3STWA

Crystal structure of tomato methylketone synthase i complexed with 2-tridecanone
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
258
structure length
258
Chain Sequence
FVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDHVTMMSKPQQLFTTLLSIANKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylketone synthase 1
publication title Emergent Decarboxylase Activity and Attenuation of alpha/beta-Hydrolase Activity during the Evolution of Methylketone Biosynthesis in Tomato.
pubmed doi rcsb
source organism Lycopersicon hirsutum f. glabratum
molecule tags Hydrolase
total genus 88
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3stwA00
3TEJA 3FBWA 5AI5A 7YASA 4DMFA 2J3DA 4QDOA 4OU4A 5IH7A 1QO9A 2PUHA 2XMGA 3H2HA 5CT9A 1MJ5A 1SC9A 1SOMA 3R3UA 4M0FA 3M81A 2O7VA 1ZD2P 4JYPA 4BE4A 3PICA 4DM7A 1BN6A 2H7XA 1XZCA 2HL6A 2PU7A 1XZEA 4OU5A 2WHPB 3C5VA 2XUPA 5ALSA 5ALPA 2ROQA 3HXKA 5ALYA 4X90A 1CUDA 3HZOA 1Y37A 4MYDA 4H18A 1XKLA 4EY5A 4D9JA 2X8BA 1XZMA 2XLBA 1ODTC 1CLEA 5K3AA 5K3EA 2OCGA 5LZ4A 2V96A 4AQDA 1QIMA 1E5TA 2BAGA 1JJFA 2QM0A 3GFFA 1F0PA 1ETHA 1TIBA 1CUFA 5K3CA 1QIGA 3FNBA 2JBWA 3N2ZB 3WKDA 4XVCA 5I9IA 2H7CA 1Z68A 4U2BA 4C88A 2ONCA 3ICWA 1QONA 4LXHA 3FVTA 5K3DA 3FYUA 3FCXA 3G8YA 1E8NA 4CIBA 2GYWA 2Y1KA 5DYYA 2DHEA 4HAIA 4OYLA 1ISPA 5AH0A 3HEAA 2HA7A 3WWCA 3R3ZA 2GYUA 3A2NA 3I1IA 1CIJA 4QA9A 1VXOA 5AJHA 4BRZA 1IVYA 4E46A 3WK6A 4GW3A 2XUHA 3C6YA 3HABA 5ALEA 2HIHA 1YA4A 4JNCA 2ZSIA 1A7UA 2ZSHA 4BB0A 5ALMA 2JGFA 2ZYHA 3RK4A 5HF8A 1XRQA 2JF0A 3WIOA 4XX1A 5AKLA 2Y6VA 4PW0A 1FFCA 1ZOIA 1C7IA 3LIIA 2UZ0A 1EX9A 5CH5A 2WIKA 4GECA 4G8BA 1YASA 1BRTA 1KU6A 4UFNA 1HDEA 1AURA 2OQIA 3FWHA 2G5TA 3PE6A 2PSHA 3E4DA 1MNAA 4AN1A 2H1IA 3F8SA 2FJPA 2VTVA 4J3JA 1EDDA 3WWOA 1HKHA 2Z3ZA 1TCCA 2HA4A 4F21A 3KDAA 5AIAA 4EB0A 4I19A 5BWCA 1QIKA 2CKMA 1WOMA 1FFDA 2BUCA 2XMSA 3EQ8A 1ZD5A 3O95A 3QZUA 4LKOA 4BAZA 2HFKA 3DYIA 5AK5A 3DOIA 1R1DA 2ECFA 1OXMA 4XJVA 3NOXA 2QJWA 1XZKA 5FXMA 1MPXA 2XDWA 2WUGA 4J0KA 3W04A 5JARA 2BUAA 4LXIA 2XE4A 4P9NA 1BCSA 1YAJA 5FPPA 3GA7A 3CCCA 2HRQA 4CCYA 4OB6A 4DNPA 4AO8A 4G4IA 5JYCA 3E1GA 1IUOA 2HFJA 3B5EA 3WL8A 1SFRA 5ALDA 4UHCA 4M0EA 2C0QA 4C4YA 1JKMA 1XLVA 2WJ6A 4W1SA 1K63A 2HDWA 5CH3A 2XQKA 1B6GA 1Q0RA 1F8UA 4N5HX 2WIDA 1JFRA 2CJPA 4Y2SA 5CW2A 2BKLA 1HQDA 1TK3A 2QRUA 1H22A 2RHWA 4I4CA 5LZ2A 3QYJA 5FUMA 3SK0A 5ALIA 5JAOA 3EIOA 2WJ4A 5AM1A 4AO6A 5HKAA 3C6BA 3G02A 4N8DA 5EGNA 2O7RA 1UK8A 4P08A 2YASA 5LZ8A 1J1IA 2D5LA 2QMQA 3U1TA 3B12A 3G9ZA 4FOLA 3W06A 4N8EA 1USWA 1N5MA 5SYMA 2VQ6A 4J0JA 1AX9A 2WSLA 3DNMA 4J0GA 2JGMA 2XMCA 4H7EA 2EDCA 4QNNA 3C87A 4DGQA 3I2JA 3EF3A 5LKRA 4G5XA 1UK7A 4WFKA 1YR2A 3D59A 2CEKA 5AKJA 4BDTA 4FMPA 1QFSA 1CUZA 1ZD4A 1P0MA 5HQ3A 5AI0A 3WK8A 1M33A 5C8XA 1EHYA 4C4ZA 1PV1A 2WUFA 4EZIA 1WB4A 2HU5A 1EA5A 2EEPA 1QZ3A 1XZJA 5CURA 2VEOA 4BP9A 5JIBA 2ES4A 3PI6A 2J4CA 3ESDA 2J4FA 5IKXA 4PNZA 3OURA 1VA5A 3RLIA 1MN6A 5E4YA 4H35A 4X6XA 1VXRA 4KE8A 1J07A 4X85A 5I8PA 5LP1A 2VJAA 2PKYX 1FJ2A 1H2WA 4UHEA 2RI6A 4RNCA 3IA2A 5ALNA 2IIVA 2HU7A 5AI6A 3WYNA 1WPXA 1YS1X 2R11A 1H2XA 3KD2A 4BVJA 1RWQA 3DD5A 1H23A 5AO9A 4DLNA 1XFDA 1U2EA 2WFLB 1R4ZA 1TAHA 3MVEA 1XZHA 3V1NA 1JU4A 4KE7A 4Q3OA 4H7FA 3FYUC 1XLWA 2PSEA 2VT7A 2XUJA 1CUSA 1HPLA 5JZ9A 5ALWA 3SX4A 3WK4A 3V1KA 1YCDA 4QDZA 3RKSA 1A8QA 1LBSA 1MX5A 5EIAA 1ZIYA 4ZWNA 2HADA 1UXOA 1UKAA 1AQLA 4QLAA 1XZLA 2OXEA 3IVMA 2JGKA 5JADA 5AOCA 5EHNA 3D5EA 2X76A 3EBLA 3H18A 3QITA 4X00A 2H9YA 2XB6A 4E14A 1S8OA 2CUTA 4B9EA 2VJDA 4JUIA 1UOPA 2FJ0A 2VF2A 1CUEA 1PFQA 1XRRA 2I3ZA 3G9UA 3QPDA 2GZRA 2PSFA 1X70A 4KYVA 3FLBA 2C5FA 4DNOA 1L7RA 2WTNA 1DWOA 2XMDA 3JW8A 1IZ7A 3WKCA 1O6GA 4KJXA 1J06A 4OYYA 2CB9A 3KWJA 5KWJA 3QMMA 3IB3A 4C01A 1WB6A 4QDXA 3H2KA 4HZGA 4ETWA 1T4MA 3MUOA 1QIIA 1VKHA 5SYNA 1CUAA 5E4JA 5JD5A 1E3QA 2O2HA 3DYVA 3V1LA 3STYA 1EH5A 2QOEA 5AK4A 1QIDA 5D3ZA 2PSJA 3STWA 4W1QA 1ACJA 3A2LA 2WG2A 3WA6A 1EK2A 4Q3LA 1XZFA 1VE6A 2IITA 1AC5A 1HBJA 1BU8A 2BCEA 2DFPA 1OCEA 3OG9A 4BTVA 4BCDA 4C87A 5C7YA 5AP9A 2XUGA 1TQHA 3G0BA 2AJDA 1BROA 4X92A 3NGMA 2W22A 4X95A 4WJLA 2V97A 5CT6A 2V98A 2ZJFA 5HKBA 2XQGA 5KWIA 4C6HA 4BTLA 1ZI6A 5J3JA 4BYMA 5AK3A 1A88A 3SC2A 4MEBA 2WM2A 1EVQA 1JI3A 4B82A 5AM2A 2WHPA 3BDVA 1R9MA 1W1IA 3OC0A 4JH0A 5CMLA 1CQZA 2FUKA 5AM0A 3ZPXA 4ARBA 1C4XA 4BZZA 1LZKA 1CUGA 4G4JA 5K3BA 5A7HA 2OG1A 3IURA 1ZD3A 2C5GA 2RIPA 5CT4A 3WI7A 2XQFA 4DTCA 3H1AA 2AXEA 1WM1A 1ODCA 3GZJA 5LYYA 5EHQA 2HHAA 4QWWA 4FWBA 3VJLA 2OCLA 2WIJA 3O9MA 5AI4A 2WIGA 5A7GA 4FLEA 3A70A 4H0CA 5EIHA 1AUOA 2VAVA 4FBLA 2DQZA 3JYHA 2XI4A 1IUNA 1ACLA 1ORVA 1F6WA 3D0KA 3QMWA 3KSRA 4PSDA 3F9CA 5D3KA 3VJKA 4UHDA 1E8MA 5C81A 4U2GA 1H2YA 1CUWA 1QO7A 1TCAA 1SCKA 5KBYA 4HVTA 2QR5A 4MJ3A 2C0PA 1LPSA 5DNVA 1RYYA 1W52X 1W76A 3R3WA 3ZLUA 4DYHA 4AMYA 1EB9A 4LYDA 1MU0A 1E89A 1E66A 4KACA 4MWTA 3O0DA 1ODSA 4BP8A 4U2CA 4Y2RA 1LBTA 1YB6A 3ZV7A 1K4YA 3G0CA 2ORYA 3ZLTA 4H7DA 1GQRA 2P8SA 2B61A 4RGYA 2Q0XA 4CCWA 1UK9A 1XZAA 3I2HA 1JMYA 4B81A 4AB1A 3H04A 3NUZA 5EIEA 4Q05A 1VLQA 4PF1A 3HACA 3IUJA 1Q83A 4QWMA 1XKTA 3CCBA 3VVMA 2PL5A 3BJMA 4X94A 