2PO5A

Crystal structure of human ferrochelatase mutant with his 263 replaced by cys
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSACSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase, mitochondrial
publication title Altered orientation of active site residues in variants of human ferrochelatase. Evidence for a hydrogen bond network involved in catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 138
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2po5A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2po5A01
1AK1A 2XVXA 2AC2A 4CCSA 2QD5A 2HK6A 2PO7A 2PNJA 2C8JA 2QD1A 1C9EA 2PO5A 4F4DA 1LBQA 2QD2A 3HCPA 3HCNA 3AQIA 2XWPA 4KLCA 2XWQA 2QD4A 2HRCA 3W1WA 2Q3JA 2XVYA 1C1HA 4MK4A 2H1VA 2XWSA 2Q2NA 3HCOA 2Q2OA 2QD3A 1N0IA 1DOZA 2XVZA 3HCRA 3GOQA 2AC4A 2HREA 4KLRA 2JH3A 1L8XA 2H1WA 3M4ZA 4KMMA 1LD3A 1HRKA 2DJ5A 1QGOA 3LYHA 4KLAA 1TJNA
chains in the Genus database with same CATH superfamily
2MOKA 3NAQA 3I8SA 2AZTA 4XOIA 1H23A 2WPNA 3D3WA 1ZCZA 1JHZA 2HC9A 2JAOA 4URUR 1C7IA 3WICA 2PMKA 2NU6B 4FK8A 2NAPA 3HU1A 4C0SA 2O5CA 1E96A 4IAOA 2ZE5A 3SHOA 2GUGA 1E0SA 1R4NB 1U0SY 1PV1A 2QIOA 2JGDB 2XMCA 1BDMA 4A8JC 1S9DA 1GCOA 2G6BA 1NQVA 1XRPA 3HJNA 4N3BA 1EFTA 5KWEA 1EVEA 3M3PA 5F78A 2HWUA 2IOQA 5EHIA 2BKXA 4L5JA 1JH8A 3HUDA 3SJZA 4PX3A 5L3QB 3L04A 5JNVA 3UK6A 1ZCJA 1DO2A 4FFBA 3GFQA 2CHFA 2JFZA 3O4JA 1QZTA 2Y1XA 2C4VA 2F1RA 3AONB 4LBZA 1AUQA 5FUWA 1POWA 4DB2A 3PDJA 2X3UA 5FAXA 1A04A 3AHGA 1XZJA 3HA3A 1R2QA 3KZOA 4Z54A 3DKRA 2FETA 1UMDA 4RGQA 4XB2A 1B41A 1OI3A 3B78A 3D0KA 3PK0A 4PGHA 2J9FA 1NJ6A 1QRAA 2EGHA 3KE9A 4U5XA 1D1TA 3SEZA 5LYJF 3A9UA 4B44A 1OW3B 1LH0A 4LRQA 3UYKA 2JK1A 3H97A 3H87A 1VE6A 1L5HB 4KPFC 5BN4B 1M34E 3OH8A 1TK3A 4U3JA 2W2NA 3VU1A 4B74A 4D0SA 5HPYB 2H7VA 5CGQB 3EUFA 2QNRA 2GK6A 5B2FA 2DC1A 5M7EA 4K6FA 1A97A 2XVXA 3ILVA 4O08A 1FZQA 4B6OA 2Q9BA 1ZR4A 4MUNA 1YA6A 2PKYX 3IALA 4X45A 3H3JA 2W22A 5K0ZA 1U8EA 1EXMA 3O5AA 2AB0A 2YVQA 1JMVA 1UL1X 3DDHA 9MHTA 1JFFB 1F1BA 3EXFA 3PCRB 1WXIA 5CTJA 1JRLA 5ENZA 1SAYA 3IPRA 3LP6A 4OI4A 3SEAA 3DE4X 3BGWA 3K1YA 4KFCA 2YZ2A 1KPGA 3EA0A 1GPJA 4M0LA 4AQYB 1UWLA 2W4MA 3F46A 4BMSA 1Z47A 1GNRA 4INJA 1TFRA 3W2GA 3COYA 2K2WA 8ATCA 1T1SA 4X6YA 3BMOB 4L0DA 4BGVA 2Q1UA 3C7AA 1DT5A 3DOUA 3IBTA 4NE9A 3U4DA 3RIGA 3KALA 5C8ZA 4DA4A 5BT9A 1NPDA 5CIWA 5IBRA 3E35A 4N4AA 3D4BA 1KH2A 3O9MA 2LGJA 4XB6B 5DHUA 3UA4A 4GRIA 2ZEJA 3B60A 4UBLA 3WLMA 4D79A 4F9GA 1T0PA 1RYYA 4QTTB 3HY6A 4DLNA 1DXYA 4Y0AA 4P0QB 1ND5A 4XJSA 1GR1A 2BSXA 2FLKA 1BDHA 1E0KA 2JDIA 1Z63A 1TVKB 3JU3A 1CRZA 3WLLA 4K2HA 3B53X 3SYMA 4FW9A 3NAGA 3TOCA 1YULA 4Z49A 3OQOA 3NGXA 2I3DA 2VVTA 3GGGA 1E9SA 2I22A 3RABA 4M9SA 3FNEA 3H0KA 1GG8A 1RD4A 2BHSA 1H0KA 2FXVA 