2PO5A

Crystal structure of human ferrochelatase mutant with his 263 replaced by cys
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSACSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ferrochelatase, mitochondrial
publication title Altered orientation of active site residues in variants of human ferrochelatase. Evidence for a hydrogen bond network involved in catalysis
pubmed doi rcsb
source organism Homo sapiens
total genus 138
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2po5A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2po5A01
1C1HA 2Q2OA 2QD2A 1LBQA 2HREA 2Q3JA 2XVZA 2XWPA 4KLCA 2PO7A 3M4ZA 2XVYA 2JH3A 2QD3A 1LD3A 2C8JA 3AQIA 1L8XA 2AC2A 2PO5A 4KLAA 2DJ5A 2H1VA 1N0IA 2QD4A 3W1WA 2XWSA 2HK6A 2H1WA 3HCOA 2PNJA 1QGOA 2XVXA 2XWQA 3GOQA 2Q2NA 1HRKA 4MK4A 1AK1A 2QD1A 2AC4A 4F4DA 3HCNA 1DOZA 2HRCA 4KMMA 1TJNA 4CCSA 3HCRA 3LYHA 4KLRA 1C9EA 3HCPA 2QD5A
chains in the Genus database with same CATH superfamily
2G40A 4FFVA 1RWPA 4XM1A 4EY3A 3AWIA 4X85A 3CUUA 4DMRA 5C5EA 2YL2A 5FORA 2X0KA 1O95C 2PKCA 2Y4OA 4LY6A 4HF7A 1XZHA 3LA6A 4PFQA 3BWCA 3DCYA 4CLHA 1Z82A 4JYAB 5JU6A 3CB4A 1OI4A 3K94A 3JQ7B 3FNFA 3Q7TA 4WNIA 1JEYA 3ZTWA 4BE4A 1YJCA 2AI2A 3AETB 1PF7E 2OFWA 3UOWA 4I5EA 4F6LA 3B82A 3PD0A 4G5HA 5CT4A 1ZWKA 4QEZA 1P1KA 5EJIA 3TRDA 3Q88A 4AP5A 1TYDE 3K0KA 1LBTA 3LXRA 1A7UA 3N05A 4LXGA 1RWOA 4Z9AA 1KBOA 2V6MA 1F3OA 3DEZA 1NF8A 4BV3A 1QHXA 3PC3A 2PT9A 4H7DA 4O5OA 1DT5A 4WX2B 2BKEA 3QF4A 4PQFA 1H2RS 3HBJA 2AX4A 3C7DB 1VI5A 2BGGA 2C9OA 2WWIA 2PHZA 4RPHA 5TY0A 3S55A 1G7TA 3V8EA 4C1BA 1CUJA 1VIYA 4H27A 1MORA 2UAGA 1BKDR 2BEVB 2R25B 1SXGA 2B34A 2Q9CA 3NUQA 1U7OA 3RTBA 2FSVC 1LPNA 3RVKA 3TJRA 1U8FO 2ZJ1A 4HWTA 2WAOA 3DA8A 1KJ9A 3WQHA 1RRKA 1TA0A 2Q6VA 1LWNA 2RIRA 2X7HA 4DRYA 4LFAB 2QN9A 2YHIB 4EAAA 4ND8B 1HDRA 1E5DA 1ZJZA 4CG0A 1R5NA 5AK6A 2G07A 2O5RA 2WZBA 1DLJA 2BMFA 2BGNA 4C9BA 3ZBQA 4LDQA 3UGKA 4YMHA 1PJQA 4EFNA 4K6GA 1RJEA 2EIHA 2WUDA 2VI5A 4U2EA 4GX2A 5LA6F 1OLSA 2CVPA 2HMUA 4UAJA 1TMGE 4ZAWA 4Q9LA 1JBQA 2ZRFA 4J1TC 4G37A 5TS3A 1MO4A 2GKSA 4M9XA 2VNKA 1P2BA 4EKGA 3DE6X 1QVAA 3PUXA 3GJ0A 4AIRA 4NV0A 4D4JA 1VA4A 1D4FA 2V7TA 3AKDA 3OIUA 4JXKA 4NBTA 1ABEA 2VHCA 3LGSA 4AUMA 2X7JA 2ZYHA 2BFDA 3E9ZA 1R5OA 3QU7A 2CMDA 2DFLA 5HE9A 4ZI7B 1QUEA 1XZQA 3MEQA 1CV2A 1KJQA 4G2TA 4CQMD 4DRXA 5KU1A 1P4JA 1QANA 4HX9A 2FEWB 4YK7A 4LJKA 1F4PA 5GM2A 3HFSA 4H1TA 1RSZA 1JT2A 3FHOA 4K6HA 4PS0A 4XUGB 1FX1A 1KDOA 4DLTA 3EHDA 2JHPA 2PL1A 2XHEA 3PE4A 2OCBA 1E77A 1T43A 3O7MA 3UHPA 4BU1A 1G1AA 1NJSA 4E7PA 2ZBFA 4F8EA 1AQJA 1OSNA 4DG9A 4H1VA 3GK3A 4J7UA 1GU0A 1F51E 1G20B 3EF3A 4M4SA 1NBWB 2JL1A 4M9RA 1SQ5A 4V2IA 4RK7A 3WBFA 1E1RD 1W8DA 2Y6VA 1XTTA 3EAFA 4NOMA 4OP3A 3OT1B 4JLOA 4JLKA 4MI1A 2ODBA 4IMPA 2TYSB 1JFVA 1M9NA 4B43A 2HU5A 3CRRA 1XPJA 2XJ4A 3PDWA 3HCWA 3UUGA 1U7TA 2BDTA 2GK4A 1JIQA 3GOHA 4PLYA 5F1PA 3HN7A 3DXFA 3FPGA 3WXBA 5CBPB 3HB4X 2X4GA 1FLNA 2G1UA 4AK9A 4YPOA 5HKKD 3GZJA 2V55B 3TNLA 2ACWA 3CF6R 3GRYA 2J3IA 3H7AA 2UXDB 5DV9A 1CQPA 1OXTA 2IPNA 1E0AA 5LYJA 3UJ3X 5BV2P 4I55F 1DI0A 1C9JA 1NVXQ 1PK9A 4JCCA 3H97A 5DI3B 3I0NA 4J0EA 4M9QA 4UM9D 3R7WA 1DRJA 4GRIA 4GVPA 5JDCA 2BH9A 2Q9UA 2BKXA 3V7YA 5LNK1 3LLUA 4J3NA 2F43B 4F9GA 2C8JA 5AVOA 5A4FS 3OKFA 3AERA 3LPCA 4WXHA 4Y30A 2FWIA 3ST7A 2J09A 3UFBA 2BDUA 2C9MA 3ANSA 3EAQA 3PA8A 4Y6PA 2FWPA 5AICA 2PZFA 4FQ8A 1Q7GA 1YASA 4NE7A 4D44A 3TVYA 5BOSB 1YL6A 2V45A 4WAUA 3ZDDA 2R8YA 3FTPA 3PQ8A 1BWSA 2O2GA 2DLDA 4D5EA 4EY8A 1UOPA 3BTVA 3ON5A 4GZ5A 2BKVA 2O7SA 4JITA 4QJIA 5KYYA 1VGQA 3HC7A 3KQSA 2P79A 3A4MA 2DE0X 2NZJA 4A6XA 3HCAA 1JH9A 1T4GA 4JC8A 2EZ8A 1F8GA 2GFQA 3KZ1E 3G8BA 4IDGA 2ZS9A 4KRXA 3QJYA 2YY5A 4FS8A 4MRVA 1KQ3A 1W2WB 3W9YA 4TMTA 1UBOS 5JY6A 1J5EB 3IJ5A 1WCIA 3A0UA 1RM5A 1FEZA 2BIFA 2WU8A 3SE0A 3MTGA 1BCRB 1SOUA 3UB4A 2X8AA 1N6NA 3REFA 4Z54A 2VP5A 3H1TA 3HCOA 4BAGA 4HX2A 1KRXA 4NONA 1XVVA 3ZH9B 3NBYC 3W3AA 3KQYA 4QXMA 4HAUA 1DNPA 2XJ9A 5HVNA 5IH3A 1F2UA 1WP9A 4S1PA 5DI9A 3C6YA 1DCKA 1DAEA 1EUDA 2JHFA 2EQBA 2D8AA 5A05A 2I33A 4HDAA 1CQXA 5EWJA 1RKUA 1VLMA 2AVNA 4Z4GA 3BB4A 4OHPA 3CUKA 1T13A 2PJZA 3LGXA 2WILA 3TAHA 1ZISA 4PYMA 3AHJA 5LSAA 3A3NA 4IV5A 1JR6A 1GGMA 2PJUA 4XJSA 4F2PA 2IOQA 3OBBA 4O8CA 3SZGA 3MGGA 4JL6A 1F2TB 1W0JD 3A58B 5FDFA 2J67A 1VIVA 3FH0A 1TVKA 3H04A 2IT1A 1C1DB 3OJFA 4ZU6X 1C1XA 4K3VA 3X2EA 4C0QC 1DSSG 1I24A 4PX9A 3FUCA 4PO1A 3WQRA 5AFSA 1U1IA 3L4KA 1D4AA 3JZAA 4PCUA 1XTJA 1ZQ9A 3GNLA 3QUBA 4WLOA 2ZEJA 4DE5A 1QVVA 2G9VA 2VC2B 1IULA 3QFTA 5KHAA 4CVNA 4ZA2A 3VU1A 2E1RA 3IMCA 1Q50A 1EZZA 1TO1E 3NIBA 4RPKA 1V39A 4S24A 2LCIA 1J6UA 2I1WA 3HB9A 3DB2A 3A05A 1T5LA 4U00A 4B5KA 4RIEA 3AUAA 4LZWA 3TD6A 3TPFA 4BIMA 1C4WA 3DM9B 4CETA 3BE5A 1X86B 1ZMRA 4JNKA 3F8SA 4OHMA 5ED0A 5FRDA 1PVVA 2XD4A 1KOJA 2B1IA 3Q3JB 4OAPA 4CTMA 3HDQA 5A3SA 1V48A 4XCXA 4B8YA 3TLBA 4ZQCB 3PUYA 5IW8A 4L8GA 3D3QA 1M2WA 1Z18A 3C70A 3KR1A 5T4FA 3CY6A 3RUAA 3PFWO 2IYRA 2LDXA 3AF5A 2XTMA 4ALLA 1KZ1A 4ZEWA 3L1JA 1ZITA 1QBKC 3A10A 2DT5A 3NAQA 4M7WA 4ZP1A 3M34A 1NATA 4O59O 2W4IA 4CM7A 1VL5A 4MPDA 3A6HA 4TTIA 1KQNA 2AZDA 