2O2SA

The structure of t. gondii enoyl acyl carrier protein reductase in complex with nad and triclosan
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
303
structure length
303
Chain Sequence
PIDLRGQTAFVAGVADSHGYGWAIAKHLASAGARVALGTWPPVLGLFQKSLQSGRLDEDRKLPDGSLIEFAGVYPLDAAFDKPEDVPQDIKDNKRYAGVDGYTIKEVAVKVKQDLGNIDILVHSLANGPEVTKPLLETSRKGYLAASSNSAYSFVSLLQHFGPIMNEGGSAVTLSYLAAERVVPGYGGGMSSAKAALESDTRTLAWEAGQKYGVRVNAISAGPLKSRAASAIGKSGEKSFIDYAIDYSYNNAPLRRDLHSDDVGGAALFLLSPLARAVSGVTLYVDNGLHAMGQAVDSRSMPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Studies of Toxoplasma gondii and Plasmodium falciparum enoyl acyl carrier protein reductase and implications for the development of antiparasitic agents
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Oxidoreductase
molecule keywords Enoyl-acyl carrier reductase
total genus 102
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o2sA00
3B1KA 1YDWA 1N1GA 4D43A 3RUAA 4BNJA 3FNGA 4GL4A 1YL6A 1WMAA 1CWUA 1JU9A 1NFFA 2NTVA 4QQRA 2JKVA 3GAZA 2P9CA 4ND4A 1GUFA 2DBQA 2NUAA 1LNQA 4FJ0A 3TRIA 1SNYA 3WQQA 4CM4B 3BHIA 1NR1A 2DVMA 4NBVA 3L4BA 5AXDA 4JJIA 2SCUA 1VLLA 3ZWXA 5A4DA 2P91A 5CG1A 5L9AA 3O8QA 4R01A 2AE1A 2VZ0A 4HADA 1IZ0A 3WGYA 1LLDA 1P1IA 1PGQA 4IY1A 5ILGA 1PJSA 3KUXA 2FWMX 4XQCA 1BHSA 4UEKA 4NR0A 3GAFA 1SCUA 3F5QA 4FFLA 4LN1A 4DPMA 5EQFA 1NTOA 5TQVA 1T2CA 2C7GA 4RVDA 4KWHA 3ZHXA 1KIFA 1XU7A 3NV9A 4DPKA 2PKQP 1PU2A 4CMIB 1YE3A 2FR8A 4BGIA 4W99A 1HE2A 2OMEA 3ROQA 4JIGA 2WD7A 4ESOA 3PZBA 4CM8B 4BNNA 3HWRA 4HXYA 4XYBA 1D1SA 3LVFO 4XYMA 1ZK3A 3RJ5A 5L7TA 1LJ8A 3KYDA 4CODB 2AA3A 1EMDA 1ZK0A 2AEFA 4NBRA 4CV3A 3NEPX 5A3VA 2NWQA 1YKFA 3JD2A 1QMGA 5CFZA 4DGSA 1ISMA 2O3TA 3HHPA 9LDTA 1H2HA 4IZHA 3R3JA 1J0XO 1LDBA 3DAPA 4IMRA 3GQVA 4FFNA 3FR7A 1KOLA 1I24A 1YB4A 5A3JA 5K6AA 2VT2A 3VH4A 4XEHA 4U6SA 1EEHA 1UAGA 3ASUA 1BW9B 3H3JA 3LC7O 4GLOA 4DBZA 3QLJA 4WLEA 1D7OA 1E3SA 5JXWA 3KSDO 3DHNA 3PJDA 4OKIA 1EUDA 3DFZA 3PQEA 1ONPA 4FC7A 4GX1A 4OL9A 2JJYA 4PG6A 4HV4A 4WOKA 5ADHA 1IL0A 4D3DA 1QLHA 5I7EA 4KDEA 3DWFA 1P33A 1PJBA 4BMNA 1EVYA 3VZRA 2EGHA 3IAHA 3ITKA 3G17A 1ZH8A 1KVTA 3KEQA 2C2XA 2R00A 4TMFA 1QYVA 3LT0A 2CDBA 2I65A 1VL8A 3PDUA 5ER9A 5JAQA 2VQ3A 2EP5A 1VJTA 3F3SA 3FN4A 1A4IA 1E1KA 2D8AA 4BNUA 2P9GA 4D7AA 1ADCA 1ONOA 1DDOA 3WTBA 1E7MA 1EVIA 1IUKA 2YZ7A 3LF1A 1C0IA 1HZZA 4UVDA 2BFMA 4FS3A 3U4IA 1YWGO 4MKZA 1OZAA 3RD5A 1Y5RA 3OBBA 1GEGA 4YJFA 1J49A 3JQEA 4Z9XA 3RAJA 3BIOA 4AJIA 2HK7A 4NDNE 1XIVA 3AUSA 3VC7A 4B7CA 1BXGA 1NX6A 3DOJA 3K6JA 4NQZA 3V5NA 7ADHA 1ENYA 4J1TA 1PZHA 4ND5A 3ZNPA 3I9OA 1D4FA 1SB8A 1U1IA 1QG6A 2GGSA 3ZV3A 1UDAA 3BMQB 3ONFA 3NAQA 1VJ1A 1DO8A 2Y66A 4E5MA 4W9NC 4E21A 2P5UA 4DLAA 4H7PA 5L4SA 2AHRA 4RVGA 3LZ6A 3E82A 4E12A 2R00C 2PK3A 5BSEA 2GZ1A 3GOHA 1PSDA 4DUPA 4WLVA 1ZCJA 1DB3A 4ZJUA 4J7XA 3B1JA 4EW6A 1WAMA 3WDSA 4E30A 4FBGA 5G4KA 4AJ1A 5IFLA 1UXHA 3LT2A 3WFJA 1RM0A 1E6EA 4DIOA 1T1SA 3AJRA 5DCUA 4LCJA 1JKIA 3TOXA 1KY5A 2OP0A 3I1JA 4BO9A 3PVZA 2W98A 1SC6A 3D0OA 2QIOA 4F6LA 1NFRA 1WZEA 3RBVA 5KJ6A 2QRLA 3BMCA 2P5YA 1XEAA 3GZNA 4UUOA 1G0OA 2HKIA 2B37A 1YBVA 3DAGA 2GNAA 3L6DA 3ZI0A 3BMNA 1XELA 4KDFA 5DBFA 2NU7A 1B16A 4WLFA 4EITA 2FSVA 4BO4A 3B1FA 1R6DA 6LDHA 2O4CA 4AL4A 4ALJA 5A03A 1KC1A 2NVUA 1Y9EA 3IQDB 1LRKA 2HO5A 1VKOA 3GVPA 4LK3A 3BTOA 4N5MA 4E5KA 2Y99A 4FFRA 2WYWA 2GCGA 2AQIA 3BAZA 1YDEA 3LT4A 2VTDA 1NYTA 2Y1GA 5HS6A 4UUPA 1SOVA 1WMBA 2AEJA 5CAEA 1PL8A 1J5PA 3HN7A 4Z0TA 3FHLA 2OUIA 2X23A 4DPLA 4BNZA 2O48X 4ZN6A 3GVXA 1U9JA 4BKRA 1EQUA 4MVJM 1NPTO 1GD1O 1B8PA 4CMEA 5IAAA 4BB6A 4CQMA 3GNQA 3LLSA 2PZMA 4FGSA 3PHLA 2VHWA 2H63A 1K6IA 5FFFA 1E7WA 1GZ6A 3IS3A 4BV9A 5IN4A 3H3FA 3OH8A 3VKUA 4CMKA 1FF9A 1O5IA 4LMPA 2IE0A 5JE8A 1ZJZA 2O50A 1LSSA 3I9NA 3C1TA 1XA0A 1YVEI 2GYYA 1UZMA 1VM6A 3OSUA 3JYNA 3PLRA 4B7XA 5AYVA 4AJJA 2NTJA 3F4BA 3ZNOA 5TX7A 3AOEC 1LI4A 5T57A 4KUGA 4WCFB 3AFNA 4XR9A 4DMLA 1PL7A 4J0EA 5B37A 4NU5A 3QA9A 2BF7A 4DLLA 4RF5A 1K6JA 1DC4A 3RUCA 2AEMA 3DC2A 4FPXA 4Y6PA 3GZ4A 1GUYA 1XU9A 5BQFA 3QJ5A 3H4VA 2X0JA 4EBFA 1TA4A 2QZ9A 4CLXA 2B4QA 2CDCA 2EV9A 4IIUA 3RC2A 2WYVA 4EGFA 4FGWA 3WG9A 4MIOA 5ITWA 4YYZA 2B83A 4M87A 2E6UX 2P68A 3EMKA 1WXDA 4GX5A 1B3RA 3DFUA 4CQLB 2PA3A 1E92A 2RAFA 4XYLA 2IEBA 1U3UA 3IDSA 3EHEA 3PIDA 4I5DA 1PIWA 2PFGA 4YEDA 3JQ6A 3I6QA 1N92A 5DN9A 3RFTA 4E31A 3MZ0A 1MXFA 3ZWCA 4XR4A 2O2SA 3KVOA 2IDZA 3ABIA 4YJFB 5U4QA 1X15A 3JQ7B 2NSDA 3ZGYA 2B5VA 1FK8A 2I6TA 3WTCA 2PKRA 1A9ZA 3DO5A 3WGQA 5TF4A 4JQCA 1C1DB 5F1PA 1BXGB 3O03A 4XIJA 3KLPX 4WOJA 1HEUA 1QRRA 3E8XA 3ICPA 4KQXA 1IPFA 3WSWA 1YBAA 3ZV4A 1ISIA 4J1NA 4BNTA 4IJWA 4GPD1 1WW8A 1EDZA 4PLGA 4BNIA 4DLBA 3UCEA 1QV7A 3CH6A 1GQQA 2Z1MA 4CLRB 3NT5A 3EUWA 3QVSA 2D1YA 3I3OA 4U7WA 3DMTC 5CHEA 2JD1A 3W4IA 1QYWA 2JD0A 1NQTA 1VSUA 1IOLA 5A06A 4CUJA 2QG4A 4JP3A 3BTUA 4AJEA 1QYDA 1JA9A 2I3GA 1NAIA 4G81A 3RI3A 3VVBA 4XX0A 2VHXA 3LLVA 4NG5A 2GDZA 4PZCA 4RQUA 1KVSA 1U3TA 4CM4A 4BO2A 3NT2A 1PS8A 4BO5A 1A72A 3G1UA 1Z73A 1I10A 4IDGA 3TJRA 2D2IA 1R0KA 4CV1A 2PH3A 5JAIA 3SC6A 4Q9NA 4C7JA 4H15A 3BTVA 4CR6A 1RYEA 3AY3A 4GGOA 3UXYA 1VE9A 3OIFA 3GG9A 3AI3A 4A5OA 3S55A 1XHLA 