3STWA

Crystal structure of tomato methylketone synthase i complexed with 2-tridecanone
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
258
structure length
258
Chain Sequence
FVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDHVTMMSKPQQLFTTLLSIANKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Emergent Decarboxylase Activity and Attenuation of alpha/beta-Hydrolase Activity during the Evolution of Methylketone Biosynthesis in Tomato.
pubmed doi rcsb
source organism Lycopersicon hirsutum f. glabratum
molecule tags Hydrolase
molecule keywords Methylketone synthase 1
total genus 88
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3stwA00
4TPKA 3BJMA 5HK8A 1GKLA 3ILSA 1X2EA 3G0GA 5ALWA 3W2TA 4AX4A 1ORVA 1ZI6A 5AI4A 4EB0A 3N2ZB 2CUTA 1R9MA 1PJAA 3UMJA 1XQWA 3EBLA 4AN0A 2ZJ6A 5DNVA 2LIPA 5EHZA 4P93A 3A6ZA 5CT8A 4YK7A 1EDDA 1O6FA 4H77A 3RKSA 3HC7A 2BGRA 4MEAA 2WG1A 5AM4A 1CRLA 2G63A 4G4GA 3IIIA 3G9ZA 4B7ZA 5ALTA 1P0QA 3FVTA 3NGMA 1T2NA 5E4TA 5AIAA 2UZ0A 1L7QA 1R3DA 1CR6A 2X5XA 4J0JA 5LZ2A 1DWOA 1NX9A 3Q0TA 3PE6A 4Q3LA 1CUDA 4QLOA 4WDQA 3VJKA 1BCSA 4G4IA 4GLBA 1C4XA 1VKHA 2EDCA 4WY8A 1ZJ4A 3C6ZA 5FLKA 5HKBA 2FX5A 4W9RA 5C81A 2XMQA 1VZ3A 1OILA 4XWGA 3G8YA 4RPCA 1K8QA 3C43A 5CH5A 4LXGA 3ANSA 3IB3A 4J3JA 3CCCA 4X97A 5T4FA 3O95A 4Y2YA 1GPKA 4MXDA 5AK5A 4GWLA 5CTAA 5IVIA 4CCYB 4ZGBA 2DQYA 1XZGA 5AKHA 3X3HA 5EIEA 5HCUA 5AO9A 3WL5A 1XRRA 4J0HA 1AURA 1B41A 4CIBA 4QA9A 4B84A 4BDTA 1IUNA 1RYYA 5HQ3A 4RNCA 1CUJA 4UHHA 1E66A 1QE3A 4N8SA 4UFNA 5I8PA 5ALKA 4FOLA 1KU6A 1EVEA 5ALNA 2ROQA 4ZXFA 2XQJA 4B83A 2H7XA 3G0IA 1XZKA 5ALQA 1MNQA 4GHWA 3AZOA 1JFRA 2YASA 4IH9A 2XMZA 1UK6A 2Z3ZA 2GZRA 1U8EA 3O4JA 3R3UA 3FLBA 3FYUC 2WSLA 4Y2UA 2CJPA 1Q83A 4LIPD 3TRDA 4AMZA 1LPOA 4QDXA 2JGIA 2XUFA 3HLKA 3M82A 2ACEA 1JJIA 4KACA 2C58A 1SFRA 3RARA 2WFLB 4J03A 2JGFA 3G9TA 5ESRA 4BZZA 1BN7A 1XZBA 4UBKA 3FVRA 3JWEA 3QMVA 3F98A 3I6ZA 1CUSA 1GT6A 2V98A 3STTA 1Q0ZA 3R0VA 4K2AA 2DHDA 1I6WA 4DLNA 3TEJA 3WA7A 4GEGA 5HF6A 4CG3A 3KD2A 3MUNA 3DDUA 2Z8XA 4QDTA 4G8CA 1TCBA 5D6OA 3STUA 1DINA 5FKJA 2RIPA 4OB7A 2PSFA 4FLMA 3SC2A 1BN6A 2OQVA 3PF8A 5HZGA 5T4HA 4OB8A 4XJVA 4IHAA 4PSCA 3HI4A 5K3FB 1CQWA 4DGQA 5FPPA 4X85A 2QS9A 5LYYA 1UKCA 2Z5GA 3WMRA 4QDUA 1JMKC 2JGLA 5JAPA 1RWQA 3D2BA 1SCKA 5ALPA 2CBGA 2OGZA 5K3EA 1ZIYA 3IBTA 4IQ4A 3WK6A 4B9AA 5IVHA 3D7RA 1N5RA 2EEPA 5ALGA 2HL6A 1A7UA 4PSUA 2JGKA 2H7YA 4P92A 2XQGA 2RAUA 3AIMA 3G02A 3BIWA 1YB7A 1GPNA 4QEKA 1YAJA 4X00A 2HHAA 1J2EA 1LPAB 4JEIA 4B82A 1LPMA 4FFVA 1YS1X 2OCLA 1EDEA 3AJAA 4ZRDA 5SYNA 1U2EA 3GZJA 3OM8A 5AI6A 3WL7A 2PSHA 4X6UA 2WIJA 3DL4A 3H2JA 1QLWA 2C5GA 4RE5A 4J7AA 2IIVA 2AJ8A 1IUPA 4HRYA 4O08A 4E46A 1L7AA 3C8HA 1MNAA 3WK7A 4YASA 1FFBA 4BC1A 4UBJA 1LBSA 3SK0A 2QVBA 4DNPA 4C88A 5DTJA 5IKXA 3C5WP 4OPMA 1CUUA 5ALHA 4UFPA 3OG9A 5AK4A 2XDWA 5AKZA 1K4YA 4QE3A 2DHCA 1QTRA 3CN7A 3OOSA 4H7KA 1N5MA 1JT2A 3L1HA 3U1TA 5DNWA 4C4XA 5CT9A 2ES4A 5SYMA 4X71A 1XQYA 3GBSA 5F4ZA 4Q34A 3ZWQA 4F21A 4GDMA 2HA0A 1OCEA 2OQIA 5EI5A 4X94A 4RE6A 3WKBA 3WYNA 2H7CA 3HRHA 4HXGA 3FOBA 5ALDA 1JMYA 1VA5A 1GGVA 2XUGA 4M0EA 3WK8A 3LIIA 3DNMA 5EFZA 3QPDA 1DQYA 1W6RA 4J0IA 3O9VA 1ETHA 2VJAA 2B4KA 4KR0A 3I1YA 1ZGCA 3F8SA 4UUQA 5LZ9A 2JGJA 2PSEA 3HYSA 4BVKA 5AH0A 1CIJA 1YAHA 3O4IA 4Z49A 1CQZA 3I6YA 1UKAA 1WM1A 3HACA 5LP1A 2VJDA 5A7HA 3LP5A 3DL7A 1IMJA 4DMCA 3CXUA 5AKGA 4LYDA 3HJUA 4F0JA 2WJ6A 2PUHA 1B6GA 4C01A 1XZJA 4K6HA 5FUMA 3QVMA 1EHYA 5CH8A 4H7FA 2AJDA 2QOEA 2I3DA 2WIKA 5ALYA 3T4UA 5FOQA 3DKRA 4JH0A 5LIPA 2XUOA 2XUHA 4FNGA 3V1NA 2P8SA 4X91A 2XT0A 3BF8A 3HABA 4F60A 2C4HA 4W1QA 2RONA 4BCBA 3H19A 2OGTA 4MYSA 4HXEB 1XZCA 3C5VA 1BEEA 4C4YA 1IVYA 4X95A 4OB6A 1XZEA 3UUFA 3WWCA 1XRQA 2OPHA 2Y1KA 5ALSA 4CI9A 1C7IA 1H22A 1EB9A 3V48A 3DQZA 4U2CA 5A71A 1LZLA 4GI1A 2CZQA 3AZPA 4KE9A 4XX1A 5C8ZA 5LKRA 1XLWA 4FBLA 3BF7A 1GQSA 3W06A 4DMFA 1PFQA 1XZMA 1XRNA 5EHNA 2O2GA 3C45A 3R3VA 2HFKA 2NW6A 2WG0A 3QYJA 1XROA 3N0TA 3ANTA 4BTVA 2VJBA 1VJ5A 3WIOA 2GBFA 4HZGA 3DKKA 4B0OA 4Y2RA 1Y7IA 2OG1A 1DQZA 1WHTA 1CUBA 5A7GA 4C6HA 3AIKA 3T52A 3D0KA 4KAFA 5CXXA 3ZV7A 1QFSA 2XI4A 1TRHA 1XRMA 1F0NA 5HFNA 3SWWA 2BKLA 2QT9A 4AZ0A 4BE9A 5IVKA 4K6KA 1BROA 5BWCA 4BRZA 1CUAA 2HA2A 5EIHA 5DYYA 1SCQA 3AZQA 4FFWA 3IUNA 2QXUA 3DEAA 4KE8A 5AM5A 3C6BA 1HBJA 4E11A 1LZKA 3I2FA 6YASA 5AKIA 3P2MA 1C7JA 1EDBA 4PNZA 4ZI5A 2BCEA 1DU4A 3ZPXA 5ALIA 5AOBA 2C7BA 4Y2VA 3H0CA 4DSZA 4HS9A 1UOOA 4Q05A 4XVCA 3DYIA 5HKAA 3Q8WA 3IULA 2ONCA 1AZWA 2O2IA 3RK4A 2PM8A 2WLSA 4OCZA 3WL8A 1CUIA 2RGUA 4EY4A 4I3FA 3WA6A 5ALRA 5LLSA 3H2KA 2J3DA 2C0QA 4YX9A 1EI9A 4X92A 2G5PA 2ZYHA 3F9CA 3OTQA 1H2YA 5AKJA 3F67A 4UBIA 3KDAA 1F8UA 5AI8A 5JANA 1TKRA 1N1MA 3RLIA 3NWOA 4BBZA 1UXOA 2ZSIA 1QIMA 2WILA 4FHZA 4ARAA 5JZBA 1P0MA 5E2IA 1LPSA 5AHXA 1ODSA 4MWTA 3STXA 1BEZA 3TJMA 3QBJA 1MU0A 5JD4A 1LPBB 2GZSA 3LCRA 2X76A 4H7JA 4BCDA 5ALUA 1BU8A 4U2BA 2GYVA 2QXTA 1WOMA 4KE7A 2JIDA 3W9BA 1ODCA 2EDAA 4FLEA 5EHQA 3I2GA 3HXKA 2B61A 1R1DA 3R41A 2ACKA 1HKHA 3I2KA 1WHSA 5CXUA 3LIPA 3B5EA 3G0DA 2GYUA 1QO9A 1ZD2P 5AK3A 2HA5A 1YA8A 1MX5A 3H1AA 1J07A 4MWSA 3WKEA 