA 4XX1A 1LZLA 1F0PA 1DT5A 3S2ZA 1EDBA 2HIHA 4AXBA 4KE8A 2OCIA 4X6YA 3U1TA 2V97A 1CUSA 1DWQA 4TPKA 2W6CX 2PSHA 3WK5A 4BP9A 5JZSA 4EB0A 5CURA 1YS1X 3I6YA 4B81A 5AM3A 1DU4A 3N0TA 5KWJA 1VLQA 5HF5A 3GZJA 4ROTA 5AI8A 4FDMA 1CUVA 3TEJA 3SWWA 5CXXA 1G4HA 4MYDA 3V1MA 4BE4A 1BRTA 5DYYA 4E11A 1YS2X 4CFSA 4DSAA 3EQ7A 2PUJA 2PSFA 4L3WA 5A7HA 4TVKA 1R4ZA 2PX6A 3WL6A 2CMFA 1OXMA 2BJHA 1TQHA 4DMHA 2WIFA 2DCMA 4X94A 2PVSA 3S8YA 2OAEA 1ODTC 5FP0A 4YASA 5AH0A 1CQWA 3VVLA 3PUHA 1GQRA 1B6GA 3WKDA 1ZIYA 3SX4A 1BS9A 4UHFA 4CI9A 1GQSA 5ALXA 4HTAA 2JF0A 5E4YA 4HXEB 3FOBA 3JYHA 5JALA 5JANA 5C8VA 4H7FA 3STUA 5FV4A 2XMZA 3ZV7A 5AM5A 4QA9A 2ACEA 5F4ZA 1XRLA 1WHSA 4H7JA 1WOMA 2HA6A 1ZOIA 2ZJ6A 1BEEA 5CH3A 4KRYA 4EY7A 1ZD3A 4GEGA 1JFRA 4G4JA 5LZ4A 3D7RA 5ALPA 1THTA 1ZD5A 5AKZA 5I7UA 4Q05A 4BRSA 4B6GA 2O2GA 1E89A 3ANSA 1AGYA 3W04A 1FJ2A 4K5QA 1JJIA 4UBMA 1CUCA 3I2FA 3QYJA 4Q3KA 3OOSA 1QTRA 5DLPA 4RE5A 1Y37A 1CLEA 2XQKA 4V2IA 3H0CA 5K3DA 4GWLA 1W52X 5ALOA 3KWFA 3H2HA 5AM4A 1QIFA 4U2FA 1ZJ4A 1Q0ZA 3FNBA 4BTLA 4DNPA 1PFQA 2HFKA 5HK8A 1DTEA 1JT2A 5LKAA 2Y6UA 1K4YA 2ZJ7A 1CUIA 4W63A 1XLVA 4BVJA 5AOBA 3R3XA 4AN1A 1SCKA 4B0OA 3FYUA 2C7BA 5LZ2A 2XUKA 5CT8A 5FUMA 2DR0A 2J4CA 3ANTA 5ALMA 4FKBA 4BDSA 1H2YA 4ZI5A 1NU8A 2G4LA 1HPLA 5AIAA 1CUHA 4QDUA 2RHTA 4UBIA 3C6YA 4G8BA 3KDAA 4UFOA 2CUTA 3WZMA 3G7NA 5A62A 1XZIA 3H19A 3ESDA 4GBGA 4PV7A 2WJ4A 1DINA 4M0EA 1EDDA 4B9AA 1DX6A 3A2LA 4Y2QA 5AI0A 4N8SA 2WFZA 1W75A 5JIBA 5EIHA 3W06A 4WFJA 4LXGA 5ALRA 2ZYIA 2WSLA 4J0KA 3VDXA 4N5HX 3AFIA 4D9JA 5C7YA 5LYYA 4JNCA 3C43A 1QJ4A 2Z8XA 1IMJA 4F0JA 1WB4A 4NMWA 2DHCA 4FBMA 3YASA 2WHPB 5HKAA 2OPHA 1BEZA 4J0IA 1TKRA 3UUEA 2QJRA 4A23A 1ZGCA 1O6GA 5E4JA 3FCYA 4UBOA 1MNQA 1A7UA 3HJUA 3WMRA 4IHAA 2HFJA 3O9MA 4H18A 4BCDA 5CH5A 5HFNA 4BVLA 2VA9A 4BTVA 3AZPA 3R41A 3EBLA 2AJCA 1GZ7A 3MGAA 3SC2A 2VT7A 3C45A 4KAJA 3A2NA 1PJAA 2VJBA 4ARAA 3QPDA 1YB6A 1MN6A 2LIPA 3AIMA 4LXIA 2XUDA 3G9XA 5ALZA 1QTIA 3B12A 3RM3A 1QOZA 4XWGA 3QMVA 1DX4A 1MX1A 4X71A 3KSRA 1UK6A 1QGED 3E0XA 1KU6A 1DWOA 4WY5A 1W6RA 1L7RA 4UBKA 1FFBA 5H3HA 1XKTA 3ZI7A 3DS8A 4C6HA 2VAVA 1MTZA 3DOHA 3IUJA 5K3BA 3R3UA 3WJ1A 4CCWA 3DYIA 1LPOA 3C6ZA 4BB0A 3ESAA 4UHBA 3BXPA 1CR6A 2HA5A 1BCRA 5JD6A 2H7CA 2WM2A 4KR0A 1QONA 2XQFA 1U4NA 3STVA 2VQ6A 4GXNA 2WUDA 2OAGA 3ZLUA 3CCCA 3EQ8A 4XJVA 4RNCA 4X7BA 5CT5A 2H7YA 1XRRA 3AZQA 4B80A 2FJPA 2V98A 3BF8A 2AJDA 4W1PA 4DNQA 4HRYA 1UKCA 2I03A 1YB7A 3I2IA 5SYMA 4EUSA 2BAGA 2QKYA 5EHNA 4ARBA 2RGUA 3LIPA 2JGFA 2OXEA 4X92A 3L1HA 3IDAA 4Q1VA 3E4DA 2G5PA 1ODCA 4X90A 4WFKA 5DNVA 1WPRA 3O4HA 2WILA 2WUGA 2I3DA 3M81A 2XMBA 1QZ3A 3D3NA 1EA5A 1K8QA 1R9NA 4MWTA 4W1RA 2WUFA 3AINA 2WU3A 4H7KA 4MXDA 4L0CA 1EVEA 2CB9A 4U2DA 1EB8A 4UHCA 4W1QA 3ZLVA 5LLSA 1NU6A 4H7DA 4N8EA 2RI6A 3VKFA 1AZWA 1HQDA 1BN6A 5DJ5A 4CIBA 4BAZA 2YASA 1CUUA 3F9CA 2C5FA 1KU0A 3IURA 4G1FA 4FNGA 1LPNA 1P0PA 4Y2XA 4Y9SA 3STTA 3SK0A 3A2MA 3C5VA 1LPPA 3H1AA 4UHDA 5BWCA 1WB5A 4QDTA 5AJHA 2HDWA 3WL5A 5AI9A 3I1YA 1XQVA 3HLKA 5AICA 4GLBA 1WPXA 3G0GA 4AZ3A 1IUOA 4CG2A 1HBJA 2R8BA 1HKHA 3T52A 2Q0XA 3IUMA 4O08A 1GPNA 4E15A 2WIJA 3I2HA 4HS9A 1BROA 3BWXA 4HXFB 5FRDA 1N5MA 1LLFA 2JGEA 3QMMA 5AP9A 1P0IA 2ACKA 3OTQA 2XQIA 2JGMA 2BKLA 2EDCA 4MQLA 1AC5A 2CJPA 2YH2A 1CQZA 2HADA 2I3ZA 3DL7A 2RIPA 3DKRA 1H22A 1THGA 1PV1A 4B85A 2B20A 1BCSA 5HQ3B 4MWSA 5IH7A 3WKBA 3IIIA 5CT4A 4KE6A 2JIDA 2PM8A 3VISA 5A6VA 1L7QA 2PBLA 1P0MA 1UKBA 1MAHA 3QPAA 1QO9A 2XUGA 3EQ9A 4ZV9A 4F21A 2QUBA 3D5EA 3NOXA 4NZZA 2ZSIA 2FX5A 1JJFA 4QDZA 1IZ7A 1YAHA 2WG2A 3WL8A 3AIOA 1GPKA 2XMCA 1CVLA 4K2AA 3WKAA 3BIXA 4MQMA 2XUJA 3AZOA 2HA2A 1YASA 2CKMA 3C8HA 3I2JA 4H0CA 2JGLA 5AKJA 4J0HA 3R3WA 4Q3OA 2JEYA 2WTMA 1R50A 4F60A 2HL6A 3VJMA 1E3QA 4AZ0A 3H04A 2XUAA 1SCQA 1UOPA 2B4KA 4EA6A 2ZSHA 2PKYX 5HF9A 1SC9A 5BWBA 2XUFA 3CN7A 4KAFA 5E4TA 3STXA 4AO7A 5I9IA 4RPCA 2V9ZA 1TCAA 3TGLA 3R0VA 2D5LA 5EHQA 2ZYRA 3KD2A 3WA7A 3VJKA 2E3JA 4DIUA 2WHPA 4XIIA 3G9TA 4NS4A 3NGMA 1UFOA 4J0JA 2WJ6A 4G4IA 4OU5A 3W05A 2G5TA 4BVKA 1MO2A 4M0MA 1XRMA 3GROA 4EZIA 4G9GA 2BCEA 1ZI6A 4HRXA 1CEXA 1EXWA 3C6XA 1VXOA 5FLKA 4PQEA 2W22A 5A7FA 1LNSA 4UFNA 1C7IA 4QE3A 3E1GA 3I1IA 5JAPA 4BC0A 4QDOA 4Y2TA 3MUOA 1FFEA 5ALNA 4L9AA 1YA4A 4X95A 4PO3X 4Y2VA 3GFFA 3G9UA 5JAHA 5T4BA 1JI3A 4BAUA 4B84A 3FSGD 3HRHA 5AM2A 4W9RA 1LPSA 2BGNA 4IH4A 4C01A 5CT6A 2DHEA 2I78A 1USWA 4FLFA 3PE6A 5CTAA 1D07A 4Y2PA 3IBTA 2Z3ZA 3C87A 4TGLA 1LPBB 2QXUA 3AJAA 3OM8A 4X6XA 3FYTA 4C89A 1VOTA 1VZ2A 2V96A 5LZ8A 3FVRA 2FUKA 5AK6A 5ALGA 2BGRA 4Z49A 4ZRDA 5D3KA 4IH1A 1RP1A 3CXUA 3PICA 4X93A 4RE6A 3I6ZA 3V1NA 2WU4A 2H1IA 5ALJA 5ALQA 