1B7GO 1XCLA 5CYGA 3V4OA 1LLDA 5BQ5A 1M2OB 1RPTA 4IHAA 1E3WB 4IXWA 2VT7A 2OR3A 1IB0A 4BLTA 4BQRA 2HXSA 5JAPA 1WVGA 4L74A 2ZQ5A 3WV5A 2EF0A 4ZYVA 4XLLA 2BFBB 4RQAA 5C3MA 1I10A 2IBSA 1U8UA 3ZC3A 4B3TB 2J5RA 2ISQA 2MSWA 4U2DA 5JCOC 2GTHA 3OZTA 1ZRNA 3N2ZB 3F7TA 4PG7A 1RI4A 5KNDA 3MJRA 2PRZA 1EB9A 4TQUS 3TDKA 4R9UC 3V8VA 4D4GA 1KEKA 4M99A 3L2OB 2XA1A 3W6UA 1YNSA 2Q7OE 1HXHA 5T8KA 2EJVA 2A9RA 4ENSA 3PC6A 3EGDA 3ONVA 3RAGA 4UNRA 2J4DA 2FZGA 4JFRA 4JEHA 3DCIA 2J3KA 4IDHA 4A0GA 3DR3A 5EZ5A 4FW8A 3FGZA 4GNRA 4ER5A 3CNBA 3K6JA 4XARA 5JANA 2H0RA 4CF3A 3N58A 4P0QB 2YKGA 3KR2A 4KQIA 1I4OA 3WYGA 3QOWA 1PNQA 3FDFA 4ZEMA 5K8JB 3LCUA 1PR4A 1JILA 2IXTA 3MNFA 4O4JA 4E21A 1VI2A 3C41J 1WQ3A 2IEZA 5JMOA 3K9WA 1WZNA 2GCOB 4CIDA 4GE0A 3C6BA 4AJKA 2RJOA 3HP1A 4MQMA 1T4DA 5KQMA 2ORED 5KYVA 3RVLA 5LDGA 4EGCB 3UFXB 1TCCA 2DHCA 4D9JA 3MPUA 5FTNA 2G5GX 3C0KA 3T5DA 1SRQA 4MHOA 1NMEA 2B78A 1Z6PA 5ICMA 1NN5A 5LQAA 3AL2A 3H11A 2PQMA 4JKYA 4AS1A 4KR6A 1VKRA 1L5VA 3L7AA 1C9YA 1LWOA 4I1UA 3GN1A 1P3DA 4ZT7A 1ZZGA 1K7FB 4WKBA 3ZWVA 3BC1A 4YLGA 4NJMB 3O26A 1F7VA 3KPJA 2PXAA 4UFOA 5LMNB 3I2JA 5I48A 3D6HA 3NBAA 2IZ1A 2XCTB 2AXEA 5K3BA 4MS3A 3RAEC 2UUAB 2XXAA 3AT1A 1ZEMA 1HDCA 4R40A 4F1JA 4Z4IA 1F6BA 5FNVF 1MABA 4IX9A 1SC3A 3DVAB 1XWFA 1CS0B 1SBTA 4GDMA 4RE6A 4WZAA 2VYQA 2YOHA 3EZLA 3L7CA 1USVA 2CUZA 4C4AA 1JZTA 3KLMX 3RASA 5F98A 3HA2A 3WISA 2FSGA 3KUDA 4CKCB 1GL3A 1RJWA 2Q6IA 4BKUA 3MGAA 4CL0A 4R54A 2OHJA 4ZI3A 1L8AA 2ZYVX 2ZPUA 5D8DA 1DKMA 1N2OA 3KUXA 2CK3A 1XYVA 2YX1A 4GGOA 4OA8A 2BZSA 4TLEA 5IRCD 2XB2A 1RLOA 1XNRB 3KYDA 4HBZA 3VVCA 2H2IA 4OFXA 2IS6A 4RPJA 4FBGA 1BFDA 4OQNA 3D5QA 3JALA 4ZGBA 4D42A 1A9ZA 3DMRA 5DH9A 2AMLA 4EF5A 1KKMA 1TCVA 3D0KA 4IO0A 4MR8A 4PN3A 1G8HA 3WKDA 4EPYA 1Q14A 2VP0A 2VQ6A 1VCOA 1DU4A 5AJVB 2A0WA 2KPOA 4GZ6A 3GFRA 3HCCA 3S70A 4JBHA 4LOJA 3ODPA 3CX3A 3NH6A 2ZJAA 3O8LA 2IHKA 3AVPA 3VI4B 3ZE7A 5BNWA 2V7XA 3BJEA 5HK9A 1K7SN 1G38A 1M54A 4HWSA 1V8ZA 3DMYA 4MOWA 4CDRA 1GVNB 4AN1A 5KYTA 1A72A 1ZH0A 3F3YA 4BNNA 4LF9B 4D74A 2JLYA 4BX8A 2NO9A 2GNPA 3VMMA 3I1YA 4YI3A 2N42A 5ALKA 1QH1A 3PT5A 1QO0A 1IDN1 1WB5A 1QH8A 2CLOB 3GUHA 3U09A 3B2EA 4IZ6A 3NHLA 4OATA 4R5HA 4RIIA 4X1YB 4MEBA 3F4BA 1Z5ZA 3ZLBA 1OYWA 3IPYA 1GR1A 1JAYA 3FD8A 3MWJA 4IDDA 1OCEA 1XLUA 4OK3A 5A9SB 4RFLA 3AFIA 2RJNA 3B9PA 3PYMA 1MC8A 5DGCA 2VNJA 4GOLD 1ADFA 1FZQA 1GU1A 2WI8A 4YRTA 5CA0A 4QM6A 1P4AA 2L18A 4WN3A 3W3AD 5EINA 4CQNA 5ITZA 2PUFA 1UANA 1Y8CA 1PD0A 2VNSA 1CP3A 1J8DA 2QRMA 1CUBA 6Q21A 1KH1A 1QCZA 4UVHA 1S9DA 4D4KA 3G17A 1MO5A 1NV9A 1P0MA 1HLFA 2WKWA 2O7VA 3M6UA 4RQUA 4XH9B 4DUZB 2AG6A 1VBNA 3HBNA 3REQB 1O6CA 4CWAA 3IE2A 4Q93A 5CVJA 3RAPR 3KJIA 1SUEA 2AOWA 5CNJA 3HB1A 1JF8A 1J56A 4DV2B 3JSXA 4JIMA 1XCJA 2EWVA 2JBHA 4KE7A 5DDIP 3WGYA 3GDHA 4B3DA 4R9RA 1XC7A 4RGQA 3J81k 2IP2A 1VDZA 2GK6A 3T7CA 4EW6A 3O4RA 4ZCTA 2WYWA 3EGWA 1MKYA 4U2BA 1YI0A 2C4TA 2NU7A 2IZZA 1NUQA 3LP5A 2VUTA 4KX5A 1FYDA 5ERYA 1PIWA 1J0BA 2ZBDA 1TO6A 5HTOA 4URYR 2J7KA 2IXGA 1Y34E 2FPMA 2GF9A 4LV5B 4BFTA 4MZDA 4TS9A 1WD7A 2GPAA 2ZTMA 1FCJA 1OWLA 5E0OA 5A5GA 4G0ZA 3V1LA 3EF1A 3RYCA 1DRVA 2DFVA 4MO2A 3R3WA 4YA6A 1VPDA 5CH3A 1J0XO 4DIOA 4KPUB 3AK4A 5I9IA 1F2DA 2BMWA 5IM4F 2QLBA 4TSRA 4RDXA 1Z5WA 3DVQX 3F97A 5I7VA 3FR7A 1QAQA 4IDNA 4K81B 4BO6A 2ZIFA 3E2MA 3ZW9A 4DDVA 2D7CA 3BMNB 3ACBA 1IY0A 3OQIB 1BS9A 1TF5A 4PZCA 3RIXA 4B35A 4D02A 4WDRA 5A0TA 4MB0A 2B92A 2O8EA 1ODFA 1SUWA 5MN5A 2AFHB 2WWXA 1A5AB 3HI4A 5EUQB 4DJAA 4NF2A 5L7TA 1LNZA 3UH1A 3DLIA 3QVGB 1UJBA 4HN4B 2XOEA 1P44A 3SAJA 1NE7A 3QXSA 1G8PA 4UHHA 2PTHA 2PVSA 1PTKA 3GT0A 4JC0A 4M1KA 2AV6A 2WUGA 2A3RA 8OHMA 1CHNA 1UXHA 4BQNA 4RTRA 2A1UB 2PMFA 5DWDA 1P8AA 4DMGA 2ECQA 3I5MA 3ZD6A 4C7MA 2G6TA 3EE6A 3NWJA 1XRRA 1T1RA 2RCNA 4D80A 5IC4A 2EAUA 3LY7A 3DBLB 1DKOA 1WX1A 4CKBB 1F0KA 1X1SA 4G8BA 4LOKA 4EBBA 2HL6A 2Z5VA 3H6GA 4HBGA 2IXDA 3WBKA 1P9NA 4EL0A 3I6IA 3W4IA 4ZVPA 2Z08A 3A9WA 1Y5IA 2ZU6A 1PFQA 1GXSA 3CSDA 3KOYA 4KO2S 1MO2A 4LYFA 2NN3C 3ZZUA 3DHVA 2PWZA 2OBBA 4FEEA 1FU8A 2XSZD 4D79A 3IQZA 3AC0A 3W5SA 4CTJA 1WU7A 1XDUA 4YIHA 2ZCJA 4OMUA 4S12A 2VDLB 4RF5A 1YKFA 5KAPA 3UB2A 2ZRGA 4N9WA 4PQGA 2VXCA 3LKDA 5E3IA 3TBFA 4RTSA 3AVUA 3O75A 3F78A 3K9QO 1Z7EA 3I2GA 4OYHA 4URFA 1S2NA 1W6UA 5BWLA 5A5VA 3MJDA 3E1GA 5ES3A 3AJ9A 4MCAA 2BFWA 3MJFA 5DTRA 4ENUA 1B0ZA 1R0LA 4NU5A 5F73A 4W82A 2Q46A 3WQQA 2QSUA 1I01A 2WD8A 3MXOA 4D3ZA 2W2MA 2QB5A 2ZIGA 3EXHC 3WLMA 5K01A 2FK8A 3ETDA 1QHNA 3EFEA 4JLVA 3R9KA 2W0MA 3JQDA 4KTVE 5BMOA 3KSRA 1COWD 1N3BA 2APJA 3LKBA 2IEAA 4FYYA 3ZCXA 4BV9A 2H29A 2QL6A 4KP7A 2RI0A 3GP3A 2XQVA 3OESA 3SSAA 2ODQA 4B81A 2IXEA 3ZCUA 3K16A 2R00A 4G6ZA 4BLWA 2KBFA 1FP7A 2ZG6A 1USGA 2ZJ3A 3AHHA 3HGQA 4ZI5A 3OTIA 1Q0LA 4RENA 4FM9A 1OH8A 2L42A 2JLZA 3NOQA 4W5TA 4AY6A 2FK7A 3RS5A 5HRAA 1NSTA 4NU6A 1VB3A 3ZWWA 4EFMA 1J07A 2XH8A 5DHPA 2CMKA 3A4LA 3ASYA 1SPBS 5K0GA 1S02A 4TT8A 1VMIA 3Q1LA 2D59A 2RGBA 2QLTA 3IOMA 1ISGA 1P2SA 3C3WA 3RU9A 4DV1B 2DF8A 1PR1A 3MRVA 5U9CA 1G4HA 3FROA 1MO3A 2BEKA 1BMTA 2BZGA 2V8OA 3GJRA 3ZI7A 5JUWA 5TGDA 4PZLA 4C06A 5DBHX 4KXUA 2B25A 1JKJA 1M8JA 2YV2A 4ZVRA 4IRUB 