1XLVA 4W1RA 5AKEA 5FPQA 4BE4A 1QIGA 2D5LA 3CN9A 4L3WA 3V1LA 3VDXA 3QPAA 4OU4A 1QOZA 2QKYA 1XRLA 2GBGA 5AKLA 5LKAA 2PU7A 5CURA 5DYTA 2ZYIA 1ORWA 2O7RA 4PQEA 1CUHA 2QJRA 3V9AA 3FYUB 2FUKA 3EQ8A 2XUAA 1G66A 3BXPA 3WJ2A 5CT4A 2QTBA 3I2HA 3ESBA 3QPCA 3O0DA 4LYEA 4AB1A 4NMWA 3G9XA 4FMPA 1G42A 3DJYA 1EXWA 3WWEA 1Q0RA 4KAAA 3M83A 3W9UA 5CBKA 3FBWA 4XIIA 1E8NA 5AM0A 5EIAA 3BE8A 3WK5A 4UFOA 2V9ZA 4X90A 5AICA 4ZV9A 4DNOA 5AIBA 3ED1A 1GXSA 5JARA 3DYVA 2XUKA 5HF5A 1X70A 5AOAA 5AM1A 3AUKA 4D9JA 1WPRA 5YASA 4OUKX 3BDIA 1HPLA 5JD5A 1GZ7A 1MO2A 1N8SA 2Z8ZA 3R3XA 1ODTC 4KYVA 1TK3A 2HA7A 2JF0A 2WFLA 1Q84A 2YH2A 4X3CA 1FFDA 5JZ9A 2VA9A 2XLCA 3LLCA 5T4EA 4TVKA 5D3KA 2OCGA 4K6GA 4M0MA 1LPPA 1LGYA 2BUAA 5K3BA 5DLPA 3PF9A 4S0XA 5DTIA 4G8BA 2DSNA 5LZ8A 3R3WA 2XQIA 3WKDA 3W05A 1EB8A 3CCBA 1QIHA 1WPXA 5BOVA 1AC5A 4UBLA 3IA2A 2XLBA 4LKOA 2W6CX 3STVA 1MX9A 3MGAA 4U2FA 2GYWA 1UOQA 3E4DA 4H35A 4V2IA 2XUQA 7YASA 4FWBA 3D4LA 3VISA 4ITVA 4UPDA 1KEZA 2PUJA 3PDCA 4NZZA 1H2ZA 4CG1A 2HDWA 3DD5A 3VJLA 2BAGA 3VVMA 1XZDA 5D3ZA 4QZVA 2VAXA 3O9MA 2RHWA 3PFBA 2HFJA 3GUUA 4J0KA 4Y7DA 1JI3A 2B9VA 1ZIXA 3HSSA 2VQ6A 3G9UA 3WKAA 1TCAA 4B80A 1EH5A 2JBWA 1U4NA 3C70A 1S8OA 4WY5A 3WWDA 5JIBA 2PU5A 5AK6A 1YASA 1EK2A 4EY6A 1LBTA 2DCMA 5DNUA 1UWCA 3VXKA 3ESAA 4G4JA 1E8MA 5AP9A 1YA4A 3A70A 2OCIA 2WU3A 5CW2A 4JUIA 2HM7A 3QITA 2XMCA 5JATA 2AJLI 4G9GA 4UHEA 5EHXA 4INZA 5CMLA 1O6GA 3E1GA 4JYPA 2ZVDA 2JGMA 2VTVA 3PUHA 1HL7A 1CUFA 5AM2A 1JJFA 3E0XA 1UOPA 4P9NA 3I2IA 4P08A 4WDRA 1E89A 1P0PA 4DNFA 1NU6A 3H18A 1CUVA 3A2NA 2CMFA 1A8SA 3FNBA 3QMMA 5JZSA 4ROTA 1EINA 2VATA 4X6YA 2PBLA 5C8XA 4QNNA 3WWOA 4N8EA 4BAGA 1CLEA 3I2JA 2OCKA 1CUYA 3BDVA 3MVEA 1G5FA 2WTNA 4HAIA 3WJ1A 1DX4A 5C7YA 5A62A 3ICWA 1F0PA 1DTEA 1MAHA 3A2MA 4PO3X 4OD0A 1R88A 5K5EA 4C89A 5CH3A 1FFAA 5A6VA 4IO0A 3I6MA 3S8YA 4RGYA 2QMQA 4J0DA 2G5TA 2OAEA 5I9IA 1TQHA 3OURA 1H2XA 1UK9A 4B85A 1XFDA 1SCIA 2XMDA 1IZ7A 2IITA 2QZPA 4NS4A 4H7HA 4KRXA 4F5ZA 1AQLA 4BYMA 4CCYA 1DWQA 1W75A 1SC9A 4Q1VA 3ZLTA 1QTIA 4JYMA 3R3ZA 4BAUA 5JD6A 4LXHA 2FJPA 2HADA 4L0CA 2PVSA 3VKFA 3DCNA 1K5PA 3FWHA 4J0GA 5DWDA 5AKKA 4ARBA 3WIBA 1E5TA 4B9EA 2ZYRA 2R11A 4FTWA 5ALOA 4Y2PA 1BS9A 3WL6A 4QLAA 2GBIA 4EY7A 1W1IA 4H7DA 1HDEA 2PSJA 1YSCA 4YPVA 4J0CA 3STWA 4UBOA 2PX6A 5HF8A 1SOMA 2ZJFA 4E14A 2G4LA 1XKLA 1JKMA 3O4HA 4KRYA 3ICVA 3NOXA 1VA4A 3G7NA 2QUAA 3F97A 3ZLUA 2WKWA 4BP8A 2I3ZA 5IH7A 5A2GA 2XE4A 1XQXA 2QM0A 4QDZA 3NUZA 2WHRA 3QM1A 5AI9A 4UBNA 4QWWA 1BCRA 5EGNA 3B3QA 1DX6A 1R9NA 4ZWNA 5ALZA 4QDOA 5AI0A 1H23A 2J4CA 2WTMA 4WJLA 2VJCA 2H1IA 2BUBA 1VXRA 4Q3OA 3AILA 4PV7A 5JAUA 1XZHA 2E3JA 1PV1A 3FYTA 3R40A 3BJRA 1MT3A 4M0FA 2OGSA 4OU5A 4UHDA 3LS2A 1XZLA 3M81A 2D0DA 1RP1A 2JEYA 4Y2QA 1Y37A 5JYCA 4W1SA 5IVDA 4LXIA 2HRQA 2YYSA 4FDMA 3D2CA 3JW8A 2XMGA 5CT6A 2RI6A 4EA6A 5AKXA 1JU4A 5K3AA 2GBCA 4KE6A 4U2GA 1USWA 3WZMA 3ZI7A 1OXMA 1VE7A 1UKBA 4DMKA 5AOCA 5HFAA 4N5IX 1CUZA 1LLFA 1BE0A 4OYYA 4Y2TA 1A8UA 2ZYSA 1THGA 3IVMA 3BL8A 4C4ZA 5JASA 3H04A 2XMRA 3K9BA 3S2ZA 1AGYA 1HLGA 4DNQA 4BAZA 1QGED 1UFOA 2I78A 2O7VA 4BC0A 5HK9A 1NU8A 4AO7A 1XLUA 4OSEA 5BV7A 1Z68A 3K2IA 1EX9A 4EY8A 4L72A 3JYHA 4PSDA 4BATA 1Y7HA 4Q82A 2X8BA 2XUPA 4GXNA 4DYHA 1L7RA 3D2AA 3FCYA 2PKYX 1CVLA 1XQVA 2YXPX 1MPXA 2O2HA 1FFCA 2FJ0A 4MYDA 4K5QA 1MJ5A 1VLQA 3FAKA 2QJWA 1E3QA 2ZJ7A 5CRIA 5LZ4A 1QIJA 3B12A 2XMBA 5HQ3B 5JAHA 1MTZA 2WIFA 3I1IA 3QZUA 4IH4A 1QIDA 2JGEA 5T4BA 2WUDA 3WI7A 3EQ7A 2DHEA 4BB0A 3FSGA 4GECA 4H7IA 2BJHA 1AKNA 1QZ3A 5JALA 4AO8A 2XUDA 1UZAA 1CUEA 1MN6A 3HZOA 2I03A 3W04A 4BVLA 4ZV7A 1E8DA 4H18A 2HA4A 4EBBA 5DJ5A 1QIIA 1LNSA 2WJ3A 2WG2A 1J1IA 1MX1A 1IZ8A 3H2GA 4H0CA 3FLEA 4MJ3A 3PI6A 5K3CA 1G4HA 2ZSHA 4UHBA 2BFNA 4CIAA 2WFMA 2OXEA 4B81A 1ZD4A 4MEBA 4JNCA 4H7EA 1ZGBA 2C0PA 2PPLA 5AJHA 3V1KA 4G9EA 3BIXA 2WHPA 4A23A 1CUWA 4Q3KA 5K3FA 1YB6A 2VEOA 3EQ9A 3KWFA 1YS2X 2HRRA 4G5XA 1FSSA 3ESCA 1DT3A 3H17A 3H2HA 2JEZA 4DTCA 4KJXA 2WFZA 1ZJ5A 3RM3A 3AINA 2HA3A 2WJ4A 4DMHA 4AN1A 2WQZA 1J06A 1TIBA 2HA6A 1F6WA 2R8BA 1QONA 3FCXA 5FP0A 2WIGA 2WM2A 2VF2A 3QH4A 1GPLA 3FSGD 3FLAA 4KEAA 1P0IA 4WCVA 1JU3A 5FDFA 2B20A 4EZIA 4B0PA 1UK7A 4E15A 5LZ7A 4WFJA 3WLAA 5BWBA 3C6YA 3STYA 1W76A 4KAJA 4A5SA 3R3YA 3KSRA 3IURA 4EHBA 2RHTA 4X7BA 3V1MA 3ESDA 2WUGA 3EIOA 3KOOA 2AJCA 2C5FA 1QIFA 1TCCA 1XZAA 5H3HA 5ALLA 3GA7A 2WHQA 3AFIA 4U2DA 3D3NA 1AX9A 3UUEA 3ZLVA 2V96A 1R4ZA 1JJBA 4WFKA 1QIEA 4W1PA 3DOIA 4G8DA 2QRUA 3GFFA 4Y9SA 4HTAA 1D07A 2VAVA 2Q0XA 4EY5A 3QMWA 1VXOA 4BCCA 4HRXA 1ISPA 5E4JA 2VSQA 1CUGA 3A2LA 5CT5A 4BTLA 3DLTA 4AQDA 1ZOIA 5FV4A 1ZD5A 2CKMA 4I19A 5DYWA 1DWPA 4OYLA 1T4MA 3PUIA 1QIKA 2OLEA 3WKCA 4BDSA 1FFEA 1XRPA 3C87A 5JADA 5D7BA 2H9YA 3H1BA 4FNMA 2XMSA 1MAAA 1FJ2A 1ACLA 3IDAA 5I7UA 4N8DA 2Z3WA 4BZWA 2XUIA 3EF3A 5A7FA 4W63A 2WU4A 3PICA 1VZ2A 4FKBA 4TGLA 2WUFA 5E4YA 1A88A 2VT6A 3H2IA 1CV2A 1EVQA 1LPNA 3YASA 4U2EA 4WFIA 2IX9A 1AUOA 2XQKA 4GW3A 4HVTA 1CUCA 3G0BA 4PF1A 4UBMA 3IUQA 1UT6A 1QFMA 2AJBA 3D59A 2QR5A 2OAGA 4DIUA 4CG2A 2HU8A 2HU5A 3WWPA 5AM3A 1QO7A 5KBYA 4GBGA 5LZ5A 1XZFA 3DOHA 1CEXA 1UK8A 1ZI8A 4BRSA 1VOTA 2WIDA 1XKTA 3IUMA 1VE6A 