3TRDA 3I6MA 5C81A 4OYLA 5C8ZA 4C88A 5HCUA 1ACLA 4X85A 3VXKA 1QE3A 4H7EA 3GUUA 1GPLA 3V1LA 1AKNA 3WWPA 4X97A 1CUZA 2XLCA 2HRQA 4Q3LA 1OILA 3C6BA 3DJYA 5AK5A 5K3CA 4HAIA 1E5TA 1A8SA 1TRHA 3IB3A 5CW2A 1SOMA 3WYNA 5YASA 2WIKA 1KEZA 2GYUA 3K2IA 4Y2JA 4UBJA 2O7RA 4FFVA 4FMPA 2OGSA 4FLEA 1LBTA 1YA8A 2C4HA 3R3YA 4J0GA 3I2GA 1R1DA 1WM1A 1VE7A 4K6HA 1ZD2P 5AKKA 4AB1A 4LYDA 5CBKA 1VKHA 2OCGA 3O4GA 2C58A 4LHEA 1CUDA 1C7JA 1I6WA 5D7BA 3V48A 3W9BA 3QBJA 4DMKA 1AMNA 1XRQA 4Q34A 3WJ2A 1XLUA 4HZGA 2Z8ZA 4WDRA 4KEAA 1QIJA 5IVIA 2DSNA 1ZJ5A 5HK9A 2WHRA 2ZVDA 2RONA 4IO0A 1QO7A 3DLTA 1UWCA 3D2CA 3FCXA 4B9EA 1O6FA 3WWCA 1TAHA 1QLWA 4KRXA 1HDEA 3WWDA 4JEIA 3NUZA 2CBGA 3O4JA 3F97A 3ICWA 4UBLA 1ZI8A 4ETWA 3H17A 2WIGA 1Q84A 2EDAA 3L1JA 4MJ3A 1IZ8A 4C4XA 2G63A 2QMQA 4PSCA 5HQ3A 1F6WA 2QJWA 1UXOA 2VJDA 2H7XA 3X3HA 1GXSA 3DCNA 1T4MA 5DTIA 4Y7DA 3WA6A 1XZCA 2XLBA 2Y2UA 3HI4A 4X00A 1J2EA 1VE6A 3BF7A 1ZI9A 5D6OA 2QXTA 1QIGA 3U0VA 1CUAA 2O7VA 3GELA 1G5FA 1DWPA 3G0CA 1XRNA 2GYWA 5I8PA 1XZDA 4FHZA 4EHBA 1XZBA 3OC0A 4B7ZA 5T4HA 4H35A 5JD5A 5K3AA 4FFWA 2QM0A 2HM7A 5K3FA 3DNMA 2PSJA 1R88A 3R3VA 5EHZA 1P0QA 1E8NA 2Y2VA 5JAOA 4AMYA 3BL8A 5HKBA 3W9UA 4UHEA 3QM1A 2ONCA 1WB6A 1FFDA 3DEAA 4DTCA 1DQYA 2Y1KA 5AO9A 4GHWA 1H2XA 1B41A 5JZBA 5IVKA 1ISPA 5J3JA 1WCYA 4KAAA 2JGIA 1N8SA 1QIHA 2ORYA 4E46A 1XKLA 5ALKA 5JASA 1AURA 1E8DA 2VSQA 3BJRA 3AIKA 2Z5GA 3ZPXA 5EI5A 1W76A 3O9VA 5JARA 2VJCA 1MJ5A 1XFDA 5ALLA 1UT6A 4PF1A 4UHHA 4YPVA 1IVYA 1X70A 4DNOA 2WG0A 1MPXA 3DYVA 3QPCA 4QLAA 4Q82A 4JYPA 1H2WA 2UZ0A 5EIAA 2VT6A 4AQDA 1EINA 5JD4A 1UK9A 3I2KA 3PFBA 5FXMA 3DL4A 3V1KA 2XMQA 4P9NA 5AM1A 2YYSA 1A8UA 1QIEA 3CN9A 4P93A 5ISMA 1YSCA 5EGNA 1M33A 5AKGA 2O2HA 1FSSA 1UKAA 2QUAA 1G66A 2XE4A 4OSEA 3FWHA 1U2EA 1JJBA 1YCDA 2X76A 2CZQA 1J1IA 5T4FA 2HRRA 1CUFA 4BP8A 5ALDA 1VZ3A 3R3ZA 1QFMA 1GGVA 3PDCA 3M3DA 3WIOA 3F96A 4OB6A 3VJLA 4UBNA 2VF2A 4WY8A 4BBZA 2RHWA 4BDTA 4L72A 2WIDA 1EB9A 2PSDA 3EIOA 3HXKA 5K5EA 2QTBA 3W2TA 4DLNA 2VAXA 2XUIA 3V9AA 1UK7A 1QIMA 3FSGA 3WK9A 5AIBA 3FLAA 3IUNA 1J06A 5FKJA 3IUQA 4LIPD 5AK4A 4BC1A 4GI1A 4LKOA 2ZYHA 5HZGA 4HVTA 2HU5A 2GBIA 3FLEA 1K5PA 1XZLA 5ALUA 3H2IA 5DWDA 2OGTA 4J7AA 1EI9A 1XZGA 1Y7IA 1VJ5A 4W1SA 5HF8A 1UK8A 2X8BA 1A8QA 1XZFA 2PL5A 3WWEA 2WFLB 1CFJA 4FOLA 2Y6VA 3OPMA 3B3QA 1UOOA 3QZUA 1MX5A 1CUXA 1CPYA 4JH0A 4N8DA 4OD0A 2QT9A 5K3FB 4G5XA 4UPDA 3G02A 4YX9A 2XI4A 1W4LA 1TK3A 1TCBA 3HC7A 4OB7A 4FBLA 2QVBA 4AX4A 3G8YA 2OQVA 3ED1A 1EK2A 4MEBA 1K6EA 1CUWA 3ZWQA 1Z68A 3BDVA 3FBWA 3DOIA 1AUOA 3DDUA 4I4CA 5AK3A 4M0FA
chains in the Genus database with same CATH superfamily
1TFRA 1AXEA 3D5QA 3KZOA 1NVMB 4MVXA 3GJ8A 3IQHX 3O8CA 1UC4B 3LIIA 1D1TA 2XNCA 1GPBA 3NDIA 1VJRA 3OCYA 1YRHA 2P6OA 4MVJD 4TQUS 4UM5A 4WFIA 2NU7A 4EG1A 2XSZD 2WTBA 2ZIFA 3U7RA 3IEVA 4DLLA 2MSEB 4GO1A 1FLDA 4MI3A 4R1QA 1HH4A 1QS0A 4V0OA 4UATA 5EIEA 3G0BA 4MKIA 1XIVA 2Y05A 3C7TA 4GI5A 4D9FA 3TIGA 1Q20A 3CNOA 1EWQA 3UKOA 4BEBA 1QNLA 3FPJA 2CXRA 2E89A 4UTRA 1W5TA 4ARIA 4HV4A 1HL7A 1VE1A 4BNDB 5HMMA 1JMYA 2IZ5A 2YJNA 3IKLA 1WSBA 3L5OA 1RSZA 3F2IA 4LJRA 5EWLB 1FTYA 3OT1B 3AV0B 3BHIA 1EFDN 3MFYA 4QWWA 2BUAA 2YBDA 4NJEA 4TWIA 3LO8A 1P9WA 5L3QB 2JZCA 1VGRA 3CNNA 4J1QA 4IICA 4RADA 2WFMA 3O95A 5FR1A 3HABA 5KTSA 4PXYA 5LIPA 2KM1A 4OQXA 3EVDA 3E22A 1GU0A 4UUQA 4UOZA 4AX8A 1R4NB 3VSCA 2X4LA 1BOOA 4DIDA 5HNKA 3N76A 1EDEA 2HMVA 4MUHA 4A1OA 4GQBA 3ZTTA 4RJ2A 2QX9A 4D80A 3K6SB 1W4ZA 3B6ZA 3RG2A 1R00A 1T2CA 3GLHE 1KI9A 1C8VB 2R7LA 3AJDA 6REQA 3K09A 2IH2A 1NUHA 3DHWC 4S1VA 1Z07A 4IDGA 6ABPA 3EWAA 5LYJB 1M2HA 4KXXA 2PX2A 1GL9B 1T36A 4HLCA 1U0EA 2GPWA 3GFGA 1CHDA 3AXTA 2XTNA 5CM9C 5MF6A 3QXGA 1C1HA 4HLNA 3TKLA 4YT8A 1E94E 3HCDA 5FEMA 5AVSA 2FZLA 3VUEA 5JH7B 2J3DA 1N1EA 1SELA 1KVRA 4HLUA 2ZJOA 2JEZA 3D0QA 4PGAA 1Z5ZA 5LLDA 4DNFA 5ALYA 3OQOA 3BG5A 3SBDA 5JNLA 4DVGA 1SXIA 4BTEA 3LLMA 5J4VA 3D43A 5E1MA 3MGCA 5AI5A 4DLSA 2ZJYA 4X7RA 3RPEA 1I4LD 4C7BA 2HU8A 5DBOA 2ZPTX 1BH2A 3D8NA 5I47A 4QFBA 4D9HA 4JBGA 2J1LA 1QGZA 4KIUA 4K6OA 1K6JA 2PS9A 1NMYA 2C0QA 2WB4A 4HZIA 4N0DA 3WB9A 1OT5A 4H7HA 3ZHUA 1A77A 2W00A 3HP4A 4HDNA 4IVPA 3K1YA 1A5ZA 2YQ4A 2H2AA 4MOWA 1E3SA 2QAGC 2QYOA 2WF6A 3OC6A 4QL3A 4FZVA 2Q0SA 1ZITA 4M22A 1CP2A 2BV3A 2QE6A 4LG1A 1SCAA 5ESWA 1PEYA 1XQWA 3CX8A 3FOEC 1J8DA 5A71A 2DQYA 2AMLA 4RC9A 1JEYB 1U98A 1KERA 5TRTA 1CLUA 2HW8A 1Z6YA 3KKNA 1NG1A 1KY5A 3KZMA 4IH9A 1B15A 2FEKA 3SR4A 4TM8A 4OO3A 2WRZA 2XUPA 1P62B 4PO8A 2HQOA 5TEVA 2ZPUA 4F2HA 4Z1OA 5LMUB 2VUHB 2HHJA 4DCCA 3PHJA 5KWIA 4WK4B 5BVGA 2W9XA 5REQB 2DCUA 4CMBA 1YNSA 4V0SA 4E5UA 1E1QD 3H1TA 3IP8A 4I81A 3U7QA 