4EY7A 1E2JA 1AM4D 3VR4H 1EYZA 4BN4A 1CLEA 4U2GA 3QE4A 1JBKA 1L7RA 2IYPA 2P6OA 1PZNA 1XZIA 1CR4A 3B3FA 4IJ6A 2WF5A 1SJ9A 4OMCA 2GD1O 3H5NA 1AKUA 2I7CA 2HDNB 4AM8A 2X8LA 4MAMA 3RTAA 2AOUB 1N9GA 1VJ5A 4TTJA 4KEAA 4HUQA 3WGUA 4FKZA 4HLQB 1BSVA 3KT8A 3UT6A 1AKEA 5GVRA 3BRQA 4QBIA 1SXJA 2EP8A 4W9NA 3O3OB 5EIFA 3IEXA 1FDVA 4O08A 2BMDA 1WF3A 4CMHA 3EPLA 4B7CA 4GWKA 2WTXA 4WTOA 1GNQA 1QO9A 7REQA 3HMQA 4P8RA 3FZYA 3RM3A 2YCBA 4ROSA 2XNDD 2P9FA 2G72A 3Q40A 5C0OE 4BQEA 1JI3A 1Z8DA 1T1GA 1CUWA 4V38A 1QO0D 2FE4A 2FF7A 2XEXA 3MUOA 4BO5A 4H59A 1IK4A 4IFEA 1ZCJA 4A8JA 3BL8A 4Z5XA 2EXXA 1OPXA 3T1QA 1IK6A 4UTRA 4PG5A 5AIAA 4E0BA 2YRWA 3ELUA 4EG8A 3KHKA 3T4UA 3PQ2A 5DTMA 1QGYA 1ORRA 2AKAB 3GRZA 3ZKWB 5LP6C 2IEDA 1V7ZA 4H31A 4WNYA 3U62A 1J2YA 1FRZA 1SKUA 1ECCA 3DEJA 3F3SA 3L06A 3EVNA 2HIGA 1R4NB 1PZMA 5JJ5A 3B3GA 2CT8A 3OEEA 3PFFA 3SVTA 4MVJP 5K20A 3TTVA 4E1BA 5EMJA 4LOHA 5AVRA 4F4JA 3N59A 4WY5A 3FJOA 3RVBA 1GZ3A 2OAGA 3QKRB 3CVYA 3ICOA 4BKPA 1BEEA 2I76A 2VG8A 4MWEA 4MCJA 3VGJA 2VJLA 4TKUB 2XMSA 5FCDA 1JQBA 1P4RA 4U7PB 4JL5A 5IAJA 4WESB 1DARA 3WBBA 3RIGA 4EY6A 5JSKA 2DPMA 3WB2A 1ZOPA 2QVGA 3A1UA 3IQWA 4ITUA 2JZCA 1N2XA 5BN1A 1XTBA 4ZYWA 3TIFA 4DA9A 4IICA 4RZ3A 4Q7MB 4OIFA 3EBOA 1ZI9A 3HVJA 3G8AA 4TN1A 2PYIA 4YJ3F 1EP2B 1EX1A 3WX0A 3UG7A 1D2EA 5JXWA 1X7WA 1XLTA 4ZGWA 1MB3A 3C85A 3PC4A 3MT9A 3QPAA 4G0YA 4BKRA 2DWOA 4B3JA 5K6TA 4JB8A 3LVRE 3KEQA 4LPKA 4P3NA 4Q3CA 1GUYA 3GJYA 2E9SA 2C03A 1TQDA 3G0BA 2FN7A 4X8HA 5I7WA 2Q4EA 3ABRB 1JIVA 3DLHA 1N6RA 1UPFA 3PJGA 3PPXA 2IOFA 2OC9A 3OZ7A 4WA7A 1KZ6A 1Z22A 3BIWA 1FS5A 4Y9DA 5AKGA 2YZMA 2YFKA 4QOSA 1LPMA 3G2JA 2V7WA 4J0IA 4HDRB 4B32A 1XPUA 1W93A 5FPQA 4HWPA 2PFGA 2VA9A 3KJEA 4OX9Y 1ZK4A 1Y5RA 2CWDA 1TVCA 4HMQA 3ZDCA 5FKJA 1OREA 2OXIA 2X5KO 4CM1A 1RE0A 3G8YA 4L9WA 5DNCA 1LH0A 3RVSA 5D3MB 2H5IA 1YCHA 2NNLD 2HEGA 3KP1A 1DO0A 2HA7A 3C1AA 5CDFA 2FEOA 4XIFA 1X7HA 4N18A 1H94A 4DC1A 4XLZA 2FDXA 2H7CA 2JF0A 2Y68A 4I1SA 2FEKA 5ITVA 3D5TA 4JJZA 1L0BA 1Y9JA 3AUTA 4BFYA 1RC8A 3M4YA 3I52A 1T5TA 2JLSA 4ETWA 5TNXA 4N5HX 2W8BA 2QUIA 1W4LA 2WWFA 2C7QA 5AYVA 1CJTC 3K20A 4DIDA 1HUQA 2W48A 2MR6A 5JTUA 1PQYA 5J4YA 2F3RA 1JDUA 4MW4A 2AKYA 4EELA 4JA0A 4S35A 1KDVA 5KTYA 3ZWMA 3U7GA 4BE7B 5D51S 2Q29A 3M5PA 2ZBEA 4L76A 2O23A 4H7HA 3W6ZA 1LX7A 3O8CA 2J3HA 3JZDA 4L08A 4DMCA 4U7FA 2C95A 3O2SB 4ARVA 3QNMA 4QUJA 2DU8A 5E95A 4CBVA 5DYIA 2XLBA 1Y9EA 1XO1A 3ICPA 4QUKA 4P1ZA 2O7RA 2R8BA 1RQXA 1F1BA 4E5UA 2V1XA 1L7QA 5FTJA 2DUMA 5AI4A 4YCBA 2CNDA 2AC7A 4BNHA 5HMLA 2UZ1A 2QN1A 3PQ6A 4WLFA 1LS6A 3MOIA 5H3HA 3CKKA 3TRIA 4ZOQI 3HKBA 2HCJB 4ME6A 5ESWA 2W7TA 2B35A 2HU8A 3VPGA 4CODB 4NMXB 4UTPA 4R5MA 1DTSA 3I42A 4MUAA 2B3DA 1A4RA 4N5MA 3R0QA 2Z1MA 4KRYA 3BXEA 2ZCVA 3S2IA 4BAUA 3J7TA 3LRTA 1NA5A 3GLQA 1G8AA 1TZCA 1V2GA 2OORA 3H8JA 1J49A 3MCAA 5P21A 4ZHSA 2P4HX 4ZI7F 5JBIA 4JI2B 3TW0A 3KDSE 4YT8A 5J5CA 3QLUA 2F1RA 5H9VA 4OQMA 3ZH2A 4RVFA 4JMLA 4DM3A 3W8DA 1HDEA 1Y63A 3T3PB 2QRVB 1WD5A 2PCLA 2BFCA 1BWQA 2PZMA 2JLQA 3LFUA 3HZHA 3QA3E 4GG1A 4HLUA 4JJFA 1S0UA 4FYHA 1T2NA 2F67A 2ZBPA 1E4EB 3UPUA 3JAKA 3RQSA 4ZMRA 5A4DA 3INGA 3PFIA 5G4KA 5BR4A 3SQMA 1WIWA 3BGSA 5K03A 3EGIA 4HR7A 4UCXA 2JA1A 1FUYB 1G5QA 3AZOA 4HXGA 4LV8B 4P83A 4LCBA 4YDSA 2W2TA 4DCUA 5KYUB 1MU0A 2P6NA 2JCBA 4PYJA 1PFVA 1RLJA 1Z7YA 1EDZA 1L4GA 1PUIA 2Q27A 2QVYX 2WIFA 3D2LA 3I5UA 1YQEA 4G65A 4TTTS 5HMMA 4ENRA 4CHGA 3PJFA 1CUGA 1DQPA 2AXQA 4XQEA 1YBFA 2FP4A 1FLVA 2JKVA 3SQOA 3WR5A 4I5IA 3ZCQA 3B13B 1LKZA 1FF9A 3RTEA 3PFBA 4B6RA 2P40A 2IBMA 2YCLA 4JLAA 2PRSA 2XWJI 2GM3A 3FKSA 4TSFD 2YICA 4OP2A 4BFZA 4FHFA 5C8DA 3L46A 4EJSA 2H4HA 2X9LA 4JLDA 2H54A 3RYHB 4EPTA 4DOMA 3DBIA 3KZXA 4M7OA 4LZJA 1CIPA 1QV9A 1N36B 3DZCA 3L1HA 1T9GR 4BFVA 2GPTA 5F35A 2YZ7A 2V7BA 4KBGA 1D2CA 5D5QA 5JDIC 2QR2A 3BXFA 3EPKA 1MEOA 2DZDA 2JFYA 3PNLA 4EW3A 1WUIS 3AH8A 1K2VN 4P7FA 1V8BA 3ZLUA 4TV9A 2AK3A 2RH8A 2QPTA 2QUJA 5ITZB 2VJPA 4YAGA 2FMUA 4Z1MD 3NYWA 4HT3B 1H9AA 1AGNA 2WLTA 4RMNA 1RAHA 1I0LA 1MJ5A 3CBGA 3LD9A 4ZQIA 1XTVA 2JFNA 1DXOA 3QWBA 2JFBA 5G0VA 4WJKB 4ZJPA 5ALZA 4M8IA 2VK1A 3VR6A 3LSTA 4MQBA 2QX4A 3G0GA 5J2TF 3TQOA 3LT0A 3VTAA 5AVUA 1N5IA 2Q99A 3QJGA 4XLTA 1U5BA 2M6RA 2NZXA 2D5AA 3LKZA 3QKSB 4A23A 3WP1B 3N2KA 3R6DA 1SXJD 2JJ8A 2P0EA 4P5EA 3WK7A 3EDRA 3AI1A 3WE7A 1MC4A 2QTVB 1L5FA 1JLHA 3JPWA 4EVRA 4NH0A 1XXLA 1MV5A 3OU6A 5L4SA 1B0PA 2HWKA 1I5OA 3BOSA 4JI3B 2DWQA 4G5QA 1HDXA 4BVHA 4XB2A 5E6RB 3GG2A 1UWVA 3OKPA 1YZFA 3HVIA 1WZ2A 4EB3A 2ZJ4A 3ETHA 1XZFA 4TKMA 9ABPA 4CEIA 1VB5A 4R6XA 3RHZA 1ORHA 4S1TA 2QN3A 4FB4A 4FE4A 4RTJA 2P9BA 1BEUB 2P2YA 1IPFA 4XQ9A 3LY9A 1GPLA 4DILA 4YJFB 2NVWA 1P18A 2CNOA 4MGEA 1P1IA 2E21A 2UDPA 4JJKA 4ZT6A 4WZAE 4FW9A 3AB8A 2BTOA 1U7HA 5KOJB 3WWOA 1LV8A 4AUEA 1U0NA 2YVAA 1TJ3A 2XITA 4OMFG 4YAUA 1W52X 2Y0BA 5IKEA 5LN1A 1LPBB 2WD7A 3GGJA 4PPYA 5G3YA 1W85A 3OEED 4X1KA 4BB0A 2DQKA 2QSJA 5I01A 2WICA 1K0FA 2IX3A 3GOQA 4K9MA 4M0UA 2QBYB 3V4SA 1DWOA 4MCIA 1FXWA 1N75A 2C1EA 4LQ4A 3ILYA 1NX6A 4I14A 5FR2A 3ZZMA 5K3OA 4NBKA 4E70A 4CEHA 1VMEA 2F1HA 2HAEA 4I2NA 1E6EA 2O05A 2H4ZA 1P7PA 1E2QA 1FFHA 2QRJA 3L6OO 