1WPQA 3A28A 4DC0A 5EL0A 4O63O 4NK5A 4RCVA 3VTFA 4R16A 3WICA 1P45A 3RASA 3QWIA 3DMTA 1GEEA 1OC4A 2UV8A 4Z9FA 2NVBA 3ANMA 1BGVA 3PHIA 1T2FA 4OXKA 1H94A 4MVJA 4NJMA 1NM5A 2I3AA 4M49A 3W6UA 3CIFA 5DZSA 4XRGA 1A4UA 4CM8A 1FDTA 3QHAA 3JQFC 3PGXA 1I2ZA 3GK3A 3BZUA 1W6UA 3KYDB 4FN4A 3JQAB 3KRTA 5LC1A 1TB4A 1HE3A 2EKLA 4AJPA 4NBTA 2P4QA 3E48A 5U1PA 5IXSA 4QSMA 4CMEC 1QP8A 1EUZA 1Y81A 2F00A 3UAGA 1H6BA 3RBZA 1A7AA 1EVZA 5F5NA 4IXWA 5AQ1A 3V2HA 3GG2A 4RPHA 3F6YA 2YHUA 3R0IA 4YWJA 4OGWA 5G0VA 1R15A 4B4WA 5DP2A 3S2EA 2D0IA 4TQGA 3JD0A 2DBVO 3SLGA 1T26A 3E9QA 4IQ8A 4K6FA 1UP7A 3OA0A 2GN4A 1TEHA 3ZWBA 1OC2A 2EJVA 4B8ZA 4R41A 2YDYA 5JO9A 4FW8A 4D41A 4B79A 2AQKA 1C0PA 3F1KA 3IL2A 2QZZA 2X9NA 4AJLA 2I99A 1ADBA 1GPDG 4L4XA 4O5OA 3BYZA 5ER6A 4S3MA 1HTBA 3KXDA 2Y1DA 4JK3A 3QP9A 5EJ2A 4D44A 2WSBA 2EP7A 3NDRA 1QYXA 3MWEB 4U6QA 2CVQA 1LU9A 4CM9D 4DL9A 2BI8A 4Z3DA 4E5NA 3PJFA 4RL6A 5DF1A 1WZIA 1SEPA 1KERA 1G0NA 1YL7A 2O3JA 2O7SA 5COBA 5CEJA 1E7SA 2PGJA 2GN9A 4GLLA 1BDMA 4OQYA 4BNMA 3MTJA 3CEAA 4FIZA 2YFHA 1XG5A 3ANLA 4WJZA 2C07A 1CJCA 3D64A 2B4RO 2PZLA 4BO1A 2I67A 4WLNA 4NBWA 3S2GA 1GAEO 3MJTA 2EWMA 1U4SA 3K96A 4P38A 3RU7A 5IDQA 1Y5MA 3TNLA 4OKNA 2I66A 4YJGA 1PZEA 4YAKA 2JFFA 2VNSA 3KB6A 4CMGA 5B4UA 3NTRA 4XIYA 4RO0A 2X6TA 1O9BA 9LDBA 5FF9A 1GADO 5CDYA 4LMRA 2B0JA 4JBIA 4MKRA 3ZWYA 4CMIA 4N5LA 2B4TO 3ZWNA 1AN9A 2C29D 5ITVA 1YB1A 1FMCA 4XB1A 3OJ0A 2HMVA 4B7UA 1SPXA 1PGJA 1S6YA 3JQBC 1DPGA 2W4QA 3RC7A 3TZ6A 3ONEA 2PZKA 5I8ZA 2NTNA 5C7OO 1Z82A 3L0DA 2QX7A 4N7RA 2FHSA 2IZ1A 3INGA 5KKCA 3L6EA 3O4RA 1I3NA 4G65A 5G0UA 3GZNB 3U3XA 4Z6KA 2GUGA 3GHHA 5DOZA 1PJTA 2R6JA 4YJHB 3BMNB 4OH1A 4IZIA 2J5KA 3GGPA 2VRCA 4XYGA 1DHTA 3RFXA 5JDCA 4TRJA 5A9TA 5AVOA 1EVJA 3OFSA 4ZGWA 3RBXA 3RQSA 1XGKA 1M67A 2ZYGA 1YJ8A 2OHXA 2DTEA 4DIFA 8ADHA 1DIBA 2YJZA 4GKVA 4J4BA 4A26A 3E1KA 4RF3A 3ROKA 5JC1A 2YQ4A 1K5HA 4R69A 3JD3A 3ASVA 3QVTA 1KBZA 4GWKA 2B36A 4NNJA 2YHIB 4R9SA 1UXGA 1Z7EA 1GZ4A 4CLDA 3HQ4O 2WDZA 4B4VA 1BVUA 1HF3A 3HB5X 1B2LA 3JD1A 4DC1A 3JQAA 1H9BA 1L7DA 4II2A 1XWFA 3WX0A 3GT0A 3H5AA 3JQCA 2HDHA 2B35A 4XZ3A 3VTZA 2J3JA 3ZWWA 3LDHA 3PTZA 5JFOA 3E03A 5KJCA 1IY8A 4P22A 2WTBA 4XD2A 4GMGA 1D1TA 3GMSA 4MVJH 2GRAA 3F9IA 4MVJI 3VDRA 2Q49A 4OYRA 4DYVA 6ADHA 3ITDA 1PGNA 3NKLA 4CLOA 1MG5A 3E18A 5C37A 2J5RA 4S1VA 3DBRB 4J9VA 2RH4A 4MVJG 5COQA 4TWRA 5L4LA 4MKXA 2GF2A 1Q0HA 5DULA 1P1FA 3FPCA 3WS7A 2EKQA 3WIDA 2QYSA 1ZO8A 3CXRA 4OOFA 4EYEA 2JAPA 1Z45A 3WGOA 4KUHA 1YB5A 1YQDA 1P1RA 3GF4A 3RUHA 2ZATA 3RKRA 1SAYA 4EEXA 4RVSA 3IKTA 5JCXA 4U8GA 1FDSA 1LLUA 2ET6A 1LQUA 4E5PA 1X1TA 2RBEA 4F46A 4P4GA 4IINA 2FPGA 5CDGA 1P44A 4ND2A 2FMUA 3PHGA 4EZBA 1G6KA 2HJSA 5G4LA 2OFPA 2Y1CA 4J1SA 3SC4A 3UUWA 4D3SA 1TI7A 4KTVE 2DBZA 1N2SA 3GPDG 5ENVA 3WYCA 4HBGA 1ZMTA 4ZU3A 2CMDA 1DFIA 1M6HA 2OOSA 1KETA 5DDIP 5EQDA 3OEYA 4NIMA 4GSKA 1C1DA 1O94A 3F46A 2JD2A 4ZQEA 3WGIA 2FZEA 2HMWA 3FTPA 2HSDA 4BL5A 1GV1A 1LQTA 4K9DA 3S1LA 4Y6SA 3WWYA 1ENOA 2VWGA 2DPHA 1DEHA 1PS0A 1DLIA 3HUDA 3H9EO 5CEEA 4RJTA 3NJ4A 3ADOA 4PZEA 3HADA 4XDYA 4CMJA 3ZNNA 3NGLA 2A35A 3WJAA 4XKJA 3QY9A 5CDTA 2O2YA 1EQ2A 3STHA 3GN1A 2NQ8A 2Q1SA 5BSGA 3B6ZA 3IIEA 1GDHA 5JMPA 5I9LA 1MUUA 3GFBA 3LC2O 4YAGA 1QV6A 4ITUA 2VZ8A 4U0KA 1NQOA 2C54A 4DQUA 1KEVA 2NQTA 5IJZA 5EN4A 3GNSA 2PWZA 4NZ9A 1RPNA 2AQ8A 2VUTA 1CYDA 1ZXBA 3T7CA 4E2XA 3TL2A 1NQAO 2WWRA 4W7HA 1AE1A 1MA0A 3PJEA 3PWSA 2I9PA 3ZU4A 3IC5A 4BNKA 3ANNA 3PZRA 1V3VA 1CETA 2VUUA 3ZV6A 2JFGA 5DBGA 2OO5A 4OO3A 3AWDA 4ZQGA 5EMHA 1Y8RB 5TT1A 4CM6A 1TT7A 3NYWA 4I9UA 4N54A 3MOGA 2YV3A 2EW8A 1G1AA 3FF4A 3GGOA 3JYOA 1HDRA 1QLJA 2GASA 3VOSA 5B4TA 1L1FA 5JLAA 3WBFA 4L4RA 2G76A 2IYOA 4R3WA 3VDQA 3DZIA 4WKGA 5JY1A 2X0RA 4R1SA 5L53A 2PNFA 5CG2A 1E1LA 4J4TA 5KJEA 3WBBA 4NBUA 4RPKA 4WCDA 4P4NA 1GY8A 4J4HA 5IZCC 1VL0A 3GR6A 1VJ0A 2ZQYA 1LX6A 3FNEA 3S2IA 4BNWA 1KC3A 3WQSB 5GY7A 4OOEA 4WCFC 1PEDA 1UZLA 4NMHA 2IXAA 2Q99A 3L77A 1H6CA 4WEOA 4CQLA 1PWXA 4JNKA 1YOVB 1QKIA 1E5QA 3HJAA 1LLQA 4JCOA 1JW9B 2C20A 3KM0A 3QWAA 1BG6A 1PWZA 4FFPA 5H83A 3FWNA 4D45A 3C1AA 2C82A 1U3WA 1TVEA 1H9AA 2G5CA 5DP1A 1KVUA 2O3UA 3BTSA 3QSGA 3BA1A 2UUOA 4KQWA 4ZQFA 3JQ9A 3JTMA 3W8FA 3DBHA 3GDOA 3INTA 3MJCA 3CMMA 1VSVA 4BKQA 3C24A 2PD4A 2ZB3A 3EY4A 1N7GA 3QE3A 5JDCC 1HDYA 3FBTA 4GKBA 3TPCA 1AXGA 2YDXA 4CM1A 1B8VA 2X22A 2VZ9A 1IE3A 2AG5A 3ZU5A 4FD3A 3GMDA 2XXJA 3NX4A 4IIVA 3DZKA 1ZNQO 4GGPA 3IKVA 4TKLA 4CR8A 4CUZA 3Q6IA 2PZJA 4RGBA 2AQHA 2X5OA 1PJLA 3PFFA 5IZCA 1PJQA 2CDAA 4RDHA 2FRDA 3OJFA 3CZMA 2Y1EA 3RWBA 4RPJA 4IDCA 5L7WA 3JQDA 3PJGA 4HUJA 3ZW8A 3HZZA 2Y1FA 4IQGA 4PFJA 5DBIA 1LBEA 3A14A 5T8KC 1Q7GA 1ZUD1 3I9LA 2W2KA 3NGXA 1DBVO 1M66A 2OXIA 3FRJA 4OQZA 3IP1A 1YQGA 2AW5A 4K26A 3GN2A 3VPHA 1MP0A 1OAAA 4AJNA 3CMCO 4BNGA 4B3HA 3NT4A 3GUYA 2JCYA 4LRSB 2HRZA 4OXYA 1BDBA 5THQA 2JHGA 1ISJA 2VUSA 2IZZA 3BMCB 1SOWA 1YONA 5GZ1A 1IZ9A 3RUDA 3C7CB 4CLEA 2A4KA 4LVCA 4UEJA 3AU8A 2ZIZA 1NHWA 2VOEA 4FOSA 3PGJA 3OETA 3U09A 1VC2A 2VOJA 1LDNA 4IDAA 1VRWA 2WYUA 3C8MA 1EK5A 5A02A 1DRWA 5L95A 2D5AA 1Y6JA 3ZHBA 1DIRA 4EJ0A 1HZJA 3WLEA 1ADFA 1HDZA 1R4MB 3H65A 4R54A 1B8UA 3Q1LA 2NLOA 4IDDA 4YR9A 1ZW1A 5T64A 1C0KA 