4DADA 4DYDA 3RB8A 2QTMA 1KDOA 4B83A 1C4XA 1ZM3A 5F3RA 1JJVA 2ZKLA 4EBBA 1MEOA 1RKVA 2BSXA 2PUWA 3UM9A 3GX1A 5J2UB 4XIYA 5A5VA 2HH9A 3OWOA 1PGQA 2QYSA 4ZT6A 5IEBA 3ROQA 4QRIA 1NR7A 3ZJUA 4HRVA 3DT6A 2P75A 3P0HA 2AEFA 2WNSA 3FB4A 2XGOA 5AVKA 1S7GA 1FMLA 1X80A 2Q49A 3K5PA 3T5DA 3F5MA 4BZWA 2GN6A 2VWGA 4B1FA 5FBWB 2I76A 2YWJA 1RYBA 1XQXA 1H69A 1CRLA 2AN1A 2BLNA 1ZOOA 1ZVMA 2L18A 2WG1A 4FFBA 3CVUA 5AXCA 3A27A 3AYZB 1N1MA 5AJTA 4FOTA 1M2VB 3AF1A 1FUEA 3D31A 3GRFA 1EFPB 1RMQA 5U4QA 1T9GS 3SYRA 1RE0A 1XMIA 2Q5CA 4JZKA 4RMIA 4UQLA 3UCFA 4YDSA 3BH7A 4U2GA 5EUBA 3CS3A 4ITRC 4B47A 2QF7A 1LB1B 2PKQO 3FNRA 4OA8A 4RFLA 3T7DA 5D87A 1JSLA 1XZEA 1Q16A 2M6RA 2R97A 3NBYC 2IOFK 1SAYA 1Z6ZA 3EGVA 5E7MA 4PYKA 1EHYA 1Z5VA 1JDVA 3OZFA 2EP7A 4NG5A 3F1KA 1Z2CA 4A8JA 5CA1F 1IIRA 1GYPA 3P0JA 2EJCA 3IQZA 2IIVA 5LPNA 4DB2A 3LP5A 4N01A 4GBJA 5HJ5A 3AHCA 5KYUA 3FKSA 3LBAA 4CJXA 4MRMB 1R0RE 2X8AA 3A37A 5DO9A 2FY8A 2K5UA 3UHFA 4BVBA 1AQNA 3EXIA 2C5GA 4P4GA 2O50A 2VNAA 3GA7A 4Q9NA 3RTBA 5CT9A 4KKXB 1YBFA 2FZKA 3F4KA 1EWVA 3C3DA 3CLUC 5DI3A 4JI1B 1P9NA 4X8MA 2I2FA 1Z06A 3VO2A 5K09A 1IQ0A 5K6AA 1FJGB 1YQTA 3HJFA 2IS4A 4Q4DA 4LPKA 3HWX1 3TK1A 3COZA 4PLWA 1PE0A 3GG2A 1U0RA 3QWBA 2OZLA 1V7CA 5JAQA 1LRJA 3A6ZA 3GZ4A 2AD1A 1GCAA 1HMPA 3H65A 5AXAA 1GKLA 2AHOA 3RUEA 4WBNF 1F1JA 4FMCF 4GKVA 4PSUA 4RAQA 4C4ZA 1OA1A 3PLAE 2UDPA 3M9WA 4JUAA 2EX0A 3RCBA 2NU6A 2FGKA 4OQEA 1SEVA 1W0CA 5DPMA 5A3SA 3DVQX 3LKBA 3GH1A 3MXTA 2CC2A 1IY0A 2X0NA 3RRBA 3DGEC 4YT2A 5C8VA 2Y0EA 4OXIA 1W47A 3L2OB 2GN2A 1VI6A 3RU7A 1T3GA 4R1MA 1V8PA 2O05A 4LJ8A 4WZBA 4BUCA 1R3DA 1F0NA 2WNHA 3PK0A 4UHJA 1JXQA 1P4JA 2HGSA 4WCFA 1VC2A 1ZSVA 3NDPA 1A8PA 1NFQA 1W59A 4RDHA 1IVSA 1DO0A 2NUAA 3HMKA 1C1XA 3PQ8A 5T8KA 3LDGA 1LK7A 4J6EA 3L04A 2CXHA 1ACJA 3H5WA 3VYUB 3WR5A 4ER3A 4KR3A 4RA6A 4U8HA 4LTDA 4OQLA 4O5AA 5U4XA 5ANRB 4AI6A 2BHTA 5KEIA 1P3JA 2HJSA 421PA 3JALA 4JQYA 1ULHA 3Q2IA 1TCCA 1E8MA 4WV3A 2DU8A 4BX8A 3GP8A 2IZ0A 1DQZA 2F8MA 3ZHQA 2CEKA 5C51B 1IFXA 1C9YA 1X7WA 9ATCA 5IVHA 2FWPA 3GEEA 3LD9A 4Y9RA 3C8MA 1D4AA 3JQCA 1ENPA 6LDHA 1GUDA 1FQKA 3FOZA 4FNAA 2QS9A 4WOCA 3ZWOA 3CFYA 3EXFA 3GJ0A 3JWGA 1P7CA 1XALA 4ESOA 2OOSA 2DSTA 2ONZA 4M9QA 2NXJA 1VFPA 4OQDA 5JRJA 5L7WA 4K1XA 4TSFD 1NBMA 3KQOA 4C4PA 1PFYA 3ONWA 3KSDO 5JECA 4C6RA 2BFCB 2GO7A 2BDUA 3V8NA 3D4LA 2NLOA 3EVTA 3T9FA 5LZ7A 2CNKA 1GNLA 2H9YA 2O2ZA 1I7QB 1EM8B 4XDYA 4FI3F 3I37X 2C7GA 4ZQHA 2G76A 5HTOA 1PJTA 2AJ8A 3A1EA 1Q14A 3KE8A 3E3AA 4B4WA 2XUHA 3HUEA 4V3CA 5KMGB 5LNK1 2QSZA 3A4NA 3EC7A 3ZGXA 4B4OA 4LRUA 3IAM1 1K8XB 3RUHA 2EJBA 3IEXA 3ZHSA 4IYRA 4INZA 4URXR 2HU7A 4OI4A 1ICIA 3ONFA 5BSMA 5L4LA 1U0HC 1VMEA 1S3SA 1UIRA 3DFZA 4XIGS 2BZ1A 2BJVA 4Q4AB 1NR1A 1S8NA 4XVCA 1JDUA 5TSDA 5L3SA 2OLEA 4CHGA 3EGOA 1Z3IX 3AL3A 3DMFA 2QRMA 5ALVA 3X2EA 3KOOA 5JSYA 3QU7A 2E0IA 1EBBA 7ADHA 4Y2RA 2V4MA 1NM5C 5JDIC 5T64A 4D4HA 1RM0A 2WVHA 4OFWA 4A0FA 1R0ZA 1XAGA 4ZYZA 3F46A 2DR3A 3D0KA 4NQZA 3O6VA 2FWIA 3LL7A 5AUNB 1UPAA 3BFJA 1GNSA 1A9RA 3MS4A 4NOLA 5ESRA 4BZQA 3EDRA 3UJNA 3RC3A 5KNBH 4URZR 5GVSA 2CCGA 5LKRA 3AKZA 2XQJA 1Z0DA 1AKYA 2OTCA 5BR1A 1NWHA 2WJ3A 4X7PA 4RPGA 2IEBA 5C4IA 2J3QA 1FC0A 1ZD8A 2BCGY 2DPHA 2NACA 2PQMA 3C1UA 5ECDA 4F3YA 4J0FA 2B1QA 2VDRB 4C4RA 2IS6A 1WHSB 2FK7A 4FFOA 4JDPA 2FQYA 1QHIA 2OE2A 4DLYA 2RAUA 4HTFB 1WEKA 2IPLA 1R66A 3AI2A 3AVPA 4CMEC 3H4IA 4K03A 4HQOA 1QGUA 2C0PA 5IAEA 4UFPA 4I14A 1OBFO 1VHQA 2F1HA 3SSAA 3VNQA 4GX1A 5LBUA 3PFWO 4EQZA 4FYPA 5K0SA 1A1SA 1S8OA 1U4SA 4F6LA 2JIBA 5CB6A 2O8EB 4GPZA 1QVRA 1VJ1A 2AG0A 4L0MA 4L73A 4ZVSA 4EEZA 3VR4H 5J4KA 4W5RA 2DXIA 2R7NA 3SHFA 1P4AA 1RJGA 1V8DA 3LXMA 1JHDA 2NZVG 2PKCA 3OZEA 3UJDA 5J2TA 3ADDA 3GBSA 3H83A 4RQUA 1A9OA 3MK31 1XZNA 2YNMA 1GDHA 2ZJ0A 4MVJP 1L5RA 4HLDA 2IEZA 4AULA 4ZP1A 2HWKA 4FKZA 5LZ9A 4OI0A 1F1BA 1VHJA 2CY0A 3CLSD 2F1KA 3R75A 4F3TA 1E2FA 3U9LA 5KREA 5A4FS 1MJGA 1M6HA 4ZCSA 4Q39A 3T5TA 1PFVA 2FUEA 5EZ5A 2DETA 1E2KA 3AUYA 5LFAA 4NRDA 2BM8A 3LT2A 1NJGA 2OESA 4Y9UA 2R96A 3R7WB 1B42A 2KMLA 4GM4A 3QJGA 1KJ8A 3ZHVA 4DAEA 2XTMA 1VJCA 3ETHA 1T9CA 3WK6A 3EFOA 3M1IA 1RJWA 2G72A 3GD5A 2CLCX 4G65A 2ZR7A 4G9EA 3SHVA 4HEHA 9LDBA 4MVJM 4R1PA 4OM8A 2BVNA 4JROA 5IT0A 7MHTA 3HVHA 3KFXA 5JSZB 2MDTA 3LTNC 2DB3A 1U8EA 1ZIXA 1IWBB 3DE0X 4CT5A 2O5EA 1CIJA 5AOVA 3IAUA 2DP4E 2OV8A 4QBHA 2Z0MA 3MJHA 3QYFA 121PA 1OB2A 5CVVA 2J3HA 1EUCB 4AJIA 1S0UA 1E1DA 1B76A 1Q83A 5B4VA 3M8KA 2BBWA 1PT5A 3VPDA 2JIRA 1QIDA 3N2ZB 4MQUA 3UGKA 3IIKA 2JFHA 2QEQA 4MS4A 2JA1A 2BFEB 1JFFB 3BMNB 4O3FA 4AURA 1L5SA 4CKBB 3MIZA 2GVNA 4BZXA 1T4CB 1Z28A 1N7IA 1J07A 1L1RA 4KODA 4BO0A 2J3IA 1XQ6A 