2ZOSA 4J1TA 2P2CA 3U48A 5ELXA 4MYTA 4AYWA 2I66A 3DMTA 3KB2A 3I1JA 3TSYA 3D54D 3PJEA 3MOIA 3HA2A 2IX9A 3OBBA 4X63A 4QOJA 1PO7A 3KL4A 4KU4A 1X3SA 1A9XA 3MILA 1SXJC 2A5DA 4KXWA 4C29A 4EHAA 1UC9A 3HZRA 4ZAVA 3ZGOA 4JOCA 4JJKA 1DE0A 2QDXA 4XZ3A 1K6EA 5CGZA 2Q07A 4KVFA 4ZGBA 2BUAA 4IVPA 2PUFA 2C54A 4TV9B 1NBEA 5BW4A 4X60A 5HEKA 1U4OA 4NKRA 4DDKA 4KACA 5JLJA 1P1JA 5AM4A 3EQZA 4UBOA 4QYIA 3U6KA 4ARCA 3V46A 5LWHA 7ABPA 2KWIA 5JS2A 4AJ1A 5IFLA 4KIUA 1NW9B 4MHTA 4BX3A 3V5NA 1TU3A 2WEKA 4A26A 2WFMA 4J1SA 2O07A 1PK9A 5FI0B 2VSFA 2GRJA 3AM4A 4YWJA 2R4TA 3WKAA 1M2KA 4MUYA 1VJTA 3H2GA 5ENDA 2OCYC 4MVCA 1OH5A 4RTKA 1ECCA 2GN4A 4H7IA 5JQWA 5EN4A 1GNPA 2COKA 4DMLA 2Z0MA 5E4JA 5HIKA 3QE2A 4F8JA 1AF4A 4AF7A 3GFOA 1PBTA 3F9RA 1WKCA 3ZTWA 2J6CA 3BWMA 3EPLA 3G17A 3GLUA 4MUFA 2XZDA 2CLMB 3CSSA 5JVDB 3AVOA 5DHPA 2JAHA 2YICA 3ORFA 1BCRA 2B9EA 4R8LA 3ADKA 2WIAA 5HTKA 4CRWB 3MAAC 1C9NA 3CRQA 2QUHA 3IQDB 1YCDA 3M5DA 3MOSA 4EB6A 2YWEA 3CBQA 1YI0A 2JZCA 2HMSA 2FWAA 4JR2A 3NWPA 1HTBA 4L85A 5LQMA 1HSZA 1I1OA 1T34A 3D4NA 3TUZC 1SCJA 2HCRA 1P0PA 1Z4PX 4Q4CA 2YYZA 3NHRA 4E4TA 3PEFA 1JIXA 2R87A 2UVDA 4PLZA 5EZSA 1EJ6A 1S8AA 4DNFA 1M3SA 4JV5B 4AKHA 1WMBA 3WQBA 4Y2PA 2IS2A 4Y9DA 4QELA 1QIFA 3RRFA 2XT0A 2GBPA 1LF0A 4L28A 2WVAA 2OXRA 3A8TA 1R8JA 4PX5A 3D7KA 4TMKA 4QHTA 3ZJVA 1UAAA 2GO1A 2O8CB 2P8SA 1MOPA 4FC7A 3AJDA 2Z09A 1O9BA 3IAM6 4LC0A 5IF3A 1BQ3A 5F1PA 1F2UA 1BROA 1STOA 2QRZA 4DV7B 1N36B 1NIJA 4C7XA 2ZAMA 4MVJF 4RL4A 3QVGA 4HFNA 4EABA 2B1GA 1EVYA 121PA 2EDAA 3E9EA 1JLSA 3I83A 2RIRA 4HRYA 3LCJA 5J2TF 2JFVA 1UPAA 1IBLB 1W4CA 1YR2A 2Q4BA 5HJ7A 1U9ZA 3IV6A 4DC0A 3S1AA 4B4UA 5BV7A 1BJRE 3PRKE 4EBBA 3C5VA 4ZV7A 1MDBA 4W7IA 5B6IA 3KPWA 1EQAA 3S81A 3TI7A 2GLUA 2HQBA 3OCZA 4V39A 1J4AA 3P0EA 1O97D 2BFFA 5F1KA 4QBFA 1PL7A 3ESAA 3WV5A 3AKCA 4FYJA 1OI2A 1CRLA 2NUTA 3BD6A 4JH0A 4HWRA 3REQA 1E62A 1QZXA 3A2MA 1Y8AA 3PPXA 5HA5A 1OB5A 2DUNA 2B4TO 4M1TA 2RI6A 3T94A 4LF7B 2J7PD 5BUZA 5EG5A 3T1OA 5JCZA 2F90A 1KFEB 1RYDA 3CF4G 4IFIA 4WKPA 3RSCA 4GVXA 4NBRA 5DP1A 4U2EA 3HB5X 4DJEC 3LXUX 3OFJA 2GGSA 4HY3A 4YT2A 4GOLD 1EEHA 4P4TA 4F11A 1W76A 3CNNA 1TEXA 3EYAA 4J1TC 3FYCA 4Z0TA 2H63A 1RLOA 1ITZA 2VDQB 2Z3WA 3ZHQA 4C78A 4RVFA 1ZRHA 1DTWA 1OFHA 4YRQA 1QYCA 1GDTA 4YTEA 2AF4C 3D81A 1XN4A 3ZK9A 5HE9A 2BL4A 3DAOA 4D46A 1US8A 2I1LA 2NSJA 2ZANA 3HADA 5FI5A 1G2PA 2J1LA 2XQIA 3SSMA 1TTQB 2HU2A 4QUKA 4DJTA 1W0KD 2VYFA 3FWHA 1P2BA 4MCIA 4EY8A 2BTEA 4K9RA 3MTDA 3C6QA 1TC2A 1BRTA 3UXMA 3KKPA 2QYOA 2YBEA 5F9FA 1U28A 2ZDGA 4YXWD 1OFIA 1CF2O 1X7DA 2IHBA 3CBGA 1YZ3A 3CLUD 1HOTA 4PSDA 5AKXA 3ZWVA 5AW6A 1KTVA 3A1NA 3H18A 1HE1C 3GZNA 3UOWA 4I1IA 5K8VA 2H4HA 1SNYA 3FSEA 2RH5A 2YZGA 5IT5A 5GMOA 4AJEA 3OTGA 4LMAA 1NW4A 2HSGA 4QHSA 5HS6A 2YXEA 