1YCDA 1CPYA 2VT7A 3AIOA 4MQMA 1ZICA 3C6XA 5C8VA 3FYUA 4CCWA 2ORYA 1M33A 3WK9A 1R50A 3L1JA 5JAOA 1HQDA 2XQFA 1CFJA 5KWJA 1W4LA 3VJMA 1WB6A 3GROA 4ETWA 5ALJA 5ISMA 3I28A 2PL5A 1BRTA 3D5EA 1K6EA 5ALXA 4BVJA 4QWMA 4L9AA 2K2QB 2WHPB 2PSDA 4B6GA 1H2WA 2HIHA 4ZREA 2AXEA 3M3DA 3OC0A 3WK4A 4Y2JA 3G0CA 3IUJA 5KREA 4Y2XA 1K63A 2DFPA 4AZ3A 3GELA 4BP9A 3F96A 1U65A 1KU0A 1W52X 3HEAA 4UHCA 3WYDA 2DQZA 5FRDA 4C87A 2XB6A 2Y6VA 2DR0A 1EA5A 5AKYA 4AMYA 3WQHA 1A8QA 1ACJA 5ALFA 2BGNA 4CFSA 1ZI9A 4DM7A 2V97A 4UHFA 3U0VA 1WB5A 2CEKA 3SX4A 2Y2UA 5HF9A 1ZD3A 2QUBA 4X93A 5ALEA 1EK1A 5K3DA 1GQRA 2W22A 3DS8A 1WB4A 3L1IA 1TAHA 4A16A 3C8DA 2BUCA 2ECFA 4FBMA 3KWJA 5ALVA 1GKKA 3TGLA 4PW0A 4NVRA 4G1FA 3BWXA 2WUEA 1XZIA 4EUSA 2J4FA 4MQLA 4Y2SA 3O4GA 1YR2A 4LHEA 3WZLA 5J3JA 1CUXA 1WCYA 4N5HX 4HXFB 1X2BA 3PFCA 3KXPA 3E3AA 4IH1A 2Y6UA 5AI5A 3MUOA 2Y2VA 1IUOA 2J3QA 4DSAA 2CB9A 4FLFA 5FXMA 5ALMA 2XUJA 2HU7A 4I4CA 3VVLA 1QJ4A 3OPMA 4AO6A 3K6KA 4AXBA 5KWIA 4X6XA 1THTA 1DT5A 1AMNA
chains in the Genus database with same CATH superfamily
2GYYA 3ZXYA 3QF4B 3TFQA 4DEVA 4JS0A 1GL7A 2VCHA 4RTLA 1LFDB 2VZLA 1C81A 1VHLA 2GA8A 4CEJA 2NUPA 5GZ1A 1Z06A 2E18A 2M1ZA 2IPNA 1BMFD 4IIFA 5H7XA 5CFPA 5K8CA 4INOA 4OLAA 3FKSD 1BX3A 2WQ6A 4ZTZB 1X2EA 1BTOA 1WUKS 1C9YA 2VYQA 4S3MA 4Y6PA 5F64A 1WETA 5C35A 4YJGB 4AX4A 4EHHA 3E22B 1SRRA 3HCPA 2ID8A 4HZIA 2HU2A 4KI7A 3JQGA 2V6BA 5EMMA 3PUVA 1ODFA 1OLUA 2AA3A 5K0BA 5BQPA 3ZNPA 4QO8A 5HIAA 3S1AB 2ZWIA 2O50A 1TYBE 2DQSA 3PNBA 1R9MA 3LHDA 3O9ZA 4D81A 5DNEA 1EJBA 1JLHA 3UGQA 3NORA 3Q9UA 1CCWA 1YQUA 3HSKA 5IU6A 2B4YA 3LLVA 3QPUA 4UASA 3VBEA 3FFWA 3BORA 2ZRMA 4K05A 4AZ3B 4YPOA 5I3CA 4AN0A 3F9IA 4CLXA 4QYIB 1X1EA 1FQJA 4G85A 1JR3D 2VPQA 4P93A 4RVUA 1XLTC 2CLMB 5UKDA 3QLEA 3GPLA 3K71B 4KQFA 4AJLA 5KTYA 3E5HA 1EDDA 1QG2A 2BFMA 4H77A 5BO5A 3W8RA 4K9KA 1N0IA 1FRZA 2W2OA 4DANA 3KT6A 3CB2A 4Q7LA 4ZQEA 3RKSA 5JMTA 1JG1A 1BH2A 1G9TA 1UIMA 2ZBQA 4OGWA 3O3MB 4GVXA 4R1MA 2C78A 5AM4A 1F4VA 1JWBB 1CRLA 1MXHA 2P35A 3D3KA 1A9QA 4EQ6A 3D8BA 3T5MA 1E1RD 2G63A 1U28A 4J1QA 4F3RA 3RYCB 1FTSA 1NVTA 3EGXA 4R54A 2XGJA 5D3MA 3OE5A 3FVTA 3JZAA 1WTCA 2P78A 3FTQA 2LR0A 4PGFA 3ZV5A 2HQSA 2RFLA 2CL6X 1O5IA 5CCBA 1DAOA 1OZGA 3K8YA 1B0UA 4FKZA 3M70A 1JLSA 4D26A 4Z0NA 4MDEA 3EWIA 2X5XA 1CJVC 1DAMA 1CY8A 1DBPA 1HDZA 4WBNA 3O8OB 2ZAIA 4S04A 4DLSA 1B1AA 1DWOA 1NX9A 4Q3LA 1D6SA 4I2VA 1PBNA 4D0SA 5MDHA 1UBMS 2PZJA 3CKYA 2FUG1 5HUQA 1Y6FA 5ICGA 3IX7A 3JSXA 4G4IA 4GLBA 1NVEA 1EFHA 2DMRA 1SUIA 4QC2A 2ZI6A 4ECAA 3LT2A 1SIBE 1LF0A 3N2EA 4BNYA 1GDTA 2EDCA 2EYQA 2O6HA 3I9LA 1TZMA 3I2YX 3PQFA 4K26A 1ZKDA 4W4TA 2W6QA 1J0XO 1YJ5A 2J9FB 3KKNA 1L5HA 3PPXA 1M72A 3CVJA 4GRDA 5I8ZA 4P31A 4LJ8A 3W6UA 5B36A 2BH9A 4R31A 5DWVA 2QJTA 2HLDD 4JL5A 3NV7A 1W1WA 2IYUA 3DE2X 3KWLA 4M38A 2C1ZA 2RHLA 3THXB 2REQB 1XNHA 2D8AA 2XVXA 3QUBA 4RPCA 4R9UC 5FUBA 1R27A 3C6QA 3CYFA 3DR5A 1Q20A 4ZQIA 1I5OA 2HJGA 4LXGA 5KTTA 1IOLA 4L9SA 3KRTA 3PTZA 3FWZA 5K6TA 2A5YB 4NYIR 2GN1A 1KJYA 5EGSA 5J9FA 2GNAA 4GPIB 4J3JA 3CCCA 4EW3A 3P94A 4Y2YA 2I2CA 3KPWA 5DHTA 3DPSA 1UJMA 1S6YA 2G5CA 3O73A 5CUQA 3R7AA 1LY1A 2B0CA 5IVIA 5BSWA 1HE3A 4X24A 1P2VA 3VC3A 3N05A 1TA4A 4US1R 5K4GA 4ZGBA 4M0DA 5KNCD 2HQBA 4KQGA 1QFJA 1CXZA 4IDPA 5AKHA 2WKPA 4IJVA 4UTZA 5H68A 4R1TA 2J3EA 4LRQA 2QUHA 1AURA 2RHDA 1TVKB 2SBTA 2ZK7A 2EWWA 1USKA 2ZXEA 3M8KA 2UZ1B 4JLUA 4KQJA 4MV5A 4M89A 4L0MA 4QA9A 4B84A 3NT2A 4DJJA 1W29A 2O8EB 1PQPA 3ONNA 3OMWA 1NLYA 2DLDA 2QZ9A 3MN1A 3L8GA 4KFCA 1E66A 1T26A 1YMQA 3M9LA 4ND8A 5D85A 1QTNA 4UFNA 4BFZA 1FNSA 3B6MA 1I2CA 1GDHA 2BLNA 5TQ2A 1MW9X 3GCZA 2CXQA 3MUEA 1Y9ZA 4PQRA 2W5UA 4NABA 1ZD1A 4TYWA 3QBTA 3B2EA 4UOZA 5C7OO 1Z3IX 2H4WA 2FPOA 2H7XA 4HDKA 5GJWC 4KR9A 3G0IA 3QFCA 4X7PA 4NF2A 3AIIA 5HR5A 5E9QA 3TLKA 4CG0A 3T1OA 3WMWA 1RHQA 3K2QA 1SPXA 5HBGA 2A0YA 2QL5A 3R23A 5KYTA 3UJNA 4ZZ3A 5SY4A 4OAQA 4MYCA 4R6XA 3KLOA 2O06A 4B4WA 4EDHA 3FPCA 2HWXA 2IS4A 3DNPA 2X4IA 1QHFA 2H1WA 4Z1MA 3FZQA 3KR9A 2XZLA 3A4IA 2IWRA 1H0KA 2JI6A 3WYFA 2YJGA 3STUA 4B8YA 2UYCA 5EIXA 1ZUIA 1Q83A 2VG8A 3SSOA 2ZLBA 3GFOA 1D1PA 2APJA 1WTAA 3C74A 4QDXA 3RK1A 4WBSA 5CJPA 3H5TA 3M82A 3ONFA 4QXOA 5FLXA 1LDMA 2D59A 2VHJA 1L7MA 3QVGA 3ADCA 1TU0A 3H1EA 4G4SO 1UR5A 4MCHA 4I4TF 3RJZA 4J9VA 4Y0AA 2DE0X 3EUFA 3TIXB 5EXSA 3U4QA 1SFRA 3PNSA 4N54A 4U3JA 2ZSUA 3KKPA 1Z45A 3I83A 2GCGA 1BN7A 2MDTA 3OM0A 3PC6A 4YRSA 1WKVA 2HLDA 4YP6A 4HDRB 1V5IA 2OSBA 2HLHA 3FVRA 4J0FA 3NWBA 4MS1B 1EE2A 3R7BA 3REFA 1E2GA 3NXKA 1PLJA 3I6ZA 3Q87B 5G3ZA 3AP1A 1BXKA 4TXJA 3DLCA 4I1YA 2VOEA 3OIFA 4NBVA 4WY2A 3A6EA 2DHDA 4Y9TA 3VV2A 3I9NA 1R9GA 2R60A 3ENNA 1NC3A 4DC0A 3HDHA 4OSOA 5JMWA 4YV0A 3CPSA 1JLKA 3T0FA 1NPDA 2PQ0A 1T1RA 1VBKA 3UC5A 1U4OA 2Z8XA 1SKBA 1Z08A 2IEGA 2XF8A 3I9FA 1N8KA 3KJIA 2DOKA 5D6OA 1GL6A 2WWYA 3BXEA 2UAGA 5D5PA 4LZPA 2I2BA 3DC7A 1G4UR 3G5UA 5FKJA 3TUIC 3UJAA 2ZT5A 1Q6ZA 1ANKA 3DEIA 4WN9B 1KRHA 3PKIA 1U7HA 4X20B 3ZEAA 1U3WA 1VLJA 4WZBE 3IHTA 2V6GA 1FYFA 4RY9A 1LTHR 3QTLA 1I3KA 1K8XB 1U81A 4QJIA 2B78A 4G01B 4PLFA 1T8UA 2O52A 2P1DA 4H4EA 5T4HA 2DZDA 2QD5A 4KXMA 4XJVA 3GLFB 3RTAA 2UUBB 2NSJA 3HI4A 1I4WA 1ZUNA 