2DUWA 3TZHA 4NPCA 1ORRA 3AW9A 2HK8A 1EE9A 3RIHA 3MJSA 1P31A 4H16A 1UUFA 3KBOA 4WEQA 4Z0HO 4CL3A 1B14A 1NVTA 1X7GA 4BQPA 4J43A 1E3EA 3OQBA 3SVTA 1T25A 4MO2A 1ENZA 4RDIA 2F1KA 3K5PA 2OZPA 1GZ3A 4I5FA 4J49A 2LDBA 5GZ3A 4XQ9A 2DAPA 2GERA 4BNHA 5HM8A 3E5MA 2J3HA 5MDHA 2YV2A 3I4CA 4GH5A 4PG5A 3U4HA 3I6IA 1GQYA 3VVCA 2R2GA 2V6BA 4HY3A 3TZQA 3WSVA 2DFDA 1A7KA 1XR3A 2RHCA 4N18A 3K73O 1F8FA 3I9KA 5ES3A 1QYCA 1NPDA 2W90A 3ETEA 4IS2A 1AXEA 1J6UA 1DC3A 1NQ5A 2ZJ1A 4FDAA 3GEDA 4UUNA 3P5SA 4IUYA 1Z74A 3PWKA 1F12A 2Y1OA 1ZK4A 3AM4A 1MGOA 4D46A 4YXFA 1GCOA 3EGOA 2QRJA 4BO7A 5F21A 5T67A 1WP4A 1YXMA 4HWKA 5EPOA 3ZWAA 3DZHA 3OECA 1YQXA 4BNYA 2YYYA 4Y8VA 3UCXA 4M1QA 3E9MA 1PZFA 2YHIA 1S7CA 1Y8QB 4XGKA 3VPXA 5JCJD 4OM8A 3NDIA 3OQ1A 3H8VA 3ONDA 3NDJA 4W82A 2OL4A 5T8KA 5BNIA 5JYDA 2PV7A 1ZXLA 2TMGA 1ULSA 4O6VA 2C2YA 1DFGA 1E7RA 4BIIA 2Y93A 8LDHA 4IJKA 3L4SO 1Q1NA 5CP8A 1SBYA 4NI5A 4Z3KA 3BHJA 4QFDA 3U4CA 3ZN2A 2EEZA 4IGEA 3DZBA 4E13A 3FCOA 3D4PA 4TKMA 4DXHA 4E3ZA 1M75A 5HWSA 3WNQA 1E7YA 2HK9A 4XGIA 1ZSNA 3PIIA 4PLTA 3L9WA 1DJQA 1BVRA 4P8RA 1KS9A 4EI2A 5IN5A 4PG4A 1Z75A 1NP3A 4E32A 5I7SA 4IJUA 4YJGB 4GX2A 1DHRA 5LDGA 3AY7A 4BGEA 4Z9YA 1QXSA 4YVFA 4JGBA 4PVDA 1O8CA 1P0FA 4XQEA 3ZV5A 4BUCA 2HUNA 2BI7A 3NTQA 4ID9A 4EJMA 3DZJA 4LISA 3M1AA 4PZDA 1JAXA 3DHYA 2GZ2A 2XOXA 4RVUA 5DOVA 4B4UA 4LGVA 1WDMA 2J8ZA 3CINA 2DTXA 3GLQA 2BHLA 3GC6A 4GI2A 2DUUA 4J1QA 4BGVA 4YRDA 5IZ4A 4WNCA 1U4OA 1ZJYA 4QTZA 4Q3CA 3JV7A 4FCCA 3ORFA 4R51A 3DZGA 1R37A 1E6WA 2Z1NA 1HSZA 4CLHA 2DC1A 4Y67A 4LSMA 4AG3A 3GY0A 3KV3O 5LDHA 4PIVA 7MDHA 1KEPA 4E2ZA 5C5IA 4KWIA 2OGUA 3KLMX 1U2DA 4H3VA 1JWBB 3WGHA 3QVXA 2ZTVA 3ZU3A 2GD1O 3WMXA 4MIYA 3V2UA 1AHIA 1P77A 1PJ4A 3H7AA 4MVJF 2XAAA 3NJ8A 2HCTA 3I23A 1O0SA 1DIAA 3ZWPA 3W6ZA 3Q11A 5CPFA 4A2CA 2NNLD 3QWFA 1Q0QA 4QECA 4QO8A 4BKPA 4PLWA 2QQ5A 3HFGA 3JCZA 3QWHA 1ULUA 4XA8A 1SMKA 3GGGA 3UW3A 5JCJA 2IRWA 1Y7TA 4J7UA 4R9RA 2NADA 3I52A 3K92A 4OIMA 4ZA2A 1NWHA 1PQUA 4BB5A 2Y0CA 1NVGA 2HRBA 4WLOA 4AJKA 2Q3EA 1E77A 3N58A 4Q3AA 4GQAA 5IG2A 1V8BA 3U9LA 4GSLA 1GFSA 1O95A 1N5DA 4U5QA 4BQRA 3JYPA 1JN0A 2GN6A 1CIVA 2DKNA 3HB4X 1PGOA 4CM3A 1E1NA 2VTEA 2RHRA 4BNLA 1PX0A 3R6DA 1M2WA 4Z0PA 4PLZA 3TFQA 3G0OA 1DLJA 3OIGA 1N8KA 3RSHA 1ZK1A 4BKUA 1P9LA 1DFHA 2UAGA 1E5LA 5BNTA 2POQX 5G0TA 2VYVD 2WD8A 5JY6A 5G0SA 2VHVA 2G17A 3H9JA 3L07A 1HRDA 3L6OO 1GL3A 1ISGA 1Y8QA 1YO6A 4PLPA 4B3JA 3K8ZA 4WPGA 3PK0A 1GCUA 2GPTA 2FR0A 3PQFA 1GPJA 1K3TA 3CSDA 1XSEA 1EE2A 3ZW9A 4DYDA 4PG8A 1CRWG 4Q3BA 4IM7A 1E1MA 1F0YA 4R5MA 2ZTMA 1WNTA 3BMOA 4P4LA 3WGGA 3WOHA 2I5PO 1EDOA 2X1HA 1JAYA 5BR7A 5CDSA 2RCYA 3OA2A 1E3LA 1I3MA 5BNFA 4I8XA 1PR3A 2IXBA 1TXGA 1BTOA 1KEUA 3COSA 4HFJA 2E49A 3S8MA 2FPIA 1LA2A 1AUPA 2VHZA 3SEFA 3JD4A 3U0BA 2G82A 4YCAA 4X54A 1I30A 1MXHA 1D8AA 4XJSA 4D42A 4UVGA 3VHRA 4F6CA 4IGFA 3SX2A 2Y0DA 3EDMA 4R1TA 1I3LA 3VH2A 4Q3EA 5THKA 1F06A 4D3FA 5TNXA 4Q3DA 1R0LA 2CF6A 4YRAA 1U5AA 2YY7A 2Q4BA 4QXMA 1L7EA 3K2EA 3ICCA 4GX0A 3LU1A 3T7EA 3CZRA 3DR3A 4FFMA 4L73A 5L7YA 3AI1A 3JQGA 5IDYA 1HDCA 2OBYA 1MV8A 3PRJA 2A94A 1R66A 1CF2O 2AG8A 2W2KB 3DBLB 1UZNA 1HDXA 1T4DA 5I9MA 3VPGA 2HAEA 1HLDA 1HE5A 2VRBA 3DBVO 3IOYA 3U49A 4RVHA 4ZQBA 4MJLA 4HFRA 3SBOA 4NJOA 2X5KO 2P4HX 4TSKA 2YW9A 4KTTE 1ML3A 1WWKA 4C4OA 3AY6A 1V3TA 1ISFA 2Z95A 3WJ7A 5TLSA 1I01A 1NVMB 3P19A 4N5NA 3JQFA 1R4NB 4YQYA 4YAEA 5FI5A 2G0TA 4ND3A 4DIBA 4E2WA 2Q2WA 1ZFNA 2VYVA 1I5RA 5JDIA 1CDOA 4CR7A 2YFQA 1SZJG 1VKNA 1Y9AA 2EGGA 4ONEA 3HE3A 3WGTA 4YT4A 4K1LA 3R3SA 1IHXA 4YPOA 1U2GA 5KJ1A 3EAGA 1QR6A 3FI9A 2CSUA 1EUCA 2PGDA 3K30A 1R4MA 4GVLA 3N7UA 1LRJA 1DRUA 5KJFA 4OXNA 2VRCD 3VKVA 3DDNA 3EW7A 1EFLA 1IPEA 5JAZA 3C3XA 2V65A 3MWDB 1DSSG 1GV0A 4CL8A 2DU8A 1DIHA 5T5QA 3GEMA 4OJNA 2YV1A 4RVFA 1GU7A 3C7DB 2FY8A 1MFPA 2ZJ0A 3OJOA 5JPIA 5JW6A 1HXHA 3E5RA 3ROMA 2VYND 3PHHA 4K28A 3S2FA 3VAZA 3DBHB 4TZKA 3V1TC 5JS6A 5L40A 4LVUA 3ZU2A 3PWZA 2QHXA 1V9LA 2X9VA 1DOHA 1H93A 2EF1A 3MTGA 4WLUA 3K2BA 1A27A 4IPTA 2PR2A 4MVJD 5TJHA 5TT0A 2FN7A 2IYPA 3EVTA 3IUPA 2IODA 4MDHA 5U9CA 3GUCA 4DBVO 2C0CA 2Y0EA 3AM3A 5JAMA 1DIGA 3LF2A 4TZTA 2OORA 1YGYA 1LDEA 2DBRA 2JCVA 4PRLA 1MLDA 5JYEA 3A1NA 1X0XA 5TC4A 4W7IA 3D3WB 5B1YA 1PJCA 3FNFA 3K31A 4BOYA 3EK2A 3KEOA 4CLOB 1Z7BA 1F8GA 1B7GO 2C7VA 1F17A 1F14A 2HQ1A 4GBJA 3T4EA 2BH9A 2X58A 4ZRMA 3RUIA 3T4XA 4BKOA 3HDYA 4WECA 3WYBA 4J2OA 1WDLA 1UR5A 3NRCA 4FQ8A 4O1MA 3OQ6A 3GEGA 1GQ2A 2XPCA 1LDGA 4AJOA 4E4YA 1RYDA 3GVIA 2EHDA 1GTMA 4II3A 4BGUA 4CMCA 1LDMA 4PG7A 4WNIA 3MJEA 1J4AA 4TROA 1JVBA 1FDVA 1SEVA 1N9GB 2O3SA 5I8WA 4Q39A 3UN1A 3KTDA 2ZTLA 3UCFA 4W4TA 4RQTA 4WE3A 4A7PA 1P74A 2A92A 4AJHA 5AXAA 4CJXA 1VL6A 3N74A 1X1EA 4JX8A 3UHAA 3ON5A 5C3MA 5G0WA 4XGNA 4HFNA 1Z6ZA 2DM6A 3FD8A 3BHMA 3B20A 3R1IA 3C85A 3HDHA 1HLPA 1V0JA 5FEUA 3TN7A 3E6AA 2Q1TA 1UDBA 1YH3A 4E6PA 1YS4A 4JN6B 1KVRA 2NV6A 1YL5A 2UVDA 4GVXA 3A4VA 2H9IA 3EZYA 5KTKA 1UJMA 2GSDA 3PDJA 4XCVA 5FI3A 3OHSX 3O38A 5CDUA 1A5ZA 2X4GA 4GWGA 5A9RA 1A71A 2FR1A 3QWBA 5C7IO 1LEHA 3WNVA 1I3KA 2VYNA 4KMSA 3AUTA 4OMUA 5KVQA 3QV1A 3LQFA 1B3BA 4QT0A 4BO0A 4BVAA 3D4NA 1NWCA 3CE6A 4WGGA 4LCEA 4R5HA 1NHGA 4HP8A 2DLDA 2ZCUA 1HWYA 