4BLWA 3L4JA 2XSZD 1PQUA 3GMDA 3GWZA 2AR9A 3WXMA 1P5JA 4RZQA 1JSZA 1O58A 2HKIA 3H2SA 1Y8RA 1U3TA 4G01B 1QBGA 4BN5A 1N7HA 3PNBA 1DAOA 4PXSA 2W5UA 5CVJA 4F91B 4FLMA 3FTEA 1A9TA 1EDDA 4LBVA 2AN1A 2WD7B 3DZIA 4QFMA 4LYAA 3UAOA 3ZCQA 2W6NA 4TYNA 1OU4A 4J0KA 5FHQA 1KE1A 1SOWA 5EFZA 3BS4A 1T2NA 1U6KA 1AQLA 1M2VA 1OBOA 1QM5A 4GXRA 1GA6A 4IIYA 2R96A 3AUSA 4JROA 4NENB 5AKZA 2GNAA 4JYCA 5TC4A 4EYGA 5A6VA 4JLDA 3WGIA 4GC9A 2IZ0A 3LWNA 1QHHB 3HJTA 2A35A 5HNKA 2XVMA 3PQ8A 1MIOA 4QT4A 4A2PA 4DT1A 5K3CA 4V02A 5IDXA 2P5TB 5IKEA 2YV1A 3WGHA 4DZZA 5H9WA 3K20A 1HDEA 4X54A 2ZXUA 2B5OA 1CLUA 1KERA 2R8EA 5ALGA 1C41A 1VLLA 1LBIA 4MGKR 4MICA 4F92B 2FQYA 4GKKB 2O54A 1XQXA 2B7LA 2OK7A 3HNPA 5BWOA 3EVAA 4D4JA 2OXFA 3Q40A 4B81A 4DWJA 1N3YA 2E4VA 3UWKA 1VGQA 2IYAA 1G98A 5DI3A 3W2HA 3L43A 2VYVD 3DONA 4X0EA 5IVDA 1RKQA 4IYRA 3THXA 3T7JA 3A37A 3VSEA 5L3ZA 2QLMA 1N57A 3U3DA 1QYVA 1YBMA 2OHFA 5G1NA 3ZIAD 3EFBA 4LF8B 2NT4A 2CBZA 2NUPA 3BF7A 5FOVA 2BI7A 3ZQ6A 4PICA 1HM5A 1V47A 3EEQA 3IDOA 5KYGA 1J1UA 1E1MA 4GDMA 1U0NA 4TM7A 1Z45A 3GGOA 3OJLA 5BURA 1PYDA 4MJ7A 1CG6A 2YH2A 3T7AA 4EQ6A 4Z0PA 4AMGA 3CLVA 1QP0A 1LRJA 1JLKA 1XF9A 1P74A 2DHEA 4N7BA 1HDZA 2J08A 2WICA 4OPMA 1SURA 3ESQA 5AUQA 5JZOA 1JKXA 5JSZB 3EGXA 1JU3A 1LC0A 4FMCF 4OYLA 3RAGA 2QTVA 1UJ2A 2QNBA 3WYBA 5BMVF 1H0HA 3GUUA 4RPKA 1M2NA 3W90A 4BEWA 2DWUA 1LS6A 3FYUB 3MUNA 3OZEA 4J0DA 4MS1B 3K0KA 2YWXA 2R4UA 5CT6A 4F12A 1L5ZA 2VF2A 4LDJA 2I6FA 4FGKA 4ZU1X 3BWDD 4DWVA 3M81A 1QTRA 2NZ2A 4Y6LA 2W6QA 1TXGA 3SI7A 5EE9A 4OHFA 4BNIA 3TL3A 2AOTA 2ZDHA 3N2IA 1EINA 2PUAA 3K4QA 1PE0A 1ZBQA 1W25A 3KX2A 3E9DA 3OZFA 3QPVA 4DF3A 3O47A 3PENA 4LYGA 3SKVA 4I55B 1KYTA 4BXOB 2W0MA 1RAFA 2XUHA 4D4HA 4DSUA 3HI4A 4Z0HO 1WXEA 1XQVA 4EEXA 3VZCA 1JLRA 4EVQA 5KUTA 5G2OA 1G55A 1V3QE 2IPLA 2LP4Y 4WCDA 4CDMA 1KDPA 1WCWA 1Q22A 3HFJA 5CEFA 4LGMA 3DT8A 2ATVA 3VR6H 3ZZ1A 5HKKA 1PI3A 1Z7EA 1QTQA 1U28C 1TTPB 5HW0A 1OFGA 4KGDA 1L5YA 1G9SA 2A0KA 1QAMA 2IK8A 3DWFA 4FFVA 4WJZA 1RP7A 1X6VA 4FEEA 4DV0B 1FNCA 4GKAA 4TT8A 5T8KA 4YCAA 3IP7A 4NOMA 5B4TA 5KYNA 2PT5A 3ESDA 1XHFA 2WYVA 3W6OA 1P9LA 2UYQA 4CKWB 3M9WA 3KQOA 3TPFA 3H6KA 3RUPA 2WYWA 2Y0BA 2HBYA 4BAUA 4A4DA 1N4AA 4MW1A 5HRAA 4K9PA 4D42A 2X7XA 3TUIC 3VNSA 1N6NA 1IBSA 2J9RA 4LKOA 1SBTA 3HDHA 3V1UA 2P79A 2PAAA 4M7PA 1HFWA 3IR7A 1OSNA 2XWJI 1PT7A 3DZKA 4G8DA 3FR8A 4B7ZA 2CNKA 4V1CI 1T6BY 1QVAA 5HF8A 5SZKB 5DSXA 4AS2A 2V4ZA 3F8WA 2VPZA 3EWNA 3U17A 1X7XA 2V65A 3VOAA 1JEEA 4RORA 1K8QA 4KK4A 3OT1A 1JP7A 1BGVA 4MKHA 4NJEA 5DGIA 1DXHA 3PKZA 2OFXA 3JV7A 3PL5A 4I1YA 3A4YA 5LXTA 1ZITA 4LRSB 4PC2A 5AK0A 4BFXA 1BW9A 1NZDA 3QOXA 1LJLA 4HZUA 5LU9A 4ARBA 5AXAA 4PM4A 4Q3KA 1CD5A 1E4EA 5DGXA 4CM7A 1N1EA 1CUYA 2D4HA 3AIMA 2JLXA 3BCRA 4DAOA 3HVRA 3ILHA 