2RAVA

X-ray crystallographic structures show conservation of a trigonal-bipyramidal intermediate in a phosphoryl-transfer superfamily.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
261
structure length
261
Chain Sequence
MTKALFFDIAGTLVSFETHRIPSSTIEALEAAHAKGLKIFIATGRPKAIINNLSELQDRNLIDGYITMNGAYCFVGEEVIYKSAIPQEEVKAMAAFCEKKGVPCIFVEEHNISVCQPNEMVKKIFYDFLHVNVIPTVSFEEASNKEVIQMTPFITEEEEKEVLPSIPTCEIGRWYPAFADVTAKGDTKQKGIDEIIRHFGIKLEETMSFGDGGNDISMLRHAAIGVAMGQAKEDVKAAADYVTAPIDEDGISKAMKHFGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title The catalytic scaffold of the haloalkanoic acid dehalogenase enzyme superfamily acts as a mold for the trigonal bipyramidal transition state.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 90
structure length 261
sequence length 261
ec nomenclature
pdb deposition date 2007-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 2ravA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ravA01
1LTQA 5AI5A 3ESRA 5AM1A 3WK8A 1J97A 5AKXA 3AR8A 4EENA 2EATA 4JB3A 3QLEA 1L8OA 4UAUA 1RPZA 2YMMA 2I6XA 3QXGA 1TE2A 1T5SA 5ALRA 2B0CA 2QLTA 4UAVA 2IYEA 2G1AA 5ALUA 4RESA 4UU0A 1O08A 2WM8A 4L6CA 3N1UA 2YJ4A 5AW2A 1J8DA 2ZBDA 2FUCA 3M9LA 5ALFA 5ALDA 1SU4A 1S8OA 2CFTA 4PNHA 5AIBA 5AVZA 1O03A 3WKCA 1Q91A 4YH1A 3UMCA 1RC8A 3J7TA 3MMZA 3ZVNA 1VJ5A 3A3YA 2ZG6A 5AI9A 3QYPA 5AKZA 3OCZA 5AVYA 3D6JA 4EELA 1RKVA 4KNVA 4F71A 4ZEVA 2FPUA 2AMYA 2B30A 4G63A 4EX7A 1WR8A 3QU2A 2FPXA 4HGOA 5AIAA 3OTQA 3L8GA 4BBJA 3WKAA 3PGLA 2ZOSA 2W4MA 2G80A 2C8KA 3AR9A 1WPGA 2I34A 3MN1A 3WK4A 2OBBA 2Q5EA 4QQFA 5JJBA 3EF1A 2BY4A 3L0CA 4L57A 2YY6A 4EX6A 2WF8A 3OCYA 3SHQA 2C9MA 5AKEA 4Y2SA 3SD7A 2FDRA 5A3RA 3QUQA 2BDUA 4MWOA 4YCNA 4XOUA 3NUQA 4IG4A 1YDFA 5ALKA 1ZJJA 3PGVA 3W5BA 3ZI4A 2MSNA 3ZUPA 5AM3A 4KX3A 2P9JA 1NF2A 5AVWA 5AVQA 2QYHA 5AW0A 5AM5A 3F9RA 1Y8AA 1L7PA 3U7FB 3ZX4A 2JAWA 3P96A 4YCLA 4KX5A 3N5KA 3N8GA 1SWWA 2YMPA 4DCCA 1Z4JA 4GXTA 5AI6A 3L1VA 2YMLA 5AW1A 4UARA 5AICA 1N9KA 5AKJA 2FI1A 2HSZA 4KYTA 3TLMA 3PDWA 4EZEA 1QQ7A 1L8LA 2GO7A 2YJ3A 1YJ5A 5AM0A 1TA0A 5AVRA 1YNSA 1EK2A 4XPZA 1CQZA 3AR7A 4B6JA 3DDHA 3PCTA 3AR6A 2EARA 4BX3A 4BX2A 1T9ZA 5ALWA 4Y2UA 2PKEA 3QU5A 3IB6A 4NFLA 5ALNA 5ALMA 3U7EB 2VKQA 3ONNA 5ALYA 1RMQA 1X42A 1U2TA 4CE6A 4HGRA 4HGQA 3CZ4A 1RRCA 1XVIA 2I55A 2C8LA 3BWVA 2G08A 3HYCA 3SF0A 3SLRA 3ZVLA 1QYIA 5FP0A 3L8HA 1TJ4A 3L5KA 4BX0A 3E84A 5AM4A 2ZBEA 3UMBA 2C88A 3R4CA 4FE3A 1VFPA 1Z4IA 4AP9A 2D2VA 1TJ3A 4UM7A 2NO4A 3WK5A 3ZX5A 2FUEA 3QUTA 2EAUA 5AK3A 4ZEXA 1RKUA 3I1YA 5AK6A 1Z4PX 1U7PA 2W11A 3NASA 1RDFA 1RMTA 3W5AA 2NO5A 1XPJA 5ALJA 4NAVA 2P27A 1Z4NA 1Z4QA 5AKKA 4J03A 1L7MA 3QNMA 1FEZA 2I54A 3ZVMA 4BNDA 2R8ZA 1Z88A 2ZBFA 4OCZA 2B1QA 5AM2A 1AQ6A 5ALOA 2G0AA 1F5SA 3N07A 3GYGA 2W43A 1NNLA 1RLTA 2WF9A 3KBBA 3KD3A 4E88A 3AR3A 3IRUA 4CF4A 3AR4A 4UATA 3KZXA 5AKLA 2RARA 1QQ6A 2YFYA 3L8EA 2C4NA 1L6RA 1ZD5A 4UMVA 4UU1A 3U19A 4UM5A 3AR5A 2I7DA 4DWOA 3L7YA 2IOHA 1KYTA 2WF7A 5AKIA 4Y2QA 4FYPA 4I9FA 5AVVA 1WVIA 2BDEA 3QUBA 3ZWDA 5ALLA 4BYGA 2HI0A 2B82A 1ZD2P 3DV9A 1PW5A 4DW8A 2AH5A 2G07A 2IOFK 4YIKA 2GHTA 1ZD4A 2G06A 2HEGA 3FVVA 3W5DA 3NANA 4CNQA 3B8EA 2AGVA 3ZWKA 2FEAA 3OCVA 2WF6A 4AS2A 3E58A 3ET5A 3OPXA 4C4RA 5AI4A 5AW4A 3SKYA 4G9BA 4BNDB 3R09A 5ALHA 2R8EA 1Z4OA 5A3SA 1JUDA 3ZW7A 2HX1A 4YGYA 2FPSA 3ET4A 4XE5A 3QUCA 5AW9A 2HO4A 4AS3A 5AW8A 4NV0A 2JAOA 2ZXEA 1Q92A 2HF2A 2HDOA 2HF7A 2YJ6A 4Y2TA 2HCFA 3K1ZA 4L6AA 3IJ5A 1RKQA 4FFDA 3KC2A 5AW3A 3U7HB 5AK5A 1QQ5A 3B9BA 3NRJA 1ZRNA 1QH9A 1N8NA 5AKGA 4UMEA 4Y2RA 5AHXA 3I28A 5ALSA 5AW5A 5ALQA 3KDPA 5IS2A 2PR7A 1L7NA 1Z5GA 2JGAA 5AKHA 3OCUA 1VJRA 3L1UA 2MU1A 3N28A 4Y2JA 1K1EA 2CFRA 2OM6A 2RB5A 3NAMA 2YMQA 4IFTA 2CN1A 4HAIA 2JARA 5A3QA 3UMGA 2DQSA 2O9JA 1Z4MA 4Y2YA 4GIBA 5ALTA 2YJ5A 2GMWA 5ALXA 3WGVA 3FPBA 2B8EA 5AI0A 1S2OA 3NIWA 3OCXA 2ZBGA 2RAVA 2OYCA 4OFZA 5AW6A 4HGPA 4YIHA 1YMQA 1SWVA 1IWOA 3EWIA 4DFDA 2R8YA 3W5CA 4Y2XA 2NYVA 3KOOA 4NABA 4ZEWA 3L0BA 3I76A 5E0OA 1NRWA 1LVHA 4KNWA 3EPRA 3WK7A 4OD0A 1L7OA 1U2SA 2JAUA 3RF6A 3L8FA 4UW9A 4I9GA 4F72A 4HGNA 5AW7A 1TJ5A 4UMDA 5AK4A 2B1RA 3S6JA 5ALZA 4EEKA 3I6BA 3WKBA 3QX7A 2HOQA 5IT4A 4CF5A 3BA6A 4NWIA 5AVTA 2WFAA 3A1CA 2GHQA 3ZU6A 3MPOA 4Y2VA 1EK1A 4CF3A 3CNHA 1CR6A 1Z4LA 2HHLA 3U7GA 3SKXA 1T5TA 2R8XA 4BKMA 3B9RA 3FGOA 4Y2PA 4O8CA 5T41A 2P11A 3WKEA 3FPSA 4RETA 1U02A 1MH9A 1ZOLA 2YN4A 2YBDA 5AVXA 1ZS9A 2WHEA 4H1WA 3MC1A 3ZTYA 1RLMA 2X4DA 4KN8A 4UMFA 3U13A 4BEVA 1U7OA 5ALVA 4OHFA 3WK9A 2Q4TA 2ODAA 3M1YA 3QU4A 3UM9A 5IT0A 3RFUA 1RLOA 1Z5UA 1ZD3A 1RQNA 4HYTA 5ALEA 2GFHA 2WF5A 3A1EA 2OA0A 3HLTA 1WZCA 1YS9A 3EF0A 3SMVA 2PQ0A 4JDPA 4C4TA 3E8MA 3U26A 3NALA 3VAYA 1RMYA 1YV9A 2RBKA 3WKDA 1ZRMA 3ZTWA 4J2TA 3ESQA 3R9KA 3QGMA 2P69A 4Y3UA 1RQLA 3QU7A 5ALPA 5AVUA 5ALIA 5ALGA 5AVSA 2B8JA 3WK6A 3FM9A 5AESA 4C4SA 4QJBA 3E81A 1XP5A 1Z4KA 2CFSA 3A1DA 3DAOA 2FPRA 5AI8A 2O2XA 3OCWA 3L0YA 2IA5A 2FPWA 4MUMA 4XQ0A 2G09A 3AR2A 4YCMA 2I33A 5AKYA 3ED5A 3WGUA 3DNPA 2Q4RA 2IOFA 4BEWA 4UASA 3FZQA 3QU9A 2AUTA
chains in the Genus database with same CATH superfamily