1GR0A 1Y8RA 3C7AA 3RJ9A 4CPDA 3RUFA 4XJTA 5A1TA 1R4NA 3WQRA 5KWEA 3DOCA 4J16A 3TSCA 3X2EA 1HT0A 2BD0A 3JQ9C 1P1HA 2DTDA 5CPBA 2FP4A 1HYHA 1CERA 4TRMA 1UXKA 4YDRA 3PXXA 4UAGA 1TT5B 2X9GA 4PLCA 1T2AA 2Q2VA 3KHUA 3FNHA 1T1RA 2C5AA 2CVOA 3DONA 2WM3A 3RKUA 1R12A 4FFOA 4ALIA 2WE8A 4JJFA 1MG0A 4F3YA 5ICMA 3WFIA 4DRYA 1CQJA 1K0UA 1UP6A 5FYDA 1B15A 1QSGA 2FPPA 2HU2A 2ZB4A 5G2OA 1ZMOA 5DT9A 3HFSA 4B8WA 5I7VA 4CM7A 4BMSA 2Q4EA 4DA9A 3EYWA 1YOVA 2ZB8A 4PCVA 1KEWA 1PR9A 5JSFA 1BXKA 1P1KA 4W9NA 2PH5A 4R3NA 3D5TA 4M86A 1Q0LA 3KSUA 4URFA 5KKAA 4A10A 4PLFA 5L51A 1PJ3A 3Q3CA 2CY0A 2EW2A 2VNAA 5BT9A 4YTEA 4ND1A 4FOOA 4L74A 4ALLA 3MJ4A 4YBZA 2BFPA 1LXCA 3PP8A 3QIVA 2D3TA 4AJ2A 1M76A 3ENKA 4WK6A 1GYRA 3ZZNA 4OSPA 3PQDA 2BGMA 3ZWVA 1C3VA 2EJWA 1X13A 4NFSA 4J6FA 3JYQA 4HNHA 4BO8A 4OAQA 3WR5A 5JDIC 2DFVA 5AXCA 4FB5A 1IHYA 3GRKA 3W8EA 3G1TA 5GZ6A 1YRLA 2ZK7A 1LLCA 2YUTA 4D0SA 3GHYA 1NNUA 3OMLA 2ZTUA 4GMFA 1JWAB 3AK4A 2GZ3A 2PKQO 4EUHA 1H5QA 3JYLA 1E3IA 3RC1A 3DQPA 3SXPA 2LDXA 2RIRA 4QUKA 1W0CA 2OBNA 3UF0A 1O6ZA 5G4KB 3ZH2A 1ENPA 1EK6A 3GDFA 2FZWA 3UVEA 3BMOB 3VZPA 5F1OA 4J7CA 4JBGA 1AHHA 4L4SA 4QFCA 3VZQA 5K6AC 3TL3A 3G79A 1CQIA 3DTYA 3K9QO 1MFZA 2HMTA 1A9YA 1V35A 2UUPA 3EVNA 2P9EA 4J0FA 1NPYA 2Q50A 3H9GA 5ENDA 1SB9A 3OF2A 4I08A 5JC8A 3UGKA 2TMDA 4E5YA 3WIEA 1NAHA 4C7KA 2AE2A 4EUEA 1IYZA 4CMBA 4IBOA 4KOAA 3ROPA 3H6KA 2JL1A 4IXTA 4PLVA 2O3RA 3W8DA 2VN8A 1C1XA 1K89A 5I9NA 3H2ZA 3VPFA 2VWPA 3HN2A 3P7MA 1MB4A 3TQHA 4FJ2A 4MP8A 2EXXA 5DCWA 4BNVA 2NACA 2XF8A 2B69A 3M1LA 3EC7A 5A5FA 3U5TA 3UFXA 4NFHA 1UXIA 4L76A 1E3WA 3P2OA 1GUZA 1HSOA 4IMPA 1OFGA 3JSAA 1C14A 5JBIA 5HTOA 2AMFA 1X7HA 3I83A 3PEFA 4Y9DA 2BELA 3H9UA 5GMOA 3SLKA 2GO1A 1OMOA 3DBLA 1ARZA 4CMHA 2BFOA 1DAPA 1I2BA 2QRKA 3DL2A 4KZPA 3WGZA 1WLYA 3HDJA 4YQZA 1R0SA 5HBRA 3WYEA 4UUMA 2C5EA 3FR8A 2UYYA 4YT8A 1PL6A 1PGPA 2EG9A 2PTGA 1ZSVA 1KY4A 2AXQA 4O0LA 4BO6A 4MP3A 1U8XX 2DQ4A 3HNPA 5ICSA 3OEWA 2BMAA 4RV9A 3V2GA 3RCBA 5TS3A 2D4AA 4CUKA 1E3JA 1KYQA 4HFMA 4L8VA 1XQ6A 3ETGA 2NU6A 1BMDA 3O9ZA 4ZICA 1TT5A 3VPSA 2Y68A 3ADPA 4MPDA 1V3UA 4CM9A 3QVWA 5HA5A 3PHJA 2VWQA 3VH3A 3H2SA 3OIDA 2GR9A 1ISHA 2WE7A 3FWZA 1PS9A 1U8FO 5HS4A 2E37A 3CKYA 4RZIA 1H2BA 1HE4A 1W73A 3TDKA 3EZLA 3H5RA 2PLAA 1BXZA 1EZ4A 2WMDA 3G49A 3PYMA 4JJGA 5I7FA 1U7TA 2A9FA 3PI7A 2E48A 1RM4A 1LDYA 4AVYA 3ZNQA 4AJ4A 2B5WA 3ZCXA 4CM5A 2VCYA 2HJRA 2O3QA 4ZVVA 4YRBA 4J90A 5EERA 2DPGA 1Y1PA 3ZDFA 1PQPA 2ZYAA 4RORA 2BLLA 3AUAA 3LC1O 4MVJP 5F1KA 1X0VA 4YAJA 4BNFA 4RPGA 3D1LA 1I36A 3UICA 3W1VA 3Q9NA 4A73A 3Q0EA 3O8QB 5A04A 1PJ2A 3WXBA 5TRTA 4RF2A 5B4VA 1UP4A 1MX3A 5EINA 1ZIDA 1NBOA 4D79A 5L3ZA 3AOGA 5A9SB 4YA6A 4TVBA 2Y67A 3Q2IA 4PGFA 2ZB7A 3F1LA 3TZKA 1M6WA 3ZHYA 3ZWMA 2X0NA 4U0JA 1PTJA 3D4OA 4E2YA 3F5SA 3TF5A 1AGNA 1B26A 3IMFA 3D3WA 4J3FA 3IP3A 5C7LO 4JBHA 1T4BA 1YBMA 3FSRA 4JLWA 4K6CA 1RWBA 3PYLA 2IEDA 3GVCA 1OOEA 5DCYA 4DREA 5MGBA 4HX5A 4NU6A 2CNBA 5TIIA 1ZBQA 1HETA 3HDQA 3M2PA 1DXYA 3H5NA 2IZ0A 4YJDA 2D59A 3JQGB 4ALMA 4W6ZA 2Q45A 4IDEA 4JXKA 3ETDA 3ULKA 4M55A 4XWYA 3UOGA 4BHTA 2J5QA 3AFMA 4MOWA 3V1UA 3E9NA 3PLNA 4MINA 2BGLA 3W4JA 1QORA 2EKPA 2NU9A 1BSVA 2JHFA 1U7HA 4RZHA 5FWNA 1WDKA 3CPSA 3DTTA 1XQ1A 3SJUA 5HRUA 4FSHA 4OHUA 1UAYA 3GH3A 3D7LA 3KETA 1N9GA 3I9MA 2NU8A 3KYCA 3WB9A 3CUKA 4MP6A 1JQBA 1OBFO 4DWVA 4FR5A 3O26A 5J23A 3ZWOA 1I0ZA 1NXQA 4MVJE 4TRRA 4I1IA 2BRUA 1TLTA 2EIHA 3AM5A 1HYEA 4IDFA 1BW9A 2J3KA 3GVHA 3TFOA 3DEYX 2DT5A 5LCXA 1OI7A 3DXFA 4HKTA 4HNGA 4J91A 4ALNA 3JQBA 4NK4A 4UVIA 5KVSA 2Q1WA 4PN3A 4CV2A 1ONNA 1JDJA 2H6EA 4B3IA 1UDCA 1LTHR 2HLPA 2HMUA 2WEKA 1DRVA 3C1OA 1E3WB 1YJQA 3PYXA 4R1NA 4RF4A 3RC9A 3JQ8B 3RROA 3SJ7A 1T2EA 3ZHZA 4G2NA 1GYPA 4OSOA 1XLTA 2CZCA 2JAHA 1FXSA 4TRNA 1VPDA 2GN8A 3FTNA 4QX6A 1U3VA 1W4ZA 1ZZEA 1HL3A 2O4UX 4BV8A 1Q7CA 4NFYA 1FJHA 4FC6A 5JNLA 5A5EA 4BNXA 2YQ5A 4XB2A 5DNAA 3I9JA 3PFWO 5T6BA 3DB2A 4DQXA 2ZQZA 3INRA 4PRKA 1ZEMA 3WMWA 2FOIA 2PD6A 1JKJA 2QW8A 3Q2KA 5BSFA 4QO7A 3TZCA 3RFVA 4G5HA 4I9NA 3KSZO 4DMMA 5KIAA 2BFAA 4JP2A 3GA0A 1I2CA 3AI2A 4IDBA 3B70A 2E82A 3GRPA 4PLYA 5KCZA 3UH1A 4NHEA 3RVDA 3GNTA 4YT5A 2W2LD 1NR7A 2CVZA 5AXBA 1K6XA 3TOZA 3MOIA 5EESA 3ST7A 5JO0A 3DOOA 2X7HA 4I5GA 2E4AA 3W4KA 1V6AA 3RU9A 3HG7A 3QQPA 4F45A 4GAEA 3OJEA 3M6IA 1ID1A 2XXBA 4M89A 4LSWA 5K0ZA 2X8LA 2I76A 5BSHA 1H6DA 1U28A 1RM3A 3CTMA 3AUUA 1RKXA 4ALKA 5H81A 4ZD6A 5IDXA 4CMAA 4EDFA 1NASA 5CEFA 2ZCVA 4XRRA 3VZSA 5EIOA 1R16A 2O7QA 1ZK2A 2ILTA 3P2YA 1JVSA 3BXXA 3FBGA 4NH4A 4AICA 3JQ7A 2Q2QA 3UKOA 1EFKA 2PY6A 4BS9A 5A9SA 2EERA 1O89A 4I5EA 1CEQA 2OP1A 4J2HA 1H6AA 2J6IA 4UULA 3I4FA 4A03A 2O23A 3NTOA 1I8TA 5JMWA 1P3DA 2Q1UA 2H5LA 3H9QA 3U4DA 3D5QA 2V6GA 1VI2A 4YT2A 4DVJA 2NVUB 2Q46A 2C59A 1DC6A 5IF3A 3IJRA 4L9RA 1PZGA 4MIEA 4A0SA 3NUGA 1ZVMA 1UH5A 5L4NA 4QEDA 5H82A 4Y98A 2JCXA 1D3AA 4ZQHA 4E0BA 4RLSA 1LRLA 1BWSA 1T2DA 4CLRA 4DQVA 1JLLA 4KUEA 4ILKA 3V8BA 3A06A 1DAOA 3OICA 1WVGA 5KVVA 3WWZA 4L75A 2QYTA 4CQMB 4YACA 2WD7B 3LYLA 4M8SA 1DC5A 2NM0A 2WJPA 3OP4A 1ZEJA 3DHEA 3A9WA 4XYEA 4E33A 1E7QA 4ZHSA 1JKFA 1MC5A 4KP7A 1FDUA 2ZYDA 3AOEA 1MC4A 3KYCB 4R4JA 4XDZA 5F5LA 3VH1A 2X86A 1HYGA 1KVQA 3L4BC 