4LJSA 2OFPA 3UC5A 1KF0A 3E6AA 1NP6A 4TWRA 4UUQA 3L0DA 3ROGA 2ONJA 1T9GR 1ZBDA 2BIFA 3BA6A 3QKIA 1SEPA 4R2XA 3MT7A 3WBBA 4GM1A 1X1BA 1BS2A 4QULA 3T15A 2PO5A 5JSFA 1DUVG 2JFWA 4BQPA 3DQZA 5E7IA 4RFLA 3FE2A 3IERA 3B5JA 4BNGA 4JI4B 1L4LA 1SKMA 4N9WA 3T9DA 4HDKA 4TMFA 3V8NA 4QGGA 3K16A 4FUQA 3CONA 1WMAA 3MIZA 1ECPA 4KH1A 3KXLA 4ND8B 4RA6B 4G41A 4ZD6A 3VTKA 5K3OA 1IHDA 1IZ8A 3TM5A 5A03A 5BUCA 1M8GA 4MUGA 3LDFA 4RE6A 5ICCA 1G1AA 5LMNB 5K3FA 1KH1A 5FOWA 2I5PO 3ESRA 5AVRA 2D8MA 4YBRA 2R6JA 2NZYA 1LFAA 1VZ3A 2H4FA 2AXQA 4KQFA 4TKVB 4BO0A 3GLGB 2CYAA 4HJRA 5BMOA 3K9FC 2AC2A 2VDJA 3EMKA 1LY1A 1Q0ZA 3DVAB 2C8JA 4R3WA 1C30B 1TPZA 4G97A 3MNFA 1GXSA 3HCNA 4WE3A 1CNEA 3OC0A 1GSIA 2X9QA 4GI2A 4OQYA 3ICQB 3O9VA 4PLTA 2HGSA 2RHBA 1UPXA 2W48A 2CEAA 3I73A 4HL6A 5KNCH 3CT6A 1V8ZA 2JFYA 2RB5A 3MWLA 1MW8X 3JZMA 3LBAA 4MIYA 3UBMA 4Y6QA 1QFZA 3IL2A 1TZ2A 2PRIA 1IWOA 4WZZA 2D62A 1G66A 1OXTA 1ZGHA 2E87A 1DLIA 2HSJA 1E2FA 2X3FA 3AUAA 3D6UA 3MF4A 1EM8A 1SVWA 4I19A 4I2VA 3RARA 3ERCA 3GG2A 1JA9A 3RT9A 3FGNA 5G1OA 1FIUA 3GH3A 1VFNA 2QRJA 3AU9A 3E2IA 4KVZA 4RK7A 4YLEA 1LTQA 1U31A 3SXUA 1NJGA 3IXMA 4MP3A 5M34A 2ASVA 4EPVA 5JR3A 1XTBA 2Q4TA 3ZJ5A 4B87A 5K0FA 1W9HA 1Z2PX 3NEJA 2BFOA 5IBQA 5KNBA 3D43A 3CLSC 3K0SA 3AVUA 3MMZA 1G64A 5BQPA 2JBHA 2DG2A 3WL3A 4OGFA 1ZA1A 1W4BA 3ZE2B 3RVJA 2OWEA 3C7TA 3WRYA 3OOSA 4AJOA 4CCYB 2DFVA 3H3XA 1XZMA 2YZ7A 3B3JA 3MCTA 1RLMA 1BSVA 1H8EA 3PV0A 2AMVA 1TJPB 5NLLA 4ILEA 1B8UA 4L3WA 1XA3A 5BRNA 4OSOA 1SBNE 1L6RA 1MO4A 2H00A 1Y4ZA 3IHTA 2ILVA 1WXFA 3FPHA 4UMVA 2Y99A 5PNTA 3WIEA 1FYVA 4QDTA 1BAPA 4ZDKA 1I2ZA 1ZD8A 3HFGA 1FF9A 4I5GA 4ZOQI 1X8XA 4H3KB 3BH6A 3OCWA 5AKKA 4DCMA 1SZPA 2H2FA 3K0AB 1N2ZA 2EARA 4M9QA 3NBFA 3EVBA 4Y9TA 3IEPA 2JLSA 3TWOA 5ADWA 5J43A 1SBQA 2GJSA 2X0IA 3TRJA 2FEWB 3VHLB 4GGPA 3ZE0B 1QVVA 3A3NA 1AB6A 1AKYA 1C3JA 2E18A 2HJWA 4OK5A 5EXXA 4O5OA 4KHZA 4F5YA 1I36A 2VYQA 2Q0HA 4HN2A 2FZ4A 4GUDA 2Q6KA 4B34A 3SWWA 4DR1B 1YUNA 3M4JA 3BL5A 2HEGA 4FSDA 3X1DA 1D4ZA 3BCHA 4HH1A 5BVGA 3CISA 4IV5A 4GYJA 3RYFA 4CKYA 1YRYE 4JWTA 1FVOA 4YCCA 1YS4A 4M0EA 1BC5A 3PR1A 2GF0A 5J1TB 2V0GA 3IIMA 1HYEA 1PWZA 3BK2A 4MCJA 4YMWA 4LTMA 1O9HA 2YY5A 5GGXA 2ZS7A 5IM4F 1YVPA 1DZIA 4BMCA 4MEAA 1FSPA 1BE1A 4B3IA 1T1RA 2OCDA 1IN5A 2R85A 4G5FA 4P33A 3I12A 4J2HA 1FRZA 3IBCA 4MRPA 5CDHA 2DWOA 3ZDAA 2CXUA 3EDRA 3EQ2A 3K6JA 4TL8A 3WE7A 3LK7A 1QHIA 3I39X 5D5PA 1U2RA 4K9KA 5JAOA 1KIFA 2WD9A 2XODA 4ASUD 4JI2B 4DMFA 4B40A 1NA5A 1UP4A 4ZAWA 4U2DA 1U7PA 2YZNA 4NFYA 5H4HA 4TXMA 3UY4A 3VNBA 1NQUA 2F4NA 1HRDA 3FKSD 3V2HA 2MYNA 1KPHA 3I2IA 3OM1A 4ZQBA 2ZIVB 1JHXA 2UKDA 3E5MA 4L76A 2XCQA 3IX7A 4BIIA 3LXXA 2YY6A 3JY6A 4LHVA 2ID7A 5E95A 4YRJA 4MRRA 4Z4FA 4NH0A 5CLHA 2ZJ3A 1YS6A 4QTZA 1TFUA 2SKEA 1R9NA 