2PO5A

Crystal structure of human ferrochelatase mutant with his 263 replaced by cys
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSACSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Altered orientation of active site residues in variants of human ferrochelatase. Evidence for a hydrogen bond network involved in catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Ferrochelatase, mitochondrial
total genus 138
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2po5A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2po5A01
2AC4A 2H1WA 4KLRA 2PO7A 2PO5A 2QD4A 2QD3A 2Q2OA 2XVYA 3HCRA 2XWQA 1C1HA 3W1WA 2AC2A 2XWSA 4F4DA 2XWPA 3M4ZA 2HRCA 2C8JA 2QD5A 1AK1A 2Q3JA 4CCSA 4KMMA 1HRKA 2Q2NA 2XVXA 2HREA 2PNJA 3LYHA 2JH3A 3HCOA 3HCPA 4MK4A 1DOZA 1LD3A 3GOQA 2QD1A 2H1VA 3AQIA 1TJNA 4KLAA 2XVZA 2HK6A 3HCNA 1L8XA 1LBQA 1C9EA 2DJ5A 1N0IA 1QGOA 4KLCA 2QD2A
chains in the Genus database with same CATH superfamily
1AQIA 4N12A 4PYQA 2QQFA 5JCXA 2PKWA 4XEUA 1TD1A 2IH4A 3E3MA 1VE1A 1R5OA 1RWNA 1J0AA 1XZCA 3IAHA 4JUAA 4TV9A 5FDFA 1TE2A 4MMYB 4B3SB 1D6SA 4NV0A 4OXRA 3V8EA 1N2CA 3B8EA 1WCYA 1OLSA 1TJ5A 4B4UA 3GK3A 3Q8XB 3FVRA 3H1FA 4H35A 3FCSB 4MA5A 4QYSA 2DOKA 1F8XA 3LL4A 3ZE2B 1MIOA 1FPQA 1VQ1A 3UA3A 3AUXA 3I1IA 1FW6A 4F91B 1ZXLA 3OG9A 4OHCA 3RWBA 3ILXA 2ARKA 1ATIA 2JJ2D 2XT0A 1S2MA 3DLIA 1Y0BA 1INLA 1FB5A 1KAGA 2GYWA 2HMYB 2RKOA 4JBYA 3UGKA 3V7YA 2J5BA 5CRIA 1Z6AA 2HRBA 4K6OA 4AMGA 4JI6B 4IDQA 3V1MA 1Y3AA 3R5JA 2HV8A 1YOVB 1PEKE 2IYLD 3C6KA 3OI7A 1KZ7B 2JIOA 4KPGA 5F2OA 1C9DB 4OJQA 4DA6A 5EJEA 3IHTA 4C4OA 2V3CC 1V2GA 4PAOA 2AVDA 4PAWA 3BJIC 5EZYB 4DT1A 4YRDA 1KI1A 3A1SA 3WL5A 1IB0A 5H59A 1DLJA 3INNA 4NENA 4C0JA 1CR1A 3GMSA 5I7UA 1E9DA 1U0JA 1DAHA 1DRJA 2AFHA 1W0CA 3AERA 2XXJA 3ENQA 1PL6A 3PHGA 3PP8A 4OUKX 1O2DA 1ORRA 4FHFA 3TSCA 2VDJA 3TW8B 3TL3A 2AXEA 1QLHA 5JCJD 4JI0B 5KX5F 1UKZA 1QCZA 2IS4A 2HIGA 1IEVA 1M74A 5AI6A 3UV3A 3DW1X 1QVVA 3AF3A 3FG9A 2YW2A 3ORHA 3Q5EA 2FUG6 3K92A 4YPFA 4OHFA 4UZSA 2CNBA 4FC7A 3OY7A 4V1CI 3FOFC 1TM2A 3QW2A 1P4GA 4IOLA 1O03A 1OFGA 3ZBUA 4NNPA 3H4VA 1WB5A 4RJ2A 2W7TA 4RVCA 4BMOB 3EEIA 1RQ2A 5ALHA 4MUFA 1B3BA 3TPZA 3VNBA 1VGQA 4AQDA 3DKVA 4TYNA 1PD1A 4FJ0A 5HJEA 3UG7A 4KGZA 4CCSA 1K5PA 3QQ5A 5F9HA 1J8DA 5JTUA 4Y6PA 4RF2A 3WXMA 5AIBA 1U7WA 4QZVA 5HM8A 3IT1A 1IAVA 3QE4A 4X91A 1NYQA 4EBFA 1V5IA 3VVLA 3ZW7A 1Y9AA 3HPQA 4TVBA 1RVV1 1MPTA 2Y68A 2O3QA 3WL6A 1JFSA 2FKNA 3NORA 4L8VA 2UYQA 5AK3A 4RSRA 1I14A 4MQMA 1X1TA 1XAGA 3MB8A 3OZCA 4JUIA 1Y8RA 4D98A 5JY1A 2QMEA 1KQGA 4M7RA 3VPFA 2A4MA 3PTAA 5K9ZA 1YE3A 3TNFA 2PIDA 5KVAA 1K8QA 1QOQB 1YRHA 3A2LA 3U09A 4FGSA 1BAPA 1Y6GA 2Y93A 1JG7A 1ZMBA 4OHWA 1KA9H 1E2PA 2B61A 2C8VA 2QNBA 4TUYF 5JJCA 2DHDA 4R2MA 5I5EA 2PQ6A 2X22A 4Y6LA 2PZFA 4B83A 4LIPD 1ULUA 3U4QB 1KXZA 4EYKA 4OB6A 2FPGA 4YMHA 4LJRA 4OFXA 3O4VA 3HL0A 2AEJA 3AKEA 4KZPA 9MHTA 2RGDA 3IO3A 3ET4A 5TGTA 4EBBA 1RE0A 1KRHA 1SBHA 3O8QB 3TO5A 4EARA 1TJYA 1EWQA 1ZD4A 4A8JA 2PTGA 3ND9A 4YT4A 2XWQA 1DAEA 2PQ2A 1YQ9A 3FKJA 5EAIA 1WNFA 4CM4B 1Z4JA 2PLRA 3HV0A 1NUQA 3RF6A 1YFLA 3M2TA 2AYZA 1E6EA 1MEJA 3F2IA 3I2YX 5LUAA 3NAQA 5EXSA 3I2IA 4UMVA 1JJ7A 4CF3A 4UHEA 4QUJA 2FR1A 3HNPA 4PLTA 3LY7A 3VHQA 3ZXIA 4B31A 4ZANA 4Y18A 1HTWA 3TX2A 3KAKA 8ADHA 2Q3EA 2FSVA 4Q3DA 4C88A 3PD0A 1JFLA 2YC2C 1ZVJA 1WAMA 1E8DA 1EUCA 2V5AA 2Z5FA 2B8TA 4RF5A 4DDVA 2J0UA 3NETA 2FLKA 5CGQB 2HIAA 2DKFA 2ZTVA 5LQRA 2JJ1D 2WM2A 4M1TA 4QC2A 3NNNA 3KTDA 2A78A 3AFIA 3WHPA 3G7UA 3F7MA 4TLMB 4KFCA 5LQCA 3IHLA 3MA0A 3NT2A 2XTNA 3M4YA 4GX1A 5GP1A 2AI3A 3BWEA 4FCVA 2W42A 2FN4A 1CUVA 1CY2A 2ATVA 2HJRA 3TSOA 1XPRA 2FMUA 2J3QA 5I9MA 1IHPA 4G01B 1ISPA 4BQEA 4Y3UA 1W19A 3JCZA 4G24A 4ZHSA 4O8ZA 3HUDA 2DPHA 4L8WB 3CVVA 3BRWA 1HI9A 1NLZA 2W48A 3UJCA 5J4YA 1JFVA 1TFRA 1K86A 2Q1XA 2WYHA 3ANYB 3C98A 3SXUB 4XIFA 2XXAA 3I9LA 1K75A 4P58A 2OESA 4HY3A 4BQSA 3FY4A 3K15A 2WY2D 2I9KA 1CQJB 1M10A 4RD2A 4CTNA 1E1YA 1NR5A 3U3DA 3SSNA 1Y48E 1CQZA 1Z0DA 5EHGA 2Q2VA 3EIEA 4UEQA 3DFIA 1R0WA 5HE9A 2N1MA 3GJ0A 3SZ3A 2HOQA 3ORQA 1Z5VA 4ODIA 2BJHA 4EY6A 1EP3B 1JZSA 5ICMA 2W4IA 3NHJA 1T0BA 2VNHA 3QENA 2HIHA 2IXEA 3R7DA 4NZZA 4ZICA 5JSZB 4W7HA 4KIFA 1JJVA 4IDPA 4ERNA 3L5KA 1T3GA 4GL4A 3EY9A 3PNMA 3RTGA 1TTQB 2QQGA 3BGIA 1VJGA 3JQDA 4KR9A 3THRA 5BSTA 1DKUA 2J3HA 1EX6A 1PVVA 1KQNA 3R7AA 5C4MA 3LGSA 5JD3A 4W4TA 2CMGA 2XNKA 3BXGA 1L4GA 3SHOA 1M2JA 4DEVA 1KZGB 4MUKA 1GEEA 3OU7A 4G2TA 3NHUA 5EWJB 4I9NA 1T1GA 3QXJA 4O63O 2HV9A 4MV5A 2MINB 1GV0A 2B7CA 2Q3JA 3U17A 2YN0A 4OP1A 4MPPA 3WNCA 4RSHA 3S7ZA 3AYZB 2VP6A 1ZLYA 1WXXA 3LS2A 4G1CA 4FWTA 1N77A 1ZG3A 3N2ZB 2RGCA 4JYZA 2H4HA 1VYHA 3DS8A 1ZMOA 2YY6A 3FOAA 1MEOA 1JHYA 5LP6F 1TMGE 3ETNA 2WM8A 4M7WA 2FPIA 4MKGA 2PSSA 3A10A 3OQIB 1JSLA 2V8BA 3BM5A 3CEAA 5DWQA 2Y0EA 5TS2A 1MHPA 2PO5A 3KKOA 1XWIA 3OD5A 4I1VA 3WMRA 2C98A 4FR2A 4BQPA 1NM5C 2CZGA 1HOTA 3FWNA 3NBAA 2GN1A 4BE7B 2IDZA 2XBMA 4NAHA 3OAAA 1PGQA 1G8PA 5BR4A 3F6PA 1M34E 1W2WB 5THQA 2JIRA 3VNUA 4PO3X 1EJ0A 1DX9A 4U9UA 2SKDA 1EWKA 2CL7X 3JQGB 4B0PA 5IANA 1XTBA 4JU9A 3NHLA 5AK0A 1QYIA 2X1LA 3FYCA 5LXTB 3BVPA 