3QVOA 4ROSA 4L0QA 1GYQA 5IXYA 1T24A 3OM9A 3RUEA 1P1JA 1XKQA 1DJNA 1RJWA 2UDPA 3D3EA 4YJHA 3X2FA 2CF5A 1C0LA 2BGKA 2Z5LA 3TWOA 3KOUA 3V1YA 4IQ0A 1LSOA 1U5CA 2ZKLA 4WCFA 2VWHA 1H0KA 2GLXA 2W2LA 1HDOA 3IJPA 2V6MA 1LSJA 3I5MA 1LC3A 3JQAD 4R1UA 4ZRNA 1HDGO 3U62A 5A05A 1C1XB 4M54A 2VHYA 4Y6RA 5TGDA 5ILOA 3JQ8A 3GDGA 5KVCA 2X0IA 2D5CA 5B12A 2NVWA 1NFQA 2FSSA 4LW8A 4UREA 1LUAA 5AOVA 3F47A 4IS3A 1LC0A 3QRWA 3DZFA 1XCBA 5KNLA 4BO3A 4NJMB 3OJLA 1RM5A 1PQWA 4D0RA 3L9XA 3M2TA 4EUFA 1I33A 2CUKA 2HMSA 4FJ1A 4CQMD 1IB6A 4PLHA 3IUSA 3LSYA 1BRMA 4BMVA 1B0AA 4UEOA 4R68A 5K9ZA 1Q7BA 3KO8A 4RPLA 1EBFA 3QW2A 1XYGA 4UVHA 3Q9UA 1ADGA 4DTIA 3KYBA 4LRTB 3LK7A 4YB8A 3MCVA 3KZVA 4I9HA 4Q3NA 4WASA 4YAIA 2CFCA 1P0CA 4TVOA 3DAFA 3DMYA 3DBRA 2BKAA 2V6FA 3AU9A 2H1SA 3MJVA 1ZKMA 1E6UA 4INAA 3FPLA 3HSKA 4O59O 1E0DA 2PGLA 1Q2XA 1X14A 4UVEA 4J9UE 3ENNA 2W8ZA 5COAA 5TJ9A 1EBUA 1XDWA 2P2SA 5TSDA 5IDWA 2Y05A 4EEZA 3MEQA 2JFHA 2V7PA 4PVCA 4IJVA 3WLFA 1FDWA 1N7HA 1N1EA 1IULA 1X7DA 4RLHA 5KOIA 4XQGA 3G3EA 2X5JO 3BMQA 4B4OA 1W8DA 1I32A 1ZSYA 4WUVA 1UXJA 2CD9A 3PPIA 1SO8A 2PD3A 3F4LA 2RH8A 4AFNA 2VT3A 3GFGA 4CV0A 5F3RA 3GPIA 1JTVA 2G1UA 1HKUA 3LT1A 5L45A 1LSUA 4JROA 4A27A 1K2WA 2J3IA 4EJ6A
chains in the Genus database with same CATH superfamily
2A0XA 4UNRA 2V4UA 1KDTA 4D43A 3I09A 3Q3EA 4NHOA 3RUAA 4FILA 1OX5A 4BNJA 5I01A 2WV7A 1JEDA 4LF8B 5F98A 2RK3A 4G85A 3T3IA 1N2OA 1CQIB 1PD0A 3EOZA 5H70A 1O0CA 4EPVA 2P9CA 5TQ0B 2J45A 2AXPA 4RACA 2HLHA 2DVMA 3L4BA 1VLLA 1V1MB 2J0EA 3FROA 4A8JA 4WN3A 3O8QA 5EQJB 1NJ8A 3TQTA 4QUGA 3ENZA 5BN4B 2HEGA 3F6PA 4LPSA 1HM5A 4LF9B 4UBIA 3K9FC 4RZXA 3QX3A 5L3RA 2Q5FA 3OJWA 3Q9LA 3WGYA 2EFHB 2NMVA 2G4VA 4MQEA 4BJ5A 1P1IA 1JQJC 4EA6A 4BX9A 3ZWKA 2O54A 5ILGA 2Z1DA 2C0QA 1QUEA 2FWMX 1EXDA 4JUBA 1NLFA 4NOLA 3TE7A 3K0CC 4JI5B 1UPBA 4PIMA 2J33A 1OBCA 3RJMA 3ECAA 4TMKA 3PE6A 5CA0B 1D9ZA 3C0KA 3QMPA 1RQGA 2IU4A 1XEFA 4OHPA 1UPXA 3LCRA 4HDCA 4DUGA 3ZD9A 1FMJA 2QRQA 3A4MA 2H2HA 1SHZA 3O8CA 3ROQA 3EULA 1AN0A 3VMFA 2G0NA 1QH1A 4MLCA 3LIIA 4CM8B 2CLCX 4UTOA 3HWRA 1JTFA 4UE6A 4H6WA 4Z1MD 3ZDYB 5KYYB 2RK6A 3E0XA 4R7TA 4XYMA 3AUXA 3RJ5A 2V7WA 4KNYA 4JC5A 2XDWA 1Y89A 4MWGA 1JFSA 2AA3A 5JXIA 1EMDA 1ZK0A 1IN5A 1KFJB 3N2KB 1HOXA 4IHJA 4ZGGA 3PX7A 1BS9A 1Q0ZA 2LCIA 4UCFA 2W2OA 1QMGA 4AURA 1G8MA 1ISMA 1CIPA 2BDEA 2VDQB 1H2HA 1MX5A 4AG6A 9LDTA 4IZHA 4J3JA 1J0XO 4L16A 1LDBA 1E79D 2VF4X 4UZEA 1XQ9A 2J46A 1Q19A 3IAS1 4QBTA 1RXEA 1SUSA 1ZOSA 3FR7A 3IBFA 4CBVA 4Z2AA 2WVJA 1SIWA 2GHRA 3NR2A 3QJGA 4LDJA 2F3TA 3VH4A 1TNDA 3LNCA 3RYFA 4DQLA 4LOKA 1UAGA 3CE9A 4GPEA 2FG7C 2GTIA 3FZYA 5EMJA 4DBZA 4UQLA 3LUFA 3QLJA 1IJEA 4H7DA 3FCSB 3F2VA 5JADA 4AYTA 5DV9A 1DX6A 3KSDO 4I55B 4B46A 3ZV7A 4AAYA 1LVGA 2PPVA 4AY5A 3RS7A 4PIPA 4OL9A 4OI4A 1QZ3A 4P2BA 4PG6A 1DX9A 1JVNA 1U98A 4HV4A 2FWAA 5ADHA 2GAFA 4EHHA 1TE2A 4TSFD 1Z68A 4Y1GA 3RTCA 5BW4A 5I7EA 1WLSA 1EVYA 1FMTA 4TV9A 4N5DA 4CKXA 4YR7A 1E2KA 5B7PA 1PD1A 1S8OA 3CURA 1T9ZA 3FLEA 3ITKA 4UJ3A 5C4GB 4TUYF 4LYEA 1GVHA 3C6KA 4B7ZA 1JV2B 2R00A 4TMFA 2YWRA 1WCYA 1VL8A 1P7ZA 4M0UA 1O5OA 1XMPA 2VQ3A 5EIFA 5JAQA 5REQB 4AROA 1IXSB 2EX0A 2FNAA 3IBCA 4M37A 1A4IA 2BFDB 2D8AA 3R9XB 3HLTA 3WTBA 4FGZA 1E7MA 4ZT7A 5IX8A 1E8NA 1DEAA 1ORWA 2EFJA 2NU9B 2VPTA 2PT5A 3IPRA 1C0IA 1HZZA 3LF1A 2C00A 4EMSA 4MCHA 1MOSA 2QTRA 4V0KA 5EIWA 1SC3A 3TJMA 5JSKA 2PE5A 4Q00A 1LZLA 1J49A 2JGEA 1O03A 3FPHA 2HK7A 3CZ5A 3QEMB 3AUSA 5LQDA 2DFNA 1U1GA 1HGXA 2VQ6A 4RKEA 3C8HA 1MJFA 4XB6B 1QGUB 1NX6A 4REQA 4NQZA 3U7IA 3G88A 3VR1A 3KXIA 3QY0A 4B2LA 1QNFA 2NGRA 1FJ2A 4TKVA 1PX2A 4ETNA 3I9OA 1J9EA 1NJ6A 4DANA 1SB8A 5HOQA 1WD5A 2GK3A 3ONFA 4DR4B 4ZEWA 2ROQA 4X97A 3CTPA 3MWKA 2P5UA 1JZQA 3CKMA 5GV8A 1SH7A 1GXSA 1JHPA 4YALA 4EQZA 3UMJA 4RVGA 2W6QA 3U13A 3ZHCA 1OB5A 3E82A 4LYDA 2R00C 2PK3A 1E8MA 1KZ7B 5ALRA 3U17A 3NHFA 5BSEA 1Z12A 4EQ6B 5HQTA 4DM7A 1N1DA 4DJFC 1MX9A 2I8CA 4JP8A 1TM2A 2D7JA 3KB1A 4C0SA 5JZOA 2R68A 3IB6A 4CF6A 3PT9A 3DC7A 4ZJUA 3MHTA 5BO5A 3QXCA 3VKHA 4RMHA 1HQYE 1WAMA 1G3UA 3AUKA 3ORRA 3FVRA 1TA0A 1XRSB 4MV7A 4YCNA 4OXQA 1R8QA 5ALIA 1E6EA 3AJRA 3P9NA 5DCUA 1I4LD 3BCUA 4MQ6A 4QULA 5AKXA 1KY5A 5HKKD 4RTRA 3PQ5A 3KKOA 3PVZA 4M0KA 4XX0B 1XCPA 3G8DA 2W98A 1TMKA 2W6ID 5EPEA 4ZYXA 3RBVA 2QX6A 2P5YA 5UKDA 2I87A 4KVZA 1WXEA 1G0OA 2YJNA 3AP2A 2IHUA 2B37A 2GNAA 2WW8A 2P75A 2PS9A 3GBVA 4MQ4A 4L9AA 2FDCA 5E4YA 1EVEA 3NIDB 1DV1A 1GPWB 1B16A 5T3UA 1XTPA 4D80A 1CTQA 4U3JB 3B1FA 3KQWA 2ZT8A 4EO4A 3QTTA 1MIHA 3WLLA 3DE7X 4EY7A 4AL4A 4F2DA 3JAWA 4NE2A 2HJHA 3HL0A 4NECA 4UHKA 2C61A 1KHTA 3EG5A 3NRJA 1Y9EA 1RAEA 5BQ5A 3RS8A 3C2QA 2RHJA 1VKOA 2Y3IA 5E6UA 4QYMA 3RLIA 2Y99A 4LK2A 2LTAA 2GCGA 5DNCA 4HDMB 5K20A 3EZNA 1TTHA 1YDEA 1ZD3A 3K70B 4K9QA 1W36B 4UUPA 2ZR7A 1U3FA 1MV5A 1J5PA 2W6OA 4H2DA 2QX9A 5EJ8A 1TL7C 2OUIA 2X23A 3RU2A 1H3FA 1EEXB 1YULA 4ETIA 1JSZA 5DXAA 1NPTO 1M83A 1AQIA 1YJCA 2ZRCA 1G5TA 2HPZA 5HFJA 2CW5A 4FGSA 2WHXA 1G19A 2RHHA 3CJQA 4GUDA 5FFFA 4Z3OA 1GZ6A 3F6CA 3MRXA 3IS3A 4U6NA 3OEED 3WNBA 4F6RA 5C4IA 4CKZA 4NAUA 5SICE 1QNLA 1XTKA 2GAJA 1XEXA 1YS9A 2V3WA 1O5IA 1ZJZA 2O50A 5AWFC 1W30A 2I4MA 4UOZA 5LIRA 1RYNA 1J2UA 1KH1A 3A6ZA 1CQZA 