1XROA 2RAUA 1EDEA 4Q3KA 4QDTA 2Y2VA 3HC7A 1UKBA 2BUBA 3V48A 4QDUA 3KXPA 4G4GA 3AIOA 5CTAA 4AMZA 2XUKA 4OPMA 4DNFA 4U2DA 4OD0A 5A6VA 3I6YA 5ALQA 1MNQA 3T4UA 3GELA 2DHDA 4ARAA 2XUQA 3C6ZA 3JWEA 3QPAA 4ROTA 1FSSA 1N8SA 1SCIA 5ALKA 2OCKA 4DSZA 3U0VA 2WU3A 3FVRA 4Y2PA 2AJBA 1T2NA 4UHHA 1VA4A 3VJMA 3WWEA 2XUIA 1MO2A 5JAHA 1YSCA 3Q0TA 3AZQA 2Y6UA 1JT2A 4IQ4A 1P0PA 1QLWA 4ZRDA 3G9TA 3WKBA 1XQWA 4FDMA 2GBFA 2PPLA 3BDIA 3V9AA 4TGLA 5K3FB 5LZ9A 1YA8A 3FLAA 1LPOA 5DNWA 3PF8A 5ALLA 4Y2VA 5IVDA 4X6YA 1JJIA 1P0QA 5YASA 2Z5GA 4LYEA 4YX9A 3BJRA 3FOBA 4PSUA 1EB8A 4YPVA 5AKYA 4H7HA 2JEYA 4L9AA 4B9AA 4UBKA 1LGYA 1A8SA 5CRIA 4KAJA 1UKCA 1GPLA 2H7YA 1L7QA 2B4KA 3WLAA 4ZV7A 2AJLI 1CRLA 2GZSA 4GWLA 3CXUA 2DHCA 3WKAA 1DT3A 3W2TA 3G0IA 1KU0A 4BC0A 2ZJ6A 4MQLA 4F0JA 1MAAA 3DL4A 3R40A 5T4FA 4MXDA 1ZGCA 2HA0A 4BC1A 1CUXA 5T4EA 4U2EA 1DQYA 5AI9A 3WJ1A 4J0IA 5ALHA 2XMZA 4PSCA 3KOOA 5CT5A 3O4JA 2XUDA 1EVEA 1AGYA 4L3WA 2OGZA 5A71A 1DU4A 3DCNA 5LLSA 2C58A 5JZBA 5ALRA 3F97A 3D2CA 2BJHA 2DCMA 4NMWA 5AIBA 5ISMA 3F96A 2WFMA 3R41A 3DL7A 1MAHA 3WL5A 3AFIA 3ZI7A 1EINA 4B6GA 1DX4A 3NWOA 1ZGBA 4QZVA 4UBIA 2B9VA 2QKYA 5AM3A 3ILSA 5JATA 4CI9A 2WFLA 3DS8A 3VDXA 2J3QA 3C45A 5IVHA 2LIPA 4M0MA 1QFMA 3SWWA 3IBTA 2PM8A 1D07A 1K6EA 4DNQA 4EY4A 1VE7A 2WUDA 4BDSA 5EFZA 2FX5A 3IUQA 3VXKA 5HFAA 4CIAA 1LPNA 4F5ZA 4RE6A 4XWGA 3IULA 1RP1A 3H17A 3OOSA 3AILA 1TRHA 3UUEA 2QXUA 2HM7A 2WTMA 4H7KA 1XZDA 2QVBA 4IO0A 1CFJA 3G0DA 2I3DA 2PX6A 5AKKA 2WHQA 1GXSA 5AKEA 1R9NA 3BF8A 1K5PA 1EXWA 3A2MA 1UOOA 5ALTA 4K6HA 5T4BA 1YB7A 3WZLA 2AJ8A 4OSEA 4RPCA 2Z8XA 2QZPA 2HU8A 1ORWA 2OAEA 1BEZA 2VATA 5AKGA 4BAGA 2JIDA 5DTJA 1LPMA 4O08A 2QXTA 4B80A 2ZYRA 1CUBA 3AJAA 1MX9A 3GBSA 5AICA 5EI5A 4DIUA 1UT6A 3STVA 3EQ9A 4ZV9A 3BE8A 4L72A 5DLPA 1LLFA 3LIPA 4AZ0A 3C43A 1WCYA 2NW6A 3G0GA 5E4TA 5BOVA 1O6FA 4GEGA 2OQVA 3GUUA 3FYTA 5DNUA 5FV4A 2WQZA 3AIMA 2XQJA 1IUPA 4QLOA 1GZ7A 4F60A 3C5WP 3AZPA 4EBBA 3ZWQA 3GROA 3R3XA 2V9ZA 3FCYA 1KEZA 1Y7HA 3A6ZA 1DWPA 5AKHA 1L7AA 3BIXA 3DOHA 3HI4A 2JGJA 5HFNA 4W1PA 3E3AA 3ESCA 3I2KA 1Y7IA 4XIIA 1VZ2A 1HL7A 2HRRA 2WHRA 4G9GA 3C8HA 6YASA 4PQEA 3VVLA 2Z3WA 1GKKA 3K9BA 5A62A 5FDFA 3STXA 5FP0A 5JAUA 4UHBA 4LIPD 2AJCA 5C8VA 3I2FA 4OB7A 3HLKA 1DTEA 3AIKA 3QVMA 4G1FA 3PUIA 3QMVA 4X93A 4GXNA 3WK7A 4V2IA 1CUUA 3R3YA 2QUBA 4CFSA 4OCZA 5CH8A 3RM3A 3VISA 4S0XA 3WKEA 4BVLA 3WL7A 4FTWA 4EUSA 4LHEA 1B41A 5AKXA 4MEAA 1BEEA 4X6UA 3O4GA 2OLEA 5FPQA 1F0NA 4FNGA 1BE0A 1BCRA 2CMFA 5ALOA 4N5IX 4DMKA 4C89A 3HJUA 3ANTA 3ZLVA 1LPAB 4HRYA 1WB5A 4WY5A 1WHSA 5K5EA 3G9XA 2HA2A 3AZOA 5CT8A 5ALFA 3F67A 5LKAA 1VZ3A 1N5RA 5ALXA 1QE3A 1GPKA 4G9EA 3MGAA 3DDUA 4E15A 4X91A 3W05A 3R3VA 1CUIA 2ACKA 4KRXA 4JEIA 1GKLA 3ESAA 1U8EA 3WJ2A 4Y9SA 5JALA 4FFWA 3TJMA 1ZIXA 2VSQA 1J2EA 5IVKA 1UWCA 1X2BA 5C8ZA 1ZI9A 2OGTA 5EHZA 4ZGBA 4MWSA 2QTBA 1QIFA 1LPPA 4EY7A 2HA6A 2GYVA 4NZZA 4B84A 5IVIA 4H7JA 3AUKA 5AK6A 4GI1A 3IUMA 1R50A 4Q1VA 2EDAA 4FLFA 3C6XA 1IMJA 2JEZA 4Y2XA 1QTIA 3I6ZA 4KE9A 2YXPX 2R8BA 3WWPA 3QH4A 3CN9A 1CQWA 5A2GA 1CUJA 1BN7A 2XMBA 4BCBA 4W63A 1DWQA 4Y2JA 4CG3A 4C4XA 3N0TA 2G4LA 4HS9A 4CG2A 5LZ7A 3WL6A 4A16A 1HLGA 3Q8WA 4K6GA 5DWDA 5HK9A 3DKRA 1FFEA 3ANSA 3LCRA 4WDQA 1G42A 1W6RA 2IX9A 2PVSA 2DR0A 4CG1A 3L1IA 1THGA 2VJCA 2VAXA 4WFIA 1VJ5A 4EY8A 1I6WA 4WDRA 3WMRA 3O4IA 5AM4A 2DQYA 4UFOA 3FLEA 5ALZA 3QBJA 4PO3X 1W4LA 4IHAA 5AOAA 1XZBA 4X3CA 4H7IA 1EK1A 1ZJ5A 4AX4A 4Q34A 3QPCA 4RE5A 1JMKC 2JGIA 4WFJA 4BAUA 3I1YA 1CVLA 4J0CA 4ZREA 2OPHA 1CUYA 4AN0A 5K3FA 4A23A 5FOQA 4IH4A 3MUNA 3V1MA 1G4HA 3D2BA 3DEAA 4EA6A 4BZWA 2WLSA 3PFCA 4X97A 5D7BA 3FAKA 3B3QA 5CXUA 4UPDA 4HTAA 4K2AA 3WQHA 2RGUA 5AOBA 4BE9A 1LNSA 2VT6A 3S8YA 5FRDA 1IZ8A 5EHXA 2GBGA 3FYUB 1OILA 1C7JA 4EHBA 3OM8A 3W9UA 3O4HA 3G7NA 2I03A 5ESRA 1QIJA 1CUHA 1QOZA 2X5XA 2XLCA 3C70A 3PF9A 3D4LA 2DSNA 3K2IA 4E11A 4Y2TA 3CN7A 3WA7A 3PDCA 2Y2UA 3VKFA 2BGRA 4NS4A 5ALVA 3I2IA 2QT9A 1U65A 4P92A 4Y2YA 3DLTA 4OUKX 5DYWA 1YS2X 1XQYA 1GQSA 3E0XA 4B85A 4X71A 3UUFA 5HCUA 5KREA 1UZAA 4FLMA 4YK7A 2JGLA 4INZA 3HYSA 4EY6A 4UHFA 5BV7A 5AI8A 2PSDA 5JD6A 3H19A 3WK9A 3OPMA 4DMHA 4GHWA 4X7BA 1EDBA 4H77A 4U2FA 1G5FA 4Y2UA 5CBKA 1EI9A 4Y7DA 1AZWA 2O2IA 3YASA 4YASA 1CR6A 2RONA 3WWDA 1THTA 4JYMA 5ALJA 3QM1A 2OGSA 1CV2A 3KWFA 4G8CA 1DT5A 1SCQA 2XUFA 1Q0ZA 2PU5A 3DKKA 3OTQA 2WILA 4FFVA 3H1BA 3X3HA 3FSGD 5LIPA 4PV7A 1DQZA 3BWXA 4UBMA 4DSAA 4FKBA 3LLCA 3TGLA 3WYDA 5ALUA 4CCYB 1GGVA 4AO7A 3EQ7A 3HRHA 5AKZA 2XUAA 4FNMA 2WFZA 4UFPA 5BWBA 4L0CA 2JGEA 2OCIA 4NVRA 3O9VA 3ED1A 4KAAA 1CUCA 4UUQA 1JU3A 5FKJA 4B0PA 3RARA 4BATA 4ZI5A 2K2QB 2WG0A 4MYSA 5AKIA 5HK8A 4K6KA 3D2AA 5HZGA 3STUA 1R3DA 2XQIA 4UBNA 3M3DA 4G8DA 1Q84A 1UFOA 4J03A 1CUVA 5F4ZA 2WIFA 3BXPA 1LZLA 5DTIA 1MTZA 1QIEA 4BVKA 4QE3A 1W75A 5A7FA 1K8QA 4N8SA 5AHXA 1XLUA 5FLKA 4Q82A 3K6KA 3D3NA 3BIWA 2E3JA 3TRDA 5DJ5A 1UOQA 4UBJA 5DYTA 1JJBA 3L1HA 5LZ5A 3C8DA 1H2ZA 4P93A 1XZGA 1ZJ4A 2VA9A 3AINA 1DX6A 5HF9A 4MQMA 4HXGA 1QJ4A 3DJYA 1VOTA 1GT6A 2W6CX 1XQXA 1TCBA 5H3HA 4GBGA 5CXXA 2O2GA 1YAHA 2WG1A 4A5SA 2XT0A 4KE6A 5E2IA 5HQ3B 5D6OA 4IH9A 2C7BA 3D7RA 2BGNA 2HA5A 1XRNA 2VJBA 2ZYIA 