2VDPB 4W1SA 1RRGA 1N7IA 5I9BA 4RNCA 5DCLA 3GHYA 1W6UA 2W2MA 1HNWB 4OM7A 3EA0A 1E4EA 4LXUA 5E7JA 1PJZA 3AILA 3RK1A 5F2EA 3IQHX 3G2IA 4AL4A 5JSUA 1D2RA 1P9NA 3SICE 1XZFA 2YQZA 2IYEA 4Q4AA 3BMNA 3EVAA 4XDGA 3U9LA 1XTTA 5F52A 1EB8A 5JDIC 1BOOA 4MB0A 1V39A 3D0QA 4CM4A 3FWKA 5CA1B 2C5GA 1Y34E 3WWZA 3FCOA 4UHKA 1EFTA 3HRHA 1VJRA 1S2OA 4WLVA 3UMJA 4B4VA 4DQKA 1P2FA 4YRIA 2Z2ZA 2JIQA 2GPWA 1A8UA 1SZPA 5KTNA 4Z4QA 1K4KA 3BULA 2RKBA 2P2SA 4TV8A 5IKPA 2GO1A 4A1FA 1ZGGA 1SVOA 5DTQA 2FEWB 4PPFA 4Q47A 6ABPA 3GLIA 2DP4E 3CE6A 4QVKA 3ONVA 4KAJA 4CMJA 4MA4A 2VLIA 2BRUC 4CM7A 4DB4A 4D96A 2R00A 6NULA 3CW9A 1GAXA 3NVDA 2VHCA 1QCYA 2ZRDA 3NQ41 4I5EA 1JB9A 5D85A 4EQZA 4ZZ0A 4BLUA 1CQIA 5EXXA 1NQWA 1U1IA 2DBZA 3PHLA 3PQ6A 2YN2A 2YOHA 3IALA 2MR5A 2PZEA 3CA8A 3MWLA 3LO8A 1GYQA 2FPRA 1SELA 1VXRA 2H8GA 2A9RA 3FZEA 2OK8A 5TNXA 1F2VA 2J4FA 4JOCA 4XAQA 3LKZA 2DWCA 3NC1C 1V4BA 4EMTA 1RLTA 4CL2A 1AXRA 1SG6A 3KCNA 1VJDA 1CR2A 3ORFA 4G4IA 1RQNA 5DM4A 3VZDA 1OVGA 4YUYA 1T9GR 4WGFA 2Z1DA 1MJHA 3T7TA 3KIPA 2N3ZA 4J90A 3D7LA 3LO5A 3UMFA 4EENA 1WB6A 1W8IA 2R84A 3TDMA 4Y7DA 1KKLA 1XR3A 4X1OA 3X2SA 4AROA 3P0FA 3IL2A 3STTA 1AKUA 1NXQA 2GM9A 2YHAA 3OSZA 4N0MA 4QUGA 5TV2A 1Z4MA 3RS8A 3N0WA 4LHYA 4TRRA 4RTSA 4N1AA 5IP5A 4OG2A 1E9CA 1GZ7A 3A4YA 4JLDA 4RK5A 2IUUA 3UTCA 3MRSA 2X9NA 2VCHA 1E7WA 2IK8A 4NCNA 4Q7EA 3PE6A 4Z8YA 1NC3A 4A2CA 3Q0IA 1H2EA 3E5HA 2J7PD 3U7RA 2PX3A 3W79A 5LZ2A 3WSWA 4HNAA 4QU0A 4YHBA 3T4PA 4HATA 4JJKA 3MELA 3R0XA 4PGMA 5CJJA 5IAGA 3H16A 3A32A 3WLLA 2WTMA 1S96A 1TPZA 4KIGA 1TM1E 3V3TA 3C3PA 3K73O 2Z9CA 3M5PA 4YP6A 1XKXA 4RAOA 3IERA 1VZ3A 4ZT2A 1CW2B 2HPZA 2KI5A 4KR7A 5E9AA 3UCFA 1X7XB 4OHOA 3CFYA 1D1SA 3O9ZA 4KRXA 4AXBA 4N0QA 1MTOA 4QODA 4RQTA 2GZSA 2POQX 3GJQA 4TKVB 4TS3A 3RS3A 5BSKA 2EFYA 1M34A 2HCTA 4YDHB 2FQWA 2REBA 3ND6A 4G5XA 2WBLC 5DNVA 4YMUA 1HEYA 2EJWA 3DFZA 1KU0A 1OFUX 2H92A 2ZRIA 3H1PA 3PUJA 4IYJA 3HKCB 4JYMA 1W36D 4AWAA 2FPXA 1GUFA 4YX9A 3ZE9A 4JJAA 1I3KA 3PC8C 4GP9A 3VHXA 5KYYA 2WVGA 4BX0A 4Y2XA 1WMBA 5C37A 4HAVA 2DJ5A 1YIDA 5TVGA 4F8YA 2ZRFA 2H7CA 3AR3A 1PZXA 5HQJA 4Z51A 4KMRA 3TCXB 4H16A 3RBZA 5F64A 4ZTUB 5CVTA 3PNVA 5A0VA 1S3IA 1U31A 1WSWA 3EUAA 2WNHA 3ROKA 1Y8ZA 3OAAD 3JRXA 1Z39A 2EJTA 4NTZA 1VKJA 3VR2D 3L8HA 5WRFA 2ZSKA 2FQYA 4MI1A 3T5CA 2CZCA 3LPLA 4YONB 1DT3A 1P6XA 1P4SA 3KSZO 3W9UA 3OE1A 2PX5A 4HYQA 2AEMA 4EHKA 2I29A 2J6BA 2W43A 3HJTA 4BLPA 4BQQA 4C08A 2O5CA 4MWTA 2ZAYA 3L4KA 4EKEA 1G5FA 2NXEA 1G7CA 1VJ1A 2WUWE 1WB4A 3VR4D 4Q37A 3HKCA 5CH8A 3GR6A 3CG4A 4ITVA 4RC9A 1B8UA 4WIAA 3LHIA 3UJPA 3IULA 2RGNA 1XO1A 1E3WA 4GE3A 1N5RA 4YDQA 1FFWA 1R8JA 4Y2YA 5EPEA 3DLCA 5HFNA 1ZEJA 1NVMB 3Q2IA 1G7TA 4S35A 5TX7A 3RARA 1JDTA 5DTIA 9LDTA 2AB0A 1DDOA 4H15A 4FGLA 2QZZA 1H2XA 2H9IA 2G1UA 4R5HA 1GUAA 1E1RA 4C4SA 4HNSA 2PKCA 3ZLUA 1F8YA 5L53A 3TKAA 3ZDQA 1O0SA 4BPRA 5HIIA 1JFFB 1F20A 1W25A 3KQTA 4MUHA 3KYBA 4HI0E 3I53A 3FPFA 5J1SB 3M1IA 4IVRA 1A7KA 2A0YA 1V41E 2GN6A 3NCTA 3NWOA 5K6AA 1E3JA 1YQGA 4M89A 4PIPA 4R83A 3FYHA 1YUMA 4CTJA 3WB9A 2WLTA 3R7WA 1OLXB 2WSSA 2Q1TA 4DS3A 3O5AA 1N2ZA 3A36A 3LPMA 1IQRA 1AUXA 3GOHA 4IDNA 4XRGA 3BAZA 3IV9A 3R9XA 2RGUA 4W5QA 1PV1A 4ZV4A 2IHYA 4F97A 2XZOA 3F1KA 3TLBA 4RDHA 2E85A 2DY1A 1MF7A 2JRLA 3CZPA 4IHAA 1L5KA 2VJOA 1XVTA 2WYOA 2XIQA 3PC4A 5COQA 3WRYC 1X0VA 1M1UA 1XQ9A 1C3XA 3C4QA 3E2IA 3TVDA 5CD1A 4HZGA 3T94A 3L0CA 1U7ZA 1N3BA 1B1CA 2BMFA 1Z13A 2VK4A 1V8ZA 4ZYYA 5IBRA 1Y6RA 1P3Y1 1BMDA 3ZBQA 2PT7A 3EIUA 3LP5A 3AI2A 3E3NA 2BGIA 1XCBA 2JLAA 4CXMA 3HA2A 5TJ9A 2VJLA 2QD4A 1JIXA 4JC5A 3P2IA 1QRDA 3DL2A 2CDRA 2IYWA 3K71B 2QVLA 3HB7A 2EP8A 2H9AA 3WZMA 5JYCA 3GUZA 2FGKA 3H9UA 5ALWA 1TK9A 5ALXA 4C0QC 4AICA 3E27A 4IDGA 3MCTA 5ALKA 3AVUA 2NSYA 4X93A 1FFGA 5FJIA 5H80A 1C7JA 521PA 1L7DA 3HWSA 2CBGA 5M7EA 1U0BB 2HHAA 2AOXA 2C97A 5PGMA 3WZLA 2QUAA 3CX7A 3CUTA 5JVDF 2O8FA 1D9ZA 3LU1A 5DDIP 4LTDA 2ZJ4A 1M1NA 1KBOA 3IQXA 5SZIA 1JSZA 4RKRA 4UCQA 3O74A 1LI5A 2CE2X 2I5PO 1L8AA 2QZ9A 3HWWA 4S0XA 3ROEA 5DB4A 1R3DA 1DUSA 3C5EA 2VQ3A 3KR9A 5D6NA 2PHZA 2JAWA 1VSBA 2C9ZA 3HSSA 3UW1A 3K3PA 5JG7A 4Q34A 4D26A 3ABRB 3FFBA 2X4GA 1JNXX 2POCA 5IEBA 2V59A 3D7KA 2WAXA 3SKVA 5FUMA 1DCMA 3ZZUA 2GAJA 4DMUB 3VNAA 5M5BA 1R0CA 4N7MA 4FKBA 4DUYB 3OUZA 4BL5A 5DYGA 3FHTA 2PV7A 4FDMA 5E6UA 3TLMA 1JEYA 2HIMA 3JARA 4JGIA 1S7GA 3I3OA 2RHHA 2RG1A 1EE2A 1I2DA 3WMFA 2B1QA 1B6GA 2R1UA 4ZMSA 5AESA 1QH9A 5DPMA 4L50A 4OXQA 2ADFA 3JQ9C 3VZRA 5FX2A 1MVLA 5IN5A 1H0RA 2FMIA 4JBGA 1HKHA 2DUJA 2A35A 2ZU0C 3TB6A 1MJNA 3WMWA 2WF7A 2C7VA 2CFIA 1K98A 2C8JA 4FI3F 1J0DA 4FEEA 4HGZA 5CXXA 3HABA 3X43A 4AMYA 3Q3HA 4XM2A 4GLBA 3LNCA 2Y66A 4JCOA 2OP1A 2CSUA 2X13A 5FBQB 3R41A 2DWPA 1XRQA 3OF5A 4ZJPA 2CMKA 1E2KA 1XCPA 4QTUB 2YXEA 4K2HA 3N87A 3T7JA 1UK7A 1N2BA 2JLWA 4MCIA 2GCPA 4FN4A 3TL6A 1S8OA 2P69A 3L8EA 2H5EA 1NMXA 5BSGA 2XIJA 3GJ3A 5JCZA 5JISA 1RR6A 4G4GA 5FYQA 3MSXA 2XUGA 3L04A 3ER9A 2FZGA 2IPAB 4E32A 3EX7C 1REQB 1ZOOA 3E9NA 3PXDA 2O2YA 1MV5A 4Z0HO 3QHQA 3CKYA 2C5AA 2VHQA 5JPIA 1PZNA 1RYDA 2BFCB 4K1LA 4MVJM 4L22A 5HILA 3SC4A 4BRWA 3RFFA 4E4YA 3ZJTA 4FYHA 3AFNA 3PXXA 2H1RA 5CPFA 5L8VA 