4LOLA 2O19A 2EFEB 1YVEI 4M9QA 4Z4FA 2C9MA 3L7AA 3OSUA 3W5CA 5AYVA 4LYHA 4P34A 3OT5A 4PZAA 4TYQA 5TX7A 3AOEC 3N0WA 5J2TB 5T57A 4QU8A 1P3Y1 1TW2A 5JANA 1KSJA 1E89A 5AW7A 2IYNA 1XPOA 3LCUA 2UYQA 3LD9A 1MMFB 1K6JA 1DC4A 1XK6A 2AEMA 1YJ5A 2X6QA 3A31A 3OOJA 2FZLA 3PCRB 1VP3A 1EA5A 3QE4A 4HEJA 3UT5B 2OT3B 5E0OA 2IGTA 3L7OA 3T0FA 3GFOA 2XDQA 2C4WA 4JJ6A 1L9KA 4BN4A 1SUEA 1H0HA 2YIDA 3CLSC 2ALJA 3PUKA 2CDCA 1AKEA 2JEOA 1R8XA 2NUBA 3T12A 2R5FA 4O8CA 1QG0A 2EOAA 2R6FA 5TMPA 4QU5A 2Z2XA 2W2VA 1BWPA 3QJYA 4FGWA 3WIBA 5ALLA 4YBRA 3EGIA 3KHTA 3FYTA 4M87A 4NP6A 4M0LA 2CV1A 1L7OA 4NLLA 1WXDA 2YN2A 1B3RA 4GX5A 1Y5LA 1LVUA 4LEIA 5E9QA 1UXOA 2PA3A 4X94A 1ZUIA 2QLTA 2HFJA 3KUKA 4FGLA 4YRTA 5DASA 4I4NA 2W42A 1WPXA 3RS2A 3CEJA 3NM5A 2IEBA 3AB8A 2DRIA 4KGXA 1LTKA 3IDSA 4L4ZA 3QFTA 3PIDA 4FXPA 4YEDA 1EU1A 3JQ6A 5DN9A 4JBYA 4DOMA 1RBZA 1X70A 3X1KA 3UOWA 4ZAVA 1POWA 2WWIA 2XJ4A 4OQLA 1OR8A 4XR4A 5FTNA 1L5LA 3ZWCA 1M6YA 5AQ1A 5KTOA 4CQJA 3ZGYA 3ADKA 5BYBA 5FWXA 5JJ5A 1MABA 3WGQA 5TF4A 3FPJA 3UMYA 2XCSB 4AS3A 3E3NA 2EKDA 3JZFA 1YZNA 1DCMA 1RHQA 3ICPA 4QEKA 1USWA 1V16B 3BL8A 3EAQA 3AHHA 3IKJA 3KXPA 2DQKA 4AUMA 3E0QA 5CURA 4B81A 4RVOA 3EXFA 4MUEA 4LDRA 1JR3E 1KU0A 2Y71A 3P94A 4IRXA 3KBBA 3BKWA 4JLOA 4ERXA 2JLYA 5BYAA 4AZWA 2CV0A 4OXRA 1EDZA 4ZMBA 2ZKIA 3WMFA 1RMTA 3B12A 4HH3C 3WYGA 2HQSA 4GD3Q 3UCEA 1QV7A 221PA 4XFJA 3F71A 3RAEC 4KN9S 1UKBA 3NT5A 4I7EA 1A98A 1LI5A 3QVSA 4PFSA 3IEIA 1XJCA 3BJEA 1NQUA 2C5GA 3OZWA 3Q10A 1N6HA 2WJWA 3CEPB 4IOMA 4NV0A 1WCIA 3ZJVA 3EGXB 1QYWA 2JD0A 3HJCA 1NQTA 3WK8A 1IEWA 4I55F 2IK8A 4D5EA 3QVLA 1IHOA 4D6YA 1DQPA 4OHFA 4KIFA 1JA9A 1NAIA 3RI3A 1JPJA 4IRMA 1MJ5A 3VR6A 3WRYA 2IS1A 3C97A 4CN9A 3FJYA 4F4CA 4UM9B 4KIUA 3WK5A 4F4UA 1JFVA 4HDAA 4LHZA 2B6NA 1K8RA 2N1MA 1SELA 3D3JA 1PS8A 4BO2A 2YNMA 5D6NA 1A72A 4KJXA 1UKZA 3WB0A 4JJ7A 4L8LA 2JJQA 3DEFA 1I10A 2HIGA 4I50A 4BMYA 3SQWA 1HT1E 3SC6A 2WM8A 2PXXA 4N8EA 4IWXA 3PDWA 2NSHA 4PWYA 3UHOA 4H15A 1KJYA 5CCXA 4RY0A 3BTVA 1WDTA 1ACJA 2XZPA 4KDCA 1EP9A 1GG9A 4KSCA 3B9RA 4P3KA 1N4AA 4E08A 1AM4D 2R79A 4WN9B 3QU5A 3MCZA 2LIPA 4RCVA 1H1LB 4R16A 3VTFA 2HWUA 3QKSB 4XI9A 3QWIA 4U9UA 1Z36A 1U80A 2FMKA 3BRWA 4NULA 1J2JA 1SVNA 1OC4A 1OGJA 2UV8A 3C6MA 3E9RA 3Q3HA 3EXEA 4OIFA 3J80A 1O7JA 4PSUA 1BN7A 1RZUA 2MYTA 2QE7A 1KMHA 3C87A 3QUSA 5MF6A 4M49A 2PCJA 2NZUG 2OCPA 3RHTA 3HV0A 1NLMA 2VKTA 4NZYA 4NPAA 3QHAA 3N53A 4D4KA 3HCWA 4MRNA 4NCKA 2NXNA 3F3YA 5H59A 3GK3A 4O02B 3KCQA 1W6UA 4BZQA 1MTZA 2NQ2C 2QQGA 3KVRA 2J7KA 4FN4A 1TB4A 3NUQA 1IBKB 3G8AA 4RL4A 1IEXA 3F49S 4OFWA 1K4MA 2A0FA 2YV5A 3S68A 1QIIA 3H05A 3OKCA 1BMQA 1EUZA 1RE1A 1Y81A 3MSXA 5F12A 4ZAWA 4PO1A 3UAGA 3RBZA 4AKTA 1A7AA 2ATEA 2NO6A 4WACA 5F5NA 3PTAA 3S81A 1FVOA 3GG2A 1OIVA 2GHIA 1K6MA 4A5SA 4JLUA 4IIEA 2QBYA 3F6YA 3V4SA 2YHUA 3R0IA 4YWJA 3R5KA 5CFOA 1RWXA 2P2NA 2YJTD 4L7QA 2PSEA 5G0VA 3OTWA 1YQUA 4B4WA 4F2HA 2YWGA 4WJKB 4UU1A 2JBWA 5DP2A 2Q8NA 1LPNA 3H9CA 4XPZA 3SLGA 3SOPA 3KQLA 3QZUA 1Y1LA 4MLPA 1XO1A 2VC2B 5G40A 1KP3A 2GN4A 5JD5A 1TEHA 2XUZA 1XFDA 3ZWBA 2PT9A 1OC2A 1XLVA 2EJVA 5JEDA 4NZPA 3FTQA 3IV9A 2YDYA 1A9XB 1WUHS 3TLCA 3KKEA 1N2EA 3G0BA 4B79A 1C0PA 3DWIA 5JS7A 3FHJA 5IM4F 1IN1A 3S5UA 3LVQE 2ZE6A 3MBOA 4AJLA 1SVUA 4BJ3A 1ADBA 1N2XA 1KI7A 2C2BA 4KWCA 1GPDG 3GO4A 3GCXA 1Y42X 1F1BA 3M0EA 4YCDA 5KC9A 2QRHA 3WL4A 1JDVA 4HAWA 1KYZA 1SCQA 4K81B 5CVCA 3IERA 4DLKA 1R0ZA 4DKJA 1IDN1 3MWEB 4WZBE 3L7KA 5J4VA 2MYNA 5JJBA 4CM9D 1MB9A 1PZMA 5HKLA 4F97A 5BRJA 3GEPA 5JAOA 1WEHA 2ISSD 1YQ9A 4RL6A 4E5NA 5LYJA 3R74A 1FYVA 1YL7A 3PE4A 1Q50A 2O3JA 3LVRE 4HRVA 1GRRA 4DEXA 4EVSA 1GGJA 1T3SA 1RYHA 2PGJA 3WA6A 1EWVA 3CEAA 1CJCA 1UDRA 3FETA 1RCFA 1NNSA 3IPAA 4KSYA 2ONZA 4RJLA 2V6IA 4KQKA 4BE9A 5GVSA 1DE0A 2B4RO 2PZLA 4BO1A 4LZPA 4NBWA 1CY6A 3MJTA 2EWMA 3K96A 3RU7A 3CS3A 2QAGA 3EXIB 1Y5MA 2ZYVX 4X91A 1FFHA 4RM2A 2NYUA 4YJGA 3WHPA 4GPAA 3QQ5A 3ZEIA 1N3IA 3DYBA 4CMGA 5B4UA 4I1RA 4P3XA 3SHFA 3DUWA 1A95A 5AJXA 8ATCA 3VTKA 5JXGA 2VDPB 5FF9A 5CDYA 4N1AA 1GG2A 5KSPA 4JI0B 5KOHA 4EEKA 3WY9A 2NTYC 2ZFUA 1Z16A 3JRWA 3NHWA 2H5EA 3N87A 3JALB 2C29D 2R1TA 3UMGA 3IQHX 2NO4A 4FKMA 2GNPA 3W7AA 3KUCA 3O8BA 3NH9A 4LF6B 5AI6A 3T9BA 2WIFA 3X3HA 2CNLA 4Q0MA 1S6YA 2PX4A 2QTCA 5EJ4A 4QKQA 1U28C 2W4QA 2WUFA 5IBPA 3STXA 4BMZA 1KO1A 1Z2AA 2FRVA 3G7SA 4HAZA 1CB7A 3ONEA 5JSHA 3L8FA 1KJNA 1NMXA 4H1VA 4PNEA 3PEWA 1NYQA 4TZ0A 4FE4A 4GWLA 5C7OO 3L8YA 5CVJA 4ZU6X 4B2IA 1XZKA 4N7RA 2IZ1A 3W05A 4C4XA 5C1OA 4D0NA 3L6EA 4DDVA 1UKCA 5KKCA 3GYGA 4W5TA 1MBZA 3AUFA 2QUAA 1EXNA 3OLZA 4DDUA 3U3MA 2QZ4A 4R7GA 1ZH4A 5DOZA 3WO1A 2Y6UA 1IATA 4HF7A 5GONB 4YJHB 4OMDA 1T3LA 1U0EA 3RFFA 3GGPA 4C6SA 4RF4A 2RHBA 1XMJA 2PXAA 4XYGA 4C14A 1QFYA 3L1JA 4LJ6A 5FQNA 2X2FA 2XXAA 2GKSA 1JQKA 1UK7A 4Q19A 5A0FA 1BXRB 3DE5X 5LZ5A 2OVFA 5K51A 3W5BA 1NJFA 3QUQA 5DN6D 5JT1A 3BD9A 3EPRA 4P92A 5MN5A 1V8PA 4H4CA 4N8SA 1QUFA 2QQEA 3PSAA 3KU1A 1YJ8A 4YV1A 5BMVF 5IVKA 4EI7A 3WE7A 3QM1A 4FFSA 3GFRA 4W1QA 4TLCA 1D5CA 2Y9PB 2YJZA 3G0GA 5FBRB 2F90A 1Z13A 2RGNA 4KI0A 1C3XA 3ROKA 3VHXB 2YQ4A 4FE7A 1KRWA 1L5RA 1QS0B 1Y6FA 1LGYA 3JD3A 2IUFA 3ZHRA 3KUUA 1KBZA 1IY0A 3QVTA 4GWKA 5HCIA 5THXA 3RE1A 