2RAVA

X-ray crystallographic structures show conservation of a trigonal-bipyramidal intermediate in a phosphoryl-transfer superfamily.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
261
structure length
261
Chain Sequence
b'MTKALFFDIAGTLVSFETHRIPSSTIEALEAAHAKGLKIFIATGRPKAIINNLSELQDRNLIDGYITMNGAYCFVGEEVIYKSAIPQEEVKAMAAFCEKKGVPCIFVEEHNISVCQPNEMVKKIFYDFLHVNVIPTVSFEEASNKEVIQMTPFITEEEEKEVLPSIPTCEIGRWYPAFADVTAKGDTKQKGIDEIIRHFGIKLEETMSFGDGGNDISMLRHAAIGVAMGQAKEDVKAAADYVTAPIDEDGISKAMKHFGII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title The catalytic scaffold of the haloalkanoic acid dehalogenase enzyme superfamily acts as a mold for the trigonal bipyramidal transition state.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Unknown function
total genus 90
structure length 261
sequence length 261
ec nomenclature
pdb deposition date 2007-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 2ravA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ravA01
3R9KA 1QQ7A 3DDHA 3NAMA 4L6AA 3WK5A 5AM2A 5T41A 2C88A 3ET5A 5AI8A 2I54A 3QXGA 4EENA 4XOUA 1RLOA 3P96A 2IOFK 3ONNA 2NO4A 1L8LA 1EK2A 3U13A 5AVXA 5ALKA 5AW7A 3FVVA 5AVWA 1ZRMA 1Q91A 4Y2SA 2AUTA 3CZ4A 3M1YA 5ALTA 2WF5A 5ALLA 2AGVA 5AM4A 3WKAA 4F72A 3PGVA 3FPBA 5AW1A 5AVQA 5AKIA 2FDRA 5AK5A 4E88A 3QU2A 2JAUA 1L7MA 3HYCA 1YDFA 4C4RA 1YMQA 2HF7A 3DAOA 4YH1A 4YCLA 3KDPA 3U7FB 5ALDA 5IS2A 5AW4A 4I9GA 2JARA 1RPZA 3UMGA 3J7TA 4DW8A 4UMEA 4BKMA 3EPRA 1VFPA 4Y2RA 3QUBA 4Y2QA 3QLEA 4NV0A 2Q5EA 5ALOA 2FUCA 3ZWKA 3E81A 5ALYA 3WGVA 2CFTA 1TJ3A 4KNVA 4C4TA 2PR7A 3I6BA 2JGAA 4H1WA 4UASA 5AVYA 2I7DA 2OM6A 2D2VA 4DCCA 4EZEA 4BNDB 2R8YA 4EX7A 4Y2TA 3R4CA 1U7OA 2HHLA 4ZEXA 3FM9A 3QU9A 3QX7A 2WM8A 3UM9A 3B9BA 4FYPA 3ZVMA 3MPOA 3AR6A 1L7OA 2FPXA 3L8HA 3FGOA 5AI6A 2PKEA 4Y2PA 1U7PA 2B8EA 4AS3A 3IRUA 3NASA 4HGPA 1RLMA 3B9RA 4GIBA 2HX1A 4YIHA 3A1EA 2FPSA 1RKQA 2P69A 2O2XA 3M9LA 2FPRA 3U7GA 1T5TA 3L1UA 5AW8A 1Z4JA 3E8MA 3KD3A 1TA0A 3NRJA 2C8KA 2HCFA 4UATA 3I1YA 4CNQA 4HGOA 1ZD2P 1Z4LA 3ZTYA 1Z4QA 3OCUA 3EF0A 5AI4A 4ZEVA 3IJ5A 5AW2A 1L6RA 2GO7A 3QU5A 1RMTA 2JAWA 3N28A 1T5SA 3K1ZA 4KX5A 5A3SA 4Y2YA 3U26A 2WF8A 3NUQA 5AK6A 4JB3A 4BEVA 5ALNA 4HGRA 3IB6A 2I33A 3L7YA 3PDWA 3AR9A 1WVIA 3SMVA 5ALUA 1QH9A 3N1UA 1AQ6A 1Z5UA 5AKGA 4QJBA 3SKXA 1T9ZA 5AIBA 2B30A 5ALPA 2WF9A 4YIKA 1U2TA 2FEAA 2P11A 2WF7A 2ZBEA 5AKLA 4NWIA 1O03A 4HGQA 2GMWA 2FPWA 4XE5A 5AW3A 3GYGA 2NYVA 3OCXA 1QYIA 3OCWA 4MWOA 5AVZA 2AH5A 2FPUA 5AKXA 4PNHA 3MN1A 2GHTA 3L0CA 2JAOA 3SD7A 2HSZA 2B1QA 3QNMA 4KNWA 2IOFA 3QYPA 5ALMA 5ALJA 4BEWA 3PGLA 2ZXEA 3KC2A 4HGNA 2X4DA 2G1AA 1PW5A 5AVVA 2C4NA 2NO5A 3QU7A 3A3YA 4UM7A 4Y2VA 3ZVNA 4CE6A 1ZD3A 3ZU6A 1Z4KA 5AKYA 3TLMA 4DFDA 2YY6A 3AR7A 4HAIA 1WPGA 1TJ5A 1Z4PX 5AKEA 5AVRA 1TJ4A 3NANA 5AIAA 5ALVA 5AVTA 4UM5A 2WF6A 3N07A 3KZXA 4UU0A 2GHQA 4L6CA 3W5DA 1YS9A 2EAUA 2B1RA 2YMLA 4UU1A 5ALEA 4YCNA 2IA5A 4Y2XA 1Z4MA 3SKYA 4UMDA 3E84A 1JUDA 2G80A 2ZBDA 4XQ0A 4HYTA 4BX2A 3ZW7A 2ZBGA 2ZOSA 2MU1A 4G9BA 5ALWA 2CFSA 3KBBA 2W43A 3S6JA 3WK8A 1ZOLA 1NF2A 3MMZA 2PQ0A 2B82A 3L5KA 4O8CA 4CF3A 2RAVA 4Y2UA 4CF5A 5AM3A 3ESQA 4OFZA 4RETA 2W4MA 5ALQA 3BA6A 4BYGA 3QUTA 2ZG6A 4Y3UA 3F9RA 1WZCA 3OCYA 5AM5A 5IT4A 2HEGA 1RC8A 1Z4NA 1QQ5A 1SWWA 2YBDA 5FP0A 5IT0A 3L8GA 3WKEA 2RARA 2I34A 5AICA 1ZS9A 2P9JA 3ET4A 2YJ6A 1ZJJA 3L0BA 3WGUA 3L8EA 1Z4OA 1RKVA 4KYTA 2R8XA 4BBJA 1RMYA 4OCZA 1CR6A 4EEKA 1QQ6A 5AESA 2QYHA 3L8FA 4MUMA 2HF2A 1EK1A 2G07A 3OPXA 3ZUPA 2YJ3A 3RFUA 1S2OA 4JDPA 4YGYA 4AP9A 4G63A 4IG4A 2Q4TA 2I55A 4FFDA 2AMYA 4BX3A 3WK6A 5AHXA 5E0OA 3WKBA 5AK3A 1IWOA 2WHEA 1VJRA 4RESA 1RLTA 3E58A 3WKCA 3KOOA 2G08A 3PCTA 2OYCA 3N5KA 4NFLA 3ZWDA 4Y2JA 3U7HB 1MH9A 3UMBA 3UMCA 2B8JA 2HO4A 1K1EA 2YMQA 1O08A 3U7EB 1ZD5A 3A1CA 5AKZA 3B8EA 3I76A 5AW0A 2FI1A 3OCVA 3ZX4A 1J8DA 1U2SA 2HI0A 1Z5GA 2RB5A 4QQFA 4IFTA 3EWIA 5AM0A 3AR5A 2W11A 1CQZA 4EELA 5AVUA 3U19A 2HDOA 3ESRA 5AW6A 1NNLA 2FUEA 3WK7A 3WK4A 5A3RA 3W5CA 3QUQA 3OTQA 5ALSA 5AKKA 3ZX5A 1YV9A 1LVHA 1J97A 2Q4RA 2B0CA 5AI0A 5AI9A 3SLRA 2CN1A 1F5SA 4F71A 4AS2A 1WR8A 4KN8A 1SWVA 5ALFA 3QGMA 5ALIA 2BDUA 2WFAA 3MC1A 3ZI4A 2YFYA 5ALHA 1Z4IA 5ALXA 1NRWA 4UARA 3ZTWA 1RRCA 2CFRA 2ODAA 4KX3A 4UMVA 3R09A 2OA0A 3AR2A 3W5AA 1L7NA 1XP5A 1VJ5A 2YJ4A 2P27A 2MSNA 3FPSA 1U02A 1YJ5A 3DV9A 4BX0A 1LTQA 3BWVA 3OCZA 1L7PA 3EF1A 4J2TA 3AR4A 2EARA 4B6JA 3WK9A 1RMQA 2G0AA 1XPJA 2R8ZA 4L57A 1YNSA 3N8GA 1KYTA 2IYEA 5ALRA 4EX6A 3L0YA 3AR8A 1XVIA 5AI5A 1RQLA 1Q92A 3L1VA 3QUCA 1S8OA 4OHFA 2HOQA 4OD0A 2C8LA 4C4SA 2ZBFA 2RBKA 1RDFA 3HLTA 1Z88A 5AW9A 3A1DA 1TE2A 2QLTA 2IOHA 1L8OA 4UAVA 3ZVLA 2G06A 5A3QA 4ZEWA 2YMPA 1ZRNA 1FEZA 4FE3A 1Y8AA 3SF0A 5JJBA 3ED5A 2EATA 4GXTA 1ZD4A 2BDEA 5AM1A 4XPZA 4YCMA 4J03A 5AW5A 1X42A 4DWOA 3W5BA 3AR3A 5AKJA 3CNHA 1N8NA 2YJ5A 1SU4A 2OBBA 4UW9A 2GFHA 2G09A 3VAYA 3SHQA 2YN4A 3WKDA 5AKHA 5AVSA 2YMMA 4BNDA 3D6JA 3I28A 5ALZA 5ALGA 2C9MA 3NALA 4NAVA 1RKUA 2DQSA 5AK4A 3NIWA 1N9KA 4CF4A 4NABA 3DNPA 2I6XA 3RF6A 3FZQA 2BY4A 2VKQA 4UMFA 3QU4A 4UAUA 2R8EA 4I9FA 1RQNA 2O9JA
chains in the Genus database with same CATH superfamily