1QRSA 2GDZA 1U5CA 5EL0A 4D9HA 3RYCB 3IP5A 2Q5OA 2D2EA 1VSQA 1LPSA 1C30A 4KQWA 2GVZC 2VJNA 2DUWA 4LQLA 4MGKR 1TYZA 3N0RA 4L0DA 4MQFB 5F73A 1TD9A 4Z99A 1KMQA 2NO7A 4RK7A 3F4KA 3AG5A 3Q2KA 3P9QA 4EA8A 2P4UA 3H6HA 3KT8A 5HA5A 4CM8A 1SRQA 2WD8A 1G0OA 1A8IA 1HQCA 2EHDA 2IIQA 3FPLA 3FE2A 4G86A 4MQEA 4BZXA 4UCWA 1SBZA 4OUDA 4UNPA 3REOA 4DR1B 2IE8A 1E79A 1A72A 2DETA 3TIXB 2XUQA 3AVTA 4MARA 1GTG1 2YVUA 4G5SA 4KE7A 2PY6A 4WACA 4Q15A 5DMXA 2GLTA 2H3HA 4TPKA 2PUEA 3BMCA 4P4LA 4OX9B 1TZ2A 2CXUA 4QULA 4RPKA 1NMZA 4P3NA 2BONA 5IKMA 4QFBA 3PVZA 3UANA 4QATA 2JH3A 3WFZA 5HJ2A 3PTLA 4NULA 2DPGA 2OC9A 4JVLA 4YASA 4WQMA 5E4JA 4RD1A 3ETJA 3VH4A 3ADDA 2MINA 1TUBB 1YZKA 4MS3B 1NBAA 3QIAA 4NCAA 2C4HA 2G0TA 3FUCA 5K8TA 4IGEA 2DB3A 3GPCA 1TO1E 3DZGA 3THXB 4BO4A 4ARZA 4ZREA 3D3NA 4FQ7A 1SG9A 1UH5A 1MKYA 4N8DA 5E4FA 1ZH0A 3AT1A 1PE0A 2XUHA 2JI4A 2R5WA 1ODLA 3NTLA 1I7LA 3LY8A 1NUAA 4I08A 2AS0A 3ISJA 1AUVA 3BMOB 3I2GA 2WD9A 1YRBA 4MI6A 4DRYA 3F9CA 1B15A 4KO3S 2WWGA 5IXSA 2CWDA 4FB4A 2VJCA 3AM3A 4ZQGA 1UJ6A 4EPWA 5LP1A 4RVSA 4AYXA 1CBUA 1ZC3A 5LWQA 4UU8A 5T64A 1ZMTA 3V8PA 2FSSA 3FKSA 5EJ9A 1AE1A 4CT5A 3L46A 4URVR 5JAHA 3MCAA 4GKJB 4PNEA 1CQWA 3KKMA 3N2YA 3T61A 4H3HB 5C1PA 2WTXA 3OA0A 4M0KA 3TSWA 4URHA 3MB5A 5B4TA 5EE9A 5KEIA 4AG6A 3CVJA 2XUAA 2JLXA 2OCPA 3DWEX 4JUDX 2BFEA 2F62A 2PXAA 3MCZA 4EELA 3RQSA 2RK3A 1DJMA 3GEPA 1PSZA 5EINA 3FRIA 4GC9A 1LNSA 3K0BA 5GTDA 1RAEA 2F3TA 2XB9A 1U99A 2FW0A 1KDTA 5CT8A 1GJRA 5HK9A 1VG0B 3UQZA 4N7BA 5IN4A 3GARA 2AF3C 5KREA 1O94A 2CVFA 4NV1A 5E6RB 2QR3A 5DYWA 2MHCA 4IG9A 2WABA 7ADHA 1JWBB 3IDOA 5UKDA 4HFMA 1XJWA 3AKDA 2PGDA 4C4PA 3IAS6 4YHHB 5A3QA 1G8AA 4MHSA 2PVCA 1JSCA 3QIVA 2NSDA 3B51X 4XSHA 2B82A 3HFGA 2D06A 2GB4A 2OKCA 1IU9A 2XWPA 1J2JA 2XITA 3WA7A 4HS9A 1XTPA 3RABA 4YUWA 4XWKA 2VXYA 5C46F 1P2BA 1Z0ZA 1FFAA 4KR3A 2XDQB 3KZVA 1UXJA 1IN1A 4W5NA 4BUJA 1LRJA 2UUOA 5A1JA 2CYBA 5ALQA 1R6AA 3VU9A 3AL3A 2PJRA 1ZN2A 3FAKA 3L1KA 4GPZA 4EB6B 4OQ4A 1ENOA 1C9EA 3PKZA 3GVPA 4HP8A 4L02A 2AV6A 4LYGA 3AHCA 2F8MA 1X92A 3KXPA 4Y1FA 2ZBUA 3C3WA 4QGSA 1S1MA 6CHYA 3C3KA 5AKXA 3OZXA 1A4IA 1OILA 5GADl 1XX6A 1BQ3A 1YB6A 4HCJA 3ZDZB 2R2AA 2FEAA 5CBPB 2Z9BA 4EF4A 4LPKA 1Z0KA 3A8TA 3DGEC 5JC8A 3T1VA 3CRZA 1USWA 3TLZA 3EXHB 1OI4A 3L7AA 2PKRA 2PD3A 3GV0A 3SX0A 2P5SA 4U9HS 4Y9RA 4F2DA 3JD4A 5JE8A 4LMBA 1CJCA 1EA5A 5IAOA 2GTHA 3D43A 1HM5A 1XU9A 3BREA 1PLKA 2E87A 1N5KA 1Q15A 3GIDA 4LMRA 1MO4A 1JA9A 4PX3A 5LDDC 3ONWA 4Q9NA 2VDLB 3NYQA 1GNVA 1RYMA 3ZOZA 4AY3A 4C6SA 3AM1A 2PT9A 1YK0A 5G0UA 2K87A 1SPXA 4GX0A 1TKAA 2JJ2A 4F2GA 4G1UC 3NHMA 2XGJA 2IV3A 4EI2A 1JDBB 2GPBA 4BE9A 4GYYA 4REMA 4HDAA 3G2NA 4RL4A 5CLQA 5K3SA 2IDMA 3QVJA 4JT4A 1T36B 2CLLB 1VDZA 4MR7B 1KH2A 5IEJA 2VHVA 3EBPA 4D25A 1Q0LA 2FPMA 3ZU2A 1T8YA 1AKEA 1DNPA 1P1IA 3S3TA 5DIFA 1VJ0A 1XQYA 3T5GA 4AJLA 4C0HA 1Y5IA 3DB2A 4NBLA 3H65A 4QPJC 1LKZA 5L45A 1BDHA 4OQPA 2QD1A 2PS0A 1XDUA 2X6QA 3ICWA 3OJXA 3PPVA 1ATZA 1Z5ZA 4C4YA 4DAOA 5C5EA 5HSGA 1EVJA 5LKAA 4RH3A 3HJBA 3C3EA 4LJ8A 2CXNA 4BE4A 2WF8A 1PEYA 3RWOA 1QIGA 3OO1A 4BEJA 4XWWA 5HCNA 4H0NA 5BN5B 4I5IA 6LDHA 3A9TA 2SHKA 5A3JA 4ZDJA 3DMGA 3IFSA 1UM8A 3OP1A 2E4AA 3HB9A 3TAXA 2YXPX 3TN7A 1NBMD 1KVQA 3OM9A 2OO3A 4PCAA 1JMKC 4L75A 3F97A 5HOEA 2FSGA 3KT6A 4NYJR 1D5CA 1OXSC 2UUPA 3E9MA 1J0EA 5JCPA 4PQYA 2H2FA 3JQ6A 3I2JA 3EODA 4BLTA 4KFTA 4E3WA 1NN5A 1XTRA 2QTTA 4QBIA 2QQ0A 2YMMA 4I36A 4BVAA 1G55A 4OKSA 5I7EA 4HL6A 5K8JB 1Z3IX 5JCJA 5A05A 1J90A 1JQLB 2Z5GA 1MO6A 1XPJA 4PICA 1Z25A 4MQFA 3LQYA 1NVDA 3UPDA 3ZWCA 2QLMA 3WKDA 3AXTA 2QX8A 3IAM1 5ANRB 1T5BA 2FDCA 2OZEA 3PL1A 4IBOA 5TPWB 4G0OA 3AIKA 1Y5RA 4QJIA 4BX2A 1A9YA 1BC5A 2OZPA 2RC6A 3FCYA 3B3AA 3MF4A 1K5DA 1P9LA 1U28A 2AI2A 2LWIA 3D3JA 3RVPA 2O8CB 4PLHA 3SWWA 4XQEA 2R9VA 1XMIA 4KYIB 4NHOA 3GW8A 4UBNA 4O29A 4ZXFA 4D9NA 1YQDA 2JFHA 4GMXA 1ZL2A 4IXMA 4PN3A 5LOVF 3K70B 1Y42X 4KLRA 2Z8YM 3VZQA 1FLNA 3M3DA 3OKPA 5KC9A 1KAEA 5HMLA 2AXQA 3BK2A 3ZY3A 2HBQA 4MW7A 2CHQA 1GT91 4CM3A 3HKEB 4LC9A 4QG7A 3DO5A 4B6EA 5EJIA 3LXRA 2IUYA 4J0DA 4DE5A 4R9SA 4YCDA 1JJIA 3H9JA 2FWAA 1O4VA 3N5CA 4RY9A 2QE7D 5JZBA 3GPDG 3K6JA 2QL9A 1RCTE 3C15C 3MJCA 3GRVA 4RH0A 4TV8F 4WGGA 3UENA 4MULA 1YXMA 4PANA 1ZW6A 2ZKLA 1JR2A 4IOMA 2NO5A 1JLLB 5KDLA 2BCEA 1SXGA 1W4RA 2EJBA 5FUYA 3OEED 2DM6A 1KE1A 1P1RA 1JPNA 3ZG6A 2XMPA 4LYYA 4N03A 2PSHA 4K7JA 5CDHA 1RI2A 5FLXA 4DDWA 1KHTA 3HA5A 2DKOA 4FPXA 4NU6A 3WIDA 1CDZA 3JU3A 2DX7A 2Z09A 3EH2A 1BSVA 4UCXA 2EFDB 3EDYA 4A0HA 2QDXA 3A04A 4ENVA 2GLUA 4JL5A 3IOCA 3KLBA 3NEPX 3R2JA 3O1IC 3G2HA 5FFFA 5CEEA 2DFTA 3CPSA 3K20A 4QBFA 3K8YA 3H2JA 5C7LO 5A4IS 1NYTA 4PZZA 5SZHB 2Q21A 4KWIA 3T0IA 2IYSA 3ZPXA 1K6JA 4S1NA 2BAGA 4XCQA 4BP1A 4E5MA 3SX2A 3RRYA 3I6IA 4HDRB 2O0HA 4LEIA 4NLLA 1RRFA 3ZHTA 3A3PA 5B3JC 2OCBA 1CS0B 1QHXA 1R8QA 2QS9A 3PEFA 1QE3A 3GA5A 4I2NA 4WK0B 4XD7A 4Q16A 3R6GA 2SKCA 2ZR7A 1P1FA 4JLUA 4RELA 2PCLA 3Q7RA 1H69A 1GTJ1 4LTNA 1EGVB 1OXTA 1RWMA 4EVIA 2F1IA 2RH4A 4R8VA 2IHBA 2PKQO 2QMUA 5D3KA 3TRHA 2WAAA 2WFZA 4TVKA 4DCCA 3FYDA 1YH3A 5T7BA 4Q3OA 3SOZA 3VM6A 4M54A 1YDMA 3ELWA 4NPCA 5GIPE 2MR6A 1M8JA 1RC8A 