1N3LA 3R6DA 4WKCA 5DSZA 1JE0A 3D6AA 2XIQA 3KYIB 4R4JA 4G4GA 4BX8A 1PR6A 5BRAA 1A27A 4YV2A 1VCHA 4BGDA 3PXXA 2XR1A 4WESA 1KYVA 4N12A 4IFIA 2J7KA 4XIIA 1FP2A 2R96A 1MNQA 3AI7A 5COAA 3OPQA 4BRWA 3A9RA 3PDIB 4BFTA 3L9XA 4A8HA 4BQRA 4EG6A 2CUNA 1NMSA 1YZQA 3IXLA 3G8AA 4YNBA 4URYR 1J0EA 2WKSA 3HABA 5FNVA 2QMYA 1EJBA 1N2IA 1XHFA 3WRXA 4BPRA 2B0CA 3HXOA 5DWDA 1BDBA 4R9UC 1D0VA 4PX5A 3SEAA 1FDIA 1SVLA 3BMCB 3GWGA 3O9MA 4D2IA 1KZHA 2DSTA 1V2GA 2CMKA 1SQ0A 1GPUA 5JAHA 1L4LA 2JLQA 3L7IA 3GVPA 3BK1A 1WDLA 2OQRA 5FI5A 1RVV1 1QIKA 1CR1A 4HVTA 5FL7A 4CL3A 2RMKA 1P1CA 1YASA 3QVWA 4AKEA 3OJEA 5F4ZA 3QSYA 2O3RA 1E4YA 2WEKA 3DZFA 4OH1A 3RAGA 3VHQA 1FSSA 5DEOA 4F92B 5DTJA 5JPCA 5HJEA 3SP1A 1BE6A 1NJ5A 2NTJA 3G2KA 4LOKA 1K8ZB 2AFVA 1A4XA 2G0NA 2ZRJA 3GUHA 1B73A 4PHGA 2Q0QA 5I47A 4K3UA 5IU6A 2YWEA 3WYCA 1OU0A 4CV3A 1YACA 1TX4B 2XT0A 1K5HA 3HB1A 3JYPA 2H7CA 4J4BA 4WBNB 1KNQA 4HNRA 4WFJA 3WJ2A 4TQGA 1CY0A 2ECQA 2C3YA 4KNVA 4ZZ2A 4ENWA 2HMVA 5G0WA 5I7EA 4ZEVA 2QTVA 4BKQA 4YAIA 3IDZA 2XB6A 3D3QA 4LHEA 5IJZA 4E2ZA 4BBJA 3U3ZA 1GNTA 2LE0A 3LCRA 4JMPA 4G23A 4R1PA 4M2LA 2ZU6A 3OZTA 3LUCA 4HSEA 3WNVA 3AEUB 5TJ9A 4IDQA 1G8FA 3IBFA 1I6MA 2SECE 3LC1O 2UXCB 4C7KA 2C59A 2IITA 5B2ZA 3MGKA 3WLPA 3H1PA 2IUUA 5KPDA 1CUAA 3FPCA 4MCIA 1NY5A 3BMNA 4P83A 1NZFA 1M6WA 2YVLA 4PYMA 4XOIA 2WJPA 5CX1A 4B7XA 1LSOA 4B48A 1P2VA 3Q0IA 2X5JO 5HX7A 2XPCA 1H69A 3IMEA 4KLAA 3DGEC 3SZLA 2YZMA 3TI9A 4EKIA 2Q0XA 1BVUA 3AFOA 1K5PA 3QXSA 4Q4JB 4TMKA 4UU7A 5EZ6B 1Q3HA 1I1NA 1QIJA 4NYIQ 1I3LA 3C8HA 1YH3A 1DKNA 4X71A 2IUYA 4DA0A 2H18A 1F17A 4YAKA 2RJNA 3JALA 5LQNA 1T36B 2RHOA 1KFJB 3C5EA 3E53A 1MT3A 4XOUA 3SC3A 1APBA 2WHPB 3ZQJA 5KVAA 1FRZA 1PL0A 3GEGA 1W4AA 2D1TA 2XCUA 5FWDA 3HJBA 1VKRA 3UATA 1FCJA 1MT0A 4RSRA 1T24A 2IELA 5KU1A 4IVRA 1JR4A 3R6WA 3GJQA 3MQ2A 5HMLA 2FZ5A 1SZPA 1DBPA 1I8TA 1PG0A 1Y8AA 5TGZA 1JI3A 4EHBA 3D0QA 2O8CB 2YVAA 1OFVA 3L0ZA 4KPFC 3TSOA 2HO5A 4DQUA 5IJ9B 1UODA 1L4MA 2HA0A 2D3TA 3RHFA 4ZAWA 1NPDA 1YONA 4EW1A 4JEIA 3BBLA 2YNMD 4KXQA 3FDXA 4JLSA 1N5RA 4TMYA 2V4UA 1QB7A 4J7AA 4H3SA 3GGCA 5AI6A 5E1DA 3E35A 1Z8HA 1IK6A 1PL6A 2CYAA 3AB8A 3PC3A 3P9SA 1C3LA 4WN9B 5G3ZA 3P9YA 5AICA 5TMDA 5TMBA 1N9KA 2AL7A 4DB4A 2GDJA 4EMSA 4LNHA 3HYRA 1XZJA 2CL7X 1EFUA 2B1IA 3PZRA 1M0TA 2LKCA 3PDWA 1KQ3A 1NM5A 3ABRB 3EMVA 2IS1A 1YJ5A 1W2HA 1QGUB 4GPEA 1CJKC 1IBSA 1YNSA 4PPYA 4AS1A 2Z8ZA 2WV9A 3HGQA 2BMWA 2AG5A 2NNLD 3GPBA 5DH9A 1NXPA 1JQJC 2XOEA 3A37A 2H16A 1ACMA 1KMIY 2KS6A 5EZYB 1E7RA 4CZ2A 3VV2A 2D13A 1BWRA 1CKEA 1JKMA 1FTWA 2VDMB 1VHDA 1MAVA 2ZYSA 4P93A 3SEZA 4L0QA 3SC2A 3BVPA 3EZ6A 3KZVA 1T8WA 2HF8A 3IVRA 4R84A 5ED4A 1YTLA 4TTVA 4CRWB 5G1PA 3AK4A 3VSEA 8MHTA 4GKJB 2VKQA 3ONNA 1P80A 1XDGA 4FOOA 4L3VA 1IUNA 2Z5GA 2ZWIA 2XNDD 2VSQA 1AGXA 4IIVA 4WV3A 5CB4B 3KELA 5K01A 1NUQA 1MX9A 1GPH1 1AXEA 4GLOA 1QAMA 1QH0A 4IMRA 2IV7A 4MUBA 1WF6A 4LJ8A 1Z0SA 1TCVA 2GAAA 4GI7A 1TDJA 1QK5A 4RIEA 5KYXB 1YFLA 2PZEA 4MLDA 4CM8A 1TJ3A 3HBAA 3ITDA 4ZKDA 5K8LA 4ER3A 3PXDA 3D43A 3H1AA 3IR5A 5DSXA 5A9SB 5B57C 3SJZA 4E21A 2DPGA 3WL3A 1GAQA 3EH2A 2RGGA 3ZXSA 3KUDA 1UIRA 5AK3A 1FSZA 3UB2A 2QDKA 3PR3A 1G8GA 1Z4PX 5EHQA 4PE5B 2IZOA 1KP2A 2UZ1A 2WYWA 3IAS6 2QTBA 3RU3A 4A8JC 3EIFA 5K0FA 4LF6B 3P2MA 1FFAA 1Y3HA 4D8XA 2OPHA 3O4VA 3ILVA 1TAGA 5FWNA 1JIVA 4I0WB 4MMZB 1PO7A 3IEIA 4YCBA 1EDBA 1U8ZA 2HMUA 1EFPB 1EGMB 2A0XA 1HLDA 3AOEA 4AF8A 9LDBA 3D2BA 2WUWE 1UJMA 2H7YA 1EJ2A 2G77B 2WNIA 2C29D 3BMOA 3DAGA 5CPFA 5T8KC 1JG4A 4Q6WA 1SC1A 4ETNA 3ND7A 3PIIA 4G8BA 2FZKA 1UJ5A 1W8DA 2WUFA 1IMJA 2ZBFA 3DEFA 1UT5A 4H1VA 2W2LD 4OCZA 1K6IA 2B8NA 1KE2A 3ZXIA 3ANNA 3PF9A 3W9UA 4Z2AA 3OD1A 4AN0A 3TSWA 3ZV6A 4HLNA 5EFOA 3F4KA 1OZGA 1UOQA 4MQ4A 3VHRA 1T2FA 1W5FA 3FCYA 1JHYA 3RS8A 4HXYA 1O9GA 4KSCA 5G41A 3T35A 1TUEA 1UBGA 2ADOA 2ONZA 2CCJA 4HS4A 3V2HA 1R64A 3BD6A 3NBZC 3IXQA 3QI2A 4DMUB 1XK6A 4ZJPA 5EP1A 3WRYC 2IEZA 2O3SA 1WCWA 2RK6A 4EZBA 5KOYA 1II9A 2QVBA 3X1ZA 3WB1A 3OZFA 3WGZA 4F46A 3FTPA 2A1UA 2OM2A 3K70B 1KSFX 4TTRA 3V46A 4AG5A 4E2YA 2XTNA 4KZKA 3V2IA 1I6KA 3L7YA 2JIOA 1EFVA 2V3WA 4R1MA 4ZAYA 1M1UA 2VUTA 4HMPA 4KWCA 4OOEA 5DO9A 3IALA 4QDZA 3DQZA 1V2HE 2G5GX 5ERGB 5I7RA 3BCUA 1FFSA 5B3JC 1XSEA 3FR7A 4MGKR 4RD6A 5A62A 4KQHA 1ZCZA 1Z28A 2JGFA 1DX4A 3GPDG 1F20A 4DW8A 4XYLA 2J7PA 4MEBA 1GG9A 3FUVA 4YQZA 1Q0LA 1Y7PA 3WL5A 1P1FA 4WKNA 4D3XA 2D2FA 2APJA 4IDOA 2QQGA 3CF6R 3D4IA 3KR2A 1QGAA 1ECLA 5TPZD 3FTEA 3PU6A 2D0PB 1ESDA 1FTQA 5AQEA 4RC9A 4IEIA 1LV8A 2V8BA 4RPLA 4ZCPA 1OI3A 2YYZA 5E7MA 1U0FA 3AGQA 3SIXA 4HYEA 1YQWA 2YHAA 1YF3A 3ANTA 3LBFA 4KQIA 5BN3A 2ISCA 2ZRCA 3BHJA 2XGGA 3IUJA 3PGMA 4J0JA 5DB4A 3VNSA 4NJEB 4F6RB 4WASA 3NKVA 5I6DA 4NU8X 5BOSB 2X6QA 2UUBB 3IEKA 1UBRS 1YC5A 3TSAA 2I76A 1ZGHA 3F8WA 4U5QA 1U28A 4ENVA 4EMBA 2PLFA 3FZNA 3CT4A 2RGWA 4ZO6A 2GF9A 5ALHA 1SXPA 1BROA 3DWEX 3FGPA 1K66A 4OH7A 2XHEA 3SHWA 1BWQA 5IKOA 4UKDA 2FPSA 2X7XA 3BGOS 1IBMB 3JQDA 4IGEA 1Q6YA 4CTOA 2VK8A 2WJVA 3K7EA 3H86A 1U11A 2FPGA 2O5VA 4GX5A 4MRNA 4BCDA 4MAAA 4O4HA 5DNWA 1VE3A 1I9CA 2ZYWX 4CMIA 2DUWA 3FWPA 1BEZA 1RD4A 4MLCA 3MZ0A 3ECSA 2NZUG 4YRCA 1AXGA 3DDOA 4UREA 1L4UA 2I8CA 5JSZA 2RI6A 1TC1A 1VP3A 1WULS 2O4CA 1PQYA 4OYHA 4QTZA 1XMXA 4WERA 5DX8A 4B2IA 4YUWA 3HXKA 4FWIB 5EZ5A 