1CJCA 1KMQA 5FT9A 3SKVA 1UJ5A 2BEVA 3OICA 4X7RA 2FDCA 3QPWA 3FYUC 1B8NA 1QU2A 2AKEA 2XLCA 3MBOA 2WUVA 5T3YA 2J6CA 2K5UA 4MMZB 1H1LA 4OHCA 3BMOB 4HFJA 2AJLI 2C7BA 4AICA 4ER6A 2YHIA 3S27A 4KO8A 1YR2A 3KZOA 1SURA 1ICEA 3E7WA 4FR0A 2F9FA 1WDKA 4L0MA 5FWXA 1NKSA 1Y4DE 3HQ4O 3X1XA 1IJBA 1ESDA 1U2DC 3ROTA 1WU8A 1I6MA 5DGHA 1NXVA 4DR6B 2HK9A 3PNBA 2ZIXA 1A7JA 2R66A 4TT3D 1RE1A 1XCBA 4F1WA 5LQCA 3A1NA 4M1QA 3E5NA 2YHSA 3IQDB 4M98A 221PA 2DTXA 4EZEA 2HQ1A 2F64A 3D2BA 4ZC8A 3SYKA 4B6EA 2J3QA 5LXTF 2BMEA 1U0BB 3OETA 3QKWA 3D3KA 4N39A 5DIFA 1JWBB 3QI2A 4HFNA 2W4MA 2PAFA 3CPHA 4A8PA 4KR7A 1LBIA 2CXRA 2OK8A 3LQFA 5C1OA 5A0FA 3FKJA 5IMBA 1UCFA 2CXNA 4MA0A 5CXUA 2QJRA 4LDZA 5EJ7A 2C5HA 3ENKA 5JSZB 4G09A 2ZAOA 4CZ2A 4BATA 1Y48E 1M74A 3CH6A 2VQ3A 2G08A 1QTNA 3QPBA 4GE3A 5GJCA 1J09A 2FW9A 3TXYA 3BZBA 1N4AA 1JTFA 1JE0A 3DOEA 1MZVA 1QG0A 2I4OA 2P6PA 5KC9A 4B4WA 3IUQA 2J41A 4N0QA 2ONYA 2VDMB 4CT5A 2ZRBA 3NM5A 1VC2A 3NEYA 3QLVC 4JV5B 1ZN2A 4WACA 3AY3A 1EA7A 2M1ZA 3I4FA 3AVWA 2JK0A 3CZ4A 3CA8A 4L8WB 4ZODA 1NVWQ 3OT1A 4LX8A 4UVEA 4B79A 3Q12A 1PK7A 4U2KA 2JFUA 1PL0A 3C14C 4G0MA 1L1FA 2ZR7A 1I30A 1PSDA 2ZUEA 2C4MA 3KHTA 1DOHA 2YMPA 2EHDA 3PNQA 3QVTA 4Q03A 4PIVA 1KKLA 4ABYA 2OAQ1 1MQ9A 4NYJQ 3WDKA 1EVYA 3UJCA 3L8MA 4X92A 2NUAB 3K3PA 3F5SA 2Q5LA 4H16A 4OH1A 5HFAA 3EZFA 1DT3A 3FNHA 2HCBA 3BSSA 1R8XA 2X58A 1PLJA 3HUTA 1GZDA 3H4VA 5BN4A 3I6QA 3L8ZA 5DI3A 1C14A 4N03A 4HB0A 2UYYA 3NBKA 1YI1A 4OQEA 4UQLA 1PP4A 1DQNA 4M2LA 1UFOA 5CDSA 1TU4A 1Q19A 1AQLA 1D1SA 3FOAA 5SYMA 4LXQA 4C76A 4TMKA 4D8XA 1GQOA 4F5EA 3GHHA 4GYWA 1SKYE 3NB0A 4CG2A 2AJBA 5AVQA 1JZSA 1RWXA 2P1RA 2ZYAA 4C87A 5BOSA 3QE9Y 2ZSDA 5K3CA 1J7KA 3U17A 5A71A 3G1TA 4DDTA 4O02B 1PJSA 1KQFA 3LW7A 4GL2A 3AXSA 3CYFA 2E89A 3LE8A 3DC7A 3HLTA 3B51X 3OZSA 1M8GA 3JAMA 3WWPA 1DIOB 3UNXA 1GZ7A 4C1NA 1S96A 2EOAA 2W6QA 3DYVA 2DX7A 1XMVA 3FCUB 5F2OA 2W70A 3ZS8A 4CIYA 4YMLA 1Z0KA 4MVCA 1RZ3A 1SXIA 1JX6A 1FDTA 5CLFA 2Q3DA 1YOVB 3ZWNA 4CIXA 3G9QA 3ZDRA 2FW0A 3VC2A 3OZAA 4N0MA 2KSQA 1P7ZA 4C4PA 3K6KA 3PUJA 5CUQA 1E1CB 2WV9A 3NWPA 2WK1A 4EKDA 1ESNA 2AUTA 2EC5A 1L7XA 4E12A 3GLIB 4K6CA 3D6FA 3N1UA 1CD5A 5EUCA 4GSKA 2CN1A 3BGVA 3ZS9A 4M0DA 2DVMA 2R44A 3JQ8B 5JPDA 1KI6A 2OXFA 4LRYA 1G60A 1P2VA 3IHKA 4J90A 1UXJA 2JPDA 1DGQA 2VJKA 1K86A 5I4KA 5H83A 3WGIA 1CUUA 1GUFA 4J1QA 2JB9A 3TDMA 4HQLA 1J23A 5AW3A 4RVNA 4JEUA 1HFWA 4MWDA 6ADHA 2ZETA 1DAPA 3PICA 2HQOA 3RUFA 1L7NA 1ZNQO 4RBNA 5EE1A 3IQHX 3VAAA 3BMXA 1SXQA 1PG0A 4L3OA 2VDUE 1N8NA 3A1TA 3MMSA 2J46A 4UTNA 3KQKA 1M6YA 4IYRA 1SNYA 3V4PB 2JIZD 3MWLA 1SKBA 2FSSA 3IT2A 4HDQB 4Q9JA 2XDAA 1H4TA 4CUJA 3R3VA 1C1DA 2ORWA 2YVKA 3KPUA 1XTSA 4YCSA 3ZVLA 4FDVA 2GUGA 3H5IA 4MUMA 4AJJA 4EJFA 1E69A 1HL7A 2NPIA 5AVSA 2VQFB 2PMEA 1DHRA 3H2GA 1EFPA 5EQTA 1U8YA 3T5PA 3W5BA 5B1SA 2PS9A 3VR6D 3DLCA 4NPAA 4ROTA 1XEXB 2GCNA 3RRNA 3R8FA 4GXQA 2V0NA 1PZEA 2YWCA 5J2UB 3RARA 1XRLA 4FYVA 5E3HA 2A86A 4INZA 1EA5A 3VYVA 5JYBA 3CQ9A 2GZSA 2XUKA 2I7DA 2I6FA 4X91A 2LD4A 1AG9A 3VOSA 3X0DA 1BN7A 4CQJA 4DSZA 1SH7A 2J5KA 3GEPA 5GINE 4HYYA 4Z9FA 4Y8VA 1VIMA 2PX3A 2E6KA 1FNBA 3EXEA 3JQBA 1D1PA 3QXGA 5TMBA 5HQ3A 2W37A 1G8JA 1VE1A 1XMPA 4UHFA 4WZBE 5C31A 1S4MA 1J2UA 1UZLA 1SD5A 2CHVA 1SVOA 2FUG6 1K7EB 2ISSD 1N5DA 2NSLA 2VT2A 2WT8A 3ESQA 3HVUA 4F8YA 1ESMA 2FQ1A 3EXHB 3TRFA 1PL8A 3TUJC 3SBOA 1N1GA 1TIKA 2V4MA 3OBIA 1W87A 4R7ZA 1W5TA 2WJPA 3WMWA 4HZGA 4JWKA 3ZWDA 4XA8A 4GBED 1HURA 4Q1FA 2SNIE 3RSOA 3CEAA 3RS4A 4WEQA 4DCNA 4B8ZA 3TN7A 4C4XA 3KLBA 2ZWMA 3KTFA 4N40A 2NX2A 4F6CA 1A5ZA 2I5PO 4IV0A 5FOVA 1J97A 4FDTA 2OXRA 1E3WA 1F5NA 3DOUA 3KOMA 1C3EA 4KNYA 3ILXA 1SHLA 1L7EA 2EBHX 4FI3F 4UU1A 2V97A 2DKOA 2RGUA 3DZJA 3FX2A 3OLVA 4LS3A 3D6AA 3PUZA 1MRNA 5HJ7A 4J7CA 5H02A 1HE4A 3T15A 4E5DA 3RJMA 4WNCA 2HHHB 4OHOA 1EHIA 3K9CA 3L7MA 3U40A 3WWEA 3ZHRA 4N54A 4HK4A 3DUWA 5AXDA 3SIXA 3I4LA 1W48A 1OTYA 5JZSA 3QBEA 4KAXA 4RE5A 2NO0A 2QQEA 1RJ9B 1G18A 2IQIA 2WB2A 2I62A 3L41A 3TWOA 1V8OA 2JRCA 3NT4A 5IHXA 3RAJA 3PCTA 3X44A 1D03A 1KAOA 1JG7A 3DXYA 4YV2A 1SXJE 2JGDB 1KAHA 3AF3A 3OFJA 5FBQB 4OUDB 5AESA 3FR8A 3SHQA 2BFAA 3GD5A 3UA3A 2ZXFA 2X3FA 2P9YA 3CH7A 2ZUUA 3MINB 1TQ4A 3H6HA 3AEQB 3OLXA 4L27A 5E6SA 4JFAA 3ZD9A 4YRAA 1CJBA 4N8EA 3TRJA 2BEJA 3WL5A 4X6LA 3HNPA 3UFXA 3T3GA 5KNBH 1IBLB 2R0QC 4F8JA 2YJ5A 4V1CB 1OBVA 1P5JA 3G7UA 1WAMA 1P74A 3RANA 1NUUA 1H6DA 3DOOA 1WTAA 4LYDA 1WPQA 2CE7A 2WJ4A 4D3YA 4A6DA 1W5BA 1PVDA 4J16C 4P92A 4N5IX 4MPRA 5JG7A 1CFZA 1E18A 3EVFA 1HT0A 1Q0HA 2G0TA 1XTKA 4YJHB 1K89A 3TFWA 3BXXA 1SRRA 5DBFA 2ECFA 5T41A 5IXJA 1K27A 4TN5A 4OLHA 1UPBA 2KYRA 1BRTA 4DSAA 3GLKA 1P72A 4JJ8A 3EDCA 1QM5A 3BWYA 1VHQA 3ZHYA 4E13A 1KYQA 1GAWA 1RJDA 3BA1A 1OC2A 3D3JA 5LP6B 5AQ1A 3U4QB 5H81A 2O9JA 1Z2EA 3WNBA 4F84A 1EWQA 4HH0A 2P2CA 4Q4DA 1LPSA 4EB6B 5HQTA 5DOVA 3TSYA 3ZYCA 4H18A 5HZHA 2HMSA 3K6RA 4G9BA 1W94A 2W71A 3DZIA 5EXPA 3TOCA 4MV4A 3GY0A 4YH1A 4LJ8A 4DAOA 2D4HA 3GFSA 3CPJB 3GCDA 4H7KA 1GTL1 2Y1LA 1G8MA 4YJKA 5LL6P 3CVWA 1N33B 4DJDC 3DT8A 5L51A 4CF5A 5JWOA 1CY6A 1B15A 1UOEA 1LI4A 5CR9A 4D9FA 3DZDA 4YGXB 3LUCA 2QT0A 1K3FA 2WF7A 3G5UA 4JQCA 4A2CA 