4GDMA 1NX9A 1QTRA 2CZQA 4LXGA 2XMRA 1QIHA 3LP5A 1CPYA 1QGED 3W9BA 3I2GA 3WK5A 2GBIA 2RHTA 3ESBA 1CEXA 1XRMA 4ZXFA 5ALGA 2C4HA 1G66A 2WJ3A 1XRLA 3S2ZA 5JD4A 4BCCA 4B83A 1WPRA 4FBMA 3M82A 4J7AA 1LPBB 4KAFA 4J0DA 2ZYSA 2XMQA 2Z8ZA 4KR0A 4J0HA 3F98A 4B7ZA 5T4HA 4DMCA 2I78A 3HSSA 3LS2A 1XQVA 4HXEB 4AXBA 2OAGA 1NU8A 5JAPA 4B0OA 4W1RA 1ZICA 4K5QA 4IH1A 3H0CA 4UBOA 1TKRA 1BS9A 3L1JA 1FFAA 2D0DA 2QUAA 1R88A 2YYSA 5HF5A 3H2IA 5AM5A 2PBLA 3T52A 4TPKA 3PUHA 1WHTA 4QEKA 1E8DA 3IIIA 2BFNA 2ACEA 4WCVA 4OB8A 4KRYA 4Z49A 2WKWA 3M83A 2XUOA 3H2JA 1DINA 3FSGA 3STTA 4BRSA 1GPNA 1MX1A 1AMNA 4BBZA 4HRXA 2WU4A 3R0VA 3I28A 2G63A 1ZI8A 3BL8A 4UBLA 3ICVA 3PFBA 4Y2QA 3BF7A 3I6MA 3DQZA 2ZJ7A 2CBGA 3P2MA 4I3FA 2PUJA 2G5PA 1P0IA 4ITVA 3UMJA 3WZMA 1XZIA 2WUEA 5HF6A 4TVKA 1U4NA 3H2GA 5I7UA 4HXFB 4WY8A 5JZSA 2QS9A 1MT3A 1A8UA 5JANA 4W9RA 4AZ3A 2HA3A 3IUNA 2YH2A 4GLBA 2B20A 2ZVDA 1XRPA 2QJRA 4FHZA 4KEAA 1X2EA 3IDAA 3WIBA 1UK6A 1PJAA 1N1MA 1AKNA 2GBCA 5JASA 1FFBA 1NU6A
chains in the Genus database with same CATH superfamily
4QRHA 1K7SN 1ZK4A 1UDXA 5JI2E 5EXEA 5KQGA 1FLNA 1LS6A 2NTVA 2I3GA 2ISSD 3EGVA 4QDOA 2IHZA 2J31A 2X13A 4B3DA 4UOEA 5EJEA 4LZZA 5A5EA 1SU4A 3OFSA 2UZ1B 2A57A 4IVNA 2PH1A 2BCJQ 5CT9A 4E6EA 1SC9A 1UQTA 3GOHA 2J9GA 4Z54A 5A1TA 4Q4JB 4Q48A 3OJEA 3UT5A 3QG1A 3T5GA 3ZNPA 3BXHA 4CMJA 1PVVA 5LXTF 2P30A 2GD6A 4IBOA 4EI8A 4C08A 1EFLA 2G36A 4QOSA 3FUXA 2MMGA 2ZK7A 5LN1A 4YIKA 1D6SA 1XP8A 2XVAA 4JYPA 3C5EA 1ODJA 1WXQA 1ZWKA 4HDKA 1PJ3A 1SB9A 2F1HA 3F5FA 4BE4A 1KO8A 2W8ZA 1M6EX 3ETEA 4HO1X 5IN4A 3LVRE 5DN6D 1BN6A 4ENRA 1F6BA 3I12A 1C1DA 3PXBA 2DG2A 2I7CA 2I99A 4BB6A 2BI8A 4F06A 3HUTA 2RGCA 3P5BA 4IAOA 3B2QA 3D8SA 5EJ2A 4WFQA 1S9DA 1RJWA 4WZBE 2ZOSA 1V3VA 5ALSA 5EKXA 2ENUA 2VBCA 4L28A 2Q5LA 2RHDA 3HXKA 4E21A 2HPHA 2YHSA 3PDWA 4X90A 4HXYA 2LR0A 4J1TC 3GT7A 4C21A 2WF5A 3ZOKA 2CZCA 3HZOA 4WBNF 1NRJB 5B55A 2V59A 1Y37A 1B16A 2YJ4A 4KQHA 3S3TA 5FAKA 2VRCD 4TWBA 5AXBA 1TLFA 3LCMA 4JELA 3MELA 2IPMA 1VPVA 3AVPA 1OROA 5D7NA 3RUPA 2BGUA 2P2SA 3T5BA 3GJYA 2Q07A 4MW0A 4C7XA 4MUYA 4DCGA 1NNLA 1L4NA 2OCGA 1PJ8A 2CLSA 3KBBA 3LQKA 3OOJA 1G6KA 3KJHA 3PR2B 4D8VA 1FP4A 2V96A 4HWRA 3USCS 1CQXA 2BAGA 2VHQA 5IKOA 4CT5A 4GOXA 5A1JA 1UJ2A 1GARA 4HQ0A 1P3DA 1KH3A 4HNQA 4TUYA 2C7QA 1J8MF 2QM0A 4YAIA 2Q29A 2V8BA 5PNTA 1DG1G 3SZOA 3V2IA 1ZMRA 3VTKA 4LNHA 3ZQ6A 3KHUA 2GPSA 3EVDA 3FRHA 3MMXA 3FNBA 5DP2A 5L3ZA 4LX8A 4RHXA 3CONA 1IRIA 3EARA 3TDMA 1ECLA 4K86A 4MUAA 3HCPA 4GBED 1GWNA 5BW8A 1FMTA 2H7CA 4GOND 3M6UA 3VH2A 3GXOA 4K9LA 2IFTA 2VT3A 5BOSA 2WB4A 4R40A 5TQVA 3ACDA 3TB4A 3DWFA 2O48X 1D2CA 1YBVA 1SA0B 4UAJA 4YJKA 4ENSA 1WTCA 4QHYA 3K5PA 4G5YA 4XPZA 3PQCA 1M8PA 2R68A 2K87A 1N5KA 3IP5A 3KVVA 5DBOA 3UF0A 4I1RA 1M75A 6REQA 1YJ8A 4QGAA 5DYYA 3KQWA 1MUUA 1WU7A 2UVPA 3T99A 3IP3A 1ZWLA 2AE1A 3K0FB 4ND1A 1L4BA 3T06B 3D6UA 3HV2A 4I8XA 1W30A 1AK9A 2JGRA 3UCXA 2EYQA 5A6SA 2GYUA 1UZUA 5K4HA 5KKNB 4MB2A 4Q9AA 5K6TA 3EZ7A 1CIJA 2JCSA 4OFWA 5H7XA 3O8BA 2B25A 2VPZA 4Z51A 4MWEA 2YQZA 3E58A 1IVYA 5CX1A 1XXLA 3R0XA 3WK6A 4E46A 1MCZA 2FCAA 1OFIA 4PZ9A 2ZQZA 3DV9A 3CM0A 4GLFA 3FB4A 1AUVA 4JNCA 3EPHA 1T2EA 3MILA 4RVOA 5IANA 3MJEA 1IRXA 4UNIA 1R18A 2G6BA 1UXIA 5ALMA 4CR6A 2CSXA 4JOBA 2UUPA 2PT9A 1QRAA 1Z4LA 5G1PA 3TRKA 3BH0A 5HF8A 3D31A 2SNIE 4NULA 1M1ZA 5HRUA 1WU8A 3AB8A 1SG0A 3UJ9A 4PGAA 3F2IA 3LNTA 5ESDA 3VV3A 1NP7A 3FWPA 4V3BA 3OUZA 4M9QA 1E2IA 2IXDA 3V33A 4EFLA 1VG9B 1DAIA 3I01M 1NYLA 5WRFA 1M6VA 3WIOA 1FC0A 1O8BA 3EVCA 3GLFA 4BZXA 3IFSA 2ZFUA 1AMUA 1ZMBA 3K73O 1OA0A 4DDMA 1B1CA 3DEHA 5AKLA 1YJ5A 2BFEB 2WAMA 2ZU0C 4ZPJA 4Z53A 2I6UA 2ZKIA 5AJXA 3LRTA 3WHPA 3ZCUA 4PW0A 4BO7A 4ENVA 4BVFA 4HATA 4M0CA 3FTFA 4IDHA 2EBUA 2IY9A 3MLEA 4PIMA 5LYJA 3WL4A 2C3MA 2FKAA 2WIKA 3OBIA 2R2AA 3GCWA 2G9ZA 1LNZA 1N4AA 3VPCA 2IPNA 4RYLA 1I33A 2A1UA 4UFNA 5REQB 1T26A 1U6JA 5TX7A 2QQEA 3GJ4A 3O84A 5F3WB 1FUEA 2XYGA 2Y05A 3GVPA 2QQFA 3PRYA 4EYKA 3K8OE 4KNVA 3UJCA 1HG0A 1PS8A 3TGPA 5E6RB 2QN9A 3NYIA 3OE4A 4IIFA 3FFAA 4DMMA 4EO9A 1L5HA 1YOBA 3W77A 4MQEA 3M33A 1HKHA 3QVUA 3WWOA 5LDHA 2HDOA 2Z3ZA 3NWPA 1TPYA 1P5ZB 2HA4A 4YRCA 1KEEB 4F21A 1C9YA 4ZOAA 4YT5A 3OFNA 4I19A 4HX2A 3B53X 3LW7A 3KVYA 4PAOA 1QIKA 3PWKA 4CRWB 2A9OA 2F43B 2P2LA 2PTGA 2JFXA 1U4SA 3GMSA 1TJPB 2BUCA 3RS7A 3HRIA 2FDXA 5DHTA 4F2HA 5KX5B 1YHZA 2CUKA 3QE4A 1J5XA 2ZR7A 1Y8RB 3QZUA 5J5CA 2IZ1A 2VXBA 3EEOA 2HYIC 4MUKA 3HADA 4YQZA 1CB0A 3LBIA 5EJIA 2ZRQA 4JSYA 4ASUA 5IEBA 5C37A 1HYGA 3ZHZA 3LWBA 2BKUA 4LWPA 4WCDA 2QJTA 1FDOA 4ZAGA 4IKOA 1RW4A 2NADA 3D81A 4RZUA 2X19A 3HYRA 2A3RA 3A4TA 3K4HA 5HS6A 5TE9A 3PHJA 3FHLA 4DQXA 1IG3A 3VHLB 1TKBA 2ZBGA 1XSEA 4P86A 2ZB4A 2IZ6A 2WUGA 3JQ9C 1SC6A 1Z2EA 3JQAA 1WA5A 4G25A 4JBWA 4N3BA 1CQPA 4RANA 4TKUB 3VU9A 1L1QA 4UOZA 5KNCH 5KNDA 1W25A 4C7KA 3U7JA 1NE7A 2ONYA 3IMGA 2PJDA 3LUKA 1KTVA 2PX5A 2FF7A 1BCSA 1GT91 1YAJA 4OJNA 4P9NA 5HIJA 1IPEA 4IFTA 3GA7A 3UT0A 4DW8A 1TUGA 3GVIA 4A82A 1U9ZA 4XUGB 1FRVA 5TDHA 2PX3A 1NHGA 4LJ4A 4OB6A 1G6OA 2RAFA 3KKLA 2FMTA 4OKNA 2QVCA 1RBYA 4CMIB 1BWQA 1KAQA 3H0EA 3B1YA 3E1GA 2A9RA 3DAHA 1Z0IA 2IPOA 2FQYA 4WEQA 5TS3A 4HFMA 3FZNA 