3I61A 3TFOA 4GUDA 4PYLA 4UU8A 5D3ZA 8GPBA 4L2IA 4YJKA 3UF0A 5BYKA 4JP3A 1CUVA 4EJSB 3A6FA 1WLYA 4N0MA 2WSIA 4Q9IA 3ROTA 3UT5A 1WQ4A 3SSNA 4MUHA 2A4MA 3I28A 2PU5A 4W1QA 3R74A 3ICQB 4R3UC 1OASA 5BORA 4PO9A 5CHEA 1JR3E 5CPBA 1EZ4A 1DIOB 1GQYA 1UL1X 1QPBA 3K0HA 1NR7A 5BMVF 1UBHS 5CCBA 3FBGA 3O82A 5BQOA 1OROA 1LRKA 3UWOA 2O2ZA 3NAMA 5JCZA 2FFBA 5JD3A 2NXJA 3B36A 3DOEA 4UHCA 4WHMA 1IHYA 4HAIA 4JGBA 3UFXB 4Y2YA 3G5AA 2CK3A 4OUDA 5KVQA 3L82B 1ZNWA 2C5FA 3E0QA 2GMWA 1AK1A 1C8BA 3FPBA 3DQQA 4NH0A 4WCFB 5CJPA 4YAWA 5CT5A 1BU5A 4MR8B 3SLKA 2J9GA 1Y1QA 1KVTA 4HAOA 4WNIA 1H9CA 1RYDA 1YMQA 1CRQA 4B40A 3RNOA 4DUYB 3DJFA 3ZI0A 3TN7A 1PSWA 1R8SA 3JYNA 5JFTA 3WDSA 2QM8A 4H0NA 3VGJA 4DV5B 4JBLA 2XT6A 3SX0A 1CT9A 3HJNA 3QKUA 1G55A 1MG5A 2WLSA 5K3FA 4XVHA 2WM9B 1PD1A 2P6OA 5CRIA 3R5XA 6GPBA 4X20B 5LLTA 3BQ9A 2IXGA 1Q19A 3TW8B 2YZKA 4HWOA 2RE8A 2FNAA 3B60A 2ODBA 4WVLA 2QNBA 1YDMA 2AN9A 3S27A 4UW9A 2QAGC 4O3MA 5ADUS 1VLZA 4DRZA 5DXFA 4YMGA 3OVMA 3BTUA 2PPLA 4HG2A 1TJ5A 1FA9A 4N18A 4DS3A 3A9WA 3R0QA 2IX9A 1ZLYA 3D8HA 4IDDA 2VDWA 1H66A 1Z6AA 2JIRA 4O0LA 3J81k 2VHTA 2Q3EA 3KEGA 4J8PA 4CG3A 3MYYA 3QLUA 4R71A 2C4TA 3BZBA 3CCBA 1X80B 3JZFA 1KY5A 3LCUA 2QZ9A 5JAOA 4QAQA 1N0HA 1BHO1 2YDYA 1RWKA 4P22A 3S2UA 3NFRA 1J1ZA 1Z4LA 2QS9A 1PS8A 2RHCA 3B38A 3BWEA 5BYBA 4Y1FA 5FJJA 2OCYC 1QH8A 4LSZA 4C0SA 2WTNA 3Q7SA 4E22A 5CDGA 2CNOA 1E1CB 1XPUA 3ZK7A 3RSZA 5HS4A 4DLAA 2HSWA 1A88A 1JDUA 5LMUB 4NCIA 1FP1D 1Y8QB 1YRBA 2DPXA 5A4KA 1AKUA 4J16C 3KQMA 3O3NB 4KGVA 2CXOA 2G28A 3P9XA 2XT9A 4DCTA 3WMFA 2JD0A 3OP4A 4MWTA 3EXEB 2VT3A 4IQ4A 2YBDA 3KX2A 4CW7A 4M37A 4H1WA 2ZJYA 1QYCA 5F73A 2NIPA 1LS6A 3NLLA 4JYAB 3F96A 4JQCA 2ZS7A 2VTVA 3AOGA 2POCA 2JIZA 2P9EA 3SBDA 1GQ2A 4W99A 3UM9A 3N0VA 2FA9A 1U2RA 5BV0A 4N3GA 1KOJA 1UEJA 2NXCA 2VLBA 3SDZA 1L7RA 3UGKA 4B6FA 1TUBA 3GNSA 4CM7A 3L46A 3DKIA 1NVVR 1GTRA 3DZKA 3A1EA 3FI0A 2OA0A 3UXEA 1A9OA 3MS4A 3L3BA 3CWQA 3IRVA 4FHZA 4CLXA 3IJRA 3KDSE 5CVVA 1QH1A 1YJXA 1E1MA 3QA9A 5DNVA 2PSSA 1H3FA 1U1IA 2ZREA 2ZYIA 4TYMA 4ZOAA 2HU5A 3ID6C 5LWQA 4GWGA 3VH2A 1EUDB 2QX6A 3NHBA 2HGZA 4KFTA 2XADA 4FBMA 2E89A 2HRRA 5JRZA 3NETA 1W4ZA 2IZ0A 4QEKA 3ZY4A 4BNIA 3JZIA 4TLBA 2VCYA 1O3YA 3A1SA 3ZZ1A 2JA2A 1A7UA 1P7VA 1OI7A 2XUDA 2WD7A 3OUTA 1NXXA 4RIGA 2ODEA 3CR8A 4E5UA 4EBBA 4QJBA 5K8CA 4V0NA 2XEDA 5HQ3B 4RY2A 2GJSA 4F6CA 2W42A 4OSEA 5ED0A 1U9IC 4WOJA 2DCMA 5JMWA 1TL7C 1E6LA 1PGJA 1UT6A 4BGUA 1T4CB 1C2YA 2FK8A 1K6XA 3LXUX 2JFZA 3LCJA 4XQ0A 1JFFB 4IVNA 4BDSA 3E22A 3EPPA 1G60A 3I4FA 4IIXA 4OP1A 5B7GA 1Q7EA 3KPWA 2IE0A 5CFQA 3RPEA 4ROTA 4BMSA 3V2GA 2FE4A 1PR4A 1CUYA 2EF1A 1HTWA 2QX8A 2X77A 2PH3A 3PLNA 5EGNA 5JDCC 3LUHA 3M6AA 4PO3X 4ZFNA 2CT8A 5DTMA 4OHYA 1PW7A 3JWPA 5C7LO 2Y6UA 1UCFA 3M4ZA 4N6GA 1IZZA 3A6LA 5G2OA 2HWKA 2PAAA 4A1OA 3CVWA 1A97A 3O4HA 3RKRA 4DARA 2IKSA 5CA1B 3SZ3A 3HKDB 5F52A 1DVRA 4YXWA 4UZSA 2OGTA 3LCMA 3MAGA 3QXGA 1VXOA 2C5LA 1M9NA 1AQUA 3MQFA 4FNOA 4UUPA 4L28A 5JNVA 1T5SA 1II8B 3LUGA 4Z1OA 2HIMA 4M88A 4X5OA 4X8OA 2ZRFA 4UCWA 1IU9A 5YASA 4BO1A 4P0PB 3AVYA 1P2TA 3I62A 3LVFO 3O3CA 5B3JA 1P39A 4R1SA 3KCQA 2B3DA 4LYFA 2D4HA 1Z0JA 1CW2B 1PP4A 2A9QA 3HCCA 1VBFA 4TV8F 2Y92A 4KMSA 5EKXA 5ES3A 1KVQA 2JH8A 3ZE7A 2ZYVX 4FFLA 2A88A 3BJEA 4R81A 2VP2A 5F64A 2NVUB 4HDOB 4JASB 3HL4A 5AXAA 2C99A 4Q4DA 3U7JA 2X0JA 1WJGA 2DLNA 2FCRA 3CSSA 3GLIA 3VZSA 1OFHA 1ODKA 4LWZA 5I9BA 2JJ2D 4JLBA 3TO5A 1QV6A 2PXCA 4W5QA 1CUSA 2V7EA 4HDQB 2D74A 2XTMA 3LW7A 2IHZA 3E70C 4XARA 1IATA 5FQOA 1AS2A 1CNEA 3ROFA 2GCOB 2ANBA 4IWNA 2Y1OA 4A2WA 2WJWA 1EINA 2XV1A 4Z99A 2GLXA 5TARA 4EDHA 3I2KA 2VYVD 2BM0A 3WKAA 1PZGA 2J0EA 3K0EA 2J4CA 3RGGA 1XK7A 1EBFA 3AXSA 3MN1A 4JJ7A 5HE9A 4LBVA 4DF3A 4F3NA 2Q62A 2I78A 1ZVJA 3BL5A 4C87A 2FP4A 3WADA 2IU3A 3R41A 1GGEA 4GC9A 4KRYA 3CLTD 4G1VA 1ZH2A 1E32A 4Z0HO 2C83A 3F78A 5EPOA 1IPEA 3CLTC 5FR2A 4EHKA 1TAUA 4EG1A 3FCUB 2R47A 1UXGA 2JRCA 2QRVA 3IELA 3QRWA 4RH1A 4NBUA 1EVIA 3F98A 4XFDA 1JZSA 3DEAA 5AKEA 5A6SB 3TLGA 1M1NA 3GO4A 3EEQA 4TTAA 2QM0A 3SC4A 4OP3A 1JG2A 4M8IA 4G5YA 1L8QA 5T4HA 3JW8A 1BAPA 1KGSA 1YZUA 4OHXA 1JPNA 1UINA 4O33A 3UBMA 1E2GA 1FJHA 3IJPA 1N5IA 2KHZA 3GT0A 3B13B 1U3DA 3QYFA 4GOOD 5AW0A 1MAUA 4NL4H 1NF2A 5D2CA 1RAIA 3O38A 3GFPA 1QTRA 3TB6A 4B45A 4CDMA 3LHSA 4ON9A 1A9PA 2G1PA 1KJ8A 1T2NA 3H5TA 5FUVA 5AOBA 3VAAA 1SUWA 1MVLA 2PBLA 1VQ1A 2E4UA 3RVMA 1BYIA 3SY8A 3UA3A 5L8VA 3EPKA 3SQWA 1WRBA 1K68A 1NVTA 1ZK3A 2QR3A 3EODA 4YMHA 5HGJA 5JY6A 3D1LA 2NU7A 3UHPA 1U0SY 2JCGA 5HTKA 1KSJA 3USES 4YPVA 1OI4A 1XN4A 1ZN9A 4M1SA 1KEWA 2EZTA 3M6LA 4TQ9A 3N05A 3O6VA 2BGJA 3B7WA 2HF9A 3HUFA 5DDIP 3W5UA 3VBCA 4RJJA 2XE7A 3GOHA 1BQ4A 3RODA 1OVGA 1BXKA 3SXJA 2ZSKA 4J7UA 4OQPA 1A8QA 4E0BA 4F04A 2QBYB 1PWYE 5BN5A 1U8TA 4RAOA 3K70D 4JJGA 4HX5A 3MOSA 3S2IA 1N5OX 5CHYA 3GFFA 3HEAA 4OXYA 3LFHA 2R84A 3WISA 2IBTA 1V41E 4LTNA 1UWLA 3DM5A 1F6WA 5IUJC 1FW6A 1FYVA 1HC7A 2ZE6A 5ALWA 3ST7A 2OLKA 4Q00A 1XQVA 3DOUA 4IQ0A 4PGMA 4Y2UA 3R7FA 2J0SA 3IP6A 4JKYA 1CFJA 1HYHA 2ERXA 4K05A 3TEMA 5EWLB 4YMVA 3GZ4A 3FMPB 4I1SA 1HE4A 4KIUA 2A9KA 2Q5QA 3Q9NA 2CVPA 2Q0SA 5BMVA 2F9LA 2PWPA 1KBZA 2GD0A 1GNVA 2CJXA 1GOTA 3CH5A 1W73A 2WWTA 2E55A 1MOQA 