3DUFB 3KVVA 2IHNA 5I7HA 1HYQA 4WOJA 1SFRA 4KL8S 4QOGA 5HSGA 3DBHB 5ITWA 2IV2X 4X65B 1O0CA 4ZVKA 3IBFA 4H60A 1YMUA 4XR9A 4EFKA 3FYUB 4Y6QA 3GDHA 1ZUNB 3KK0A 2BSAA 4ZYUA 2JFOA 2E85A 3P2JA 4QYWA 4D0GA 4JV5B 1OLSB 1RWQA 4LEIA 1PZEA 5BURA 5IZCA 3RJ9A 2YOHA 1XMVA 4P83A 2YYZA 1FUYB 2Z43A 4QBTA 3WWOA 2ZM6B 1NUQA 3UPTA 1NF8A 5JS1A 2I3GA 3OY7A 3L6UA 1E5QA 2JFUA 3GFPA 4RLSA 3V7NA 2QYHA 4RXUA 1GLGA 5SZKB 4FGWA 1MV5A 1RZUA 1VLHA 2ISSD 4Q18A 4K7JA 5KHLB 4BKPA 1G20A 3EVZA 2VT3A 3VTFA 2PXHA 2H29A 3ILYA 4BXOA 1DUIA 2VSNA 3TNLA 3WK8A 2ATVA 2QTRA 2JBWA 3HR7A 4GOOD 4BQRA 5CYOA 2HWUA 1H2ZA 1YZLA 2BE7A 1GCUA 3I5YA 1KQ3A 4DT1B 5EOVA 3W8NA 4FTWA 3T3OA 1L7VC 4OL9A 2ZLBA 2CVHA 5HIIA 1NE7A 5CGZA 1JXOA 5LOVA 2C84A 2K4MA 5HG0A 1KA9H 3ECSA 1WPQA 2X6TA 3CEJA 4PWYA 4BNTA 3CCBA 3B8EA 4PNEA 1G5RA 4LRTB 2VXBA 3Q8WA 2O8VA 2XOXA 4X24A 2QOEA 4JN6B 5EXXA 5TPWB 3SSMA 3ZD9A 4U00A 4M8NE 4N41A 3KB8A 4ZJYA 3OT4A 5LA6B 3EMDA 5DVZA 4YP1A 5F12A 3WLPA 4N0QA 1U8TA 1TVEA 2WEKA 5L9AA 3SX0A 2IYOA 4JFAA 4A2QA 5EA2A 5JI2E 4QT0A 1CZNA 5F9HA 4XFDA 2VATA 4M9UA 4BCCA 2B8NA 2GK7A 1AMUA 3RHTA 2E4WA 1GGMA 3HBAA 3KXPA 5EIOA 1QV7A 1KXJA 4JI5B 1FVFA 5KOIA 1XROA 1AKWA 4DCNA 3AR7A 3QBDA 1NBME 1PD1A 3BKWA 1UPCA 3WRXC 5JLJA 1TYAE 2B8EA 2D3WA 3IAFA 5TC4A 4DCMA 3RYTC 3TSZA 2FRDA 2OCLA 4CQLB 2OXCA 1XJQA 1W4AA 5SYNA 2I2XB 1IUPA 2A1TS 2EATA 4PZDA 4E2XA 3R44A 5DRTA 2LP4Y 4URUR 2O8DB 4R9UC 4PG8A 1TM3E 1SBCA 3NBKA 1N8TA 1HGXA 1XCPA 2DLDA 3U48A 4O4JB 3ZHXA 3FVTA 1TUBA 1UUFA 4HBZA 4WESB 5F77A 4XSGA 4KQEA 4Z0PA 2NVUA 2L42A 3T1VA 1C3EA 3RYIA 3PFFA 1J5EB 5LMNB 2YC2C 1JHUA 4Y2GA 3OBBA 3NX4A 1QGDA 3EXEA 2GEDA 2I8CA 3IP7A 2YFKA 4MLDA 2ZRDA 4AUKA 1E6WA 1PJ8A 4HX9A 4TLEA 4WXEA 3TGPA 4P0QB 2AN4A 4HB2A 4B6QA 4RHCA 3EQZA 2VH2A 1OREA 2NSLA 2HA4A 4FC6A 3IHWA 2IXFA 4CM9A 1XC7A 5B7NA 2ZANA 1PD0A 2WSIA 2K7FA 1KZ9A 5FJIA 3ZHRA 3NFRA 3EZ2A 3DNFA 3EG9A 3TQRA 5ABPA 3LQFA 4Q5IA 2CLKB 3H86A 5IHPA 3NEAA 4II7A 1XQ9A 2F64A 3C85A 3KJIA 4HGRA 1UPBA 4JEMA 3ME5A 3ZCPA 4PCLA 1OH7A 1AKUA 2H8GA 2V7UA 2VNKA 3AUKA 4H16A 4HDMA 1YKGA 5PNTA 3SC2B 4OJKA 3C14C 5KKNB 3A6FA 1NXXA 5FADA 5I51A 3T3NA 1IE3A 5F33A 2R7MA 1WXQA 2HCRA 3A3YA 5HJEA 2VBCA 3HU2A 1N2HA 4LJ6A 4C20A 3AW9A 4XD7D 4KFRA 1LZKA 5EFZA 4AKEA 2WB2A 2JZNA 4FFPA 1Z4IA 4ZPJA 3N86A 3A70A 3BCRA 1Q12A 1G38A 1VJ0A 3I53A 2O06A 2C2YA 3GXBA 1U31A 2FRVA 3EUAA 3H2JA 2GHQA 2EJUA 5AD1A 1ONOA 2JG3A 1IOLA 2PU5A 4ZIRA 2E4YA 5K0JA 4F5EA 1PW7A 3JQAA 3LHSA 3OG9A 1KFEB 3I32A 3JR7A 4BHTA 4D0SA 3R5FA 1R6VA 2JGJA 3LKZA 1VL6A 3HFSA 4PNZA 3PUJA 3ZWCA 1NGSA 4KPGA 2OECA 3HSKA 4DB4A 1JEOA 2HQBA 1ODKA 1PVOA 1UP7A 4QU8A 4WXPA 2OV6A 1IM5A 1RM3A 4DR5B 1SXGA 2HXYA 3D2BA 2QX7A 4IDCA 1OKKA 2NO9A 4MPJA 1JB1A 4E6PA 4OYRA 1SVLA 2JS7A 2FEXA 2NPIA 5FPYA 1YS7A 2H4JA 4JHXA 1J25A 5G40A 3K6KA 5LN1A 1GTVA 4WW0A 3NIDB 2IXBA 3DMTA 4RY0A 2BDTA 3RRZA 8ATCA 2CGEA 2CNWD 2V5UA 1U8ZA 3AKDA 4H1UA 4XX1A 1QMGA 4X5OA 4EENA 1YS6A 3QVGB 4IIJA 4IXMA 2OHFA 3HBNA 5ADUS 1BCRB 4CDRA 3S2ZA 5KVSA 1EDBA 4RLHA 1QHNA 3PDJA 2FQQA 5DASA 2OUKA 4XWOA 1XA3A 1Q0UA 4D3FA 1VKZA 1LNQA 3C3JA 4MB0A 1H9AA 2BFFA 2EJWA 1GZHB 3VOAA 1MG0A 3PKIA 2AXQA 2V97A 4KMMA 2FZVA 3FMFA 1HDGO 1PT7A 1G3UA 1CUSA 1DWQA 1U1GA 2IP2A 2ZYUX 3CE9A 3H7IA 3KTAB 4O4HF 5JZSA 2JJ1A 3ZK7A 5IFLA 5BN3B 1WD5A 4CTOA 5E6SA 2J45A 1F4PA 2VL7A 3I6YA 4KNVA 4WK2B 3ZU3A 5IABA 5KTNA 1PR4A 1RZRA 3VZPA 1AHHA 2COUA 4XJXA 3VR2A 1CP3A 5D1HA 4B3FX 3QEAZ 4BS9A 2GCEA 1DU4A 2V3VA 2G06A 2V7BA 1M1ZA 1NDQA 3OQ1A 3NDBB 1KR5A 2HPVA 1SCDA 4UAUA 4AZVA 1TJPB 2PR2A 4LF6B 2ECKA 2FSSA 2GZ3A 3FZQA 4ROTA 1JSCA 5DISB 3TUJC 4U0JA 2ZRCA 3P9CA 1P9LA 4FR5A 1NULA 2X7HA 3GZNB 3UT5A 4X1KB 2A57A 4CL2A 1J1ZA 1Q57A 3AUSA 4HDQB 5KC8A 3KR2A 2Z3VA 3BM5A 4TS4A 5I9BA 3W5VA 4BE4A 4E11A 1YS2X 4M89A 5K45A 3WLTA 2OKCA 3TOZA 2RHCA 4YCAA 4JT8A 5LBIA 3ROPA 2GLXA 1O1YA 2H2DA 1CERA 5DBEX 5H4HA 1Z8HA 4L3WA 1A5TA 3SJZA 1MO4A 2Z5FA 4Q93A 4YBZA 2W2LA 3M3HA 5EQFA 3OQIB 2RSLA 2YDXA 5ELXA 2IH5A 3KUCA 2JHCA 2PX6A 2DFDA 2IHVA 2YFYA 3C3MA 3PFHA 4GBED 1R10A 3DHNA 2IIQA 1L8QA 1A72A 1TUEA 3GI1A 3R9XA 2CMFA 1DG3A 1APBA 1G20E 2X8WA 1TQHA 2H1CA 2IQIA 3OF2A 3EF0A 3AO0B 1T9BA 4O25A 2A5LA 4DMHA 4IJWA 4X94A 5DM0A 3WHLA 1BMFA 2LE0A 1CK4A 1A9XA 2XNDD 3HJHA 2C4NA 2I71A 1H05A 9LDTA 4D45A 1RC0A 2X3YA 3B20A 4C4AA 2MSLA 5FP0A 2JVIA 3JZAA 4FFSA 3L0YA 3ECCA 3NG1A 3ZNNA 1HDRA 3PNOA 4Q48A 1F2UA 3D7LA 2XB8A 3R3JA 3E9MA 3USCS 3H2YA 4FD3A 2Q9AA 1FNDA 1NPDA 4KLRA 3UJBA 1VBMA 1UJ4A 4YGYA 2WMDA 1Z29A 1HFKA 2B1RA 3T0FA 3H5RA 2XZDA 3WHPA 3D6NB 4ATNA 2WMNB 3L05A 2XBUA 4CI9A 3F7OA 4L51A 4EP1A 1C2TA 1QAQA 2BEUA 5KNBD 3ZD7A 5CA1B 2X0RA 1QNFA 