3STWA

Crystal structure of tomato methylketone synthase i complexed with 2-tridecanone
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
258
structure length
258
Chain Sequence
b'FVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDHVTMMSKPQQLFTTLLSIANKYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylketone synthase 1
molecule tags Hydrolase
source organism Lycopersicon hirsutum f. glabratum
publication title Emergent Decarboxylase Activity and Attenuation of alpha/beta-Hydrolase Activity during the Evolution of Methylketone Biosynthesis in Tomato.
pubmed doi rcsb
total genus 88
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3stwA00
3Q8WA 4DM7A 1H2YA 4IH4A 5EFZA 3M83A 3H1AA 3ZI7A 4OB6A 2VTVA 1WCYA 2QUAA 4G5XA 5CW2A 1YCDA 5LIPA 3X3HA 4B84A 1NU6A 1DTEA 5HCUA 2JGFA 1UK9A 1DX4A 2VJDA 4UFNA 1FFBA 3WWPA 1QLWA 5CT9A 1L7RA 1AKNA 4JNCA 4L3WA 3WA7A 1K6EA 2VJBA 3AZQA 5I9IA 5LZ7A 4G8BA 2WG1A 3MUOA 2XQIA 1THGA 4PQEA 1VOTA 3LIPA 1UK7A 2OCGA 1EI9A 2VA9A 4FLFA 5T4EA 1ZI8A 3ZLUA 3IUNA 1QFMA 2XQJA 2XB6A 3STXA 2DFPA 3FVRA 4KR0A 3IIIA 4RPCA 5DNUA 4LIPD 4OUKX 1ZGCA 2O2IA 1VZ3A 4B7ZA 2UZ0A 5AIAA 2ONCA 3VJKA 1EK1A 2XQFA 4C6HA 2WHPB 4HVTA 4BVKA 4KE9A 1SC9A 4Y2UA 5AM5A 1CUFA 3RM3A 2I03A 4J0GA 3GA7A 5AHXA 1XRRA 1UXOA 5E4TA 2PM8A 4FFWA 2JGEA 5A6VA 4Y2PA 3FYUB 1MX1A 4UBIA 3W04A 5A62A 3D4LA 3EQ7A 5JADA 5ESRA 2QS9A 4FFVA 4W1PA 5K3AA 1CQWA 2J3QA 3G9UA 4FHZA 1EDBA 1PJAA 4QLOA 3I2JA 5C81A 3HC7A 1MX5A 2DHCA 1Y37A 4QA9A 1IMJA 4C4XA 1F8UA 4N8EA 1W1IA 4B0OA 3CXUA 3QPAA 2PUJA 3L1JA 4WJLA 2QJWA 2JGKA 2O7RA 4X95A 3CN9A 4AQDA 5LLSA 5DTIA 4WFIA 1BROA 3C70A 5AOAA 2WIJA 2XMSA 5H3HA 4G4IA 4J03A 3FYUC 3HJUA 3OURA 5AM3A 2ZJ7A 4IH9A 1YAJA 1JJFA 5FV4A 4I19A 4GDMA 2Q0XA 4BCCA 1TK3A 4IO0A 5AIBA 1DQYA 5DTJA 1SOMA 3LS2A 4JYMA 4A23A 4U2CA 3FYTA 1CIJA 4ARAA 1LLFA 1F0PA 4YX9A 3H17A 1CQZA 1GT6A 4D9JA 4XJVA 2WKWA 4CCWA 3U1TA 3BXPA 4Q82A 1MAAA 1A8UA 3EBLA 4WCVA 2FJPA 2NW6A 1H2ZA 4J0HA 1XZFA 5E2IA 2GBGA 4B81A 4FBLA 4W9RA 3B3QA 1XLWA 2WIFA 3WZMA 1E8NA 2RGUA 4UHCA 1W75A 2Z8ZA 4X6UA 1VLQA 2HA4A 3DNMA 5AICA 1ZD4A 1VXRA 2O2GA 3SWWA 3PFCA 2BAGA 3ESCA 5JZSA 2J3DA 2AJBA 1CUXA 3WYNA 4PSDA 4DTCA 4C88A 5DJ5A 3HABA 4BP9A 1YR2A 3ZV7A 2JF0A 5AKZA 1GQSA 1RWQA 1QIEA 2OGTA 4H0CA 3C6BA 5CT8A 2EDCA 1E8DA 5FOQA 4WY8A 3AZPA 2WLSA 2D0DA 4S0XA 3WMRA 3BWXA 5AI4A 1LPBB 4H7DA 5LZ9A 4PNZA 3ICVA 1WB6A 5AM1A 5DNWA 4KACA 3IURA 1E89A 1HDEA 1LNSA 1ODSA 5A7FA 4B82A 2CBGA 1TQHA 3FVTA 2XUQA 4MXDA 4GECA 1DT3A 1A88A 2OLEA 4X93A 2PL5A 3D7RA 3OTQA 4M0EA 2PSHA 5EIAA 2HHAA 2QXTA 4DMFA 5JD6A 3QITA 1OILA 4B85A 3WL8A 3KSRA 2RI6A 5ALWA 1H2XA 1C7IA 5ALIA 1AGYA 5C8XA 4QE3A 5ALXA 1N8SA 1G4HA 3VKFA 3NWOA 3PI6A 4CCYA 4BC0A 3PUHA 3QM1A 5HKAA 1Q83A 4CCYB 3BE8A 1HBJA 5I8PA 2HRRA 4BATA 1FJ2A 2XUGA 4FBMA 1JI3A 5AH0A 1S8OA 2QOEA 3WKAA 4ZXFA 3I2KA 2HIHA 4BCDA 1MX9A 1UOOA 4AO6A 3QMVA 1FFAA 4BAGA 4KAAA 2OAGA 2E3JA 5AKYA 5CH5A 1ORWA 4U2DA 2DQYA 3QMWA 5AKLA 1ZJ4A 3H0CA 2C7BA 2ZYIA 1QIFA 1E8MA 3BF8A 3HXKA 5E4JA 4NVRA 1IZ7A 3JW8A 1P0PA 2YH2A 1ZJ5A 2OCIA 1CUZA 1CUBA 4KRXA 3R3XA 1DT5A 4UPDA 4XVCA 4DLNA 1UKBA 4X71A 1XZJA 2DHDA 4Z49A 2HA7A 4OB7A 5FDFA 3WLAA 3I28A 3HLKA 1DWPA 1ETHA 1XZHA 4GXNA 3H19A 1WPXA 2WM2A 1JMYA 2ZJ6A 5AKHA 2DCMA 2I78A 5HK8A 4UBNA 1CUEA 4E11A 5AM2A 1YA8A 1ZD5A 1P0MA 3FOBA 3C5WP 4CG1A 1Q0RA 4X6XA 5AKKA 3QYJA 5C7YA 1BN7A 1DQZA 3G0CA 3AIOA 5C8ZA 3GUUA 1ZIYA 5FLKA 2JGLA 1EB8A 5FUMA 2XI4A 1XQYA 2CB9A 3UUEA 1MNAA 3T52A 1LPSA 4N5IX 1W76A 3R3VA 2XUJA 3SC2A 1W52X 5K3BA 5DNVA 4AN0A 3D0KA 3WKBA 1UK6A 3H2GA 2QJRA 3IULA 5ALYA 4UHBA 1C7JA 4H7IA 3ESAA 3DOHA 1BEEA 4PW0A 3O4IA 4UBMA 4AXBA 3FCXA 2XUIA 1EDDA 5AI0A 1MPXA 3M82A 1AURA 4P9NA 3EIOA 2VAXA 4BBZA 1IUPA 4PO3X 1UKCA 3KOOA 4BC1A 3KDAA 1UOPA 5JARA 3MUNA 1MTZA 1XRNA 1XZIA 5AK3A 1JT2A 3M3DA 1CR6A 1TCCA 1YSCA 2GBFA 1LZLA 2VATA 3SK0A 2P8SA 1CV2A 1CUIA 1QGED 2Z3WA 3C43A 5HFNA 1USWA 2VT6A 2CZQA 4FKBA 5ALHA 4AB1A 4GW3A 1KU6A 3O95A 3PDCA 1XKLA 1ZI6A 1XQXA 2C5GA 1AMNA 3F97A 2B20A 5F4ZA 5JALA 4DNQA 4E46A 2LIPA 2OXEA 2QKYA 2OQVA 4A5SA 2H7YA 4DNFA 1X2EA 5HKBA 3G0IA 3ZLVA 4BP8A 2HDWA 2WTMA 3UMJA 5D3KA 4GBGA 4OB8A 5AKEA 3LLCA 2G4LA 1YAHA 4CI9A 1F0NA 4EHBA 1LZKA 4EY6A 4FWBA 4DYHA 3BL8A 1EVQA 5ALRA 1VXOA 5KREA 2WUEA 4ZRDA 5DYYA 3WK9A 3IUQA 3H18A 5J3JA 5HF6A 4WY5A 4F5ZA 1TRHA 2WUGA 4Q3LA 3TJMA 5DYWA 4LKOA 1GZ7A 3WWOA 2RHWA 3IB3A 2WUDA 1JFRA 3A2MA 3PFBA 5ALDA 3HYSA 4ZI5A 4HAIA 2ZJFA 5LZ4A 4IH1A 4BE9A 1FFCA 1XZMA 2ACEA 3L1IA 1TCBA 3I1IA 3U0VA 3ZLTA 3W9BA 3K9BA 1R88A 2EEPA 2OAEA 4E14A 1G42A 2J4CA 1DWQA 5AKIA 1E66A 5AOCA 1LPAB 3VVLA 4EY7A 4RNCA 4UBLA 1X70A 4GWLA 3QPCA 3G7NA 2ZYSA 1LPPA 1VA4A 3OM8A 2BKLA 1VKHA 4HZGA 3TGLA 3HRHA 3PF8A 3UUFA 5T4BA 5D7BA 2XMBA 2XMQA 1HL7A 5DLPA 2GYVA 1CUDA 1J2EA 1EXWA 1ODTC 3W05A 4BE4A 1EK2A 3PE6A 4PSUA 3O0DA 3IBTA 2XQGA 2HU7A 3WI7A 3HZOA 2B61A 3WQHA 4EZIA 4ROTA 2XUDA 5DWDA 4FNGA 2QTBA 2PSJA 3FNBA 4BAUA 2DQZA 1XROA 2YXPX 4EBBA 1N5MA 3WYDA 2WU4A 5AK4A 1CUGA 3D59A 4C01A 1HQDA 1SCQA 2O2HA 2C0PA 3STWA 5CT5A 4X91A 3AJAA 1C4XA 1JJIA 1XRLA 3F9CA 1IUNA 1R4ZA 3M81A 3ESDA 4K6GA 1QIHA 3KWFA 