5E3JA 1DADA 4MV8A 3P9IA 4P1ZA 4KOAA 5C7YA 1KPGA 4UVHA 2W6CX 1Z7WA 2R8OA 2A3NA 3K0CA 3UMBA 1AS3A 5KQLA 4PZCA 1VMEA 1V71A 3PQ4A 3UMRA 1OCEA 4AMGA 2XCRB 3QBTA 5BR7A 1EVQA 1FFWA 1X1EA 1KKMA 3L8CA 1T9GR 4NDZA 4OFBA 4Z8YA 2DMRA 4NAHA 5ICMA 4UXIA 4E31A 4UM7A 1KO1A 4B6QA 5KC8A 3ZX5A 1IN8A 4LDJA 4MPRA 4Z4HA 3AF0A 2ZAGA 3SPXA 1HEYA 2VNIA 4LN1A 4EY6A 3NASA 4CIXA 5EWJA 3HWX1 3L4BC 3RAEC 3FWNA 3IILA 1JDVA 1JDSA 2P9QA 2ZJ6A 2Q1XA 2JI8A 4JSTA 3QX3A 2ORED 2A0WA 5IF9A 1H5UA 2J46A 5T64A 1HYQA 5BWCA 1D2HA 3LUDA 4XRGA 4M36A 1LJLA 3NUGA 5KJ6A 2QTRA 3Q41A 4ZVOA 2PVSA 1VSTA 4Q9AA 1IQ0A 1ID8A 5CCXA 2CLEB 5HF6A 4IMPA 3OURA 1PYGA 1SVNA 5EJ2A 2P9BA 3ASUA 4PLPA 2ZIVB 3KK0A 1GLGA 4NBVA 5EWMA 2IW3A 2I9PA 3Q8XB 3AJDA 1YQTA 3D54D 3N07A 3EUAA 4ZAGA 1UM8A 4GP9A 3JQGA 3OEHD 2OSBA 3EFEA 3AJ9A 3QVOA 3A1UA 3C8ZA 5KSYA 1FUIA 3BCHA 5HKKA 2GXQA 1FFXA 2H85A 4UE2A 2AWNA 1QV7A 3I45A 1NLMA 2ZUTA 4BLQA 3GLFA 2C8VA 1NZDA 1MABA 3R9XA 5TX7A 1TK2A 2AMLA 2GJ9A 2A92A 2H9AA 5DHTA 2QRGA 3VNQA 5KB3A 4I66A 4F56A 1K6MA 1Y81A 2HDHA 3R20A 3SQDA 1PNOA 1LPNA 5JYDA 3R7AA 1ZITA 1M8KA 2FJUA 4ID9A 4UQOA 3TRDA 3B5IA 2XGOA 3H1BA 4PZLA 3PTZA 4HUJA 4AO8A 1NI5A 1KYTA 4KUGA 2NOAA 3LKDA 3NTLA 2AOVA 4K6CA 2BDEA 3FPFA 3R5TA 3RQIA 4Z4EA 2FJ0A 2HK6A 1UJNA 4KZPA 4MI3A 5TDHA 3LTNC 2RGAA 2VR1A 4G24A 4WLOA 3DVLA 3L2OB 4Z9BA 4MO9A 1GTJ1 4XWAA 1SFRA 2N1BA 3SR4A 4TS1A 3IAS1 1IEXA 1IJEA 1B8NA 2HWYA 2UUPA 1UPAA 4U8HA 2KX7A 4WW0A 3V4FA 4D9MA 2I1QA 2OD9A 2P1ZA 3MVEA 3OF5A 4P8RA 4U2CA 3TNJA 3GH1A 3PD0A 5DHAA 3U6KA 4MDFA 1QG0A 4FB5A 4XQCA 3G1WA 2IY7A 1OB5A 4GI5A 1GD1O 2BHNA 4UDXX 4ZO9A 2HTEA 2FWRA 2XVXA 3ZZ0A 4J0CA 2HLPA 4JHXA 1CZKA 1M54A 5FCDA 4A36A 3GRAA 2WAMA 3PNMA 4P2GA 4TV9F 2H48A 4XSHA 4ZT5A 2ZUFA 2H1OA 1GILA 1VRCA 2ONCA 3NW9A 4I55F 4QYIA 4XB2A 2FUKA 4Y9SA 4B3IA 3RVLA 2LWIA 3KT8A 3OIDA 3IVGA 2C2YA 1Y9EA 1K89A 1JUDA 4HDKA 3BGVA 3WGMA 2Z43A 3NWOA 3RS9A 4E1VA 2WMDA 1C5KA 2CLOB 2GWRA 1IHDA 2DHQA 2FN7A 2IEYA 3H2HA 3AIKA 3QUCA 1M72A 4N6NA 4XE5A 5LDHA 3AETA 4KQCA 4RKYA 5LYJF 1VBMA 5LDGA 1SVUA 4Y9RA 2QL9A 1KSHA 1MLDA 1H05A 3ICCA 4IO0A 1YA6A 3JD2A 4F06A 3QJGA 5IVDA 3DTVA 5KIAA 4P86A 2SNIE 4PG7A 3VHLB 4ZICA 2G9RA 1Q50A 3AFMA 3IEUA 3QZUA 3DULA 5GJVC 5I4CA 4NV3A 5K4HA 1GQRA 3F46A 3ZWQA 2HCBA 2G9QA 3AEZA 1CRLA 1RKXA 2Q9UA 3GGOA 5AW3A 3IR7A 5MFPA 2ZT6A 3QXHA 3AVXA 5A06A 1R3DA 3ANXA 3A1NA 3OFJA 5I8PA 4UVIA 1XHEA 3HKEA 2FR8C 3CW9A 2PZBA 3DHVA 1V8DA 1GAEO 4IJ6A 1UH5A 3CMCO 3FG9A 2JHGA 2Q9BA 2VSYA 4JYCA 5FBLB 4E6PA 4IUYA 1NVWQ 1D04A 3P26A 3EGVA 3KQKA 5DTIA 4YRBA 4BS9A 5LZ5A 5EP3A 1P45A 5KWSA 1LBQA 1O57A 3EGDB 1QG4A 4G0NA 4BZPA 1BN7A 4QUJA 3LPDA 3IMKA 5FNZA 3AYXB 1NBAA 2WFMA 3LIPA 4TV8A 3ZEIA 3MGAA 4ZDWA 5KDOA 1I5RA 1KO7A 3IPCA 5TQJA 4V2UA 1OR8A 3AVVA 3ASVA 2IHJA 3PUHA 1WCIA 3T9BA 1RLIA 4C5CA 4IKOA 1R10A 4J1SA 5A4AA 4MA4A 2COUA 1Y48E 4NICA 4BVFA 5EIEA 5KQMA 1LTHR 2WHRA 3PR2B 1M2KA 4KVFA 1LPBB 3IBCA 1NN3A 1OJLA 4LIPD 3AEQA 4AJ2A 3AHCA 2CDAA 3B1XA 4FYVA 3E7FA 1HOXA 4FW9A 1H2RS 4PLCA 2HNKA 5CA0B 3BB1A 1NKTA 3B5JA 5KJCA 3LRTA 4ZD6A 2CEAA 2OBMA 2P9CA 5FV4A 4RVDA 1MU0A 2YVKA 3EW7A 3UXMA 3VDQA 1PGQA 1GA6A 1VLLA 3AEKA 3PJEA 4WBSA 3ZGOA 4BKUA 1WPQA 3EPRA 4OKNA 4LJRA 5K1ZA 4Z7JA 3ENNA 2P6PA 4O02B 1VGVA 4TGLA 1CLEA 1K7SN 2JGIA 4ZYZA 4YR7A 2VHUA 3D8RA 1J24A 1U31A 4ENUA 2C7BA 2DE0X 4RTPA 2R3SA 1R0LA 3I6BA 1ZIYA 2PG3A 3QTTA 1ONSA 1UBEA 5TQ2A 1Z38A 2ECFA 2O23A 3ABZA 3C8UA 4WD3A 2Z6AA 1N1EA 4FZ3A 4G4JA 2IK8A 4RD4A 4EGAA 1Q7BA 4ZZ3A 4DLXA 4PFQA 3KHUA 3ONEA 1PR9A 5AXDA 1C7ZA 2Z56A 1VPEA 5FJIA 4CJXA 1S7GA 5B4TA 2AG1A 1F6BA 2CHFA 1NVBA 3DT9A 3QFTA 5DBEX 3WL4A 4CCWA 3SJ7A 5D5HA 3SSAA 2JEYA 3CW2A 4TVKA 2V98A 3JVIA 5LSAA 1P1HA 4BKMA 3HE3A 3DMFA 3HKCB 2WU1A 2W6MA 3KS9A 5J23A 4FINA 4JWKA 1VPTA 3KJGA 3LT2A 2FPPA 1X0VA 3PPIA 1MH9A 2OZKA 3GHHA 1Q5PA 4EFDA 1GTVA 3EXIB 1LDYA 2W6IA 1XRMA 1XWFA 3AB3A 4C6TB 5IJAA 3K9QO 4HKTA 2JFWA 2P9YA 4RXMA 3OM1A 4CG1A 4PF1A 3FDZA 4XEHA 3THOA 1ENYA 2C98A 4YYEA 2ID8A 3EUEA 1MCZA 3N74A 4BLRA 4F5DA 3GLHB 4IV8A 2AXNA 2PPVA 4NKRA 2ZVPX 3WK9A 3H2SA 5A0TA 5JQWA 3KHTA 1YRQA 1GNPA 2C94A 1TM4E 4F45A 3L92A 1ZD3A 4QIHA 2OKGA 2BEVA 1OI2A 2ZP1A 1E3WA 1ORWA 3OZBA 3TZ6A 3VYRB 1GYQA 3R6TA 1RXUA 3AY0A 5DBOA 1RQRA 3JV7A 4N8SA 5EP2A 2O0KA 1G8PA 2G72A 3ND8A 4YP6A 2WAYA 1XAJA 1GCIA 4C4TA 4EI7A 4CCYB 2DSNA 3KSBC 4FNAA 4EHAA 2C96A 3KEFA 1E2HA 1JHMA 4DIFA 1AGNA 2FU5C 2X8LA 4LPSA 2IXFA 2QYSA 4KUEA 3GMDA 2HC9A 2VH2A 1T2AA 3R9KA 4DC0A 3D7LA 2XUKA 4DMCA 5C8DA 3KETA 1HETA 1SB9A 1IWBB 2Z2XA 4IDBA 5ALGA 3NKFA 5I8WA 3SDSA 1I4OA 1TM1E 4UVEA 2PQMA 2VF8A 2ZUVA 1ODFA 2C8JA 2CFSA 1FJ2A 2O6HA 2F55A 3QMMA 3THWA 1PGPA 2AZMA 3WYFA 3Q7RA 3N6RA 3OAAD 4K9KA 4BB0A 3AIMA 1TRHA 1FSGA 2NUPA 2YXLA 3IIIA 3PA8A 3JD1A 4EA7A 3F97A 3QIVA 2DUJA 2I33A 3B3QA 2ZRKA 2C5SA 3DTTA 4GPZA 3D7MA 3W2GA 1GL3A 4KWHA 3W04A 3WL6A 2DHRA 1DQYA 1VE5A 3L7NA 4BEWA 1V9LA 6AT1A 1EFRD 2CXHA 3FLBA 1YUBA 3DCIA 4O2BB 1BXRA 2AUTA 2FFHA 2N0SA 3QU9A 3UUFA 1A5SB 1RPAA 2GYVA 3FYTA 4H9GA 3CE6A 3IMFA 2EGHA 2VEOA 3BIOA 3KL4A 4LRTB 5KSZA 4PC2A 4TLCA 1UDBA 1V45E 1XEWY 1OJ7A 2BLLA 2WWFA 2Y77A 2QLLA 2XWJI 1NUSA 1P2UA 3GCDA 1XJQA 1CRWG 1QO9A 3MFQA 3D1JA 4IPTA 5CXUA 