1UBEA 3ZX4A 4BNMA 4D9CA 4EM6A 4U1RA 1TRKA 1LY1A 4EK9A 4KWTA 1VKJA 1OX4B 4GXTA 1Y8AA 3LO5A 5TARA 2B9EA 1F8XA 3EC2A 1MAUA 2VKQA 3MTDA 5CRIA 1N2IA 2GAOA 4GUAA 1AHPA 4BFLA 3IP1A 1DWQA 5EIEA 2PH7A 5MFZA 1I1NA 2PUGA 1KPIA 1HLGA 1JEJA 1D0VA 2ZU0C 4INJA 5A04A 3U19A 4U02A 2EDCA 4Y9RA 1BMQA 3RVPA 4HPXB 3C6ZA 4RDHA 3V4ZA 1JB1A 1D4ZA 4P0TA 5ELMA 3W4KA 1N34B 3Q1KA 2QLNA 4R2KA 4XD7D 3L0BA 5AM2A 3W2EA 1ZX1A 1A9XB 1UOQA 3O4VA 1C9KA 3DNPA 1WUJS 3SPXA 3TW6A 3AJRA 2ID7A 2P30A 3HO8A 3KOOA 5G0UA 4DV5B 2R3SA 2X19A 3DFIA 5A9SA 3RABA 3LNTA 1QIMA 3OEYA 1WVMA 5J40A 1N0UA 4WHMA 2ZJ6A 1MXFA 3ZVKA 3UYLA 4D0GA 1BX3A 1EP3B 1G8YA 3BHIA 2P27A 2XDWA 1PFYA 3E5MA 4M8KA 5EGSA 3CX4A 5H70A 4TMZA 3TECE 1TEZA 4JUAA 4DDHA 1KAGA 4UBMA 4LYAA 1ELOA 2R1VB 2QQGA 4O1MA 3V3KA 5AKHA 1PGOA 2WAAA 1CQWA 2ATXA 1YRAA 4RQBA 4PAGA 1OH6A 3DC2A 1O9HA 3E15A 4NDAA 1VL1A 3DL2A 3LT2A 1E2PA 3GLRA 4L5CA 3O8OB 1P5HA 2ZS8A 3DBHA 3HH8A 4JN6B 4ZCSA 4YGYA 1YS6A 4BECA 2ZE8A 5IK2A 1RABA 1T3LA 3PKZA 3I8OA 3EZ6A 4DC9A 2D74A 1IHOA 5L3QA 1UPCA 2MIIA 3G2OA 1R00A 3MS7A 1PS8A 3M9WA 4JT8A 5KQLA 1NAHA 3GVPA 2J07A 4PCAA 4XJVA 5CHYA 2G7ZA 2IVZA 2CB9A 3KNZA 3EISA 2VF2A 4PSUA 2NP7A 3LPMA 4LHVA 1DC7A 2WG0A 1I1QB 2GTPA 2EFJA 1CF2O 1I3NA 2GBPA 5FYDA 5B3LA 5IDWA 4IXNA 3PC8C 4DL9A 1RD4A 5FOXA 1L5QA 3P9CA 3TVDA 2FETA 3SCZA 3PVSA 2D1RA 4IIYA 4OQQA 1OF1A 2XRYA 1AOXA 2FPUA 2GM5A 3CTMA 4FYWA 4R9VA 4TL8A 5F5NA 4AT1A 3CXUA 4FHEA 3AF0A 3JAWB 2ZE5A 1KJNA 1EDEA 4KPUA 3TNDA 4O5AA 2NQTA 1QFXA 3A04A 2BONA 4ZVMA 1W4BA 3VUFA 2CEKA 2A8YA 4ZCPA 1LA2A 2B69A 4BMVA 2IHJA 1OWMA 4BCBA 3AY7A 4JVMA 3K2BA 3BMNA 1UFRA 1T10A 3OQIA 2ZM6B 3G89A 2C29D 4ATNA 1SCQA 3SVZA 1E1KA 1J00A 4MUXA 3HNOA 4J3FA 2UKDA 3VOTA 4ARAA 4DLWA 1DJLA 5AH0A 5K2OA 2CVHA 1VJ1A 3L4EA 3DKRA 3E2PA 4GC5A 3HSKA 4YRIA 3B5JA 5L4NA 2IH2A 3IDAA 3NIGB 3QVGA 1M0EA 3EVBA 1F6WA 1YS1X 3Q9NA 1QK5A 2PZGA 4RA9B 5F4ZA 1LZKA 4NOLA 4Q6WA 4DR3B 3B48A 1KAQA 1ONSA 2YTZA 4OJNA 3T8YA 3PYXA 4EFDA 5IU6A 3AVTA 1KNXA 3RYIA 1HYEA 3F1KA 1QQ7A 1EG2A 3GUZA 4BGIA 2P5SA 4CIBA 3PD7A 3OE5A 4ON9A 4DV7B 2VHUA 1IONA 2F4NA 3ESZA 4JGBA 1JIIA 4C22A 4GP7A 3DGEC 1JR4A 3G2NA 2YC2C 1FP4B 2MDTA 2WG1A 4NICA 5C3UA 4B84A 1AZTA 3RC8A 4G25A 1Z16A 2P6UA 2HI0A 2E82A 3BB1A 4CR6A 3DDOA 2WWYA 1ZJ6A 3N8DA 2AFIB 3O03A 2BZ0A 2FUNB 3CR3C 3DBLA 1OXVA 4ARSA 3WK8A 2CV0A 3Q8MA 4UREA 3KQHA 1KIAA 2MCFA 3CW8X 2KBEA 2CCKA 3GFTA 5I9TA 2BCEA 4MAFA 5CVVA 5C7LO 1Z7GA 3K70C 4TVKA 1GQQA 4KBYA 5KIAA 1UMCB 2CCGA 4LECA 4BBJA 3FCAA 4J6FA 4UU8A 2QUZA 1H9BA 1KO7A 1MOQA 4HAOA 4AECA 4F3NA 3O9MA 2Q5JA 5AW7A 2AWOA 1SVUA 2ACVA 1KHTA 1PQUA 1Q20A 3A31A 3EFHA 2ZQZA 3G79A 2FYTA 2H1RA 3PGKA 3ZWKA 5IF3A 3JYPA 4J0DA 3WS7A 4Q9DA 2C97A 2WWRA 1FDWA 2GXQA 2IHTA 5BQOA 3SFTA 3K7EA 1RR6A 5JSYA 1HOTA 2A5YB 2POCA 3MPOA 1BJRE 3EMBA 5EPEA 3WYEA 4RFVA 3JVUA 2PKXA 5JS1A 3WIOA 1E5QA 3VU9A 3WSWA 5K7SA 3K8ZA 4ZVTA 3CEPB 1DUSA 4C88A 3U7QB 4I19A 1Z9BA 1JMYA 1OZ0A 4AZ0B 1PWEA 4A82A 3E7DA 2I6GA 4GH5A 3TINA 1CRLA 1E2FA 2C84A 2VK8A 2WU4A 3FDZB 3HDHA 1U0SY 1J2JA 4BLSA 4DUPA 4Q4LA 1EHCA 3HA7A 3KV3O 2C94A 3THXB 1VHWA 2FV8A 4UBOA 1NLYA 2PKWA 2PN1A 3V4VB 5LIRA 5JZBA 1QGZA 3M6FA 4ZTUB 4DXAA 1F60A 4G1BA 3RV3A 1L7DA 2AEFA 1JG6A 3T1YB 2YW9A 3DVLA 1O95A 3FPCA 3MAJA 2HIAA 4OKNA 4F04A 2IUYA 2X1VA 1HZZA 3ZUGA 4TUYB 3SHTA 5LKAA 2R85A 1JG3A 3NP9A 2YMLA 2F4VB 4PAMA 2FU5C 3MCZA 1GZHB 1Q92A 1KZHA 2XCUA 4L51A 2CDNA 4OFWA 1L3CA 2HF2A 1VCMA 3GXBA 3N75A 5C51B 2PR7A 1E79D 2D1QA 4OKSA 3TEFA 2ACKA 4D9IA 2AR9A 1QRUA 1ECBA 2P6MA 4TL7A 2KE5A 5ECWA 2I7XA 3L1VA 4A6PA 1ZHFA 2PT7A 4FLFA 3UYKA 3VU8A 1IUOA 3G9TA 3N39C 3LHFA 2D06A 4DQXA 4Q15A 3BD8A 3CBQA 3SYRA 4UXIA 4EFLA 3OT5A 5EA2A 4IQGA 2VWGA 2GQ0A 2ZITA 4EEZA 3TJZA 4QARA 1E8NA 1AQUA 3LVBA 3FYUB 2C82A 1I51A 2FSVA 3NRCA 4QJ5A 3CN7A 1US8B 2ZLBA 3BZUA 4PLPA 2OM2A 1JKMA 1JT9A 5LQMA 3VZRA 4LPSA 1OLOA 2WQ6A 2QQ5A 3E1SA 2JI8A 3CRNA 1LJUA 3EQ9A 1QTRA 4CMKA 3BCRA 1RW4A 4CV3A 4YAWA 2NUBA 2C83A 4XQGA 2LUOA 3HJNA 1ZD5A 1BGXT 1K63A 2NZUG 3B6ZA 3EEQA 5FPHA 2HGZA 1ONBA 4LCJA 2Q0XA 1DZ3A 1GNVA 1Y1LA 3OZIA 1M2FA 4XGNA 1V96A 3ZHZA 3ZHVA 4YRLA 3ISJA 4K26A 1WO8A 3QV2A 3HS3A 5K0ZA 4OQ4A 5BYAA 3OUUA 4OBBA 4XB1A 5B58T 1IBKB 5LC1A 4M54A 2AI1A 3ZBPA 1E9RA 1IG0A 4RTPA 4YEDA 1W49A 1MEJA 5ALDA 3ABOB 2BI8A 3EW9A 5CGZA 5DMHA 4EZBA 3HDTA 2OZLB 4CEJB 3JPYA 5FPYA 3ZTYA 4ZMBA 2H5LA 3JD1A 1WZUA 4G56A 5REQA 1XNHA 1DRUA 2AI3A 3PRKE 1HLDA 3GGPA 3P2IA 3QVJA 2GARA 4BFWA 5DT9A 3HKDB 2QTBA 4TXHA 2YRFA 1JU9A 3JR3A 3WLNA 5JNVA 3L8GA 3LIIA 4YQEA 3WMGA 2WM9B 1C4KA 4UARA 1X7DA 2VO1A 2CLDX 2ZSEA 3G2MA 3QZUA 1DDOA 1FX0A 3ORFA 1B14A 3GAAA 4H3KB 3O31A 3AKYA 4HN2A 3SZOA 4ZK2A 1CFJA 3NG1A 5K0NA 3PDHA 4TMYA 4Y2JA 4WZ6A 4A15A 2IYOA 1E4OA 2Z83A 4P86A 2A0XA 4WCVA 1UEJA 4YASA 2IYAA 1PDWA 3PDJA 1ACLA 4C6SA 3NJ8A 1NI4B 1ZVQA 5IK2D 1FZTA 5IEBA 1EUZA 2WYHA 3KSZO 4JHXA 1Z13A 5DKFA 3PRJA 2QEQA 3HNRA 3WIUA 2V7VA 3ZNPA 1E1MA 2GBLA 2XQFA 3B9QA 3PQ3A 1P7VA 2I1VB 3D3WA 3AHFA 2BEUB 2XE7A 4JI4B 1EFDN 1YB7A 3OM0A 4MQUA 1X1EA 4FGKA 1XYGA 2GB4A 1CQJB 2VSOA 3AUYA 3Q7SA 3V7UA 4DUYB 4GM1A 4ZOEA 2PZBA 1H0HA 4NG4A 1M67A 4K46A 1TK2A 3B2QA 4MP8A 