4RPHA 2OQ2A 5IJAA 4HDRA 1NLFA 4HKTA 1TTHA 1V95A 1F5NA 1FS5A 1Z07A 3FGNA 2ZRHA 4X85A 4BUJA 2RC5A 3SQWA 1VPWA 3LXUX 3WMRA 4PSVA 2ZKLA 4BP3A 5KMGB 5JFGA 4LC1A 1SB9A 4EW1A 5JAPA 2H1RA 1UFVA 2QROA 3D2BA 1XA0A 1SCKA 2IY8A 4ZKDA 4C0HA 5FEUA 1DE0A 1GTMA 1W581 2CBGA 4L74A 5ALPA 3WMXA 5KMGA 5L8VA 3FDZA 4CF5A 1E7MA 4C4TA 3K5PA 2ZSAA 3KVRA 5AW2A 5IVHA 2X5KO 1NN1A 4EYGA 3GQBA 3P9IA 5ALGA 1T13A 1QE5A 3BBLA 3OIVA 4G1CA 4BNMA 5G0TA 1ZBQA 4JI4B 1Y81A 2FDRA 4OUDA 2G09A 3IA7A 5IDWA 2BI7A 4P92A 3S40A 1ACMA 5HIJA 3AIMA 2UYOA 4JA2A 3WLRA 3MK31 1YB7A 4JT4A 1T5SA 2PNFA 2X42A 3NBFA 4JX9A 3OE4A 4HDMB 5BN5B 2A92A 2GAIA 3COVA 1G7RA 2QRPA 4GYWA 3HY6A 2A5GA 2YMMA 3RAFC 1QF6A 5I8WA 1QFYA 1W0JA 1D9ZA 4FC6A 2F9FA 1RQ2A 4JEIA 1DRUA 3UT6A 4B82A 1LPMA 1QZTA 1YS1X 2PRKA 3DWGA 3OOWA 1N4DA 2HRZA 5ES3A 4I46A 4WOCA 3LT1A 1BWPA 4YJHB 2OE2A 3MWGA 4UVIA 3ZBUA 3WRVA 1U2EA 4KODA 4JKIA 4U5XA 1F7VA 3QBEA 2PSHA 2EZ8A 4X6UA 3ZU3A 3SYNA 2WIJA 4R41A 1IJEA 3H2JA 2C7PA 1HFKA 2J59A 3B7PA 2IZ1A 1HMPA 1TYZA 4QXPA 4BRUA 3G8BA 3ADPA 3CLTD 4KDFA 4J7AA 4QUBA 2O5RA 1C7QA 2HV8A 5KC8A 1ILWA 2AJ8A 2QY6A 1VP9A 5DMHA 1GUDA 4G09A 1VPDA 1IUPA 3PFWO 1GPUA 2X9LA 1ISHA 2FUCA 3PV0A 4HRYA 4O08A 4E46A 2ZXUA 3K9WA 3R6GA 1SXJA 1WDWB 3G59A 4N0DA 1X1TA 2QTLA 2JCXA 2WE8A 2O1SA 4R7TA 2IYAA 2PUWA 3SSAA 1BMFA 1VYTA 1ZW1A 2HSZA 4YRGA 1FFBA 4PX3A 2ECQA 3KUCA 4GXTA 4QGHA 4BC1A 4QPPA 3KTAB 4TS4A 3FA2A 4YRLA 4LF4B 4WLOA 2NU9A 3ZI0A 2PJZA 4H0FA 4HZUA 1IHYA 4ZI2A 2E4VA 3CRNA 5AUQA 4DNPA 3TI7A 5I7OA 2Z5LA 3KAQA 4W5QA 1R6XA 1N7IA 3AFOA 3LV8A 2HJSA 2O2JA 1W34A 1RYZA 1U02A 4UFPA 5IDQA 2R68A 1KY5A 2J6HA 2NZWA 1UC8A 1WNFA 1E2QA 3TB4A 4HO1X 5HFJA 3O31A 2P5UA 3TD6A 5LL6P 1IIBA 1MOQA 2WA1A 4A0HA 2Q50A 1M2VA 1PFVA 3GFSA 3L7KA 2FMFA 3K2EA 4PNEA 5I9BA 3IO3A 3TTVA 2Y1OA 4B5KA 1JT2A 3L1HA 1VE5A 2XIQA 4KIGA 2X8JA 3GBPA 3IKJA 1J2JA 3O1JC 5IJWA 3A36A 3WZ2A 3OESA 4ND2A 5DNWA 3OJFA 1HV8A 1O08A 4BE7B 4ZQBA 1KEKA 2CSUA 4OTZA 1M6EX 3UMCA 3BEOA 3C14C 1XQYA 1ZUD1 3L4KA 1PUXA 1QOQB 3GDFA 1JFTA 1YQ9A 1KE2A 8LDHA 5HKLA 5A3VA 2KSQA 4YDQA 1O6BA 2GN0A 4TLLB 3EA4A 4Q34A 4GPTA 2R8OA 4ZVVA 3ZWQA 1DO0A 4F21A 4Q4CA 4DLZA 2OMKA 4V0KA 3RU3A 2R97A 1X7YB 1TGVA 2GZMA 4CMIA 4ND7A 3WP0A 4RFVA 5ENVA 2R47A 3DEZA 5EZYB 4E5PA 4MTCA 3VSBA 4LZJA 3FXAA 5EI5A 4X94A 4GOJA 1TO6A 3BQ9A 3K9QO 2XRFA 3WGNA 3ZKAA 2PSSA 2XNHA 2G17A 3EFEA 2C2XA 4QU5A 4RHEA 5EAIA 3NVDA 1A5BB 1YDFA 3HR4A 1OQAA 3WYNA 1GHTA 1I0LA 1JE1A 4MR7A 3I4FA 3LT5A 2DBYA 3QY0A 4F45A 2V03A 5DGXA 5EPOA 1VA5A 3OUTA 5HKOA 5TNXA 1YZTA 1FA9A 2C8JA 4C43A 2XUGA 4BY9E 2VZ9A 4J7CA 4IV0A 4M0EA 4EKGA 1M1NA 1YRAA 3H16A 1IM8A 3WK8A 1HOXA 1O97D 2L0XA 4HP8A 3LIIA 3DNMA 4XOUA 2O1XA 2K5UA 1Z83A 3QPDA 1DQYA 1NC1A 4FMDB 5EFZA 1W6RA 1QVWA 3NHMA 3O9VA 4ZODA 4F8EA 1V6SA 3IPRA 3OZSA 1I3NA 1DCMA 2ETVA 1RPZA 2Q4BA 4WXEA 4LE2A 4PM4A 3QKRB 1ESMA 5DBIA 4ZZ1A 2X0KA 2OYRA 2ACWA 1JPNA 3PNKA 2JGJA 3QX7A 4OK5A 1RZRA 3MJTA 3AESB 3Q6MA 3TQCA 1IBLB 4G0OA 5JSHA 1KQOA 1O0SA 2YN4A 4FHDA 4BVKA 2YWBA 3R0XA 5DOVA 5CPFA 4OH1A 3DE1X 1XTSA 4ZICA 4BNUA 1JPVA 5H81A 2NXWA 3KQOA 3D8TA 3E7DA 3C3KA 1E1MA 3KSDO 3NQ41 3U16A 4RTSA 3O4IA 2ZZMA 1VGVA 2IHBA 3IDOA 4UTNA 3ZDYB 4Z49A 2W2TA 4JVSB 1DOZA 1KRXA 1VL2A 1WM1A 3HACA 2OO7A 2XB9A 1L4MA 3MTJA 3A3PA 1QRDA 3HB4X 2IE8A 1AHHA 4TV9F 2VJDA 2PGLA 3PZRA 1CNFA 2CXPA 2D06A 3V33A 4DFDA 4V0SA 3D64A 1PP4A 4BZPA 2LCFA 2JFPA 1AK1A 2FRVA 3MTDA 2JFFA 2PJUA 5M7EA 1P9WA 1QVZA 1XU7A 2X1MA 1I7SB 2NU9B 2R6CA 5AW5A 4YDSA 3CXUA 3IODA 1H65A 3DDCA 4HWPA 2QMUA 4REQA 5AKGA 3AY0A 4HF7A 4M3NA 1RYMA 4F5EA 1VG0B 2PUHA 2XWQA 4YONB 2WJVA 3WAKA 5ADVA 3H5WA 4TTRA 1IH8A 2J6BA 3AH8A 3D3WB 3IHWA 1BKDR 4BV3A 1JDVA 1JQEA 3C3YA 2B3TA 2J3KA 3M49A 4AKTA 3RIYA 3ZUPA 1L6IA 2HX1A 3NCTA 1ZD9A 3F9RA 5AYVA 4WK2B 1GG5A 5HZHA 3QVMA 2FVYA 5ICSA 1E3EA 2W6OA 4LHVA 2AKAB 4WKBA 5MN6A 2GSWA 1P8JA 3A1WA 2QOEA 3CLSC 3GJ5A 2V45A 3PPWA 3FTCA 5JUWA 2FZ5A 4R69A 3AQ4A 3MEQA 3MOSA 3RDPA 3TNJA 3VPSA 1SCBA 1XPOA 2Y1CA 4WNAA 3HJFA 2AG6A 3DZHA 3I37X 4XR4A 2X40A 1UZUA 4YJHA 1PRYA 3V1NA 4KLCA 4KK3A 1WD7A 5A3JA 2W6JD 2OBXA 3BF8A 4LMBA 2ZBUA 1WEKA 2RONA 1O0BA 2VYVD 2YW2A 3G5LA 2FA9A 4G1MB 1IBMB 4MKIA 1B2RA 1CETA 1TPZA 2OBFA 1Z2AA 3DZJA 3EAGA 4MYSA 4D97A 1FSFA 2VDRB 2AF4C 5IANA 1NYLA 4UM7A 1EFRD 1G0NA 2E55A 4C4YA 4X95A 5BN5A 3K0CC 1XZEA 2X1LA 3O47A 4NP6A 4B48A 1P4AA 4Z54A 3R9XB 1YMUA 1PT8A 4RJKA 5C1OA 5B53A 3LC1O 5TVGA 1AUXA 3DD1A 4NI5A 3HG7A 4QRHA 5ALSA 1FMJA 2BEWA 4TT3A 4CI9A 3NC1C 1U0FA 1NX6A 3OQMA 3PSAA 121PA 3AWDA 3UJ9A 3ELDA 5BN3B 1MH9A 3RU7A 2ZTMA 5JH7A 4BQPA 2WB4A 1RXCA 2XKJE 2FMUA 4FP9A 4NBRA 1LZLA 4GI1A 1NG1A 2CZQA 1NOJA 1YS4A 2GCOB 2H5IA 1VIDA 1OFGA 1E3JA 2P9BA 2VDPB 4G0YA 4MX8A 1PGOA 4MGHA 1XLWA 4L95C 4QG3A 4P32A 4EQZA 2YMQA 3NUQA 4FBLA 1RXUA 3LXMA 3OY7A 4X9XA 4JB2A 4L5CA 2A9QA 2J3JA 3KU1A 2O2GA 1MJGA 4MKGA 1VGRA 2VZ8A 3LVRE 2AFHE 3TIFA 4BKMA 4RY8A 4A36A 4L8VA 2AKYA 4NBTA 2Q6KA 5TQ0A 2CVHA 2OC9A 3BK2A 4OHKA 3HXTA 3FTPA 4OVKA 3SBEA 3ZN2A 5AVUA 3OKAA 4ZQCB 4N5LA 5LQAA 4L0QA 1ADYA 1TM2A 4XWWA 1NBEA 3HM2A 4EUKA 4BTVA 2AN1A 1XC7A 1VJ5A 2FW1A 3TZHA 5IJ0B 3K0KA 3IAAA 2GBFA 3R7LA 4KPYA 3DKKA 