3FN4A 2XNJA 4P84A 3INTA 2IYEA 1H4SA 1C1DA 1MORA 1RPNA 2OMEA 2ILVA 4OJYA 1V5IA 3VR3A 1JT2A 3SR0A 3N9IA 1JMVA 3IQGX 1TIPA 3TL2A 2ZR9A 3M9LA 5JI2E 5GZ3A 2C2WA 3FYCA 5DPMA 4PNHA 2F3SA 3TRFA 1T25A 4N47A 3I09A 1FU4A 4CIWA 4QT0A 1AMUA 3VKFA 3CINA 2C7QA 1VL6A 1P4GA 4L5AA 1U2DC 3NB0A 5JHHB 1Q2UA 4JA2A 1A8IA 1TMYA 3EVEA 2ZSHA 3IHLA 4JVLA 3A3YA 4OV6B 1HMYA 1GR1A 1ISSA 3L9WA 4FR0A 4HR7A 4KV7A 4YBZA 5MHTA 3JPYA 4CQLB 5TQ0A 4DV2B 4KREA 4X1KB 5CFPA 3NHPA 4GU5A 5GM2A 1PHPA 3OFSA 4EELA 1RKVA 1U6IA 1XNHA 2HGSA 4LDRA 1BHSA 1UK8A 3T61A 3AU9A 3E9NA 3W06A 5IXYA 1ZKDA 3DV0A 1K5GA 5ER6A 5D3MB 1D0SA 3GQVA 2G80A 1Z0ZA 2NO9A 4IYJA 1P4AA 2AEEA 5BSMA 1ZRSA 5U1PA 3T3GA 3HVIA 3CS3A 4Q3NA 4ZARA 3K1AB 3LI2A 2PNFA 3I5YA 1YUNA 2NYUA 1AB6A 3L4SO 1BQEA 1HRKA 2NAPA 1WHSB 2Q5EA 3S99A 3NDBB 3GJZA 2R62A 1TK9A 2Q7XA 3QLTA 4U6QA 3RTDA 1QQAA 2GPJA 2HT6A 1LZKA 4ZN6A 5I5GA 4MVJH 3W90A 2HHCA 3WB0A 1LVUA 1QHHA 1X1CA 4EUSA 3DL2A 3L6CA 3LOQA 4ND5A 2A14A 4TROA 5JALA 3KQPA 5H83A 3WLAA 4R01A 1HZJA 3OQ6A 3WIDA 2WSBA 2X0EA 1X7HA 2AD1A 3ZEAA 5A3RA 3O8CA 1EXWA 2E4WA 1UOEA 5D5QA 4BVEA 1H3NA 4H3VA 3C3YA 1ZM7A 2EW1A 4DLVA 1DAEA 1YVPA 4BASA 3MLEA 3Q6MA 2GAIA 1A1SA 1WZEA 2PJZA 4OG2A 1X87A 2GWHA 1CS0A 4TV9A 3U4MA 2WWGA 4WZ6A 2AXQA 1LSUA 4I55A 1E6WA 3TG2A 2IPXA 4O4LF 3TUIC 4B44A 1UFRA 1XRLA 2XMZA 5ELLA 3T1QA 1WCYA 3IOEA 3RABA 4X3OA 3TS1A 5HILA 2JAWA 3OIYA 3ZBUA 1CD5A 2VPTA 3VH4A 2QEQA 3CF2A 3C3EA 3ONVA 4H4EA 3GFBA 4LW8A 3TE6A 1XVVA 4HBZA 2P30A 4L72A 4MMYB 3VDXA 5D7NA 5DW0A 1NHWA 5LYJA 4BMOB 4BVLA 1LS1A 4KVAA 3CLHA 3HGTA 5FPQA 1WMDA 1JHVA 1WU8A 2ONYA 3LL7A 3LY7A 4RKWA 3NIBA 1JJFA 2DWOA 3F6BX 4KXLA 4XWOA 4K86A 5KYYB 1I7QB 1RWMA 2A9OA 4Q1EA 3O9VA 3U4AA 1I4WA 3THYB 1D8TA 4XQGA 5J2UA 2XMCA 1TKRA 3O1JC 3S55A 1FQOA 4Z0PA 3TZQA 1NMEA 1YMVA 2VJCA 1DDOA 3VR4D 1ESNA 2ZYGA 1OFTA 1KS2A 2X22A 2EARA 4HTAA 5GP1A 1NMZA 4B85A 1CNFA 1HLPA 1SUEA 3QOXA 4IF4A 1MX5A 4RDXA 1NN1A 3FBTA 3KU4A 2VPZA 5HJ7A 5I4IA 2VWGA 3K8ZA 1YSCA 3N3AC 2AJBA 1D2NA 1PNRA 3C4QA 5HEKA 3EXHA 4RHXA 1H8ED 2FFAA 4ERNA 1CUCA 3BTVA 3M4YA 3K0FA 4FDUA 4QFDA 2NO0A 4LGYA 4V24A 3SZOA 5JBNA 4NZNA 3RAFC 3HVUA 2HSJA 4M1WA 1O7JA 3HN2A 4LJ5A 5EQJB 1EAMA 4EYKA 1DAIA 4Q34A 2FOXA 5EKDA 4MYSA 4BMDA 4KXFB 2FF5A 4XSGA 1W36D 2YZ7A 3O2NA 3WXMA 2XDQB 4RZQA 1JHRA 4L07A 5DI9A 4E4RA 1JLSA 4CLDA 3HVKA 4L5CA 4Q6BA 4XD2A 5BT9A 1SC4A 2J3MA 1Z06A 3V5NA 1ZO8A 2GK7A 4QU8A 1H4QA 4LGVA 1FFBA 2QTNA 2TSYB 4O3FA 1SN7A 3IKJA 1VLVA 4C08A 1VB3A 2JGEA 2AYZA 2XWQA 3BIFA 4KXVA 1LC3A 1E2UA 2G4VA 2PWZA 5CJJA 5CMLA 4C7BA 2W2QA 3R7SA 3TOXA 3A14A 2JVKA 3MJDA 3IVCA 2EVWX 5KOIA 4FS8A 4TVSA 3QKRA 3W7VA 3H84A 2GAJA 1JR3A 3UJAA 1PQUA 1IN5A 2OAQ1 1XGKA 3OZDA 3CZ9A 3FSGA 4GQIA 4DHEA 2RH5A 1Z3CA 2OCIA 1L7MA 4EVRA 2ZE7A 4K9SA 1SAYA 2GBPA 1RBYA 2VTKA 1L8XA 3RKUA 3PTLA 1EFTA 4NP6A 4YCDA 1TKAA 2O2CA 5JAIA 4Q7EA 2OORC 2WUEA 5BSRA 4L22A 3ISVA 4IH4A 4R98A 4CQMA 3BEDA 1GZ3A 3OLVA 1VJ1A 3KD3A 3WHIA 2TS1A 3AR3A 3OLQA 1MDFA 5KYVA 5I7OA 4CKZA 1ES9A 3HSSA 2GN8A 2GZDA 4G85A 3HDHA 3GAMA 5KAMA 1D6JA 3A1FA 3UJ9A 3QMWA 2QZZA 5D51S 1QQ6A 1LNZA 3PFBA 1LUAA 3MS7A 2E87A 4F4UA 2OHHA 3H6GA 4QBIA 4BL5A 3CJQA 4CNBA 4G0UA 2G3YA 1W6UA 4WFKA 3P9ZA 3R4VA 5U4XA 3W6NA 4AWBA 4BQSA 1DIGA 2BMAA 3DSRA 4IILA 2C1XA 4RANA 5GVSA 4NATA 3UAOA 4F6LA 1VJDA 2QKYA 3VNBA 2QD1A 2Y1XA 2BAGA 3AUJB 3IVAA 4D80A 4K3VA 5HZMA 1KJWA 5EXTA 1BG6A 1CLUA 5FOUA 1KXJA 3M6UA 1F48A 4LX0A 1WXHA 1WOYA 3RBXA 4IH9A 1T8TA 2P7HA 1IBKB 1B00A 2CL5A 4L3WA 3S70A 1EVJA 5CTJA 3THSA 5CYGA 1MGOA 1NN5A 3P8ZA 4IIYA 3SHOA 2R1TA 4LZJA 4QQ8A 1J1UA 3U6BA 2L0XA 2F3UA 3LH5A 1R0KA 1JALA 3VM6A 2PE5A 5CLGA 4F8EA 5GAJA 3PX7A 1TCCA 1P0MA 1G5PA 3IV9A 1DQZA 1U80A 3PPXA 4GVXA 3L84A 2X3FA 4R9VA 4UHEA 5B7QA 4OLBA 5GGYA 3QLVA 3FFXA 3PNBA 5IAJA 3FZYA 1FY2A 1TGVA 1YS6A 4LMRA 4M1TA 4AJ1A 2Y93A 3CZMA 1J8QA 4I81A 1U2EA 4OBBA 4EITA 3EVGA 3OE5A 2FDXA 1EVLA 1FE8A 1MBZA 2BRUA 1VBKA 2AFIB 3L05A 4BVKA 1G98A 2CHVA 1W30A 2OR3A 4Y6PA 3ZE6A 1DGQA 2GN1A 4MQEB 3C3WA 2ZXFA 3VC7A 3T15A 4ZCIA 3GFQA 3AZOA 4XLZA 3SZMA 3OTGA 5HOQA 1OYOA 4PR0A 2R6HA 4LGCA 5GV8A 3OT1B 3CUEF 3MINB 2OOKA 2RH4A 4XEUA 2JFQA 3LBNA 1Z34A 5ANRB 4DJJA 1YR2A 2WU3A 5FUYA 3TZBA 1LKZA 2BBTA 5IJ0B 3DWIA 2XNKA 2HF7A 1V3VA 2F3RA 1ESMA 3A31A 4MS1B 5DW3A 2YJ6A 3ADBA 4WVFA 3GYBA 2C2OA 1NPTO 2QSZA 3HCWA 3QPAA 4XSVA 1M83A 1W29A 2G40A 2GS9A 2XOXA 1KF0A 5DISB 3NC4A 2ZWVA 1YHNA 3K1ZA 1MX1A 2AOWA 1RKQA 1BZYA 1MD9A 2K4MA 3A3KA 5LM3A 2HHJA 4GGOA 4HPXB 4HJXA 4KQGA 5DXJA 1GLVA 4D96A 3DAYA 3MNFA 1JZTA 1JBEA 3TIIA 2DLCX 5KJEA 2IF0A 3VNAA 2Y2UA 2JIQA 2PL9A 3PDCA 5ESRA 2EFHB 1Z83A 1XZLA 5HIMA 4Z0NA 5FV7A 4DCSA 4ZYYA 1KWGA 2ZZKA 4XTCS 5H3HA 5FUMA 1O4WA 2PDAA 3ZNQA 4RKFA 1G0OA 5HQTA 2XNHA 1W87A 4JIGA 4L9RA 2BUCA 3RARA 2K87A 3U62A 1B23P 3A28A 3L4EA 4E3WA 2CXRA 3EPJA 2AXEA 3N28A 1M7HA 4BNUA 1YZNA 1DO2A 1N92A 3DBHB 2RB5A 5HRAA 1LI4A 1SKAA 3EVNA 4NZPA 3U16A 2LZ0A 1A9XB 2WSSD 3AYZB 3UMGA 4YECA 4PGHA 3W5HA 3O8QB 4IUBS 4UM9B 2J5BA 5TR9A 3NIFB 4BNKA 1PEKE 3GJRA 1JNXX 5FFFA 3EGXB 4X3CA 5HTOA 1ICEA 4E5SA 5L4LA 4ZVVA 1V95A 3W3ZB 3HZZA 3BXOA 2GI4A 3EF3A 3L1HA 2DJ5A 1YE3A 3LTEA 4HGPA 4BV2A 5IYZB 5DLEA 1KRHA 1XYVA 3RSFA 2NYVA 3K73O 