1LZKA 3MGGA 4F8YA 2PS3A 2DU8A 3BJZA 3EDCA 2ZR7A 3VNSA 4Z51A 1BVUA 1D2RA 2FG6C 3OLCX 4R7ZA 3TGPA 1O0BA 1BGXT 2WMOB 2QUJA 4G67A 1F0NA 4LXQA 1RHQA 3UQYS 3NHBA 1TECE 3DKRA 3MWFA 4O4JB 1VRVA 1G59A 4H1UA 3K9FC 2W6JD 4NYIR 1G4AE 3NUZA 1HFEL 1N75A 1WXGA 2XLBA 2R97A 1L8LA 4YLEA 5ELLA 5TMEA 4DIFA 3ICCA 3TF5A 1H1TA 3AF0A 1JLRA 1E3DA 3QQPA 3WIUA 2ECFA 5B1HA 3RS7A 3AGPA 4F72A 5H3LA 4MX8A 1JVNA 3TR5A 2A9JA 3OE7D 1DVRA 1T9GS 2OGZA 4BMZA 1NATA 1Z0KA 1PFUA 2N1MA 3VH2A 1OTHA 1CRWG 2J0UB 2UZ1B 3NGLA 1PR0A 4G07A 4G8CA 4O6VA 5HJ2A 3TPFA 4CU2A 4D8UA 4BC1A 2PUDA 1RZ3A 2GK7A 2HT6A 3ASYA 1M8KA 2OHHA 1DQZA 1G8JA 1NBMD 2EKDA 4CLEA 3SZUA 1A7AA 3DE3X 1CP3A 1Y3FE 3U7FB 2AFHB 2PU7A 4DQVA 5CPFA 3Q7QA 4QQKA 3W3AD 3SBDA 3D8UA 4ZCLA 2XE6A 1G2OA 1NN0A 1KO7A 3TZQA 1IM8A 2CVPA 3PF8A 3IA7A 4MWEA 5KQMA 2XWJI 3DKPA 5JD3A 2PD3A 4MUXA 1UDWA 3IOYA 2R5FA 4P98A 3FTEA 2I4RA 2B4AA 2Q5EA 2G5CA 4GT1A 5KQRA 2DQZA 4E7PA 3G02A 3G7NA 4B1FA 3E81A 4EY3A 2CFTA 2B4TO 4PC2A 4AECA 3OIUA 5TVGA 1COWA 3ENVA 5AK0A 3N2IA 3SF8B 4CDGA 4HEQA 3UPUA 3Q7PA 3QNWA 3U4MA 4UVEA 4TYNA 1FPQA 1SXJC 1GG9A 4P7FA 5EC8A 5JHGB 2JLBA 1OSNA 2HJVA 3VR3A 1UPCA 2PRJA 4BV9A 3CO5A 2NP7A 1A9XA 2CXPA 4IKPA 5M7EA 1XG5A 1V7CA 1FXWF 1JYSA 1A9YA 2P0YA 3OCJA 4N03A 2IELA 2QVGA 4IMRA 5EXDA 1Q11A 4I50A 1J21A 5GV8A 1MGOA 3RSFA 3TEFA 1BXZA 1P1BA 4E5DA 2WMNB 3K4PA 5EHZA 4HDMA 5EERA 3CR7A 2O4UX 1CVRA 2QMYA 4FFLA 4EJ0A 1N2CE 3HCWA 2RGWA 3R7WA 4LZAA 2WFMA 1H2RS 3UMFA 3THYB 2GM5A 2B98A 2X4LA 2Z4TA 1UMBA 2L2QA 4NJMA 3FGPA 1PZXA 4TUYB 5DNWA 1MX3A 2Z83A 3B9RA 1G5FA 2BF4A 4GL4A 3A10A 1P1JA 2ZTHA 1GYQA 1QUEA 3WL4A 3QW4B 4Z6KA 1T8YA 4YIHA 3UJNA 3BE4A 3W1VA 1SRQA 6YASA 2D62A 2HXSA 1S4MA 1RKQA 2FR8C 1KI8A 2COUA 2OBXA 4TTRA 1KMCA 1U4SA 5TIIA 3TQSA 1MJ5A 3DVRX 5IAKA 2VP6A 1T5TA 4NBLA 4TSFA 3G8CA 1Q12A 3HY3A 3N8HA 4I8DA 1U11A 3LC7O 2AXNA 3HCDA 4BO5A 5LD2B 2BGGA 2C7QA 2GXSA 3MBKA 3JD3A 3GLIA 1E6MA 5DBGA 2EC5A 2BJHA 3I1YA 1R10A 3PDIA 1IZYA 1HG0A 3FYSA 1I5EA 2W2MA 1GV0A 3QLJA 4I4TB 2Y92A 1WTAA 4XWAA 4QXPA 3H5OA 5L4SA 4FMPA 3QM1A 1BEZA 4QRHA 4TOIA 2VJNA 3WYBA 2GSWA 3V3KA 2P6RA 2GM3A 4O4IB 5HK9A 4QELA 4UREA 4ZT6A 2ZDHA 3QVSA 4P1ZA 4BLSA 4C7XA 1H22A 4DV1B 3KOZA 5TNXA 1T9AA 4PZPA 3VR5A 2C20A 3KU1A 2YY7A 4ARIA 3JR3A 1W5BA 1XDWA 3OX1A 3L7YA 1KQ3A 1PP4A 2EERA 3L93A 2XCTB 3JWGA 1LLCA 1U9ZA 3QIAA 1QDEA 3VPAA 1KMQA 1TCBA 1NI5A 3ND6A 4K9KA 4LVCA 4YP6A 3UJCA 4ARZB 4D6XA 5JZ9A 1FP7A 3F1KA 3ZEAA 5DHSA 5FOSA 4QDZA 2OXIA 4UFOA 4LC0A 4D9EA 2IXGA 5I4KA 1GTZA 1R0XA 4BQOA 2OO7A 5ALPA 4EMSA 4ZYXA 2VC2B 2XDWA 4DLUA 4FBLA 4MVJI 2BEWA 2E4XA 5I9MA 1RRVA 1TVMA 3AFOA 3PUIA 3L18A 4JASB 1DTSA 2NO9A 1VJ1A 3R24A 3GFBA 3SJCA 1FTQA 3IDZA 5AW3A 2YX1A 1UBNA 4HXEB 2YL2A 5CCBA 4PZEA 4H3HB 3RW9A 5CG1A 3KJEA 4Y9TA 4DBLE 4N5MA 1Z62A 1AKRA 2BLLA 4BXOB 1BQ3A 4TL9A 3L9WA 3K30A 5JSYA 3F7MA 3OF3A 1JEYA 2I3ZA 1NHGA 5K8UA 1BHQ1 4DWWA 3GEGA 2C4MA 1FMFA 2D7CA 4HDQB 4Z0PA 4BLTA 1G6HA 2HBRA 3DF7A 4Z53A 1A9PA 1QO9A 1GZ4A 3BJIC 2HM7A 2ZXEA 4RA9A 2XGSA 1EFVA 4CKBA 2NZXA 2XQKA 4G0OA 4AIIA 1PIWA 1GA4A 4RIEA 3DFMA 4R54A 2NO5A 3VHQA 2BMWA 1D8AA 1NULA 5ITSA 3KB1A 4M4SA 2FR1A 1GYPA 3D3KA 1NF3A 3QPAA 4AP6A 3LYUA 1W25A 4ILEA 5ANRB 2ZBVA 2ZK7A 2D2XA 2ZTVA 3GLFE 3LPDA 2CDNA 3W3ZB 1I80A 1O95C 2GM9A 1MB9A 3T7SA 1MGPA 4ZCMA 3KT6A 5TMBA 4KQFA 2ZSFA 1QH1A 2H1VA 1TUIA 4JJZA 1Z5PA 2X8LA 4X7RA 3RROA 2X4IA 2YJZA 3DXYA 3SK0A 1WF6A 2O0MA 4KVFA 2AFIE 1KK3A 1JDBB 2CHFA 1AV7A 1S8AA 4J49A 5FNVF 2RGUA 1QLJA 4B32A 5DHRA 4CV3A 2YV5A 2ZU6A 4E09A 2J5BA 4ZKDA 4HYTA 2I2BA 2VPPA 1U99A 2BF7A 1E0SA 2JGMA 3KQTA 3WO1A 2NTEA 4S1NA 2AHOA 1P75A 3DP7A 5FPSA 2Z58A 3WNBA 1AT1A 4J0CA 1TEZA 4YK7A 2NT3A 4RTOA 1MO4A 4I08A 3HJGA 1KDOA 1TLTA 1G42A 4IIJA 2RJOA 4HNTA 4TX1A 3OPMA 4WCFC 3RVBA 2WD7B 3KKZA 1B43A 1TQ8A 3C2QA 2IYNA 2CMHA 1E9AA 3RK4A 5UKDA 4F4JA 3U48A 4GXQA 1XZPA 2BBOA 3HXMA 3A1FA 3L49A 2JANA 1O3YA 5CYOA 1VSQA 2AG1A 3TOSA 2P9CA 5JJ5A 1UJ4A 2OZLB 2GAFA 1QQ5A 1XVAA 2NTVA 2Y1LA 3EZGA 1N5LA 3QFRA 5KPJA 3LG2A 4I5FA 5AUNB 3VSBA 3L8GA 1SG9A 2XUIA 2RHHA 4HFNA 4PXSA 2P40A 4B82A 1H8ED 2JK1A 4FPXA 4NYMQ 4KG7A 1TKRA 1V6AA 1HDRA 3OPYA 1GQYA 1U9YA 1Z35A 2JD2A 5FTJA 4F4IA 2PQ2A 4OU4A 4I5IA 2RHJA 3EBOA 1T5IA 3HEMA 3R4VA 1IY2A 1W2GA 3TXAA 1CZLA 2IUFA 4I1SA 5K7SA 3LS2A 3U5TA 3LCVB 5BYBA 2B5OA 4LQ4A 4X6YA 1GXSB 1CE8A 3HXPA 1LNZA 3DT8A 2WJ6A 2DT8A 2GF0A 2QP9X 5BOVA 3WGZA 3ZWNA 1P80A 4MUJA 3VKUA 2HZ7A 4OUKX 4JFAA 4PRLA 1LBEA 4KKXB 2E0IA 2W6NA 5IPFA 2YJ3A 1Z6YA 3OPYI 1Q1ZA 1S2OA 4DYVA 5JS7A 2HHAA 3IAS1 2HUPA 4OP2A 3WZLA 5CUQA 3Q15C 3N0VA 3EW7A 3KT0A 4JCOA 2RG1A 4FQ5A 1B8VA 3DV0B 1NU8A 3I12A 4WRRA 4MYTA 1YRQA 3AFHA 4NCKA 4TLBA 3W2EA 1V16A 1U9CA 2P7IA 1K8ZB 2RHTA 1TYCA 4L9SA 2XMBA 3NHZA 5E1DA 1MVOA 4OHYA 1OJ7A 3UHPA 4CW7A 4DMCA 1FNBA 2WHEA 1OA1A 3OCCA 4QOHA 1HWYA 4XDZA 4AZ3B 5IF9A 5KTSA 2NN3C 5C81A 3WLSA 1SFRA 2EQAA 3PV0A 2GKGA 3R1IA 2OYCA 5FAKA 3HMQA 2ZUVA 4JEMA 3IT0A 5EMHA 4Z4GA 3AM1A 1A9SA 1IY0A 1UBSB 4H7KA 2YNMD 1XZ8A 3A4VA 3EXIB 1NBEA 4I5EA 3U7HB 2I87A 4PO8A 3IT1A 2B8JA 4FFSA 1K1EA 1NV9A 3DFZA 1UUFA 4Z0HO 1B3RA 5FT9A 3VPBA 3CEJA 2GEBA 1W94A 3GAFA 1KAOA 3HFRA 1RI2A 3BXPA 3M3PA 5FHQA 1IXYA 3D4LA 2OHXA 2WTBA 3AH8A 3FNQA 3ROTA 4EFKA 1G8GA 2BZSA 