2XD9A 1JQJC 1C9JA 2OORC 2QGNA 4UDXX 1OY1A 4I4NA 3DWIA 3C1AA 5JSKA 3T95A 4DA9A 3L41A 2BH9A 4DOMA 1GV0A 3AVQA 2P2DA 4DPLA 2WHEA 3KEOA 4FSXA 2E9SA 4E2FA 4LV5B 4JIGA 4QOSA 5ETJA 5JANA 4E4YA 3HU5A 2H9AA 4LHWA 3STUA 1LXCA 3CNHA 4IJMA 1P9RA 4MYTA 1VIAA 2QY9A 4FDVA 5K3SA 4NI5A 4K86A 1GZ5A 2Q46A 4EKGA 3HZRA 2RHDA 2H31A 5EVJA 3K4PA 4RORA 1OFUX 5CB8A 3I1JA 3K1TA 2MOKA 5F4ZA 4US1R 3VR4D 1PYOA 2BE9A 1GPYA 1SVOA 5JTTA 5FI5A 2BFAA 3A6LA 4LVCA 4UE2A 5AT1A 1GAXA 2VWPA 3U4HA 3KLPX 4FMCB 4U9HS 2AZMA 3K53A 2OHVA 3PL5A 3SYNA 4KRYA 2R5WA 4MQEB 4NK5A 5BUSA 5CITA 4H0NA 2VYND 1JFRA 4RIFA 2P1RA 4LC0A 4UVIA 2HMTA 3VHXA 4AG3A 1LDNA 4Q05A 4FE3A 2QJTA 1AG9A 2H48A 3LUHA 3QVVA 1E89A 3N8DA 3OHMA 5CLFA 5C3UA 4AL4A 3ANSA 3NOQA 4TSRA 4NSNA 1AGYA 1UAYA 1YUBA 5HHTA 1FJ2A 3PEEA 3ZXXA 1Z47A 2NXWA 1LQUA 2VPIA 4AKTA 5BPFA 3WMWA 3TL3A 3H9EO 3REGA 1NATA 3I2FA 3Q3VA 2BYTA 1SBQA 2NT4A 5JS2A 4Q3KA 2II6A 2UU9B 1T8PA 1R8YA 3U4QA 1R12A 3L77A 3PUKA 4GKAA 3UZUA 4R41A 3FPEA 2AWOA 4JU9A 3LZ6A 4G6ZA 2HI0A 2J31A 5D3MB 2AQKA 1P1BA 3GRPA 1Z33A 5DM2A 5ELMA 5TT1A 2FW7A 3NP9A 2CWWA 3BH0A 3I0NA 1K06A 2GUWA 3ZHZA 4V2IA 1L7XA 5DK6A 2J3EA 2XIJA 3UMCA 3X44A 1BCSB 3AHIA 2GFIA 3TOSA 4I55F 3SQOA 3D4NA 3MB8A 2JI9A 2HLPA 3WTBA 4BMPB 1NXPA 4POAA 5ALOA 4C7KA 3KWFA 3S44A 4N0PA 3R74A 3TSAA 3ZBPA 1T5OA 2IEAA 4DIFA 4JLSA 3U3OA 1T1EA 2AOXA 2I1VB 3FNQA 2JANA 3WZ2A 4R81A 3MT0A 1GSAA 1N2ZA 1C9KA 1GTSA 5JNTA 3OT5A 3D3JA 4LWOA 4UDOA 2HFKA 5A2QA 1K9SA 3X2SA 4YAWA 2J5KA 1RIFA 4KV9A 2VP4A 3H9JA 4RY9A 5C5IA 1BTOA 3SBOA 1K4YA 3IFSA 1PAUA 4TTJA 4BNJA 1HYGA 3CH7A 4L2IB 2B4QA 4W63A 4ND2A 1ZD9A 4WHMA 3EXHA 5ECYA 5LQAA 4K9OA 2YWEA 4BVJA 1E20A 5AOBA 3AVXA 1KE1A 3WNCA 3BX1A 4F12A 1KI8A 1RXUA 3DEKA 4HLQB 3MWEB 4OXKA 4S1PA 2P9ZA 4R3UC 1COWD 3SR3A 1XZ8A 4GOJA 2XUKA 4ZK2A 3KZCA 1FNMA 4Q3AA 3T4EA 1X94A 3TMAA 1V8OA 3OP4A 3HCEA 3T3PB 2DR0A 2J4CA 1M8KA 3HBLA 3ZCUA 2YZKA 2V3WA 1SHLA 3VSDA 4AY6A 3ENQA 3ICCA 4BDSA 2A86A 2NSJA 4IS2A 3RJZA 1NVWQ 1QHXA 2BIFA 1RI5A 2CWDA 3L6DA 4DIMA 4FFNA 1CZLA 4MYCA 1HPLA 4WD3A 2ORED 1N1GA 4AP5A 1UBNA 1CUHA 1DTWA 1K3UB 1V8ZA 5BVHB 1AHNA 4G26A 4IOKA 4ZOLF 4HNVA 4BKOA 2IYXA 1C0PA 2RARA 4QEZA 4EPTA 4Q3BA 2RHTA 3LGSA 3U81A 4AS3A 3D6FA 3OU2A 4YAIA 8GPBA 1PLKA 1N32B 1ZL2A 4G8BA 2HV8A 3IIEA 3KDAA 3MRTA 1P5FA 2G3YA 2OC4A 3L82B 4N3CA 1NJ5A 3BZUA 4QFCA 5GP1A 4H08A 3RVJA 1JSXA 1AK1A 2BDEA 1XZIA 2AFHA 1KSJA 2BZGA 1F60A 2QROA 4LHSA 2VJLA 3DB2A 3TW8B 4C7OA 1L4KA 1UT5A 2WHYA 3QVUA 3KD3A 1SVSA 4Y0NA 3KQNA 3ENWA 5BV1A 2WJ4A 3U7GA 1FBTA 4LSZA 4M0EA 3F78A 2ZJ4A 3M70A 3WMGA 4BUJA 2Q62A 2F3PA 4I8IA 4B9AA 3IX7A 4DQKA 1JQ5A 1DX6A 1E1CB 4BE9A 5HMLA 1S6YA 2W37A 4NCXA 2D7DA 1Q74A 4IIDA 4MS1A 1K66A 2VK1A 3OPQA 4O02B 1M7BA 3P96A 5CB4A 4LF9B 2NTJA 5CFOA 2CNNA 2LXNA 3RSFA 2DBZA 1W1UA 4QX6A 1G9SA 3W06A 2W70A 2JRCA 5DNDA 2P3OA 3JYQA 4LXGA 4RQTA 4Z4HA 3QY9A 2P6RA 1Q3HA 4NAUA 5HDQA 3LRTA 3SMVA 3DOJA 1N3LA 1MZVA 4J0KA 4JBWA 1UKVY 1ZLXA 2VI5A 3AFIA 3HHEA 3M6AA 3RC7A 2VRCA 1K7YA 4JNCA 3E18A 3EIQA 4XJSA 4R2MA 3E1SA 1QJ4A 1JIVA 2Z8XA 3OCUA 1JQAA 4E5MA 4F0JA 4G41A 4P4NA 4B4UA 2GN1A 1QLHA 1BDHA 5IZ4A 2PA3A 2NUPA 4K9LA 4OXNA 3TM5A 3WLRA 4AF6A 5J43A 1OD6A 1B73A 2Z2KA 4BQNA 3EGDB 3SICE 1BA2A 1A0OA 1YULA 5HKAA 4HOYA 1O94A 1WUKS 3IBYA 2A2ZA 4UU8A 1XT6A 2F1OA 4ZZ1A 3HL0A 5MHTA 2Z6AA 1J5XA 5ERXA 2CBZA 2BZSA 3KPVA 4IOLA 4EECA 4B46A 3G5TA 5G3ZA 3RC2A 3ZWXA 4A4DA 2BRUA 2XB2A 2EFEB 2CLIB 4YAUA 3T5PA 4C76A 3HCCA 3V34A 1KYYA 1J2UA 4L8LA 2BGWA 1SHKA 3H5IA 2RG7A 3EG5A 4TXMA 1A7UA 3HJUA 3UV6A 2MR6A 5E7IA 2HKIA 4ZYWA 4A8PA 5HIKA 1BSVA 2HFJA 1E63A 1G8YA 2YVQA 3HCPA 3PNPA 4D92A 4ZA2A 3N3BC 3GLGB 2VNIA 4FYIA 4GI7A 2C8VA 4LISA 2ZDQA 4BCDA 5I3ZA 5EE5B 3M34A 2VA9A 4BTVA 3EBLA 3X1MA 1NMZA 1GZ7A 2ZRJA 1PTJA 5J1TB 4B45A 1Y42X 2VT7A 2G5GX 3C45A 3HB1A 4KAJA 1TU3A 3V32A 4OUDB 4U6QA 4CBVA 1Z18A 1ZESA 3QP9A 5EQJB 3B3AA 4DMGA 3UAXA 1GWNA 1ZU5A 2DVMA 3N39C 2RCNA 5D7NA 4ARAA 4JYAB 3QPDA 2VPPA 1BDMA 3E8XA 1KAHA 4UQPA 5BXQC 1DEKA 1T26A 1U99A 4II2A 4LXIA 5KUTA 3G9XA 2A0UA 2VSFA 5ALZA 4ZAWA 2WWRA 3B12A 4JT2A 2Z2IA 5E3IA 1DX4A 1MX1A 2X0KA 3E27A 2IV3A 1NVFA 4XVRA 3KSRA 3E7FA 2I2DA 2Z1MA 1I6KA 1TC2A 1G5HA 1KS2A 3E0XA 1KU6A 5AFSA 5J1SB 1DWOA 4M46A 4QKQA 4UBKA 3KFLA 1F5NA 1L4BA 1FFBA 1WDMA 2NV2B 3CY6A 3K2EA 4OAPA 4OHXA 4GP7A 2CYCA 2IU4A 2JKYA 4B6JA 2PUCA 1XKTA 2CD9A 3FH0A 1SVUA 4L4RA 4OH7A 3H5NA 1W8DA 2GF9A 4QG7A 1XJ5A 4NV3A 4OP2A 2F55A 1F38A 2AZXA 4KDRA 1HI9A 2ZPAA 3CRNA 4PONA 4B35A 3R5HA 4M99A 3TUIC 3V4FA 1ZRHA 3PKJA 2OAQ1 1II8A 4MR9A 2UXBB 1TYCA 3ONDA 2YIVX 1YNOA 1K86A 2SNIE 3F5SA 1W29A 3AJEA 4HNQA 1TQDA 4X41A 1LPOA 3GZTB 