4XQGA 5JH7F 4YUYA 4HEA6 3SBXA 4B0OA 1PYGA 2NU8B 3CPJB 4QPNA 2C5AA 3CX6A 5A7GA 1CUBA 2YBDA 3A3YA 3PPYA 5FA6A 2W2VA 3BL5A 2FLWA 3MQ2A 2NP7A 2A9RA 4AKHA 3CZMA 2HPAA 2AMJA 4QU9A 3RRFA 2AW5A 5LQMA 4PZ0A 3SR0A 3S81A 2VP6A 1EWVA 2OV3A 5TE9A 3DP9A 4IVRA 3AKYA 4TZ6A 2OD2A 3RADC 4YIHA 2ZR8A 5L4NA 3WRYC 1Z12A 1DIGA 3DTVA 1XRMA 4QQRA 4WNIA 4QTTB 1VKNA 4PZZA 1XNRB 1EP2B 2BKLA 2PGNA 4U0KA 3VU9A 4AZ0A 4BE9A 4EGCB 1NPTO 4Z0HO 1KDZA 1T4CA 2HBYA 4ZDWA 4D4JA 4RK1A 4KN8A 1KERA 3VC1A 4RETA 1PJCA 3A3OA 4TLBA 3BHNA 1BROA 5FB3A 2IELA 4FHEA 2E49A 3TBHA 3ETJA 3VR2D 3CKMA 4FJ0A 2H2WA 2B5VA 2WF7A 2YDYA 3KTOA 3NNSA 1X74A 2QBYA 3ZWDA 4LC9A 5EIBD 1H05A 1U7TA 1YFKA 4JT2A 3W90A 4F7DA 8ADHA 4PCLA 3F90A 4KUGA 1QQ6A 3W8EA 2IZ0A 3GJ0A 1H69A 3HDTA 5JEEA 4RV9A 3RF6A 5ECYA 3GGCA 5EHGA 4Z9FA 2QXUA 2VHTA 1QC5A 5TX7A 2BTOA 1O6ZA 4AP9A 3JQCA 2QSYA 1W25A 1PR2A 4NDAA 1XRJA 3N9IA 4N1AA 1QYVA 5CGQB 5ADHA 2H92A 4R1NA 5C37A 1LZKA 1GZDA 3I2FA 3G2HA 1GYRA 1US8B 1S96A 1OWPA 4NPAA 1S8FA 1SC4A 5T67A 5BR4A 1E0AA 4REOA 3P2MA 1VKOA 4R0VA 3NJRA 4PNZA 2BEJA 3TYXA 3VR3D 3ZWMA 1Z88A 1EDOA 4O63O 4ZI5A 4X8LA 2QI9C 4P35A 4A82A 1V4VA 2BCEA 2DP4E 3RRXA 3EUAA 3PENA 2P11A 4ZO8A 2ZE7A 2D1TA 5ALIA 3RWBA 3UT5B 5JSZA 2OWEA 3JQBA 4DSZA 4I66A 3EW7A 1TPYA 3BH7A 4OGLA 3H8JA 5JV5A 4C29A 4NEQA 2IW3A 3RROA 1J0CA 5G4LA 3AM4A 4W8OA 3B3GA 5HKAA 3IULA 1QB8A 3IT2A 3KS9A 4IXMA 4EM6A 3MUFA 4RYLA 1HH4A 5L7YA 2FDXA 2M1XA 3WL8A 2W8ZA 5BWOA 1Z62A 2VWGA 1GTVA 1YD7A 2JFWA 3QNWA 2RGUA 5A2QA 4BLOA 3G7UA 4MW1A 1G21A 4RCVA 3HHPA 4L8LA 2AOUA 2OK7A 4TMVA 4LXXA 1FDWA 5ALRA 1O96A 2J46A 5F7XA 3CR3C 2V8BA 1NNI1 1UC5B 2J3DA 3SDBA 4TSFA 5IG2A 4YX9A 3MD9A 4NU8X 2IZ6A 3UJDA 1CY4A 1UM9B 1PU2A 4D9IA 2GM4A 2NXCA 3QNUA 3E2PA 1W59A 1L5SA 4P7BA 1ZNXA 1M9NA 2CUKA 5T6MA 4ZCSA 4EKIA 3COWA 4EJ2A 2WQ7A 5HMLA 3V8PA 2BSAA 2HJVA 3DOCA 2G5PA 4DGSA 5FIUA 1NUAA 2EFEB 2B6HA 3SICE 1I6LA 2C1EA 3OTQA 4LN1A 1H2YA 4S24A 4ZQGA 5AKJA 3VR0A 1X1BA 2PG3A 1DDGA 4FBGA 4QGBA 3KTFA 2AJTA 4NMXB 2IPMA 1NATA 3OFKA 4B3RB 4AICA 1YRWA 2Q2VA 2P4SA 2C8VA 2LBPA 4NV3A 3TQQA 3ZWBA 2NO7A 3PXXA 2J85A 4XWAA 3LY9A 3BFXA 3RLIA 2VAMA 4BBZA 4WUVA 5CJJA 1MP0A 1FW6A 1G21B 2R5WA 2YYZA 1K9SA 3U17A 1GSAA 2ZSIA 1QIMA 2DSTA 3A26A 3CNOA 3IAFA 3QVWA 4FHZA 4FN5A 2X1VA 1NP3A 3KV3O 4J07A 2FRDA 4M60A 3U56A 4DJDC 1E7WA 1Z5VA 1R3UA 3MT9A 4F1KA 1WMDA 4QD3A 3D3QA 2OAQ1 2YZ7A 3CU5A 2ZPTX 1UXIA 3OU7A 4YCLA 1JW9B 3UCXA 4WX2B 5LMZA 1DCTA 3IESA 1QORA 3OWOA 2V59A 1ODSA 5BOSB 3W2HA 4CV3A 4ZAGA 4K6FA 3UMYA 1QS0A 2R25B 2R87A 2XB8A 3MBKA 3ZWCA 4COKA 2R1TB 4E6PA 5KS2A 2A0WA 2G67A 1PSWA 3VOBA 4DMRA 5FO1A 1YVUA 2NVUA 4KGZA 2ISCA 2PKEA 4DAOA 1H1DA 1MU0A 1J8YF 2P8JA 3T5BA 3UAGA 4ZJPA 1AQ6A 5E3HA 4ZO4A 1HR0B 1WP4A 3DFMA 3QSYA 1UMCA 4ZDIA 5BUSA 3TTTA 2FG7C 3E8XA 3LCRA 3CJTA 1GNPA 1P18A 1NBWB 3ENZA 4BS9A 3F0TA 4DT1B 4NNJA 2A35A 3H0EA 3HFJA 4BCDA 3LSYA 1SXHA 2FEXA 1MABA 2OM2A 3A4LA 3HJCA 2OQRA 2L69A 1A50B 3K6JA 5CP8A 1UDAA 2G40A 1N5DA 4LGYA 1J56A 4XJTA 1BQ3A 4MJXA 3HU2A 4EATA 5CFOA 3MHPA 2V7WA 4A5OA 4I4NA 1QYCA 2P2DA 3DO8A 1J20A 2ZE6A 3F1KA 2PKCA 2DFVA 3KP1A 5JSUA 4U7FA 4E7OA 2WIAA 4RKYA 5ER9A 4EQ6B 3GNQA 3OX1A 4TZ0A 4FLEA 3D4OA 4MIYA 4DA0A 5L6LB 2MSEB 1GAXA 1E94E 3L3BA 4B43A 2B61A 3VYTB 1OBCA 5ESWA 3NX4A 3R5JA 3QOFA 2ACKA 1HM5A 1RRMA 3DOEA 4CMHA 1Y5NA 2YCBA 3I5YA 4PYRA 1M2HA 2F1OA 1DXQA 1WHSA 1KI8A 1Z0AA 2HWWA 5AJWA 5T3UA 3LIPA 3GNTA 2O2ZA 3B5EA 3FKJA 5FEMA 5ETJA 3T3OA 1CZUA 1SU7A 4Z99A 5TLSA 1VSUA 2IJGX 1WDTA 1JWAB 1UFRA 1DRWA 3PQ2A 3VKGA 4PFQA 2R8RA 1FFYA 1FRFS 1NFFA 3H9GA 4JBIA 1ZD2P 4BWFB 4W5RA 3H7IA 2LRHA 2FQXA 2O8FA 2YWRA 3BKXA 4C3OB 4AC9A 4JC4A 4URXR 1W7AA 4OATA 2H3EA 3OPYB 2GJ9A 3OT4A 4YIKA 2MINB 4NCIA 3K6SB 1J07A 2Q3DA 4LF5B 3BX1A 5U4QA 3BB3A 2JFZA 4UUPA 4AY5A 3CZ5A 5FNVB 1E9SA 1Z7BA 1O7JA 2XKBA 2H51A 1JAZA 4LA4A 1S4QA 5KKNB 1GSIA 1GJRA 4JU9A 3R9IA 4K8OA 5CBPB 1BYUA 1FEZA 1U2PA 4HYYA 5DK4A 1O2DA 2CXTA 1WV1A 2I87A 3CUWA 4CU2A 2Z9DA 4MP8A 1ULUA 1R10A 5AW4A 4FDAA 2O2XA 3IAHA 3NEYA 4HJXA 3SE7A 4NESA 2VQFB 3KYIB 3QI7A 3QPAA 3P9ZA 3H9CA 3EIWA 4OU4A 3BDAA 4Y6SA 3N2NA 2QKYA 3FMOB 1QF9A 2GBGA 2CL5A 3K1AB 5MN5A 1VPTA 2I66A 4EYEA 1MEEA 2VDMB 4YCMA 3RD5A 3U6BA 4MPTA 3TIGA 5B64A 1B43A 2O7RA 1HGXA 1QH8A 1CUHA 1T5IA 2QJRA 2OL4A 3KJEA 4FINA 3AF2A 3B5JA 4UDOA 4KGVA 2FUKA 1NGSA 2RDMA 3AF3A 1Z18A 2J48A 2I7XA 1E7QA 2HXGA 2C9DA 3SZ3A 3WJ2A 3QQPA 1EEXB 3EGDA 5CT4A 4E5SA 4RACA 1GPJA 3D6HA 4QUHA 4BJHB 4F9FA 3QPCA 1QNLA 4YWHA 4PVCA 5KQMA 2VXYA 5DGDA 3O0DA 4ASUD 4MW9A 3OQ1A 3VMMA 4E3WA 1WSBA 1B8OA 3EZYA 4WGGA 4YJKA 5FI5A 1OROA 1M7HA 1M6WA 4N0MA 1PV4A 1ID8A 5C7LO 3QTBA 1KSHA 1UQTA 2ASVA 5AFSA 4IDQA 2JGNA 3HKCA 4LOAA 3R7DA 4D9GA 4KAAA 4FHCA 1FK8A 1F2TA 4ZRNA 2RHRA 4NENA 2Y0DA 1D8TA 1Z38A 1SVIA 1JH8A 4IIJF 4XIIA 2AZXA 4KMSA 3HE3A 4NENB 3M33A 4HH3C 1I7LA 5A4JA 1SG6A 5TPWB 3C39A 1IZZA 3BE8A 4ZOLB 3WK5A 1HDGO 3N53A 1SBTA 4MUGA 2G5GX 2Y4OA 1HQKA 1GXSA 4M4SA 4FGWA 4EGSA 5B1EA 2ZPUA 1X70A 2V8OA 1YZ3A 3IRUA 1PNRA 1T9CA 3QU5A 3AUKA 5AM1A 4DV4B 2VPXA 2AEFA 4JOQA 1WPRA 5YASA 4OUKX 4OJYA 1H0SA 2HOQA 3BDIA 1QV6A 1YOBA 5F78A 3B3AA 1V47A 2M6KA 3TECE 2YC4C 3FPFA 