1SAYA 2H1FA 1U5AA 4U2KA 3QYAA 1KSGA 4MINA 3H7AA 5EIXA 2J41A 1T4GA 4PPNA 2ZJAA 2J0UA 3IUBA 4DYVA 2HDWA 2Y1XA 2GS9A 4AFNA 4R9SA 1MB0A 2P11A 1ABEA 4GNRA 4HDNA 1JHMA 2Y27A 3JATB 5IPFA 3UKDA 1H4QA 4P4TA 5AVRA 2DOKA 4RQBA 1PI3A 1NE2A 3HPRA 3AF5A 2D1TA 4D45A 1JFRA 2CJPA 3HY3A 5GTDA 3VZDA 5KOJA 2Q6TA 3V8NA 1QRRA 2OM2A 1BSVA 3G2LA 5B4VA 2V55B 1QGUA 3PNSA 2KSQA 4BNUA 1G5PA 4Q4HA 3PC2A 3PPXA 1V26A 2G88A 3ONNA 4DA8A 2IZZA 1F4LA 3F90A 5FUVA 5LZ2A 3QYJA 5FUMA 1A4XA 5H1YA 3RJ5A 4JHXA 5JAOA 3D4PA 4WT7A 5ITWA 3ZCQA 1FX1A 2WJ4A 5AM1A 4DLXA 1U3TA 5HKOA 3I9JA 3G3EA 3ZWPA 1YQEA 1GKUB 4S3MA 2AX4A 2ZYDA 4AUEA 2VL7A 1DE0A 3C6BA 3LF1A 4C3UA 4G5QA 1J6UA 4DV3B 4EATA 1KYWA 1P61B 5DN6A 2FVXA 1OBOA 4PY2A 1HDOA 1Z56C 4IIBA 3R8CA 2IHKA 4HYTA 3MB8A 3FJYA 4GPZA 4MVJG 4MQUA 1Q5PA 4EX6A 3RADC 3BGOS 2CVFA 3TQOA 3B12A 3H9UA 1Z2DA 1E96A 2GK6A 5DM1A 2PQ0A 3UGJA 1VKRA 3MWKA 4LSMA 2ZBPA 1USWA 3QEMB 4N54A 1T36B 4WCFA 4D8TA 3L4BA 3PYLA 1US8B 3R23A 5KHOC 3FM9A 4AXXA 1K7YA 1E2FA 2G3YA 3HXPA 3OUTA 1ZKMA 1R8SA 1YKFA 3UMSA 5BNIA 1ZZGA 1BZYA 3FTDA 4IJMA 3DNMA 4J0GA 2VRCA 1Z6YA 3ESXA 4NF2A 2CNLA 5E4FA 4QUGA 5TF0A 4PPQA 1G8JA 2GRAA 3OPQA 4S24A 4JBIA 5H9VA 3ABSB 1X74A 4QNNA 1UODA 4ZD6A 3T34A 4DOMA 3I2JA 4M8KA 1O4WA 2W2LD 3EH1A 4YAJA 4QVIA 1IBLB 1MGOA 3VO2A 1H3NA 3LC0A 2ZW9A 5AVXA 1DEOA 1UFKA 2WQ7A 1UK7A 1V5EA 3FAZA 3K2QA 4UNSA 4WFKA 3JPYA 3ZVKA 4KFRA 4ZU3A 3MWDA 3IQHX 2VF4X 2I66A 2ZJYA 3QVTA 1M2VA 3RSZA 1YZHA 4ZYVA 3LDAA 4E5SA 4UZEA 1DJPA 4MDFA 4DMRA 3JWGA 5C8XA 1EHYA 2P9JA 1IN5A 1KKMA 2JFWA 1CR4A 4IV5A 5GJCA 1PV1A 2Q2QA 4YMHA 3N74A 3IAS1 1R8QA 3UV3A 2J3IA 1QX3A 2PRIA 4MIKA 4WECA 2IUTA 1KO4A 4KOAA 1WQ4A 4RHEA 3WGGA 3WAGA 3OCXA 4CNBA 3N86A 1CXZA 1NXWA 2YXDA 3ZK8A 1H1TA 1T8PA 2RJOA 2X1HA 1Z5PA 4M1OA 5CURA 5B53A 3NANA 1FW6A 2ADOA 4BP9A 4CLEA 2RAVA 3L8HA 4K6MA 4WXRA 4CMEA 3WAJA 5M7EA 5JIBA 4OGWA 4B31A 4CIWA 1ZUHA 1SXQA 1F17A 1F9AA 3MJVA 1ZD9A 3V7WA 4JV5B 3ZBTA 1TUIA 3IT0A 1D6MA 1PLKA 3ESDA 1U90A 1XWIA 3I04M 3OIWA 4LHXA 2Q3EA 1T4DA 2INGX 3CO0S 2J4FA 3IVCA 4PQRA 3NYQA 4JP8A 4PQFA 4RSRA 5BUSA 1H05A 4GZ5A 1MN6A 4YGXB 3SKYA 3ZCXA 1WX1A 5JZVA 5LOVF 1DKUA 1IN4A 1J07A 3HVRA 2X3FA 1KVUA 3BE5A 4B3RB 3AKZA 1N6IA 1NNSA 1QB7A 3SYRA 4M98A 5LP1A 3AF6A 3KXKA 4H1WA 1T0JB 1NSTA 1JDPA 1HDGO 4JBYA 2HF9A 2FZ4A 4P3XA 1FJ2A 1GQYA 1L5YA 3M1IA 3FCUB 2E5WA 3OCWA 4IIEA 1AKRA 5IXYA 3GFOA 1WPXA 4DJJA 1USGA 3KD2A 3THRA 2X2FA 2R7KA 4KLRA 5EHGA 1PZMA 5IM4A 4RCZA 1DXQA 2HQ1A 1V5GA 3HDYA 4BVJA 1RWQA 3D64A 4BYGA 2RG7A 3DE1X 3PQEA 4RLHA 5HFJA 4BUJA 3C3AA 4KN6A 5AVJA 1KYXA 3MQFA 4M7OA 2ORED 2O7SA 3C7AA 4GQIA 5EPEA 4E2XA 3MRVA 4MKXA 3E7FA 3ICOA 4UVEA 5JHHB 1SMKA 3JRNA 4C76A 2ZEJA 2VQSA 4H31A 2P7HA 4R0NA 4ZEOA 4QOIA 4BLUA 2AKYA 4QKQA 3EXHA 2I29A 1GL3A 3HN6A 4Q3OA 3KSBC 2C03A 4HNAA 3AESA 5IFLA 1YOVB 1ISIA 2QGFA 3L6DA 1A97A 3EC2A 4EF5A 5IYZA 1RHJA 3WR5A 5B37A 2GBLA 3VHXA 2VDQB 4EG1A 2EKQA 3C4QA 1TKCA 3O4RA 4P81A 3S7ZA 1ZM7A 5ALWA 4A91A 3NORA 3WK4A 3H6GA 3NDJA 2VHZA 1WDMA 3M5PA 4EEXA 5I9BA 4OIFA 1ZYUA 4EQ6B 1EVIA 1Z88A 3ZXXA 3OJXA 2PZKA 3H9CA 1ULSA 3AKEA 2GJKA 4REQA 4WGFA 4YC7A 3RKUA 4ZYLA 4NESA 4RKRA 3WMWA 3X2EA 9MHTA 1ZIYA 3ZV3A 4ZWNA 5FTNA 5AOVA 4OQXA 1RXCA 5F1PA 4HAZA 1JE1A 4HDRA 3JYPA 1V95A 2WD9A 3PUKA 1XZLA 3VR6D 5LBUA 4CIVA 4WASA 4XM2A 4GUDA 3BWMA 1XKXA 3TDNA 3C6KA 5AJZA 5BWCA 1U80A 4JEUA 2ZRJA 4QU5A 3H18A 3OZ7A 3PJEA 2H9YA 3SE7A 2PH3A 4KV7A 1ZH8A 1SRRA 4IGAA 2J3JA 4DXDA 1K8ZB 1GXSB 2P5SA 1FVFA 1I24A 1Z39A 3GJQA 1EDZA 2HLHA 5FH9A 4Z0NA 1LBQA 2VJDA 2EOAA 3GAAA 1E62A 3RRZA 5CIYA 2AQHA 3M1YA 3HLTA 4F56A 1T6YA 4P4SB 5GV7A 4JI8B 5FUWA 2EW1A 2ZBEA 1JKXA 4O4HF 4V0SA 3AJDA 3VFDA 1Y5IA 2H59A 1UC9A 3ONDA 3S2EA 2J3HA 4LY9A 5CLQA 4AS3A 5BN3B 3GZ4A 3WLOA 1D1QA 5CB4F 4P0QB 1Q91A 2J8ZA 5C8YA 4PHFA 1X70A 1XYGA 1QX4A 4FONA 3NKVA 3FUCA 2AF3C 1YL6A 3CINA 5EYPA 4MVJE 5BSMA 3T7EA 4YQFA 5KYYB 3QJGA 1ID8A 4WEOA 3C39A 2X8WA 2WWXA 1Y1PA 1Q20A 4O02B 4QBHA 2WTNA 1K97A 2ZPTX 3KUXA 4NC9A 3TRFA 4U7JA 2F8MA 2ZSUA 3TG2A 2PBRA 5ABPA 3ESQA 2JARA 3JW8A 3ROEA 1GCOA 1A04A 4J3NA 4KWTA 4KJXA 3QF4A 4TLCA 3Q6IA 1Q95A 2CB9A 2JGNA 2BFPA 3B52X 3CG4A 4CMAA 2OKCA 3OQPA 4J49A 1FQJA 3PJGA 2E55A 1ZM9A 3NM4A 3PHCA 4MUHA 1K3TA 3IB3A 3G82C 3QUCA 4MS1A 5LUBA 3PX7A 1MABB 2IYVA 3L4KA 5ECWA 4KREA 3N6XA 1N7JA 3RVNA 1VPTA 4J1NA 2IIBA 4HZGA 3TTYA 1M1YE 4O4IA 3RVSA 3OWHA 1DAMA 2WAXA 1DLIA 1QIIA 3R8XA 3JVUA 4NTZA 3AY0A 4LF5B 3CW8X 3LHIA 4TROA 4BV8A 4ZQGA 2V6MA 3PFIA 4GSLA 3IV7A 5JD5A 4X3OA 5KTTA 3IEPA 2QOEA 3R44A 2EWWA 3CE9A 1XXHE 2FEKA 5AK4A 4OOFA 5D3ZA 2PSJA 5JXIA 2O8EB 4EJ6A 1ACJA 2WG2A 1KP9A 2YQ4A 3WA6A 3GT4A 3NTVA 4NJEA 2JH3A 2BFBB 2C96A 3BT7A 2YWBA 5DLYA 4HWKA 2QL5A 1OLXB 1AC5A 1XF9A 1FYFA 2HZ7A 3AJRA 2OV8A 2Q4OA 2O2EA 3TLYA 1BU8A 4B3XA 2DFPA 2CLDX 3Q9SA 4IS2A 1G0OA 2RHGB 2FTKE 4ZQCB 1E7YA 3WNQA 3EQ6A 2REXB 2VJQA 1JB9A 1TU3A 2QYHA 2ZGVA 3AY6A 2XIQA 1HFEL 1B7GO 2ZCUA 1ZBQA 1QJCA 4E4YA 4R6XA 4X1KA 1KF0A 3L1KA 5EVCA 3KR0A 4JOCA 2FMHA 2HJVA 2YWFA 3G0BA 3KZXA 2AJDA 1BROA 4GZ6A 4F3NA 1ZU4A 1ORDA 3ICPA 4O59O 1B3RA 3MJRA 4RF5A 1Y1LA 1B0UA 4ND6A 3VNVA 1DBIA 1TZBA 1IEWA 1MJHA 2J07A 4PXAA 2V97A 