4W5RA 1PT9A 2WUFA 1QS0B 4IJVA 4UNNA 2ZVQX 4AS2A 3CZ5A 1T9BA 1CY2A 2R5FA 5E4YA 2FLWA 4CMJA 4DQ0A 2GKGA 3OA0A 2XVMA 2GJSA 5FEUA 5L7YA 3PC7A 1C7RA 2FSPA 5HUHA 3GLFB 2MYUA 3ZW7A 4BUZA 4EEKA 5HRCA 1O97C 3M5CA 4FYJA 2FI1A 1AKQA 3LNCA 4ZQFA 3PXGA 1W5FA 2FEAA 3CV3A 3LQYA 5JFTA 2HYIC 1KQOA 4X54A 1JEQA 4DSOA 1MJFA 5ULLA 4JVOA 2ZANA 4NL4H 2VZEA 5ERGB 4I8DA 4PXSA 5D3MA 1MR3F 4O3MA 1A69A 1YRLA 1H3EA 5JJLA 4DLSA 1XSEA 5J5VA 4AAYA 2OCIA 2X0JA 4M55A 4XX0B 1L7BA 2P7HA 1F0NA 5IAGA 4HDOB 1J39A 1Q7BA 1VG9B 4XFKA 2O2DA 3A11A 4HKTA 1CY4A 1RNLA 4MGKR 5G1NA 4Z7OB 5I9LA 3BWMA 3ZIDA 2C07A 2QVLA 1ZRSA 3I9JA 3EMKA 2P11A 1L7VC 1VKZA 1XJ0A 1U3UA 1DAKA 3PFKA 2VDJA 3AF4A 2ZK7A 3W7BA 1MN6A 4BN0A 4HATA 1T8PA 1XDDA 3EYWA 3FNEA 3S4YA 1XU7A 2ZT5A 2ROQA 3U7EB 5CW2A 1EBUA 2DKFA 3GLGA 2ON6A 1GD1O 4LDNA 4MRRA 5FOQA 2P4SA 2ZULA 4UMFA 4AMZA 4M1OA 2OG2A 2A67A 4MIEA 1JSCA 1E99A 1LRJA 3LYUA 3Q3HA 3RR2A 1VE5A 1ORVA 1HRKA 3SX4A 2GMWA 3BF8A 1U0GA 2EBWA 3TTSA 3B6JA 3CRZA 1BXGA 2C88A 4LNHA 4KAFA 4B8WA 1CBUA 3KQWA 1C1HA 1NQTA 1XDZA 2JJQA 2MWMA 1V8PA 1Q0UA 3ED5A 1JTEA 4N6GA 4J0CA 4G41A 3M1AA 4DBVO 4KQGA 2OMEA 2Q5IA 4GLFA 1XZAA 2HLPA 5ICEA 1AGPA 1RMQA 1N5RA 4I5FA 1I2MA 1SAYA 2UVPB 4QHTA 4X84A 3ICQB 4UCQA 4EUFA 4F1KA 2RKWA 1NN1A 3U4GA 4OLAA 2WIJA 3V97A 1T6NA 3KSDO 3DKKA 5IDVA 1LFAA 3CLKA 2UU9B 2ONKA 3EULA 2FEMA 4GKVA 5K51A 2BH2A 2QRVA 4TROA 1ID8A 5JYDA 1F4LA 1ISFA 2J30A 3P32A 4AJIA 1Z15A 3INNA 3JVDA 2PCJA 4XEUA 3DE1X 1E4EA 4J4HA 1T35A 1M1YB 5F1YA 4N41A 3O0TA 5IZ4A 1Z2AA 2DHQA 2ZSAA 1IE3A 3RIMA 2F17A 5KYUA 3OCVA 2TMYA 1U7WA 4I8IA 4NOKA 5HP4A 1IY8A 1D2MA 2NYAA 1XLVA 3CCBA 1KSFX 3IIKA 1Z5OA 4KQ1A 5HS6A 1C9MA 2X5XA 1ZA2A 4W9RA 5CT8A 5FOTA 1OLUA 1QHGA 2PRKA 3ENZA 1UBMS 4RELA 4W4TA 3WWZA 1CHDA 4XE5A 4JK3A 1P45A 1NXOA 3GVXA 1FU7A 3PNMA 3TL2A 1Y42X 2C9CA 5CB4B 3LX5A 5E4TA 3ZHQA 1QB8A 3JZIA 2XKKA 1G7RA 3B7WA 1U7XA 1ZJYA 1R7RA 1WUYA 1J8MF 4MUYA 4J2OA 4KN8A 5E8RA 4KYUA 4OGFA 5E9WA 2BKLA 2NZ2A 3BFVA 1U8CB 3DOJA 1FBTA 4GMKA 4MYUA 3RYHA 1IHDA 3PHBE 2FJPA 2REQB 4O4LA 2AEMA 3FJ1A 4LJLA 2XUZA 3JWHA 2UV8A 4M60A 2RI1A 2AZMA 1QV6A 1MB2A 521PA 2J0QA 3UK0A 5JCOA 3SOZA 1T9CA 3L6RA 3F67A 3IRVA 3MCWA 2EZ9A 5EEHA 3T9CA 1PX2A 3BK7A 1DBRA 1ZC4A 3M8KA 4O1IA 3T54A 4O4IB 3A3PA 2OAEA 4K9KA 2H4YA 1QFJA 2WAYA 4IEFB 1EVQA 4PYOA 1P9RA 1XAHA 2ZI7A 1T9KA 1OQAA 2JJ1A 2Q8QA 1L5HB 2CLIB 4PLGA 4C78A 5B3AA 2IHBA 2YV4A 3KWLA 4MRMA 3GA7A 1CYEA 1U80A 1W0CA 3ONWA 3IX7A 4NP6A 1GL9B 1ID1A 2OUKA 2ZT6A 3LI2A 3BAFA 1COZA 2ZRKA 3FW1A 3H5OA 4UE3S 2NZWA 2QTVA 1MIHA 3GBVA 1PS0A 3PSHA 1NYQA 5TMDA 4AKGA 1V3TA 3R7AA 2ZJ8A 4HDNB 1JJFA 2FHSA 2VDPB 5E6RA 2C9ZA 5C34B 4OD0A 1O6ZA 2PFKA 4IIXA 3CZCA 5C4MA 4LE1A 3H1AA 1BO6A 4JROA 3HJHA 4EHAA 2DSNA 4QDTA 5K8UA 2FPGB 3IOEA 1ENPA 4YJFA 2GHTA 1SU7A 1E2KA 2PL5A 1ZD1A 4GBMA 2FLKA 2XAAA 3CW2A 3OX4A 4RGYA 4RLHA 4RYLA 5D01A 3TQFA 1NASA 4AYWA 5KSWB 3IPLA 1OR8A 2XYHA 2XZLA 1XQ6A 3IUSA 3B1ZA 3I9NA 4L73A 5JISA 1W0KA 2NW6A 3WKCA 3GMSA 4M36A 1MXHA 5AW0A 3RIHA 1SVKA 3BRSA 2QBYA 4MVJA 3ZG6A 4A0RA 4EVIA 4JC5A 1J4AA 1NY6A 1XDGA 1Z34A 1KK0A 1VYTA 1SQ6A 2FWJA 1BC5A 3L8FA 1PSWA 1O4VA 4FPXA 5G4LA 3ZJYA 1KTVA 2FFJA 5IT0A 1INLA 3L92A 4DJEC 3A4NA 1LSOA 1GUZA 4B3HA 3HBAA 4I5GA 1KR2A 2AN9A 1U2RA 2MMCA 4JY7A 2H0QA 4IG4A 1NX9A 1ZMTA 3JWPA 4K28A 3GNSA 4IJWA 3UH0A 5IT5A 4EL5A 1BMDA 3QUTA 1T5OA 4XD2A 2O4CA 4L0CA 2ZSKA 1LQ2A 4HLDA 3U4IA 5T6BA 3B1VA 3PJDA 4TVOA 4EO4A 2QTAA 5IUKC 4XSGA 5I8WA 4RM2A 3FI0A 1YCDA 5FLKA 1X74A 3UAYA 7GPBA 2ZRMA 1S4QA 5CM8B 1U1EA 3O8DA 3FOFC 5B2FA 3CKLA 3EUWA 3GRRA 3UAGA 5AKJA 1RXCA 2FPRA 3TBKA 4I4IA 2IGTA 1JTVA 3ODGA 1YOBA 4KWHA 1DWUA 4Z1OA 3JQCA 1VLQA 1VLZA 4WASA 1II8B 1R12A 2HTFA 3GZ4A 4NNOA 1I3LA 2QAGC 3L7YA 4H2DA 1B6RA 5ALSA 5FAXA 1CW2B 3GVHA 3M6XA 4NI5A 3DCNA 3RNOA 1IQPA 2VJCA 3B9RA 3CLUC 4BTEA 4Z4FA 1Y3HA 5T64A 3RJ5A 3BKXA 3HV2A 1U31A 3SZRA 2JC3A 1UXOA 4GMFA 3RK4A 4DJTA 3TSCA 1I6KA 4JA2A 4QATA 1C7QA 1BE8A 1MH9A 2IPOA 2JVIA 4MR9B 3K9HA 4ENWA 2VQSA 1Z73A 2PPVA 5LD2C 4AY2A 4MQ5A 4DNOA 1Z4LA 2NV6A 2P9TA 3VHXA 1F3LA 3BBPA 3PEEA 4AY3A 1RQLA 1S3SA 1ZK2A 3GRCA 4B6SA 1E3JA 3SR0A 4UXJA 5I7SA 1ZPDA 2XGJA 1YXMA 2F3PA 4FSDA 4KO1S 2I87A 3N2EA 2XIQA 2W8ZA 2C42A 1EVJA 2G63A 3UBMA 1V16A 3R5KA 1Z63A 5C7IO 4P6VF 5I7RA 4IHJA 5DX8A 1E9SA 1ZDMA 1GILA 3GGDA 2I2FA 4DADA 5AXAA 4HSEA 4JLNA 1MEEA 3QOYA 2Q6OA 4Q3BA 4C0HA 1NXTA 3MYRA 5AHKA 4Z9YA 3L7DA 3NHYA 4KYTA 4G4SP 3HKEA 4C04A 2P1ZA 4ES6A 2NUAA 2IY8A 3NHUA 3ZU4A 5DEIA 4DIMA 1OHHA 3HL4A 1FTQA 1NTOA 3FKQA 1DZIA 2J6IA 2YDXA 1U1DA 2WVGA 1UKEA 5FTKA 1DKUA 3P5BA 1EI9A 3MERA 3WGVA 5ICSA 2DFTA 4LK2A 3BWVA 4R41A 3DAGA 4UJ5A 4EYOA 1VHJA 4ZRNA 4Y2UA 3URMA 4JBXA 3GA5A 2E5WA 5DXAA 3AM5A 4MQFB 3U9TA 3KR0A 3PUKA 4I66A 4OFBA 3W3ZB 4CTKA 4M7PA 4Q82A 5A4IS 2C2YA 1FYFA 1BGWA 4YP9A 3ZPXA 4DCCA 5HYVA 3HV0A 3GA0A 1TIBA 1CT9A 1GLGA 2PLRA 3AIMA 1URPA 4JD5A 4DNQA 1WB6A 1OC4A 3PQ5A 4LE2A 3E53A 2J7PD 3KBBA 5H68A 3T5MA 2BR5A 2Y9PB 1P4SA 4KN6A 2V9PA 4KXLA 4BJ1A 1QYDA 2EG5A 3N3AC 4TKVB 1T6YA 2R5NA 1Y9AA 2Y1GA 3QIAA 1P9WA 2Y0DA 5TGTA 2AC4A 2Q5OA 3LOQA 1UDXA 2FXIA 5DB4A 4RKRA 2I29A 3ROZA 3OPQA 1UBSB 