1GZ7A 1E32A 1FXWA 3DMGA 4ZI7A 4D6YA 2YJZA 1OTXA 2D4AA 3IYLW 4YY3B 1M0TA 1UP7A 2I91A 2XYRA 2AW3A 4P5EA 1YR8A 3KPJA 5CLIA 5KSZA 3PZBA 2OCDA 2ISSD 2GEJA 1PJLA 4NBSA 5CFQA 5LYJF 2FFAA 1G7CA 5A5GA 1ZA1A 4X1IA 1NSTA 2DPGA 3FPJA 5CNIA 3T7IA 1IBCA 4Y18A 4Q4LA 3KZMA 4LGVA 3S8MA 3WLSA 1DCFA 2Z9BA 1MC8A 2A4KA 4DV5B 2RB4A 2VA9A 3R3JA 5IYZF 3LBHA 1QBKC 1BJTA 2P6NA 1V96A 3A9UA 1NQTA 1Z4QA 1UBGA 1OBOA 2BFEA 2PUTA 3QFSA 2WT9A 4IDOA 2X7XA 4LCJA 1ZM7A 3D1LA 2Q0QA 3BRQA 2AE1A 4M0MA 4ND3A 2PEZA 3CSSA 4DCGA 1G19A 1LGYA 3BG5A 2VNIA 4EJ6A 3W5BA 2IZ5A 4EKNB 2EW2A 2AEJA 4FE4A 5MF6A 3SBOA 3I30X 1VJDA 1XIVA 2JANA 1PFYA 3L43A 4LJ4A 4C5BA 4G8BA 4O2BB 4UHJA 3KQMA 4JBWA 3NYQA 4Q00A 3R3WA 3TSZA 4BEJA 3CLRD 5K3SA 1TTTA 1HOTA 3GJ7A 3ZDRA 1EB8A 5F51A 1GNVA 2GZ3A 4LNUA 2NSHA 2XVYA 3QOXA 2D54A 3DXZA 4PLWA 4OQEA 1RVV1 4UBLA 5H02A 1WXFA 1JPJA 4EGFA 1YOVA 2CFRA 2ZGVA 4H6PA 4M0UA 5TEVA 1AMUA 2ZSDA 3FNGA 3RUHA 1SVLA 2HDOA 2UKDA 4X63A 8ATCA 3P2EA 3PGA1 4DCUA 5FI1B 1Y6ZA 4H35A 5DTEA 5KYYA 1ZY2A 5AUNB 4YJFB 2F00A 1ZISA 2AQHA 4RMNA 2WPDA 3RWMB 3B2QA 3KB8A 4UMFA 4BFYA 1R8JA 1T3HA 5G0UA 4FWBA 4DDUA 5EE1A 4R2MA 1HLDA 3RUIA 4DQ0A 3AEZA 3QJGA 1F0YA 2Y1WA 3K4PA 3SAJA 4ITVA 1CR2A 5IEJA 2DBRA 4MRSA 1L7PA 1RMQA 3CUUA 5F76A 3MCUA 4KDCA 3TR6A 4HB3A 1EUYA 1REQB 3I12A 1UPTA 4HFJA 4F6RB 5D3QA 3LUCA 3RG8A 4ZOQI 1S2MA 3VJLA 2BAGA 2PZMA 4BO7A 4ZCMA 2O59A 1CF4A 4L85A 2O57A 5D3ZA 2BMJA 1MB9A 2QVXX 3PI7A 2LW7A 4GIBA 3AXTA 5FFNA 4DBVO 1GADO 4IGEA 3JQEA 2RHWA 3EYWA 3LQKA 2D5BA 4AWXA 2XE8A 2HFJA 3GUUA 2FN9A 5E8JA 1HYQA 3B3FA 3BIFA 3N74A 1SXJE 4DV1B 1ZIXA 2IPXA 1QCCA 2VQ6A 3A11A 2E9SA 2IXTA 4QHSA 2ENWA 4LRTB 2JBWA 4Q5IA 1RRCA 3RVPA 4GBMA 2REOA 2CJFA 4ESVA 5A0TA 4RLHA 2AC7A 1CZOA 1U8UA 4IOLA 4GGPA 2QORA 4O2RA 3AMVA 3IBSA 5ISMA 5ABPA 2XZTA 5AK6A 2I4IA 1Y4DE 2X41A 3ZDXB 1GQOA 1LBTA 1L3IA 4EY6A 4B74A 3PWTA 4NULA 4PLYA 2G08A 4I3GA 3LTNC 1UWCA 3VXKA 3WLQA 4TSFD 5DLYA 1A1VA 1GNRA 2JD2A 2VLBA 4G4JA 5DPMA 1YBFA 2DFDA 2OKGA 4MKZA 1ZMBA 2DJ5A 1WJGA 2RGNC 1XP5A 2CHGA 1R4NB 4OK6A 2IYNA 5AP9A 4I5FA 1JJ7A 4O3MA 1PDOA 2HM7A 3AGQA 3UO8B 5HPYB 1KZYC 1SUPA 2XMCA 1W88B 2R84A 1DX9A 1DBIA 5JATA 5E0KB 4A1FA 1F38A 4XARA 2Z1DA 3CX4A 1OSNA 4E1AA 2WD8A 1TD1A 5BW4A 4Q4DA 1MOZA 2QRQA 3HUTA 4C7MA 3UCFA 4RMJA 2JGMA 3T3IA 5HE8A 1RYFA 1OVMA 3HKEB 1H5QA 3QKSB 4K86A 4TWRA 4WK0B 3BSSA 4R1LA 2OEPA 3M89A 4Q4JB 4N3CA 4BQOA 2K7ZA 1ADCA 2I9KA 1I3OA 4ZYXA 4YA6A 1PNOA 1XK7A 2JNWA 4IINA 4M8KA 3L8ZA 4ZAXA 2QRZA 4JWKA 2B83A 4MI1A 3ZJYA 3Q8LA 3ZCTA 3K53A 1Z28A 3EDRA 2RCYA 4WDRA 4IGIA 4WQMA 4DNFA 1A2OA 3RYCA 3H18A 1LK7A 3FKSA 2JCGA 2G83A 4C4OA 3HVUA 3V4FA 1BE8A 3E70C 4MUIA 1QE0A 2EJUA 3E9YA 5KTRA 3IHLA 4E31A 1D2AA 3WNQA 3HN7A 3O92A 1EINA 1GYQA 2XYQA 4B7CA 1KOLA 4K88A 4QNNA 1GRVA 3WWOA 1WULS 1HSOA 3ZHQA 3I2JA 3GW8A 3TG8A 3T1NA 1ZVVA 4RGQA 4W5TA 3WVNA 1OREA 2NU7A 2GJKA 1N2EA 3P5SA 4YRMA 1EVIA 4ZEWA 1FQWA 2B2XA 3SS8A 3SXUB 1LTQA 3UMBA 1ECJA 1KO8A 3MB5A 1DIRA 5F52A 4I08A 5C7YA 1CJCA 5A62A 3VYRB 1NUPA 1KAMA 1DELA 2FR8C 3RLFA 4MYRA 4PTZA 4CQJA 4P34A 4XIGS 4IBOA 1ND5A 3D6UA 3IEKA 3A2MA 5KOJB 4ZD6A 1Z5ZA 4TMTA 2BTQB 3P32A 5JXGA 4AI6A 3UOWA 2YYAA 1T25A 4HGOA 4B3TB 3AHDA 4BKOA 1M5TA 4YRNA 2WZBA 4Q19A 4CNQA 2QSJA 3IT0A 3JY6A 4D2IA 1BS1A 5JLJA 2HK7A 2XADA 4RHTA 1XUOA 5J2TF 1FFAA 4M9UA 4FZ5A 4MKRA 4Z1OA 1V8BA 3VZRA 3EGEA 3AVWA 2ATEA 5BVGA 2QMQA 3RI3A 3VR5H 3ZHRA 1Z7WA 2G5TA 4P81A 3HXOA 1ESZA 3COPA 3LZCA 1JQAA 2VHVA 4WOBA 3UAZA 2W42A 1M67A 1BVYF 1XO1A 4U4AA 3N58A 3TVYA 4RA9B 4B1FA 1UK9A 1L1EA 1Y8QA 1HURA 3CW9A 1MG0A 1SCIA 2I7DA 2P7HA 1I6MA 3KLMX 3PFFA 2O8CB 2VTKA 5LP6F 2ZIXA 1DLIA 1HG0A 1WHTB 2P77A 3PEYA 2R8ZA 3JWPA 4PANA 4ZOEA 4BV2A 4EPRA 3ASVA 3WIVA 2XDQB 5K3OA 2UV8A 1AQLA 4GZ5A 4UUNA 4TKVA 1OIWA 1T9GS 1YT5A 2WI8A 3KYCB 5H3CA 5K1ZA 4DWOA 5K4HA 2ZCJA 1W75A 1SC9A 3TLJA 4Q1VA 4A8HA 3PR1A 2ISQA 4YRKA 3NB0A 3ZLTA 4UMEA 1VCOA 1NMQA 2NVWA 4HNGA 3L0PA 4HQ0A 1Q0UA 4CLHA 1LJ8A 4ZYYA 3AXSA 1YL5A 1FZTA 5HGXA 4LGMA 4QTZA 4UAJA 3RNLA 4YJ3A 3GH3A 4CRWB 5C9ZA 1JEEA 3GQVA 3WHKA 1PJSA 2I4MA 5GP1A 4QATA 5DWDA 4TZKA 4K81B 1ZRSA 3N2KA 1VHDA 1E5TA 1OFUX 1UINA 1Y8QB 4E7PA 5KB3A 2ZYRA 3EW9A 3HBNA 2I4RA 3P45A 1J4AA 4NDZA 3AF5A 3OPYI 1NRWA 5ALOA 1F8YA 1WU8A 2IK8A 3VZBA 4OFXA 1DJQA 2OG2A 1KI7A 2FUG6 4JJ7A 4QLAA 2GBIA 4EY7A 1W1IA 5CNKA 3TJRA 2PSJA 5IN5A 3W2IA 2ZFUA 3Q2OA 4HDCA 1YSCA 4L5IA 5AHOA 5AVOA 4YQYA 5GOTA 5GGYA 1G2OA 4BFTA 2C29D 2QR2A 3QX8A 4NZMA 4F4IA 5DM4A 4UBOA 3H3JA 5EQTA 1OGIA 1P5ZB 2GCNA 2YIMA 4BX2A 2DVMA 2IP4A 3IALA 3L0SA 4IF4A 4JP2A 4MYHA 4DS3A 3SI7A 3VR1A 1WR8A 5KQRA 2Z6VA 4O4HA 4G1VA 4BMNA 3OSZA 1OW3B 1AUVA 4I1VA 3O4HA 2A5LA 3ICVA 4M8SA 4CCAA 1Y33E 5IC6A 4B3BA 3AEKB 4OJKA 1K5DA 4PYOA 2FMTA 1TT5B 2QUAA 3F97A 1QAOA 1H8EA 2CHFA 2WKWA 3VR5A 4YAIA 1P77A 2A5DA 3UWOA 2XVZA 5IN4A 2VSXA 2W9XA 2QPAA 4RFSA 1F8FA 2JB9A 1TJYA 3OCWA 2GASA 4ZT3A 3ZG6A 4BIMA 2NZ2A 2OXTA 1C3VA 1ZXLA 4O2LA 1PAUA 1LV7A 1IVNA 1HE4A 1KEPA 2JH8A 2Q3MA 1Y8CA 3LRXA 4XX0A 2PMEA 3WLEA 1XTQA 1KZ9A 1UL1X 2C94A 3AR3A 3OFVA 2IXFA 1KYTA 1SXIA 3C2QA 5FPTA 2FW0A 4O8ZA 2JLAA 3ELBA 4NOKA 1K97A 2I6QA 1BCRA 5A3QA 1HYBA 5EGNA 3B3QA 3RQIA 