4ZT7A 4BB0A 2IYEA 4LJ4A 4GX5A 2WD7B 3DR3A 2ZJ2A 3BRQA 4WN9A 4CIYA 4GVXA 2QTGA 4HH4A 3BSWA 2O1WA 1UBOS 2GNPA 1M8JA 2TSYB 4UHBA 3MJRA 2F1IA 4JAVC 3N75A 2HA5A 4DLZA 1GFWA 3K5HA 2HZBA 1SVMA 5JD6A 3KVYA 4O2AB 4EG5A 3JR3A 4CT0A 4KVAA 4EJMA 2XQFA 3AB3A 2QLNA 3MT7A 2GDJA 2VAMA 1GLNA 3DEHA 3LBNA 4F4IA 3ACBA 4XRGA 4CCSA 1V5EA 3STVA 4DIOA 1AT1A 4BWGA 3ZE8A 1I0ZA 3K4HA 4KN5A 1Q2UA 4TL8A 4HCJA 2QRVB 4ZVNA 3TCNA 1CY7A 2IZ6A 4EG0A 4ZKEA 3N5CA 2H2WA 3NIWA 3CUKA 1L9XA 1I3MA 4A2WA 2PEYA 2C2OA 1E7RA 1CEYA 5CT5A 2JLXA 3KZ1E 1ST3A 1MW9X 3F49S 2VNHA 4FNOA 1RXVA 3EWSA 5CM8B 2VHXA 4D7AA 1HEIA 4DKJA 2JJYA 5KSYA 4U7GA 3O83A 4QXOA 1E7SA 3AW8A 4A2CA 5JYBA 3O91A 2QJOA 5AWFC 1XTKA 1V1RB 2H1LA 3ONVA 4Z54A 4W5TA 1T1SA 4XQCA 1QCYA 3SP1A 3BXHA 2QORA 1GR0A 4RV5A 3DO8A 4CL3A 5TQJA 4EW6A 5IJZA 3IE1A 2PJDA 2UZ1B 3SFTA 1VYHA 1SG0A 4KSBA 1YHNA 2HBYA 4IIXA 2H51A 4N03A 3PENA 4NYIQ 5TV2A 3JZIA 1TJ5A 3OICA 3SQWA 2BAGA 4YJHB 5KNCH 3AX6A 4ZGWA 4U4AA 4UUMA 4N76A 2JGFA 4NU0A 3DDHA 3LAWA 4PYQA 3O8NA 2JIZD 4YMSA 5A9RA 4X92A 1KY3A 3S99A 3AP1A 3HB9A 5JAZA 1R7RA 4GBMA 2HY7A 2WV9A 4RZ3A 4IMRA 3VBCA 4UTPA 4JLPA 4CMIA 4YLYA 2A0KA 4YRLA 2JCGA 1WY7A 4JI3B 3PX3A 4W7HA 1YI0A 4DCSA 4E4RA 3NTUA 5DV9A 1CY2A 2I3DA 4QUIA 1W5FA 2I3AA 1XK6A 2IYRA 2XMBA 4C0HA 4XWKA 1TUIA 4W1RA 3UHPA 3K1AB 4O5OA 1FFXB 3TTXA 4BNLA 4DQLA 1T2VA 3KQWA 4H7KA 2VBIA 3NMUF 4L0CA 1T5TA 1EVEA 2I4OA 3HYTA 4ZEXA 3CZRA 5AVJA 1CS0A 2YXDA 4DYVA 3HM9A 5JU6A 1ZBQA 2B2NA 2AFHE 1GNVA 1WSDA 2HK8A 2GS9A 4BB5A 3R4CA 1JH8A 3AT1A 3L40A 5DMHA 4I1VA 2JAHA 2ZSKA 4WN3A 4NOJA 3K9CA 1O4WA 1JQDA 4UHCA 4Q9KA 3Q5EA 4E2ZA 4TOIA 1ABEA 3H5AA 1XHEA 1UM9B 2QE7A 3IJRA 3NBZC 3ML1A 3C98A 4KQGA 1PGJA 3ZBQA 3THXB 2VP5A 3EYWA 2CSXA 1PNOA 1NC3A 3CNQS 3IAS6 3PEWA 3CW2A 4NH0A 1WULS 2I54A 4MUMA 3R76A 4ENSA 1O95A 1QCZA 1TQ6A 4BAZA 1IWOA 3ECAA 3IPAA 1R18A 1OIWA 5B58T 4XM1A 3TQHA 2XEDA 3V2HA 3HKCA 4FFMA 3U0BA 1YV9A 4QBGB 1NUPA 1V7ZA 4QXMA 2NUTB 5CFRA 2BTQA 2I8LA 2NVOA 3IURA 4PZLA 1E7MA 1HXHA 1XQ1A 2FLKA 1LPNA 3WISA 1P0PA 2PX0A 4EGAA 3QKRA 4ALJA 4Y9SA 1A5SB 4I1YA 3SK0A 3OIUA 2GTHA 3GPLA 2P9HA 1GN9A 2R6FA 3BD8A 3D3WB 5IP5A 4M0KA 4RLQA 4UHDA 4DG8A 1LFDB 4JSTA 2WM3A 3ZZMA 5BWCA 3PDIA 4I6JA 1UOEA 1WB5A 4XVHA 3WL5A 5FOTA 3WAKA 2BR3A 4P8RA 2LTAA 3KYJB 1XNHA 4BU1A 4U5XA 2OXRA 4FYMA 1FU4A 5F78A 2Q1SA 3DBOB 3GFBA 5AICA 1NWCA 4DRZA 2QDXA 3ICOA 3F6SA 2KI5A 4ZCPA 4GLBA 1WPXA 1ZOLA 2NOAA 3QKTA 4HJXA 4MV9A 3RVDA 5CCXA 4TXLA 3ROTA 5FA6A 5IC4A 1MOQA 4O4HB 3T4XA 3T52A 5JXHA 621PA 5I9MA 4ZQCB 3VC3A 1TEHA 1E6MA 2HQRA 3EHDA 4PC1A 2OSVA 1UQUA 4F96A 3SHOA 1DSSG 4YMVA 4DJDC 3TRJA 2ATXA 1L7MA 1J00A 3NHUA 4MV5A 3FBTA 2D0IA 3VYVA 5ES3A 3TZHA 3QMMA 1AXRA 4ALMA 2QW1A 1EQAA 2R0QC 3PWZA 1H0RA 1T2FA 2HJVA 4FWIB 3V4LA 1TTTA 2I9KA 1DC6A 1P0IA 1QRTA 2ACKA 1QZTA 3PIRA 1ZK0A 1U6KA 5JNSA 3IAS1 4JL6A 5L7TA 2BKUA 4ALIA 2QM8A 2O2JA 4LRWA 1YRBA 5I9TA 3MTAA 2CJPA 2YH2A 1Z0AA 3H6GA 1CQZA 1KH2A 3O8OB 3G79A 5E6UA 3THYA 5C31A 3DKRA 4YMLA 2NYAA 1H22A 2B69A 4LCBA 1PV1A 4JU8A 3IERA 4NC9A 4B85A 2B20A 1EUDB 1ZRNA 3ENKA 1JEDA 1NV8A 1EWRA 5F5LA 1WKVA 3KOXA 1EA7A 4NQRA 5FNZA 3HK2A 2JIDA 2WSBA 3S28A 2YRFA 4I3GA 4Z1MA 1FPMA 1U2DC 4TL7A 4ND1A 1JDBB 4MLZA 1QGYA 1SURA 3UJAA 4Q1BA 3C1OA 5C4MA 5JQGA 4YUVA 2ZE5A 1Z2OX 3LVFO 4QU9A 3EPRA 1XCLA 3Q2KA 1QO9A 1UADA 3ZY5A 1DWUA 5SY9A 3FNIA 2YXNA 3AJRA 4QQKA 5HKKA 3J80A 1RWOA 2XWQA 2WKPA 4I1SA 4YMGA 3BGDA 3AXSA 2A3NA 3NHAA 1GR1A 4NZZA 4RANA 2Z83A 5KVCA 1P6QA 3K9GA 1JJFA 5CIWA 4YLGA 5A5FA 2O19A 3R5XA 3V42A 2H85A 3HA2A 1VL2A 3UH0A 3Q72A 4G5GA 5JSHA 3EZLA 2FVXA 2XMCA 3DVAB 3BRWA 1Q6ZA 1HTTA 1PZNA 3WKAA 1RABA 2P2ZA 3KXIA 1C0EA 1RZ3A 5GIOE 3LT1A 4HEQA 1AOXA 1R4MA 4FINA 1CEEA 1A9QA 1VSTA 3WNVA 1U11A 2GZ2A 2CKMA 2IU3A 2PS3A 2VDVE 3DUWA 3K72B 1L7BA 1WP4A 1ZVQA 2RDMA 2W8BA 2D1TA 1B4DA 1L7OA 1V43A 3VQTA 3K70B 1UBFA 1XG5A 2FV8A 4H0CA 5AKJA 3KLBA 4KQIA 3FGNA 3VYRB 3O38A 4A03A 1YA6A 4DIKA 1FSPA 1OYVA 2OYRA 1RU3A 1YQ9A 3R3WA 2IBSA 2WJAA 1WUYA 1VJTA 4BUZA 1NPYA 2HUNA 1T1RA 1ZSNA 1WUIS 4EJSC 4CKEB 1Y48E 1FYEA 1JLRA 3N2LA 1BXKA 2FR0A 4ZI7A 1SHUX 4CUZA 1J7JA 4ZYYA 4YCLA 4LZAA 2WTMA 3AIIA 2VDWA 3MJEA 5EC8A 1R8XA 4YJFA 5E6RA 1MJNA 5EXSA 3R7AA 4RMJA 3ZHYA 1DEOA 2PCJA 3A7EA 3P0IA 1E3QA 4NIMA 4R31A 4UKDA 3A1VA 2ATEA 4GRDA 3S5UA 3VO8A 4BPBA 1IHPA 4M8KA 1D04A 2D1RA 4NU5A 4XWAA 3NP7A 3WSVA 3AUAA 2RE8A 1EJ2A 4EA6A 4BX2A 4Q4JA 1Z2EA 3UJ3X 3E2PA 4A26A 3QQ5A 1D4ZA 2FCAA 4WLVA 3E8SA 1T5IA 2QVLA 4KH1A 1N4AA 4EKIA 5K4GA 2NP6A 3QE4A 4CUKA 3BHNA 3V4PB 3ZU4A 3STHA 3H84A 2A14A 2ISCA 1KOFA 4UTXA 4ZANA 4KVGA 3CHYA 5E4TA 5IM5A 4CF3A 3JWPA 2QENA 3SCZA 3SVZA 5I9IA 