3S2FA 1KU6A 4LHWA 3VNSA 5BN3B 5BURA 1RHJA 1WUTA 4E5YA 5JZOA 1Z6AA 2PUJA 5LB4A 2XYQA 3JYOA 4YV1A 5B3KA 3I2HA 4NZPA 3ED1A 5IVKA 5EZYB 1HQDA 3DOCA 3LUHA 3G6KA 1NNSA 3NAMA 2AMYA 3AHEA 1L2TA 1H65A 1IZ9A 3H84A 4PICA 5G41A 1TNDA 1E1CA 3PCXA 2E4WA 1X8LA 1XE3A 1XX6A 1NI5A 2HGSA 4EQZA 1CKEA 1N7GA 2GYUA 5BV0A 4HADA 4NULA 1GRCA 4LWQA 1EGVB 1G2PA 4IVNA 4QO8A 5PGMA 2CKMA 4GHWA 3QOXA 2HTEA 2GJ4A 3EWSA 3QLJA 4CV2A 1XA3A 2O3TA 1PV4A 1DEAA 3CF4A 5CLIA 4EF6A 1NBME 3DEFA 1ZXXA 1KZ7B 1H6AA 3EEBA 4O6VA 4EENA 3BHMA 3RW9A 5ICGA 4E3WA 3PR2B 1QCDA 4I4TB 5J1SB 3UM9A 5CVCA 1Z8NA 1RLUA 1QDEA 2YFQA 5B7PA 2HZ7A 2ZRHA 3U7FB 3FZEA 3ICWA 4XVRA 2G09A 4GUDA 1YS4A 9ATCA 3BPSA 3NHAA 4FDLA 4CT4B 5AVVA 1CR1A 1AK2A 1FE8A 1SA0B 2RGYA 3G3EA 1QIJA 3PIRA 4KLAA 3K70B 1FVFA 1BOOA 1MO6A 1VIDA 3K0AB 2NQ8A 2FN4A 3QKIA 3BBLA 1KHHA 1C29B 2ZKIA 3QPDA 3JYNA 2JJ1D 4L8FA 1C2TA 3HSSA 4UUOA 1XRNA 4JVSB 4LEIA 1GKKA 4XDZA 3NMUF 3QXJA 3ENWA 2QE7D 2QP4A 1XEXA 2GZ3A 5B36A 2REXB 2CLKB 5J2UA 3IOYA 5EHQA 3OQHA 1PL6A 3IV7A 3MCUA 1SCKA 3CJRA 1V3QE 1YMUA 3H7IA 3P2EA 3PBKA 4ID3A 4I2VA 2NXNA 2CVOA 5AI0A 1PZXA 4YR9A 4EYEA 3AKEA 3ET4A 4BBZA 4DR7B 3EZ7A 5A7HA 3RBXA 3CNEA 4DWJA 1KIFA 4GOJA 4RH0A 2CXXA 4AKSA 4EHJA 3EA4A 2FZCA 3QG1A 4DIFA 2YUIA 4G9EA 3ET5A 4PZEA 2KMLA 2XTNA 1TI7A 5E9JA 2C8VA 4IXDA 5KB3A 3KZVA 4MGYR 5C4IA 1YK0A 3R9XB 1Q74A 2DCMA 1GP2A 2O7NA 5TVKA 3TL3A 5LP1A 1ECPA 1MJNA 3NCHA 2R8ZA 3A6DA 3IELA 2WEKA 3NRBA 4ND4A 3WLPA 1WULS 1JHRA 3ULKA 7MDHA 2QUKA 1N1EA 2HSZA 3K09C 4R3WA 3M4JA 3RDPA 4MKIA 3LHDA 5DHFA 1T2VA 3L8EA 2WHQA 3TZHA 4R9NA 4BP9A 1EK2A 2WNIA 1W0KD 2XGSA 4HGYA 4B6GA 5HR5A 5I7FA 1I4WA 1NRIA 1QYRA 2C2KA 3D8RA 3LPLA 3NC0C 2XCOA 4H4EA 4Q1CA 1RQRA 3LMKA 2OG1A 3GJ4A 4M0EA 3E0XA 4Q47A 4Z99A 3RG2A 3X1JA 2JFGA 5DM70 1KXZA 3HB7A 3FTNA 3TLAA 2YHUA 3MT7A 1HNZB 1C0LA 4RZUA 3HXTA 4FFBB 4UDOA 2HNKA 2Q2NA 4UW9A 3ACCA 4ECEA 3Q4GA 5K0CA 3BTOA 5IN4A 3IDFA 1NM5C 3ABZA 2AW3A 3V7WA 4GQIA 4C3VA 1NMXA 3BVPA 3K0FA 1ODLA 3ESRA 3R0XA 4L02A 3EVCA 3NTLA 3VUEA 3WL8A 2CYCA 1Y8ZA 2RGEA 3TFQA 1GTG1 1RJ9A 1H2AS 3OH8A 1XCMA 4O2RA 3RWOA 1WSDA 1X77A 1SVWA 5COBA 4EI8A 3AX6A 3JQGB 1GPYA 4BNDA 3USCS 2NUPB 2V54A 3M70A 4AZVA 2V5VA 4G0UA 4DIBA 2Y0CA 3FYHA 2JGDA 3U1TA 1IXZA 1FRVA 3RWMB 1WB9A 1EFTA 1UJNA 4OUDA 3RWBA 1CDDA 3KX2A 5FYQA 4BMOB 2QT9A 5G0WA 3EGCA 3UOAB 2YYAA 3ZKAA 2H8GA 1S6YA 3FPEA 3MINA 3O2JA 4KQXA 3HL0A 3AWDA 2YWHA 2YNMC 1GCAA 4BMPB 2RGNA 5DMXA 1CUYA 1B74A 4P33A 1OGIA 2H52A 1U3GA 2QZPA 1A8PA 4HH3C 5DISB 3VSAA 1N6OA 2I7VA 4M83A 2FZ5A 1SHTX 3ZV3A 4F4HA 1CR2A 1G5IA 2GPYA 2OGSA 2WU1A 3GFOA 5EIOA 4ZYUA 2PUAA 1SEVA 4LXHA 4Q02A 1OV4A 3LUKA 1O77A 1OROA 1XYYA 3QU2A 5EIAA 3OQMA 1TT5B 3H0KA 5KNDH 3G8CA 4KV9A 4TYWA 4P4UA 2VRCA 3IT1A 3KD3A 4R8LA 3CEMA 2WVAA 4D92A 4MGZR 4Y2QA 4WOKA 5CM9C 2PFSA 3GR6A 3LDHA 4OXIA 2YOFA 4YJHA 5DZSA 1P2UA 1ADYA 2G5TA 1GYRA 1KI7A 4LI3X 4M8LA 4MA5A 4AO8A 3G82C 1DKPA 5E2AA 3T5CA 1Q21A 3TE7A 3PF9A 4XGIA 2OCDA 4QC2A 1TKRA 2CHGA 3LLMA 1G64A 4B85A 1DDGA 1TAHA 4AZ3B 3N87A 3Q7IA 5LP6A 5ERXA 3L7KA 3NHPA 1L5KA 2J9FB 4MKGA 2H4JA 4B82A 3TF5A 1HE2A 5LMUB 3LA8A 4GEKA 1WETA 5ALHA 4F2GA 5AHWA 3H65A 3B20A 3KVOA 2FR1A 2O0MA 2WDZA 4LVOA 3G49A 4QQFA 2ZTSA 2V1UA 3Q7EA 1JXAA 2ZIVB 2I8AA 3KU4A 5EKDA 1U2SA 1XIVA 4GXNA 1GZ4A 3I04M 5BT9A 1E8DA 2C4WA 4HVAA 5DGTA 3THWB 3DB1A 1RYDA 2O20A 2DY0A 2XB9A 3UGJA 1CIJA 1JQ3A 3QU9A 4XPIB 3U0VA 3JW8A 3R09A 2HPVA 4Q7LA 3LQ1A 4MJ3A 2ZYIA 3FCYA 5ED4A 3NX4A 5K3FB 1HEYA 1L8LA 1DG3A 5K5EA 4EGFA 1GGEA 3M5DA 3BILA 1VOTA 1W2GA 3D4PA 4KC0A 4QUIA 2K7ZA 5I47A 4N3BA 7ABPA 2BR3A 1T8TA 2PANA 1EFRA 1TKAA 3FTDA 1PGPA 1GFIA 4G4GA 3VTZA 2JLBA 5E7JA 2IS2A 3FLBA 4ZVUA 1J9ZA 3H2JA 1N3LA 4IJKA 1I1HA 5KX5B 4Q7QA 1UBCA 1G8GA 1T2DA 1BHJA 4TS1A 4QLAA 1UMDB 1UMBB 3PX2A 4HNAB 5CPFA 5IFKA 1NQXA 4IRXA 3V2GA 3EVDA 4G0PA 4UC0A 4BL5A 4DV4B 5EWLB 4P7KA 1HMPA 1OJ7A 2AD1A 2CDRA 2HHJA 2P0YA 4F3RA 2XVXA 1K7CA 2VAXA 5SY6A 2QORA 2X8WA 3ZQ4A 2V7QA 4D3DA 4B3SB 5L3ZA 1I2BA 4QPNA 4TUYF 5F77A 2OOKA 2ZXEA 2C7RA 2BHLA 4IKOA 1PZGA 3VR3A 4W5NA 1U0JA 1FA9A 3U26A 4DLKA 2X9GA 2DPLA 1PNVA 1V8DA 2OO3A 4L3WA 4WI1A 1I7DA 1OA1A 4KLCA 1GGVA 1AN0A 3GUYA 2OL4A 3QI7A 3I3SR 5IVDA 1Z0DA 4BO8A 5CCXA 2K87A 2VTDA 2HA3A 4O33A 5BSEA 3R0IA 3EF0A 2AG0A 2RGRA 4QEKA 2PUHA 5ALEA 1KETA 3FCXA 5AUQA 1CJKC 3GAZA 4V0QA 1HNWB 2YQ5A 1BZYA 4CPDA 4RABA 2ZUVA 3N70A 4GPAA 1QB7A 1YQTA 3E4DA 3F3KA 1A3CA 3O8OA 3T7IA 5HPYB 1F12A 2C5SA 3OQ1A 5D00A 2ZUBA 3G6WA 5LUBA 3ZK8A 1JU4A 5LZ2A 2XF2A 1IC6A 2ODEA 4AY5A 2QL5A 3DAHA 2NYUA 2CYBA 1CEXA 4A5SA 3A1FA 4OQXA 5INTA 2XGOA 3ND6A 3DTVB 5AOVA 1IY1A 2B1RA 2NO5A 5DXFA 3VPAA 2PSFA 1UBGA 3KS9A 3LDUA 3WKBA 1OXBB 2VYND 4XIIA 1YU6A 4BJ6A 4ZAXA 1SKQA 1YE3A 2RGDA 4WN9B 2EX1A 3TE6A 5HW0A 2ET6A 1JG4A 1SQGA 4BGEA 1KI9A 8MHTA 1WOMA 3T0FA 1R3UA 3JAWA 3NWOA 1F48A 5TJHA 5T67A 5HKLA 1H05A 4GECA 3DYIA 1SZJG 4I1YA 5GMOA 2PX5A 3DDSA 3JQAA 1P2FA 4B83A 4CR7A 1A2QA 2QE6A 2VLIA 4OYYA 4XWGA 4DUGA 3QNWA 1BEZA 1OH7A 1MVNA 4NE9A 1CE8B 3WMFA 3OFSA 5JE8A 1VJ0A 1U04A 2YS6A 3NXKA 1AXEA 4NATA 5K8IA 3E5RA 3W79A 3ER6A 4RJLA 4NENB 1E0SA 2G82A 2PXHA 1EVEA 3KXDA 1LPAB 1NVUQ 