4YT8A 3VAAA 1AX9A 2PGLA 1K8YB 2WI8A 4KQ2A 2EXXA 3GIWA 4TTTS 4DIDA 2F43B 2Q8NA 3MGKA 3LG2A 3QVGB 4KQIA 1GPUA 4MAMA 5AI0A 1X70A 2W2QA 4WZAA 2C2BA 4ZU6X 3W77A 4XFDA 4ZFNA 3A1DA 3EFOB 2Z5VA 3NFYA 1PTKA 5JLJA 5FNVB 1TQ6A 3TOXA 1HL7A 4QSHA 5FOQA 3Q0EA 1RI1A 2AG6A 3BA6A 2MSWA 1W36B 1XCLA 4E11A 3KYCA 3RM3A 2J3EA 5BV7A 4CPDA 4U7DA 1IVNA 4N6GA 2D8AA 1ZJ5A 5K45A 5GONA 3E9DA 3KPUA 3C3BA 1CNEA 1DAMA 1QGDA 2AA3A 2RGAA 3QW4B 1W73A 4GZ5A 2J08A 1BE8A 4XR4A 2QRHA 2WIBA 1YOVA 2QT0A 2G06A 4M1YA 1DKQA 1X1SA 3R76A 3ITEA 5AW3A 4RD4A 4DV6B 2GAFA 4YJFA 3SS8A 4DAEA 5D84A 1T34A 1CG6A 5EJGA 1YHNA 2GEFA 3Q5GA 1KDZA 1CVIA 4O02B 2I78A 3OVMA 4BTVA 1WQ4A 1B23P 3UBMA 2ZYTX 1D0SA 2XR1A 3ER6A 3NC0C 4M38A 5G53C 2IHKA 3KD3A 3LA6A 4QFMA 3ZCSA 3R9XB 1FNMA 4FLMA 4NRDA 4Q4HB 2AOVA 5HRAA 5CCBA 2GJAA 4JJ4A 4C0XA 1E0SA 4MV1A 2ZE6A 1LLUA 4MWEA 5DGXA 1F8FA 4IQGA 1GGJA 3KKZA 3UWDA 3S6JA 2CN1A 3GBSA 4JB2A 1JFFA 4LGYA 4MVJP 2VG8A 3ZWYA 2VYVA 3EDMA 1XZLA 2QP9X 3NYWA 3PRHA 4GC5A 4ND1A 4PRLA 3Q7TA 3UJ6A 3EGXB 4K0KB 2DF8A 4NC9A 3BF8A 5A4MS 4PV7A 2Y8EA 1C8LA 3QWIA 3DZFA 3PNSA 2P65A 1LSUA 1XB2A 2I3DA 1WMDA 3K9GA 4G5OA 3TZKA 2QVXX 1DAPA 2C3YA 3K2QA 4B1FA 3B1KA 3LPNA 1NI5A 4CMBA 1QWSA 2RH8A 2ZI7A 2MSLA 3Q7PA 2CKDA 2ET6A 1L5LA 1IBCA 4MVCA 1HT3A 1FUYB 2ZB7A 3G0OA 3NUZA 2IVZA 3U4CA 3G2JA 4UFOA 3WIVA 2HLPA 1EFPB 5JDIA 4GICA 5MFZA 4CETA 2IP1A 3E35A 2B3TA 2ATEA 3LVRE 2YV2A 3NTOA 4GH5A 4JX9A 4IDOA 2ONKA 1B8NA 4QYIA 1U0OC 3UK0A 3NRBA 1HQDA 3T5PA 3UFXA 3QLTA 2NTNA 4QNNA 3UWKA 5D7NA 2I7CA 4KXWA 3ZU3A 4CM6A 4YXWD 4F3TA 4MSUA 4IZIA 3E8MA 4MP6A 1KKUA 5AXBA 1E9EA 3PC2A 3H1TA 4YXWA 4MWSA 3T7SA 1OR8A 3FWHA 5BQ3A 1XZPA 4RVGA 2GD0A 1FS5A 5BQPA 1PR1A 1TYAE 2PD6A 3LLCA 5IJXA 3WL8A 3N8KA 3P0IA 2W6NA 3NJ8A 2HR1A 5EUCA 3EVTA 1XU7A 2I2AA 1JLSA 3QBDA 4LK2A 5EI5A 4DLBA 2F1HA 5E1OA 5JSHA 2WKWA 3CLUC 1LPMA 3CT6A 1JS1X 2XPCA 1FMLA 3O2NA 4DILA 5L4SA 2P9BA 4KAAA 2Q5EA 5FBZA 2F55A 1EFKA 1SBYA 2NXWA 3MXOA 3KTOA 4WT7A 4ERXA 1UPFA 4BTLA 3TW4A 3PFGA 3LW8A 1DEAA 4FYPA 4ZOLA 3SZOA 2WHYA 3M2PA 2R0QC 3GLHE 4LW8A 2WUGA 2X8LA 2C5LA 3Q12A 3X0DA 4EWLA 1DIRA 2RJ3A 4I5DA 3QVKA 3TLGB 4QPDA 2VT7A 2AOTB 1X7ZA 4P4UA 4Y2GA 3TZEA 3VOTA 3BL8A 3GVCA 3CHYA 1YE8A 1IDOA 1U2DC 5B7PA 1RPAA 4DLPA 3TVTA 2RSLA 3CC8A 3E0QA 2WJ6A 4M7OA 4IHJF 3U5ZB 4K28A 3H1BA 1G42A 1ZNZA 3AR8A 3KSBC 5EZSA 1QQ6A 5EKUA 5MFPA 1WETA 1Y1TA 3KXLA 3QJ5A 4HT3B 4X1YA 1LVGA 2AC4A 3GRCA 3QPCA 1QHYA 1TA9A 1RPTA 1D1PA 3LFTA 3C5VA 2H16A 1LX6A 1DBQA 2HYDA 3IP3A 1SVLA 4PZCA 1G4AE 4LOAA 1X1EA 2GZAA 3H8WA 2O3UA 3OCXA 4WXYB 4AJIA 3D3WB 4X20A 3F7OA 4LE0A 5BV2P 2ZI6A 2G76A 4X63A 4S0ZA 3O8RA 2GM5A 2XTJA 5G0WA 5LQSA 2C82A 5HKAA 4KV7A 2PNJA 1VP9A 4INZA 2XTMA 4HDKB 4AKEA 3F8SA 3KAPA 1FOEB 1VLQA 2IIBA 2XADA 3NOQA 3WJ1A 4G0YA 3QFTA 4MVJH 2R85A 3C5CA 2YHIA 1II8B 2ZSIA 3DMTC 2O54A 3GQVA 1QS0A 5IDYA 1EZ4A 9ABPA 2EBWA 1C2TA 4GBED 4M0FA 4RMHA 2X58A 2FN9A 4UE6A 2IKQA 2Q7XA 2ZWMA 3MT8A 3P8ZA 4FTWA 4Y2UA 3T7IA 2V6FA 3FGPA 4F45A 3NM4A 2HTFA 3DM9B 3JXEA 1D4OA 2NZUG 4XUEA 3BQ9A 1M6HA 2PWBA 1F51E 3IR5A 4RDXA 1W0KA 2AC7A 2AR0A 2VZLA 3I28A 4IIUA 1A8HA 3SHQA 5H83A 3I5XA 2DJIA 4DHWA 1WMSA 2I4NA 2ICAA 2CBZA 2MSKA 4GIBA 4Z9YA 6ADHA 2I55A 5DGHA 3FBTA 1FNBA 1GCOA 1LI7A 3WBFA 1DG9A 5FFMA 3G9ZA 3HDHA 1T24A 1J39A 3LZCA 1GZ3A 3QYPA 1XEWY 2W2TA 3KEFA 4C20A 3ZZTA 2OVBA 2P2NA 2LGJA 4O4IB 4KO1S 4JNCA 1Q7EA 1KMHB 3G6KA 3BIFA 1DO8A 2EOAA 1YQQA 2ZYVX 3L7DA 4GRIA 3DO8A 5JAIA 2ZM6B 3GN1A 1Z4PX 3NWPA 3MWYW 3OC6A 3NP9A 4P8RA 5ECDA 5HRCA 5JNWA 4ZOEA 4B7AA 4QM7A 1FK8A 5J3JA 1DQSA 2AZXA 2ZIGA 1C9JA 3MBIA 4ER6A 3DAOA 1R27A 1XAJA 2BFMA 4OHVA 4M46A 5E9WA 4PYMA 1N92A 4RGVA 1NONA 4Z9XA 2MSDB 1KIAA 3CZ9A 3HSYA 3VX3A 5JZOA 4PAMA 4DIBA 4M9XA 3C48A 1UAAA 1T2EA 4RCYA 4MRMB 1XLVA 2P3LA 3LQKA 1KYVA 3AFHA 4TXMA 5DP2A 4AZ0B 3OIVA 2WPDA 5JMPA 3TKLA 3ENWA 3VGJA 1VHDA 5AP9A 2A3RA 1KC3A 2CXHA 2ZUFA 2VNJA 4OI0A 1PQUA 4R1MA 4V38A 3TLXA 1GPH1 5JAUA 4CV3A 4AG5A 3CRQA 4BU1A 2DSTA 3FBGA 3KOMA 2IZ6A 4ARAA 1GILA 2BYTA 2GBCA 5C0OE 4JAVC 4C76A 1IZ9A 2DUNA 1NBEA 4Q3AA 3HCOA 3D7MA 1TZBA 3ZIAD 2OUIA 3FUXA 3FNRA 2CKMA 1AUOA 1TVKA 2OHXA 4ZKEA 3CVWA 2IPLA 1PFGA 4LZWA 1L1EA 2FR8A 3EXG1 4X97A 4YBRA 2OBFA 1XRSB 1V45E 1Y8QB 2Z2XA 4D8VA 1V1RA 4D9FA 1D0IA 1C1YA 4UTZA 4X8OA 2GQ0A 2VJMB 2HF7A 3FYUA 3OMLA 5B6IA 2G6TA 2P1RA 1YGPA 1ZZGA 1TQ8A 3ADKA 4F85A 1DGQA 4F7DA 4EAAA 5I3CA 3VYRB 1YIAA 1FU8A 1CQIB 4E2FA 2BE9A 2UYOA 2XDAA 2OT3B 3H11B 4YRPA 2K6GA 4OI4A 2L19A 3W90A 4CHGA 2YRFA 3GLHB 2AMLA 4OHRA 4BAZA 1U6JA 2LR0A 2GJSA 4K9RA 3PK0A 3GEIA 4ZHQB 1OSNA 3E61A 3UCEA 5D86A 3FHLA 3LRTA 2FH5B 1CERA 2GJ8A 4I8XA 4ND3A 4V0MA 1H65A 4BEVA 4M1ZA 4R51A 1MNAA 4HFJA 4U8HA 2EYQA 4FZVA 2P6UA 1XTIA 3O9VA 2R96A 3SYMA 2R6ZA 3EPLA 3P7MA 4OVKA 1FE8A 1KQOA 1W4CA 2NXJA 1D1TA 1GNLA 2ZSJA 3R40A 2ZSAA 4ND7A 1WUJS 1SCQA 2FN8A 3IPLA 3VOSA 4DQ0A 1WHTA 5TQ0A 3GYGA 2IS6A 16PKA 1KY4A 3LL7A 2QVBA 2REQA 3VR3A 4YLEA 2GBGA 4CI0B 1YBFA 1WQ1R 2CXXA 3P27A 4JYCA 3CVOA 4RYDA 3DBOB 4HQNA 5C5CA 2DT8A 3KWFA 4NX2A 4Y1EA 5A5GA 5L51A 1L5QA 3IPRA 4FLFA 5ALDA 1MX5A 2QRJA 1FW8A 3H18A 4QFCA 1GCGA 4EJSA 2FRDA 4TM7A 3K1AB 4B79A 