4KE8A 4C4ZA 3SX4A 3C5VA 4C87A 5AI8A 1QE3A 1U4NA 3R40A 2BJHA 1LBTA 2XMRA 2FUKA 3D3NA 4GI1A 2PBLA 4H35A 1XQVA 4XIIA 2PPLA 2ZSHA 4LYEA 3KD2A 2G5PA 2EDAA 1EA5A 2X5XA 4DSAA 1QO9A 3LP5A 3IA2A 2IIVA 3I6ZA 1YB7A 2HM7A 1OXMA 1CUYA 4AZ3A 4OYYA 3O4GA 5AKXA 1UWCA 3ZWQA 4Q1VA 1ACLA 2ORYA 1LPMA 2WG0A 1A8SA 5A2GA 2VF2A 2V97A 4DNOA 3HACA 1R50A 4DMKA 1WHSA 4FMPA 4UHDA 4B9EA 1K63A 4UHHA 4L0CA 3G9TA 2H7CA 2X8BA 4H77A 3BJRA 2WJ3A 1K8QA 1XZKA 1A7UA 2I3DA 4LYDA 3IDAA 5AI5A 3DYIA 5IKXA 5BOVA 3B12A 2V9ZA 2PSFA 3ICWA 1SFRA 1WM1A 2PUHA 4DIUA 3GZJA 4N8DA 2Y6UA 2WILA 1ISPA 3Q0TA 2ZYHA 4G9GA 3G02A 4Y2XA 2GYUA 5HF5A 4OD0A 4YK7A 5FP0A 4U2EA 4Y2RA 1ZI9A 4MEBA 1WHTA 1DU4A 3S2ZA 4Q05A 2WFMA 4Y2JA 4HTAA 1CUJA 1XFDA 3ANSA 2OCLA 5ALGA 1AUOA 3WJ2A 3O4HA 3LCRA 5EHZA 4RGYA 3W06A 4QDZA 3YASA 4X90A 5LKAA 3WA6A 3K6KA 1QTRA 5AI6A 3IUJA 1DWOA 2H1IA 4BTLA 3H2HA 4X00A 4X92A 1SCKA 3V1MA 4QDXA 4EA6A 1ZGBA 3WZLA 3QPDA 4FLMA 4U2FA 2CJPA 5K3CA 4OU4A 1QOZA 5EIEA 1QIGA 2Z5GA 2QMQA 4AMYA 4H7JA 1BRTA 3ED1A 4OYLA 1F6WA 3W9UA 4DMHA 2Y2UA 4B80A 2HFJA 4J3JA 4JUIA 2QM0A 4TGLA 2C0QA 5JAPA 1Q0ZA 4AMZA 2WTNA 3H04A 1RP1A 1CVLA 2VT7A 1AX9A 3A2NA 2BGRA 1CUSA 1DX6A 2HU5A 5ALEA 1O6FA 2WFLA 2XUPA 3R3UA 4DSZA 1RYYA 4CG2A 1MO2A 5KWIA 2YYSA 2PSDA 5K5EA 3DOIA 4BVLA 4EY8A 1R9MA 2QZPA 4DGQA 5LZ8A 4KRYA 3WK4A 3A70A 3BJMA 2ROQA 4BRZA 4MYSA 2WUFA 4EUSA 3BF7A 2BUCA 1ODCA 6YASA 2ES4A 4XX1A 4P08A 1BCRA 1NX9A 2XMGA 1MT3A 5YASA 2ZSIA 4TPKA 3L1HA 3O4JA 3E3AA 5HQ3A 1ORVA 2Z8XA 1FFEA 3WIBA 2R11A 5ALKA 5HQ3B 2WG2A 4AO7A 3GELA 5JD5A 1TCAA 5A71A 3QVMA 5EI5A 4KJXA 4YPVA 2W22A 3EF3A 4I3FA 1P0IA 2D5LA 5CURA 1QFSA 2WIGA 1CEXA 2AJ8A 5AOBA 2XMDA 4MQMA 1Y7IA 1HKHA 1QO7A 5A7HA 4QDOA 3WJ1A 5ISMA 5SYMA 4UBOA 4BYMA 3P2MA 4GEGA 1GKKA 1XZGA 3HSSA 4CFSA 4UHFA 1MNQA 3RKSA 3I2FA 2WJ4A 4BZZA 3G8YA 3WKDA 4H7HA 4E15A 3N2ZB 1K5PA 3KXPA 4W1RA 1EVEA 3QBJA 1CUUA 2W6CX 3FLBA 3A2LA 5T4FA 2RIPA 5AKGA 2WHQA 5AM4A 4WFJA 2AJCA 3LIIA 4HS9A 1ZD2P 3G9XA 3IVMA 4OPMA 1QIJA 3BDIA 1J07A 3NOXA 5CMLA 5I7UA 3NUZA 3MVEA 4J0DA 3O9MA 2HL6A 1SCIA 1EH5A 4KYVA 4G8DA 3WKEA 5LZ2A 2PSEA 3C6YA 1BCSA 4AN1A 3BDVA 3D2BA 1CPYA 2O7VA 1XLVA 1UT6A 3JWEA 4BCBA 2HA6A 3DL7A 4P93A 4KAFA 4Y2TA 1CUVA 4G4JA 2VJCA 3A6ZA 1XZAA 4MYDA 5IVHA 2PVSA 1XZCA 3AFIA 5KBYA 1R1DA 2XUFA 2G63A 5ALPA 1W6RA 2OGZA 4FNMA 5ALNA 5CT6A 2WIKA 1J06A 2RHTA 2ZYRA 3WK8A 4Y2QA 2VAVA 4EY5A 1AQLA 1N1MA 1XZLA 1U65A 2VEOA 2B9VA 3DKRA 4BZWA 3WIOA 5IVDA 1JJBA 3ZPXA 5CH8A 3AZOA 2QUBA 1BS9A 3I6MA 3WK7A 2WHRA 5AO9A 2WHPA 2FJ0A 5HK9A 2OQIA 1PFQA 3N0TA 2GBCA 1D07A 3C8HA 4F0JA 5K3EA 1YA4A 2JEZA 4U2GA 3TRDA 2GBIA 5AP9A 4QLAA 2JGIA 1GKLA 3STTA 4ZV7A 5A7GA 1VZ2A 2XMCA 3STYA 1YB6A 1YASA 3WL6A 1G66A 1QTIA 4U2BA 2OGSA 3V1NA 1GPKA 2IX9A 2J4FA 3WL5A 2QXUA 1QIIA 3FLAA 1NU8A 4N8SA 4BB0A 1LPOA 1MN6A 4P92A 1XKTA 3FYUA 4W63A 2XUOA 5CXXA 1JU3A 2WFLB 3DL4A 5EHQA 4OSEA 1QONA 1QZ3A 4AX4A 4J7AA 5CRIA 1T2NA 5IVKA 3WK5A 3OG9A 4KEAA 4F21A 3O9VA 4Y7DA 5CXUA 5ALOA 4K6HA 1EB9A 3D2CA 5BWBA 3H2JA 2ZVDA 3ANTA 4NS4A 2VSQA 4A16A 3DLTA 4QZVA 3C87A 1ACJA 2Y6VA 5JYCA 5ALVA 4HXGA 3T4UA 1XZDA 4G1FA 4N5HX 3OC0A 4UHEA 2H9YA 3V1KA 3FSGA 5K3FB 1R3DA 1H2WA 4L72A 5AK5A 4RE5A 5JASA 3JYHA 1KU0A 3WWEA 2Y1KA 5JATA 2JEYA 5JAHA 4JH0A 1H23A 2PX6A 4HXEB 1K4YA 2I3ZA 4MJ3A 1AZWA 2IITA 2AXEA 2WFZA 3WWCA 2HFKA 3OPMA 3VJMA 4FDMA 1CUWA 1KEZA 4H18A 4W1QA 1U8EA 2QRUA 2XQKA 5HF9A 5CT4A 5D3ZA 2B4KA 3VVMA 1BU8A 4IHAA 4X85A 4L9AA 1BN6A 1P0QA 3I2HA 2PU5A 1FFDA 4OU5A 3R3WA 1QIKA 4HRXA 1JMKC 1VA5A 3FCYA 4X94A 4G4GA 2XDWA 4H7EA 1CLEA 1IVYA 4Y2YA 1JKMA 2CMFA 5ALQA 4Q3KA 2HA0A 2CUTA 1T4MA 3DJYA 4QEKA 1ZOIA 3WK6A 3QH4A 2FX5A 2XUKA 4H7KA 1VE6A 4C4YA 1GPNA 3DD5A 2WSLA 3GBSA 1YS1X 3QZUA 1ZD3A 5HFAA 2XT0A 3V1LA 1ZIXA 3C8DA 4QDTA 3CCBA 3ESBA 1EX9A 4QWMA 4AZ0A 4B0PA 1FSSA 3VXKA 5FPPA 1XRMA 3NGMA 1UKAA 1GXSA 1U2EA 1XZBA 5JANA 3F8SA 1R9NA 3WWDA 1X2BA 2QR5A 4V2IA 1TAHA 3WL7A 2QT9A 4K2AA 3GROA 4EY4A 3DYVA 1QIDA 3HI4A 5JIBA 2HA5A 4ZWNA 5JZBA 1JU4A 2BGNA 4FOLA 3G0GA 3R3ZA 4IQ4A 2X76A 3QMMA 1E5TA 4H7FA 1HLGA 1XZEA 3RK4A 5LP1A 5ALSA 4W1SA 4X97A 1CFJA 4ZREA 1QJ4A 1A8QA 1TKRA 5ALFA 4AO8A 4JEIA 4C89A 1Z68A 1CRLA 5AKJA 4GHWA 3V9AA 4B83A 3STVA 3B5EA 4G8CA 3I1YA 4YASA 3AIMA 4QDUA 5ALTA 4LHEA 5FKJA 5ALZA 4MWSA 1L7AA 4TVKA 1GPLA 3F96A 4X7BA 5FPQA 3FAKA 1XRQA 1Q84A 2JGJA 1IZ8A 2XUAA 2GZSA 4DNPA 5CH3A 4Y2SA 1MAHA 3G0BA 4ZV9A 4CIBA 5IVIA 1TIBA 3ILSA 3F67A 5DYTA 5LYYA 5HF8A 1UZAA 1HPLA 5D6OA 5BV7A 5AJHA 4HRYA 5ALJA 3H2IA 2WQZA 3AILA 1DINA 2PKYX 1WOMA 5JAOA 5HZGA 2JIDA 4LXHA 4I4CA 5AK6A 5K3DA 3RLIA 1BE0A 3CN7A 3C6XA 2G5TA 4ITVA 1E3QA 4J0IA 2JBWA 4MWTA 2XE4A 5KWJA 4PSCA 3K2IA 1GGVA 3KWJA 2HA2A 2BUAA 2CKMA 4WFKA 5T4HA 4Y2VA 2H7XA 3DS8A 4B6GA 4PV7A 4RE6A 2WJ6A 2OCKA 2XLCA 2WU3A 5AM0A 5AI9A 2HRQA 4QNNA 3DCNA 5EHXA 4WDQA 1CUAA 2GZRA 2DR0A 3D5EA 5JZ9A 1M33A 5CTAA 4KE6A 1N5RA 1WB4A 2OPHA 2VJAA 5C8VA 4PF1A 1XRPA 4DMCA 3MGAA 2RONA 4BAZA 4B9AA 4UUQA 5JD4A 3PICA 4QWWA 3IUMA 3WKCA 5JAUA 1EDEA 1QIMA 7YASA 3I2IA 1Y7HA 1IUOA 1UK8A 4M0MA 4CG3A 5SYNA 4BDSA 4BVJA 2BFNA 4BTVA 4WDRA 3BIXA 4EB0A 2XMZA 2DSNA 5CBKA 2VQ6A 5LKRA 1THTA 3PUIA 4LXGA 