2J9FB 3S44A 5LJLA 4RYLA 3N8KA 4J9VA 4UCXA 4ZEOA 3JWEA 3O84A 4PAQA 4Z3DA 1XKXA 1CSEE 4NMMA 1TF2A 2Q8QA 3L0PA 3S81A 4HWSA 4P4GA 2QR2A 2HU2A 2VJLA 5K8JB 1DLJA 1CYEA 1KHHA 3U44A 2DUMA 3KUKA 5FA8A 1JBQA 3L8FA 1JMYA 2C00A 1ETHA 3LECA 4N3AA 5BR8B 1WBDA 1M66A 2Y2VA 1ZVQA 2NYRA 2ZT7A 1WMEA 3TSYA 5ILOA 3QX7A 5FBWB 5B1EA 1X0XA 4LI0A 3I9MA 3PQ7A 4V0ME 4EA8A 4ZCMA 2PGJA 3KZKA 4ZK2A 4NWIA 4WY5A 1OA1A 2QM3A 5I9MA 2ZRQA 3VYTB 5SV2A 3DEZA 1CFZA 3A1CA 1J2RA 3FSEA 3K8OE 5FPTA 3ZU6A 4CF3A 2V1UA 3WE7A 1IUOA 2NW6A 4KTTE 4ND8A 1KJJA 3PE6A 4QOGA 5AVOA 5HKOA 2XMRA 1OIXA 3DFIA 1UXKA 5DULA 2NUBA 1D2CA 1N1DA 3U2QA 3T9AA 3DOJA 4E2WA 2HJSA 3T99A 1H1DA 2ACWA 3ZU2A 3HY3A 4I36A 4Y2PA 4L4XA 4RH0A 4YRAA 5HP4A 2RHDA 5IK2D 1U0LA 3DEHA 4I50B 3RU2A 5EXPA 4CM9D 1JEQA 1JQAA 1QIIA 3D4PA 4O4LA 2RBEA 3WLJA 5C3MA 3CVXA 3O03A 2B20A 2HREA 2P9FA 2YV4A 3HXPA 5KYGA 1PAUA 1E99A 1ZS9A 4KW7A 4TSKA 1PZNA 2H31A 4HWKA 4IS2A 4C0AC 4EQ6A 1RXYA 2WSLA 4HH1A 5ILGA 5ALVA 1OBHA 1KJNA 1I32A 3U9LA 4D8WA 3FSRA 1MA3A 3DZIA 3KKPA 2FMFA 4V3CA 3PQDA 4EI2A 3JRWA 1XZQA 2YHUA 3FXAA 4KQ6A 4MJ7A 1A5AB 3R5SA 4MTLA 3A4TA 4JEHA 2AC7A 4MR9B 4DSTA 4QGBA 5FLKA 3TNLA 3S5UA 1GFSA 2WG0A 2GVNA 1M8PA 2ZRPA 3RYHB 1W7AA 1Q1EA 3K0AA 2GFQA 2YZNA 2ZI3A 2ZFUA 1P7PA 4H17A 1U0OC 1S9HA 3DUFA 4H7DA 4IUDS 4N7JA 3W4IA 3X43A 4UUMA 1XNQB 2V6BA 1I2BA 3G9TA 3JATA 1QIDA 3HCBA 4IJKA 3C97A 1Y6RA 5C1DA 3P9KA 4RFLA 3BCRA 3BF7A 1A72A 1CEXA 2HNBA 3CWZA 4NYJR 2ZSDA 4DDUA 3NHYA 4V1CA 5IDXA 4C7OB 2Q5FA 2ZBQA 2B94A 2HUPA 3IOYA 4KMMA 5CU7A 4M83A 3FCOA 1J2TA 3QGMA 2VXBA 3TQIA 3HHPA 4E46A 3QF4B 1IVSA 2RGNC 1DI0A 3VDRA 3B3JA 2GTHA 1E7YA 2ZEJA 3CURA 3FYHA 1JFLA 2B8JA 5EINA 1RCFA 1T5IA 5AVSA 2Q45A 1C81A 2Z8YM 5IF3A 4RMIA 2OAP1 1MENA 5AXBA 4KR9A 2FQXA 3E0XA 2BM1A 4EA9A 1T26A 2HMWA 2DHCA 5FBVB 3HDYA 2IA5A 2X5KO 1RJEA 2QT0A 1WKVA 1HL3A 2ZSFA 4WFQA 1XP8A 3CU5A 1FMFA 1WUYA 1H6BA 4PPGA 2WTBA 5LQSA 1ZH0A 3KV1A 3V7YA 2QQ0A 1NI4B 3DVAA 3FA2A 4G5SA 3L5OA 3QEOA 1Y5NA 4H59A 2XQJA 5KTYA 3OJOA 4QPCA 4ZU3A 5B1IA 3RBAA 4DCGA 4QPNA 3C41J 3ESRA 3BE6A 4QVGA 1JHAA 4MRAA 4NCBA 2ZULA 1WPRA 1TZ2A 1KS9A 4HQ6A 3EC2A 1MHTA 4EYGA 2AI1A 1X3LA 4ITRC 4DLKA 4N40A 1J23A 3PHBE 1O0SA 1ENPA 1A9TA 3R40A 5HF8A 2JCVA 2H2DA 1RRPA 1RAHA 5ULLA 1YQUA 2WB4A 2YY7A 4L0MA 4OQNA 1KYQA 1UPCA 1QCYA 1P9WA 3H75A 2X4LA 4KDRA 4KYIB 5KREA 2PTGA 4LNUA 4RA6B 5K3AA 2OXTA 4MHTA 2J6CA 2E18A 1L1FA 4C3VA 3CX3A 3RC1A 1O08A 3TR5A 2FHSA 2VSNA 2F48A 2YJ4A 4IG9A 1J2EA 1T5LA 2G5TA 2DG2A 1RAEA 4MRRA 2Q3LA 4L5JA 2KYRA 1IAQA 2O05A 2OC4A 4DPLA 1RM5A 2GBLC 4ZHQB 3KFLA 4LNAA 5CAEB 3IAEA 4G65A 3HHEA 1ZN2A 4HGZA 3PUJA 2ZUEA 2CY0A 1GFZA 1JIKA 3TKAA 2CVFA 2OPBA 3ETLA 4PFJA 1IY0A 3BEOA 4OAQA 3JSAA 5DYYA 1BEEA 2OO5C 2H63A 3QXJA 2E1RA 2VNSA 1Q1GA 1T3ZA 1U3CA 3P27A 1L5ZA 3DD5A 4ZV4A 4ZZIA 1IOVA 5AVYA 5JAUA 1XZDA 2H29A 3PUWA 2CE7A 2JIDA 3I6ZA 3HH8A 4QEZA 1HT1E 2B30A 4KLZA 4M89A 4WK4B 1HDGO 4TS9A 2WFLA 5CDFA 3RAJA 3ILXA 2H2IA 1DIBA 1FOEB 1VL1A 1EI9A 4IQGA 1QQTA 1KDZA 1BVHA 4HLDA 4I1PA 2HA2A 1JHPA 4DLZA 1KFCB 4YAJA 3WBJA 3D5EA 1WPGA 1H6CA 2DYKA 2XQKA 2IS4A 1G291 1Z6QA 5C8VA 1HY3A 3FPAA 1XEWX 1S4QA 3HS3A 3WDLA 2JCYA 2PANA 1EHCA 4EUNA 5JJBA 1LDNA 5FI0B 1SXJB 4KIWA 4LVCA 4MWEA 2BH9A 2KPOA 2DX7A 2YICA 3AVQA 2AQ8A 3HY6A 3U3RA 2F1OA 2VHQA 3K1TA 3DFFA 4W1RA 5K3SA 4QTYA 1E1RD 5F1PA 3EX7C 1VA4A 2J07A 3L7LA 4QPDA 2BPOA 5IM5A 3TTYA 2L19A 3I5AA 3OC0A 1ZJWA 2CMHA 4M0UA 1P9RA 1RJ9A 1YBMA 2C03A 3MJHA 5AOCA 1TLLA 3TQHA 2VF2A 3T7SA 4ETIA 1SHLA 4QUIA 5F2KA 4PN7A 1YDFA 4P53A 3C87A 1P72A 1PKXA 2Y8EA 5UKDA 2JH9A 4M7OA 3B51X 2YHIB 2BFBB 4EECA 3LC0A 3KJQA 2MSNA 3KIPA 3WLEA 2V7VA 2QP3A 1D4ZA 1NRXA 1NFFA 1STOA 2X86A 3CLUD 3BFPA 4M9UA 2NSDA 2QYHA 1GUYA 3UK6A 2Q2QA 3AZPA 2ZYHA 3CLUC 3IO3A 1GSAA 3MT8A 4PPFA 3R24A 4B82A 1GLNA 3AJ8A 3CUKA 1KO8A 2Q7OE 1OVMA 1RJWA 3U7QB 3RK0A 4HP8A 1UANA 4RD0A 4IX9A 3PTAA 2JDIA 2VYND 3KXKA 3H11A 3I6YA 4KK3A 2VQDA 1JP7A 2AYYA 1TT7A 2ZJ4A 3KPYA 4RCVA 3GFRA 5K51A 2GCEA 4HJRA 5HQJA 3J7AC 1AKNA 2ATEA 3AL2A 5EG5A 1PK8A 1ICIA 2EWVA 1BCRB 2QV0A 3I2GA 3PFIA 5CUQA 1GUZA 1J70A 1RC1A 2W2KA 2BELA 3AM5A 3I2JA 1HM5A 4JQSA 4BO7A 4YA6A 4BMYA 4CWAA 4CPDA 1B0PA 2Y3IA 3ZHUA 3FR8A 1UJ6A 3PE4A 1JHXA 2P77A 3KHSA 4P4TA 4UD2A 5EE5B 1QQ7A 2WUGA 1HTTA 3DD1A 3EZYA 2A0UA 2HSEA 2CNDA 1F8GA 1FNBA 2FB9A 3ROEA 3OOYA 5AVRA 2DH5A 3HBJA 3RJ9A 4ARAA 1VL0A 2Q21A 2FPIB 3OIGA 4PC6A 5CYPA 2OKCA 3M1LA 1KH1A 1PT6A 5TNXA 4D9GA 4ER6A 1OPXA 3OJXA 1ULAA 2Z5LA 4NBNA 3QUSA 5CVDA 3J81A 1JE1A 1Q0HA 5E6SA 1E2BA 1GQOA 4DWWA 4KV9A 4N3CA 1XCGB 3CBGA 4RV4A 2GXAA 2BH2A 1X9HA 5TV2A 1V1MB 1N32B 2PGLA 5JS6A 3EGWA 4YALA 1LWOA 4UTRA 4DSAA 1NAHA 1T15A 4N4AA 3TDMA 2A33A 4F4DA 1E18A 4MV4A 1KZ1A 2H17A 4GPAA 3EGOA 4P08A 3R9WA 1CQWA 5HOEA 1T2EA 3AUYA 2K5UA 2ZB2A 5CNKA 2BFFB 4FE7A 5JRDS 5A02A 5A0VA 1HV8A 1QGED 4TYPA 1NP7A 2BW0A 3PIRA 5AM4A 4HATA 3ZG6A 3ZDZB 3UVEA 4B0PA 1J9EA 4QJ5A 2MCFA 3ZHXA 5GIOE 3WRXC 4RVUA 4JHLA 4BV8A 5LMCA 1ZRHA 4CEJB 1B2LA 2D2VA 2E5WA 2HQBA 4AMBA 1IOZA 2AKYA 1GTZA 1TQ8A 4GGMX 4R2JA 4RLHA 3W8RA 5LZ9A 1EUCA 1MP0A 4ABTA 4ZTBA 2FSFA 2R0QC 1P7WA 1R6AA 2Y4NA 5BVHB 3P0IA 4KDFA 1U7PA 3L1KA 2WFZA 1QRUA 1X14A 5HWSA 3UC9A 3L8MA 