1HUQA 4RTKA 4ZVLA 5DWDA 2WAMA 3VSAA 5TPZD 4DLZA 3NHYA 3N7AA 4JVNA 4MWGA 2YJZA 3NH6A 1MIHA 4BKMA 4WJLA 5I48A 3K0CC 4YRJA 4LDRA 5TPZA 3T7RA 3WK6A 1TU3A 4EG4A 1EG2A 3C3XA 1U4OA 3P9CA 1ARZA 2JCSA 2IEGA 4NFLA 5CYFA 1MR3F 2I03A 1DJNA 2O23A 3NLLA 2DBYA 3VU3A 1NUHA 2P9HA 4P32A 4Z1OA 1U8AA 4MB6A 1MA3A 2E4UA 4YIHA 2PZMA 3UWMA 2QTLA 4AVYA 1YNOA 2KBFA 4ER0A 1A27A 4LF4B 4QBKA 1E58A 1YJ5A 4FKMA 3E6AA 4LCBA 4M88A 5KNCD 3CGWA 5BUCA 2YBDA 4LV6A 4ZZ3A 3X44A 5K2OA 5ALLA 4TMWA 2VDRB 3OCWA 1SXJD 1A9QA 3QLUA 3ZK8A 2XCQA 1IN4A 4RZHA 3VBCA 3L6RA 1YI8A 2OQIA 5DX0A 2ZUTA 3A3NA 5K8IA 4BP8A 2WG2A 4DM7A 1OA0A 1TCVA 1L7RA 1T4BA 1RQLA 2EARA 2JAUA 4KYUA 4RE5A 4FXOA 1FJXA 3DE3X 1IHUA 4BNTA 5E3HA 3AFGA 3OLZA 3H17A 2M9MA 4KXXA 4MJLA 2O7NA 1E69A 1HE4A 1LBSA 3AR4A 3P9XA 3UJHA 1IQPA 1IQ0A 1UOEA 1WY7A 2GZ1A 3ITNA 3ZH9B 5HW0A 5B2ZA 1Y1LA 3GMTA 1H2HA 4NWIA 4W9NC 4E21A 4F8EA 2IEDA 4ZN6A 5CFZA 2B5OA 4AJ2A 1UWLA 2J41A 2Q4DA 3HKBB 1AM4D 5DYTA 3X1ZA 5JNUA 3DDZX 3OIWA 1AHHA 2ISSD 2IA5A 3L8MA 4GPAA 3M6XA 4MWOA 4NZPA 1ICIA 3H4IA 5EMLA 1L5YA 3CLRD 4EVRA 3WWOA 4GR4A 2Q1UA 4O2BB 4AMVA 5AVXA 2YMLA 5ALGA 2WNSA 3DL7A 1FMFA 2NPFA 3G2PA 1ML3A 4L6IA 3O94A 4F4CA 4J2HA 5JQGA 1YZLA 3D3EA 2QRZA 1G20A 1MRSA 2FZVA 1E2HA 1L4LA 3G49A 4Q6WA 2OCGA 3H83A 5J4LA 2PGNA 3TTTA 2D8MA 2KE5A 4IWXA 1GV1A 3IMFA 1IY8A 1H4TA 2P1DA 5JXIA 3IA2A 3SJZA 4KKXB 3KV1A 2XB6A 2DZDA 2V58A 4HQFA 2QGFA 3GUUA 3KAJA 5F51A 5ADVA 4UE3S 1I6KA 1R0SA 1GT6A 1WM1A 3CUUA 3A3KA 1YR8A 1DIGA 5CBKA 2VL7A 1V5FA 4ZK2A 2H08A 1Q74A 2NAFA 2P75A 3I9NA 4K1XA 3P26A 4J9VA 2GCOB 1OBCA 3E5RA 1RZUA 3GZTB 4LECA 3UV6A 4OHBA 3SZLA 1RLIA 2Q2OA 4YAFA 5EN4A 4BC1A 4LVNA 3DYIA 4YWJA 3WAJA 2R7AA 4D8TA 5E0OA 1V2HE 2ODPA 1E7MA 1TUGA 5BYKA 2FWRA 1YB2A 3R9IA 2WQ7A 3HY6A 3PJFA 3DA8A 1KR2A 1PBTA 1UKCA 2HB6A 2O6HA 1HFJA 4J7CA 2HDOA 4JSRA 4KUHA 2DPLA 1ZY2A 1RLOA 1G19A 2PS3A 2FWIA 3AGPA 1E8NA 4JB0A 4Q3EA 5FLKA 5EE1A 2PGJA 3LXMA 3CZMA 2XA2A 3S8EA 1EVQA 3N53A 3JQCA 6PFKA 1G4UR 4NR0A 3LWDA 2QAGA 1IIBA 4QQRA 3BB1A 3WGYA 3WXBA 4BNYA 2NUTA 3UJAA 3O9MA 4RHCA 1YKFA 2IP2A 3PIRA 1BDJA 2O3TA 1OFUA 2ZVPX 1DWOA 1JILA 1XDWA 3X1JA 1H94A 3DCNA 1AGYA 3WFJA 1ABFA 1AK2A 2XWSA 3NEYA 2C07A 4QX6A 4FYMA 3DF7A 3CONA 4C4TA 4IS2A 1VBNA 4UU7A 5G4LA 1B0UA 5JJLA 4G0WA 4K26A 2LZ0A 2W2OA 3LUKA 5T4BA 3I05A 4C3VA 5LQJA 1WZUA 1UC9A 3KT0A 4Q19A 1W47A 4INOA 3CNOA 2H17A 3P4UA 4LPSA 1WW3A 3L02A 4WINA 3G8BA 5EJAA 4ZEOA 1BWPA 4D56A 4K0RA 2XWJI 4TQGA 2G40A 4ZCMA 3T0FA 1HYQA 1RHJA 4KFSA 4DR7B 1CDEA 2JGNA 3PF8A 3QPAA 5EHNA 3OHPA 3OQMA 2D54A 2H4XA 4L7QA 2NT3A 4CIVA 1QP4A 1JKJB 2FOXA 5AOCA 4D3SA 3T5TA 2Y99A 3G9QA 3UJ8A 3VMMA 1Y6JA 2QTMA 1GZVA 4I19A 2PX2A 1DTWB 2WTEA 3A0UA 4US2R 1KFKB 2QW0X 2NQ8A 3TNDA 1U1CA 3A9UA 4B3RB 4MIYA 5DN6A 4AI6A 4TKUB 3B70A 3HP1A 1M83A 4I55B 3SSOA 1SPBS 1JPVA 3CX4A 5HKKD 3U60B 1XVVA 3VO2A 4PSCA 4YRGA 1SU4A 4QUBA 3AKYA 2UZ0A 2YZ2A 3L7LA 5E7QA 1W4BA 4QVIA 5EQFA 4OLFA 1QAOA 3F3SA 1LPPA 1NLFA 1FDVA 4Q7JB 1L7XA 3RKRA 3V00A 3BIJA 3FYSA 4G56A 4WLOA 4Y6SA 2G3YA 1L7BA 2NVOA 3VZPA 4WK6A 4IYRA 4DFDA 3PDCA 5HDBB 2C4WA 3O21A 5A3RA 1T4MA 4EVSA 2I6SA 1RZVA 3OZWA 1B6TA 3KVYA 1XZ8A 2OG1A 2ACWA 4DB2A 4ZC8A 1TLTA 1SBNE 2E0IA 1QGED 5E9JA 2W2KB 3DP7A 3P2KA 1NU6A 4JSTA 5CH5A 1DX4A 3NHPA 3EF0A 1Y3CE 2VAWA 3EGWA 4QGHA 1ISSA 2GI4A 3C5WP 2ATCA 2REXB 3IUYA 1QHHA 4IO0A 4OTZA 2FE4A 1J07A 4FLEA 4PYOA 3C87A 1L7EA 1XVUA 1EVKA 3OJWA 4CQLB 3VC1A 5BY2A 3OEHD 1I3LA 4QTTB 2YXNA 4OYYA 4GI5A 3S1SA 1U6KA 5BUZA 3I32A 2X0NA 4FCTA 4RADA 3K2EA 4GSKA 4DT1B 3CW2A 1FTYA 2EL7A 3IC5A 2PUTA 1SJ9A 3R5XA 3AVYA 2R44A 4G0PA 3AHIA 5MDHA 1YJXA 3O1LA 1O95A 1QIIA 2JIZA 3A1VA 4J76A 3ANTA 5AOVA 2Y1CA 3WP1B 1TI7A 4YAJA 3OTQA 4FYIA 4M60A 1E1KA 4U63A 4NJMA 1FP6A 5KSWB 4N48A 3BDAA 1XRMA 3TS1A 4YCCA 1M1YA 3QU9A 3LLUA 3S40A 1Z6YA 1B8PA 1Q6ZA 2H1CA 2HJSA 4YNBA 5GONF 3DVAA 1OWMA 1QORA 5KWIA 4WK4B 1UXOA 1REQA 2HU5A 2YQ5A 2ZVDA 4A16A 2ZBDA 3THWB 3DVSX 4RL6A 4LSGA 3L4BA 3LX4A 2ZJZA 2VZ9A 1E1LA 4FWIB 1LWOA 1Y9EA 1EXNA 4G26A 4KGVA 4KXYA 4IV5A 2GHQA 1EINA 3KLOA 1BCSA 2OYSA 5BW8A 4M8IA 1FFHA 1QWOA 1AB6A 3I37X 1Z5WA 4UXHA 2I71A 4FZJA 4R84A 1H8HD 3CEPB 3FTPA 4B8ZA 2FXIA 2HEGA 4YRRA 2IHTA 2LIPA 2O05A 3P9SA 2H51A 2L42A 4X84A 1CT9A 4H60A 4WHMA 1MX3A 2AFHE 4W9NA 3EWSA 1U2GA 2X1VA 2YUIA 3I12A 5AQ1A 1AQ6A 4I4CA 4N8SA 1IEXA 1AF4A 3UNXA 2AZTA 2UVDA 1P3DA 3KTAB 2W37A 3FJOA 3QVMA 1WG8A 4W6ZA 3WGUA 1L9KA 2MIIA 3D1VA 3EGXA 4ESVA 1SXJC 4O33A 1YL7A 1XLTA 3A3OA 3MWJA 1E3DA 4UUPA 3II6X 5M34A 4QECA 2DR0A 1RIFA 1AGXA 3CRRA 3KPWA 1P8JA 1QSGA 4FEGA 4TSFD 4WFIA 5FPYA 2A0FA 2C2GA 3OPQA 3SVZA 3TQFA 3DEYX 2H11A 4WWHA 3ZQ6A 1OU0A 2PBLA 2ZRNA 4CT0A 4P3XA 2YXLA 1DPGA 2O5EA 721PA 1K68A 4OLJA 1J0XO 2TRSB 2AK2A 4AXXA 4IRUB 4ENRA 3OTHA 2C8KA 3ZJUA 3C1UA 4EUFA 5LQAA 1R8XA 3F73A 5LZ5A 1Z45A 3WWYA 3PDIB 5DSZA 4CNQA 1Q1ZA 3L18A 5K0ZA 4QQ8A 3C45A 3SQLA 2H54A 4KRYA 4HAWA 4ZI5A 3HCAA 3S28A 4ZAYA 5L6MB 4NOLA 2CNKA 2H1LA 1DTSA 2JIDA 4RZIA 5K0CA 4NEQA 4UMDA 2BF7A 4DBLC 1U1DA 1PTJA 3TIVA 2AJ8A 3OLYA 3NH9A 2XZPA 2X0FA 2LBPA 4PVCA 1BJRE 2ZRHA 1CJBA 1UK6A 1ZD1A 4EHIA 4BFXA 3JALB 1ZRNA 3ZDYB 2WU0A 