5HWSA 5KTKA 4OAPA 1SQGA 2AC2A 2EKBA 2R6DA 2OHHA 2PR2A 4LQDA 2DBZA 2ZUBA 3QELB 1FXWA 1GYRA 2X58A 3KYIB 2W2LA 1DTSA 2ZUUA 1RJDA 3P9NA 4JP3A 1D6NA 4KN8A 4MIOA 1NPDA 2NGRA 5B3JA 5KWIA 1WTAA 1RAHA 5BP7A 4IJQA 1I01A 3SJBA 2MINA 5J3JA 4Z5XA 5GVRA 5FBVB 1XV5A 1Q22A 2Q1WA 2YN0A 3BXZA 3NATA 5AK3A 4BYMA 5BPFA 3SC2A 4TL6A 2VTEA 2WYVA 3G2OA 3LPCA 1ABBA 1EVQA 4E1VA 1EXNA 1Q6ZA 2JLAA 3KT8A 4RSHA 2WHPA 4CM4A 2PUGA 1R9MA 1JKIA 5DASA 1W1IA 3OC0A 3KV1A 1AA9A 3LX8A 4JH0A 5CMLA 5CP8A 4MCAA 5TQ2B 4YJ3A 2Q7DA 3T7AA 2H48A 3THXA 1ZJ6A 1C9KA 5AW2A 2HQSA 1JG6A 2X4LA 4R9NA 1YR1A 4D8XA 3DB1A 1VLLA 2PO7A 1C4XA 4PN3A 1ZJZA 1ZCZA 2MTBA 4TN1A 3R9XB 4US1R 4PFJA 3VC3A 3BWYA 4RGQA 4XW2A 2D1RA 3RANA 5BQXA 5DVZA 3WIVA 4GS5A 2DBRA 3A6KA 5B1IA 1WZNA 4CODB 1Z4MA 1FU8A 1MIHA 4WKCA 5SZKB 1JG3A 4E6PA 3HVHA 5A7HA 4Z3DA 3BULA 4PBTA 3TYXA 1XAHA 1ZD3A 2P5YA 2VWHA 3DBHB 4FZRA 1X7GA 4B6JA 3T8YA 2REQA 2M1ZA 5D5PA 2IDMA 1KMIY 2J5RA 1YQWA 3HZZA 1SUPA 3UYKA 1ZJWA 2WYUA 5AFSA 4BMCA 2PGXA 3D0QA 1P9OA 5BQ5A 3IR5A 3VBCA 1J0XO 3HBNA 3SU8A 1C9MA 1ODCA 3GD5A 2NUPA 4PZUA 3RROA 5LYYA 1PSDA 3OOHA 5EMNA 3T9DA 1RM5A 4EPVA 1ZN7A 4INOA 1E9BA 2WVAA 4RLFA 4DQUA 4F1KA 3KJZA 2IPAB 3PCRB 4FWBA 4I4TA 4MW9A 1J21A 1QVVA 4QWWA 5ILQA 1KWGA 1JFSA 3B2NA 1U2DC 5FUXA 2GZMA 2QN6A 3O9MA 1BDMA 4OA8A 5I7AA 1ZC3A 2X7JA 1JPUA 1GPAA 1IOVA 1SR8A 1ZSYA 4ARVA 1L5FA 3FPHA 4DQVA 3IILA 1SHUX 2J0EA 4AULA 2Z83A 1AG9A 1XK6A 1ZK1A 4E3ZA 3QX7A 1NJGA 4DR1B 3ZCTA 3TW4A 3DFZA 2C20A 1BS1A 5D3QA 1G3IA 1X3SA 4YJDA 2X6TA 4F2PA 4LF9B 1NA5A 4G1UC 3ANNA 4MUIA 1GTZA 3DJFA 3PS9A 4HSEA 3B3FA 4OP2A 5KDOA 3JYHA 2YN4A 1OQAA 4C7OB 2R97A 1F1JA 4HG2A 2QIPA 4XOUA 1SELA 1NSFA 4C4SA 1GL7A 4V39A 3GUHA 3ZE6A 4IEFB 3GZNA 3WYBA 1ST3A 2H5LA 1F6WA 4QYTA 4IYRA 3QRWA 2XGOA 1KDOA 4PYIA 2RK4A 4NPHA 1QC5A 3KR9A 3IYLW 3VKWA 3KSRA 3NNSA 4EZBA 4ZK6A 1Q0UA 4LK3A 2F9LA 1CJSA 1HH4A 1HT1E 3F9CA 8LDHA 3C0KA 5DBIA 4MQ5A 3BHMA 5KOYA 2MYPA 1UZMA 1T8WA 2CBZA 3LBYA 1XAIA 2Q5CA 2M1XA 4RO0A 4DLRA 5JQGB 1H2YA 3TOZA 3LHDA 3MWJA 1QO7A 4FU0A 4NYMQ 1L1EA 3DFMA 1P2DA 2GAOA 2BFFB 2H7VA 3OSZA 1OD6A 1NG1A 3PGLA 4PZDA 4R2IA 4LZAA 4WKGA 3WYFA 3DLHA 2V58A 2MSKA 3G0HA 1J00A 3NASA 4GPAA 5FAXA 3VR6A 421PA 5KBYA 2OZPA 3JQ7A 3OZAA 4CVNA 3V7NA 4FYMA 2PLAA 3SFZA 4TMWA 2J45A 1N2OA 1AVTA 4U4AA 1LPSA 4A8JA 3N8HA 4BX8A 4Q0MA 2WWGA 4NFHA 3DTTA 4HKTA 4G1MB 1FFYA 1NW9B 5CEEA 1MU0A 3A1CA 1HUQA 1L8AA 3L1VA 4H4CA 4KACA 4OO3A 3KLPX 4TQGA 1ODSA 4ALMA 1LBTA 1YB6A 2CDBA 3LY5A 2G9UA 3J81A 3ZV7A 3TX6A 5H70A 1KERA 3FGOA 1TM7E 2A8YA 4RY8A 3SFTA 1A69A 4NNOA 2G0AA 4H7DA 5CPFA 4C0JA 2WKRA 2BMFA 1GQRA 1SUIA 2LIVA 1VMAA 5FT9A 2B61A 2EFHB 2VO1A 2AC7A 2YWXA 4HEA1 4MPDA 4RGYA 3RUIA 2Q4RA 4BRWA 3DXFA 1OXVA 3I2HA 4MZXA 1JMYA 4IDBA 3R3SA 4KUGA 3AR9A 3U60B 3UWOA 4OJYA 1G8GA 3NB0A 4NBUA 4U7HA 5IH3A 1K9VF 1NW5A 2PZMA 3TLBA 3GMIA 4YT8A 3FNIA 5TR9A 4XOIA 5KJCA 4RV4A 5EIEA 1Z83A 4POAA 4Q05A 2EP7A 3GJ8A 5IJ0B 1U2SA 4RXTA 2ZM5A 5CYGA 3ITNA 2JFUA 4XGIA 1HMPA 2BHNA 3T3DA 4QSMA 3DTYA 4X1IA 2O6HA 5KYUA 4G0NA 3TK1A 4DR5B 4CEIA 4W4TA 3CCBA 1YTLA 3VOAA 2FMUA 5KMGA 1JIIA 4I6JA 1GQFA 1OU0A 3E9NA 4Q6BA 3T3PB 1PL6A 3FIJA 4JFRA 4PO1A 1KAMA 4Y1RB 1MA3A 1E1LA 1H94A 1PIWA 1S9HA 1QF7A 3FDZA 4JB3A 4JYCA 4F6LA 3JVEA 5B5SA 2W6ZA 1CK4A 3AHIA 3MTEA 3NYWA 1VRCA 1R6UA 4J9UE 2ZXUA 4GOLD 1EVZA 1PWXA 3OLVA 4QTUB 2YC4C 3HC7A 4LDRA 2RSLA 1QYIA 4TYNA 1R00A 2F67A 4UDNA 2QX6A 4R1QA 3ONWA 1EFCA 1NUTA 4E7OA 2B83A 1BWRA 1IDN1 4OTZA 2WM8A 3MZ0A 4RORA 4S1PA 3UAZA 2X8LA 1WXWA 3Q87B 5HS4A 2I22A 2PE5A 2PAFA 3KKKA 2Q9CA 2WC1A 2QK4A 4G0PA 3OC6A 1NPYA 2UV8A 4PS1A 5C8DA 1KHTA 1T2AA 1PQUA 4O4JB 3AI2A 4Y67A 2XKAA 1PL8A 3TXYA 4ZYYA 3SBDA 3ER6A 3BWEA 3BB1A 3HJGA 1HOXA 4U2DA 2OSVA 1ZL0A 2GNOA 3F5SA 1J2JA 1E9AA 1Y4ZA 4UE2A 1YRHA 5ALQA 1J7KA 4DA9A 2FSUA 5KTOA 1KH2A 1WCIA 4DDTA 3FNRA 3QFSA 4MP6A 1RQLA 1O58A 2OO3A 3C3BA 3RSQA 3P2IA 4BKQA 4EX7A 4OEHA 3MS7A 3QXGA 4O8ZA 3QPAA 4XQGA 1RXYA 1N8SA 1QNLA 1SCIA 5ALKA 4UREA 4X66B 4XM1A 3R7SA 4BVBA 3RH0A 4IY1A 4UTXA 3E9ZA 2W2KA 2VPIA 3EGCA 3UK0A 3A37A 3FVRA 3IAUA 1OXUA 1UJBA 2FW6A 2GEFA 1RKBA 2VP2A 3H5IA 4S1NA 1R0KA 3IMFA 1SY7A 3JZFA 1NI5A 3TZKA 4JLWA 3WWEA 1UWKA 2B35A 4GI5A 1H2HA 3REOA 1RQRA 1YSCA 2C29D 2GAFA 3PNOA 4J7XA 5H0IA 3SHQA 2TYSB 1JT2A 3LVQE 3QVVA 1KMHB 1P0PA 1RMYA 4KODA 2JL1A 4ZRDA 3S2SA 3TTXA 4A6DA 5CFOA 2FV8A 4RS4A 3WKBA 1XQWA 4NYJQ 1VG1A 5KNBH 2AGVA 5C46F 2GBFA 4KG7A 4Y6PA 3VMFA 1QVAA 5KYVA 3V9AA 3BDIA 5K3FB 1O95C 1PT7A 1UMBB 4TMFA 3RBZA 4B6SA 4BU1A 2HQOA 2NUTB 1PSZA 1UQUA 2P65A 1XTJA 3LT0A 2IA5A 5HDQA 2PYZA 1SM4A 3TCKA 4OATA 3WO1A 4KVGA 4EECA 3GAFA 3DHWC 5DULA 2Z56A 4HDQB 3ZKAA 4EABA 3TIXB 4F4HA 1IVSA 5CDFE 5BR7A 2O2SA 1K6XA 1GTG1 1MV8A 3LT1A 2QE7D 1OASA 1TUBB 3DT6A 3P19A 1RC0A 1V1RB 1NVDA 3HS3A 4V24A 3KQVA 4E5NA 2DETA 1GQ2A 4M49A 1MH1A 2DLCX 1QDLB 3QVSA 1ZHOA 4FYIA 2O8NA 2O2ZA 4JJZA 2ZWOA 1RAIA 3N6VA 3M6FA 5LDGA 1YK1A 2IL1A 1E4OA 5LA6B 4A5OA 4OI1A 4EW2A 1K86A 1IG0A 2YIMA 2HSGA 2HWWA 3BAZA 1DTWA 1UBJS 2QZ4A 5AKYA 1Y0BA 3WFJA 2JEYA 1XEWX 4UBKA 4DEVA 2AZDA 3VC2A 3WHIA 2Q62A 4U5QA 5CRIA 5FPSA 4EBFA 4QYWA 4ZJYA 2VCYA 5F2KA 1L7QA 3UA4A 4WA7A 