3ACCA 4WA8A 1HNZB 1URPA 4DVGA 5BSFA 4IZOA 2EVWX 4NECA 4QBFA 2ZJ1A 5KWIA 2X40A 3UFXA 1UMDB 4OU5A 3N6RA 1OXKB 3LPAA 4NEHB 1C7FA 2EJBA 3G23A 1W8IA 3JQBC 4G01B 4GPBA 4AKSA 2W2TA 3HYSA 1EH5A 4O2LA 3U4DA 4RD0A 4F6RA 1E89A 5DEOA 1HDCA 3S40A 4PPQA 4IX1A 5ETJA 4F4FA 5I7SA 1ECPA 3ZBUA 1KY2A 1KFJB 4DZTA 4C3OB 4EHFA 1ETUA 2PGXA 1Y9DA 4Q15A 3GBSA 1X9HA 1V3QE 2DFVA 4RZHA 1DGQA 3NFRA 4MUIA 4XIIA 4ITUA 2VT2A 3FD8A 2VH2A 3QENA 1RZVA 3PXUA 4C29A 5C80A 1F4PA 2JJ2A 3GV0A 3F2VA 1GRVA 1WR8A 4JP2A 2HYIC 1M3SA 1CCWA 1BWRA 4YAKA 2E1RA 3OA2A 3HDTA 1L7BA 3AJAA 5DXFA 4W9RA 1RZRD 2GUWA 4TXLA 4UUAA 4X20B 2PWAA 4O2AA 3A6KA 1FNMA 3LSTA 3K4QA 2CLDX 1U0NA 3B1FA 3NCHA 4CL3A 3RKUA 4F9EA 5JCXA 4UARA 3V7NA 5LZ5A 2AR7A 3MRTA 5FULA 3DLHA 1KEZA 2NU8A 9GPBA 2QRKA 4M0UA 1PWHA 1E2EA 1J00A 2H51A 3LA6A 4R0MA 5D5QA 1VE7A 3V4RA 3D64A 3TN7A 5GGXA 2IT1A 2YIMA 2ILTA 4ENPA 4WBNB 5JSQA 2CXHA 2V7GA 4XJVA 5CFOA 1VJ5A 1TVCA 2G5TA 2NQ2C 1AHIA 2QUBA 2XDQB 3DV9A 3E9NA 2WYWA 3EDRA 3MRVA 3WMXA 1VXRA 2AN5A 3ZNOA 5JAHA 3W4IA 1PYOA 1G20B 3JWPA 1DMSA 4IDHA 1GGMA 1L7PA 1KORA 4AICA 4BFTA 4PXYA 1W4ZA 2VIIA 1C8LA 2FZCA 4HQ0A 1M2EA 2J87A 4NFYA 5E6SB 5CB4A 1MH1A 3C8HA 3HWWA 3UT5A 1IUOA 4FBMA 4FNGA 1XPJA 1R3UA 5E7IA 3GXBA 3ACBA 4BJ5A 4UEOA 3CLSD 3LOQA 5KYYA 3SAJA 4MCIA 5HYVA 3TYXA 1VGQA 3RODA 3HJFA 4RCYA 3QY0A 1E1RD 2XR1A 2XIJA 1Q50A 3D5TA 5IBPA 2CDAA 3QUCA 1LKZA 2EBUA 2FLWA 1XLTC 1G2QA 4O1HA 2C8LA 1PGQA 4L5YA 4C4SA 1VIAA 4DC1A 2G4VA 5IK2D 3EPHA 3PD1A 4PYMA 1D9ZA 3AJ8A 3KTOA 1DPFA 1JDVA 2QLTA 4GHWA 4B4VA 1AM4D 4U7GA 1OLUB 2C03A 2G06A 3LZCA 4XWYA 3UGTA 2KQUA 3VFDA 4WZBB 3HSKA 2QGFA 3JQFA 3K6JA 4AZSA 1NBME 2FW1A 4HQOA 3I72A 3SZLA 2PEYA 3NOXA 4AO6A 2ODEA 4RD4A 1CTQA 1K3TA 3PHHA 4P3PA 5CFRA 3KB2A 5LIPA 5JMPA 2P4HX 4DDMA 2G6BA 4FDUA 3ZXSA 1PJ3A 4E11A 1J2JA 3W5BA 2XEDA 2XNDA 3K6RA 3TNDA 3MTQA 5BSHA 3CNHA 1MHTA 5MHTA 3TZKA 4ZVRA 3NRCA 3FVTA 1VHDA 3AL3A 3B5EA 4HEHA 1JQJC 1FJ2A 4PHGA 1NW9B 1M7BA 4ZVPA 5A62A 2ISCA 1DO0A 2B1GA 2TMKA 3FDIA 4Z9FA 3SHQA 4KK3A 3UMSA 2YN4A 3WKDA 2AYXA 2XYPA 3DE7X 3DKIA 2WHXA 1H2AS 3FTDA 2KYRA 3SCZA 4DL9A 1Q1NA 4QTTB 5IAGA 3HRHA 3ZJ4A 1FZTA 2C31A 2ZW9A 4R9RA 1IFXA 1GQOA 5KNCA 3U7QA 3KP1A 2DB3A 3E22B 3RC2A 3WGOA 1X7HA 4RVDA 2WFZA 1P1FA 3MWEA 4V0SA 5F9FA 2R7MA 4DLXA 3TLGA 4KNYA 1EEHA 2DFTA 2J5RA 4NOLA 4R1PA 3ZUGA 4F97A 5BWCA 5D84A 3EYAA 3MLBA 4IDAA 4N7MA 3KU4A 4XM2A 5BN5B 5E8JA 3LCCA 4MB0A 4PGAA 3PQ2A 5DW3A 1GV1A 5DB4A 2EZ4A 2XA9A 1YHNA 1ATIA 1I9CA 2JCSA 1KY4A 2K7ZA 3BREA 1KQGA 1SXIA 1U8TA 4TL6A 5CGZA 3U60B 3O38A 4RIIA 3MXOA 2JA2A 1Q1AA 1TTQB 3DKKA 1V1JA 1WCIB 4GWGA 2PJUA 1WQ4A 4ILKA 4RORA 3RJ9A 3CWZA 1FDTA 2P65A 2X2EA 4DM3A 5L6MB 3U09A 1X1TA 2I7VA 3PITA 5EE9A 1V48A 3KPJA 5LNK1 2CHQA 1GPDG 3HYLA 2QYOA 2OXEA 2QX7A 1I2ZA 2QNBA 4B17A 1CY2A 4OM7A 3W06A 4ABYA 1E98A 3BHJA 5MN6A 2WF5A 2P35A 4AKHA 2J7PA 1RJFA 4HTFB 4LDZA 2BP7B 4Q9IA 3O26A 3ZWBA 1NYLA 1QPGA 1WHSB 2WIAA 4JYAB 2VAMA 5KHLB 4N76A 1T5LA 1E2NA 3JQPA 3QFCA 4UXHA 3NTVA 3ADKA 3LFUA 2P91A 4YV1A 1NASA 4J0FA 1TI7A 1WPRA 5T4HA 1U4NA 4PRKA 1L8QA 1WSBA 4PG5A 5E8RA 5HDQA 2FZEA 3RAGA 3SY8A 3N8KA 1DO8A 4XWGA 3O8RA 3KDPA 1E6LA 2OCLA 2VZ8A 4C21A 2YCLA 1YVEI 3FYUA 4CIDA 2SECE 5AWFC 3C5EA 2KBFA 4RFSB 3KSBC 3LHKA 3U7JA 3J7TA 3R23A 5BOSA 2GPNA 4CFZA 4E5PA 3OMXA 4UMEA 5JJLA 2JJ1D 4BKMA 2F64A 4QDTA 4A23A 3WYGA 5LPNA 1I2BA 1FXUA 1J8FA 1YB4A 1GD1O 2BW0A 3I73A 3LC1O 5I7AA 3IAAA 4TMTA 2XOKD 5ALOA 2IEDA 3M81A 5HMLA 1U3CA 2F90A 1Y6GA 1FSPA 1DQNA 1T43A 4DIKA 1TAUA 1T0BA 1TQDA 3STHA 1NX6A 4CYMA 2JJ8A 3D6NB 3K71B 1IY9A 2FSSA 3TO5A 1WW3A 3GW8A 4ND7A 3JALA 3UJ9A 1M2JA 3WS7A 2C99A 3N9IA 1E66A 1Q95A 3DEJA 4UQOA 4AO7A 4RQUA 5AOVA 3JCZA 4I2NA 4MWGA 4E6PA 1M0WA 4Y9RA 4HDNB 2WWIA 2GDJA 1SAYA 5JRZA 2HJHA 2A1TR 2V7VA 1YC2A 4X8MA 2X0DA 1XZBA 5FTWA 2Z1NA 4ND3A 2Y6UA 4EUSA 5HKLA 2H2FA 2QJRA 2XGJA 3FAZA 2FZVA 5SZKB 1U1GA 3BEDA 3OP4A 1NN1A 2GBCA 2RH5A 4D41A 1PKEA 4IM7A 3BRCA 4JC5A 4AX8A 4J0KA 2IU3A 3R0QA 3IIIA 5ES4B 3CZAA 1SIWA 1ID1A 2I80A 3FKJA 3MGCA 2PUEA 2PZLA 5FTMA 2RE8A 5E2BA 3QUSA 2HL6A 4KBFA 3R5KA 2G28A 1TZJA 1A5TA 2GJ9A 3CNBA 2AEMA 4HGPA 4K6CA 4KO2S 4ZYZA 4JT4A 2QU7A 1ZOOA 4HYYA 2D6FA 2P77A 3TM5A 3FTPA 5CM8B 3F0TA 2UYOA 3WJ7A 5BWNA 4ARBA 2OL4A 1E9DA 1Z36A 2VK4A 4R8VA 5I7WA 4P3XA 5IVIA 4OXXA 4YAJA 5DN9A 1PV2A 3RK0A 4BLOA 5BSGA 1KOLA 3E9YA 1TA4A 1PJZA 4ZRNA 4B4UA 1GUBA 2H57A 4PNPA 3P4UA 3M6IA 3EGIA 4GX2A 1R4AA 1Z4JA 3SX4A 3M9XA 4WY5A 5LMUB 2C8KA 4ND4A 4IIGA 1JXMA 4H0FA 4IICA 1GR0A 2VJDA 1B6GA 1HMYA 3MT0A 1DV1A 3USZA 1LK5A 3OHSX 2J9RA 2X0FA 2Z1MA 3THXB 5AI4A 3EEYA 5A9RA 4MKXA 2BD0A 3KYDA 4WOKA 3H75A 4O5AA 3W6PA 4AKGA 1DXOA 4I36A 2GARA 2HO5A 2A78A 3SHTA 1T35A 4C6TA 3X2FA 1B0PA 3RM3A 1NXSA 2G36A 1TU3A 2PL1A 3OIVA 1KIAA 1NZFA 4OHRA 5K03A 4LF6B 4BEVA 2DKFA 5IC5A 3TXXA 2F3UA 2Z43A 3V7FA 1ESDA 1I7LA 1U04A 3GZ4A 1Z6XA 3INYA 4HGRA 3PFNA 4ZOAA 1GTL1 2QYSA 2XUGA 1KQOA 1GWNA 1IN8A 1U6JA 3ZWAA 4G2NA 5BN4A 3N1UA 2ZT5A 1ZSYA 3QTTA 4TPKA 3T7DA 4ETMA 1R00A 2PA3A 5B1DA 3QKWA 1GSAA 5DJ5A 5E2IA 4RVHA 4BFCA 4HVCA 1EAMA 4B3MB 2QR3A 1CS0A 1Q7TA 4HVLA 3HFSA 2UU9B 1MNQA 2JKZA 3IELA 2WF7A 3OECA 5ECWA 2GJ4A 2C3OA 4KR7A 2HQBA 5BQOA 2IXFA 1M67A 1SVLA 