3H1BA 3I2GA 2K2QB 3E1GA 1H22A 4K6KA 2PU7A 3OOSA 1J1IA 2V96A 1I6WA 3E4DA 3FWHA 1O6GA 1CUCA 4J0CA 1XLUA 2C58A 3I6YA 2RAUA 1G5FA 4X6YA 5K3FA 2OG1A 1UFOA 1OCEA 3G0DA 3DQZA 4G9EA 4Q34A 3HEAA 2AJLI 2XUHA 2R8BA 1WB5A 1YS2X 5ALUA 4O08A 4F60A 5ALMA 4X3CA 3W2TA 4BDTA 3FLEA 2Z3ZA 2BUBA 3C45A 1UOQA 2C4HA 4CIAA 2WIDA 4M0FA 4KAJA 1L7QA 4UBJA 1GQRA 3AIKA 5E4YA 4Q3OA 4ZGBA 4J0JA 2Y2VA 4LXIA 1VE7A 3EQ9A 4K5QA 2ACKA 3AINA 1MJ5A 4MEAA 3DEAA 3G9ZA 5FRDA 5EHNA 3DDUA 3EQ8A 5ALLA 3R3YA 1CUHA 4UBKA 4MQLA 3BIWA 4BRSA 2QVBA 1EINA 1VJ5A 2HADA 2JGMA 3V48A 1ZICA 3PF9A 3VJLA 4UFOA 3VDXA 1LGYA 4NZZA 3S8YA 4OCZA 2DHEA 2HA3A 3D2AA 4J0KA 3STUA 3E0XA 1AC5A 3RARA 1WPRA 4FTWA 3FSGD 4FLEA 5EIHA 4KE7A 5IH7A 4GLBA 2C5FA 3DKKA 5EGNA 4XWGA 4ARBA 3VISA 2GYWA 4NMWA 4HXFB 3CCCA 3R41A 1LBSA 4INZA 2XLBA 1PV1A 2AJDA 2BCEA 1MU0A 3AUKA 1XQWA 1W4LA 2V98A 1EHYA 1LPNA 3C6ZA 3GFFA 1BEZA 5FXMA 3TEJA 1B6GA 3FBWA 2CEKA 2ECFA 5LZ5A 4ETWA 4JYPA 1B41A 2HU8A 4UFPA 4Y9SA 3H2KA 5BWCA 2YASA 3F98A 3R0VA
chains in the Genus database with same CATH superfamily
2HSWA 1FXWF 4OH1A 4EGCB 4DM7A 5JYEA 1DRKA 3NT5A 1H0HA 1XK7A 1R5OA 2GVZC 1T8YA 4FR5A 4PHFA 4W5WA 4D8UA 4IH4A 1A2KC 4D92A 5EFZA 5K2MA 1NXOA 4MUGA 5K9ZA 2W43A 4YAWA 1J2YA 1KEUA 4MPJA 3ASZA 3M83A 4QATA 2YWDA 3QPWA 4ZK6A 5DH9A 3K6RA 4PC3A 5C34B 3MMZA 1X9HA 3UJDA 1LSJA 1GCUA 4OB6A 2VTVA 1ADFA 1RCUA 1QYIA 4Z7NB 4G5XA 4G89A 1ULZA 1FDSA 2ZJBA 3AUAA 4OVKA 4BKUA 4XSGA 1SHZA 1ZC3A 5J43A 1AQJA 3EXFA 3KK0A 4LXTA 1T10A 1KDPA 1DTEA 3NHSA 5K0BA 1QFJA 5EMJA 3PUWA 4U6SA 4F4IA 1JR6A 3OFVA 3ELWA 1RJFA 2IDJA 3ELDA 4HFMA 4KXLA 2GTHA 2VHYA 3LFTA 1AZTA 1N9ZA 4HYEA 3RYFB 3DBHB 1L7RA 4M89A 4V03A 4YJ2F 1ZM3A 4R1LA 3R6DA 5U9CA 4DM3A 4G0OA 5TQ0B 2EBFX 1O2DA 2YZKA 5HJ5A 5KMGB 1YS6A 3N8HA 3WA7A 4M1TA 2WJZB 1SZPA 1ZG3A 1KMNA 1RJEA 3K09A 3ET4A 1T6ZA 5IK2A 4A2WA 2OZVA 4L5JA 4IIHA 1PG0A 4LVNA 4YAEA 3U3OA 2H4HA 4HNRA 4BNWA 1C1DB 5EXPA 1UKVY 4PAOA 4G8BA 5KB3A 5HG0A 5B3JA 1E6KA 1YRAA 3QIAA 3WZ2A 4YHHB 4OIMA 1WXIA 2HF7A 4P86A 3T6KA 3CUVA 3HE3A 4F4DA 1V9SA 3ZDXB 5D5QA 1ZI8A 3ZNOA 3PL5A 2NSYA 5EE5B 5C5DA 4CVNA 1K5DA 2IKQA 3H9JA 2UYOA 4JELA 3L7DA 2BTQB 3M7IA 5G3YA 2E4YA 3KR1A 5D6NA 1ZD8A 3STXA 4CF4A 3DVQX 5BW8A 2F3TA 4TLLB 2CVOA 3V4VB 3QUTA 1VJ1A 5BWMA 4L7VA 3PC4A 3V7NA 1GPDG 1XI2A 3IIIA 1YJ8A 4RPCA 2D2FA 4JC5A 2ZSUA 2P9TA 3L8GA 4ZVLA 1CB0A 5DNUA 4RPKA 4Z9BA 3DMPA 1GCOA 1DG1G 3L4BC 1VZ3A 1SXQA 2BCJQ 2F1KA 4ZP1A 3FGNA 3IP1A 1CEEA 3U80A 2XVMA 3MRTA 1MZVA 5AIAA 2G9NA 1T25A 2ONCA 2CL7X 5KYUB 6AT1A 3DSRA 3I05A 4Y0VA 4Z0TA 3BE5A 2GD0A 3RSQA 4C6HA 1U9ZA 1FW6A 4LG1A 4R01A 5K0EA 4JR1A 2XXJA 1IJBA 2NTJA 3INRA 3AYXB 4QICA 3RM3A 2I03A 1OH5A 2X4GA 3GA7A 3GRYA 4HWRA 1QH0A 4X7PA 1KO4A 3GFQA 3C3EA 2WZQA 4D4HA 2GM4A 3QHQA 5BNTA 2Y1CA 2Q7OE 5KTKA 4KI7A 4Y2PA 3W5BA 2CLFB 4YYZA 4M8NE 4MS1B 4QTTB 1GOTA 3FYUB 4IYRA 1YB4A 5JCJD 5CA0A 1CY0A 2IVZA 1OFUX 3W04A 2ZITA 3FNIA 5A62A 3O8CA 2QN2A 3D4LA 2ATCA 3E9DA 3S70A 3KLBA 5F9HA 4NHEA 3RTEA 1W4RA 4RZ3A 3WMGA 3GJQA 4PLPA 1FTSA 4K9PA 1TUGA 5TPWA 4FD2A 5CCXA 3T5TA 1M1YA 3R23A 4ONEA 1CLUA 2Q9BA 4EY3A 4Q24A 4U5XA 5HIKA 2RB5A 4IQ0A 4DZRA 2UXBB 2UVDA 3DPUA 3RGWS 2J3QA 2PDAA 3SVZA 1B14A 2H52A 3P9XA 3NHUA 4RV9A 1EDBA 1FYEA 1K7FB 2I71A 2ZIWB 3U7QB 3QA9A 4I50B 5HUHA 5IS2A 5FNVF 4Q7JB 4LDQA 1K66A 1W73A 2RKOA 3T7KA 4C3VA 5ED4A 4Q3CA 2CXHA 4Q18A 4MS4A 3VVCA 5KJEA 1F8UA 1KH2A 2ZU0C 4P84A 4BBAA 1AMOA 4B0OA 3QPAA 3AQIA 1TZBA 1B6RA 1XEFA 3ZI4A 3VSDA 3L1JA 4G86A 2AFHE 4F45A 3ASVA 4BO2A 2NX2A 2IIQA 2W4IA 2O7RA 3EGOA 3O1HB 4CLRA 3RUIA 5E6RA 5B3KA 4DV6B 3UK2A 1E1RA 5FD8A 4ITUA 4OHFA 5E1MA 1M7GA 5LLSA 2VF4X 4ETNA 3ETDA 1OZHA 5E38A 4P35A 3PXAA 5EJAA 3EXHB 5KSWB 4IDQA 2XMSA 4UVGA 3A4YA 2ZJ1A 2YS6A 3HWSA 1IXKA 4P32A 4G5SA 2Q6LA 4G4IA 4J03A 5BW4A 4BTEA 3VR2A 3ETCA 5AM3A 1QMGA 4P0TA 4W7SA 3ZDCA 2J6IA 1J9GA 1TA9A 3R44A 1V6AA 3GFVA 4RMIA 5G0WA 2WWXA 4JYZA 4BCCA 4EA7A 1PVDA 2G1AA 3ORYA 5LP6A 2DJIA 1FA9A 2UUPA 4CM5A 5EJ8A 3G6KA 4YJ2B 5AIBA 4DV0B 2IE8A 3JS5A 3KV3O 1CZUA 4DLSA 1U1DA 5CX1A 4Y6PA 5BYBA 1J2UA 4NK5A 2LNDA 2OB1A 4JYMA 2B25A 3LY9A 2N1MA 4X3OA 4A23A 4U2CA 4CQMB 1OFTA 4CKCB 3LO5A 2WJPA 4PHTA 4G07A 1DKPA 1R6XA 1S1CA 1T9AA 2C03A 1F0PA 2WT9A 5IAKA 3H17A 4Z9FA 3MIIA 1T3ZA 2X9GA 2JVIA 5CCEA 2D0PB 5WRFA 1FMLA 3IDSA 1TDJA 1M67A 3IP3A 3L8HA 1Z3CA 1YQWA 4EKNB 3B2EA 4A26A 1XA3A 1FCJA 2D2VA 2WKWA 5ARDA 4ZT6A 5K3SA 3W2EA 4CCWA 1W4CA 1B6SA 3RU3A 4Q82A 1REQA 1IWBB 3AF4A 2GKGA 3QX9A 1CJSA 3DW1X 3DEJA 4KQFA 3HCRA 5CB4A 1RE0A 2XDQB 3DMGA 5JSQA 1EVJA 1VJRA 3OLXA 1FU4A 1T5DX 3EC2A 1AKEA 3LI2A 4YGXB 4C0KA 3U3MA 3U26A 4TVSA 3B7WA 1ZUIA 5LBIA 1NL3A 2VDWA 1CNMA 4GZLA 2X9VA 4WLEA 3CT4A 3PQDA 4B81A 5LVAA 3E81A 4JVLA 3KQVA 3N8IA 1I7SB 3BSYA 4JS0A 4JI4B 2DR3A 4NQZA 5CVCA 2FKAA 1TJYA 4J16A 4WVFA 4ZT7A 4RTKA 2GPWA 3MA0A 1ISIA 1N4DA 5IJWA 3I42A 4FYJA 4KR3A 1QR2A 4D99A 2PX0A 2CF6A 4Z4FA 4YUWA 1GGHA 4G1MB 1DJQA 5ILQA 1IY1A 2NV2B 2A2ZA 1ZRSA 3W4JA 1SMKA 2BFFB 2O2GA 2OBLA 4TMWA 3SWWA 3K6SA 1L0BA 1ECFA 2RHBA 5LDHA 2HIAA 2EFYA 2W2TA 3PFCA 3EZLA 3IUBA 4V0MA 1TPZA 1Q91A 2O7SA 3N0WA 1CUXA 4Q48A 2BGWA 2QN7A 2C1EA 3BE6A 4I66A 3NBKA 4FGLA 