2B4KA 1TQ8A 4O1HA 4QQKA 5I9TA 3ZKWB 3HFSA 1M72A 2I7DA 1BW9B 2ECPA 2GZSA 1D0SA 1HGXA 3CXUA 3P9CA 2DHCA 3U4AA 2FGJA 5LQKA 5EIOA 1DT3A 2HEGA 4I66A 1G21A 1CQIA 2C99A 3D3WA 1KU0A 2FSSA 5HNKA 2PGOA 2AI1A 3L92A 2O7QA 4B76A 2O5CA 3ENNA 5T4FA 3PKJA 1Y82A 4WBNB 1VM6A 1BHJA 2CHEA 3G7UA 4MXDA 1G5TA 1DJNA 1YBHA 1ZGCA 3EASA 3E9RA 4O2BB 3WTCA 5JBNA 2WPDD 2J0QA 5KINB 1QMGA 2HMUA 4U2EA 3JASB 5LB2A 3NHMA 4TT8A 3WJ1A 1Z38A 1WVMA 5ALHA 1M6WA 3LX5A 1ZO8A 1QH9A 2PYDA 4UVHA 2CMDA 2ZBUA 2IU6A 5G0TA 4QATA 3BZUA 5CGZA 4DDHA 1T29A 1T5BA 3F2VA 3GG9A 3CF4G 3P2JA 3UZUA 3W7AA 3QWIA 4C6TB 1LJ8A 3E7XA 2YW9A 3OE5A 5EZYA 5F4BA 2ODPA 1PLJA 2OWEA 4MW2A 2QWXA 4Q3CA 5MN4A 2PUAA 1EVEA 1ENYA 4ZOEA 1QU2A 2I6SA 3BBLA 3KL2A 3QW4B 2OGZA 3BA1A 5CFMA 5A71A 3DCNA 3D54D 1GD1O 5LP6F 4QUHA 1KMNA 3GARA 5KYWB 3MRTA 1KAGA 5ALRA 1EHIA 4NMWA 5AIBA 1NVUQ 3P9KA 1GHTA 1P6UA 2REOA 2PT7A 3FY4A 5A0FA 4RTNA 4NABA 2QUKA 4NYIQ 3DD1A 4PS0A 3ZGLA 3A4LA 2C9BA 3GJXC 1Z34A 1BX0A 3AFIA 1L3CA 1ZH2A 3LOUA 3LOPA 4GLOA 4IUDS 1WVIA 4RMJA 1NLYA 4C43A 2I2FA 5J4YA 3H65A 1P1RA 2OQ2A 3A6HA 3ZI7A 4F3RA 2FPIB 3KVRA 1JECA 4B6GA 1KFJB 5C53B 3TLGA 2OMKA 1T8YA 4M55A 3KHSA 1LDBA 2XCTB 3Q3EA 5CDYA 1VGRA 3C3CA 4DV4B 1FFGA 2B9VA 2ZWAA 3LV8A 2IEYA 5AM3A 5I7EA 5E6SA 3I45A 3UXHA 2ZR0A 1DCFA 3ILSA 1WKVA 5JATA 4CI9A 1GAXA 2EQAA 3FF4A 2R1TA 1GIAA 1FW8A 3M4ZA 4LGMA 3L9WA 4M83A 4G56A 3GFSA 2P3OA 1K27A 2VJLA 4XUDA 3SXUB 2YJ5A 2J3QA 4JI5B 3VDXA 4TWZA 5TPZD 4CM3A 3SD7A 5KOIA 1F14A 1E2HA 2LIPA 2QSZA 4IX1A 4L75A 1RQGA 4YAWA 2BRUA 4OMUA 4RHUA 2D62A 2PANA 4AURA 2VH2A 3CX3A 1QBGA 3IBTA 3E5MA 2PM8A 5FHQA 1H2FA 2G1JA 1W9MA 3JQBA 3Q72A 3AK4A 5H80A 4EY4A 3ZZ0A 1HTBA 3PB3A 2C31A 4GMXA 4NR0A 3H9GA 3PRJA 3SFVA 3LLVA 5GJVC 3UUGA 2P5UA 4P4GA 4CF5A 3TWOA 1M6NA 2RHBA 3DV0B 2J7KA 5E7MA 2KW5A 3L4EA 4ER6A 3K6SB 3U31A 5D85A 2HXGA 1DXYA 4Z8XA 2Q5HA 3MSXA 3I2YX 2NSLA 1LSSA 1VE3A 2IV2X 3VSDA 5J2TB 4PAQA 3V2HA 1QP0A 3RJZA 3AILA 3CISA 2YHUA 3UUEA 1TA4A 3OP4A 5G0VA 5FO0A 2RGNC 4C4AA 2XKKA 1HNNA 2DPHA 2NPOA 5DCWA 1Q1QA 3B13B 3EW9A 3EVZA 2WTMA 4M9ZA 2AFIB 3DE0X 1QHHB 2JJQA 2CXPA 1HURA 2EZ4A 2QVBA 1MVLA 2P79A 4MR7A 4N5NA 1UFRA 1GL6A 5EPOA 4PWZA 1FF9A 3H2YA 5JJLA 3BK1A 3PVCA 4AMGA 2J7PD 2CJWA 4NZPA 5AKKA 5FLYA 4JC8A 3PA8A 2WHQA 3KZ1E 2IYTA 1P3Y1 2AG6A 2GTIA 2Y66A 1KDYA 3PUWA 2CLEB 5I7RA 1WD7A 3EXG2 3M49A 3KPJA 2R0QC 2Q1TA 2AEFA 2LZ0A 1R9NA 3IE2A 3LFUA 4WW0A 2PXHA 3RWMB 1EFTA 1RFLA 1P7WA 3GA5A 4HSGA 4DA6A 1NN3A 1PR3A 2E48A 1KFKB 3AEKB 4I1PA 3GFRA 3BUSA 3CEMA 1MRZA 2YQ5A 3GVHA 3HJCA 2VJMB 3CX4A 4JQOA 3FBGA 5CVUA 1YVRA 4NE7A 1UOOA 1KY2A 1WRBA 2WJPA 3AKDA 5ALTA 1ABFA 5SICE 1V1JA 2IHNA 1PT5A 2JCBA 3OT5A 1RC1A 2AW5A 3AW9A 1G17A 1EFVA 1HT3A 1SH7A 1G8YA 2XBLA 2Z5FA 3F5QA 4C30A 1JFFA 4G85A 4IILA 4D7AA 1U7HA 5AVTA 4OP3A 5C7OO 2P6OA 4RVGA 1ZKDA 2CMGA 2PD6A 1J90A 2A94A 4XIGS 4C07A 2OAEA 1WMBA 4WBXC 4U7GA 6ADHA 1UZNA 1BEZA 2IGBA 2VATA 2R00A 3PQ4A 4LYHA 1BDHA 3SDZA 1OA1A 2IPXA 3CGWA 2C1ZA 4BAGA 1RVV1 1M7GA 1SC3A 2CXTA 4IYJA 1T1SA 3QA3E 4REOA 1WDWB 4B5KA 4GIBA 1ZCFA 3TD2A 1E79D 3GFTA 2LXNA 2WPNA 2QXTA 3EAGA 2DPXA 3DQQA 2ERXA 3LFTA 2ZYRA 1PK8A 1YC5A 3NTLA 2J9RA 5EJ8A 5FWXA 4GMHA 1E69A 1G98A 5D1NA 3IRVA 3NV7A 4B87A 3KALA 3WG9A 3BE8A 3TUJC 2QU7A 1T9KA 1DBRA 1DFHA 3I37X 4L72A 2AWNA 3FI9A 3GGPA 1Z35A 4OUDB 5DLPA 1LLFA 4X1OA 4ERNA 4RJLA 4EG7A 1JNYA 3C43A 2NP6A 5JQWA 5EWJB 1CJMA 4R5MA 5CA0A 5C9ZA 2R87A 4XAQA 4HWPA 3WNDA 2OZLA 1WXGA 2PS1A 4MQ6A 4REMA 1R16A 2OP0A 2P1ZA 2TRSB 1W93A 2DR3A 5LFAA 4FFOA 3QIAA 4QFDA 2IYOA 4N9WA 4QOGA 3UFXA 5AW6A 2YUTA 5LLDA 3ELBA 2ANBA 5DZSA 1SHTX 2B1JA 4C3ZA 5ELMA 4CKEB 2V8OA 3MM4A 4K8RB 1PJSA 4U7WA 1DC3A 3VSBA 1N92A 2Z2JA 2VNJA 5DNUA 1QHEA 2PR7A 4X20A 2Q3LA 2OV1A 2QE7A 2HBRA 2HF7A 2I3AA 3W90A 1QYRA 2R7AA 3TOCA 1IOZA 3F6EX 3C5WP 1G5RA 4EBBA 5JC1A 1NUSA 3A9VA 4ZICA 3BILA 3DWGA 2V9ZA 3A1NA 3CJQA 1YR3A 1PNTA 1X80B 2WLTA 1JSXA 3LP6A 4DYDA 4ALKA 4DWWA 4FYJA 5JSZB 5L95A 4Q66C 5DNEA 1GUAA 1OAKA 5C1DA 1RQNA 4L6CA 3BIXA 3HI4A 3MA0A 4KQGA 3C1UA 4UUNA 1YFLA 2NZJA 1II8B 4ZVVA 5HFNA 2N75A 4DUPA 4KR7A 3AC0A 3D2LA 1Y7IA 4FPXA 4HS4A 3AESB 2YN2A 4G86A 5DFAA 3ZHUA 1K98A 5BNWA 1DIAA 2FWAA 4FILA 3NIWA 2WHRA 4PTZA 2IODA 3B6JA 3ANLA 4QELA 4CL8A 1YR7A 2G1AA 2V7BA 4G9GA 4KGXA 5B64A 3MJHA 3ACBA 5B2FA 4AJEA 2FKNA 4LVNA 1KI1A 2QTLA 2LCIA 3SKXA 3SZ3A 4AY2A 3IPCA 3RTDA 1N0UA 1Y3AA 2WINI 2ZE8A 3BEDA 4FT2A 4QPNA 1E0JA 3VPBA 4BNNA 1PF7E 4BLSA 2WPDA 3C3YA 5JAUA 2DZDA 4GP6A 4UHBA 4EPTA 1CEYA 4LIPD 5FCDA 3VR4D 3JS5A 4OHZA 4QYIA 3QQ5A 1MPTA 1JHXA 2HK8A 2GZHA 2RHCA 3KCQA 5FOWA 4CT0A 4CHTA 1OH8A 4M1YA 1O94C 1OXSC 3Q7RA 2AOVA 3V1TC 1OXTA 2HPAA 1Z4NA 3ZJVA 1CCWA 2Q9UA 1CRZA 1WSBA 3AIKA 3V6MA 1CTQA 2NSDA 2J9XB 3RJTA 4HN2A 3NONA 1HYHA 1VMDA 3KJNA 3Q7IA 5BYBA 5B7PA 1A98A 2GARA 3FIUA 4WLEA 3FFTA 1S2GA 2AHOA 4L73A 3VX3A 3MMSA 2ZETA 1H65A 3WE7A 2HWKA 3N8KA 1NY6A 4OCZA 2PZAA 3O3NB 4EGJA 5FNVA 4AL4A 3AR2A 2OYSA 1XU9A 2NM0A 4ZAWA 1BNCA 4EUSA 4ZOQI 3ZZ1A 4LHEA 4WXMA 2NZXA 2ZUVA 4RKFA 5D86A 4FVTA 2PG3A 2Q46A 3HBLA 3R0JA 3R5FA 4JDPA 5FF9A 2QBYB 5ARDA 3VO9A 2R6R1 1FMCA 1U2PA 1YB2A 1JHOA 3JYOA 2IT1A 4H6WA 3ICEA 3OIVA 