5JR3A 4RPCA 3CVXA 1J8MF 1BE1A 3RS0A 4YQYA 1TCAA 3PNQA 2CNLA 1GQ2A 1QF9A 1X8JA 2J67A 3FTNA 1CEQA 3DONA 3SN6A 4DQXA 1TNDA 1MHPA 2AK2A 2I99A 2RB5A 3PT5A 1O0SA 2D5LA 2C61A 4EW1A 2EFCB 2VCYA 1UZLA 3KD2A 4IX1A 3D5TA 1QFYA 3HYNA 4ETNA 2FMUA 1ISSA 1KMHA 2RJNA 3DE7X 3VJKA 1PEKE 5KNLA 3FAZA 3TNFA 3WIEA 4B3IA 5IM4A 1ES9A 2AUMA 2P5YA 2QI9C 2EFJA 4ALKA 3RWMB 1I7LA 4I55B 1JLMA 2M9MA 1R8JA 1V26A 2J6BA 3JQGA 1J9GA 3EDQA 2HXSA 1OXTA 1KP3A 2YMMA 5FUBA 2WJ6A 4KHZA 1U1CA 1MQ8B 1R0WA 2O9JA 1G7TA 3AG6A 3R6GA 3FCOA 2JARA 2R8ZA 4H15A 4UU0A 3W05A 4LC1A 2FKAA 1TVCA 1TM4E 4R69A 3TOVA 3QXCA 3UAYA 1A7KA 1NVXQ 3LFHA 5CJJA 3GJYA 3WNQA 3UXYA 1TVMA 4QT4A 1QPBA 5A6SA 3A4YA 1KMMA 2VYVD 3G0OA 5LQMA 3CZAA 4LJ5A 3GJTA 4Z7QB 3OJCA 3DZDA 4QLBA 3DM9B 1JF8A 2C31A 4E5SA 4K9PA 4QYXA 1CDEA 5HX7A 1V8FA 3KUUA 2HC9A 5F2OA 2IYLD 4MDFA 4QHYA 3WWZA 4HDOB 2AVNA 4PC6A 1L5ZA 5IH3A 5BY2A 1UPUA 5P21A 3TLGA 5FLKA 2G09A 2W22A 3LYUA 4PQEA 5F1YA 3T94A 4HT3B 1Q0LA 2W2TA 3T9EA 4ASUA 3SHTA 3TFWA 1SOAA 1B0ZA 2Z2JA 2ZUVA 1ESCA 4YLEA 5A06A 3E1GA 3I1IA 4NOKA 3DCIA 1L8AA 4IKPA 3VC2A 2FSVC 3D1LA 4HH0A 1N3IA 5EJ9A 1DBQA 4AP9A 4ZYTA 2FR8C 1PNQA 2E6KA 3OCZA 2A5FA 4K46A 1TZCA 4RYDA 1YXMA 4RY2A 1XTQA 5EP3A 4QDOA 5CD9A 2QTTA 4Y3UA 3MUOA 1ISGA 1E2LA 1TF2A 3NC0C 2QQ0A 3IALA 2WSMA 5IBCA 5LP6C 4DEYA 4X95A 1AMOA 4DV2B 3I04M 1FQJA 3OQPA 1W0KD 1EGVB 4U0KA 3RU2A 1SZPA 2R8EA 1QYWA 3ZYZA 1G5PA 1DEAA 4J4HA 2F4NA 3RWOA 4MGIR 2JGDB 1SU8A 5EWJA 1HTBA 5A3VA 3CEAA 4OX9Y 3A4IA 3KOWA 4W9RA 4BEVA 1GT91 4DR2B 4PLHA 5DX1A 2BGNA 3DTNA 3H0KA 5JNRA 3TQSA 3N28A 4C01A 1RHKA 2G0AA 1RP7A 5EJ7A 1P1FA 1Q1BA 3Q9NA 2FF7A 1USUA 2EIHA 4RDXA 4ZQGA 4X1IA 1Q5PA 4YMWA 5CTAA 3QX9A 5CHYA 5IEJA 1Z82A 4TS3A 4C0AC 3SPXA 1YZUA 5LR6A 3L1VA 4X63A 2RHMA 2QXUA 1O3YA 4H1HA 4DC9A 1X7DA 4KPEC 3QGMA 2C3PA 4X6XA 5EE1A 3EH1A 5HXAA 2Q8NA 4QBFA 4F7WA 3NONA 2WY2D 3HN6A 4PIMA 2PNFA 2HJGA 4YCCA 1ZVVA 3UV3A 3QOXA 4GR9A 1SBZA 5B2EA 4F4CA 1VZ2A 4RIEA 5EZYA 3CBQA 3UJPA 4G0MA 1S96A 2QVYX 2YDYA 4RIGA 1HUQA 3VR3A 5AK6A 3BILA 5GONA 3U39A 5K6TA 1T6XA 2R47A 3OM1A 3OO1A 2OXTA 2JLYA 4BFZA 3QLUC 5EKUA 4BQSA 2Q6LA 4JUBA 2GAAA 1QGAA 4AG5A 3L7CA 3BWBA 4B76A 1CDOA 4Z49A 4IH1A 4AY3A 1ZZEA 4MW7A 3ZGVA 3PDWA 2QUIA 4YUAA 3K0SA 1BH6A 2AQIA 3TEFA 3B82A 3MMZA 5CX1A 5JTUA 4RIHA 4ER7A 4X6LA 2ZI5A 2D1SA 3H9GA 3DWGA 3FTEA 1EFRA 2QRHA 2WU4A 5IYZF 2OBNA 3ORHA 4UXJA 4EATA 5EXEA 1I9GA 3W3AA 3E9YA 2WTUA 4OK3A 1X42A 1SBIA 2MJLA 3EA5A 3JVIA 2VHCA 4N4AA 4O1HA 3SIRA 5KHAA 5BV0A 2EQAA 3EGIA 4BNFA 4P98A 1W25A 2YVLA 3KDSE 1KJZA 3NASA 3PLNA 4LMAA 1T2AA 4TT3D 5J63A 1B16A 3ROEA 3LY7A 3OSZA 4I08A 4OJNA 3OESA 1NA5A 3ZDEA 1D2MA 4YJKA 3T9BA 3VOSA 1LTKA 5T41A 3T1HB 3BCHA 1AD2A 3T3HA 3HUTA 1CC1S 2ZI6A 2P6PA 3T7IA 1E3WA 2P78A 2PMDA 1MVOA 4X85A 1UT8A 4B31A 4EITA 3MWDA 1YCFA 1GPLA 2EBFX 3ACDA 3DTVB 4QNMA 5DHSA 1FCJA 3CKLA 4AF8A 1U0BB 2G77B 4X97A 4PCUA 1CUZA 2ZP1A 4PX3A 4UM9B 2PS1A 3LL4A 1G21A 1B3BA 1IZZA 1QVZA 3L8EA 2O1EA 3W8RA 1F14A 1S2LA 1I3OA 4F1JA 1J2RA 2OP0A 3N8GA 4MCHA 4WKBA 2VP0A 1RI2A 5BW6B 5CW2A 1FS6A 4IJ6A 3G7SA 3H2SA 4RMHA 3WYNA 1U90A 1XNJA 4OREX 2FWJA 3TRIA 4D4GA 3K2IA 4F1WA 3P9KA 4Y2JA 4DV5B 1NJ8A 2F3RA 3B38A 3EA4A 4N9WA 2E4ZA 1WW2A 3Q6MA 2G0TA 2DM6A 5K8CA 2CLOB 3ZY4A 4FLEA 3K8YA 4I4LA 1YA8A 1BWSA 2GEJA 3FPFA 4GLJA 3CLHA 1OX6A 2QGZA 2C4HA 3D8UA 3R3YA 4RSHA 4QNRA 4YS6A 4ZODA 5HKOA 5DLQC 4EHAA 3EDCA 4QGFA 3SZUA 1Z34A 3BOSA 5H59A 4BGIA 2VTKA 3I9NA 3ASUA 3PQFA 1I2AA 3PRKE 5EIBC 3DHVA 4BU0A 3BFPA 3UB2A 4MWDA 3T7JA 1FBNA 1HURA 2UVDA 2DG2A 4FS8A 1ZD2P 4AB1A 3AWIA 4C7MA 5CBKA 2AG6A 1VKHA 2GPYA 3N2GA 4QARA 3ZD8A 3ZCSA 1USIA 4H59A 2C58A 4LHEA 4ZV4A 4CV3A 1JTEA 1K4MA 3O3MB 2XTAA 3A14A 3PJFA 1MD9A 2FP3A 4O59O 1VPDA 4Q7EA 1U2RA 1JS1X 1WPGA 2ZUDA 3CTPA 5CX4A 1UBUS 3GVHA 3D6JA 1OH5A 1NUAA 2VEDA 3P27A 5J59A 2YHIA 1A5AB 2Z5LA 3SEAA 2G8LA 1UBEA 5IBPA 5TIIA 1WXHA 4LDQA 5B7QA 1E4OA 3LJKA 1B8UA 1WSAA 4MGYR 5TVGA 4U9UA 5LUBA 2IXGA 3IAAA 2Y77A 1NVVQ 2GKSA 1SD2A 3JYLA 5ICCA 1QIJA 2JFYA 2WAXA 3L0DA 1KVQA 2XGJA 3GR6A 2DSNA 4HZUA 4L75A 2QD1A 1L5MA 4XUEA 5HDBB 1BZYA 3ZZ0A 4AN4A 4RVHA 2VTBA 3NHJA 4YV7A 1IJFA 2WHRA 2ZWOA 4DIBA 1N34B 2MHCA 2A5JA 3SZGA 3WLLA 1F06A 2KSQA 1QO7A 3CEPB 1T9ZA 4U39A 1UWCA 3DAGA 3DLPX 3EK2A 3FCXA 2CNBA 2EQBA 2EX1A 2IOHA 1SO8A 2Q45A 3GJ5A 4YRRA 2IUTA 3ZCXA 3FWPA 2GBPA 1S89A 1L8LA 2BKEA 2DYKA 2QG9A 2EG5A 3A9VA 3QI2A 1H4VB 3UQZA 4AROA 4XLLA 1Y8QB 2C8JA 1YZVA 1Z25A 4QEDA 3QUCA 1RI3A 3EJ6A 4J7UA 2BFBB 3FFTA 2YRWA 4M1WA 4R1NA 4I9GA 1E2PA 3UB4A 5JNWA 3SFZA 1I36A 1GDDA 1TFUA 4JEIA 3SZ3A 1REQA 1TQ4A 4LCJA 2ZRIA 4MJXA 1U8YA 2NN3C 2QRZA 3L7LA 4PQGA 3RRNA 4X20B 