4NNJA 1Q16A 2M6SA 3WOVA 2WDZA 3P9KA 1HF3A 5EWJA 1B2LA 3JD1A 2A5JA 3MTDA 3HYSA 3KHKA 3IQEA 1DOAA 3JQAA 3IP9A 4NEHB 4OP1A 2IOYA 1X19A 2IW3A 5DSXA 5K2MA 4CG0A 4WDRA 1A9QA 1M6NA 4YLGA 4ZANA 5AIBA 3ZY5A 3THYB 1EGQA 2OQRA 3JQCA 2BV3A 4Q9DA 4XZ3A 1MDFA 2IH5A 2PA0A 1GCIA 1KFEB 1Z6GA 3AF1A 5KJCA 1Y8CA 2WTBA 4P22A 3MTAA 2F59A 5DE3A 3L3BA 2ZULA 1NXVA 3COVA 2VJYA 1I9GA 2QJTA 2GRAA 4DZTA 1O94C 2HZBA 2GN0A 5C34B 4DCGA 2ETVA 3E81A 3TL6A 4NWIA 1KAMA 3VDRA 2Q49A 2VATA 4I4LA 3NKLA 1VMKA 2CJPA 4RGVA 1L6RA 1D4OA 5CYGA 5BW5A 2ZXFA 2O8CB 4O33A 5HFNA 5LA6F 3AHFA 5K4GA 4MVJG 4X63A 4Q7LA 2VQEB 1YUBA 1LY1A 3FPCA 1Z6AA 3WIDA 2QYSA 1HFWA 1XZMA 2PO7A 2DJ5A 1ZO8A 3CXRA 1G6HA 3B1ZA 4RHCA 2Q7OE 1BMFD 2JAPA 2IWRA 1Q7TA 1Z45A 2I54A 1AGRA 1YB5A 1YQDA 4LTMA 5EIHA 4TYWA 4NZNA 3MXTA 3NIBA 4RV5A 3AR7A 2ZJ3A 3RUHA 3F67A 4MUGA 5JBNA 4QM7A 2ZATA 3D3NA 3RKRA 2AK2A 1SAYA 4EEXA 3QBTA 1QCZA 4RVSA 2VXBA 3SP1A 4DCVA 3JWJA 4D3YA 1NBMD 1WX1A 4CFYA 4PAOA 1WO8A 2HI0A 1KI4A 1LK0A 1B73A 1LLUA 1YI0A 2XW6A 4ETMA 1L5OA 4DMKA 1JJBA 2P8SA 4JU9A 2Q9BA 2RBEA 1V6CA 4F46A 4POAA 4HWPA 1YACA 1AGYA 1AS2A 3FCUB 4DC9A 4XUGB 2COUA 3WNDA 1P44A 4ND2A 2FMUA 1USIA 3JYHA 1FX0B 4OM7A 2X2PA 1Y9DA 3AG6A 5TVKA 3R7WB 5A62A 4KNVA 1RCTE 1L5MA 1PO7A 3AF4A 2DBZA 4Y6QA 3GPDG 2B4YA 3GJTA 4BBZA 3HEBA 1KI3A 3B3QA 2WPNA 2ZT6A 2JGLA 3T9AA 3WYCA 3Q3JB 3KKNA 1L8XA 2A5YB 3NATA 3ICOA 4ZU3A 2BH2A 1M6HA 2CYAA 4N12A 1TQDA 4Q12A 3M89A 4GSKA 4ENPA 2G7MC 1C1DA 1R8JA 2J48A 2GHTA 4HB2A 3F46A 3VR4A 5BR8B 2ZYSA 1P80A 2OA0A 1C7EA 3VSCA 2AZDA 2CHFA 4P7GA 2JD2A 2CMKA 2FTKE 1IXYA 5EA2A 3FTPA 4I0WB 4TWZA 3ZXXA 1W88B 4FOLA 5ELLA 1Q0PA 3ACCA 4Y6SA 4JA2A 2MDTA 1ENOA 2XWPA 4MQEB 2DPHA 1XL0A 4IOJA 1V1RB 3EQ2A 2QSZA 4DG9A 1ECPA 1TEVA 3ESCA 1NP6A 2YBEA 1QP0A 1QKKA 3HUDA 3H9EO 2JKZA 4LMAA 2CNKA 3NJ4A 3TW8B 2KBEA 3ADOA 4PZEA 5CB4A 4XDYA 4CMJA 2A35A 2QMYA 2QMQA 5TQ2B 3TD9A 3SDZA 1QZUA 4RKQA 1EXVA 2XHZA 2K2WA 1NN0A 4V1CB 5BVGB 1UBRS 1COWD 1GDHA 4N0QA 1JECA 3QFRA 1FEZA 3GFBA 1Z26A 3HFRA 3IODA 1QV6A 1JPUA 3O2JA 2VZ8A 4EFDA 5ALVA 5EI5A 1MH1A 4PHTA 4DLNA 3U39A 2NQTA 5EN4A 4JT9A 1JSRA 3F7OA 4NZ9A 3E7PA 2AQ8A 2OYRA 3ENVA 4OJMX 3TINA 3BDVA 4E2XA 3PXDA 4ER5A 5PGMA 3SE7A 1JJIA 2ZYUX 3ZXYA 1AE1A 2IZ7A 3PJEA 3PWSA 3NAMA 1Y3CE 3C41J 1CJMA 3LK6A 2Z30A 3ANNA 5A6SB 1N9KA 2CHEA 1FFGA 1BS2A 1KDVA 1OYOA 4BNKA 1UKYA 2VUUA 5E3HA 3ZV6A 2JFGA 2XUJA 2UXBB 5TT1A 1Y8RB 1M2VA 2QTVA 1CUVA 3PRHA 4I9UA 3ADBA 5F3DA 1Y37A 5KYKA 2EW8A 3DDCA 1TK2A 2I4RA 3FF4A 3GGOA 3GU3A 1HDRA 1TECE 3G9UA 5B4TA 1TU4A 4LWQA 2ATVA 2CCGA 2ONJA 1RDFA 3WBFA 3F6SA 1Q5PA 2MIIA 3HJFA 3JXEA 2A0UA 5JY1A 1EH5A 3NBUA 3GJ4A 3A1DA 1E1LA 2O1XA 2OGWA 1FRVA 3JATB 3LY8A 3FCEA 3AEUA 2CD7A 5KNDA 3FSGA 1RI1A 1WUTA 1GY8A 5ALQA 5IZCC 5BYKA 1Q21A 5CT8A 5KAMA 4KN8A 3PKIA 5FRDA 3VJLA 4C4ZA 3S2IA 3K0BA 1Z62A 3RGWS 1EZ1A 1U0SY 3BILA 4TLMB 2V8BA 2QUIA 3DCYA 3A3NA 2PANA 4OOEA 4WCFC 3T5GA 4TUYB 3EEOA 3I76A 1U0BB 4NMHA 1TIKA 2IXAA 3M81A 2EL9A 2KSQA 1BGXT 3H1AA 1H6CA 4EM6A 1PWXA 2A3RA 1XHEA 1XA3A 4IQFA 2E1PA 4AS2A 2GCOA 2R86A 2Q3FA 2Q3JA 5LKRA 3KM0A 2VP5A 1PWZA 3FWNA 3LO5A 3LOPA 3OJXA 2JGKA 1U8ZA 4UD2A 4F4IA 1OSNA 3JZDA 1XHFA 1ND5A 1H9AA 2FK7A 2QLFA 2IYFA 2X77A 3DKIA 3BTSA 3MHPA 4NSNA 4LXYA 3EZ2A 4C21A 5IYZB 1XZDA 3JQ9A 2I8LA 1V37A 5EE1A 3W8FA 1T0HB 3INTA 1N0VC 3BGOS 3QXXA 3CGWA 4ARAA 2VPYA 3GFSA 3ISJA 4D4HA 1J07A 3OQJA 4IXMA 5H80A 2ZCJA 3EY4A 4LKRA 2IHJA 2MSEB 3K9HA 3IXLA 4UBLA 4XWWA 3HKBB 1PEAA 2H1IA 2O1WA 1AXGA 3KQOA 3O92A 4X61A 3L93A 3PBKA 3IVAA 2JJ1D 5GJVC 3TUJC 1B8VA 4CL2A 4YGXB 4OLJA 5KYVA 3ZU5A 5EJ5A 3NC4A 3PUXA 2XXJA 3B3FA 1E2LA 1EVLA 4I14A 3DZKA 1ZNQO 3IKVA 3IQXA 3GARA 4MUJA 4CUZA 3R20A 4DSTA 4QXRA 2PZJA 5HIAA 2DCUA 3ZI7A 1HG0A 1XPRA 4TT3A 2BDTA 3E5NA 1PJQA 1OX4A 1QHSA 4INOA 4RDHA 3WISA 2BFCB 4FLEA 4RPJA 5HK9A 4IV5A 2BFEB 1FX1A 1WCIB 3PJGA 4ZPJA 5CB6A 4M0EA 4EQ6A 3HZZA 2Y1FA 4ROTA 3RAGA 4BU0A 3NYRA 4P0TA 1T36B 5KUTA 4EYGA 3IR5A 3A14A 4PPQA 1R2QA 3ZJTA 1Q7GA 1ZUNA 4F3TA 3I9LA 1Y3FE 2I91A 2AKEA 4K2AA 3L4KA 1GT6A 2VBGA 3IP1A 4J2TA 3WB2A 3Q15C 3BK1A 4IWNA 3RHZA 1MP0A 4AJNA 4AM8A 5CBKA 4PHCA 4BXOA 2YBDA 3WNZA 1VL1A 3FUXA 3NT4A 3QFHA 4LRSB 2IUUA 5ITSA 4BATA 4YO8A 3DWEX 2JA2A 4BMCA 4RHTA 4K6KA 1AURA 5THQA 2AGVA 3OUZA 2KHZA 4CW7A 3VGJA 1OLXB 4Y2UA 2ZR8A 1NURA 1G9SA 4ON9A 1UBHS 4BLRA 1MIOB 1BE0A 2O07A 4RMJA 4FT4A 3WL3A 3MM4A 4HGRA 3AVOA 3NTXA 3AU8A 4QTYA 1DBIA 1P19A 5CA0F 2FEWB 2VOEA 1R6AA 3F3KA 4EG7A 5DHRA 1VC2A 2VOJA 3NORA 1CD5A 1P72A 1RJ9A 1ZWLA 5DMHA 3URMA 5CB0A 1E2EA 5ABPA 5DN6A 4B87A 2OOKA 4ZMSA 1SULA 1Z37A 3O8DA 4EA7A 1EPUA 1NVWQ 2D5AA 3GJ3A 4QC2A 1PLJA 2NXJA 3ZHBA 1JAHA 3DBOB 2QJRA 4R8KA 4EJ0A 3WGUA 2FVYA 1JBQA 1QKJA 1MPXA 2CC2A 3R44A 4C2TA 1R4MB 1HDZA 3K53A 3BSSA 1XZNA 1PV1A 1YMUA 3KVNA 3Q1LA 1TYDE 3GLKA 4J75A 4HZGA 4UXIA 1L3BA 5CXUA 3IVCA 1YIDA 1GG8A 4LZWA 3E5HA 5EMKA 2IBTA 1X7YB 1ORRA 1XAGA 2PWYA 4EPXA 1FSZA 2PR7A 1P31A 1WVMA 2CDRA 3R3ZA 4Z0HO 4ER6A 1E6MA 1B14A 5FORA 1NVTA 1KNXA 3K9WA 4J43A 4YQEA 3OQBA 5J5AA 5TPZA 2N9UA 4R1QA 3ZE8A 2OD9A 4PZ0A 2XBLA 1H4TA 3UUFA 3RIMA 3U4MA 1LPAB 2QJOA 3A70A 4YHHB 3AVUA 3WAJA 3R0ZA 2B4AA 1SRQA 1ADYA 3MWLA 4J49A 3I8OA 3E22A 