3HCNA 3OEHA 4C0WA 2R6AA 1GITA 4PSDA 4CCAA 1TE2A 5L4LA 1QC5B 4PC6A 4EMBA 1DMRA 3VI4B 1W29A 1KDVA 2ZLBA 4JP2A 3KOYA 2K4MA 2PJRA 4ENPA 5ESDA 3BD6A 4C21A 2ZE7A 5EEHA 1GQSA 1WV1A 1RWQA 1E1LA 3Q3EA 3C6BA 4BO5A 4OG2A 4Q3DA 4RTLA 1A8PA 1BS2A 3SXUA 4P7FA 4JHXA 4JWTA 1E8DA 2EX4A 2WJYA 5FOQA 1ST3A 4RD6A 1Y98A 3OMXA 4GNKA 3CZMA 1JB1A 1BVRA 2JIQA 3FMPB 1ND5A 3OX3A 4S0XA 5AI4A 4DQDA 5KQLA 5LFAA 2DFLA 1Z5UA 1DBRA 3EGEA 3OKPA 1YZUA 1ZH0A 3TQQA 3AUSA 1WB6A 1SCDA 5DNWA 2IYXA 1E89A 3QOWA 5CA0F 1GAEO 1HDEA 5JJCA 3N86A 4LGVA 1NRXA 1V8DA 4JJEA 3AJEA 1P2GA 3CLUC 3PLRA 3AXTA 1DXHA 2C98A 4AURA 2LZ0A 3QYPA 3Q3VA 1TQHA 4RZHA 4XD2A 1JFFB 3DD1A 2XUQA 3FVTA 3P8ZA 1L5NA 5BQ3A 4FFNA 4KXVA 4MV1A 4PINA 3GDOA 1W0JD 3GN2A 3NHBA 4L8GA 4X93A 3K92A 4XASA 1Y9DA 1P31A 2YVQA 7GPBA 3FW1A 4WKOA 4BGVA 2ZVPX 3D7RA 1F1JA 2DPHA 1CDDA 4HDAA 5B7PA 2BSQA 3IEPA 1ZIDA 2ZIVB 4P4LA 3LT5A 3WYCA 2C88A 2QMHA 1M5UA 2DHRA 2B6NA 2NYVA 3HYRA 3AY0A 4UNRA 5IRCD 4KJZA 1LH0A 1ND6A 2P30A 1QGDA 1E32A 3R0ZA 2QQ0A 4KGXA 2M6LA 3ZZMA 3WL8A 4EVQA 4ZA2A 3KSRA 3BILA 4YQYA 3FSRA 5D1HA 5AW7A 2YMPA 2G1JA 5EERA 2O05A 1C7IA 5ALIA 5B1SA 4XIJA 3FHLA 1PR4A 1R0WA 4E32A 1WUHS 4B3SB 3B52X 2F1IA 3KUXA 1TVCA 3SXPA 1WEKA 3TD6A 4BO6A 4UUOA 1DAEA 3WLFA 1FRVA 5TQ0A 5KMGA 1PJCA 2X5NA 4RMGA 1FBTA 2IYAA 3PWZA 2D2IA 4IGKA 1RQXA 2I22A 1G20B 3NWOA 1Y3BE 3PI6A 1Y80A 3WDSA 4BQNA 2CLEB 5CA1A 5I47A 3E3NA 4KWCA 3RJTA 4MQEB 1T5LA 1UZLA 2QWXA 1H4TA 4ENRA 3SZOA 2P0AA 4I14A 4CGYA 3SY8A 1EJBA 3RFXA 3PFHA 3D81A 4MROA 2L18A 1AUQA 2QPAA 4CCYB 1G8JA 1VRWA 2H63A 2ZTUA 3FE2A 3VC1A 5IMSA 4MUIA 4RC9A 2AOTB 3GGSA 3X43A 1P61B 4ZAFA 1H05A 2IH5A 1UM8A 2AL7A 4AD8A 1QCCA 3HR8A 3PZBA 3HR4A 3S4YA 3QOFA 3VYUB 4EELA 2D5IA 5GM1A 3RU9A 1JI3A 1RYHA 1IB0A 1UDAA 2NTYC 2I54A 1E4VA 2FMUA 4H59A 4HFRA 1MXHA 2OOSA 4EGJA 3OQMA 2B5OA 4BCDA 2Y1FA 4RETA 3I5UA 2FPUA 1E3WA 1UOOA 4DC0A 4E3ZA 1EGAA 3OF3A 3PYMA 1KK3A 4RHYA 4F2PA 1RXWA 1OASA 5FUXA 1YJBA 3RHFA 2FRDA 1QDEA 4XYLA 1OB5A 1P7CA 1RZ3A 2QW0X 2PXAA 5AKYA 2UUCB 1T5OA 2NO0A 4I36A 5CBPA 3U44B 3PXEA 1WHTB 4Q4JA 4QNRA 3QMWA 5K0LA 3TSOA 3EAQA 4HS4A 3MWJA 4RLHA 3E9RA 3B6MA 4P6VF 1VIVA 2CMGA 2IUFA 5GY7A 1KERA 1VGQA 2ZWIA 3RB8A 3PRYA 2ZYIA 1JSCA 4PC7A 3OD5A 3HXKA 2C77A 3AM5A 4NVRA 3WTBA 3DE0X 4QOHA 1PR1A 3ST7A 1P0PA 1TM4E 1GU7A 2LCIA 3VPDA 2OCIA 1SIUA 1JDJA 2BEWB 2YZNA 1VMEA 1CUZA 4KRXA 4Q39A 5K0TA 3R3XA 3QP9A 5J59A 2C42A 1WZNA 3BQNB 3KU4A 1V35A 1RPJA 4LHVA 4OQPA 1XCOA 4XB1A 1Y3IA 3LX8A 4J3FA 4FNOA 4X0EA 2Q5HA 1UKBA 5KTTA 1R0CA 3IUEA 5H9WA 1HDOA 1V6SA 1G21B 1T3LA 1YQTA 2B4YA 2R8RA 2CFTA 1V37A 1COWA 4XGNA 5JBNA 2HA7A 1TZJA 2B3DA 4BVGA 3T1OA 5FDFA 3I28A 1QVRA 2RGWA 2ONJA 4OQ4A 1DWPA 5IDWA 3BZUA 4TV9A 4DVGA 4OY3A 2ID8A 4EHAA 2QG6A 2GEUA 3ISTA 3EUEA 1P2VA 1WPXA 1QAMA 3B85A 5J4VA 1H8HD 2H2IA 3JQFC 4HYTA 1ZHHA 2FG7C 4I4TB 3VU8A 1JWLA 3HK2A 1M1YE 2ICAA 3LHFA 3ZIAD 5IHPA 1QTQA 3FPJA 5FBVB 1S01A 2W4MA 1XWWA 2O14A 2XTMA 4HAOA 4L4ZA 2FG5A 2HLDD 5EPUA 4UBNA 5HK8A 4DJFC 2HZ7A 1CUEA 3AI3A 1M73E 3ITNA 1TGYA 4E11A 1QE5A 5KWEA 1UDCA 4PXYA 3AB3A 1JP7A 3CRZA 3IC5A 3JTEA 3DFKA 3CRQA 1WPQA 4HDRB 5CD9A 3FOBA 1O4VA 3LA6A 2V4ZA 4F1WA 1RIFA 1NQVA 3GO4A 1OHHD 4BWGA 5CB4B 2WMDA 1J0BA 4FOOA 3CEJA 3HCAA 1T2FA 3RIYA 2JD1A 3A6DA 4ZCQA 4FYIA 5C7YA 1XTIA 3K0AA 4EI7A 1QVAA 3B1ZA 1Y8RB 3SX0A 3G0CA 4CM9D 1VQ1A 1IBMB 5C8ZA 2JFOA 3JR3A 4J1SA 4BP1A 2JGLA 1MQ9A 1OC4A 4GM1A 1ZOOA 4ZXPA 2SNIE 4N7MA 3FYHA 1P9LA 3HCCA 4Z9YA 5EMNA 4MH0R 3VZQA 3BFXA 4R84A 1SXJC 3BG5A 1DXQA 1N2BA 4KQWA 4HAYA 1MHPA 4TVOA 4UU8A 1VRCA 5DHAA 1JILA 2JFUA 2Q1WA 2IELA 4LYJA 4EKYA 2Q99A 3AR5A 3JQAD 2ZRCA 3GAMA 3JD0A 4KBYA 2PXCA 3R7WB 3SC2A 3WGTA 3KS9A 3MSXA 2H5IA 1W52X 2AFVA 4JQZA 4P53A 3WMWA 2EKPA 5B1IA 4B17A 4EYGA 3KKPA 2JAHA 4AN0A 1WW8A 1QHXA 3CB2A 1Q2XA 3ONFA 4P4NA 3TE7A 3AX6A 1CS4C 1EFAA 1K7CA 2JJMA 3MJRA 4FDLA 4RZXA 2RDMA 4FI3F 1YS9A 5C8YB 4UOEA 3DDHA 4W6QA 1TXGA 1N32B 2IHBA 1L4NA 1S2LA 1SZDA 4H7IA 2ZRIA 3ESAA 5F7ZA 1V1MA 5THKA 4REQB 5BRNA 4PRKA 2Q5EA 5FL3A 4WESB 1JAHA 1IBCA 3O4IA 4N82A 4UBMA 4ADSG 4AXBA 2WHEA 1U9JA 2XUIA 1EYZA 3IQDB 2J5XA 1EAMA 4TS4A 1VIDA 3WYEA 3E9NA 3RVRA 4K0KB 4P9NA 4IGIA 4BNZA 2CZGA 1N25A 1W94A 3QVTA 4DQLA 2YY6A 2VAXA 1WP9A 4UNSA 3A1WA 1H9CA 3DMFA 4TN5A 4NBNA 2QX9A 1M83A 2XNDA 1ICIA 3B48A 1MENA 2TS1A 2ZBPA 2RHLA 3CLSC 4UPEA 3KDAA 1EK0A 1R0RE 5DGHA 1AKRA 6REQA 1WPGA 2RH5A 1MTZA 3IV7A 2FSVA 3K0BA 3R6LA 4G5HA 5FUYA 1E7QA 3N05A 1DOHA 2P4SA 1I7QB 1SKYE 1LTHR 3MGBA 3G5UA 1ZA1A 3IKTA 2IXTA 4BVFA 4MB6A 1LBEA 2VATA 4UM8B 3GMTA 1CV2A 4YYEA 3NDRA 1O87A 1QGED 3C43A 1USWA 2FW6A 2FFJA 4G0NA 4E1BA 1JDUA 3GPIA 1OFVA 1QVZA 1TC1A 3BUSA 4OQLA 3HCWA 5AK0A 4K81B 2YXBA 3FTPA 4GMGA 4DSTA 3T3EA 2D1RA 2YXDA 3O95A 1TO2E 3QWIA 3RVMA 5BPFA 4E7PA 1FNMA 5H3CA 4F92B 3S0JA 5I6DA 4DPKA 3D6FA 2QTWB 1LSUA 2C5GA 1G1AA 1X3SA 3ZHRA 3MBKA 2HDNB 1ZVKA 1RW4A 3SIWA 3JX9A 1A9RA 1KYYA 1U9IC 1ONPA 2MYNA 2C7QA 1R5BA 2VJOA 2ZRQA 3A1TA 4Y6SA 1G7CA 4M1QA 5ERGB 1TF2A 3BXFA 1NF9A 1GN8A 3Q3CA 1KGDA 4HADA 5JALA 5IC6A 2XVZA 1PNVA 1O6CA 2RHCA 4AY2A 5EWJB 3INTA 1CF9A 3E1SA 4FJ2A 4JI1B 3RRXA 2QKYA 4PYQA 3LWDA 4GP9A 4TM7A 1XVLA 2DTXA 2OR3A 