4AVYA 4YRAA 4EB3A 4F12A 4J0HA 3S5JA 1CUXA 3INRA 1PJCA 1FMTA 4WN9A 3LDFA 1JHPA 1J9ZA 1NC1A 4KQ6A 2X7JA 2RHWA 4RFLA 4FUQA 4ZAVA 2OD9A 3H8SA 1NRIA 2NSJA 2YC2C 3DQQA 1U80A 2BBSA 3PFFA 1EBUA 1RKXA 2C8VA 2GPAA 3U5ZB 2GVZC 4EATA 2HSZA 2B1QA 1SQ6A 2HC9A 2R6DA 2ZETA 3N75A 1QCZA 2UUAB 5KYGA 6ABPA 1BW9A 3WXMA 3NDJA 5ALMA 2JKYA 3WL7A 3LDAA 1VLJA 2VUHB 2LCIA 4DGQA 2AEEA 2EKZA 3U44B 3BJEA 3VZPA 1NQ5A 3IOMA 1SZJG 4BQQA 2GH1A 3ZK7A 1JPNA 2ZS8A 3EUWA 1I9GA 4FHCA 4QARA 3DJYA 2Q9UA 1AQUA 5D85A 1NFQA 1G7TA 1QCYA 4MI3A 1VDMA 5FEUA 3ZHUA 1JYFA 2O57A 4V02A 1P2VA 4ZCTA 4UEJA 4QVKA 3RC7A 1QYVA 1SD1A 1Y81A 3OVMA 5HJ5A 2AOWA 1KOGA 5LWQA 1R8QA 1OXVA 1PD0A 1UBRS 3HG7A 1GNLA 2EFDB 3H86A 5CPBA 1XZQA 3P0FA 4HUJA 4FYXA 1MTOA 4S1WA 2XADA 3ZYCA 2GN9A 4BV2A 2Y1KA 5AUOB 1OREA 4LW8A 5H3HA 3B51X 8ABPA 4HK4A 2EWVA 2DBZA 3QVOA 4IDPA 3HKDA 5LD2C 2GNPA 5THQA 2CJWB 1A69A 1G5TA 2VOEA 2XPCA 3RJTA 4KI7A 2B1RA 3ND5A 4EJFA 4PYIA 3HL4A 3QKUA 4RMJA 2XMGA 1WZ2A 1VPWA 2DOKA 1JUDA 5LYJA 7YASA 2DBRA 4Q1AA 3PUJA 1XWWA 2WVHA 1Z6ZA 4U9HS 3CLUD 4XCXA 5GM2A 1ECBA 1ZIPA 3IJEB 4O4JF 5LJLA 3GGGA 2O8FB 2VZ9A 4EG5A 4H7EA 1RXIA 1Y9AA 3R5FA 2MYTA 2PQ0A 1OI3A 1BDJA 3VR6D 5B7GA 2ZJOA 3SKVA 1WIWA 2YIVX 3RC1A 3U6BA 2K6GA 5L3ZA 1JIVA 3VRHA 5KWSA 1M1YE 1HKUA 1L7QA 4HRVA 3U9LA 4FN5A 4ESVA 3SIPA 2OC4A 5ADVA 2NU7B 2XKJE 4HNAB 4JEUA 2V6MA 1RWNA 1SHZA 4OY3A 5CM2Z 1U2PA 3V2UA 3ZD8A 4DG9A 1UR5A 2BIFA 4NJOA 4O1MA 4MUEA 4W9NA 4D8TA 4P84A 1NX9A 4LHZA 4EF4A 3T06B 4D81A 1W5SA 4ZYTA 5DNDA 1QC5A 5TR9A 2Q6LA 3V80A 4EEZA 2W4QA 5KC9A 4A2WA 1B42A 1YASA 4RYLA 3VX3A 3K1JA 4YECA 4UM8B 1MJHA 1V9SA 1IRXA 3NKLA 4YDQA 1C9DB 1K5DA 4Q4HB 2OILA 1RRFA 1XXLA 3HBAA 1FLNA 3P1JA 4R8LA 2QZPA 3AINA 3U81A 2X41A 4HF7A 1IHXA 5J9FA 1FS6A 4OCZA 4ZVVA 3W8DA 1U5CA 3F6SA 2Q1TA 2FGKA 5LWHA 3C6XA 4KH0A 4B73A 4PSVA 4Q00A 4E33A 3C6KA 4K8OA 4Q16A 3V5NA 1P31A 2FVYA 1POWA 1UPBA 2HSEA 2Q99A 2XJ4A 2XUZA 3AJ9A 3LX4A 3WGKA 4BJHB 2I6SA 4FGWA 4ECEA 2ETVA 2H85A 5MN4A 4HGZA 5CJJA 3H2KA 3IAXA 3J81k 1AKNA 3HJTA 5D6NA 1Z73A 2F9LA 3F5DA 4C5AA 1JHDA 1TK3A 2FLVA 4XCQA 5B7NA 3P9NA 4R81A 4JDPA 4F4CA 7REQA 1Y4DE 1ULHA 5DNAA 4E4YA 2WR8A 1PS9A 1MFZA 1N9GA 3MGAA 3K16A 4OUDB 4AT1A 4EDHA 5CA1A 4RTKA 3ERCA 3NXSA 3QW2A 5BPFA 1PU2A 4UTOA 1CDOA 2Q3MA 4XLLA 2ZUWA 4H3KB 4J16C 4OMFG 1XU7A 4YJGB 1E1DA 3WJ2A 3H9UA 4I3HA 4F38A 2YWGA 2PJDA 3TG2A 3JAMA 4M55A 4EGAA 4YFVA 5HIIA 2ZT8A 2VNJA 3NWPA 4YPVA 2ZREA 4RESA 4KSYA 1SCJA 3AVWA 5LZ4A 1R15A 3PCTA 4NMMA 5HA5A 1SUWA 2OV3A 2ZB8A 3M4ZA 3UNXA 8ADHA 4HWRA 4GD3Q 3ILXA 4HXYA 1W5TA 1E1NA 1YFZA 3CEAA 4TUYF 2OBMA 2DR3A 4N12A 1QP0A 4GICA 1W36C 5KNBA 5C1PA 3GPIA 5ELXA 1YZYA 3E18A 1O08A 1YQWA 1X9GA 4KIWA 2EKPA 2W6OA 3GMSA 3OF2A 4IGAA 3OCVA 3C6ZA 3ZJTA 3QBJA 2IH2A 1S7CA 1WY5A 3RUIA 3KUCA 1XNJA 1LDEA 1HORA 2FPMA 4CKEB 2RB5A 3UY4A 1KVRA 3CG4A 4G25A 4NTZA 2W2LD 5DKFA 2NQ8A 4EKYA 5BNIA 4CM7A 3VZBA 3UMMA 2HBQA 3KWMA 1HK7A 4NI5A 1MB3A 2XZDA 5CT6A 4GE0A 4I4TF 1CQZA 1UQTA 1ZM9A 1NW6A 2WPDA 4MQEA 5EMJA 1DS6A 1NNLA 1SVUA 5KKNB 2UZ4A 1HTWA 1ZC3A 4O4IF 4TYMA 2B21A 2Q5HA 3HI4A 4KBGA 3LQYA 4GQAA 4XYGA 4YJ3B 2AQIA 1PBTA 3OTQA 1JEQA 1Z16A 1ZIOA 4UQPA 1YV9A 1K6IA 4RNCA 2H1HA 4QDJA 3IP9A 3ZQKA 3ITKA 3DL7A 2C7GA 2DFKB 3L7OA 2AJDA 2NT4A 5LR6A 3C3AA 3EZXA 2A59A 5IKXA 4ZMRA 4KN8A 4BV8A 5I4IA 2Z5VA 3T5TA 4XJSA 3H1AA 3ZLUA 1IIRA 5JADA 2AJTA 5FYQA 3AW8A 1FYDA 3JQFC 2P8JA 1NYTA 1KI4A 2BH9A 3GMTA 4P0QB 4MVJH 3I9V1 5ECDA 1J06A 5ITVA 1Q2XA 3WTBA 4C43A 2J3JA 1PK7A 4QBKA 2O0LA 5HFJA 3I42A 3DXFA 4MULA 3C7DB 1XK7A 4RL4A 3PKIA 1KSGA 4XGRA 5EPUA 3T6KA 1PBNA 1HEIA 1TD1A 4V24A 3NR2A 2AX3A 2YQZA 1RHMA 3KWLA 3W5AA 2LCQA 1U7UA 4ISBA 4X1OA 1P61B 3S2ZA 5DCLA 2VT7A 3VU1A 2WFLA 3W2IA 1JDUA 2B4KA 3Q6NA 4FE7A 1AK1A 1MOPA 3OZUA 2JLCA 1V4NA 4N9QA 4WEOA 1REQB 5LZ8A 3SPXA 1L8AA 3LVFO 4HS9A 4HB4A 3IGFA 4RK1A 4RZSA 5E0KB 5FORA 5DHTA 1UJ6A 1MIOA 1YQXA 2QE6A 2XTNA 2YHSA 1ZM4A 1SXJB 3B60A 1NPYA 2X42A 4UEWA 4CQLA 1RMQA 5SYAA 4Q03A 4HR7A 3EGEA 2G0AA 1RRPA 4X3PA 2D1SA 2ACVA 4E51A 2QJOA 4GZ6A 1FSZA 2P9GA 3A36A 4JI1B 5KINB 5JANA 3EGDA 1XROA 2FPGA 1DHRA 2A7XA 5TGZA 2IYEA 4PZYA 5HX7A 4Q05A 3PC4A 3I5MA 2Q0SA 1U3TA 3K32A 3ONDA 5T3UA 3NEAA 3TK1A 1KQFA 3AI3A 4Q7KA 4EFDA 1TUGA 1WKVA 1A8SA 2PBFA 3NBZC 4P53A 2QI9F 1UP7A 3CVJA 3R77A 4JS0A 4BTLA 5E4TA 1TC1A 2HEIA 2J9GA 3LY9A 3AERB 3EDMA 2IOHA 3CO0S 4QRIA 3RUCA 5ILOA 2V4UA 1T3GA 2A5LA 2QMOA 4YR9A 1KJIA 5B4VA 1BWSA 1T1RA 4IH9A 4FE3A 4UFNA 3LP6A 5D6OA 4EEXA 2DJIA 4R9VA 5DM60 4QYIA 1TUEA 2ATEA 3DPIA 1XA4A 3DT6A 2BKAA 4HN4B 4DR4B 2DCMA 2JLQA 2ZB7A 1PAUA 1CUEA 1PFKA 2O2IA 2ETXA 1Q15A 3C8ZA 1ONOA 4LC9A 1Z22A 1IM2A 3T1NA 4I81A 2Q0QA 4HWPA 3TPCA 2ONYA 2I6GA 2JIZD 3OP1A 1E79A 4JXKA 4IINA 3GH3A 4XRRA 3GVHA 2PJZA 2ACEA 2G17A 3JY6A 4M9CA 1KI2A 3IIMA 2QMUA 3AZQA 4IS2A 4PCVA 2QN8A 4PWYA 1MZPA 3JS5A 1ES9A 1XL0A 4V3CA 3IEPA 3KLMX 2G40A 3MCWA 4DMRA 2JCBA 1ETHA 1F2DA 1SPBS 5JATA 3KJIA 1G291 4MW4A 1XA3A 3MWKA 3UK7A 2M6LA 3BZBA 5CCXA 1C81A 4QOFA 1I32A 1SQFA 3DNPA 4H17A 4L0DA 1VKHA 5B3LA 3KKPA 4P7JA 4DCGA 3MHTA 2OAP1 4ZAZA 3I2IA 1U2GC 1GFZA 4WZAB 1I4EB 4M8KA 4R84A 3FDXA 5GY7A 5BR4A 1TJPB 3MK31 4RPIA 2O9JA 2ZJ8A 4JK3A 4BNVA 3MLAA 1E99A 4U0KA 