1NWHA 2GJ4A 4TTSA 3AHGA 5EY5B 3PWTA 3KDSE 4RXUA 3EIHA 2XNCA 1DBVO 2Z56A 1B7GO 3AHJA 3LCMA 2ZJ3A 3QSGA 4WFKA 4FFRA 3WGQA 2A9KA 4NZMA 5CDTA 1IN6A 1FUKA 1TLLA 3IBCA 2C8LA 1G8JA 1IY1A 2AGVA 2YIDA 2ECOA 3Q9NA 4FK8A 2DUMA 2PGXA 1QZ3A 3UAGA 1RQRA 1RXSA 4H3VA 3PFHA 4L6AA 4CU5A 1TCBA 5T4HA 3BC1A 1J20A 4LZOA 1ODSA 3EMDA 4JY7A 3BDIA 1N1GA 3NOXA 3AEUB 2CL0X 3TRDA 2VHJA 4HYYA 4X60A 1CYDA 3AUYA 1SU7A 4RO0A 4XLLA 4I99A 2E48A 5I9TA 3GLTA 4P81A 4EX6A 4HDNB 4OHXA 3SR0A 1HETA 1F4LA 2GNAA 2IUTA 2Y1GA 2L82A 3RRBA 4HXGA 1DAFA 1UAGA 3QEKA 3QFCA 5F9MA 4KN8A 3D4IA 3DOOA 3V46A 2I8AA 4MRSA 4JR0A 5EIBC 3WIUA 3G5UA 1UM9B 2I2BA 1KY3A 1Q0ZA 2DAPA 1F8UA 2JPDA 1IBSA 3GEGA 3T9FA 3NVKI 2QROA 2C9CA 4E5YA 5LQUA 5HCIA 5ARBA 4JSYA 4WH0A 1DC3A 1L5GB 2A8YA 1T26A 4IGAA 2M6RA 5F76A 5EUBA 1SXQA 3D8NA 2IV7A 4URWR 1WU8A 4Z2AA 2IF2A 4E31A 1JDUA 3RASA 3WLPA 3KLMX 4YECA 1LUAA 4ZTBA 2QTCA 3UXYA 5KWEA 4FR0A 4DCGA 4DUGA 3WQRA 3EYAA 5FOXA 3WYEA 2NOAA 5A9SA 4R6XA 5KVSA 2KLHA 3JYPA 1ORWA 1U3VA 1N2SA 2OM2A 4KNYA 3ZX4A 4LGMA 4IHJA 2DCMA 3HHPA 4I1YA 1UMCA 1ZKMA 5FA8A 4J3NA 5KBYA 5CUQA 1JKXA 2X7JA 3VTFA 4MVJD 2FUG1 4UFNA 5EWLA 3EA5A 3OURA 2L0XA 2GN0A 5TSDA 3VTZA 1JXQA 1Z5GA 2VTVA 3CEHA 1QGUA 1XKQA 2IJGX 3BCHA 5AHKA 1NW8A 3R3XA 4B4WA 1WPRA 3LYAA 1ZS9A 5TMDA 1RRVA 3CMMA 3OJOA 1OWOA 2Y1WA 3M49A 3T35A 5L3VA 4JV5B 3A70A 4PIVA 5AM0A 1T0IA 3WLJA 3P97A 4D2IA 1CR0A 3IUJA 3KD2A 4M9RA 5G1NA 221PA 2P6NA 3C3MA 1P9RA 2RHRA 3MGAA 2OCKA 4LE2A 2D74A 3T5BA 3KSMA 3VR6H 1YQXA 3V8MA 3HZHA 2EHJA 1NR1A 1PK9A 3E1SA 5E0KB 2JFWA 4CTKA 3CUEF 4LNUB 4FFDA 1IVYA 1OTHA 1EIZA 3BILA 3D6VA 3A4VA 4OIMA 4Q4AB 1KDYA 4HDMA 3ZVNA 2DKNA 1EFVB 1Y63A 3GUCA 1Z15A 1YO6A 3QLUC 4YMSA 2Q3CA 3Q9LA 4Z9BA 5EPUA 4EKYA 3WTCA 5FWAA 3I9KA 5AUQA 4K6FA 2RI0A 3OX4A 3NS7A 4PCVA 4B3MB 2FZLA 2QM7A 1HX7A 4G0QA 4YLGA 3KHUA 1SH7A 1GLVA 1T35A 2WA1A 1M6VB 4EPVA 1U2QA 4WXRA 2XMZA 1TF5A 4ZCIA 5AW6A 3OQJA 4L9AA 1JHQA 3KKNA 2VJPA 3OTGA 3DEHA 2Q0HA 3RKUA 1XN1A 2JVJA 3HUTA 2E4YA 3MJEA 1GEGA 1OAAA 4H7HA 4KJXA 1DKLA 2HQRA 2O2GA 1YMVA 3JQPA 4H17A 1N6HA 2JGMA 3PGVA 3MJ4A 1RZ3A 1IB6A 4HHEA 2D1RA 3WBBA 3G8DA 1EG7A 1NRJB 2XMGA 2F6RA 2VLBA 2GZ3A 2Y4NA 2ZRLA 1J7KA 4QKQA 1UR5A 1GITA 2YVKA 3R5KA 3U39A 2QN8A 1U0FA 1VBFA 3RT9A 3PUHA 5EIXA 1Y89A 4L95C 4AJOA 4PBRA 2HLNA 1T10A 2CJYA 4YYZA 1GQFA 2NWQA 3VTKA 2JI8A 3E1KA 4H7FA 4OLAA 2XDYA 5C8DA 2UZ4A 2XB2A 2ZRMA 1T8TA 5DW0A 5DTRA 4Q6BA 1QKKA 2RHMA 3MWEA 3DNMA 3L8CA 1I2ZA 4FW9A 3RVBA 1EFHA 2E3JA 2V45A 2I33A 1Z4OA 4RQUA 3D8UA 3I62A 2NO4A 4H1WA 1CZUA 3AIOA 3IDFA 1NLUA 1YSCA 3HU1A 1C5KA 4JQSA 4HRVA 2CCJA 4WI1A 3PKIA 2FFRA 1IXRC 2JL1A 3MTIA 3AB3A 1H3EA 1NFFA 1KMIY 3UAXA 1B14A 1G3QA 3ROPA 3WIBA 4YT2A 4B6GA 1JPJA 2BMEA 5FO1A 3F96A 1Q1NA 1B42A 5IF3A 2AFIE 4JKIA 4EGCB 2NP7A 2BM8A 1U8YA 1I2MA 1RRMA 3OPYI 4LC0A 5SYAA 4ND2A 4FJ2A 4V3CA 3UWPA 1LSSA 1HOXA 2PT5A 4IV0A 3G0IA 3GUVA 1T2NA 3SM9A 3ADBA 3QX7A 2LCFA 3LC1O 4W9MC 1PFWA 1D09A 3QE9Y 3PJDA 2ZAMA 4UVEA 2CT8A 1Z7GA 5AXDA 3LNTA 4CEHB 1QOPB 2OXFA 2FF7A 3LOPA 4QPPA 1Z4IA 2CL5A 4YAIA 2OOSA 4D0NA 2W2VA 5F4ZA 3RVJA 1UIMA 3HEAA 4MW1A 2RJOA 3FIUA 4MUXA 2G08A 1WXIA 1MLDA 2Y4OA 1GLGA 3PDIA 3QJYA 4CIBA 4EY7A 2VJAA 2I6UA 3C1AA 3A3YA 3C7TA 1NQVA 1DMRA 3N2LA 4G65A 1V43A 4IGKA 2E1RA 4X7RA 1AGNA 3AEZA 3D6MA 3O8QA 4EGJA 3GEEA 4RLFA 4G0VA 4HEHA 3ASVA 3AR7A 3DUFB 3DW3X 1XZMA 4TV8B 4QOHA 2P77A 4R40A 2G5PA 3QOYA 4CMEC 3GVHA 4PSAA 2YY5A 3RYHA 5K0NA 2Z04A 4D8YA 4ARCA 4E46A 4EG3A 5I7WA 2BHTA 4N0PA 5EIFA 4DTCA 2XH8A 4DR3B 3ESAA 3HRIA 4BN0A 1Z29A 2GXUA 1VHLA 4R9UC 2F43A 1ESNA 3QVGA 1VE7A 2EIHA 1MB2A 1U1GA 3KZKA 1CP2A 1HEUA 1H2AS 2XJ9A 1TF7A 2Y77A 3F9RA 2QN2A 2GK3A 5FPTA 3LP6A 3S8MA 4HGPA 3H5OA 3N05A 3NC4A 1T0HB 1EUCB 2DT5A 3OFJA 2M2IA 3N8HA 1OHHA 2QBYA 3B1FA 3DR5A 4O1MA 5ICGA 5C53B 3DWGA 1K4YA 3H2SA 4HNGA 3LBYA 1LJ8A 3WLAA 2J0SA 3FROA 2OHVA 2G9NA 2NU9B 5I7RA 4G5RA 4C5AA 2NTEA 1TRHA 3C1TA 3FLMA 2P67A 1ZJZA 4H31A 1RE1A 2Q29A 3JQBA 5C1DA 2OPHA 3F4LA 1LVUA 3JQBC 4UREA 4TRMA 4Q12A 1K66A 2GZ2A 4J0GA 2R8ZA 1T0JB 3MQ4A 6Q21A 1RHKA 3UUFA 3TTUA 1HZZA 1NKTA 3EFEA 2P9EA 1R0KA 3I0NA 4E7PA 2X6TA 1IM5A 1IOWA 4C4ZA 4DLSA 4CL8A 1W4ZA 1M2EA 2H00A 4IIFA 2IELA 3T6KA 5KTTA 3MS2A 2DULA 4GE0A 2RHCA 3C41J 4Z1MA 5KNDA 2AZDA 2QG4A 3HQ4O 4NYIQ 4TS1A 4OHPA 5C7YA 2P2CA 2H7YA 3EFOA 3SKYA 1AS2A 3OH8A 2NTVA 5ALZA 3HNOA 3JPYA 2MDTA 2I6FA 2ID8A 1TYDE 4M8LA 4S05A 4YGXB 3LPCA 2FMXA 3K1TA 2WF5A 3EC1A 1LXCA 3ET5A 3JD3A 3LC7O 3F5MA 3PYLA 1S5PA 4YP7A 2G72A 2AFHB 1VPLA 5CP8A 5LP6B 3WRWA 5A6VA 2UUAB 3V2GA 3JYQA 2O8BA 2BBSA 5E7IA 4Z4HA 2Q46A 3MT9A 2QYSA 1IBKB 1MX1A 1XC7A 1T9CA 2HMTA 1SIUA 2FZ5A 2W8BB 5IDXA 1OXXK 1S01A 2VA9A 3KELA 1KO8A 1CJMA 4X62B 1J2EA 3NKVA 3FOCA 4NVRA 4TMTA 5ECGC 2IXFA 3HCBA 4O5AA 3AR5A 3DE0X 1CP3A 4CMKA 5ERYA 1XEXA 3CG0A 3UATA 3DBHB 4FWBA 5KTOA 4P2GA 1BWSA 2N42A 4C7OA 4EX7A 2M6KA 3GRAA 4B47A 1TM3E 3UK2A 4XXHA 2AN9A 2AOUA 1WW8A 1JG4A 2G77B 3G0BA 1PNRA 2B8JA 1E4VA 4RIGA 3B82A 4AS2A 2HTEA 3JATB 4MV3A 1WBBA 1GFWA 2RFLA 3I5UA 3C6QA 3NKLA 2YOFA 2WP0A 2VBFA 4BLSA 1F48A 2GBFA 5LA6A 1IZYA 3ZWBA 1L7MA 1TA0A 2QUBA 1DEOA 3BJEA 3DPUA 3N9IA 