1DX6A 5JC8A 2P6PA 4LDAA 2JLUA 4HWSA 1E9FA 2PYDA 4CKZA 8MHTA 4K7JA 2Q0HA 3OA2A 1YDWA 4TQ9A 1QB7A 8AT1A 1ZFNA 3LUAA 4U3JB 3RVQA 1PT7A 4OI4A 3JQAB 2AOTB 2J4CA 2P3SA 3GLQA 1Y6RA 2CXUA 2VJCA 1SA0A 3TLYA 4CV2A 3OO0A 3WAGA 2ZYDA 2HRBA 3LCJA 3NHKA 1DC4A 1F17A 1CF2O 4MVJM 4DT1A 4Z1MD 3IJ5A 3NM4A 2GHIA 3IAEA 3KQQA 3QPWA 2VUTA 4RW0A 4JELA 3BWCA 4B3HA 2OPBA 4Z3KA 3OPQA 1N36B 1NNUA 1B3BA 2PH7A 4EB3A 2FPMA 3U7FB 3C7CB 3R40A 3OE1A 3K94A 3Q3HA 5BXQC 2VN8A 1Y3BE 3W5IA 4RYDA 3I09A 4M0FA 1TVCA 1E7YA 4N0QA 1X92A 3MWLA 5H0IA 1XZLA 4G0WA 1SBZA 1KMIY 4WPGA 3EXFB 2JEYA 2BM9A 2R1VA 3ADBA 5BMOA 1G8HA 4FOSA 5IVDA 3Q7SA 4ALMA 4FDMA 4Z51A 1G7SA 1UF9A 2GO7A 2QD3A 3THXA 1NVUQ 5DX8A 1ZXBA 3GMTA 2YXLA 3JW8A 4HATA 4IZOA 4AZTA 5K8JB 1IN8A 3MBIA 5JOQA 3EFOB 1P7PA 1U3CA 4FIZA 3WDMA 3KUXA 1W30A 3DQQA 5BVHA 3DE6X 3LBAA 4R8RA 1FU4A 4UVDA 2YWXA 3RK0A 3NXSA 2FK8A 3TBFA 1TQ8A 3AR6A 3NYWA 2GEFA 4ND6A 3REGA 1ECCA 3RV4A 1Q77A 3AU8A 4AXXA 3RC1A 4EJ0A 5CEJA 3WZMA 3FOZA 5DT9A 4C78A 4TVSA 1GZSA 2EV9A 4MZXA 1NYQA 1ZZEA 2FSSA 1H5NA 1RHKA 5JG7A 3T5TA 5K8IA 2ZIFA 1SEPA 3BHIA 1L7EA 3PVSA 4R1OA 2XNDA 1XVVA 3IEIA 3OZRA 3WB2A 3AHEA 2J3LA 5SY9A 2HREA 5T64A 3V42A 3KB2A 5EY5B 4DPMA 3OZTA 1LLFA 1HDXA 4MSUA 2WT4A 2HJ9A 1NMSA 5LOVB 1V39A 3JVDA 2G72A 4LJ9A 3JYPA 1TVKA 2ZYSA 1KPHA 1T5LA 1TECE 4JCCA 2HLPA 1V1MA 5B6JA 5EZ6B 1ZOSA 4N6NA 4LVOA 4XQ9A 4Y1RB 3TK1A 1QNFA 2J32A 3KVVA 4FYHA 3JQAA 4IJWA 4DJAA 1Z0JA 4JEHA 2V58A 4YQFA 1Q22A 2QG6A 5FOSA 3DUFB 2Q3HA 3IRVA 1J8FA 3M1LA 4B6JA 2IXBA 2D0PB 3BL8A 3KC2A 4C4ZA 5JASA 5F77A 1I4DD 1E1CB 1TJ5A 3S2ZA 4BFSA 2XBLA 3CEMA 1AGYA 2MSKA 4PG7A 4UU0A 2IYPA 3C3AA 1XMJA 4BUZA 2PLRA 1E77A 4JK3A 3UNXA 4EKEA 3E9DA 4ZT5A 1FP4B 3K4QA 3I1FA 4NG4A 4J1NA 4S1TA 1SVWA 1EFUA 5EMLA 3ZZMA 3L5KA 3M4XA 2AYXA 1Y34E 5BWMA 1LA2A 1R6BX 2B98A 1PX2A 1XI2A 5FBLB 421PA 5BNIA 1X14A 4O4HF 2EXXA 3QFTA 5HM8A 4US2R 1YQDA 1YOVB 1MVLA 4F9GA 4OSEA 1VL1A 1YQTA 4E13A 4OMDA 5AJUA 2A9PA 3V80A 4Q48A 3KFXA 5HJEA 1LS6A 1XJ0A 1NVAA 2FLKA 3I9KA 3VJRA 4MP6A 1KI4A 2W83A 3GP8A 3V2UA 5EZSA 3OEHD 4EY8A 1XN4A 1W5SA 4A0GA 2NWQA 2QYSA 1YFLA 2GCIA 3ILHA 4NAHA 3SEQA 5BNZA 1RQXA 4XUGB 5E0OA 1DFGA 5HM6A 4PSDA 1G3QA 3GJYA 4HFRA 2ZUBA 3HUEA 4D8XA 3GP5A 4EX7A 5REQB 3QU2A 2O8DA 5CDGA 2GVDC 4JA0A 2JCYA 2FZWA 2QUKA 2DFNA 2PHZA 3IAUA 4IOJA 2E1RA 1S2LA 4O4IF 4IIGA 4FK8A 1WMFA 3S70A 3T9AA 5KSYA 1L7RA 2Y99A 3D2AA 3HA7A 1QC5B 2PKYX 1GCAA 4KO1S 4RK6A 1N33B 3DWFA 2PR2A 2DWPA 1Z9BA 3G2JA 1JDBB 4UXJA 3AM5A 2QYOA 1Y3DE 3GVIA 3UBTA 4UPEA 1Y6QA 2HQRA 2O2HA 3G3EA 3HB0A 3NTQA 1NUTA 4TTSA 4PZAA 1FFCA 4NTZA 2NU6A 2AOTA 3MOIA 4K5QA 5AHRA 3RSQA 4EJSA 4K1LA 1XKQA 1J21A 5AHWA 2E21A 3DOFA 4LRWA 5IBQA 1NWHA 3TH5A 4XA8A 2DKOA 1BSVA 2ZJ7A 1MIHA 3E03A 3ENQA 1KO4A 3KVYA 2EBHX 1WSWA 5CRIA 4YRCA 1QIJA 2CV1A 4LJYA 3ZCQA 4ZEMA 3B12A 3TAHA 3TDKA 3UHFA 5KQSA 3SHFA 3COYA 2FFJA 2X58A 2VHCA 3LHIA 4GOLD 3ZDDA 1BXRA 1RPNA 4B40A 3NBUA 4DLRA 5KO2A 2WHYA 1PNVA 1W4ZA 5A03A 4IYJA 4BB0A 3LK7A 2CLLB 3SOPA 1GPWB 1UEIA 4FYPA 2GBPA 1UJ2A 2C99A 2D7JA 3F3KA 5CR9A 2YVAA 3DTVD 1UDCA 2G9ZA 3G0OA 4JHXA 4XUCA 5CVTA 4KPGA 3ECCA 2W4QA 3ORQA 3LVBA 3NNNA 3H3FA 1R7RA 2D0IA 2H7VA 3CBQA 2OFFA 3U4DA 4H18A 1KK0A 3EH1A 1E1YA 3QU7A 1FRQA 3RFVA 3JAWA 2NAFA 3T7SA 5DP1A 2UVPA 4BU0A 3JQBC 2RIRA 4LG1A 1L5ZA 2C04A 3O91A 4ND5A 5DXAA 5K4AA 3FLEA 1AUPA 3GPBA 4E33A 4H2DA 4JI2B 3E9NA 3LW7A 1QG0A 2Q1XA 1EA7A 3LWBA 4IWYA 4P33A 1C3EA 1COWD 1G4HA 4UHBA 4ABYA 5EQJB 5LJLA 4NCBA 2BC9A 4FW8A 4G5GA 1XZPA 3FCSB 2ZUVA 1CY2A 4HUQA 3ROMA 3SIPA 1YULA 3A9TA 3NIGB 1QYIA 5D84A 1DKMA 4H7EA 5HUJA 1II8A 2JJ1A 3L8HA 4B17A 3UGJA 4AQYB 1JEOA 3NKLA 4J2OA 2GR9A 1IU9A 3BVPA 3ILXA 4UUBA 2N1MA 1TUEA 3WLFA 4KR3A 4CGYA 4I8DA 3TX6A 4C2BA 4FILA 1VHTA 1YB6A 2RH8A 2MYTA 3HBAA 2KLHA 4V24A 5JNVA 3PE3A 4UNSA 2ZRKA 3K1AA 4LC0A 1I01A 1YHNA 1SH7A 4KXQA 3SZRA 3ADDA 3CRW1 1N3BA 3ZCRA 1YS2X 3THWB 4ZOBA 4ZKEA 3S99A 5CDFE 5EQFA 1I24A 3M5DA 3KQYA 2R85A 1C4KA 4M76B 4DADA 2HRRA 4G5XA 1NW4A 3ZZ1A 3VNVA 2GPNA 3ODGA 1NRXA 5AJYA 3N75A 5FTMA 3SKXA 2WF8A 4LNAA 1I36A 1ZCBA 4PZLA 4AYXA 5IZCC 2WFZA 1ZJ5A 1T5BA 3R6DA 1V6AA 3ZHUA 3L84A 4BO0A 3K6SA 1ZN8A 1ZITA 4UOQA 1LDNA 1PJQA 2ZIXB 2R3SA 2ZYGA 4H16A 4IMRA 2WJ4A 4DBZA 4LBVA 4YCAA 1MGOA 2OR3A 2ZJ0A 5FOVA 5B3LA 3RASA 4L7VA 5HZKA 4L0DA 4PAWA 1RP7A 5GONF 1KPGA 5DI9A 1QMGA 3C3WA 2DYKA 5JJIA 5IT5A 2DLCX 2TS1A 3DZCA 4KMRA 4ENSA 1MQSA 3G13A 5LYJB 4W9MC 4RIHA 1UJCA 4BV8A 3SVTA 5LDDC 1RMTA 3GPDG 2PWYA 3FCXA 4Z0TA 4H1VA 1CZKA 1ABBA 1DC8A 2WIGA 3DULA 1PR4A 2C07A 1I0ZA 3PC8A 4ISCA 3UB3A 3UPUA 1Q91A 1T9DA 4UUMA 5EFOA 1XDZA 2GVZC 3BREA 3IAM6 2QVGA 1DLJA 1UT8A 1FJGB 2QD1A 2RJNA 2Q46A 3LF1A 2Y66A 2FETA 2Q5FA 4HNHA 4KEAA 5KYUB 3G68A 1P0IA 1JR4A 4NECA 1R0ZA 5TGTA 5KU7A 3L0ZA 3V8RA 1T5HX 2X22A 3LPCA 4EAQA 1C9MA 2XGOA 1CQXA 5FDFA 1E2EA 4EUHA 4X3OA 3GCWA 4OHPA 1QSGA 3GG2A 1JKJB 4K46A 1CWUA 2HHLA 2CYAA 5ESXA 4E15A 4K87A 2NUBA 4CJXA 3D6VA 3SBDA 3I9JA 3Q3CA 4G23A 5BWBA 2JLVA 1AKTA 2J3HA 2M2IA 3UXEA 5J4HA 3TPFA 2HQ1A 4PO9A 3ZD8A 1W76A 1WMAA 1Y48E 4KAJA 3WV5A 4C4SA 5MFZA 1T0HB 1P3JA 3DLIA 4EP1A 3AK4A 4MKFA 2BE7A 3R3YA 1H93A 1FDTA 3KPVA 2FPIA 