4QFDA 1KJ8A 2OFPA 4XIGS 4YCBA 4NJEB 2IPOA 3E5RA 1TDJA 2VYNA 2ZRDA 1T6YA 3DDWA 3NG1A 3OQIB 4PLFA 1TMGE 4WNIA 1MMFB 1OD6A 4EM6A 1GTSA 4ZT3A 2XUKA 4OQEA 1QQBA 1NYQA 1UK6A 3OSZA 2Q4EA 5KTKA 5C53B 3W7VA 2X13A 2VUUA 1P1HA 2OECA 3HA3A 4ZICA 2RAFA 3IR5A 3SIRA 4FNMA 5TX7A 2VDVE 5EVCA 3RVQA 3O91A 3WHPA 1P2SA 2W7TA 3AI7A 4M8SA 1UJ5A 4W5WA 3LOPA 2VTKA 3SN6A 2QTWB 1T91A 4B3HA 1G7SA 5INTA 2O5RA 1RYDA 2P4QA 1SBQA 3ZDFA 1QMGA 4XW2A 1DWQA 1IDOA 2AT1A 3RV3A 2D59A 3SYMA 1HX7A 4CMEA 3EVZA 5EXSA 3FROA 2BSXA 3T5GA 2D1QA 3H2YA 4W5JA 2Q5JA 1W0CA 1E2DA 1YU6A 1KDRA 1HOTA 3JQ9C 4BOYA 1TO2E 3HYCA 5TGTA 1IOWA 1YMQA 3TSYA 5DM70 4HADA 3JSXA 5DK4A 1YDWA 3FYTA 2P6UA 3DP9A 2GEDA 4NMLA 4GBJA 1ZJ5A 2IHJA 2ZUSA 1KZ6A 3LGAA 4XR4A 1YIOA 4B85A 5KNDH 2X9VA 2JARA 4PN7A 3P32A 4NQRA 2PZGA 1AU9A 5H02A 1ZITA 3U31A 1W96A 1U3UA 2AHRA 3UPDA 1A8IA 1YBFA 5A5GA 2VWQA 3E9DA 4UVGA 1SULA 2VUSA 2NNWB 1YZTA 1NSYA 4A0GA 3CLHA 3OWHA 3EBLA 3ZHQA 5J5AA 2DMRA 2Y9PB 4B87A 5LQSA 2C54A 1TM2A 1Y3AA 2WKRA 4NNJA 4IQ0A 1NXTA 1DX6A 1L6IA 4GYYA 4OATA 1FTGA 5J2UB 4BVHA 4C22A 2EDAA 1AQYA 2DECA 2W8BB 4F93B 5CD1A 2KX7A 2C92A 3N2GB 4IRMA 3QMWA 1A88A 5F3DA 5JRDS 1YIAA 3VSEA 5BW5A 2WK1A 5LA6B 1H3FA 3CPJB 2V3VA 3KR9A 4EJSC 2BCGY 3KUUA 4MDEA 2JGLA 2RHLA 4X61A 2D0PB 3KWJA 4PAGA 3EEFA 5JASA 3GEMA 4ZDKA 1U5BA 4OAPA 4PQGA 1WVMA 3PK0A 3VZQA 4CUJA 3HVRA 5JQWA 4DZRA 3EA5A 1MHPA 3ZW9A 5EL0A 2YXDA 3PDHA 5JQGB 4Z4IA 2PKEA 1I36A 3DZKA 3EQ6A 5HZKA 3TLZA 3HJCA 4NKRA 3MCUA 2R6CA 2AE1A 3ZV6A 1OYOA 3OZDA 3FHOA 1XTBA 3GHHA 4OYRA 2EHDA 2VDJA 3NHRA 3JWIA 2GFQA 4F4HA 2FWJA 3IC5A 2PGIA 3AF2A 5DIFA 2OKGA 1X8LA 5KX5A 1SBYA 1WZNA 2DH6A 5E6RA 1YZ3A 2ZYSA 1ND5A 2GKSA 4RD3A 3T9AA 4LSWA 4TROA 1OI4A 3WGGA 2W2OA 3M9LA 2VTBB 5K8LA 3KTAB 4BTEA 2BFFB 2HF8A 2DWUA 1C3EA 1T36A 3CRW1 4EYEA 3NDBB 3WMGA 1QU2A 1CUAA 4ZIRA 1Q21A 2XCOA 2AL7A 3SP1A 1U65A 3H2ZA 3ZJ5A 1Z4LA 3IPYA 4ZZIA 5I9LA 3BGVA 4FS8A 4G9GA 4WXYB 1V47A 4DC0A 3FRIA 1I01A 4ZT4A 3UWPA 2ZSHA 3G8YA 3KQUA 2QTAA 3A7EA 3D6HA 3IJ5A 3QU5A 4IH1A 2TYSB 1OT5A 4WNYA 5DLDA 3SSMA 3VYVA 1XI2A 3SLGA 4WBNF 4OLAA 4JEHA 5A3SA 4UTNA 5J3JA 3VR4H 2GESA 5ERYA 4KXNA 2HJWA 2XGGA 5EFOA 1CRLA 2QM3A 3AESB 4I55B 4L16A 4X1IB 4ZI7A 2PGJA 3A6ZA 2QJFA 3E2MA 3U16A 2O2EA 3NM4A 3OPVA 1TUBB 2GZ2A 3QBTA 4HUQB 3UGJA 5AQ1A 1CZRA 4XRGA 2FR0A 3DD1A 1KYIA 3KZ1E 4HAOA 4UE6A 3SQMA 3DCNA 4L08A 5FOQA 1FX1A 1G5QA 3D4PA 3HBMA 5K0NA 3UAWA 1EM8B 1SA0B 1H4TA 1E1QA 4WLFA 5D3KA 3R3SA 3T4EA 1X1RA 3RSQA 1JALA 1E9CA 1TEHA 1ENZA 1XWIA 3CKLA 3JQGA 3LL4A 4DNQA 4GNKA 2MIIA 1TZMA 2RGNC 4W1RA 3HCEA 1YKGA 2C2ZA 1OZ0A 5IJ0A 2VPZA 1DWPA 4RE6A 4G24A 4CV0A 3UB3A 5CFMA 1YA4A 3NWOA 2AH5A 3JZIA 1IY1A 1I10A 4DAEA 1OILA 3ESDA 1F1JA 2H9IA 1J0DA 1RRGA 2NMVA 3KSDO 1OR8A 1CT9A 1OYYA 1T4BA 3GPBA 1EFRA 1V8BA 5L3SA 5JWRA 1R0RE 5FA5A 1OKKD 3A3KA 1YQUA 3PICA 3U1TA 3B9PA 1GEGA 1ZQ1A 3BGSA 3GFRA 5H1YA 2WNSA 4Y6QA 5DBFA 4J0IA 3WLKX 1O94C 5LM3A 4EF6A 4ZZ1A 4B3RB 2BFBA 1SC1A 4X1KB 1FYXA 1G5PA 1ZGAA 2GR9A 4TSKA 2X4DA 4ARAA 4IBOA 4AMUA 2BI7A 3DR5A 1BJTA 5LOVB 3FBTA 4CL8A 4EYKA 2VNAA 4QSHA 2NZ8A 1ZD3A 1WUYA 2O3RA 4F1KA 1TO1E 4MUYA 3TW8A 1RYFA 3E3MA 2XNSA 3ZLBA 3G2IA 4G8BA 3RIGA 1YKSA 3TMKA 2UUBB 2DPMA 3S7TA 4EAQA 2WTMA 5H4GA 4BKOA 4P7BA 5JIBA 4UM5A 1TZKA 2MSKA 1H0RA 3H05A 4YO7A 1L5VA 1DSSG 4N5IX 1M0TA 1L1QA 1UMKA 4CG2A 1USUA 2VOJA 5HR5A 3ADBA 4NXMB 4Z3KA 3GZNB 4UU1A 1SJ9A 1A5BB 4WLEA 4AAYA 5JXGA 4DJDC 1PR3A 1KXZA 2XVXA 3WWOA 1F4LA 3E3OA 4OXIA 1NMYA 3T3MB 4B83A 5KNCH 2YKGA 1L1RA 3W2GA 5MGNA 4TZ6A 3FCUB 2Z6AA 4Z4FA 1DKQA 4TMWA 1A8QA 1QNLA 2Y4NA 1QTRA 5B1IA 3WIOA 4C0LA 3DXXA 1J8YF 1NXXA 3GG9A 2QZ9A 3PC7A 2WAXA 4D79A 2HLPA 5AM3A 1BTOA 2ZPUA 3BZUA 4Z0NA 4BNFA 3LQRA 3KQPA 4OJNA 2XGOA 2P3QA 3BXHA 1UEIA 2CNWD 4JT9A 2X5XA 4O33A 4AQDA 1DQSA 2J6IA 1V11B 3OCYA 4TRMA 2AJCA 2CXQA 3GFOA 1DAOA 2PT6A 1LS1A 3PP8A 4B75A 2JHGA 4C6RA 1E4OA 4QSMA 1DFIA 3AG5A 3V9AA 3PYXA 1WLSA 5FFNA 3ZZ0A 1W93A 3VYRB 1SWWA 3ZE7A 4R71A 3MUFA 4IIHA 4D9JA 2OO5C 5K4GA 4IV5A 3DZDA 4ARUA 4Z4CA 1P19A 1KYYA 2CV1A 2VNSA 4A2PA 3HLYA 1P7PA 2MINB 2RHDA 2ZRIA 3CCFA 3GROA 4BP9A 1DDGA 4RH0A 3TDNA 1R4NB 4RE5A 5KQGA 1QFZA 3L0BA 1LUAA 5JY6A 3PEEA 2CYCA 1RKVA 2YZNA 1IM5A 2A9FA 3DTNA 5CA0A 3TAXA 1OYVA 4TMYA 1NWCA 1ENYA 5C3MA 3HACA 1PJBA 3IQZA 4YMVA 3DFUA 1D9XA 3D4OA 4BJ3A 3GBPA 4P3NA 2P9FA 5E1MA 4EOGA 3WGLA 4HDRA 2RAUA 2AS0A 1JZQA 1FUIA 3O84A 2HF2A 1L5WA 3PPYA 3TVTA 4BZQA 4GI1A 2VP2A 4DXAA 1OH5A 4EPYA 1E1MA 3FSGD 5CM9C 1MAUA 4X1YB 3G89A 4ZC1A 5A02A 3DWGA 3QTLA 1IMOA 3SIWA 2I7TA 5TQJA 1TKBA 1JR3D 3B6KA 3RAEC 4FFDA 1ULUA 1N8SA 2QN3A 3DBHB 5GJWC 5JROA 2AK3A 4UNIA 3TQHA 1AGRA 3OQBA 5G0WA 1SUEA 3UJAA 4L8LA 3GCGA 4H6WA 1MO5A 1K9SA 3JQAB 1E77A 5F4BA 4AG5A 2P6MA 5IJWA 1T1IA 3A3NA 1TVKA 2Z6QA 5CT9A 3E3NA 4JSTA 1JA9A 4M9XA 4HQRA 2A14A 1E6UA 3N5KA 1XCJA 4F3RA 4OLBA 3WRXA 1W88B 3NTXA 3USES 4UBNA 4TT3A 2CFIA 1FUYB 4JJKA 2O8BB 3HXKA 2QPLA 1LA2A 2QTLA 2YVAA 3KOXA 1HXHA 5IW8A 1HH4A 4ZOLA 1IJEA 3RGGA 2LWIA 5F2EA 3ZGVA 1M2NA 4IL5A 1W0KD 4Q4AB 4JJ7A 4JUDX 4UD6A 1RYZA 4U2FA 1N0VC 3RHZA 2IX3A 2HR1A 1LV8A 5CLHA 4J76A 3L6RA 4AKIA 3IVGA 4J7AA 4BKRA 4WBXC 4IHJB 5H7XA 1NNI1 4XR9A 3GLFA 1NNEA 1P0MA 3CVWA 5A71A 