2MJLA 2VG8A 3FTPA 1WUIS 3OUUA 5JXIA 1K27A 1XYYA 2BH9A 4ND4A 1NBAA 4UM9B 4DV5B 4AUNA 4OCZA 2C5BA 4DPKA 5F5XA 1GCGA 2IGBA 4OHWA 4DLWA 4HATA 4MI3A 5ICFA 1RAGA 1D0IA 3UJ3X 3R24A 3A4TA 1HYHA 2F55A 5KYWB 2D59A 3LBNA 1BHSA 3MMXA 4XI9A 4UXJA 4OBWA 3BIFA 4ARZB 4XGQA 2FZVA 3D2LA 5GINE 3DXYA 2VF7A 1E9EA 1KGSA 2AJLI 5TRTA 4JL8A 4F7WA 5JVDF 4RVDA 1ZW6A 1YOVB 2C04A 2XUZA 2KLHA 4WUVA 2M6LA 5FI1B 1OA0A 4ME6A 1HTTA 4DHWA 3SR0A 1ESZA 2I3ZA 1HT1E 3LBYA 4KMRA 2CNOA 4WI1A 1ZHHA 1L5KA 4Z8XA 2O8BA 3DE3X 5L45A 3IPYA 3QIAA 1DKPA 1W73A 4F45A 5JTUA 1FMFA 5KSOA 3TBFA 2H1RA 2HEIA 3HQ4O 1JZQA 5C8VA 4K88A 4BU1A 4F3KA 2A1UA 3IP8A 4B9EA 3B7PA 2ECQA 1TC1A 2Q7OE 1UXGA 3VC3A 5EHZA 3AIOA 2FA9A 3AVTA 1CJMA 5A3VA 1GL3A 1GLVA 1J8MF 1JQJC 1B8VA 3ADCA 1TZJA 4QDUA 2CVOA 4DSTA 4F4JA 4OQMA 5EVCA 2JGIA 2RIPA 4UNQA 5DM2A 1YJCA 2WJVA 2QKYA 2X23A 1O8CA 2Q6LA 2DE0X 4ZDIA 1KYWA 2RSLA 5TEWA 1F2DA 4BV3A 4C03A 3BWEA 5JBQA 2QRLA 3LSTA 2A9VA 3A9CA 5CX1B 2EJWA 4UVDA 1BEEA 3NP9A 2ZKLA 1MGOA 2IKQA 1S3IA 3OWHA 1M8JA 3EC7A 3G9ZA 2JC3A 3D6JA 2ZR9A 1AOXA 5BYBA 5TQ0B 5IXJA 5AVKA 1YUMA 2R65A 4KQGA 3SN6A 1NOIA 1IDOA 2BFBA 3Q12A 3UWSA 2ID9A 4Z7JA 2VPPA 4TTTS 1OUMA 5B1YA 2ZCUA 3CW8X 1ZQ9A 2CZGA 3D6MA 3EC2A 4X41A 5GIPE 3QV2A 3M83A 3IQGX 3UXYA 3CX6A 5LLDA 3O26A 2YKGA 4ZOAA 3WWOA 4ARAA 3TQSA 1ZVJA 1GQOA 2QMZA 4F1KA 1WBJB 4UFNA 1H2RS 3BH7A 2FMUA 2XXJA 3UFXA 1FMTA 2CNNA 4ALLA 2YDYA 3DOCA 2HTEA 1M66A 2OZLB 4RD1A 3TI9A 4EJFA 1EUQA 4K28A 1AV6A 4PQRA 1YS9A 4L1KA 4D98A 4CKXA 4M89A 3AILA 3IKJA 3BHMA 4NJOA 4BJ3A 3I2KA 3O3OB 4E5SA 5C7LO 2ID4A 3D8NA 3Q72A 4P08A 3PYMA 1L4EA 3ANLA 4HS4A 1G6Q1 1T1EA 2ONCA 1YB1A 5ERGB 5IKOA 4BE9A 3GUYA 5LP6B 4II3A 3ABIA 2F1HA 1KVTA 4HC4A 4MR8B 1DIOB 3MYRA 3HUFA 4RLSA 4XOUA 2G63A 3PQ6A 4EDFA 1F4VA 4F60A 1PGJA 4F2HA 4BZZA 4HUQA 3I6YA 4PYQA 4AX4A 3KSBC 4B3TB 2A2ZA 2D5IA 2EX0A 3IE0A 3ANNA 4MARA 3TIFA 3ZNQA 1ZC4A 4C3OB 2G40A 3HO6A 5KREA 1OTHA 5C8DA 4MO2A 1O95D 2LW7A 3R5TA 1C14A 2RH4A 1FS4A 2R84A 3AW8A 3NHSA 4H0NA 4PNHA 4C1BA 1CUWA 2UZAA 4FYXA 4MGHA 4BQFA 5AM3A 5AW8A 2HJRA 1A8PA 4CG1A 4Z7QB 3EAQA 2AFVA 1YQDA 1TM1E 3R0JA 1G2IA 1P29A 3WFZA 2AJBA 2GF9A 2H4XA 3DMGA 1KI9A 2V0NA 4IJVA 1FQOA 4LRYA 2UVQA 5JRZA 1CUFA 4J76A 4IIHA 3SHTA 3O6VA 1VCIA 2WYIA 2GTIA 2Y1DA 3OCUA 3UGJA 2C20A 4AFNA 5AYVA 3I9FA 2E9SA 4IHJA 1CW2B 2ZUBA 4H31A 4KQJA 2LBPA 3L7OA 4KQ9A 3OQIA 3FHJA 2J6HA 2I80A 2QSYA 2JB9A 1V1MA 2WJWA 1UIMA 5K7SA 3IDQA 4OHBA 3JQ7A 1CQWA 3I1FA 4MVJD 9LDBA 1UJ4A 4JQSA 4TS3A 4OGGA 4WK0B 4ZT2A 4PSVA 1DDGA 2NZUG 1QAOA 3KZVA 4P53A 2OG2A 3T34A 1V3UA 1M1NA 2AXEA 2EEZA 4UZSA 3P19A 2AD1A 3PZBA 5EERA 5EIHA 1VIDA 4E5NA 5K0TA 1WLYA 2PA3A 1CY2A 3NKFA 3L92A 3O8RA 2R9VA 3EXHC 3ISJA 1Z29A 2AX3A 4IKOA 4LMPA 4OL9A 1MZPA 4YPVA 1E5QA 2CV1A 