2EGHA 3GEBA 2BD0A 1JYEA 3O8LA 2QTNA 2CV0A 1X2EA 3K53A 1PJQA 1E1DA 3EXIB 4UREA 5EXDA 3W34A 2P9JA 5EHIA 3VO1A 1R12A 3G1UA 2GN6A 4EO9A 1DAFA 3ZHCA 2HV9A 1QG2A 4K0RA 3CWQA 4FVTA 4OMDA 2YJ5A 4NF2A 4CHTA 3BAFA 2JFVA 4K1LA 3TTSA 4DB4A 2HDWA 2HWXA 2ANBA 2WTMA 2DHQA 1N0UA 2BZGA 2WM9B 3A8TA 3R4CA 3UGQA 3P9YA 5JR3A 3J81k 1SUCA 4RY2A 3PVZA 3EGDA 3F5MA 4WKGA 1CE8A 5AKEA 2EZUA 1Z08A 1I1QB 5HWSA 4P80A 2R5FA 1BYUA 3EGIA 2NVUB 1L5SA 4QPZA 1OI2A 4CI9A 1YBMA 4CTOA 4N03A 4LZAA 2JFBA 4DV4B 2WNIA 4OQMA 4EY6A 4QG7A 2QVGA 1VLVA 4FWBA 4YWHA 5HS4A 4N41A 3BL8A 5FA6A 1AQYA 5EVJA 5IASA 4I9UA 1EUDA 1WOYA 3I4LA 4MJXA 4PLCA 1RKBA 4Z99A 5DOVA 5KC8A 1P44A 1GIAA 4ZRDA 3DFMA 5H0IA 4AJ1A 3EGWA 2E5LB 3ZJUA 1O97C 2YYAA 2WYHA 2Q6OA 2SKEA 4FYYA 4Y9UA 4X1YA 3OOEA 4F5ZA 2F3RA 4QAQA 5JI2E 1JEEA 5EJ6A 1BDBA 4IUDS 1GTVA 1I0LA 2RGAA 3U3JA 3ZG6A 1QHFA 3GPDG 2FNAA 5DHRA 5IT0A 4EJSC 1G6Q1 1DBPA 1XTBA 2XDAA 1GZ7A 1Z0DA 1ZLYA 1DARA 1HZZC 1JEQA 1FYFA 2DJ5A 2RHWA 2VSNA 3EODA 4N5NA 3B9BA 4TMVA 5JC8A 1VL5A 2JI7A 4KMOA 3FVWA 4M0DA 1NP7A 2R1VB 3MPOA 3ESYA 4PAQA 4YI5A 1NXWA 3JVEA 3QIVA 3RT9A 5BR8B 5I8ZA 5CCBA 1A97A 1VYVA 4I4IA 4O4LA 1N2XA 4WKPA 3RASA 3JYOA 1SXPA 1WVGA 4U1RA 1XPUA 1AD2A 1V1RA 2A6PA 3JQRA 2AN5A 4ZYZA 2FU5C 4O4HB 2YOHA 1D4FA 2ACEA 2FPGA 3JY6A 1VKJA 3D0RA 1P2FA 1EE2A 1RKUA 3TUZC 2GTPA 4PC1A 1C9MA 4IDPA 1ZH2A 3ZLTA 3TJZA 5GADl 2W6MA 2XW6A 2BI4A 5EKUA 5DYGA 1XEWX 1N0WA 1NP6A 2N3ZA 1U0OC 5A9TA 3DOOA 1UDWA 3GXBA 5IDQA 3U4MA 1RRGA 4E14A 3ZUPA 3VGPA 4C3OB 3NQ41 3SXJA 3K73O 2BZSA 1LPAB 2VO1A 3ODPA 3OOHA 2Z0MA 3VVLA 5A1JA 2FPPB 4KFTA 1UH5A 4RIIA 1FP6A 4EY7A 1Z8NA 1X70A 3KL2A 1MIHA 1P7VA 3MJCA 4GWLA 3HV2A 5GV7A 4KDRA 1N5JA 2IXAA 4IYJA 4RCYA 4EL0A 3KQQA 3V8BA 1JG7A 3WNVA 4LUCA 1OA1A 4HQLA 5CNIA 3TR6A 4LDJA 2VXBA 5JSZB 2AKAB 2Q07A 4KNWA 3DXYA 3TUIC 4HZGA 4LBWA 5CPBA 4WI1A 4MR7B 4C29A 2QTTA 3UUFA 3ORQA 4GPD1 3B70A 3K8QA 2LVBA 5CR9A 1A4RA 3JPYA 5K8IA 3QFFA 4M1YA 2I4IA 3UV7A 5LA6B 2XMBA 4QQNA 3CLVA 3G2MA 3HVIA 4FWIB 3T12A 2CXUA 3MB8A 1B2LA 1AB5A 1EK5A 1OPRA 2QTZA 4JLKA 4DR6B 1CUDA 1E4OA 4HTFB 3VHQA 2C8VA 5GONF 3I9LA 1DKNA 4CV1A 2QSYA 2XVYA 3W05A 1W35A 2OHFA 3TFQA 2W70A 5EUQB 2YMMA 5FJJA 1J5XA 2YZMA 5JSHA 4ASUD 3GW8A 2R60A 3H87A 1ULUA 1PJ4A 2FCAA 5IC5A 3PE6A 3EVZA 2P9EA 4B2IA 1Q7EA 3QXCA 3IP8A 4C9BA 2DLCX 1J09A 3MJHA 4P7BA 4CG0A 1A72A 2CHUA 1CQXA 4FS8A 4MRMA 4EZIA 3E61A 1OE0A 2O8FA 4ROTA 1ADBA 1KYIA 3N2GB 1MJNA 1WXEA 4G0PA 3ZX4A 3QXXA 3RS5A 3MNFA 4BN4A 1UBFA 1ZONA 5JAZA 2OILA 2PH3A 1OOEA 2V7TA 3K16A 4PANA 4RSHA 2QBYA 3RYHB 3SQDA 3JWGA 4B5KA 3U60B 3TRKA 2QTBA 4RACA 2JH3A 3CMMA 3KSMA 4A4DA 1YGYA 2G76A 3P9CA 4GLOA 3UFBA 3MMPA 4F97A 5IT9A 5DGDA 4B87A 4PBSA 3UENA 5SY4A 2QLFA 5EQDA 2Y8EA 2FPOA 2HUNA 1X1TA 2WU4A 3BGOS 2XA9A 3WYDA 4HFJA 1CY7A 1G3QA 1KJQA 2IUSA 3D59A 1AK9A 1X0VA 4U9IS 2P9FA 1WLSA 3NW9A 5FQOA 1G20E 1HQDA 1OX6A 1V8FA 2VK1A 1PJ3A 4ZYLA 2C0PA 3SG0A 5CT5A 1IPEA 4EA8A 3N2EA 5HOEA 3L6RA 3JQ7B 4OMUA 2OYCA 1CF4A 1R4ZA 3CNNA 3M81A 4K6GA 4CM9A 1U2TA 3O9ZA 1JSZA 3SX4A 1OYOA 2OSVA 4C4ZA 3O1LA 5AI8A 1Q0PA 1A50B 5BQOA 1RZUA 2BJHA 2CXTA 2QMOA 3UTCA 3B6KA 4H7PA 4YR9A 3ACBA 3L5OA 1EFRD 4BLSA 1H2BA 1SEVA 3FETA 5J5CA 3M6UA 4EPXA 4B3TB 5JAIA 5JO9A 4H35A 5M7EA 1XQVA 1RJ9A 1JKFA 2QN8A 5F2OA 1YBAA 4HNVA 3RVNA 4X44A 1N78A 1EUQA 2G7MC 1QBKC 2WF9A 3UXMA 3A4NA 3BIJA 2C4UA 5B2EA 2ZSHA 5SICE 3DC2A 3WNQA 3OIVA 3QVKA 3KD2A 1GVNB 3RVKA 2G5PA 2EDAA 3HXPA 1G4AE 4DSAA 1QO9A 2GKOA 3FPLA 1NWHA 3TRHA 2C59A 3RT7A 3QSYA 1IOWA 1G18A 1PVVA 1ZUNB 2FRXA 3LBYA 1J56A 4Q1BA 4PYLA 3EH1A 3NYIA 2O2YA 4OF4A 1ADCA 1GPYA 4CMEA 4G3XA 1W5AA 5LMCA 3PIRA 4E07A 3QY0A 2O3TA 2R6GA 2P5YA 4NBKA 2Q3DA 1SK8A 1FUIA 4E1AA 4F46A 4Q1VA 4B4DA 4ZTZB 2XE6A 5DASA 1GCAA 1SXJB 2KMLA 3IEMA 3MBIA 1KS2A 1TA4A 3C8MA 3B9RA 3VR1A 5I9NA 1UMCA 3ZDFA 1IN6A 1XVVA 2HREA 4OAPA 1B0UA 1N0HA 4DNOA 3U9LA 4OBXA 2I4MA 3HACA 4R0NA 4UD2A 2AFRA 3MT8A 4FMPA 3WLSA 3EG5A 4OHRA 4LHYA 3DLCA 4IIJB 3BCUA 2BGGA 5GJBA 1JU9A 3DEFA 3EOAI 5IC4A 4IMRA 2VYVD 2ZTHA 1KVUA 1VBKA 3K96A 4UHHA 2VZLA 4LY3A 1VP3A 4OGFA 1Z0FA 2OZEA 4WZAB 4X62B 4BLPA 4FZJA 2WPDD 2DULA 4ZQCB 3WGKA 1YC5A 4H4EA 2X8BA 3DTVD 3TI9A 3GBPA 1QU3A 1OUMA 1NT2A 1OX4A 1VLMA 3BJRA 4D56A 3TJRA 4GS5A 4PPQA 3SZGA 4J8PA 1M2KA 2XCLA 1WXWA 3P26A 4PGHA 3QWBA 1S96A 2OO5C 4LYDA 5K0GA 1XFAA 1ZWLA 4MW6A 4C06A 3N0RA 5AW2A 5KQPA 3F8WA 1Q77A 5E9JA 5JXGA 1BGWA 1USUA 2Z09A 1RRKA 3MJVA 4I5EA 2XXAA 2PZEA 1YV9A 2ZB7A 4D9MA 1PNTA 1CS0A 4RZUA 3RFCA 4I5DA 2P3QA 1X7XA 2C9OA 4HEA6 4V0LA 4ZYYA 3IBCA 2ZZMA 2CJWB 3RSZA 4AJ4A 2W4QA 4OFWA 5I7RA 4L4RA 5CJJA 3KPJA 1SFRA 3EDQA 4DIUA 3OTOB 2AMFA 3WJ7A 2RMKA 4QUJA 1N7IA 16PKA 2GK7A 2WILA 2A3NA 2Y6UA 3B89A 1ZK1A 3Q0TA 2LRHA 2DG2A 2WM8A 5ES4B 4UCQA 3DDZX 4BMDA 3K6JA 5JZMA 1Q17A 4GOJA 121PA 4EI2A 4G25A 2GYUA 3FTFA 3MTIA 2G08A 5TC4A 5FP0A 4Y2RA 1MAUA 5AW1A 4A82A 4CRWB 2D00A 3JQPA 4YJGB 6GPBA 4E21A 3WQQA 2P78A 2GFHA 4ZAVA 1HE2A 2BVNA 2GK3A 2IYOA 2PEZA 3F6PA 4Q1DA 1L5KA 3MC1A 3C4JA 4HH4A 1FTQA 3TQRA 3AL2A 1LK7A 2AMJA 1SUAA 3GLHB 1U0BB 1AKYA 2Q50A 1RQGA 3MT0A 2ZXFA 3V34A 3EF1A 3AXSA 3M1IA 3RTGA 3KQTA 4Y2JA 2GXSA 4HTAA 5FYDA 1SEPA 