4OX9Y 1TQHA 5DZSA 1VFNA 3EWIA 1P39A 5HILA 1XTPA 3FUVA 4DV6B 4FT4A 2XSZD 1LY1A 1MAVA 2FGJA 2C9OA 4I1YA 4ONEA 1P3DA 5EWMB 2BKVA 5JPIA 5IASA 5AVUA 4MHTA 4MPPA 1IVNA 4IGIA 4J4BA 1DZ3A 1K75A 1YF3A 1F5NA 1ZN9A 3I09A 2NXNA 5F35A 5HWSA 3W5CA 4PF1A 1N5MA 4RIFA 4A27A 5CIYA 2VDUE 4MOWA 4CGZA 4NYMR 3RYHB 3M5PA 1VYTA 3K73O 5M34A 1L4HA 3ULKA 4BQFA 5EIEA 2CN1A 4JP3A 4MJXA 5BR1A 1M2OA 4X90A 2O52A 2XITA 3A58B 3M8KA 3PNOA 4CVNA 2QB5A 4WZBE 3CJTA 3H84A 4ND8A 3HNRA 2VR1A 3ANTA 4M1ZA 3WB0A 3K0FA 3G2QA 1ZCAA 1CHDA 3A9CA 1DC6A 3T7RA 3A6PC 1LCIA 1IOVA 4QGFA 3U4CA 5G0SA 3EB9A 4FFMA 5L4NA 4H77A 1V6CA 4I0WB 1P77A 2J9YB 3I30X 3X3HA 4OQFA 4WTOA 4I8XA 3WLJA 1YXMA 2YXEA 4MR8B 4YASA 5CDFE 2IGTA 4OKIA 4X54A 1GHTA 1VHJA 4L2IB 4JYZA 1J33A 2SCUA 4QXOA 1OAOC 4AW9A 5EWJB 4ALIA 1II9A 3MVEA 4WI1A 3QWIA 1J0BA 5F1YA 4GYJA 2Q2WA 4WNAA 1T0JB 2Y1FA 2XMPA 5DTJA 1QYXA 1EUYA 4YQFA 5FCDA 1BCRA 5ED4A 5JWOA 1QHHA 1XKLA 3EOZA 4S35A 3KPUA 4MW0A 1IATA 3D43A 3MTIA 2DR0A 4HNRA 4IJKA 4H7PA 1C2TA 5EHNA 5BORA 1ADJA 4G0PA 2XUPA 4INJA 1E2QA 1QLHA 1Z2EA 3FOCA 1TYDE 3KD2A 1JDTA 3U3DA 5FWNA 5A9SA 2X9LA 4HTAA 3WK9A 5D7BA 4M89A 1CZHA 3FLEA 1SOMA 3F78A 1GKLA 2VYCA 3QHQA 2E5WA 4IG9A 4E30A 3FMOB 3D7MA 4OYHA 5BRJA 3H8WA 4IIVA 1IUPA 4L6IA 1SXJD 4QO8A 1YVDA 1IZZA 1KYTA 4YREA 2CD9A 5ALRA 3WFZA 1BOFA 2XMSA 3AUJB 3K35A 4IUCS 4LRWA 4J2OA 5KYWA 1PR2A 3E70C 4Y30A 3O9ZA 1C9MA 3O0TA 4OH7A 4ZMBA 2DLDA 5KOYA 3HLTA 2IYPA 3R3JA 4YPOA 4JD5A 3WB2A 2D0DA 1NKSA 2A9RA 5EPEA 3LY7A 4BMPB 4F7WA 3Q3VA 1W73A 4MK4A 4RWZA 1BA3A 4PZ9A 4ARVA 4LOIA 3FKQA 2DFDA 3WGMA 4CMEC 3QITA 3PQ6A 5K0FA 1S5PA 5FO1A 2PPLA 1RE1A 4INAA 1H9AA 1CEYA 1WVGA 1PDWA 3DAGA 1F14A 2AQHA 1XTKA 2D2FA 4N6OA 4D4LA 5D01A 1G9XA 5FPTA 1GCOA 1HT0A 1Z29A 3EPJA 2ZZNA 1NTOA 5ELMA 3PR2B 1LVUA 4IWXA 3THOA 3VUFA 4NOMA 1ORWA 3WB1A 3D7LA 3ZHYA 1PJQA 3PQFA 5DN6A 3IKTA 1X7YB 2HQOA 4BNDA 1KAQA 4LIPD 1JV2B 4YJHA 5DYIA 1TCCA 4OLFA 1UPAA 3P94A 5H82A 5EJ9A 1AMOA 4ZGBA 3H1TA 4KGVA 1PJ4A 5LXTA 4CEJB 1X7WA 1QRSA 4JUCA 3F4BA 1IG3A 1MOZA 4NABA 2HSWA 2LE0A 3VC3A 2QD5A 4HLDA 1MOQA 4HQFA 3ILHA 1C3OA 2ID9A 4FYYA 5IBRA 4D6YA 2C7RA 4MVYA 3PFHA 2BSQA 5E9WA 2GFIA 3VTFA 1I7DA 4JUAA 1ND6A 4GVXA 1TMKA 4GPEA 2HTFA 4TQAA 4U9IS 3AB8A 2QR2A 4A6DA 3O8OA 3KUKA 3L6CA 2BMAA 4LRQA 4CLOB 1WMAA 3EPLA 3M33A 1ZA2A 4CLRA 5IJ9A 2ZSKA 4ENRA 3DB2A 2BE7A 2EIXA 2H2AA 3LUCA 2J46A 2XECA 3OKFA 2Q1SA 4K0KB 1B14A 1FFEA 3AUTA 2ECOA 1RLOA 4HX9A 3PE3A 3TUIC 1XWFA 1GDTA 3FVQA 2XTJA 5J58A 2Q8PA 1FX0A 1K0UA 1RTKA 4DTCA 1XDZA 1S7GA 3ZJVA 1V8DA 1NP7A 4LBYA 3GVXA 5PGMA 3HWX1 1V3VA 3M4NA 1RWVA 3PGVA 4DQUA 3KJGA 5AKIA 2H59A 2IXAA 1R0ZA 2QAGB 4GMHA 3UG6A 2A0YA 2NO1A 4WPGA 2FEWB 4RMHA 5BMOA 1PRYA 2A84A 3W2HA 2LIPA 2ZR9A 4GMKA 1L3BA 3OOJA 4RJ2A 8OHMA 1WXQA 3NJ8A 4X7MA 5TS3A 1MTZA 2FDXA 4YH1A 4DMMA 5JR3A 2HNKA 5C8XA 3G13A 2QRQA 2OY0A 4AJIA 3D8TA 2FSVA 5ALDA 2VJAA 3EZ9A 3NBMA 1B3BA 4EVRA 1C0PA 2DTDA 1CEQA 3L1KA 3VYUB 1XIVA 3EIEA 2DT5A 1IG0A 3FRJA 3BM5A 4ECAA 3FN4A 4AJJA 1D1TA 1FA9A 3Q3IA 1ODJA 2QE7D 1IQUA 1JXAA 2WJAA 3MOGA 4OK3A 4QDXA 4ZPXA 1Z13A 5B57C 2R48A 1A3CA 2HHJA 2JJQA 2JFWA 3GEBA 3Q2OA 3R0XA 5C7IO 4LDJA 3EC7A 1M2VB 1QGED 3DGEC 3GLHB 1DC3A 1FYEA 3I0ZA 2DWQA 1QYWA 4WOBA 1BROA 3AM3A 3FB1A 1D03A 5EYPA 1GSOA 4ANFA 1T1JA 4OHZA 4DIEA 2PR7A 4A03A 4ETIA 2G4LA 2CNDA 4FD3A 5FTLA 4B2IA 5T4FA 4WJZA 1ILWA 4OGWA 2WTXA 3O8NA 4IEEA 3NORA 1AKVA 2NAPA 3X44A 4OB7A 4PW0A 1PEYA 3CX4A 2UYCA 1HZZC 1WMEA 5I48A 1T2FA 1I3LA 5G40A 4Y6GB 4C3UA 1P45A 3JATA 1YK1A 4EMBA 4L3VA 1P9RA 3K8ZA 3N76A 1USGA 1YOVB 1ISSA 3FGOA 1TCUA 4QM6A 1QFSA 4B6FA 3WIEA 1ULBA 1NT4A 4MO2A 4JBIA 4BQPA 4MV7A 2HK8A 5EJEA 2C1ZA 4LHVA 4YJ3F 4R1SA 4C1NA 1GN8A 3ND7A 4M9UA 5DYTA 3KYCA 4DB2A 2OAEA 3JV7A 2YVKA 3TPZA 4H7HA 4MYCA 4RV5A 5LP6A 1Z2DA 2UZIR 4DRZA 3LVRE 1SVMA 1B8OA 2WSMA 3HPRA 3W90A 2VHCA 1IE3A 4DQ0A 1B16A 5CFQA 1WXXA 3T1OA 2AR9A 4X6LA 4M49A 3V4FA 4R6XA 3VXKA 1E9EA 4WFKA 1E3QA 3L1UA 2XB2A 1KH1A 1ZICA 1AQLA 5BSKA 3CWQA 3AGQA 3KD3A 1QORA 3DDSA 3NRJA 1TM5E 4CNQA 2ODTX 1VYHA 4GGOA 3F7OA 4BBAA 2W70A 3EF0A 2IPMA 3IIEA 4H18A 1PT6A 4FC7A 4HOYA 2G1PA 1OX4A 1KS2A 5AW2A 1KNQA 4P54A 1PF7E 1L4BA 1TYAE 4OA5A 2WP8J 4IFBA 4UAGA 4DUZB 3FLAA 5LFAA 3CMMA 4FXOA 4R1OA 5LB2A 1B4DA 4HN2A 2QM7A 2WM3A 1NSFA 2NSDA 2G88A 5AK6A 1FRVA 3PSHA 2BGLA 3LUDA 3U3MA 3MHPA 1SRRA 3O7MA 4LYYA 4MPJA 4DM7A 3NNNA 4V0NA 4W5QA 2CV0A 4P9NA 3OTHA 3CONA 4G23A 5EHXA 3K70B 4HDKB 4RJIA 3IQHX 1ZW6A 3ETHA 4A2CA 3O3MB 3SKXA 2RG7A 1IONA 4BB0A 1SQ5A 3IO3A 3L84A 3PNPA 5FI3A 1V71A 1WF3A 4JJIA 4N6GA 3GWZA 4MARA 4YIKA 3TNFA 3UB2A 3T41A 1JFLA 1YJCA 4TV8A 2ONCA 3OHMA 4ZVLA 4YY3B 1T3HA 1Y3DE 4FR0A 4KV7A 2EZUA 1DLIA 5CFPA 4MDYA 3GJ4A 1GPJA 2V74B 3WOHA 2PKYX 1DKNA 2MSLA 2VA8A 4RQAA 2OB1A 1QYIA 5G2OA 5JFTA 5TF4A 4W5RA 2OD2A 3E3LA 1Y48E 3GNLA 1S01A 3WDKA 3OQOA 3AEUB 4S0ZA 1HLPA 1NI4A 3L7NA 2QGNA 3PD7A 1Y7IA 5JXHA 1JFSA 4BMVA 3HCBA 1CUYA 3AOGA 3P4YA 2J9FA 2SKCA 5DXJA 1O0SA 4NDZA 3UQZA 1JDPA 1R16A 4M36A 1TZCA 4TWJA 1KSJA 1JFFA 3D81A 3T7CA 2REQA 3GDFA 4Q3NA 2CZCA 3MS7A 3CY6A 3DNMA 3STTA 2LIVA 4MV4A 2DWOA 1DJQA 2VS1A 5TPWB 1TGYA 3AETB 3AHHA 3C1UA 1P8AA 4OQMA 1TTTA 2UUCB 1ACLA 1W2HA 3IURA 3NEJA 