2G9NA 4DDUA 3DMRA 3K05A 5TPWA 5AVVA 4IHQA 2I4OA 5FJJA 1U63A 3KQMA 1RXEA 4I8DA 1YBMA 2BZ0A 3KYBA 1ZONA 3C5CA 4GC5A 4Q9HA 1PYGA 3HJUA 4F11A 5DNAA 2C9MA 3EDRA 1K7XB 1Z12A 4M8LA 5LOVB 5DX1A 1C30A 4EVSA 3LYUA 2HBYA 2HMYB 3B7GA 1DJQA 1WQ1R 1PQWA 3OM0A 4UCWA 2AQKA 1K2VN 3NLLA 4RL6A 5TPZA 1C3OA 2BMVA 2FWBA 5K5EA 3F6CA 4XIFA 3G9XA 4ME6A 1DZ3A 3MNFA 4UM9D 1ID1A 2HA2A 4DSUA 3SHVA 4YIHA 5J9FA 1RXUA 2D13A 1J8DA 2P1DA 2R7NA 5CT8A 3U26A 2ZCVA 1OJ7A 1U7PA 2DTXA 3BKWA 4A92A 5HXAA 1GZ3A 5LKAA 5ESXA 1LV8A 4C4TA 1RYMA 3QI7A 2QG4A 4LXQA 1GPKA 4DQLA 5TEWA 2Z6VA 4YPFA 3K15A 4R81A 1O0BA 3BMOA 3H11A 4HX9A 4R2WA 3WB1A 3NZEA 1B1AA 1NNUA 4ZI7A 3QWFA 4AQ7A 4NJMA 1PJ4A 3IKVA 1PG2A 4HH0A 2OBLA 3DDUA 2VZ8A 3AR4A 4LXYA 3MXOA 1MJFA 1E20A 3KP1A 2WR8A 4HMQA 2N42A 5DE3A 1AKWA 1OF1A 2MHCA 3ESAA 3NYRA 1FSFA 2C2XA 1TQ2A 1Y48E 4DE5A 3E3NA 4ZO6A 2II6A 1ZMOA 4U0KA 1I5RA 5FWDA 1Z7EA 4KQ2A 3F6YA 3WRXA 3O5AA 5JALA 3N5CA 3C3WA 1EXVA 1GPMA 2EW2A 1JEQA 1D4AA 1NUQA 2PX8A 3H99A 3MK31 4WSOA 3TJMA 3U2QA 2N3ZA 1LWNA 2J7PA 3GLKA 3SZLA 2VSQA 1ZJYA 5IT4A 3H97A 5IVKA 3I42A 5MFPA 3D0RA 2A9FA 2ZYTX 4M8NE 3MGCA 3OPNA 4N49A 3SX2A 1ECJA 2OGTA 4BPBA 1LLCA 5A9SB 2R3SA 2BGKA 2RB5A 3F0TA 2AQIA 3RUDA 5FLXA 1L4UA 1QOQB 1JQ3A 4UDOA 2BEWA 3TJRA 3PC7A 3HJNA 3O93A 2GTPA 3A27A 2ZBVA 1L5WA 1MENA 4CTMA 1WBBA 1QIFA 4B46A 5I3ZA 4L78A 3LBHA 2GM5A 3BZWA 4EKGA 4XASA 2IZOA 3ZE9A 3KKOA 3IEMA 5B58C 4TTRA 4B84A 2DX7A 4KX5A 2Y77A 2FEPA 2QTGA 1DO2A 3HUEA 4RQUA 1NXPA 4GO1A 4S2EA 3EPJA 1M5TA 1X1RA 3Q3HA 2X15A 2EDAA 3DTVB 5B1EA 3ET4A 1ONPA 4C1BA 3AEXA 3BWBA 1TAQA 3G6KA 3NTRA 2QL9A 4JL8A 3U13A 3C6XA 3H5WA 1I2DA 3O8NA 3FWYA 4L1KA 1E92A 3AM3A 1ZH0A 4B34A 3TW8B 4Q7MB 3F6SA 3WWPA 5JZMA 2FG7C 1P7YA 3L8YA 3CN9A 4Z99A 4KXUA 3Q1LA 1EGQA 1RAAA 4ZHQA 4ER0A 3WQSB 2GHIA 3OJ0A 4O4HB 1E79A 2R4TA 5E2AA 4ER3A 4QEZA 1CUJA 4F3YA 2C9CA 5B58T 2QUZA 5CLGA 4ABYA 5CB4B 1TVKA 2H65A 2XMBA 2EJVA 4RD0A 5DNDA 1DWQA 3A4NA 2D8MA 4BQQA 1XHFA 3OPYB 1DRUA 4LMRA 2XE7A 5FFMA 4C20A 1U1GA 4ZCIA 2N9UA 4YGYA 1ZHHA 5IMBA 2ALJA 4CLRB 1Z7WA 2FN3A 3Q8WA 3LUDA 3GEDA 2MSEB 4QXRA 2MT9A 4FCCA 4IG4A 1SBTA 2RHJA 4DADA 3OIYA 1SVIA 2R1VA 3FG9A 4K6GA 4TX1A 3RYFB 3DKRA 1HQKA 4B8YA 1KYQA 3LUJA 1IIRA 2XDQA 2BF4A 1JLLB 3H5NA 2XAAA 3LCRA 4V03A 2PUBA 1U4OA 1W5AA 3HWX1 3BE6A 4UUPA 4F4JA 4G5HA 4DARA 2E1RA 3CT6A 3CZQA 3LBAA 1VFNA 4BNMA 4DJFC 1IHXA 4H9GA 4GBMA 2XA1A 3DKIA 4FN4A 5FTJA 3E27A 5ICGA 1PK9A 5LL6P 1OLUB 3E9MA 3QUAA 4WFIA 5IDWA 4LJRA 3QKWA 1CNFA 2NYRA 3UQYS 3TBHA 1J9GA 4G4SO 5BVGB 2FEOA 1N2EA 1YD7A 3ZI0A 3O4IA 3FOFC 1GTVA 2JFBA 4MW1A 4WACA 4IWNA 5DN9A 2EZTA 5EY5B 3FLEA 3QA9A 1W87A 4P7JA 3OHSX 2DUJA 1KO1A 1JJAA 3EIFA 3QBJA 2BPOA 1GGHA 4HQ6A 1XHLA 4J7CA 4RLQA 3WV4A 3ZGVA 5JZOA 1XZBA 2O54A 2BM0A 1ZJ5A 2A58A 1FLVA 2YOGA 3JQCA 4Q34A 1Y6FA 2YRFA 3HG7A 3JRXA 3I39X 3WTBA 1E1QD 3INGA 1KETA 3IHWA 3SAJA 2NO6A 4OHWA 4YT2A 4FOOA 4K9QA 5LJLA 2PQ2A 3GNSA 1Y8ZA 3TR5A 2E87A 1YBFA 4MUJA 2CHUA 5ITVA 1CY0A 4MVJP 3S2IA 1J22A 1XN4A 5DHSA 2I91A 2CKDA 3DEYX 1PYDA 1CB7A 3IALA 2W2QA 1BRMA 3K0CA 1Y3DE 2Y1DA 2WK1A 1KK2A 2ZAOA 3EEIA 3I4FA 3ROFA 2DPYA 3BMCA 1KVRA 4ZVPA 3ZNOA 4KC0A 1G4HA 3CKKA 2X86A 3DEAA 3NRJA 2XV1A 3KLMX 5ITSA 2W37A 3F71A 4DIOA 3IAEA 4PXYA 2X7XA 2DWUA 3MPUA 3PFCA 1MVOA 2I1LA 5UKDA 1P1IA 4GPIB 3FAKA 4ZZ2A 1VB5A 5CXUA 1KY3A 1QK3A 6LDHA 1JIVA 1HO3A 2FMKA 4CKBA 1KMMA 4BFTA 1IULA 4B47A 1J2UA 2ANCA 2BEVA 5GZ6A 4BVEA 3JARA 4K2AA 3VR4A 4LOJA 3NRBA 2PMKA 1CY7A 2Z5VA 3NBXX 3VR0A 4C7BA 4UCFA 2BZSA 1E6KA 3ORQA 4OBBA 3K9FC 4IIYA 3Q4GA 3EMVA 4P7FA 4H1VA 4L6AA 5AOBA 1YNOA 1RPTA 2PRJA 3IP8A 3MWFA 4GR5A 4TLDA 3WMGA 3TZCA 2VT6A 4R1UA 5F64A 3CLSC 2F4VB 1IFXA 2GXUA 1DRVA 1R66A 4RK5A 2FN9A 2GBGA 1UIMA 2JJ8A 3IT2A 2TMYA 3FYUB 2B3DA 1OILA 2DUNA 2PA0A 2PRYA 3KD3A 3WQRA 1FTGA 4UARA 1UP4A 2QN1A 4BZQA 2YC2C 3G1TA 3HJRA 4ZQIA 4KBFA 4Z4QA 2GM9A 4TMXA 4PLZA 1E9FA 2Q21A 3FTQA 1GUYA 1R0ZA 2QUHA 3G7NA 1A3CA 4FGWA 4N5LA 5EE9A 5JXGA 1YQQA 2X3UA 1QIJA 5CFRA 1PL0A 2ZJ3A 4XEHA 3H1FA 3RV4A 2O07A 2X5XA 4PBSA 4CCSA 1TM2A 2XLCA 2BGWA 3F9RA 3KKQA 1LDGA 4AIRA 4YR7A 1MB2A 1V1MA 3KZCA 4PIVA 3ZDDA 2BFMA 721PA 2UAGA 3RSFA 2B34A 3D6VA 1KZ1A 4ECAA 3KUKA 1F2TA 1UDRA 4Z7QB 1ZGHA 4E4TA 3CN7A 2D5CA 3GDGA 4YY3B 1W5SA 3RYHB 3PDCA 4AQYB 3QLVC 4JI3B 2PTHA 1W88B 3T61A 4B3CA 1GDTA 4MULA 4QXAA 1HYEA 3DWEX 4RTQA 2XBMA 2O7NA 1GAEO 5ALVA 5ICCA 3UMMA 3I2IA 2WJAA 3OQIA 1S2OA 4P92A 3B5JA 1PUIA 1XMIA 3NHJA 1AKMA 3K8YA 4Y2YA 3UTDA 5K6AA 1N2JA 1JLSA 5FA6A 1XQYA 4HN4B 2NX2A 4BNXA 3UO8B 1OUMA 2VFAA 3PNLA 2FFQA 2B5VA 1CVRA 2F1JA 2FPUA 2ILTA 2IU4A 1ZH6A 5ENZA 4JZYA 2QE6A 5ICFA 1IY1A 3RG2A 2ZIGA 1TB4A 3UUFA 3G8AA 4QJ3A 5HCUA 3ZS9A 2FPPB 2GPNA 4GXTA 1UZAA 5KREA 1DRKA 1W85A 3B7PA 4C6RA 1UXJA 4FLMA 1K06A 1A9TA 4U1RA 5J59A 4UHFA 2Q3HA 2B5OA 4X8OA 2VXOA 1BH6A 3PUJA 4LRTB 5AI8A 2BFDB 4LYYA 1UXKA 1ORHA 2MWMA 4ISCA 2P2NA 4Q00A 2RAPA 4MV1A 2Z30A 3NC4A 3WK9A 1Z7BA 4LZWA 3IESA 4ILKA 1KFCB 2AN1A 4FGSA 4XKJA 4D4LA 3OX4A 4JVLA 3SSOA 4RMIA 3W8EA 1GNPA 3KPUA 5C7LO 1C4WA 4N76A 4D0NA 4MIYA 3K1JA 4YCDA 4PSKA 1J4AA 4RPIA 1CVIA 1SCBA 2BM8A 1LTHR 1YQXA 2FB9A 2Q4BA 2AMJA 2QENA 1T0PA 2P2DA 3ESZA 