1XFDA 1ZL2A 2OCLA 1RAGA 2ASEA 3EC7A 3LCRA 4JJKA 4EA9A 4E33A 1Z36A 3O8DA 4QGFA 2GD6A 1W0JA 4E5MA 2YVKA 4CM8A 3EEIA 3NAZA 1HKUA 3O5AA 4DRZA 5EZYA 1WVMA 5LKAA 5DK6A 4TLCA 3GLIE 2EBHX 2RB4A 1C30A 3UBMA 4BZPA 4PPGA 4OOEA 4OLFA 3RS0A 4LOKA 4Z54A 5KYKA 5IZ4A 5HIMA 5F23A 3TM5A 5KAPA 3PA8A 2GM3A 3GUZA 2GR9A 3HUEA 3TLZA 3FJ1A 2ZB8A 4LRWA 4IICA 4V39A 3FJOA 4AYXA 5AW3A 4R3NA 2D6FA 2VDUE 3H2HA 4X00A 2VUUA 4CMBA 4YJ2A 2HMUA 4KN9S 3IDQA 4TXJA 1QFZA 5AUOB 3TCKA 1N2ZA 1KOFA 3V1MA 2BGJA 4BJ3A 4YRDA 3BULA 3RS9A 3BXHA 2GJ9A 3QPDA 2CLMB 4GX2A 4EA6A 3KVRA 2JLYA 1YZGA 4FLMA 3JWJA 4Y8VA 4D80A 3OCYA 3OQPA 4FW9A 5TB5A 4QU9A 2CJPA 3V2GA 4EVIA 1E6LA 3JQQA 3WFIA 3OQVA 4PLTA 3TTTA 1N77A 4MVYA 4L8WB 2GCOA 1MB3A 2VBGA 5JDCC 2Q4BA 1PYDA 4MYCA 5A5GA 1YZ3A 4TWBA 4M55A 2I2FA 3W5AA 1DB3A 3JQBA 1KY3A 5AJXA 5FWXB 3GB9A 1RPNA 5IKMA 1C0IA 4ZDJA 4UHKA 3HXTA 4RULA 4TRNA 5JCXA 4X45A 1JAZA 1CYEA 1SUIA 2HJ9A 1GPWB 4DMHA 2Y2UA 4B80A 2H17A 4B2YA 4AYTA 2QNIA 4XRRA 4JP5A 4ZVRA 4CQMD 1ZVMA 1PT6A 1XQ6A 3R6GA 4J3JA 3IELA 4JUIA 3LDAA 1KH3A 2QM0A 4ZC1A 2VJNA 5JVDB 3ZHQA 3SE7A 1YDGA 1KFJB 2FPPA 1Q0ZA 2M6RA 3T95A 3MCZA 4LE2A 4AMZA 2HJVA 1N2CE 4CWAA 5JRZA 3KLPX 4CL2A 3H04A 1HYBA 1CVLA 1RP1A 3OJXA 3TNDA 1AX9A 1RXVA 1ZISA 4A73A 1F2UB 4RFSB 4WGFA 2BGRA 3D1JA 1MG5A 5MFPA 3LPNA 3HRKA 3I62A 3CNEA 4MI3A 2C84A 2FX2A 4W8GA 3A9UA 1T91A 2I1LA 2OV8A 3NNNA 1XTJA 4EUNA 4IFEA 5KWIA 3PX7A 5IVKA 1BWPA 5D2CA 2YYSA 1IQRA 2PSDA 4LN1A 1S8NA 4BGIA 1EFUA 4TMKA 3AESB 5K5EA 3L7JA 3V7FA 3K4PA 4ZQBA 1W36D 5KNBH 3HKEA 4Q03A 1RMTA 4BGDA 3C39A 1A5BB 4ISCA 2QZPA 2OORA 3NKFA 2DBZA 2Y99A 3J80A 1NXTA 4ED9A 1Z2EA 2ZUVA 2CJXA 3HP1A 3A70A 4MRRA 2D1YA 1XF1A 3BJMA 5EMLA 2EYUA 2VKQA 3ETLA 2BP7A 3A05A 3HMKA 2E49A 1R2QA 1X1CA 3OQ6A 4N5DA 4RVHA 4BRZA 5HM8A 5IW8A 1YBFA 1P7WA 2X15A 4UU0A 5REQB 1V71A 1ODCA 3C24A 4MP6A 4OLAA 3OX2A 3ZY5A 1USIA 1H69A 2ES4A 5AVOA 4B3HA 1IEWA 4FR0A 5KQGA 2ZM5A 3Q88A 1JFSA 2ZJ4A 4O5OA 1Y1RA 4P33A 2ZSIA 1N7JA 3EXG2 4OFBA 2FF5A 2ZAGA 3T4PA 3F7TA 4RIHA 3L1HA 3LXMA 2Q5QA 4KQHA 4ND7A 1RWWA 3OECA 1YF3A 2Z8XA 2O1SA 1CX9B 1FFEA 1XYYA 2EFCB 4DAEA 1U1FA 4OQDA 1JXOA 1OXXK 1RYBA 1V8BA 4YMIA 4F3RA 2P4EA 1FK8A 5HQ3B 5A04A 2JCXA 3RADC 3MD9A 2MSEB 4R8LA 1QAQA 5FIUA 1KY4A 3CUWA 2YWXA 3EPHA 5ILGA 5EJ7A 3NC0C 4KJXA 4TLMB 2GN4A 1US8A 3ZY3A 4UNPA 1EJ0A 3FX2A 4I3FA 1F48A 1GG9A 2R96A 4QM7A 1IOZA 4NLLA 3NPMA 3QELB 5CURA 2BFEB 2WIGA 2BGLA 3ZNNA 1DV1A 1CEXA 3IEKA 4GUAA 4MVJI 2FUG6 4L27A 3UGKA 4B8WA 5K8TA 1LB1B 1Q19A 2A59A 3UVEA 2HUPA 4B8ZA 1AN9A 3WJ1A 1ULHA 3BMCA 1MABA 3PJFA 3OT4A 3PYLA 3VRHA 1DCTA 4LBYA 3MMXA 3LVRE 4XB2A 2ADMA 2GD2A 3RRMA 2YBEA 4Q1AA 1NLZA 1W0KA 2QSZA 2IYUA 2R00A 4BYMA 4GEGA 1EHCA 1P5HA 3TG2A 4HNQA 3HSSA 3TCXB 3DONA 1E2MA 5UKDA 1MV8A 4UHFA 1EG7A 3GOQA 3M9WA 1K92A 1O0BA 4FMDF 1FFXB 2HRZA 4QO7A 3RKSA 3EC1A 5EHGA 3QTBA 5L95A 1SPXA 1TUBA 3I2FA 5EJEA 3OAAA 2PX8A 4HXYA 3G5AA 1GNSA 4HUQA 3X44A 4YGYA 4PZAA 2O54A 4N1AA 3O2JA 5DYIA 3M4XA 3WKDA 5JH7F 2Q5CA 3I04M 4W4TA 2PNFA 1XQ9A 1MABB 4V0SA 4KW7A 2ZAIA 3AVVA 1CP2A 4DQXA 2FXVA 3P9IA 3ZLJA 1FDUA 3P9RA 1NG9A 1QRSA 2OY0A 5IEJA 3HVRA 3FLBA 4JLVA 3K9LA 5T4FA 5KKAA 2RIPA 1R27A 1P7PA 2VNHA 3ONWA 3G2PA 4LX0A 4OKSA 5AKGA 4DXAA 1W96A 3DXZA 5DSZA 1YNOA 5F35A 4KKXB 4JROA 4EBFA 2HJRA 2JK0A 1V3TA 2CFIA 1KEEA 13PKA 2QTMA 1O5IA 2ZR0A 4HS9A 1ZD2P 4KPUB 3THOA 3H83A 2F3PA 3IVMA 3MLEA 3PZRA 1KXJA 2W6ID 4QJIA 4AF6A 3ZHXA 3NOXA 1RQRA 1W93A 4DIDA 5MDHA 3FF4A 1XD8A 2IPNA 3VPXA 1GGFA 4X8MA 4Q7LA 4R54A 4X61A 5EP2A 1NJSA 1KI4A 2F8MA 1XC7A 2IOFA 3DAYA 3MW8A 2HL6A 5HM6A 3A6HA 4IIJA 4AZSA 1P7YA 3ONDA 1KJIA 2VJPA 1OBVA 721PA 3C5EA 5E7IA 2PL1A 1ZGZA 1KMMA 4TTTS 3UHJA 3SEZA 2JJ2D 4PPYA 4JUBA 1QSGA 1Z4NA 4B3MB 4I1VA 3T5GA 1Q7CA 4TTAA 3JWIA 2JVJA 5J2UF 1ZHOA 3E2IA 3IAM6 1FJXA 1XVAA 1KFEB 4DRYA 4IUCS 1KR2A 3BDVA 1ETUA 3D2BA 3INYA 4RAQA 4Z4EA 4OXNA 2JLXA 1VE9A 1Q2UA 2ZUDA 3NOQA 3RV3A 5E7QA 3KQLA 2CLSA 2HA6A 2ZDQA 3IP6A 3K1AA 3Q7RA 1NLMA 1PR9A 2IP4A 2OSBA 1BG6A 2Q9CA 1OB2A 2W0MA 2QE7A 2WLTA 4FGKA 2WWYA 1Z3IX 3HBFA 2COUA 3DGFC 4MOWA 2GB4A 4GMXA 4PTZA 4TLEA 3WAJA 2VJCA 1E4EA 4A7PA 1LTQA 1WZCA 5I4KA 2B37A 1KYXA 1GADO 4HEQA 2WU1A 1Z6GA 4QBTA 4E1VA 3T7DA 1S1MA 5JCOA 3ZGZA 2F2TA 5IPFA 3LPAA 3CRMA 4YROA 4FNMA 2VHQA 3HLYA 1QWOA 4CMGA 3OE7D 1I1HA 2RGYA 1W44A 2B5WA 2DWOA 2Q4RA 4OQQA 4XIFA 1G9XA 2I66A 2A78A 3UHOA 5FO0A 1N34B 1IULA 5EIBC 1Z0KA 4JN6B 3WLEA 2VDOB 3VHRA 2E5FA 4DMLA 2EV9A 3IO3A 4KPYA 1W88A 2PUTA 5GV8A 4YJGA 4EHKA 2YV5A 1CZRA 3P52A 1TUIA 1YFKA 3LM8A 3WNZA 2VEOA 4E2WA 3DKRA 2E1PA 3ZNPA 4EABA 5FFNA 3U17A 2C5BA 5HX7A 1KEVA 4FGZA 3IKJA 2DQ4A 4KQ6A 5F64A 1KHHA 1ISRA 1PZXA 3I6MA 1ODFA 4GI7A 2FUG1 3WYFA 1XJWA 3V4RA 1JKIA 2LD4A 1HYGA 2DWUA 4UM5A 2IYZA 2JLSA 1JR3E 2QX6A 1PFQA 3AL3A 1N33B 4X20A 1IPFA 5FA8A 2Y9MB 1I3KA 3I92A 1YL6A 1MC1A 2GBCA 2VFAA 2DUNA 2Y77A 4JSTA 3THRA 1F3OA 4H3HB 3VR0A 4W5RA 1BH6A 2PWZA 3NHMA 4FYHA 4J91A 4DGSA 4YUYA 1EJ2A 2HCBA 3GGJA 3NC1C 5IKOA 4F0JA 3BE4A 1I30A 3GLSA 4BPRA 2VL7A 3WLJA 4E6EA 5LQUA 2K7FA 1EFPA 4BJ6A 1YA4A 2HPZA 2GFQA 3CB4A 4IJMA 1KPGA 1G3RA 1JEJA 1IQPA 5C7IO 1RJWA 4PSKA 2GBIA 4INJA 4J0QA 4OGGA 