5HMMA 4R40A 4TKUA 4Q9HA 3BFKA 1RLUA 1AN9A 4QTYA 4EY6A 2O2YA 4JLJA 2DPLA 1JQAA 2DQYA 3C16C 3CUKA 2WJZB 3OJLA 3ISVA 4PG6A 1NY5A 3LGXA 4IIBA 5H9VA 1MENA 4Q66C 1QIGA 5I7HA 3IIKA 4AJPA 4S1OA 3KEOA 3ZU6A 2AI2A 4GXNA 4KVGA 1CYEA 5I9SA 3A4LA 2R7AA 3ORQA 1JE1A 2BV3A 2MSEB 1YJXA 4B0PA 1Z4PX 4AYWA 5A4KA 2WWTA 2BUBA 2PH1A 1ADGA 3QVGB 1KVUA 5ITWA 3S2YA 4RH1A 1XRRA 5DBEX 3QG5A 3ZI7A 3QKSB 2IEGA 1GCUA 3GUZA 2AG6A 4IVRA 1WNTA 3NHJA 1YIDA 1R6BX 3ABZA 1CR0A 4XX0A 4NATA 1YFLA 3UBMA 2QT9A 2I0FA 2C9BA 4QATA 3DOIA 3RK1A 3T9BA 2CSXA 1N5JA 3GRVA 1CZKA 1JKFA 1ODIA 4J75A 1KDZA 5LZ9A 6ADHA 4H35A 1KSHA 2HGSA 2ZBDA 2HCRA 2P2GA 4WBSA 5C18A 3RBZA 4TKVA 4JROA 2OGWA 1E2HA 3RBXA 1ISJA 1C0LA 2BEVB 3G8BA 3JARB 1ZH2A 4DBLC 1L5FA 3JASB 2YBEA 3QFTA 3OEEA 2QQ0A 1HSZA 3GD7A 5JS8A 3WK8A 4LZOA 2R2GA 2ZQ5A 1B0UA 2YZKA 2AWOA 3ZGXA 4KR3A 4XB6B 2ZJ6A 3E27A 5CXSA 2UUOA 3MJHA 3CPSA 4NFHA 4J90A 3R75A 1XK6A 3ZLVA 1KFKB 1UWKA 1LBTA 1TAGA 2JF0A 4PIVA 3RDPA 5HUHA 4EB8A 1X14A 2IVZA 1XAJA 1E9VA 3WRXC 4TYYA 2GO1A 1WUJS 2H1IA 5CVTA 4RMNA 2FUKA 1LLDA 2LGJA 3Q2IA 2DFNA 1IVSA 5AM5A 3FRHA 1SCIA 4RJLA 2B6HA 4TMKA 4Z8XA 1JA1A 3KKMA 4W6QA 3V8QA 1UXGA 2ZRKA 3WGYA 3KVOA 4M0PA 2QORA 2QT0A 4RC9A 5KWJA 2WD9A 1O96A 3PIIA 2IHZA 3KSRA 5JNTA 3BFXA 1R7RA 2O1SA 4FCTA 3A6EA 2JZNA 3M6FA 4P2BA 2WC1A 5L3RA 4QDOA 1SU7A 2QRLA 1CUHA 1QIMA 3I39X 5DT9A 3KTDA 1EX9A 5KVAA 2AE2A 4IIDA 2DLCX 4CJXA 3NYQA 4HO1X 3E48A 1X7ZA 3GYBA 2CYBA 2ORYA 4MYDA 5BMVA 4RDIA 1C0EA 3M1AA 3QXHA 5L6LB 2D4AA 2AZ4A 3VNUA 4BNGA 2QLNA 3LJKA 2V97A 3TLXA 4Q9KA 4DTIA 5J2UF 1G3IA 5C9ZA 3JSAA 5FV4A 3E03A 3ZUPA 1SC3A 2M32A 5FI5A 3L43A 3G9TA 3MINA 4OBXA 4UUQA 5AFSA 1D4ZA 3AY3A 4GQIA 3C41J 3E9EA 3IV9A 3MUNA 1T8RA 3G7UA 2I55A 4KO4S 5LA6F 4EUHA 2LKDA 2C2YA 1N32B 4OXNA 4AO8A 4PV7A 5REQA 2BTEA 5DGIA 1RBMA 3AKEA 3NM6B 4QJIA 1ZAYA 1KFCB 4Q9DA 3ZXUB 3CB4A 4H0NA 4X62B 4AMVA 4X95A 3AI1A 1GUZA 3G0DA 5JV5A 4OFBA 2X6QA 1HL7A 3CUYA 3F2IA 4AUKA 4BJ1A 3ZE8A 2O20A 5JQGF 1HF3A 1KEVA 3N39C 2NTYC 2OCGA 3MB8A 3JQAD 3QHAA 4JENA 2IYUA 1MNAA 4CIYA 1EU1A 3GIWA 1C3VA 1U31A 3DDUA 4UBKA 4AMZA 4KPGA 4N5NA 2MTBA 1R0KA 3UMCA 1AS3A 1RJ9B 2ZAOA 3L79A 4QUHA 2VRNA 1UFKA 1QAQA 2GTPA 3PXXA 5BRAA 1G6KA 4UUNA 1CB0A 3HA7A 3UHOA 2OV6A 2AUMA 3E7PA 3Q87B 4F6CA 1A97A 4MYHA 1Y1LA 2ZKLA 4BO9A 3REQB 2GKOA 1SXJE 1BSVA 1MAHA 2KSQA 2Q5LA 5I7EA 3EWAA 3LMKA 3V1TC 3GLQA 4B6EA 5C3UA 4G84A 4B4OA 3D59A 3QE4A 4JBXA 2GCOA 4YRIA 3HB7A 1M2FA 1NQWA 3K5HA 3TBHA 2R4UA 2AMLA 3BG5A 1JDNA 5EMMA 5JFOA 4YBRA 2XXAB 4CM5A 3C5WP 4ZA2A 4A5OA 4RK4A 5FWXA 2WJVA 2ZT7A 2Z2JA 1MEOA 3CB2A 3PL1A 3WK4A 2D2EA 1Q14A 2G1UA 3FMIA 3OESA 2FZKA 4R41A 3VHXB 1E1CB 3SXPA 1BEEA 2HU2A 4MGZR 5CYPA 4KUHA 3KRTA 1KVTA 3D6MA 3MRXA 1IB6A 2PYZA 4RM3A 1O8BA 3UJBA 3HKCB 5K6AC 3C14C 4R98A 5K8IA 3BL8A 4B8ZA 1ATZA 2H4JA 5ALIA 4AY2A 5MN5A 1PSWA 3I1FA 3KQYA 2ACWA 4DA9A 3SQNA 2YNMA 2X5JO 1NOIA 2Q4OA 1X92A 3DCIA 5TJHA 1H3NA 5A6VA 2E4UA 3DEYX 1OU4A 1DTWB 3ZTWA 4G0XA 2BAGA 2HNAA 2WPNA 1C7ZA 1EFUA 2DWCA 4KO8A 1BN7A 3JVEA 4I7EA 1DRJA 4OL0A 3P19A 3ZHRA 1Z6PA 3AVXA 1WMDA 3EC2A 2FU5C 2ZI7A 2GPYA 3B13B 3K0AB 3CFYA 3PFGA 1M1YA 3FPKA 4UHDA 2EG5A 4KX3A 4JR1A 1BG6A 4LI3X 4O2RA 3T5PA 4EO7A 4AJKA 2IIBA 1E2JA 1TW2A 2CFCA 4WJKB 3E9RA 3VNQA 2FMKA 1ESEA 1OE0A 1UC4B 4PFJA 3TOZA 2Y1CA 1OV6A 1OX5A 2ZTSA 4FSHA 4MICA 5BYJA 5D3MA 2RHBA 3T3PB 3W9SA 1CF9A 2X9NA 1GUYA 3OQJA 1ZLYA 5C8YA 3ZKAA 2Z56A 1ZXLA 2GPSA 3AQIA 3PKZA 4WN3A 4INPA 4OFXA 4AM8A 4ZYVA 2L17A 5KTTA 2SKEA 1D04A 1XJWA 1TZBA 1EAYA 4MMXB 3I04M 4WZAE 3SZOA 4DA6A 3TE6A 4DLLA 3WLOA 1H6CA 1VE5A 3G59A 4KXYA 5IARA 4QE3A 5KWVA 2ZSBA 4KWCA 4LX8A 4NENB 1Y63A 1POXA 3A6JA 4ZZ3A 1V96A 1R0BA 2DULA 1CYDA 3AONB 3ELBA 3IVAA 3PQ4A 3UCEA 2PE5A 3MAAC 4IVQA 3Q5GA 1MIHA 5LOVF 3ZR4B 4WLUA 4DNOA 5JNRA 3WLFA 4OHOA 1VCOA 3TUZC 4JVOA 3L0YA 3GG2A 2IW1A 1DAMA 3ZC3A 4XWKA 5C7LO 2E5LB 1W0JD 2IHYA 2QL9A 1LQUA 1SXQA 2PSEA 4HEA1 4Y7CA 1JNXX 1MB0A 4FHEA 5AVKA 2V6BA 4MEAA 1QGOA 2ZTUA 3W6UA 2B20A 2QVYX 3I1JA 4ALNA 2QSJA 4TN1A 4QXRA 1G8SA 1TE2A 3KQMA 4UZFA 1L8OA 3TDMA 3ZDXB 3ZJYA 1T1EA 5AXDA 4C5BA 3K8QA 5ADUS 1XXHB 2ZIXB 3QELA 5JS6A 1EDOA 5J47A 5KSWB 4I1IA 4JV5B 3SF0A 1VMDA 3P0IA 1AXRA 4J0EA 1Z5VA 3U4QA 3DHVA 3HDYA 5EUQB 1QHYA 4X92A 2R6HA 2E21A 3JD1A 1Z15A 1G8PA 3NBFA 5AW5A 3X1XA 2DPYA 9ATCA 2AOUB 3GLSA 1A0OA 1CVIA 2RAPA 3G2OA 4FZVA 2YJ5A 4AY3A 2B0JA 3G0CA 3H7AA 4H7IA 2YHAA 2C29D 2IYRA 3MGBA 4LGCA 3R8XA 2Q62A 3WGHA 1BFUA 3W9UA 7ABPA 4O2BB 4BYMA 3BK1A 2I2CA 1IH8A 1GG8A 4J7CA 3IQGX 2WY2D 2AN1A 1XNQB 3GJ3A 3WX0A 3VHLB 1B15A 2PV0A 2Q3DA 4ND6A 1WUIS 1QH8A 1T0IA 4DZZA 2Z5FA 3E1KA 4CF4A 4EA8A 2GPTA 2I6XA 2J3EA 4DY6A 1ZVQA 2XI4A 1VI6A 3E7XA 2GZSA 3EGXA 1XVVA 1BN6A 1E1RA 3HP4A 1NQXA 4ZZ0A 1PT9A 3FSJX 1WPXA 3Q8XB 2GAIA 3GPCA 3SVZA 3ONEA 3HDHA 3QBEA 1FZQA 3T9CA 3T9FA 3QSGA 4RK7A 1WKBA 4C4ZA 3BRQA 3S7ZA 1Q0RA 3ZIAD 1IJKA 4KIJA 2PH5A 2PSDA 2FW0A 1T2DA 3KS9A 5FUXA 1Z6GA 3JRWA 1S9DA 1OUMA 2DE0X 5PNTA 3CXRA 2ZBRA 4EI9A 1R6VA 4JLOA 3P20A 2IDJA 4XA8A 3KR2A 1SBIA 3DAFA 3LXRA 4R2WA 2ZBPA 3CUTA 4BKPA 1LDGA 4LKRA 4L3WA 3JQ8A 3STUA 4D9BA 3ASZA 3OO1A 4Q1FA 1ZKDA 1YNOA 1KMHA 4OTZA 1FDVA 4QAQA 4QPJC 4U5QA 5FJIA 3OZEA 2B83A 2UXDB 3AWDA 