1V1RB 1P1IA 2Z98A 3JD3A 5B7NA 2CWWA 1QPZA 2ZRKA 2XZLA 5E9QA 2AK3A 3W1WA 4QOGA 1R3UA 4NBLA 3PFWO 2EGGA 4TRRA 1W19A 4RAQA 3ETEA 1T91A 2FG5A 2JATA 4FE4A 3OUTA 1L7AA 5BNZA 3MWYW 3VJKA 2YN4A 3AKEA 4YRKA 1DBPA 2HIMA 3CNOA 3AR5A 4BL5A 1NG9A 1DRVA 5TY0A 3ROZA 2GD0A 2PKCA 1Q84A 3WLNA 3R9XB 4RHEA 4RTMA 3AF0A 1R74A 1RE1A 3GFGA 3E7DA 2I2DA 5FOTA 2G0NA 3D7RA 3C5CA 4B4DA 4B17A 4HSGA 1R8QA 4KLRA 3RNOA 2IZ7A 1YZVA 2ASEA 3TG8A 1FFXB 1JIVA 1JZTA 3A7EA 4IH1A 3BFXA 4Z7NB 3IJPA 4CL8A 1H2BA 4BO7A 2J5BA 1S6YA 1KAMA 5JFOA 3T8YA 5EWLB 2O7VA 2FEKA 5EMJA 2XD9A 1X8LA 4AG5A 2ODQA 2R7LA 4JLPA 4Q02A 1D1SA 2VZ8A 4RF4A 3C43A 2OXTA 3K6SA 1O5IA 1UM9A 2H2HA 2Q3CA 3O83A 3P96A 3GXOA 4I1UA 4JJZA 4MCAA 4DG5A 5JZMA 3HG7A 4DQKA 2J0QA 8OHMA 5P8WA 5ALJA 2OGWA 5INTA 4OK3A 4FHCA 3BIWA 4HFMA 3E7PA 3T52A 3G9XA 2HHHB 3OU2A 3HJUA 3KZCA 1LDYA 2Z2XA 3TDNA 3IBYA 3PR3A 5IC5A 4NF2A 2FMTA 4CEHA 3ZY5A 3KV1A 1CY7A 3MT9A 4H1TA 3N1UA 4A1FA 3WHIA 1W47A 3U0BA 2HOQA 2VRWA 2XCTB 4IIDA 3QHQA 2QZSA 1MXFA 4YAJA 3SZMA 1QVZA 1LNQA 3NYQA 2HA7A 5A4MS 5ECYA 5IKPA 4C76A 5KU7A 2B8TA 1MABA 2H9IA 3OOWA 4CJXA 1XLTC 2IZZA 4R9VA 3EAGA 3DAGA 3HCFA 3QX9A 4CCWA 3QJGA 1K8XB 4NZOA 4YRLA 1GL6A 4KWHA 4F6RA 4HCJA 5JCJD 4TX1A 3AFHA 4JB0A 5C8XA 4O8ZA 3I62A 1G8KA 1G17A 1J9EA 1QONA 1BVRA 1QIIA 2VFAA 2ZETA 2OHHA 4NABA 4JI6B 3SSNA 3JATA 3MSXA 4HNRA 4JZYA 4D9KA 2ZPUA 4JT9A 5C37A 1SKQA 1ULSA 3RIYA 3K09A 2GYVA 4C6HA 1GT6A 1L8AA 2DWPA 1KSHA 2FR8C 2ZTHA 3ETNA 4HGZA 2NN3C 4JWKA 3RHZA 2JL1A 4BKMA 1EESA 1UKAA 1LTHR 3ZI4A 2IXEA 3ZV4A 4AJHA 4IWNA 4KAXA 4YDQA 2X77A 2B21A 1VMDA 2WZQA 4Y6OA 2FDXA 3ETCA 1DOAA 4D96A 2CFSA 1WABA 1GY8A 1TECE 1X1AA 5GY7A 3NATA 3OQBA 4H16A 1WQ1R 4XWKA 2PGXA 3JYHA 1M7HA 2ZR0A 3ICOA 5G3YA 2ST1A 4NU8X 3R77A 4ZA2A 2AMLA 1E1YA 3KFVA 4OKNA 4JB8A 1K98A 2XRMA 4Q3LA 5K8JB 4AKTA 2AJCA 4DLPA 1ACMA 4B48A 4FDUA 1MENA 2P77A 3EUAA 2FYTA 4BNHA 1N5MA 2I4RA 2JBAB 4N5HX 3OKPA 5HR5A 5KTYA 1KWGA 2X3YA 1BWQA 1GPKA 1CERA 2PUJA 2ZRCA 2GSDA 4DQ0A 2FE4A 4RK1A 2O0HA 1JDPA 1RBMA 1W9MA 4EGFA 3GGJA 3L9XA 1J39A 3WRWA 1PSDA 1CUGA 2BM1A 2DLDA 1A1VA 1GUFA 5GM1A 3GCWA 4YQYA 3C85A 1FRQA 2AOXA 4ETNA 3M6MD 3CH7A 1EDZA 1RAAA 2PWYA 5DRYA 1JUDA 3HHEA 4DA0A 5EIAA 5TMDA 1VPLA 1QIMA 3WKBA 2HYDA 4TTAA 5DM0A 3I5MA 4R8VA 4ESEA 5KX5A 4R41A 1B0AA 1ZI9A 3TAXA 1AQNA 3AWDA 5F2KA 4DJJA 3H5RA 2RBGA 5TB5A 4K9NA 4O4LA 4X8MA 3HJAA 3VQTA 4RQTA 4I2NA 2FKNA 5MN4A 1CSEE 2BFDB 3GLSA 4I4IA 1R00A 1PFQA 3IFSA 3NJ8A 1EUCA 4D3DA 4E51A 3V1TC 1EBBA 2W83A 4K05A 4RIHA 5FWDA 4FOPA 4ZGGA 1N1DA 1ZGAA 4KX5A 1W36B 3C3BA 1RPTA 4EK9A 2RD2A 3LBIA 1ZWLA 1QZZA 1Z0AA 2YWRA 3OLXA 1GCUA 4PFQA 4NMLA 3QG1A 4PN7A 4LCJA 2A0YA 4NLLA 4R9RA 5D3MB 4MR7A 5KPJA 2V55B 2XD4A 3V2UA 2Z6VA 3A70A 4ZOBA 3W5JA 1K4MA 3KQSA 4OUDB 2A5GA 