4NEQA 2F6RA 3BT7A 2I3DA 2NZXA 1SIOA 4OEHA 2Q3DA 1KARA 3BM5A 1N6RA 1YU9A 1BJTA 3FCSB 2Z6VA 1YXMA 3QTBA 4ITVA 4KTVE 4MWBA 5LZ7A 2EW2A 1FZTA 4UHBA 2GLUA 3VPSA 1JYSA 4MW6A 3QNMA 3ZI7A 4Z9YA 5BW5A 5HK9A 1HR0B 4HVCA 1QKKA 3DG9A 3P7MA 1CDOA 4AJHA 4AKHA 4WH0A 1JAHA 4FMDF 5C18A 3CKYA 5CH5A 5HFNA 4ZI2A 4Y6QA 1Z17A 5AM2A 2PMFA 3W2IA 3HCOA 4PRYA 5EZQA 3D6NB 2C4KA 3QWBA 4OREX 1WV0A 3EVAA 2XVAA 4BKOA 1V1RA 3UGJA 3RVSA 2A67A 3U1TA 5ISMA 4V2IA 2VSOA 3A4YA 1XL0A 4MRSA 1B6TA 2H5JA 3Q3CA 2BMVA 3QELB 3AR4A 1SIBE 2B4QA 4AT1A 1AA6A 4NCNA 2O8BA 4GFDA 3CEPB 1FRFS 1PBNA 2ZTLA 3MJVA 4MTCA 5H7XA 3NV9A 4B76A 1FDVA 4FT4A 4L5IA 4KNYA 4MRMA 3VI4B 1XXLA 3VJKA 3FKSD 5FAKA 5JFGA 2IGBA 1XYGA 1T1EA 1P9OA 3GXBA 3RC3A 5HVNA 2Q46A 4AZ0B 2ENWA 2QL6A 2YWJA 3G9QA 4IHJB 1DHRA 4TTSA 3IP1A 4ALMA 4ED9A 1US8A 1IXRC 2Y4OA 4D6XA 4CIAA 4C3UA 4HEHA 4IMIB 4UM9D 3GDWA 3LO8A 1ZP6A 1JJ7A 2FLVA 2VQSA 2JANA 2Z2JA 3BXZA 1H6DA 3EC7A 4I9FA 3Q12A 4D7AA 1TYCA 3WB2A 2XB8A 3AY7A 4EO4A 1CQXA 1RHUA 1CUUA 1QFMA 1TZMA 4UUNA 4L74A 4DYDA 2AX4A 3OCJA 4BU0A 2F43A 3C6XA 4LCEA 1X7DA 4RGVA 5DVZA 4OQEA 3C74A 4LJAA 1ZN7A 4Q1VA 5HDQA 3EIOA 2UZ3A 2EF0A 2IHTA 1E6KA 2QNRA 3CKKA 4PXAA 1I36A 3WQHA 1WL8A 3WLTA 3VYUB 5E4TA 3FIUA 2P68A 1MH1A 4MYCA 3ETGA 3RTGA 2LD4A 1S3FA 3KVYA 4PSKA 1GWNA 3IUEA 1XVUA 1ULUA 4KGXA 3T1NA 3GFSA 4AS2A 2DKNA 1T3GA 2HDNB 2OHFA 1ODSA 1FP4A 2CMDA 1KEEB 4C4RA 3H9QA 4DEVA 3LFUA 1MJFA 2G8NA 4RFVA 3B3GA 1F9AA 2I03A 2PS1A 2Y05A 3HA2A 1P61B 3IIMA 4HZUB 4RE5A 4HPJB 3Q11A 1NM5C 3ZCUA 3H4MA 2ODTX 3LU1A 1D1QA 1V5WA 2I7CA 1NW5A 2R1VA 3LVQE 4Q7JB 2JGDA 3G6KA 3VKGA 4NJOA 3EYAA 5JBIA 2F8LA 4CI0B 2CHQA 3ET4A 1U8UA 4GR5A 1GG8A 1XTZA 5AW9A 1CX9B 1I4LD 5K0ZA 4UTXA 1JXAA 2PYZA 5DP1A 2DRIA 3TCKA 4C6SA 2C3PA 2PUWA 4JKOA 1JEJA 4NEHB 5D1HA 2FQQA 2F3QA 5DMXA 1CCWA 5A1TA 4JSRA 4DIOA 4MI6A 4IGKA 1ANKA 2PRIA 1EUZA 3ADDA 3B78A 1DAPA 1NASA 1NUHA 1M6VA 1SC9A 4OGLA 4RTJA 1P29A 3EPHA 1I0LA 1Z0FA 5GM1A 3RT7A 1XX6A 4HDCA 4QBGB 4ZDIA 2BGTA 3CT6A 4JP2A 4MW2A 1CBUA 1YQDA 5F5LA 1GARA 3H5WA 3NTRA 2XMQA 3U7HB 2MSEB 2ZAOA 3F6SA 3WSVA 3F3KA 4YREA 1ML3A 2CJYA 4F9FA 1VE9A 3LP5A 3MMPA 3AL3A 3LK7A 4OTZA 1ZRNA 3DP7A 3MCUA 5E7QA 1EVYA 1OIWA 2BEUB 4GLJA 2XXJA 5JD5A 1OAAA 1IJFA 1YUMA 4HRVA 3IDOA 3M89A 3PICA 5LD2C 3EFOB 3U4IA 1FTGA 3MRXA 5EJ8A 3HB9A 3DMPA 4YUAA 1WCV1 1D1PA 2JGAA 1OBFO 3Q3JB 1NFRA 4I5GA 1VJRA 1F2UB 2FCAA 4NRDA 4DMRA 1U0TA 2CMGA 3FHJA 4KAXA 1K1EA 1X86B 2BEJA 1EAYA 3G7SA 3N6XA 2UZAA 1JLKA 2XNDA 1CF2O 4ZJUA 2ENUA 4MV3A 5TVKA 2BFPA 2WWRA 3KJIA 5DYWA 4CIVA 4D3DA 2FK7A 4UOEA 1OWMA 1XLVA 4YC7A 3O8DA 2YJ5A 4WDRA 5ALXA 3VO2A 4QGAA 5IT5A 2W2OA 4N8DA 3ZHSA 3DOFA 1XA4A 4YRIA 2GT1A 2RAVA 2ACEA 2H1WA 5ERXA 1WB5A 2X23A 5JVDB 5AW6A 5I01A 3VYVA 2JPDA 3KVNA 2X4IA 4N3BA 3ZXXA 3CR7A 2FGJA 4YV7A 1UMKA 4K87A 2OP1A 4IEEA 5JMPA 5BWLA 2VJKA 4N7BA 4RTOA 4A8JA 3AKYA 3T7RA 3ZXUB 2QJTA 4RAQA 4U7WA 2SCUB 1BCSB 4OAOA 2W0SA 4ZRNA 1IJBA 1A4IA 1TIKA 4FHCA 5F9MA 2IWHA 4WGFA 5ICSA 1SA0B 5DNYB 5IXSA 4I08A 1KZ9A 4XW2A 3IOCA 1F9EA 1KTVA 3D3WA 5FQNA 1BX3A 5IULC 4HGNA 2VBFA 1E4EB 1I2DA 4HMOA 5F3DA 4QICA 3LC7O 4XDHA 4F8JA 5T8KA 2Q49A 2C82A 1T5BA 2Y9PB 2JKYA 3DZBA 5B12A 3JARA 4JWTA 4RY0A 1ABBA 4GPBA 4Z9AA 3K9WA 3WGGA 1DC6A 2W2LA 4I4CA 3DLAA 4GMDA 4CM4B 2P4SA 5IG2A 3DKPA 3UJBA 2BI4A 5KNCD 1G5RA 3OE4A 3SQLA 2YWGA 1XDUA 1YJBA 4XUDA 1MEOA 2CXPA 4RUKA 2PV7A 5JS8A 2Q6KA 5HFAA 4HDRA 5IDYA 3ZIUA 2YWFA 2O2GA 1HT3A 4M76B 3W3AH 4M6WB 3WRYA 4EW3A 4U2FA 4YUYA 1M5RA 5CB4F 1X1QA 1YAJA 2SKDA 2YN4A 3N7UA 4HS9A 4G1CA 4QGFA 2CDCA 4RE6A 3TW6A 1JQ3A 5EXXA 4D0RA 4W5JA 4RPCA 1XZBA 4PSVA 4RA9A 4URZR 4CFYA 3AT1A 3U4GA 5FWYA 3I8XA 4MJ3A 3ETNA 1XTIA 1QRSA 4KE8A 4X64B 4HAZA 3DZ8A 5BW8A 1QE3A 3DXFA 2VT7A 1XTQA 3D81A 1ACLA 3EXFA 2B4RO 3SIRA 4ACBA 3PFFA 4YJ3A 1E61A 3JQQA 4GM4A 3LRPA 3LWDA 1XWIA 4MGZR 4Q9JA 2IU6A 3CNQS 3GJYA 1WEKA 2J9RA 1T5HX 2H9IA 1T2VA 1N9GB 4G67A 2WA2A 4JB2A 3WNBA 4EP1A 3GN1A 1ZUNB 1RHMA 1TEXA 3TPCA 1PJTA 1UMBB 4OB6A 3BDAA 5E0KB 1GTSA 4KRXA 3RUHA 1TC2A 1UKBA 3P45A 1RFLA 2GZSA 3QLJA 3T7IA 5JLJA 3WTCA 4R8VA 4XIJA 3W1VA 3ISTA 4V3BA 5IAGA 1E0SA 3HDJA 2A84A 2E37A 4MPDA 2VUIB 4J2TA 3A4VA 4UULA 3SFVA 5JUWA 3IV6A 2ZE5A 3DCYA 2Z3ZA 1Y89A 2OGSA 1XDWA 4BAGA 5BV7A 5CNIA 1L4FA 1T2DA 4JXZA 4B3JA 1KI8A 4HXEB 1NI3A 2PFSA 1E4OA 1VMDA 1Z0AA 2QE6A 3K9NA 4UTOA 2ZUCA 4ZYTA 4EG7A 3MAAC 2QRZA 4QDJA 4LXQA 5CK5A 4PIMA 4IS3A 1FDTA 2OOSA 1Z29A 2GEFA 2GHRA 4PC3A 1I14A 4K9OA 1WSWA 3BWCA 1Q3KA 1KHTA 2D8MA 2G09A 2Z2IA 4GLFA 4U6NA 5KHOC 2WOOA 1YO6A 1R37A 2QHXA 3PCRB 3BQMB 3NIDB 3HDQA 4D9BA 2Q6LA 3MLAA 3RU9A 3UTCA 4FR2A 3VOBA 4UASA 4BZQA 3FOZA 3O4FA 2Y0CA 5AJVB 2CCKA 1Y0BA 3X1JA 4QLBA 1MV5A 2J85A 4FIZA 4H4DA 3T4EA 4DCOA 1T2UA 2TMYA 2XMGA 4KFUA 4BAZA 3A2NA 3PXEA 3UXHA 4C4OA 2QTAA 3TEFA 4DCMA 1XPRA 1N6LA 2FUNB 2JJMA 2QZ4A 5AJYA 4XUEA 3UGQA 5JCPA 1GPBA 3JYOA 1ISMA 3FMVA 1BX0A 2Z4TA 3VU8A 4ARBA 3DR5A 4CUKA 2DERA 2RKWA 2I6XA 4MINA 1TE2A 2C04A 4WADA 4IM7A 4YRPA 2PX8A 3WYNA 3PA6A 1UP7A 5CM8B 3IQIX 5ALUA 2GPAA 3WMEA 2BBSA 5C8XA 5DGDA 2WYHA 3IUQA 3R5FA 3R3JA 5LN1A 1B8VA 3N1UA 4H4CA 3VPHA 1BWPA 2IUFA 2CF5A 3TQRA 1QQBA 1V5GA 1ZI9A 3ACBA 1EM8B 5IAOA 4QSHA 2LR0A 3PNOA 