3WLQA 5GZ3A 1RFLA 3KEMA 3Q12A 2IYSA 4GQBA 1NF9A 1QVAA 2V55B 4GNKA 1QQAA 2NG1A 3B3GA 3ANSA 3HJTA 1C9KA 4J0HA 5IUKC 3VYUB 5JCZA 2ZJ2A 2Q9CA 2XKKA 4BMPB 2AOUB 4ZIRB 3D1VA 1WETA 1UCFA 2I62A 2IYEA 3KFVA 5JCPA 2J3DA 2E87A 1F8FA 5LP1A 3I9KA 2DB3A 2VHCA 1QYCA 5ES3A 2YFYA 1AXEA 2TS1A 4QBHA 4EBBA 3GEDA 4XLTA 4UNSA 4IUYA 4MQFB 2ZRHA 4TLAA 1TO2E 2AI1A 1ZK4A 1ZYUA 4HAIA 4OHCA 4D46A 4DT1A 2HU7A 2HF7A 4WFIA 4YXFA 3I2JA 1QONA 4D4MA 3ZWAA 5T67A 1WP4A 1YXMA 2W7TA 3CVWA 4AWBA 1HT3A 3MB5A 4QWMA 1E2BA 1I5OA 5EXXA 2YHIA 3CX6A 3T61A 1S7CA 1O97D 2CLEB 4MA5A 4CFZA 4ANFA 3Q87B 2LIVA 3H8VA 1BYUA 1M54A 2XSZA 3CLTD 3ONDA 4ACBA 4IDNA 1UDXA 2E6KA 2E0IA 2GYVA 4F60A 9ABPA 4UD6A 1CY8A 2TMGA 4KN6A 1ULSA 4HO1X 4BIIA 1BEEA 1DFGA 3TQOA 4MB6A 4ZXFA 1F9EA 4IJKA 1F2DA 1X9HA 2G5PA 2QD4A 2H9AA 2YUIA 1O6FA 1USVA 3AEZA 5CP8A 5E2BA 5EXSA 3I73A 5CYFA 1ZI8A 5B1HA 4DIMA 3MLBA 4HSEA 2WI8A 4JYAB 5TV2A 3KP1A 3D4PA 1IY9A 3KZMA 3TR6A 1A8QA 2XGMA 3CFYA 5HWSA 5KYWA 4JZKA 2L82A 4NAVA 4BQEA 3RDPA 1XPJA 4PLTA 1OI3A 2V7QA 4MW0A 4P8RA 1KS9A 5FOXA 4PV7A 3QE9Y 4KREA 4GBGA 4L51A 2IF0A 4KDRA 3ZW7A 4RTOA 2QSUA 3FSJX 4V39A 4GX2A 3H5TA 5LDGA 3TLJA 3AY7A 3B53X 3S44A 1WXQA 4BGEA 3A26A 3W2HA 3ZK9A 1N25A 4KPYA 4PVDA 4RFSA 4RK4A 4EUKA 2XNDA 4IFEA 8OHMA 2E7ZA 4YWHA 3DZJA 5DJ5A 4LISA 5KOHB 1I4DD 4C0XA 2NTEA 1I2DA 3ORYA 5K0LA 3X1ZA 1O9HA 2I6SA 3ZQ6A 5DOVA 5KNCH 2PFSA 4LZNA 5DXFA 3RGGA 3CINA 3ZX4A 4ZMRA 2DUUA 2RGYA 5IZ4A 2QRVB 4YAWA 1HRKA 1PKEA 1Z8DA 3JAMA 5E7IA 1WV0A 2FPGB 4EH1A 3PUJA 3NNNA 4UNPA 1V9SA 4LDNA 2B9VA 5FPSA 5GIOE 1SXJC 2WOJA 5EZYB 2Z1NA 3W77A 1AKRA 3IKLA 2DC1A 5FCDA 4PC3A 4AG3A 1S96A 3GY0A 3KV3O 4K2HA 1EFRA 3B85A 4ZO4A 3L43A 1JRLA 1T5HX 4YRJA 3U4QB 2AFHE 3KLMX 3O2SB 3P9ZA 4H3VA 2AFIB 4C1NA 4ZC1A 3WGHA 4Q7EA 2UZ3A 1QV9A 2PMBA 4FYVA 3PA6A 3ZU3A 2C9BA 2GD1O 3WMXA 2EBFX 4DBLC 2ABWA 3L04A 5DRYA 2CXHA 2VHTA 1AHIA 3U44B 2PUFA 3ER9A 1JG1A 2WHYA 1WKVA 2HCTA 2JIQA 3I23A 3NJ8A 1DIAA 1M2EA 3ZWPA 4A2CA 3KPVA 4CIAA 1RRCA 3OD5A 3QWFA 2OD7A 1CJSA 2B1IA 2DCMA 1Q0QA 4QECA 2QP4A 4HNAB 1MPTA 4X24A 1TZ2A 4PLWA 2A5GA 3E7DA 1KI8A 3QWHA 4YJ3B 1ULUA 3M6VA 1Q83A 2XQJA 2PSJA 2HDWA 3EXEB 4WZAA 4CIVA 4KXMA 4EJ2A 4GLBA 1JFTA 5T6MA 5KINB 1I14A 4E46A 4OIMA 1NWHA 5CLLA 2IELA 2WIGA 2Y0CA 2AG1A 3SX0A 1CW2B 2ZRGA 5KS2A 1KZGB 2H5JA 4WLOA 4AJKA 4LGCA 3FOEC 1W35A 3N58A 3DXXA 1AQJA 3CR3C 2BJWA 4X71A 1PLLA 10MHA 4G0OA 5IG2A 3FB1A 1XZFA 3WK9A 3U9LA 3UK7A 4H1HA 4UTPA 4YQFA 3JYPA 5FH9A 1JN0A 1V5GA 3SC2B 4HC4A 4ZVOA 4EA9A 2DKNA 2PV0A 1FYEA 5EY5B 5KQGA 5AVXA 1ND6A 3PC8C 4L78A 5HK8A 3LKBA 1FJXA 2QX8A 2H07A 2RHRA 4BNLA 2BC9A 5ICEA 1M2WA 1HQKA 3OUTA 1T5BA 4HOYA 3H1PA 4Z0PA 5FA5A 4F93B 1WU7A 1ESEA 2NP7A 2QR3A 3TFQA 3G0OA 3Q6NA 1Z7YA 3D2BA 3OIGA 1C3OA 3FDXA 4RPIA 3RSHA 2X2OA 2WJAA 5FBLB 1ZK1A 1GL6A 1P9LA 4JB2A 1TAQA 3F8SA 5BNTA 3CUVA 3DEIA 4OB7A 1V8FA 3AP3A 3BWXA 4P81A 4DT1B 4AXBA 2P4SA 5G0SA 4B2PA 4R8VA 2JJ8A 4QXOA 4CETA 3L07A 1RRKA 4QVKA 3RABA 2ZIWB 5TR9A 4B3DA 3OPQA 1JKMA 1N2CA 2O5VA 3MJHA 4PLPA 3REOA 3MT0A 2WJGA 4LHWA 3I5UA 1WMSA 3K8ZA 4I8DA 2B94A 4BIMA 1JH8A 2XMDA 4JLMA 4Z9AA 1XSEA 1EE2A 3ZW9A 4DYDA 4HXFB 1FA9A 4O2LA 1CRWG 4PNZA 4HXGA 3IVMA 3L79A 4ESEA 4KFCA 3C5WP 3N8DA 3FI0A 2L19A 2YN0A 4K6MA 4YN3A 1JIIA 3HM9A 4EKEA 1H69A 1JDUA 1L4FA 4ZK6A 3A6KA 3FMGA 1EDOA 3RYTC 4EHJA 4IP0A 5BR7A 1J0DA 3NDPA 3NWOA 4M0MA 3PGLA 1EESA 4OK3A 4I8IA 2HSJA 4MCAA 2XTNA 1PR3A 4K9SA 4P6VF 3ZHQA 1TXGA 1KEUA 1PL0A 3MD9A 4BC0A 4E7OA 5K8UA 1VIDA 4MYUA 2IEYA 5JD3A 3UMFA 2E49A 5B53A 2FPIA 3CLKA 2AOXA 3JD4A 1VE5A 3AR4A 4X54A 1XMXA 1GLGA 3ITEA 5FD8A 3OT1A 4E5VA 2D74A 1MXHA 2JBHA 2R2AA 4LOHA 1KDPA 4XJSA 1M34E 1C9NA 2QU8A 4UVGA 5HR5A 1NN1A 4Q93A 1FU7A 4NBLA 4OJTA 4XCQA 4YP0A 4F6CA 3EDMA 3PDIB 2Z5FA 2D1SA 3BC1A 3MS7A 1N75A 3T9FA 1KEZA 4G01B 5AKJA 4ABTA 3IGFA 3U7QA 1E98A 2BUAA 5LKAA 2QENA 3KAJA 1JEOA 3T6KA 5FUMA 1RAHA 3I2HA 2I29A 2XWJI 2FQWA 2DE0X 4HNVA 4KBYA 4CMCA 3QYFA 5A3QA 1L7EA 4WQMA 3ICCA 1IVYA 2QMUA 4W8OA 3UBMA 4A8JC 4C2BA 3ZDZB 3WIUA 3DR3A 4L73A 5C3UA 5L7YA 5IDYA 3MBKA 1RZ3A 1HDCA 2CMHA 3OLYA 1JTEA 1NUAA 1SBNE 2I78A 4ZVUA 4D9KA 2MSKA 2A94A 2Q5QA 2W2KB 3HTXA 1GSHA 4V0MA 2C96A 2IS4A 1UZNA 3R5JA 1HDXA 1T4DA 2OCLA 4S35A 2B8WA 2FE4A 1HLDA 3QMWA 4XWGA 3U7EB 1RP7A 3Q72A 3GX1A 3QEBZ 4RVHA 4L85A 1FYXA 3TGPA 3IBGA 2Q0QA 1WSAA 2OV3A 2FX2A 4LNUB 4HDKA 2QE6A 1H8HA 4KTTE 1OI2A 3AY6A 5EHXA 3LJKA 5CT9A 1GA4A 1V3TA 4Q48A 1ISFA 3JVVA 5FAXA 4C4RA 1ZGAA 5K3FA 2XODA 5BWNA 3MQ2A 1NVMB 4TMYA 3AL3A 1KBOA 4F85A 1R4NB 1NVAA 4YQYA 4YAEA 1IQ0A 5FI5A 2FWPA 2XQIA 2J4CA 1B74A 1GL7A 3IULA 1ZFNA 1SCAA 3X1XA 2XA1A 3FOCA 2ISCA 4RDCA 4BFVA 1CDOA 1A2BA 3H1FA 4MWBA 5KSZA 2EGGA 3B2QA 4O4LA 4TTIA 2HPAA 2V7XA 2JIZD 4J0DA 3WGTA 2OAP1 3M1YA 1QH0A 1GPLA 1DKNA 3R3SA 5ARDA 4TVKA 1K98A 2OO5C 4EPTA 1RYZA 4XWOA 2UZ1B 1HYQA 2C9DA 2P6MA 3EAGA 1LVHA 3FI9A 4A9AA 2PGDA 3NALA 4IQ4A 4QNRA 3CN9A 3N7UA 1DRUA 1DTWA 4XDGA 2C3UA 2CVHA 3MTQA 1D5WA 1XJQA 4O2BF 2ZJ6A 2CXXA 3GQBB 4YDSA 3EPJA 5DYTA 4F3CA 1CRZA 1YVDA 2JNWA 1U2ZA 4ZKDA 4QM6A 2PZFA 1R74A 3QXJA 3GEMA 5T3YA 2YV1A 5T5QA 3C7DB 4HPJB 2FY8A 2ZJ0A 2WR8A 4MWEA 3TMAA 1U90A 1R5OA 3E5RA 1FSGA 1OY1A 2PZBA 2QYOA 2VYND