3RWMB 4GX5A 3W4KA 4EHJA 1EFDN 1TF7A 3AC0A 4KO8A 5CYPA 2ZIXB 2WWFA 4GX0A 5AKGA 3VKVA 5HRCA 2QTFA 4NBVA 2AMYA 1NVMB 3RVKA 4G4SP 3WL7A 3LUPA 1X3LA 1XJQA 3MJSA 4EARA 2JPDA 1UBMS 1ZN2A 2RC6A 1E3IA 2KLBA 2X2OA 1UCFA 3NCHA 3OE1A 4H7KA 3S2YA 2CZQA 3I45A 1NVEA 2AX4A 1GTJ1 3NBQA 1DO0A 5DU2A 1SKBA 4EGJA 2PL3A 2EOAA 4PTLA 4E94A 4RVCA 3RFXA 1UBNA 4MGYR 1YD7A 2GPNA 4US0R 3TSCA 5JQGA 1CUCA 2II6A 3HVIA 1YOBA 1ZONA 1XTRA 1DDIA 3HCBA 4LFBB 5L7YA 2O6HA 1THMA 4JMPA 2V3CC 2IYSA 1V26A 4WK2B 3RLFA 2YHAA 5F77A 3C98A 3G9UA 2V7TA 4TWBA 2C9OA 4FVTA 5ALOA 4IIEA 4OXNA 4D0NA 2EW8A 4JLUA 3ZWDA 2BONA 4AY3A 3H1FA 2CE2X 2JS7A 1VB3A 2HR1A 1NQAO 2X58A 4R1SA 3EGOA 4X9XA 5GV8A 4BFYA 3DOJA 5IHXA 2OKGA 2HTFA 2WV9A 1RLTA 1TRHA 3KQWA 3NYWA 1K66A 2YWBA 3FFBA 2R5FA 4FTWA 1K75A 1P5HA 3K09C 2IT1A 5ALRA 1KJ9A 4YRRA 5E0KB 4A0GA 4C0JA 1L4HA 3CEPB 2P0YA 4FS3A 1SGWA 1MTOA 2NYAA 3HYTA 5GJCA 2FPIA 1UOPA 1NUHA 2V98A 2YXNA 2XVZA 4RXMA 4CE6A 2DCUA 1IJKA 4PAWA 821PA 1AHHA 1PHRA 1T29A 6YASA 3ASVA 1OREA 2BLNA 4TQ9A 4XWWA 1V1JA 2HRZA 1GQQA 1JAYA 1FXWA 4NU6A 5E2IA 1N0VC 3REGA 4YXFA 4WNIA 1IMJA 3KRTA 2HU5A 3DPIA 5AHWA 4TYWA 5KJ1A 2ATCA 4YNBA 4D9BA 1QZ3A 4UVEA 4CDNA 2REQB 1WTAA 2ZRGA 4WMLA 1C7EA 1ZYUA 3PFGA 2B6HA 4A3SA 1ADBA 3F1KA 3IQFA 4C4TA 2BLLA 3OJFA 4UUAA 1Y1RA 3CE9A 1UJMA 3OA2A 4JOSA 1X7WB 2PMEA 4EI8A 5B4UA 5ALKA 1RU3A 4W8HA 4DGSA 1WNFA 4L7VA 7REQB 1EDOA 1TLFA 1IY2A 1Z6YA 1Z7YA 2GKSA 2LD4A 1Y6QA 2ORIA 4H18A 5AD1A 1JG7A 2QVCA 4JP2A 1IZ0A 3TS1A 2EWMA 1GUDA 2D2XA 1K9VF 3H2ZA 3KBOA 5IASA 3UA3A 2HF2A 1IPFA 3I6IA 2I8CA 4EG6A 1LD3A 2HD4A 5J2UA 3GJ8A 1J2TA 3TLEA 1ZU4A 5FPKA 1G8AA 1KDYA 5EE5B 1EEXB 4FX5A 1DC5A 3DP7A 2FW7A 3LW8A 2QT9A 4UHDA 5ALIA 1MOSA 4TKMA 5B3JA 5B3AA 2JHGA 2PA0A 3NHWA 3O90A 4BE7B 3EZ6A 4U5QA 2QR3A 3PFNA 4G84A 4EG0A 5IK2D 5KVCA 3R6WA 3DH0A 4XDGA 3V2IA 1JFTA 2FEXA 1E6LA 1MZVA 1S2GA 5CNKA 4XSGA 3CZQA 4X93A 3R7FA 3GA0A 1CPYA 3STVA 3ZVLA 4G1VA 5ARDA 2ALJA 1UQRA 2HO5A 3A3OA 1RXVA 2R6AA 3FJ1A 4O02B 1T9CA 2XLCA 3ROTA 2XCLA 1F5NA 1UKEA 2QLTA 3QX7A 4J0JA 3PFBA 3QNMA 2ZRMA 5DNAA 1K0UA 1WULS 1Y34E 3P26A 4FP9A 2ZRIA 1OLSB 1YZFA 5TPZD 4BRWA 3EVGA 1SUPA 2C7PA 1Z5OA 2PZMA 3IJEB 5AJXA 1UMBA 3NW9A 4TQUS 3VDXA 3LC7O 5T41A 1CQIA 2DXIA 1CJUC 1FS6A 1JILA 2RJNA 1XBTA 5E1DA 3HB4X 4NVRA 2H0AA 4LZNA 4DYVA 1ARZA 2YMPA 1PFWA 1FXUA 2VSNA 1FU4A 4MQ4A 3SDBA 4DVJA 4X8HA 2O1XA 3TIXB 2SCUB 3VM6A 5LZ4A 5K4HA 1W4ZA 4XDZA 1B0UA 1DAGA 2AV6A 1F0KA 2BHNA 2YJZA 3KLMX 3L1HA 5KQRA 3THYB 5BPFA 3NUZA 3DMHA 1E3MA 2O8FB 1JEYA 5E1OA 1LEHA 5HQ3B 3JAWB 5EGNA 4Q9HA 4DL9A 2JFGA 4PZAA 2X15A 2YJ5A 2VHTA 5HCNA 1X1CA 5CFQA 3VX3A 3C4QA 3UJCA 1G8FA 3H5WA 3QUSA 4PWZA 1C7QA 2JLBA 1V8BA 3L8CA 4ZYWA 4C20A 2QRMA 3B82A 3UJ8A 3VTFA 4UXIA 2G1JA 1PL8A 1ZD3A 2E1PA 1Z8HA 