4D6PA 1IZ7A 1UQUA 2HBZA 4MS4A 2OQVA 3CXUA 3U80A 2O1EA 5DK4A 2Z5LA 2FOLA 4QHSA 5K01A 3N07A 1ND5A 1YB5A 3OOHA 4J07A 4GOLD 4PEVA 5LVAA 5AJZA 2IOFK 1EGAA 4LA4A 5A4DA 5FOUA 1VDMA 1XD2A 3MYRA 4JLNA 1DDIA 3OQ6A 4PW0A 4BVEA 2G5CA 1FP7A 3TE7A 2Q3HA 3FHCB 3COSA 1WF3A 3AY6A 1CV2A 1UDXA 3QUQA 4IFBA 1T29A 1JR3E 5DEOA 5CB6A 5H82A 4B7UA 2AE1A 1RKUA 4GPIB 3ORRA 3PWZA 1N2CE 2Z4SA 3G8CA 5FPKA 1EYZA 1BMQA 1GRNA 1V3VA 4ZCLA 5KO2A 2I91A 4LBWA 4POOA 3U9TA 1H66A 3PHBE 4HGQA 3REQA 4B3GA 3IPXA 3A1CA 4YVFA 1Z35A 3OIYA 3ROFA 1F6BA 4HEJA 1ELOA 1G98A 1EP2B 2WUEA 4TVOA 1NL3A 1DOZA 2J9FB 4LXQA 5FNZA 4Z4CA 4HUJA 3ES9A 3FYUB 4MDHA 4E2YA 4Q1FA 3L6EA 1Z0SA 2AE2A 3IRUA 5DNUA 3SFTA 1N3LA 5BV0A 2I9PA 1OC2A 2WQZA 3AP3A 5CX1B 4C3OB 1ODJA 2PAAA 3KQMA 5AK6A 3V4LA 4LJ5A 5KQLA 2ZUDA 1AG9A 1B0ZA 3WMXA 3QVSA 2EBHX 1DOAA 4QYMA 2P79A 1OB2A 1R18A 2VKTA 1R1DA 1OUMA 1RS0A 2P0AA 4LRWA 3KM0A 5FAXA 4KO2S 4DR4B 2NP6A 3LJKA 3CN7A 4YXFA 2LKCA 3F6BX 1XLUA 4B7XA 2QD5A 1K6XA 4N5IX 4CN8A 2CNLA 2D62A 5YASA 1FQOA 1FYFA 4ZK6A 1DMSA 5HF5A 3AOGA 4RXTA 1KWGA 4B4DA 5KYWA 2G80A 3HUFA 4GM4A 4LN1A 5JWRA 1Y8CA 5TLSA 1HK7A 4UHDA 4GKKB 1J0BA 2X2OA 3T3MB 3MLAA 2WSLA 2YS7A 4I9UA 5FTWA 4RHTA 2CXTA 1CIVA 1OAOA 3V4OA 2GN9A 3PQ2A 2JCVA 2XF2A 2JEYA 3I83A 2ROQA 1GVNB 4M1KA 4BCCA 2B4KA 5K4GA 2PUBA 3QBVA 3D2CA 1FEZA 3K53A 1P9OA 4HDSA 2ZDQA 3VAZA 4DMRA 5FEUA 5I4CA 4PR0A 1EBBA 3JZMA 2IVFA 2X14A 2JRCA 4M9ZA 3RSFA 4XJXA 1HO3A 1RJWA 1Z0FA 4L78A 2PDAA 4ZQFA 4AMBA 3I5YA 5EZ6B 2H7XA 4F06A 1QP8A 5KB3A 4ER7A 1C30B 3KPJA 2E37A 4M98A 4LUCA 5CLFA 4IIHA 3BXHA 5CLLA 3VRHA 2NACA 3DBIA 1KZ6A 3GNLA 2ZPAA 1XFDA 3ICPA 4P5DA 2PUFA 3HXKA 2GSWA 3CSUA 2MYNA 2CVZA 1GFIA 4B3DA 4RTJA 4HWOA 1TIBA 1LF5A 2R7KA 4M86A 5ILGA 1ZRMA 3WK4A 2AFRA 1O54A 5JARA 1W36C 3GAAA 2Z08A 3HCFA 3HKBA 1F06A 1TT7A 2YASA 4BB6A 3CLSD 2O52A 2UUCB 1C1XA 2UAGA 1IM2A 1AKTA 4L5YA 3D4LA 4V0NA 1TECE 4EQ6B 1EHIA 1LZKA 4RD0A 2BGUA 4QXPA 4TKZA 5DHTA 1C0KA 4Y9SA 5IBCA 2ZUEA 5K4HA 2H2IA 4FBLA 3AIMA 4KXQA 4M37A 5ALYA 3GPLA 1IUKA 4QGGA 2P6RA 3KVNA 2O8BB 4GFDA 1IPFA 1URPA 1V3TA 1Z6GA 3GP8A 1O6GA 1JMVA 1HDYA 1JQDA 4A5OA 4OJYA 5FWXB 3LFHA 4NENB 2FWNA 3JZDA 2OAP1 3GVXA 3QBEA 4LJKA 2AJBA 2I62A 3K0EA 3MWKA 1CRPA 2VWQA 3KUKA 4J0FA 2CLEB 4MB2A 4B09A 5JZMA 5JTTA 3W6NA 3OQPA 1KOJA 5M2QA 5DCWA 1N6RA 1HKUA 4UM5A 4QU5A 4CLXA 3RJZA 4R31A 3VZCA 2QTNA 5A6SA 1HDXA 1W6RA 2HHHB 2I4MA 4TROA 5K8LA 1NVVR 1PU2A 1QYCA 3BH7A 4DLVA 2XNSA 4J0IA 4ASUA 1E94E 2W2NA 3K9WA 4GMKA 5HS4A 2ODQA 2C95A 4NE9A 3P19A 3M89A 2GFHA 4GGMX 2INGX 4XYEA 4L16A 5CAEA 5EVCA 3DO6A 1USIA 2GWHA 1G20E 3AIIA 3LUPA 4Y6RA 1GQQA 4ZVUA 5GOTA 4PNHA 3RRNA 2ZRCA 1W7AA 4WDQA 1JWLA 4FSDA 1Y80A 3KT3A 3MSCA 2QRVB 3L8DA 5GVRA 1QV9A 4Z7NB 3IGFA 4RKYA 2ISQA 1LCIA 4ZTZB 3EZGA 1R88A 1LFAA 2A59A 4GKBA 1HE1C 1UBEA 2F3PA 2IUEA 3C3AA 4RFVA 4WE3A 4KR6A 2C4VA 2ZS9A 3RPEA 3Q5DA 2CDBA 3WICA 2Y1KA 2VZ8A 5F78A 2QG6A 1XRNA 4DDTA 4KBFA 3HU5A 2QT9A 2F8SA 3ICEA 1N4AA 2VK8A 3NEAA 2Q3MA 4EG0A 3NMUF 1JU9A 1OPXA 1QIMA 2A9VA 2FHSA 4EG8A 3DEZA 3NHSA 1PHRA 2AMFA 3OLQA 2UKDA 4AK9A 1UWKA 3JQ7A 3LPAA 1I94B 4TTPA 4LXHA 2Q28A 1MC5A 1GUBA 1RKBA 2YQ4A 1IWOA 3RD5A 3RO7A 1E6MA 1GNTA 1L6IA 1VFNA 1WP9A 3DKIA 2BZ0A 4LHXA 4G6ZA 3L4BC 1UMDA 2IUSA 5LP6C 3RUIA 3WMGA 1UANA 1U0HC 4R8MA 4Q0MA 3EMVA 3N0XA 1T3SA 1XAHA 1FVXA 5J1TB 1IJFA 1XA3A 4MCJA 1G291 1CZRA 2DBVO 1T5TA 1GZ5A 3I4CA 5JMTA 4MA0A 3VH3A 2CVQA 3V6LA 2DFDA 5CYOA 1Y4DE 3CLSC 1EVZA 5U4XA 1ZI9A 1JW9B 3BUSA 5I7OA 4P34A 3WWPA 2NU8B 3TZ6A 1NR7A 2RHWA 1UBOS 3K9NA 4ZO9A 4OB7A 5FQOA 2YYZA 4JC0A 5DLEA 2ODBA 4QHTA 3BRSA 1V1RB 2A92A 3RYIB 1NDUA 1SBTA 2WWWA 1PEAA 1XD9A 3OCCA 2YS6A 4LVOA 5BR1A 3IIMA 4INJA 2WKPA 5EQTA 4DEXA 3REGA 1OBOA 2B30A 2C2ZA 5C35A 4AECA 3UFXB 1BE6A 4MQ6A 2A94A 1O1YA 2QLLA 1FFDA 3SNHA 1J33A 1RXCA 2ZGVA 4B6RA 4GMHA 4E33A 1ZUHA 2JLCA 2QIPA 2RI6A 3KFVA 4KB5A 3ESZA 4AJNA 5AUNB 1JI3A 4PHTA 5JOQA 1PNOA 4FQ8A 2ZEJA 3V55A 4G3XA 1N2XA 4KDCA 5KYGA 4OYHA 4MVJE 1NUTA 5C34B 2JCGA 3C8HA 3ZHCA 4C0LA 1G3RA 3RCBA 1M73E 4A2PA 3HWRA 4KLZA 1R12A 3DMYA 3HUUA 1JVSA 1WZCA 2RK6A 4XYMA 1SC6A 4BMNA 1KWKA 4DARA 1LF0A 1ULZA 2J31A 1AV6A 2C29D 3V1NA 5EXTA 1RLJA 2WWVD 2ODEA 4HNAB 5DGDA 2QTHA 4Q4JB 3WRVA 1LDGA 4Q9KA 1AQJA 4HLCA 2VHXA 2C42A 4Q39A 3HJNA 2Y1DA 2V0GA 4A3SA 1SC1A 1YULA 3M6UA 4QTZA 5BR7A 2JFOA 4ALKA 5JXWA 4UXIA 5DBGA 5J47A 1YCDA 1KERA 2BL4A 2LKDA 4YREA 3WQBA 4DPMA 5IT5A 1VSUA 3JARB 1BRTA 3LW7A 4NECA 1J2RA 5AI9A 1G8FA 4UNQA 4QXRA 1PAUA 3KWLA 1QBGA 5KQRA 2FJPA 5KU1A 4ZOCA 4QPNA 4Y2PA 3DDNA 3BJRA 3UXMA 4G09A 3C4JA 4B9EA 4D42A 2ZBFA 4WBNA 4PTLA 2B3DA 4V0OA 3DZJA 1QX3A 4AX8A 3OIDA 3OFNA 3R7NA 2JGRA 1DINA 2YHBA 2BH2A 4QRHA 4AYTA 3ZWOA 1RLUA 1SXIA 1WU7A 1ZGZA 2FK8A 4DDHA 2JJQA 3QEJA 4OV6B 3O73A 3B89A 3OFSA 3T1QA 3QUBA 4G5QA 4QJ5A 5GZ6A 1WQ3A 1XCJA 4PAQA 5JZSA 4MV9A 3PRKE 1IXKA 2C00A 1U8FO 4S1TA 2NU8A 4N82A 4GF5A 4IDAA 3O3CA 2Y67A 4LHSA 3C3YA 3F2VA 3MZ0A 4L5AA 2CJWA 3DOJA 2OHFA 2ZCUA 2NZ8A 1UT6A 3N8NA 1ZHOA 4OFZA 2WHXA 2CXPA 1NXVA 3UT0A 1H85A 2IEBA 3PA6A 4GRDA 1KAMA 4IJQA 1QP0A 4BMXA 2CHFA 2GXQA 2HO5A 3MCWA 1K2VN 4ZZ1A 1MW9X 1R9GA 2ODNA 2X5XA 5AYVA 