3IP9A 5CFLA 3HCBA 1LK5A 1E79D 1ZU4A 3IX7A 4YXWD 4LYHA 3LDUA 3FNGA 2B0JA 1AM4D 2V7QA 3STTA 1FP2A 4WL0A 2QRVA 3Q5GA 3RS4A 4WK2B 1FUUA 2IVFA 4ZV7A 2FQ1A 1YZVA 5GPBA 4DHEA 3T5AA 4MI1A 4EG8A 4KFCA 5TNXA 1EM8B 2LDXA 2R25B 3CLRD 2YHIA 4EUEA 2XMCA 3KJHA 5CXQA 3P4UA 1NRWA 3CR3C 2NP7A 1Q11A 4GH5A 2CKDA 5KNDD 3R5SA 5ITWA 4LK3A 4PRLA 1W0KD 1H4SA 4QYSA 1VIYA 1T1EA 2XT6A 1G66A 4LJ4A 1UT5A 4KNYA 3GWGA 5CTJA 3L84A 4B75A 4DLXA 2GN1A 4MGIR 4QTYA 3NCHA 2OGSA 2HHLA 1IDOA 4EJFA 1U2SA 4HDMA 5TS2A 3TG8A 4JSYA 2FOXA 1M1YB 1GPKA 2WJVA 5B36A 3MUEA 1GGMA 1G6OA 2J4FA 4H6WA 1OFGA 4C20A 1XRSB 2WZCA 2ZB4A 4ETMA 1QIIA 2HCTA 1V41E 3LV8A 5IBPA 4LHZA 3RHZA 4BB0A 2YHIB 5IJ0B 5JVDA 2W6JA 4KC0A 3AKZA 1W8DA 1Z28A 5B5SA 1KO5A 4TX1A 5FBRB 1A9YA 3RWOA 4F7WA 2GPYA 3REGA 3EVCA 1L6RA 2Q7XA 1NHWA 1R8JA 2XHEA 2AFIB 1XKTA 4PCVA 4ZDWA 3KQHA 5DN6D 3TOCA 3ICEA 5CYOA 3OLQA 4RA6B 3PXXA 3P2IA 3HKDA 4LJ6A 9LDTA 2GCGA 1DAIA 3H65A 4AG5A 4MW7A 3GLHE 3KEMA 2HQSA 2WFLB 2UVQA 3DL4A 3JARB 5KOHB 3RVPA 5E8JA 4PBTA 2OHHA 1E9FA 4UEJA 4FDTA 3CF2A 4OSEA 1AKTA 2AYYA 1QZTA 2FN8A 2GO1A 2I2DA 4HWKA 5SZIA 1TUEA 3T9EA 1WZ2A 3FUCA 2IXBA 1OI4A 1Z75A 3A31A 3OZTA 3JD3A 5LPNA 1K98A 5IJ0A 1NNLA 1AS0A 1T2NA 2YWJA 4RF5A 2ZBDA 3QV1A 4WCFC 1AV7A 1PO7A 1S3IA 2AW5A 3A32A 3TW8A 2XR1A 2I29A 4PONA 1EB9A 2Y0PA 2VNIA 3T9BA 1MZPA 1JJ7A 1SKAA 4PG7A 1V45E 1RI5A 1UBCA 3L0SA 3FHOA 4FFSA 2JDIA 3VKUA 1LX7A 3W6OA 4OK5A 4OYRA 4D4IA 3G3EA 1TKAA 2X7HA 3W3AD 4FD3A 4PX5A 3RVDA 4DBLC 1Y8RA 2WC1A 2AOUA 1QUFA 4QZVA 2GJSA 1I2MA 3DR3A 2AQIA 1TF7A 3IJPA 1ZGJA 3P5BA 5FEUA 5LD2B 1H4VB 1QXSA 2O7QA 1EE1A 4LBVA 1QQBA 1O94C 3K1ZA 2CNNA 3QX7A 3ID6C 1K1EA 2F1RA 1OZGA 3D3EA 4PTYA 4DIKA 3RSOA 2YY5A 4YRRA 3JQGA 2LGJA 2OCYC 3LWNA 3FZQA 4TSFD 5H16A 3X2EA 3MHTA 1UQUA 1F4VA 4G1FA 3OC0A 1D04A 3WYGA 1EFLA 4R68A 1G98A 4WK4B 5TQVA 3V1KA 1QU2A 4CKYA 4DV2B 4DANA 2PWYA 4EF4A 1B15A 3G13A 5K3FB 1RI4A 2H1FA 4XAQA 4DIEA 5K03A 2WWTA 3IHKA 4KLNA 5CU7A 2ZFUA 3EFOB 3USZA 3HGMA 2CDCA 2PR2A 3Q7PA 5JASA 5ED0A 3WYAA 4INAA 1IFXA 4HQRA 1BNCA 3IPYA 2PJDA 2V7GA 1C3LA 3LUDA 4RELA 5CIQA 4B2PA 5TIIA 2JLUA 2AI2A 3H4VA 3INNA 2QAIA 4M22A 4PLVA 1KMCA 1KDYA 1R6AA 3EA0A 1GPJA 3DDSA 3LZ6A 4JAVC 4JKOA 4TV8A 4MQ6A 5CIWA 5HA5A 1UKYA 4HQNA 4RLFA 3RW9A 2I3ZA 4D42A 4NXMB 1AZWA 2WFZA 5AQEA 1TECE 4L9RA 2GCEA 3WWCA 5HZMA 5EMKA 4K40A 2XEXA 1W5FA 3RUFA 1RE1A 1FX1A 3I8OA 2FTKE 4ZU1X 3OO1A 4QU5A 3KB8A 1K7SN 3B9QA 3KP1A 1VKRA 4LGYA 3SZMA 4C2AA 2YFYA 2C29D 5A9SB 2VUHB 1N2HA 3C3BA 4QT4A 4PO9A 4FE7A 3SM3A 4HNUA 4REMA 3AONB 1OTXA 4UMVA 3E3LA 1WAMA 3VM6A 4IZIA 5CT4A 4YO8A 1J39A 2FPKA 4PG6A 5CAEB 3LQQA 1A4XA 3GG9A 4C4SA 2B4KA 2HPHA 2J3LA 3CKMA 3DUWA 3D4PA 4EG6A 4IHJB 4DRXB 1XALA 4L9AA 1P0QA 1JLLA 1ADYA 3I2HA 4R2JA 3PUKA 1YR9A 3N2KB 2UZ3A 4B74A 4I4TF 3A9CA 4OU5A 3OU6A 4G67A 1QIKA 4JGGA 4JJFA 4HRXA 4TWRA 1BA3A 1D09A 1XAHA 1KSFX 4JR2A 1L1QA 1BW9A 4G0YA 1D2EA 1JDNA 1HE3A 4M6WA 3EZGA 3V1UA 3ZDRA 4C0LA 4EQ6B 2FWBA 2V3WA 3D7MA 2DPXA 4Z5XA 3PQ8A 2PT5A 1PGJA 4JU9A 3QNMA 3N75A 3SYMA 1UBHS 3AFOA 2BISA 3MCTA 4PNEA 1L4BA 1LF0A 1T4MA 1ITZA 1FJGB 4Z0PA 4BWFB 3L82B 2ZDHA 2XCIA 2AMYA 1NUPA 2WYVA 2DB3A 2G6BA 3CX7A 3H9BA 3H42B 1V39A 3P71T 4GMDA 3L4SO 5LDDC 3U09A 3C7TA 4U8GA 2FX5A 1FXWA 4F8EA 1NUQA 4BJHB 1DUSA 3D3KA 4H7KA 2UYQA 3KELA 3I1JA 4RHFA 2WSLA 1I6MA 2JLVA 1TJ5A 4C4AA 5HMMA 1T6BY 3OZXA 1D1PA 1UEXC 3AETA 3PR2B 5FWYA 1SO8A 1GSOA 3OZ7A 4MZDA 3RVSA 3Q3GE 4IDDA 2B0CA 4M53A 3VZRA 2GJAA 2BFBA 2Q4TA 5JDCA 2AOVA 1E3LA 1DEHA 4FSHA 5A05A 1EX9A 3HDTA 1E6EA 4QWMA 3T61A 3TI7A 4I1PA 3NBMA 3FNRA 2MSLA 4TM8A 3OM1A 2VPTA 1L9XA 3O82A 2RHJA 4CMAA 3NGMA 5MN5A 2Q5JA 1PJZA 4MUXA 1IM8A 2QRVB 4BB9A 3OF2A 4Y9DA 3V2UA 1O3YA 3KZOA 3UUWA 1NONA 2A0FA 3F8SA 5TEWA 4CFYA 1F3LA 1R9NA 4NAUA 4EAQA 2H2DA 3B5IA 1X2BA 2AA3A 1YJAA 4P38A 3L07A 4V2IA 3GYGA 1KOLA 3DT9A 3AW8A 2BLNA 3VYVA 4TN1A 1XJ0A 1J9ZA 1U8TA 2H4WA 4R6XA 2XZDA 2QT9A 2Q5IA 1WZEA 4FQ5A 1GV0A 3P9PA 5GMOA 2G6TA 5AMXA 5J4HA 5IHXA 1A9TA 4K2AA 3QU2A 3PC6A 3QVVA 1Q44A 5EA2A 2GO7A 2I6UA 3RWMB 2GZMA 1BFKA 2B8TA 3KZNA 2HNKA 2ZANA 3L40A 1K9SA 4QPJC 3OFKA 4MA0A 4PVDA 1YONA 5AVUA 1BEUB 2LKCA 1BQ3A 1P1FA 2BKAA 3F5SA 4MB0A 1ONBA 4YCDA 3R7AA 2IYEA 5A5DA 1JDPA 4MA5A 4YRNA 1NVXQ 2OC4A 2HA5A 1WXHA 3CISA 2IY7A 3CMCO 4QBKA 4HLQB 4B3GA 1T2CA 3ZGLA 4JYBA 4I4LA 1V0JA 4CLDA 1LK0A 2EEZA 5TX7A 4LVOA 1A9OA 2Q2QA 3TNFA 1FVFA 5CX4A 1J2RA 2QTRA 3GNSA 2JIPA 4BLQA 3NVKI 3QMMA 3OPYA 2O0HA 4BMPB 3LLMA 4NG4A 2BEJA 1XTSA 4J0FA 3KQNA 1J8VA 1YR8A 2BZ0A 1DC4A 2C3UA 2X0JA 4ODIA 2YW9A 2AKEA 1AKWA 1RU3A 3RK4A 2AEEA 3GGDA 2VQSA 3BHNA 4WK0B 5ALSA 2YJGA 5AVZA 1Q0LA 4W1SA 1CFJA 3FR7A 4EATA 3TQCA 3ETNA 1QJ4A 5CITA 2HBZA 3P5SA 4NK4A 1QGAA 2NZWA 3GMSA 1YJ5A 4YP9A 4D79A 1QP0A 1GFSA 3KKLA 4JVSB 4EPRA 1XMVA 4GQBA 4IFIA 4NATA 3LY7A 2BGKA 1L5GB 1SCJA 3QFSA 3DHYA 3UPTA 3CURA 2QQFA 2NZUG 4GHWA 4HLDA 4OMCA 4ZYWA 1E0KA 2QRLA 2VWQA 4PQGA 4ND5A 5KSPA 2O4CA 2JCVA 3ZGXA 1NIJA 3GL9A 1CTQA 4HEHA 4QXOA 3RVJA 4B83A 3STVA 3H4IA 4BMOB 4JXJA 5EXXA 1UBTS 4JX9A 1Z9BA 4ZVOA 5BR7A 3RYFA 4LRQA 3DR5A 3QWAA 2IHTA 5ER9A 3VQTA 1VMIA 1SUEA 5BQPA 2Z6AA 1Y9ZA 1ZVJA 1I0IA 1VKNA 2ESRA 4A0QA 