1DRUA 1IOWA 4YAFA 4N6OA 2NTVA 4FKBA 3L1IA 4N1AA 3LE8A 5AJHA 2A5GA 4PLFA 2JLUA 2BJVA 1ZY2A 3IA2A 1G7CA 4AUNA 3EE6A 3OFND 1UFKA 1D7AA 1XQ9A 2F9MA 3EQ8A 4OHRA 4G1BA 3C39A 3DEIA 1W75A 4QL3A 3N2EA 4IDNA 5NLLA 4DLYA 4RHTA 5FPPA 4DRXA 5AI9A 4CM1A 2WVAA 1QRDA 3PC4A 3W2FA 4ZT3A 4JI7B 1UM9B 4BECA 3C2QA 1ZM2A 4JL5A 3RD5A 4I5EA 4XFKA 2VJAA 1L5KA 1W94A 4QPZA 5CEEA 1LX6A 3DHYA 4PBTA 2B4AA 4OHBA 3T4UA 4BQEA 1BGXT 1JQDA 1XALA 4A6PA 2C8KA 4L9SA 3AQ4A 3AR9A 2EX1A 1V39A 1H22A 2NV6A 3OZVA 4P9NA 1E0AA 3C1AA 5J63A 1ULSA 2R7NA 2UZIR 3EWNA 3GPCA 1KI1A 2QSUA 1USIA 2QAGA 2VNAA 3NHWA 4MVJM 3VHXB 2IHNA 2ZU0C 1QYRA 3SI7A 8AT1A 1FX0B 1E2FA 2J9YB 3OM0A 4GR4A 4C0HA 2F1KA 1GUFA 1INLA 2QRNA 4G5HA 2CVOA 4G0MA 4LRWA 4YAEA 4NYMQ 2PZFA 3PNYA 4DNOA 1DPFA 1O8CA 1OFGA 1NLFA 3B5EA 1SUAA 2A3RA 4IJ5A 4XR9A 2OQVA 3ZWOA 3WMGA 3MJRA 1AK2A 3TBHA 4RH3A 1ZIDA 3JRNA 2JAPA 3GJXC 1G2QA 3KTDA 1OH8A 1Y3DE 1CJCA 3CKLA 4DDTA 2P6RA 2NSLA 2PR2A 3F73A 1EEXB 3ZUGA 2LDBA 2LDXA 3LT4A 4KGZA 4C78A 3UQYS 2PIAA 4C01A 1YRWA 3OM9A 3E9QA 1R88A 1V6AA 4B5LA 3BS4A 1GU0A 2D5LA 2R7MA 2ZQZA 3I92A 4EY8A 1LZLA 4WEOA 2JZCA 2I6FA 4Q47A 1AG9A 4RGBA 5HUJA 3GG2A 2MMGA 1O95D 4Q82A 5AVWA 5AVQA 4ENRA 2XXBA 2GOYA 3SICE 2GASA 2ZTUA 4Z9XA 3TCXB 1DFHA 1Y3CE 4Z7OB 1EFHA 2D0IA 4YCAA 4AROA 3QHAA 1G17A 4XWGA 3SJAA 3V97A 4N76A 2V7PA 1JSCA 1SHKA 4YACA 4OBWA 3U0BA 2PRZA 2VP6A 4FDLA 4ER7A 5BWMA 1DX9A 1AZTA 2PXAA 5KOJB 1IN4A 2FFJA 3QWAA 1ONBA 1A5TA 3GUYA 1M10A 4PYJA 2VQFB 1C1XA 2GM9A 3LCCA 1AGPA 1P2SA 1RYMA 2WJYA 1EG7A 3H2KA 1UMDB 4IL5A 3T7KA 3EPLA 2IHBA 4OXXA 3RUIA 4RV9A 3B2EA 4OM7A 2GEUA 4KYTA 4F60A 3PGA1 3ZE0B 4I99A 4OGWA 1N2SA 5KUTA 1ZOSA 1IXYA 4MYDA 2QE7D 3O1HB 5LQRA 4GRDA 2HIGA 1KZ7B 1QIGA 2DTEA 3B6EA 2COEA 4FX5A 4PBRA 4PLVA 3MRVA 4G86A 2Q41A 3OD5A 4BMNA 5G4KB 3MFYA 2PWYA 3IHTA 4B6JA 4EUHA 1T10A 1U3FA 3H1TA 4X90A 5JNTA 2QWXA 1DU4A 3MJ4A 4QRHA 2VKTA 4BX2A 5JTUA 2G63A 4L5BA 1YB4A 4EFNA 4X00A 1MQ8B 2HDWA 2FQ1A 2QL5A 3QU5A 1WZUA 4YLYA 2WV7A 2X3UA 4L1KA 3GLHE 4BVBA 4PNPA 3VX4A 4NOLA 4EK9A 1CZRA 4L02A 4CE6A 1O2DA 2A1TS 1LA2A 3V32A 1XVIA 2PUGA 1J25A 2NVBA 3ONWA 3SLRA 1SUSA 5LP6B 4PCUA 3H65A 1W9HA 4QFBA 1U9IA 2REQB 4FNGA 4JC5A 4IIDA 2Q5OA 3E84A 1YCFA 1KWKA 3GD7A 3FIJA 1AB5A 3Q7TA 1VGQA 5AWFC 1KNXA 1PZFA 2A5LA 1TECE 3ILYA 4D6YA 4RTQA 2Y1FA 3E3LA 3S1SA 4Q5IA 1NKVA 6NULA 4C07A 1IHUA 1N2CA 2BM9A 3G7UA 1E1QA 3GEMA 4Q3CA 4V0SA 4CFZA 4ZI7B 4YRZA 4I5DA 2ZUDA 3Q9UA 5EPUA 1TEHA 4MPJA 2UYHA 3RTAA 3LUFA 3WIVA 3VDMA 5I9IA 3UYKA 3K1YA 4QULA 1K92A 2FAXA 5KTMA 4MUEA 4A15A 1NLUA 5FUXA 3WQBA 1Z82A 3BE5A 3H19A 4G1MB 3USCS 4PO1A 1Q0TA 3S4YA 1GCAA 3RFVA 1YS1X 1C9MA 2FZWA 1NVEA 4ZCSA 4N03A 4H6PA 3GRYA 3PUYA 3UHOA 1QK4A 1EX6A 2I22A 4KO1S 1EEHA 3NIGB 1KI4A 2BR4A 3F90A 3OZGA 4B3CA 3OQMA 4GI2A 4KN9S 4LVUA 4PYKA 2I54A 1AKTA 1SBZA 2QD5A 5CP8A 4S0XA 4E7OA 1ZU5A 2HA5A 4A0HA 2BT4A 1MRNA 1Z88A 2EDCA 5L3SB 3WA6A 3GT4A 5FORA 1U1EA 5IKEA 3PUKA 5K2OA 4PIVA 3H4TA 4MVXA 3E8SA 3GZNB 3NRCA 3L7KA 2IL1A 1RVDA 1T9AA 1OFIA 1GUBA 1YQEA 2ZBPA 3ZHTA 4Y67A 4Z2YA 4GZ3A 4YJFA 5B6JA 2J3EA 1NV9A 4BGEA 2Z1DA 1AMNA 3CZPA 4E4YA 2AQIA 1K3FA 2VDPB 4JUAA 4GECA 3RBZA 3O90A 2HUNA 3X1YA 1LK7A 1PJLA 3EDMA 3NC1C 1A77A 2WU0A 2WKRA 4AJEA 1QP0A 3WAKA 2FN8A 4IFBA 2D5AA 3BSSA 4EUEA 4RFSA 1OA0A 4K9DA 3CN9A 3I4LA 3LK6A 3M9WA 1JJVA 1M2FA 5CB4A 2BFCA 1VDMA 3AESA 3CO0S 3TL3A 3EHDA 3N2GA 1F8UA 4FJ0A 5FWXA 2FMHA 1H2ZA 2VYVA 1SIWA 5EHIA 4GMHA 4ZCLA 1E2EA 1XTTA 1UAGA 2X4GA 1DRJA 2UVPA 5JNWA 5KKAA 5JASA 5CBPB 4X1YA 1SPXA 2H4XA 1S2GA 3E3AA 7GPBA 3HADA 3BHMA 3PNVA 3TTSA 4B79A 4B6RA 2OHOA 5DI3A 2VAXA 4V0MA 4WTOA 2QSJA 4MNTA 3PQ2A 4MH0R 3O73A 4YLEA 4MB2A 1RRGA 2DKOA 4WXEA 5LOVB 1CHDA 3MBKA 4X41A 3GMIA 3HLKA 2AVDA 3MPUA 5LYYA 4P35A 1ZCAA 4CNQA 4B34A 2W2VA 3AHFA 3COVA 3CZRA 3K4QA 4QREA 4UQPA 3ZNNA 3UQZA 1RJFA 1VJ0A 3O4RA 3X0DA 2DFDA 3PJRA 1E1DA 2FEAA 1JHQA 1E9SA 3IESA 3OQIA 3KEMA 1SBCA 4ZCRA 3QM1A 4BMCA 5SY4A 3HUEA 5JWHA 4PU0A 1XRJA 3MBIA 1H9BA 1CF4A 3IUMA 2RHMA 4EPVA 2QLJA 2RHJA 3BDVA 2Y1CA 2C4VA 3CE9A 4CMJA 5EIXA 4F5EA 1FC0A 3HB4X 4BNDB 1BA2A 1NYTA 2QPLA 1TQHA 2CC2A 1P31A 3HA5A 2HKIA 3VVLA 1XKLA 3KXIA 1HSZA 3ZW7A 5ER9A 2ZS8A 2CSXA 4IIJB 4JJKA 4DA9A 2VP0A 1NA5A 5IHXA 3I5XA 3I1JA 4IQ8A 3KYCA 1N3YA 1J2JA 2IYPA 1OF1A 3F9CA 4KYUA 5LB2A 1G63A 1TQ6A 3IKLA 1XTBA 1UXIA 421PA 4DUGD 4TL8A 5ITZB 3OSUA 3IV7A 4C0BA 1YCHA 2XSZD 1C7FA 2R6CA 4I8DA 4NDAA 3JASB 2WMOB 1VPWA 4MJLA 3U40A 3RSOA 1VKZA 3G7NA 2XYRA 3G0OA 2YKGA 1K6JA 4C4ZA 3UA4A 4IYRA 5CFNA 1C4WA 3H1EA 4KHPB 1DLIA 2FPOA 4W1PA 2OZVA 2J8ZA 4NOJA 4R6XA 5FLEX 2QPOA 2G9NA 3CPJB 3WWCA 5CBKA 5F2NA 4BOYA 3C6KA 4F21A 3ESDA 4URUR 4GI3A 3JQAB 3VPBA 2I80A 1TYAE 3T8YA 2RAFA 4BWFB 4D5EA 5BYAA 1QZXA 2GAOA 2ZJBA 4YRDA 4DTIA 1NQAO 2XQVA 1MC5A 2PGIA 4M8KA 4DR1B 1AQIA 3ENKA 4J0FA 1ORVA 1P2DA 4US2R 2BGGA 1QF6A 3F5SA 2R6FA 1MZVA 5T7BA 2OILA 4M7PA 5JTTA 2O0LA 3LNCA 3MIZA 3ZWVA 1UK9A 2WIDA 3ND6A 2IZZA 2D59A 3CGWA 2JFPA 2PX6A 3IA7A 1X74A 2YV5A 1V1JA 3OFVA 1M33A 2YVQA 3HM2A 4CKBA 2A0YA 4O4JF 2O9JA 1JT9A 1YBVA 5ICEA 2IWRA 5BWNA 5C7OO 4GIBA 3ASYA 4JJ4A 1NWHA 1ARZA 1V25A 3K8YA 3QMVA 1BXZA 4RWEA 3WGVA 1QANA 4JU8A 1AQJA 3RFCA 2XW6A 3IP5A 3OQHA