3IURA 1A9YA 1RFLA 4AJ2A 3PYMA 3OTIA 4JGBA 1OV6A 3FHCB 4FYKA 1G20A 4PLVA 1P91A 3HU3A 3NOQA 1E1CA 2FFBA 4FT2A 2G76A 2GXSA 4IDAA 5KX5F 2AX4A 1EFVB 3K0FB 4O2BF 4PAGA 1F3OA 1WNTA 1XVTA 2L82A 2WUGA 4L2IA 3UENA 5SICE 2AJCA 3UJ8A 2AG0A 4CGZA 1TCCA 1XZAA 2ANCA 2JGRA 4EG6A 4AN4A 1A5AB 1ZO8A 3M4JA 721PA 3IGFA 5DI3A 3Q85A 4XYMA 1QH0A 3JYLA 3FPKA 2O8EA 2VDOB 4XQ0A 5J1TB 2O5EA 2K7FA 4BPBA 3WJ7A 2NO5A 4I7EA 1TAQA 2WHQA 1ZIDA 3NBAA 1E63A 1U5AA 1YH3A 3PGKA 2ZREA 4IVPA 2J0EA 3CNNA 1Y98A 3H8WA 5E9AA 2IYZA 1RWNA 2VQSA 2YN2A 1D7AA 2YNMA 4KG7A 1ODIA 2XT6A 4IG9A 4DA7A 5B6IA 4W99A 1B16A 3I6QA 4WFKA 3UK6A 1QIEA 1NVBA 1F2UA 3IPLA 3SEZA 5GVSA 3KZXA 1UBOS 1RXVA 2H1SA 3L46A 3DAGA 4ZC8A 3A1TA 2EWMA 4HWOA 2P7IA 4DLUA 3A04A 3VNQA 2OC4A 1LB1B 4IKEA 4RUKA 3WTCA 3RS0A 3MERA 1D07A 1K7XB 5A0VA 2C2MA 2Q0XA 3N6VA 2AMLA 2H1OA 3CEJA 1RRPA 3W1WA 3ZK8A 2QVYX 5KNDH 3L4BC 3GLHA 2C7RA 4JLKA 2CY0A 2WHEA 3CH7A 3QK7A 3BXGA 3OCCA 4E5MA 1E0JA 2OOKA 3ED5A 1P8AA 2EOAA 2QLMA 3FRJA 3AT1A 1KP9A 1QYRA 2PMCA 4J7UA 1JU9A 1KJJA 5CLFA 3IOCA 4NICA 4BTLA 5A3RA 3OZEA 4LX0A 1V11A 5ICFA 4EENA 1RZ3A 3DLTA 1YTUA 4OP3A 1TX4B 2ZBEA 4OHOA 4WK4B 4B87A 3GFVA 5B57C 1ZOIA 3LGAA 5FQOA 5FV4A 4OLBA 4RZQA 3L6EA 1N2IA 5ELMA 1A3CA 3UV7A 4YMIA 1DWPA 2O48X 1VJRA 3HCCA 1QG6A 1CDDA 5TF0A 1QIKA 1X1SA 3IIMA 4O1HA 4X1YA 4YLYA 1KH2A 3CG0A 3DFZA 5DSZA 1IUKA 5JADA 1BJRE 5HKKA 2IODA 3TLZA 2V6MA 1KYIA 1MAAA 2IC5A 4FCTA 5HGJA 4I1PA 2W2LA 1XD8A 2WMYA 4KI0A 1O0CA 3A3NA 3OCZA 5H59A 3R8XA 1OIXA 3IE2A 3PHIA 4GPAA 4ZU1X 1BDBA 5I7UA 5JBIA 3N8KA 3QE9Y 5DU2A 4F5YA 4XCVA 1Z13A 3WQQA 4BZWA 4JROA 2G71A 2PR7A 2WPNA 3AI3A 1G6Q1 4GVLA 5EJ4A 4TLCA 3ISJA 4W63A 2BEUB 3I0NA 1FYXA 2O1EA 1JYFA 2WU4A 4PPYA 4RQAA 2X0IA 1YJBA 1G8JA 2W6ID 4NG5A 4QUGA 1FUIA 5K45A 1IVSA 2QJFA 4EG1A 4TL7A 4G5RA 4FKBA 4AD8A 3NW9A 3UHOA 2VT6A 3H2IA 3O75A 1QK5A 1N4AA 3NBZC 3SHTA 4WK6A 4E88A 3PLRA 2Q9BA 1U0JA 2RBGA 4WFIA 3D5QA 3E2MA 4JITA 2PXHA 5FPSA 1Z34A 5JAMA 4HVTA 1DHRA 1VYVA 3G0BA 4LUCA 5IFKA 2JBAA 3IUQA 4PPQA 4TQAA 2YWJA 1X1DA 3SZGA 4YRFA 3OJOA 4R40A 3T7DA 2Z57A 4II2A 4FXOA 3VFDA 2GWRA 3WWZA 4QPZA 2YIVX 4DIUA 3FDIA 2H07A 3DBLB 1CK4A 5ERXA 5I7RA 4F06A 1VE3A 2NPOA 5AM3A 1DC3A 4PZYA 1BQEA 4IHJF 4QARA 2JI7A 2I29A 2QAIA 3ESXA 1F3LA 1NA5A 1UK8A 2YJ4A 3DTVB 4IFBA 5IM4A 2ZQYA 2IHKA 2DGDA 1T29A 4KTTE 4YLEA 5C3UA 4CLOB 4ZVUA 3P0RA 1VOTA 2X0DA 3U9SA 4OFWA 2PX5A 3F7TA 4URYR 4R3NA 4DUGA 2OAP1 1SGWA 2XSZA 3EARA 5JDCC 2VUIB 1FUEA 1CPYA 3R3HA 2MSNA 4RS3A 5MGNA 4ZJYA 2OUIA 1FYVA 3C6XA 5C8VA 1AZSC 4GQIA 3S2FA 2P4QA 4UTPA 3TLXA 2X5JO 3ZGVA 3S1SA 2ZBGA 1XCLA 3KJXA 1NKTA 4N9QA 1SOWA 4QG7A 2VNAA 2PKXA 2JG3A 3FHTA 4MGEA 1I10A 1CT9A 3QLVC 1YS7A 4BWGA 2BFAA 2HTEA 4KTVE 4TMWA 5I7SA 3HV0A 4CTNA 4W5HA 2XF2A 2FGKA 4YEDA 2EFDB 4D9NA 3U7HB 5EKTA 4OXXA 1VL5A 4TTIA 2HWYA 3HU5A 4NJEA 3EEQA 1W4LA 3R4CA 5F21A 2XTAA 2QUIA 2QN9A 2FDCA 4OHBA 1FU7A 1ZJJA 2DWQA 3KB1A 1MRZA 3I28A 2IVZA 3UJHA 2VUUA 1HT0A 4QAJA 1QXSA 3RPEA 5JXHA 3VZSA 1U63A 1B8NA 4MROA 5KWEA 4L9AA 3BCSA 4QBIA 1RW4A 1AGPA 2WHPB 4OHCA 1YJCA 3KBOA 1H2BA 4AX8A 3HBJA 3OWXA 4MPDA 3X1ZA 4ABTA 2CBXA 2FHSA 2XWPA 2PSDA 4HY3A 4CLOA 4B6GA 4LOIA 2JKYA 3PEEA 4B4KA 4DG8A 5IPFA 4YAOA 2X3YA 3HU1A 4LF6B 1J2TA 1PEAA 4BJ1A 1EG7A 1PVDA 2FN3A 3LZDA 2HIHA 4P4UA 4XWOA 2NAPA 2H18A 2EKZA 1BOFA 3UTCA 4Y0VA 2HC9A 1FOEB 3NI2A 4Y2JA 4CODB 4RTOA 4QO7A 1VDMA 2P30A 1Y4SA 4YMGA 4N18A 2PGDA 5F1OA 3UEOA 3CG4A 1KFEB 2I2AA 2WZDA 4K6MA 1DFHA 1OXKB 3DSRA 4DDKA 1GCIA 4WBNF 2GN9A 3OJEA 1D0SA 2OK8A 3SLGA 4ENWA 3FX2A 5J5VA 3GELA 4HNVA 2JJQA 3DE0X 5L3QB 4MA5A 5KVCA 1Q15A 3HEAA 1RLUA 3WYDA 2DQZA 1M1ZA 1Y1TA 4KK4A 1U0SY 3HNRA 1Q2UA 1EA5A 3GRCA 4DR3B 5AKYA 3F6BX 1GR1A 3IELA 4LTNA 4RSRA 4OXNA 1ACJA 4WCDA 1V2HE 1EP3B 3KXKA 5PNTA 5B6PA 2J67A 4X7MA 2B1IA 4ACBA 4DKXA 5FFFA 1P2TA 2DWOA 3PHGA 4II3A 3HB5X 1OFUA 1AO0A 4JGIA 1JVBA 3AETA 3TSAA 1QV7A 4AZWA 2DAPA 3UQZA 1ABEA 1JIUA 5LWHA 5HF9A 3F5DA 3WLKX 1ZD3A 1QAMA 4KNWA 3WGIA 1W1UA 2FSVA 2PXXA 4MPRA 2IEBA 4P3XA 4X93A 1S3GA 1J2YA 1KF0A 2JIZA 2C83A 2LVBA 4ND1A 1TEHA 5F33A 1YUBA 1G2PA 1GRRA 2W22A 3A05A 1S2NA 4FS8A 4IILA 4Q1CA 2CE2X 3AF0A 2XYHA 4QBKA 5J5AA 3ZQ4A 2AXQA 1ZR2A 1VFPA 4KR6A 3PK0A 4C04A 3M6XA 4C3VA 1L4KA 4Y9DA 4P2GA 1CE8A 4PZDA 5DM2A 4B6OA 4K9OA 5JJ5A 3AUXA 3C8DA 1DEOA 1JDNA 3NIFB 4R1UA 1AXEA 3U26A 4IVQA 2Q8PA 3PKZA 3OZGA 4P58A 5ALVA 5JMOA 1QRSA 1I32A 1QGYA 4EFLA 2ZRJA 4RVNA 1G8AA 1RJ9A 3UWMA 3ZX4A 3IQWA 4XW2A 1DBWA 1TIPA 3CRRA 4TLAA 3FI9A 3KEMA 1NW7A 3TSCA 4EVQA 3FDFA 4TX1A 2R6JA 4AKEA 4MDHA 3TQSA 1C1XB 1AQYA 4EUSA 1JXOA 2ZRCA 4IGFA 1QYDA 2PEYA 3DG9A 4PYKA 2DWCA 1OAOA 2XXJA 4MQLA 4MRVA 5TRTA 1VG8A 4QPDA 4RVCA 3C8MA 3AESA 2PT7A 4HN4B 4YV2A 2ORWA 1PW5A 4Y2SA 3GN2A 5BW5A 1ZJWA 1KORA 3MPUA 4GMXA 4LJAA 3UT0A 1MRNA 2ILVA 4LHEA 2Z09A 4QDJA 2H4JA 5JZVA 5ITZB 1XWWA 1DC5A 2EL9A 1F5SA 5CM9C 4HX5A 1NM5C 1CUXA 1WCYA 4DN6A 1X94A 4N5HX 5EP1A 2GLTA 2PUCA 2PZ8A 2B4TO 1G3IA 1M34B 3IEPA 2BLLA 3QELA 4XR9A 2IS1A 5JCXA 4KB5A 3IVCA 1O89A 3W6PA 4RM2A 4F2GA 3IT3A 3MRSA 4CHGA 4BNFA 5JCJD 3MUOA 4DIMA 3SS7X 4B3MB 4C0BA 4KIUA 4DHEA 4BMYA 1Y9EA 2NN3C 2OY0A 3GIDA 3Q6IA 4BLRA 4ZFNA 4LJ5A