2A5JA 4BL5A 1BMFD 3T7IA 4IG4A 5KTMA 4MB2A 5CDTA 1L7AA 3UMFA 2VAPA 5E6UB 4OI1A 5K8CA 4HSEA 5JNTA 4MV8A 4CMIB 4QX6A 4Y6LA 1QANA 5FPQA 4WADA 2RKWA 4Z3KA 5HKKD 2WAOA 3VDRA 1MB4A 1FXSA 4FHGA 4DYVA 5K0FA 3QX3A 2HIGA 4S1TA 4WBNB 1N75A 2I2WA 3QK7A 2XUAA 5IJ9A 4GD3Q 4M7PA 1IK4A 2AFIA 2GZSA 2R00C 5EUCA 5J2TF 4ZFNA 2BBWA 4RM2A 1E1MA 2BN4A 5G2OA 3G0BA 5JWHA 5BWOA 1OXTA 2DT8A 1TIBA 2W2NA 2BELA 2PRYA 3RT1A 3IEXA 5FPKA 3LW8A 4AWAA 4BV9A 3V4FA 2UDPA 3EG9B 3WLOA 1JHAA 1T24A 2Y92A 3D8TA 4IM7A 4MLZA 5A3RA 1ML4A 1FRNA 5L3VA 2ZYUX 1MFPA 1KIMA 5ENVA 1HEYA 1MORA 2ASVA 4KQXA 3GJSA 4QUKA 5D6OA 3ZE7A 4TYNA 5H4HA 3T0GA 4WUTA 5JQGB 4GBJA 1W9MA 3WFJA 3DFFA 4FK8A 5ENDA 1ZZGA 3NAGA 1ESEA 4CDNA 4KPUA 4XIGS 2YN0A 4YALA 2O59A 2JASA 2LR0A 2GD1O 4WXYB 2B34A 5CVUA 4RH3A 3WHKA 3ZQ4A 4CE6A 5A02A 4EB6B 2DBRA 5JMPA 1GTJ1 4FFMA 1AG9A 1M7BA 3I52A 3OTHA 1NW4A 4FEGA 3DTTA 1DG9A 1LNQA 3DULA 3RS8A 3SIRA 1T2DA 1M2EA 1WOMA 2PKYX 2V55B 4DA6A 5I4CA 3WV4A 2XGOA 3IOEA 4M9SA 2O50A 2A30A 1YTUA 5KVVA 4G85A 1ZZEA 3QKUA 1M10A 2A86A 4LXHA 5A9RA 5I7AA 1ZU5A 3T34A 1Z2NX 4IFTA 3U4IA 2HR1A 1SU6A 5AVXA 1EHIA 4F2GA 4LV8B 4TZ0A 2G5TA 3I04A 2FFHA 2Z43A 4ITVA 4IIFA 3A1UA 1LDMA 3N3BC 1ZXLA 4D46A 4ZT3A 1J1UA 1H85A 1WKBA 2XE4A 3OBIA 5D3MB 1K8YB 5FOUA 1LSSA 2C94A 1NT4A 1JFLA 1TLFA 3AB7A 1GGVA 1UEJA 2VTKA 3KVYA 4E2YA 3S6JA 1JSRA 4DMGA 1FSGA 5JMWA 4BQOA 2OPBA 3EEBA 2W00A 3MWLA 4QGAA 3SBXA 1IHDA 2XD4A 1FXUA 1XMIA 4LTDA 4TMTA 4WERA 2HNAA 5HGJA 4K8RB 5DI3A 1Z5VA 1D9ZA 1XVIA 1MVOA 3H99A 4TWJA 2QD1A 4L85A 5DT9A 3HV0A 2R66A 3PU6A 5LCXA 3STHA 1NN5A 3LKBA 4TZ6A 1O54A 3MWYW 4AG6A 4RFVA 3D7NA 2CK3A 3LBHA 4H1TA 2XLCA 4A8JA 4Q9NA 1NQWA 1V47A 2M32A 3FDZA 4WQMA 2HRQA 1E0AA 4QVIA 1RQ2A 2CLLB 3K15A 5DHSA 2EHJA 4M9ZA 1ZW1A 4YONB 4U00A 3DJFA 3PQEA 3A7DA 3TW6A 2O2ZA 2GZRA 3TZ6A 3VNVA 4RXUA 2Y67A 1VL2A 1L4UA 3TNLA 3DWEX 4CUZA 1YR3A 1T3TA 3AG5A 5CTAA 5BN4A 5FTJA 3C4VA 2EZ4A 1XNRB 1VJCA 1WB4A 2OPHA 1L7EA 3KPUA 2R44A 4NV0A 2OV6A 4IV5A 1J2TA 4KU4A 5MGBA 2Z5LA 4C14A 2B9EA 3E9EA 3E35A 4PSVA 2VH2A 4L3VA 3E84A 1I1NA 1P6UA 1T4DA 3MHPA 4MP3A 3LUBA 3TK1A 2RONA 5COQA 4MS3B 1FS5A 3CPJB 3I9V1 2ONYA 2ODAA 2D4HA 3A26A 4MWZA 4EH1A 2ZTSA 2RAVA 1H42A 1QF9A 4B47A 3KZVA 1X7DA 2FLKA 3AEYA 5GOZA 4MINA 2X1MA 5DVZA 3OCWA 1WMSA 4O2AB 1EDEA 1XUOA 1QIMA 2Q21A 3TCNA 3ZWDA 4BX8A 1W7AA 2EW8A 3I2IA 4LVUA 1JYSA 1Y7HA 2J0VA 2OKGA 2QAGB 2KHZA 4BDSA 1DAOA 2WSYB 1T0UA 3WLNA 4BTVA 4GOKA 4G97A 4YR7A 3TDMA 3NGLA 5CBKA 1BKYA 2VNKA 1OA0A 4C5BA 5A4KA 3HM9A 1L7PA 2WHYA 1RC0A 3IIMA 4D6XA 3PNLA 3H1BA 1V3VA 2WJGA 1Y63A 4WNAB 1UDBA 2H3EA 5BNWA 1UXHA 3I58A 4EGSA 5HGXA 3ZHZA 1SXIA 4ZT4A 4A8JC 3B6IA 2QPTA 3GGPA 1JEDA 3AEUB 1FJHA 1AIPA 2ODBA 3KLOA 2AN9A 3HP4A 4NWIA 3ZDEA 4KQKA 3S2FA 4L78A 3OOSA 4JBHA 4UEKA 5KCMA 5MN4A 1J22A 3GJYA 1N2GA 4IR7A 2NQ8A 3L1UA 4ZARA 3WLTA 1T5BA 3CPHA 3PUVA 3OEED 1PAUA 2E48A 1Q1AA 4YRZA 2QLNA 3AY7A 4FCTA 4KLZA 4UTZA 3E4DA 2JZCA 3MTQA 1UPAA 1CUCA 1N0IA 1CZHA 4FFBB 2C58A 3A9RA 3I6YA 2RAUA 4YP0A 3DNPA 1V4BA 4LQLA 4X6YA 1D2HA 1Y42X 2NU6A 4YJHB 3ROTA 2CSXA 4EFKA 1OCEA 1KIFA 4FSXA 3F46A 3A6PC 2PJUA 4M0LA 3DQZA 1C9NA 4G9EA 3KG2A 3ZC3A 4L3OA 3EUAA 1FFYA 2VLBA 4TL7A 3REFA 4EHHA 1WB5A 1YS2X 5AVYA 3C1UA 1VIAA 4CLHA 1G60A 4O63O 3V55A 4O08A 3S7TA 3V7YA 4GOND 3TUJC 1W36B 4RZ2A 2IV3A 1FDRA 5JWRA 2JAOA 1E2GA 4MR8B 3BA1A 5JZOA 4R7ZA 3C45A 4C78A 3EJWA 3BVPA 4MW2A 2L82A 2OVBA 4HDQB 1QQAA 2WIDA 3HEMA 5IN5A 4M0FA 3ZE9A 1ZXBA 1ORTA 3GYBA 5TT1A 1B7GO 2G0AA 2YINC 1GQRA 4UBJA 2VDQB 3I2YX 1N1GA 2HQ1A 2ZS7A 3FXAA 2R6ZA 3A4IA 2W2KA 1NYQA 3ZLBA 4BQSA 1PTJA 2Y2VA 2YBDA 5K8UA 1FE8A 3DGEC 3KTDA 2EC5A 4IWYA 1IXSB 2A88A 3P9KA 1O95A 1T9ZA 3GJ3A 3AINA 3IQZA 3MGGA 4JBWA 3WQSB 3JQ9C 5DBOA 3IH5A 4B4WA 4K6FA 4C07A 1R6DA 1SC6A 1FB5A 5L40A 4QXRA 3TNJA 5AXCA 2YNMC 4AI6A 4LWPA 2XOXA 2Q6TA 3JSAA 4P1ZA 5ALLA 1C9EA 2W71A 1OZ0A 1SB9A 4BUJA 2NXJA 5B6PA 2PT9A 1DFHA 2HEGA 3ILHA 3DDNA 4MQLA 4I6EA 5BSRA 3DYBA 1EINA 2RFLA 4UDOA 3BD7A 2IU3A 3DF7A 3O8RA 5AW5A 3PF9A 1N3BA 1Y1SA 4OYHA 4UFOA 2IHNA 4IHJA 2WQ7A 2PUEA 4NZZA 3X2SA 4RMHA 2EJCA 4JIMA 4IIXA 2DHEA 5CD1A 3OQJA 4P4UA 3R9IA 4U5QA 4CL0A 5A4AA 2ON6A 3BXGA 1OAAA 1AC5A 1FFXA 2BFFA 3SBDA 3JWHA 3IXMA 1WPRA 4J0EA 4FTWA 4HQOA 5E1DA 3RARA 1XJCA 4XSVA 1YZQA 4JYCA 1UQRA 3AK4A 4KE7A 1SQSA 4F6LA 1C0PA 4AT1A 3D2LA 1PIWA 1O8CA 3AUYA 3DE3X 4L50A 2GQ0A 2EWMA 4EMUA 3G8DA 3ZE8A 2HMYB 3QUQA 3W5VA 3JQAA 3VISA 5LWHA 2NXCA 4NMWA 2OKCA 3CVXA 2MYPA 2OZLA 3I45A 3ZJ5A 4INZA 3C5CA 2HSDA 2VPXA 5JH7B 5BWLA 2XLBA 1KNQA 3A3YA 4BZXA 4IIBA 5CGQB 3ZTYA 2ZT6A 1S8AA 1ABFA 2O0JA 1UBRS 5KTSA 2YIVX 1LLQA 1TYZA 1UDRA 1BJKA 1OF1A 2X8AA 3TAUA 4GX1A 4BFSA 2QTFA 3GC6A 5CEEA 2LBPA 1I13A 1Z12A 2QVCA 5L4SA 4XZ3A 5DX0A 3GFPA 1N9KA 3L9XA 2EKQA 1NF8A 3QEMA 1LBIA 5K0CA 3E22A 1E3TA 2QIOA 1LPNA 2QD2A 2GF9A 4WKNA 2WE8A 1N6HA 4TVBA 3PC3A 2FSUA 3V8PA 2OD9A 2ZKLA 2BRUA 4A2CA 5LU9A 3T8YA 3L7KA 4F8JA 4RMJA 4HC4A 2C4NA 2IGTA 1GL9B 1X3LA 3EIQA 2FVXA 1P73A 1QJCA 3M2TA 3PLNA 2IIPA 3FBWA 2C4MA 4LYGA 3HBMA 4ZJPA 2GHQA 3CCFA 3KJFA 3F3KA 3EMDA 1DKQA 1ULTA 5FLYA 1ECCA 2P6MA 3QY9A 3SZLA 1T3SA 3MF4A 2XRFA 1A27A 4E0BA 1TT5A 5CFPA