4B44A 3GT4A 2FB9A 1UMCB 4MZDA 4U7PB 4XI9A 4B2LA 3Q98A 3VJKA 4DPLA 4YRKA 3PGMA 1KDRA 4L4XA 3SHVA 2W6MA 1IZ0A 1Q0SA 3DF9A 3GLFB 4BMYA 1CIJA 1ID1A 1OH8A 2EKZA 2JLVA 4NAUA 4DSOA 4ENTA 1NBOA 3CV3A 3KWJA 1HPLA 3DNPA 1K7CA 4Z86A 5KX5A 1GQSA 4P4NA 4RMNA 3FVTA 2QPAA 4DUPA 5CB4F 1XZGA 5DX8A 2XRFA 4B35A 4FC6A 3GL9A 3TFWA 3ZQKA 3CLRC 1JB1A 4C07A 2VDVE 3E82A 2PPVA 1CY8A 4JEMA 1NVEA 3ZS9A 1N0UA 4H7IA 4HX9A 1G17A 1OAKA 5CXUA 4RHEA 4JBNA 1WDLA 2V9PA 3EUFA 3FKQA 3MHPA 4UEKA 5EMJA 1WBDA 1UIRA 1Y5MA 3ITKA 4R6WA 1KEEA 1ZBQA 3PUWA 1EXMA 1VKRA 4XD2A 5HMMA 3WYBA 2CL6X 5KPJA 3M70A 1NVGA 1X14A 1Q5PA 3IBSA 3B12A 3PQ8A 4G07A 4HYTA 4Q18A 1R50A 3TQQA 3UB4A 1GFSA 2HQSA 1CVLA 3DHEA 1UFQA 3W5IA 3I3SR 5REQA 3NBKA 1QNLA 1J70A 3D6NB 3DMTA 1T9ZA 4WL0A 4PC1A 5JYEA 5F3DA 1O77A 3L8FA 1GM5A 5HGXA 1DQYA 2BTQB 4KN6A 2ZB8A 5DSXA 4DSNA 2RGEA 3ELBA 1EK0A 4RK6A 4F3CA 2WZDA 1JH8A 3CXRA 3IURA 4IJ6A 3ILYA 4C4XA 1OX4A 2XTZA 3JS5A 4I46A 3EFBA 4INPA 2R68A 1AK9A 2VXBA 5JCOA 3VBEA 4MR9A 5JVDB 4DVGA 1L3CA 3EXEB 4NH4A 4W8GA 4FR5A 5D2CA 1RP7A 2KX7A 3M8KA 3IS3A 1FXWA 4COKA 3UT5B 3IQFA 4OK3A 2LV8A 5E8JA 3CU5A 2I6TA 1NMEA 2C7OA 1R0XA 2YNMD 1R64A 1P7WA 3C24A 4MGHA 4Y6OA 5D3MA 2CC2A 4AWBA 5LL6P 3KQLA 2VHUA 4RTLA 4CYMA 5CEFA 3U44A 3JALA 2AJDA 4WCFA 5CFOA 1DRVA 1UPCA 2ZAOA 3PXUA 4QNRA 1SB8A 5IFLA 1DJOA 3OC0A 3MTDA 4WCFC 1O0BA 1C4WA 3NBYC 2BY4A 3GCXA 3MK31 3S2SA 3KR1A 1LDMA 4X0EA 3RV4A 4DXAA 4GEGA 3P2JA 5KOHB 3KOZA 4OHYA 2XE6A 4RIEA 1OXUA 2TMDA 2JIBA 2XGSA 3LP8A 5F5XA 5K51A 5LIPA 3O0TA 2ZBGA 4ZT7A 1UPXA 2Y0DA 1MX9A 3DKKA 4HBZA 2ZJBA 5LSAA 3LBNA 3K30A 3RGGA 2QAGB 3R0QA 1DCKA 2WYWA 3M5CA 4R0NA 4V0LA 4E22A 2HXYA 2YZ7A 4OAQA 1JUDA 3PGJA 1KJIA 2PZBA 4R5MA 2CB0A 1ZP6A 2BGLA 3OQBA 4LC1A 1G9XA 2DUUA 2WV9A 4DLXA 4Z0PA 3LZDA 3O93A 4OOFA 1QHSA 5TR9A 5BUSA 2W98A 3LLSA 5LD2C 1CE8B 4CG1A 1NIJA 3UICA 5MN5A 2YWBA 2WG0A 2CNWA 5ER6A 2A4KA 1QU3A 3LXUX 1QOZA 3AHDA 3SJ7A 4FFPA 3L3BA 3CGGA 4AP6A 1MO5A 2PBFA 2YIMA 1P2TA 2GN8A 2R6FA 4G4SO 2CV2A 1TGVA 2WJWA 1N2GA 1H2FA 3L41A 5ICEA 4P7FA 3GEHA 3WNQA 1COZA 4G2NA 1RKVA 1X7WA 1ZIPA 2FJ0A 4KDFA 1XXHE 4V0KA 3R3SA 4LZPA 4EZBA 3U7QB 5B36A 1UDWA 4KQFA 1MB0A 3A6FA 5ADWA 3WLFA 2GPYA 4CCYB 1JU4A 3RFVA 4J16A 2F64A 2O1XA 4JMPA 3OZFA 3FOZA 1EUYA 4E5KA 3LECA 3FN4A 1NZFA 1NJ2A 2DLCX 3O6VA 4DHEA 4YJFB 1RP1A 2AFIB 1EFRA 5B4UA 1E1MA 2GO7A 2ZUBA 4NCJA 3I1FA 4CTOA 3TCNA 2TMKA 3JVIA 2OZVA 5CA0B 2ZWOA 1QX4A 2VQDA 2CUZA 4KLNA 2H1VA 1JA1A 3MT0A 3HK2A 1CFZA 1KY2A 3NTRA 1C4KA 1SIOA 1GG2A 4Y2HA 4BNMA 3U56A 2DQKA 2W00A 3UUWA 3D7RA 3OM0A 3QVLA 2PRYA 5ES3A 4AY6A 4KQXA 3ENNA 3PDHA 1SUIA 3PL5A 1H42A 4Z7JA 1QJCA 3O4GA 4D46A 5ESDA 4ZMBA 1YVPA 2KJQA 1GPJA 2D5LA 1IK4A 2QI9C 3EXHC 2Q2QA 3NGMA 4IJKA 2WOOA 2XCUA 3I9V1 3JZAA 4AB1A 2Z3ZA 1HNZB 1QGAA 3E3LA 3FDJA 4PRYA 3UEOA 1RKXA 4B17A 5LBUA 1FX0B 3MM4A 5BW5A 2WM3A 3QF4A 2ZUCA 1TQ2A 2KYRA 4PINA 4MWDA 4XVUA 5JT1A 1JHVA 3L40A 2PRKA 2AJLI 4HMPA 3WY9A 3A26A 4EUSA 2IV2X 5JCOC 1ZJ4A 1EM8B 2WHPB 3I1JA 3QK7A 3WKEA 3E84A 1G7SA 4HQ6A 1ONNA 2I4IA 2JHCA 3B3GA 2XQVA 4HAXA 3QWFA 2CLHB 3VKGA 2HJVA 1GGNA 2A9QA 2PZ8A 3KQWA 5DI3A 5BQ5A 5B30A 2WJGA 3EVBA 3SX4A 4XCVA 1ZVMA 3NYIA 3UWSA 2QPOA 3Q9UA 2VNKA 4FOPA 4A2QA 1F2TB 4LHWA 5JNSA 1J2UA 1KS9A 3PI7A 2PKQP 3PPYA 1Z8HA 5FNVF 4P80A 4B9AA 1LBHA 4QLAA 2B2NA 2XODA 1EXVA 3OUUA 5JDCC 1E1QA 1PJSA 1VHQA 4TRJA 3V6MA 4CUJA 3KALA 1JE1A 1E4EB 3IKJA 1XCOA 2RH9B 3D3QA 3D8HA 4QYWA 5KDOA 1G7RA 2YFYA 4LJSA 1PRYA 5KYUA 5I01A 3E81A 3CRMA 2VYCA 2C77A 5CDYA 2ZJ0A 2V9CA 3T52A 2N47A 2YNMA 3WVNA 4ZP1A 4PC3A 3ILHA 2DWUA 5JSFA 4CRWB 3SQMA 2VTDA 3U3XA 4X64B 4QGFA 1OA1A 4TMKA 4EJ6A 3LDGA 5JS8A 2QU7A 2XMDA 1HFEL 3VUEA 4Y67A 1UJMA 3TD6A 1YBHA 4PHHA 3OQVA 5EZYF 3P2MA 3TLEA 4C1NA 5BN5A 1FDWA 1RBYA 2HMVA 3DUFA 3M1AA 3KYJB 1PR5A 3V2IA 2Z83A 2HHJA 3BF7A 3I23A 5AVTA 1D8AA 1YOBA 2WHEA 5E1DA 5DM1A 1RCFA 2XJ4A 5E3JA 5EYPB 3TQHA 4LY0A 1E1NA 2WA2A 4OYRA 3DUWA 1JLHA 4HLQB 4U02A 1SEPA 2HPHA 2V6GA 5IDVA 1QCDA 4G1BA 2EV9A 1CR6A 4WZAE 4UVHA 1EBUA 1N6LA 2E4ZA 4P36A 5JXHA 2QGZA 2QRGA 3EXG2 5LOVA 4DV0B 4QARA 3BEDA 4KDRA 4N9QA 4WJZA 1HZJA 1TQ4A 1XROA 4NBNA 3SBXA 3DAHA 3RBXA 4AO8A 3SF8A 4AS1A 5FRDA 5DNYB 1JR6A 2OILA 2OEPA 3A27A 4G5GA 3UFBA 3Q3GE 3KNZA 1HYGA 2I4TA 2F48A 1KDVA 4WLEA 2FP3A 1PJ8A 3M4NA 1FYDA 1R16A 1W85B 3PQ3A 5TPWA 1Q2XA 1QZZA 2R6HA 4I1UA 3BKXA 2PKYX 1GA4A 3CINA 3DZDA 4QL3A 3C6ZA 1IUPA 3JQGA 4CIDA 1I2AA 4FMCF 5K1ZA 1OPRA 1TL7C 3ZZ1A 1TEZA 2VP4A 3IB6A 2J9FA 1I0ZA 1YAJA 4FE4A 4UDOA 1YNSA 3AC0A 1A76A 4LVUA 3BE8A 4B7ZA 3DVRX 4JASB 3KZXA 4RMJA 5KAMA 2DR2A 1LBQA 2Q6KA 1BX0A 1NW5A 2X0RA 3LUFA 2PEYA 1N75A 1Q77A 1Y1QA 3QQPA 3ABQB 2G9QA 1TX4B 4RANA 4GW3A 5HZGA 1VSVA 1TVMA 4XQCA 3B2QA 3UO8B 4C14A 2IHNA 3BRWD 4OGLA 4HYEA 1N9GA 1ZN8A 3R7SA 1E2JA 3KUDA 5AKZA 4BGDA 3D2BA 3MGBA 4C4AA 2DFLA 4F96A 2XT6A 1BHJA 5DHRA 4S2EA 2I4OA 5EVJA 1N6PA 3GNSA 4JFAA 3SJBA 1PJCA 3HDJA 4HDKA 4Y1GA 1UFVA 1I5EA 1RI4A 2MMGA 2R1VB 1JG3A 2RAUA 3C8MA 3PNQA 1R4AA 1W1WA 3IQDB 4M7PA 4BKQA 1R9JA 3ELDA 3ESXA 1X7GA 3NOOA 5LMUB 4RAQA 4KHPB 1ZGBA 3ZW9A 3NBUA 3ZHZA 4KFUA 2PYIA 4YAUA 2LDBA 1DBIA 4KI0A 2WWYA 1ORDA