1XEWX 2QG6A 3T9EA 4YRNA 1O5OA 4BO6A 3UAOA 2BEUA 2AGVA 1Z63A 4EW6A 1V4VA 2WWWA 4JJFA 4E5SA 1SHUX 1KBQA 4RDHA 1O9HA 3GFVA 3DHNA 3ZKWA 1X8XA 2ZI5A 1R9JA 4G9EA 4PC1A 1XQVA 4NONA 3S2FA 1XPOA 1JYEA 3EXHC 4M9QA 3L07A 1BS9A 1HDGO 2PGLA 2YY5A 1T8PA 5GONA 1Z0FA 4TLMB 4NNOA 5HIJA 3GFTA 3KJQA 3ND9A 4D9HA 3BAZA 1NRJB 3LCUA 4IJMA 4OJTA 3U3OA 2IU6A 4ZVOA 4MLDA 2BGJA 1RPZA 3PDCA 3DEZA 1QV6A 3DDCA 4YI5A 1UKYA 3MJVA 3DLTA 4NU6A 1C8KA 3V97A 4DW8A 3SU8A 4X97A 1GVHA 3R9XB 2Q1UA 2O2SA 3EPRA 3I6IA 2GBLC 3IQIX 4KLRA 2PTHA 1AZSC 4FOPA 1L1FA 2XMRA 1KF0A 1JEAA 1II8A 3AEQA 2JGFA 4ZU3A 1J23A 3RSLA 5BV7A 4DR7B 4OJQA 1C1XB 2QY9A 5E95A 4S3MA 4ZYYA 4RIHA 5EJ7A 1ZHHA 3EVBA 1TJ3A 3PLRA 3RRNA 1I33A 3PUYA 5FBWB 3SYTA 4MP8A 1GADO 3G8DA 3TR6A 4AY4A 4H1WA 2CJXA 5LQDA 3AVUA 4WXEA 3T12A 2IYWA 2XB4A 3A31A 3CINA 4JOQA 2FLKA 4QJ3A 5KTRA 2XVMA 2HCBA 4G0YA 4PSDA 2R8RA 4G5GA 3IMGA 1CR4A 1RU3A 3H1FA 3QU9A 4AMYA 3V1MA 4U4AA 5CEJA 4D8VA 1KY5A 2NZJA 2QVCA 3ENWA 1EGHA 3E9MA 4IHJF 3LLSA 2VAXA 4FDVA 3PZRA 4P86A 3CUVA 3DS8A 2NOAA 2R79A 5GJBA 4E2FA 1H2ZA 4UHKA 1MC1A 3BRWD 2JFHA 3AR6A 5COQA 4MRRA 2OGTA 4PO1A 3OEWA 3P9IA 4NH4A 2H3EA 5AI6A 1W6RA 2WV9A 3BK2A 4LSZA 1K6JA 1PJLA 3AF1A 1N0IA 2E1PA 5B58C 1C9EA 1KZHA 1EQ2A 3H7IA 4JZKA 2J0UA 1WULS 1WXEA 2UZ1A 2VHTA 3IRUA 3NASA 4MKFA 4OFWA 4HNVA 5TQ0A 4GEKA 1FDOA 1JKMA 1UXIA 4MKGA 3WICA 1SUBA 4JBNA 1GKIA 3A1EA 2JJ1A 2FPSA 1QB8A 3D9QX 4YI3A 1TW3A 3BN3A 4D4JA 2XOKA 2C1XA 5B2FA 5IZCA 3OKAA 5BQFA 1EK6A 1JHVA 4ZAXA 3B2NA 1DC5A 3VOTA 3SBXA 5A5DA 4YDRA 3LWNA 1JVSA 3SDSA 4HLCA 3WRVA 1FUKA 1JJBA 2A88A 5GP1A 3ESXA 1ZD2P 1JN0A 2QMEA 3FDZA 4GPAA 2EV9A 3HABA 1CIVA 1N6NA 1CHNA 3DC2A 1INLA 2GN2A 5HF6A 1T2NA 4DREA 1P7VA 1Q6ZA 7MDHA 3VZDA 3IAM1 1K92A 5BT9A 5ITZB 4AY5A 3SEQA 3DBRA 4FLEA 4BRZA 3BB4A 1U8UA 3F7TA 5C52B 2R85A 3U26A 2IBSA 3E4CA 5TXGA 3M6VA 3LA8A 4LQCA 4LFAB 4TL7A 2KWIA 2NZYA 3TVYA 5E9AA 2VG8A 2JNWA 3A0UA 2PGOA 2EP5A 2EX4A 2REOA 3GJ6A 2IH4A 5CX1A 1LI7A 1DADA 2XZTA 5KJFA 2OV1A 2IJGX 2QROA 3L1JA 4CL2A 3DBLB 1AZWA 1Z2OX 2GK4A 3ROZA 1K66A 3QEOA 1BVYF 1ZMTA 3K70D 2BRUA 1JS1X 5CBPB 2Q5QA 4TUYA 5T5QA 3D0OA 1C0KA 1L7XA 2I22A 3NHWA 1ISFA 3T15A 4QWMA 1M34E 4C3ZA 1X7DA 2HBZA 2Q2OA 1Z45A 2HDNB 4K9OA 4FIZA 4QHSA 4KVAA 1XZIA 1DRVA 3A32A 5K0LA 1NG1A 2G0TA 5FLXA 4UVIA 1JA0A 1WJGA 1Y1SA 4BO3A 5JZOA 4RABA 3ZHBA 1M73E 1CKEA 1JMYA 4QXQA 4A8TA 3PS9A 1ZH8A 1ZGBA 2RIRA 2EXXA 2Q21A 4LNUA 2G71A 2PUHA 1U1EA 2AVDA 2I1LA 4NG5A 4PLTA 1CNFA 4J1TA 1BKYA 2VAVA 3CJQA 2HMYB 1X15A 3EG9A 4ZOCA 1JQ5A 1PSDA 3NC4A 5EEGA 3RNLA 3HS3A 1L8XA 5IHPA 5KTNA 2Z4SA 2J4DA 4YXWD 1U0RA 1GT91 4AF6A 3DTVB 4QT4A 5F78A 3IQEA 1F3LA 2HA6A 3QYFA 3TRFA 1FYWA 3OMWA 3GP8A 3H9JA 1YBAA 2GZAA 3QKTA 2AOVA 1MB4A 1N5OX 1Y7HA 3TOCA 3K0CA 3L4BA 4A6XA 3S5UA 1AC5A 3G9ZA 3AKDA 1HTBA 4LVNA 1CJUC 2F3RA 4NG4A 4UCFA 4TRNA 5KVCA 4ARZA 2ZRPA 1WQ1R 1LC0A 2V9ZA 4A0HA 5KKAA 2COKA 2XJ9A 1FVFA 3JTMA 5JAZA 5ALVA 3LFTA 1U2DC 2V7PA 4P3KA 4H3SA 3GLGB 1KI3A 3D0KA 4P3OA 3W5UA 2F9MA 2Y0DA 3U7IA 1TPZA 3KFLA 4GE3A 4QUAA 3U61B 1HV8A 1UXJA 2BELA 5FH9A 1AZTA 1DELA 2EAUA 4INZA 4ZANA 4BGDA 3C1OA 3HP1A 4E15A 1F2TB 3UA4A 3KOUA 4A82A 1FUEA 4MLCA 3FWYA 4JQYA 2QG9A 3ZD9A 4BQRA 1XZCA 1PJ2A 3DHEA 1Q1QA 2DJ5A 4WVFA 1SNYA 3SXUA 3ZIDA 1XF1A 2ATIA 5TQ2B 1E7RA 2XQJA 4Q7JB 4JI2B 2FN3A 3STVA 2Z9DA 3OLZA 2DHDA 1ID8A 1W35A 1QGAA 1Y89A 1PNTA 1L0BA 2IS1A 3TIFA 3MMZA 4O8CA 1VBMA 3VO9A 3ESQA 4RSGA 1FU8A 1LW6E 2O3JA 1C80A 2VYVA 2GASA 2W4MA 4IH4A 4P31A 5JTUA 5TQVA 3KLPX 1UJNA 1XSEA 3BERA 2ZG6A 4EL5A 4TS9A 2C97A 3W77A 2CWDA 2JJMA 1SVNA 1JJIA 3CLKA 4R1QA 1GZUA 2WJIA 3OTIA 4IO1A 4MLPA 1EXWA 2QIOA 3DOFA 3PVZA 4YRZA 1BFKA 1OBHA 3H18A 3AUSA 3K53A 4JLVA 5M2QA 1R9NA 2AEJA 2FK8A 4MQMA 1B8UA 2OHIA 4ZCQA 1P18A 3TLAA 2H7VA 3TCXB 2MOKA 2NXWA 1M72A 4LA4A 1QTIA 5H4HA 5ICCA 1NMEA 1Z6QA 3SR3A 5IM4F 4CN8A 3WLNA 1DIRA 4RSHA 1BZYA 2CUTA 5JARA 1AXGA 1JZSA 3GMDA 3NVDA 2WJJA 5B2ZA 2GB4A 1TYZA 1TF7A 5F1KA 4AN0A 2HDHA 3SNHA 1AV6A 1K4MA 4ZYWA 2H2DA 4PS0A 4YBZA 4AQ7A 3ROGA 1FFXA 3TZLA 4PR0A 4R4JA 1ZVMA 3FPHA 1C9KA 2PEZA 1UBEA 2R7NA 2V98A 2F1JA 3K9LA 4MVCA 4O4LB 5AJWA 4AP9A 3NDIA 4F2PA 3BSSA 3FPLA 2BYTA 1QRAA 4U0JA 4K6GA 4EP1A 5I7RA 1ADFA 3CSUA 7MHTA 1FS4A 1GT6A 3UAYA 3CT6A 2PGDA 2W90A 2YNMC 5IYZA 4FOTA 6GPBA 4MRVA 1DXQA 3VH3A 3GEEA 1UKZA 2JFGA 3JYOA 4KC0A 5HG0A 9MHTA 5I6DA 3ZV3A 3M82A 2P68A 3UAVA 821PA 3WBJA 3WKCA 4K0RA 5CJ2A 5JYEA 2HIAA 5KYVA 5JCJD 2YWFA 3VNAA 2Y4OA 2J5XA 2EWMA 2YYYA 4MUNA 3FFBA 4HQLA 2QW1A 3WQQA 3G7SA 3NM5A 1WWKA 1M2KA 2HU5A 2YWBA 2ZBQA 4V38A 5H80A 5BSUA 2IYOA 3PWSA 1G6OA 5J2TB 5LJIA 3COVA 3T7IA 1P4GA 2BTOA 1VJDA 3FX2A 4US0R 3BF7A 3IBSA 1DKPA 3F6PA 1B2RA 2LTAA 4L75A 4LMPA 4MVJE 3HCCA 2OQVA 1ZWKA 2A3RA 3ZX4A 1L5HB 4RKFA 4OXYA 1D2MA 3TQOA 1LQ2A 4NCBA 1NR5A 4JN6B 1J8DA 1FTYA 1U2SA 1EX7A 3W3AH 1FJHA 4QQFA 5F3RA 1ISRA 4RENA 3K5WA 1G8MA 4FFBA 3MRSA 3C6MA 3QXSA 3K6SB 4LOAA 2ZS9A 4E1VA 4HDSB 4RTQA 1I4DD 3IR6A 2CXRA 2R8BA 2VJKA 2V9PA 3JQDA 4PPYA 4RPJA 4HXGA 3S3TA 2HDOA 2HQRA 3CF4G 1ZN8A 2BMVA 3FOFC 3QVMA 3UHFA 3IE2A 2R5WA 3P52A 3W5IA 1E63A 3BL5A 4ZVUA 4TTIA 1ST3A 2R87A 4M3NA 5ES3A 1W49A 2F3TA 5JSHA 1Z06A 3MJCA 3DV0A 3ZY2A 1YMVA 2C83A 3AY0A