4QTUB 4WVLA 4RA9A 1VZ3A 3LK7A 1ZSVA 3QEMB 1N3IA 1JKXA 2O5EA 4HNVA 1J25A 5CA1B 1D04A 4UBIA 4G85A 2V9ZA 3FPSA 1V1MB 1YBVA 3C97A 3E8XA 2OBYA 2A94A 3F5QA 4NYJR 2E18A 2GERA 1L4HA 3D8UA 2GJ8A 2QMOA 4QSHA 4DHWA 4OBXA 4UAGA 2NU8A 4NVRA 1CCWA 4UZEA 4A91A 1Y80A 1FP4A 4HQFA 3FVTA 4G2NA 1UXIA 1XRPA 3S2YA 1WR8A 3IILA 2WFMA 2A58A 3PLNA 2WSLA 1KE2A 4TZTA 2MSDB 2PSDA 3SXPA 2YXPX 2WF6A 3IE1A 1BXZA 3VHLB 5LR6A 3BCSA 1PT7A 1K5HA 1L5OA 1PFUA 4IVQA 4J49A 3GFVA 1RXYA 3NHSA 5G02A 5B1DA 2ZIUB 3SN6A 3VJKA 2B7BA 3O3MB 5HF8A 3OIGA 5EKUA 4EUNA 3F46A 1WBJB 4LY9A 4Q00A 2ZVPX 4GOKA 3ANTA 4PO3X 5D87A 3OX1A 3HWX1 1N4DA 3WIEA 1N2EA 5ALXA 3D9QX 4ALNA 5JDIA 4C3OB 3P9PA 2PBLA 5EVCA 1AURA 4C7BA 1O5OA 4B0PA 4YUZA 3CIOA 4BB9A 2Y05A 4CW7A 3P0IA 5FWNA 1DKLA 5JNSA 2ZM5A 1XN1A 3DD5A 4D8WA 3DE5X 4FQ5A 1QHIA 4Y2VA 1FYEA 2C96A 3ZZ0A 2HQBA 3VR4D 5CEEA 4TMWA 1RI2A 2PD3A 4DEYA 4D8VA 4C5AA 3I8SA 4PLHA 2EQ5A 1XR3A 2AN4A 1LPPA 3AILA 5EP3A 1KYYA 4MV6A 3U7QA 1BDJA 3HUUA 4E1AA 4C2TA 4H7PA 4P5PA 4EX6A 1OYVA 4IKPA 1T1IA 3WHLA 4KIUA 2PMKA 4AZ0A 4DGSA 2ZWOA 2UZAA 5AVYA 1ZR4A 4M38A 3R0ZA 1GLVA 3CX8A 1EVZA 1ZN9A 3AVQA 4M1SA 3LC0A 1SG6A 2VJNA 2ZDGA 1OVMA 2QK4A 3OZUA 1V37A 3THXA 3GH3A 2ZBVA 1QX4A 4K6KA 4K87A 4OP1A 4UUNA 3CT4A 3TLKA 1K9SA 3T94A 3WLHA 4ETNA 1JHZA 1VL2A 4XWTA 3T7DA 3EQ7A 1MDFA 2A7QA 5IC6A 3B53X 3WMEA 3P9ZA 3FJYA 4X3PA 2HUNA 3MLBA 1H2ZA 2H31A 3L7BA 2ZPAA 3VSBA 1IUKA 4Y2YA 5JVDB 3RUCA 4D0SA 3W5CA 3BWDD 1A7KA 3C43A 3TTXA 2X14A 1Z5NA 4FDMA 4FKMA 3D7NA 4TUYA 4KPFC 2E4VA 3ZW8A 1H0SA 2HOQA 4QIHA 3L8YA 3C1OA 2JFWA 3HY4A 3R5XA 3ZIAA 4MVJE 1HYGA 3H9JA 1B0AA 3FWHA 4WUTA 3ZNNA 5EY5B 2YIMA 1EXNA 1X1TA 2QAIA 3NBUA 1LK7A 4H17A 4NV3A 2HWYA 1RHQA 2VZ8A 2YWBA 3Q2KA 5E9QA 4FC7A 3WTBA 1SM4A 3LYAA 4BLOA 1ZOIA 3B89A 1N7JA 2DMRA 4ICIA 5CLJA 1X8KA 2C9DA 2FFBA 4HTFA 2HSGA 1NDUA 3KYCB 4GMHA 4U8HA 2JIMA 2CWWA 4AO6A 1O0SA 4CM5A 2JNWA 4KI7A 1AX9A 1D2NA 4MUEA 4X9XA 3RS7A 1Z39A 4DARA 2FPWA 1V26A 3ZQKA 1R88A 5IJ9A 3ZCSA 5IZCC 2ZYGA 1FRNA 4FEAA 5C1DA 5EHNA 4U7TB 4WPGA 2G80A 1V35A 2A33A 2EFGA 1KVQA 4HB2A 4BLQA 2NO1A 5T7BA 2IOHA 4WK6A 1LF0A 3BA6A 2OCAA 1PQ4A 3H2ZA 1US8A 5EI5A 5JS2A 1G9XA 2OV8A 2QZJA 4YPVA 5E4FA 2DQYA 5EP2A 2NO7A 1MHPA 5KOHB 3B6MA 2OP0A 3OZGA 1EFRD 4N49A 3FGPA 3UJNA 4Y3UA 1U2DA 4PLCA 1H9CA 4LMRA 4KMSA 5FBLB 5FUYA 3WB1A 2AN5A 2WP8J 3I9OA 4ONEA 1LRLA 1M0SA 3UWSA 1VYHA 5EXXA 4FOOA 4LE0A 4FILA 4K9RA 4OFZA 3DFKA 3AUSA 1P6XA 1CJUC 3QMWA 2P4EA 1BWPA 4RIHA 3UJAA 4QPCA 2QAGB 3WOHA 5HX7A 4IKEA 1RS0A 3K0BA 3L9XA 4NTZA 4ENTA 2CLFB 1X6VA 1SCUB 3I92A 2YASA 3MN1A 4EKIA 1DCFA 3OQPA 1W73A 4YXWA 3PE6A 5EKTA 2VHXA 1EX6A 2ATEA 2WYUA 3HJRA 3A2MA 3A6EA 4RKFA 3USZA 2GPWA 2Q28A 2NUTA 3F4LA 2XT6A 4I5DA 4WFIA 1YAJA 3UMBA 1CY1A 2WR8A 1DAFA 2JBWA 1POWA 3D4NA 3IQEA 4IDEA 4QGSA 5CB4F 3SI7A 4BX3A 2Q8PA 2X2FA 3M1IA 4PYQA 4H1UA 2BE7A 1P60A 2ZCUA 3HKDA 4JJAA 2F59A 2Z2YA 8AT1A 3KUCA 4UOZA 4I9UA 3GB9A 1FTGA 2BPOA 3IAM1 3VZDA 2IBTA 2ZRIA 1R27A 1JA0A 1NP7A 3FF4A 3KLPX 4HNGA 4Y2XA 1TJYA 5DYTA 3SVLA 3COVA 3LCRA 2KLHA 3IBTA 4L72A 5E0KB 3FDIA 3MK31 3GFQA 2NXWA 3LBNA 1WXQA 4FCTA 3O83A 5EMLA 2R1TB 3D4BA 3ORRA 3PGXA 5DHSA 4FUQA 3W7VA 1R3DA 4B7XA 3OX2A 4RO0A 2R7MA 3ROFA 2KW5A 1GFWA 3NAZA 1V9CA 4V3CA 3KV1A 2LWIA 4ZCQA 5CNMA 1XWIA 1YRYE 3OPYB 3COJA 1MAWA 1VGVA 1RHUA 1U3VA 1U8ZA 3GO4A 1WMDA 4QOIA 4F9FA 4PG8A 3J81A 4ND2A 1J2EA 3AF2A 1J5PA 5DASA 3P71T 1O3YA 4ZVSA 4HEA1 5KVSA 4JELA 5FP0A 4Y0VA 2WZQA 1U3WA 2COUA 1ENZA 2JASA 4S2UA 3THRA 3FSGA 4WT7A 5FI5A 4R3NA 3GEMA 4YDRA 4HDKA 1KO5A 1OI3A 3ID6C 3KCNA 5JQGF 4RTNA 3PI6A 4C4YA 1CUXA 4XFDA 2J48A 2ONJA 1R4MA 1LQTA 1R64A 2AS0A 3FMIA 1F38A 2CD7A 4BMZA 3SYNA 4L8LA 2DH6A 4Y2SA 3G0HA 2N0SA 1HM5A 2SCUB 5IUJC 4LOAA 4OQDA 3ASZA 2IF2A 3NUGA 4S0ZA 3JQAD 4V0RA 3MWEA 1E2IA 2PMBA 2RHMA 3FIJA 4DUGD 2WZDA 4F7DA 1U8TA 3EIOA 1FNMA 4P3OA 3GDGA 1JB9A 1ISJA 1P1CA 1M7BA 1IN6A 2JZOA 3QYJA 1DX6A 4JQSA 1XCOA 5CIWA 2IYQA 3TKYA 5KOIA 4FVTA 3WLEA 2QYOA 3E18A 3GLIE 4XX0A 2FPPA 3HYTA 2O4UX 5LQSA 1UK7A 4B4OA 2GO7A 2QP3A 4HZUA 4KFSA 2UUPA 3ZE2B 1WMSA 1LI5A 2H51A 4L4UA 4OBWA 4Y6LA 1A8IA 2WJHA 4B1FA 3UWMA 1K5GA 1Y4UA 4AVYA 4CLEA 5JALA 4HEJA 4KPEC 5I51A 1A5BB 3BL6A 1HNNA 3AMVA 1B00A 2I22A 1M2HA 3RHFA 4PF1A 1I2AA 4RSRA 2XNHA 1KYVA 3N6RA 2Q4DA 3IP6A 3TZLA 3D81A 3V55A 4ZTZB 5F2NA 3UMRA 2EX4A 2DFKB 5CURA 2PKQO 3T5BA 4F2DA 4KPGA 1U94A 1P6UA 5LJLA 3KELA 2AXPA 1T91A 1Q1GA 3IPXA 1Y1TA 2VTBB 1NIJA 4B4KA 4RFSB 3ZV6A 1HRDA 3ZD8A 4DW8A 4MW6A 4AMGA 1UKBA 2Q0SA 1MC1A 4TXLA 4RIFA 4C03A 4X65B 2H1WA 2PU5A 1G3MA 2WU0A 3OTWA 1RLTA 5KDDA 1T9GS 4OL0A 4Y6QA 3RRJA 2GPSA 4LWZA 5CXSA 3QFSA 1EPUA 2TSYB 2ZGVA 4MULA 4ITRC 1IWBB 4LSGA 2I03A 4LZOA 5ER6A 1LDNA 2H85A 2LW7A 3LYLA 4P58A 3FNBA 3V9AA 4BAZA 1RPZA 3I3OA 3FPJA 1JW9B 2BM1A 2CEAA 3BFXA 3FA2A 1R6VA 3AEUA 3TJMA 3HP4A 2PJRA 1F17A 2CFIA 1V5WA 4HS4A 4IZHA 2UVPA 1GPNA 2WZCA 2OBXA 3LQKA 4PZYA 1TQ8A 3R24A 1UBNA 4WXRA 1Y6FA 1DMRA 1TM5E 1QRRA 3R6GA 3RODA 4NV1A 1E7RA 2JLRA 1AKNA 3EC7A 1GCGA 4I99A 4HVTA 4UE2A 2BSQA 2BI4A 4G8DA 1PZFA 5FULA 3TD9A 3X1YA 1POXA 3HA5A 4WKGA 3RVOA 3KQNA 1NW7A 4CMIB 5AR1A 4IW3B 4LHXA 4PBSA 5