1GU1A 1TMYA 1THZA 1RTTA 2YZ2A 3ITDA 4CZ2A 3COWA 1MJHA 4HAWA 4L85A 3TR6A 3U37A 3F74A 4XR4A 5AW1A 1X38A 3I83A 1YRQA 2Z4TA 1VP3A 4IIFA 4XCVA 2GPJA 2OAP1 2RHLA 5FOWA 4NECA 4CL0A 5MFPA 2BGGA 2WIGA 4MX8A 3ZN2A 1JLLB 3QENA 1UJCA 3PVCA 1LWNA 3Q7RA 4XARA 4GEKA 1AZSC 3ZE2B 4C4XA 2G63A 2B30A 5BNWA 2ZR9A 3UG7A 4GPD1 1ZA2A 3IVRA 3E9DA 1E0SA 1GTZA 3QFFA 1QB7A 1WCXA 2VO1A 1F6WA 2QJWA 3KSUA 3OPVA 4LBZA 1RMTA 2NU9A 3ETLA 4WNAB 3TLJA 5BN1A 1RYDA 2YR0A 2NZJA 1UXOA 2VJDA 2HD4A 2NGRA 4HMPA 1M2EA 1VTKA 3G5LA 3KEMA 4HPJB 1T2DA 3PEYA 3VC1A 4HRAA 3NHLA 2TRSB 2PZFA 1LBHA 2V6IA 3W2EA 3VX4A 2OSBA 1UANA 1ST2A 3F9IA 5C80A 1QDEA 3NAQA 3WA6A 2FN7A 5HIAA 4DY6A 3TTSA 2DFKB 3HI4A 3ZXIA 3CMCO 1OYYA 1OZGA 3QXSA 1KHTA 1NXWA 2VAWA 3VU9B 2ZI4A 2R8RA 821PA 1N5KA 4RD1A 2LGJA 4R2JA 1TD9A 1GKUB 3FM9A 5JDCC 2FCRA 5GZ6A 2EGHA 1WNTA 4ND3A 2RGRA 1IHOA 4R7TA 3LOUA 1GNTA 1XJWA 4EYGA 1OBCA 2O7VA 1K3TA 4N3NA 1UDXA 2FTKE 2E49A 2GHTA 2R86A 4PN3A 1Z63A 2H9IA 4MPRA 1JAHA 1WX1A 1E18A 3ETEA 3MOSA 3O8BA 4FX5A 1L1EA 4JLNA 5FL7A 3TL6A 2LR0A 3NAZA 5B2FA 3R3HA 2BMVA 1SCJA 1K0FA 1IXSB 3FI9A 4FHDA 1JZSA 2GYWA 5SYAA 4B71A 3UWPA 2G88A 4YFVA 1MZPA 3CVYA 1XDGA 2Q5IA 3ZXSA 4BB6A 2H0RA 3FUTA 1IJBA 1G3RA 1OFGA 4IG9A 4EABA 1R0YA 5K3AA 3TB6A 1N6LA 3WDLA 1UAAA 1KOJA 1Z0KA 3ETNA 3G13A 4V1CB 2HM7A 5ED4A 1TKBA 5K3FA 1DHRA 1IRXA 2ZUBA 1VYUA 4H7PA 3HLTA 4CM6A 5BN4A 1U9IA 1JTVA 3A28A 3R3VA 3FKSD 1I2MA 1MVLA 4ZCLA 5FBHA 5IAOA 1ZAYA 3K0FB 1QR2A 4MYHA 1JEQA 3GT7A 4OGLA 3K35A 4JLDA 5BNIA 2Y2VA 2VZ9A 1YL6A 3GG9A 1Y1KE 3MS2A 5K0EA 3W9UA 4LX0A 4WK6A 4WVLA 2R68A 4JASB 4DDTA 4M1SA 3AF6A 4PY2A 1MOSA 2OB2A 1M6VA 4XJTA 3RFUA 2SECE 2PGDA 4DTCA 2WJIA 3PYMA 1POXA 2Y1KA 1F2TA 1HL3A 3OM9A 4YRCA 1SA0A 2OCAA 1NAIA 3FY4A 3OA2A 4DARA 1KKLA 3RE1A 4ZQBA 2QN9A 1H2XA 1BX0A 5I7AA 3KQMA 2XAAA 3EMBA 4K9DA 2UVPB 2W2OA 3MWLA 3OFNA 1IBMB 3HKDA 1G21E 2TYSB 4H6WA 1ISPA 5J3JA 4DMUB 4PG5A 5CD1A 1WAMA 4LFCB 2P9FA 1XP5A 1A7AA 3MBIA 4IIBA 1RBYA 4G84A 3OJ0A 2ZXFA 3I76A 5FEUA 1CYDA 2HSWA 4K26A 4LJKA 4KQJA 5HOEA 4O2LA 1C7EA 2D4HA 4GM0A 5ALKA 5JASA 5MN4A 1J0XO 1E8DA 4BMCA 2BHSA 3A9TA 4KQCA 5DTMA 2Q6TA 3BRSA 4LE2A 5JW6A 5FD8A 5HPYB 2CMDA 5EI5A 2X58A 1V3TA 4C05A 1DRUA 2GX6A 5E2AA 2IW3A 1CZUA 1AVTA 4NENB 2C5BA 4X84A 4Q16A 4E08A 1NRWA 1SKUA 2XCUA 3B1VA 3HWRA 5JWRA 3OX4A 1MG5A 2VJCA 1XAJA 3U31A 4AYXA 3G5AA 1UBLS 1X13A 2V03A 2VTDA 5ALLA 3TZ6A 1C41A 4LRYA 3SNHA 4ENUA 1Z75A 3RUCA 3USES 4LFBB 4UHHA 1OXSC 5TQ2B 2QP9X 2ONKA 4R2XA 5GGXA 1ZCJA 3TG2A 1NN1A 1M2NA 1NF3A 2YOFA 2JD0A 2XVAA 3EOBI 4XH9B 4EVIA 4JT4A 1Y98A 3RJTA 2GEFA 1HYBA 1MPXA 2PLFA 3UT6A 1BEUB 3DYVA 3QPCA 3I01M 3MM4A 2X9QA 1ZVJA 1NBMD 3GT3A 4UXHA 1W88A 1WQ4A 2IODA 3L1KA 2IX3A 4QAQA 4XFJA 4D9MA 1IVNA 1L3BA 2GBLC 2Y1XA 3LKDA 4AKGA 1PBTA 4JP8A 4EPXA 3BT7A 1H2WA 5JBNA 1TPZA 4Y6LA 1QK3A 1AJEA 4YRSA 4AQDA 1NOKA 1U5CA 2AD5A 1QZXA 5JD4A 1YR6A 3UMVA 1KZ6A 2GAFA 2MMGA 4NFSA 4XQEA 1LBQA 1QRAA 4TXHA 3N58A 2HU2A 3GFRA 5FFFA 2XECA 4MV3A 2XMQA 1GILA 5KS2A 1X7YA 3Q8MA 5AW9A 5AM1A 1X74A 1WP9A 4CEHA 5C8YA 2VNSA 3KJFA 1QIEA 2PSSA 2Y1GA 1C30B 2R8YA 4P93A 3KU1A 2QR2A 5GY7A 1ORHA 2CL5A 1HNNA 3F8TA 5EMLA 5F1KA 1FP2A 4B40A 2WJGA 3L4BA 4QOJA 521PA 4TTPA 2QUAA 3HL4A 3O2QB 2IGTA 4FHGA 5AJZA 3TW4A 4UD6A 2XADA 1C7FA 4JCCA 4N1AA 3EX7C 4GOLD 1W93A 3U19A 3UFBA 5BOSA 1G8GA 3T3GA 1E69A 1ID1A 4PPGA 2QBYA 2OFWA 2P41A 3OIGA 2V9PA 2E4XA 2B37A 2X76A 3ET5A 2FPXA 5FNVF 4DLRA 4EHFA 1I7NA 5IMSA 2NP7A 2C3MA 5AYVA 4BMSA 1N9KA 2ORWA 4G67A 4QVIA 5FO1A 4BP8A 1T13A 2WM9B 1HDOA 1RWPA 1VZ3A 3ETCA 3R3ZA 1K3FA 1LW6E 1IG3A 1P2BA 3N0XA 3W3ZB 2BTOA 4FYHA 1NVKA 2P7HA 3CF0A 3PEFA 1UDCA 1LY1A 1AB6A 2RFLA 5J4LA 2CXNA 3EFBA 4TUYA 1YQXA 4BLQA 2O8CA 3L8FA 5BYKA 3SZRA 3EGXB 4XSVA 2V7GA 3NBMA 3F6EX 1I1QB 4BBZA 4NE2A 2BP7A 4BDTA 4YV2A 1Z17A 2RHOA 2ZAGA 4L72A 4PO1A 2MR5A 1EB9A 2WIDA 1QVAA 4NATA 3EIOA 3WRYC 3C4VA 4MQFB 3O8RA 4JX9A 5AXDA 3URMA 1E9FA 3VKGA 3L0IB 3WGYA 2LKDA 3I30X 2HBZA 3V9AA 4ON9A 5SY6A 4C29A 3P5BA 3A1SA 3D2LA 3FSGA 5EYPB 1EWYA 4RVDA 2DUWA 1LUAA 4HDSA 4TLDA 3AVYA 4K6MA 2PV7A 3DE2X 1F8FA 1PJ3A 1W2GA 2VVTA 2WJJA 4P0PB 3LX5A 5KYWB 3HN7A 3NORA 2YNMD 5CIYA 5AK4A 2CJFA 3FE2A 4HB0A 4BN4A 1U7OA 3B36A 1XMXA 2C54A 4U7HA 2QAGB 3BICA 3ZE1B 5HZGA 2GBIA 1CYEA 3QKWA 4HQFA 3R5KA 1Y8RB 1J97A 4JUFA 4TZTA 1FYVA 5DWDA 3WIDA 4NFYA 3L7AA 3QKSB 4IGEA 1FP1D 3Q5DA 2JKZA 2WSYB 1YJ8A 1PR6A 3A4MA 2OVBA 2FEPA 2Y1FA 3E2IA 3MWGA 1CQJB 4FCVA 3OEYA 4M83A 4TTVA 5FWYB 3T61A 2X8BA 5JJ5A 2OBYA 2PL5A 5JFOA 2F4VB 4V0LA 3U7FB 2GJ4A 3DEJA 1PUIA 1SXJD 4MGZR 4QHTA 3P26A 3WOHA 1WKCA 1DTSA 3DOOA 4EI7A 1IZ9A 3B3QA 1Q17A 3HCFA 3S2FA 5LWHA