3IQXA 3NEAA 3QXSA 3LNCA 2XB2A 2CVZA 1QYDA 2ZRCA 3DE6X 1K8RA 1SKUA 1AZWA 1G1AA 2O2IA 4TS9A 4Y7DA 3HXTA 3ZBUA 1BDIA 2PKWA 1TFRA 3IBSA 3RJ9A 3RK0A 2BTEA 2PS3A 4BJHB 1U98A 5BSKA 1THTA 2JAUA 3WOVA 5BYKA 4EL5A 2GNPA 3A6EA 3NBMA 2EXXA 3AVWA 1KC1A 4KPUA 2OGSA 1CV2A 2Q3FA 3DM5A 3TVTA 3O92A 1ELOA 1PAUA 2XUFA 1Q0ZA 2QRMA 1PKXA 1NQTA 3KYDB 4JIGA 4KXNA 1MF7A 1T5SA 1YZFA 2VSFA 2WILA 4Q02A 4BVHA 3PA6A 3DBIA 3H1BA 2ZDHA 2VJOA 3FWZA 3WGZA 3KJIA 5TT0A 2FRDA 2IHJA 4EVIA 1ISSA 1Q0LA 2YR0A 2JK0A 3LUAA 1V35A 3NVAA 3U7EB 2Q7XA 4YWHA 2MR6A 3HKEB 3HEBA 3TLXA 4EJMA 4XWYA 2GRJA 4LDQA 2QTMA 3ZE1B 2PKEA 2XHEA 4DCPA 5C1BA 4KQ9A 1N8NA 1ZRHA 4L51A 1U11A 1WXDA 2VH5R 3OPVA 3FUWA 1B8VA 4YJHA 1Y1QA 4IINA 2Q50A 2VH1A 5ALUA 2UYHA 1GGVA 2DB3A 4EAQA 2N1BA 1Z0AA 1E2QA 4KMSA 4TL9A 1MO3A 3RNLA 4M6WB 2H18A 4D56A 4DIEA 5HVNA 3LLUA 2PPVA 5JNUA 1U8YA 4IIJA 3NPAA 4IQGA 5GADl 2HR1A 4DVGA 2C84A 3N8NA 2Y1EA 4DLPA 3DDCA 5F3RA 1OTXA 2J85A 2PH5A 3O9VA 5FKJA 4CIDA 2QUJA 3HP7A 2VQ3A 2I8LA 2GF9A 2Y0EA 3ED5A 4B0PA 3CLRC 4FX5A 2CDNA 5G4KA 4BATA 4L85A 3NHAA 4WWHA 4R9RA 4KXLA 1XMPA 1SOVA 1LY1A 4ND8A 1SUBA 1JNXX 3L6UA 4UOQA 4UE3S 2M6RA 1TZMA 2ZRLA 4AZWA 4O1MA 1OT5A 1TEHA 1YV9A 3WICA 3UEOA 3B6MA 5AUOB 1KL7A 3QPWA 5JSYA 5C8YF 3KK0A 3JD4A 4RC9A 2PUCA 4ZZ1A 4I9FA 1BU5A 2ENWA 3M3DA 3QX9A 4Q1EA 5DT2A 5C3MA 1W1WA 2K5UA 3N28A 1Q84A 3EUWA 3IBYA 1KDVA 1CUVA 3W1WA 5IF9A 2IF2A 3WIUA 1K5HA 4MTLA 4YWJA 5M2QA 5DTIA 4CLOB 1D0VA 3GNTA 4DLVA 1E1DA 3WOHA 1PR2A 2LGJA 4BVKA 1BMFD 3T3IA 4DM4A 1UZLA 1ZU5A 4E12A 4JVNA 5A7FA 4ZT3A 4INAA 4RK7A 2ZQYA 2FP4A 2VHYA 2V4UA 5ARBA 3Q6NA 3DZJA 1NHWA 2FVYA 4FFRA 4BE7B 3U7RA 3P32A 3BIWA 1YJBA 1ZRNA 1E1QA 2E3JA 2HYDA 2IU3A 2YRWA 4QNRA 1ZVJA 5DJ5A 3HWRA 3OD5A 5FX2A 2G08A 3H1TA 3KFXA 1X94A 1SQ0A 1JQAA 4O4IF 3U5ZB 1E4EB 4KSBA 4S35A 1VG0B 2VEDA 4QGFA 2Y76A 2WY2D 3C8DA 3PYXA 2C2BA 4QO7A 3W1EA 4P93A 1XZGA 3ROGA 3HFRA 1BWSA 3BJIC 4Q9JA 3OO1A 2ODEA 3AINA 1X7XB 3BM5A 1DX6A 3C4JA 3EG9A 1GUBA 1T43A 1DLJA 3TD9A 4KQMA 3HJHA 3KQYA 5L3VA 1G7TA 2Q41A 4CETA 5JR3A 2O57A 1V8OA 4F6RB 3OI7A 3QIVA 4TT3D 3FR8A 1KYYA 1XQXA 3IV6A 1TCBA 3O8OB 3QWHA 2ZTSA 3OCJA 4WADA 1UP6A 1DEAA 1EX6A 5JROA 1QH1B 3KAJA 1YAHA 2VP5A 5H16A 1YDGA 2QN2A 2B78A 3R1IA 3W4IA 4AJKA 2K7FA 3CE6A 3DVAB 3DBLB 3GVXA 4BQOA 4FWIB 4DREA 2WABA 3ODGA 4EIWA 5E2IA 1T34A 3KRTA 3CNOA 2PGIA 2QUIA 2IEGA 2ESRA 2BGNA 4WUVA 1LK5A 3ZZTA 3MBOA 2QDXA 3INYA 2OZEA 2Y4NA 4PX5A 1KIAA 2HA5A 3CURA 3DEIA 1FBNA 1V41E 2NN3C 4CQLB 3RD5A 4QG7A 2GJ4A 2CZQA 3UJ8A 4P8RA 5DB4A 2QR3A 4XVHA 3COJA 4GKAA 1K0FA 3JD3A 3C7DB 4I4LA 4DSTA 4JITA 3L7LA 5BVHB 1KBQA 3I2GA 1NUHA 2R6FA 4YV1A 3WK5A 1KPIA 2ZITA 2NU8B 3HR8A 5A4KA 3PC8A 1PVOA 1W6UA 5FI5A 3NKLA 3UB4A 1W4RA 3GD7A 4B73A 1KY5A 3G2JA 1I2CA 2RBEA 3MCTA 5L6MB 4PPYA 4GVLA 1AKQA 2GILA 2C4KA 5B2EA 3RFUA 2C2WA 3AEQA 3CR3C 4JLNA 1M1NB 2BFCA 2ZRFA 4TXNA 1MLDA 3S44A 2ZSDA 4IJ6A 5B1HA 3REGA 5CB8A 4DB2A 2PRZA 1QZUA 1HEUA 1SBZA 3P94A 1XALA 2F7SA 4YJ3F 1UMKA 1WIWA 1WD5A 2HNKA 2XNJA 4L15A 4YBRA 3GLHA 1WXIA 4PN7A 1CBUA 4UU7A 2FE4A 1SD2A 1WPRA 4FBMA 1MEOA 2IH4A 4GNKA 4KAFA 2J0VA 2VDUE 4GKJB 3G5UA 3N59A 4KR0A 1KDTA 2Y1FA 2FPRA 3F98A 5IC4A 4JC4A 1L5OA 1VHQA 2X14A 3D3EA 2OVFA 3K16A 2A0WA 1XDBA 13PKA 5DGCA 2HB6A 4E5DA 3A0RB 1I4TD 2XA9A 2I78A 3HSSA 5K3SA 2NACA 5TC4A 5GOZA 4TRMA 4O2AA 1XA4A 2WVHA 5EE0A 4MKFA 5H3LA 4YCMA 2JIRA 4XGQA 4BL5A 1SGWA 2OHJA 2QNBA 5AHRA 5TSDA 1AF7A 3EWNA 5IVPA 1ESZA 4MRMB 1UWLA 4Z2YA 2OAGA 5DYNA 2P69A 1RPJA 4K28A 1G9XA 2J9FA 2JAWA 3WRVA 1THMA 4IH1A 4MAAA 4AN4A 4PYJA 3AUSA 5FLEX 1P7ZA 3ANXA 1VLHA 3M3HA 3MJDA 4QARA 1M8FA 4KMRA 5KC9A 1YE5A 3LT4A 4COKA 4N6NA 2NVWA 3GP8A 2XA2A 1TKRA 2W8BB 3HY6A 3M9LA 4RA6B 3MIZA 3W5HA 5CG1A 1PV2A 2NZUG 1BS9A 2CE2X 4OGGA 4FJ1A 2C5HA 1OTHA 3J7TA 4WZAA 3L1JA 2F3RA 3B6KA 3COSA 4CM9D 4QQRA 5LM3A 1KYVA 4YAFA 2QUAA 4ID9A 3OJOA 1Y4AE 4LI0A 4RGVA 4A4DA 3TQTA 3GFGA 1OVGA 5AM5A 2VHJA 4FR2A 4QBTA 3HB0A 3THWA 4ZCTA 4PNHA 2O2YA 2OBNA 4J16C 1BHO1 3NHSA 3R9KA 1WMAA 4HEHA 3MGBA 4RPLA 4XYMA 5FBLB 5JNTA 1MIOB 3ZDRA 2R86A 4PC7A 4LXXA 5H82A 1NTRA 2NQTA 4LX0A 4QEKA 4N47A 1QO0D 3TNYA 4LTDA 1XJ0A 3NKFA 4WK4B 2KJQA 1J2RA 2IUUA 3WLFA 2J09A 1Z4PX 3I52A 1MHTA 1DEKA 3DTNA 3T7JA 1GKYA 5F73A 1BXGA 2VRWA 3AETA 2Y9MB 3M83A 4J4BA 3TNDA 5L6LB 2VKQA 5AQEA 2X9QA 3STTA 1H0SA 2PLRA 1VE1A 2XOEA 4BNJA 4W9NC 2F64A 4BBZA 1KXZA 1EHCA 2NXNA 4HB3A 3OZXA 3RFXA 2WU4A 3HDGA 3CA8A 3I28A 4HAYA 1OWNA 4PRYA 4ND2A 1YDEA 5EOVA 4QXOA 5H5JA 4DMUB 3W8NA 3VOTA 2BWJA 4L5IA 4RH3A 2VA8A 3PFBA 4XYEA 5AK0A 1UM8A 1NYTA 1XF1A 4DXAA 4L76A 1UDCA 4UW9A 2CL5A 4C0QC 1RI4A 2VHEA 4RULA 1XPRA 3DVSX 3GP3A 3WBJA 2XXAA 3EGEA 2PZJA 1E6UA 4ESOA 1DOZA 3ODPA 1QKIA 3PGVA 1XWFA 2PUJA 2D3TA 5M04A 2X5JO 5BV2P 1JE0A 2G5PA 1P0IA 3SM3A 2W11A 2ZJ1A 3AEZA 1JAIA 2WIBA 4IDNA 3WLJA 4CYMA 1PZFA 4CUZA 2DY0A 2F6RA 1OGIA 2NU7B 2R1ZA 1T3LA 5DU2A 2W2MA 4TM7A 3X2SA 2JLCA 4RIHA 3PD1A 1XTSA 3IBCA 4D02A 5T41A 3A2KA 3Q6MA 3RIXA 3K9CA 4MWDA 1FY2A 3LY7A 5JZSA 3GPBA 2QS9A 1J24A 3ITKA 5HMMA 1CEQA 2GZ2A 3QWBA 4QAQA 4UDXX 4AZ3A 3CRW1 2C3YA 3QPUA 1KJYA 2JI4A 4EA7A 3B3AA 4ZI2A 1JA0A 2L82A 4JY7A 2B20A 5IBPA 1E9VA