2R86A 4YMHA 2G4VA 1Y7IA 5F3WB 2FDRA 2W42A 3OCYA 2H31A 1SFRA 4B3JA 5KSPA 3I3SR 4DR2B 5KYKA 1NSYA 3L4KA 4AY2A 4B82A 3EIXA 4JUBA 4URWR 3LL7A 2P1RA 2P2DA 2PCLA 3U4IA 3W9SA 4GZ5A 2F9LA 1O8BA 2A5JA 1YB4A 1NNLA 2VIIA 3WHKA 1X7ZA 2VC2B 3F5QA 3CVOA 3FVWA 3OHSX 2JH8A 3D64A 4QDJA 3NO4A 4MLPA 2G5TA 5EMHA 3T9AA 4DVGA 4ZIRA 5ARBA 2AW5A 4K87A 4N0EA 2D5CA 4Q1VA 5C9ZA 3QM1A 2CV0A 3L5KA 2PTHA 4IHKA 5H82A 5KMGA 4QSHA 3DJYA 4K81B 3EQ9A 1D6JA 4EB8A 3LT0A 3MWEA 5E2BA 4ABYA 2OAQ1 3SLKA 4RM3A 3RJZA 3BQ9A 4CLRB 1JLLB 1C81A 1LGYA 1SRQA 4PPGA 4HPWA 4P7BA 3IR5A 1C29B 1O94D 3ZDZB 1ZLYA 3PPIA 1MF7A 4RF2A 2GYYA 1X77A 4HV4A 4GI7A 3QVKA 5CA0B 3JTMA 2EFYA 4UW9A 4HZGA 2WSLA 3BFJA 3NM6B 2CVHA 1QKIA 4AO7A 3C3DA 3CMCO 4Q05A 4A03A 2GJ9A 2LPMA 3QEMA 2WTXA 5DN6D 2JLWA 2R48A 4TGLA 3COVA 4E5YA 4FCWA 1AHPA 1V16A 3ZHVA 2EZUA 2EZ9A 1MH9A 1YGYA 4YDRA 2IGTA 1DNPA 4MGIR 4NE2A 2Q5FA 1NYQA 5EKUA 3SOZA 4R05A 3Q98A 4ND7A 4IXWA 1OWMA 1Y9ZA 2QMQA 2WUEA 5AUPB 5CG2A 5IJ9A 1N32B 2F8TA 3RRYA 3HXOA 3TE6A 3TOVA 1GWNA 2AEMA 4DBLE 3FROA 2AQHA 3ID6C 2G17A 2ILTA 2XTMA 1T0UA 2IF0A 1W30A 3C1TA 3H8SA 5LP6F 5EJ7A 2BR3A 1D7OA 1ZL2A 3F5MA 4ATNA 5UKDA 2ZREA 3EVFA 2DBVO 3ODPA 1UBHS 4D4GA 4Q9LA 4J2OA 2X5KO 4MW5A 4TTPA 3VMMA 2W2KA 2ZZKA 2PSEA 1N2IA 3JASB 3MVEA 4N03A 4U4AA 3AETA 5CA1B 4QRHA 5AVVA 2ZJBA 1YK0A 1Q21A 3LHIA 3PDHA 3DUWA 1PW5A 3M6UA 1RAEA 4MK4A 3CZCA 4X1YA 1MOQA 2HSWA 4N7MA 2B9VA 4XM0A 4NOJA 5BWCA 5D5HA 2J0EA 5EZYA 4UTOA 4WNCA 2OY0A 1XZGA 2H17A 3FDZB 2ADMA 1TM7E 4HVAA 4N8SA 4RMHA 4L7QA 3D7MA 3WLTA 4E31A 2QYTA 2DFPA 1FSFA 4J0HA 1HO3A 2VPQA 4LA4A 2XZTA 4IMJB 1SKYE 5ED0A 5JXHA 4ND2A 1A2BA 3L6BA 2HSEA 4KO4S 2E4YA 3IAUA 4ASUA 4EO9A 4UCQA 1VFPA 4AZ0B 1A4RA 1FLNA 3HBLA 4J7UA 5HCIA 3KT8A 3RUDA 3V80A 3VJLA 1BKSB 1HY3A 1NQWA 3FKSA 4TXJA 4PC7A 2FKAA 2Z2YA 4ZTUB 2C9CA 4RK5A 3ZDEA 4CV1A 3R09A 4D8VA 4OB8A 3S0JA 2CYCA 4B6GA 3CMMA 4LECA 1RJWA 3Q7TA 4FQ8A 1VIMA 3F78A 4BKQA 2VA8A 3C48A 4U7PB 5LYJA 2BISA 2PZKA 1EHYA 3HSYA 4UOZA 4WLNA 5KDOA 2ZTSA 2I55A 3A9RA 1UXIA 2QVXX 3S2IA 4OMFG 4EFLA 3CNBA 2FX5A 2ORYA 3QY9A 4UVGA 3WAJA 5L3SA 1RQ2A 2OBLA 3DZCA 3V7WA 4I3FA 3F7OA 3SMQA 5ALXA 1BMTA 3O4HA 4N3NA 4INOA 4ZP1A 1MIHA 2AG8A 4N5IX 2CLOB 5FCDA 5KSZA 3II6X 4B4VA 2W11A 1MAHA 2Q3LA 2WDZA 4QDOA 1KR2A 4XTRA 1ZMXA 3K73O 2H1VA 4IIFA 3RSQA 1O1YA 1P2UA 1UBJS 1WRBA 1YRWA 1R16A 5T4EA 3C8HA 2GLXA 2Z6UA 3FOAA 4ZVUA 4NNPA 4AZTA 5CHEA 4LJ9A 5LA6F 4BBPA 4BFTA 3CF2A 2GCNA 4XLTA 1D1PA 1I6WA 3LNCA 3PNYA 2QUZA 2WYOA 2WUGA 4CGYA 2DKNA 3R7NA 1XZCA 5AKEA 2PDAA 1G3UA 1KZHA 4IRXA 1R27A 4D4IA 5AFSA 1D5CA 1E2UA 3A2NA 3BE5A 4QLOA 4MSUA 2VYND 1WS6A 3FOCA 5BSWA 1C3EA 3ZLBA 1GAWA 3PP8A 1N2JA 3IV7A 4OB7A 3TLGA 1ZVQA 4BCDA 3TB6A 4MV4A 1I5RA 3U13A 5AI0A 4HLQB 2E3JA 3ZWOA 1JSXA 4PYLA 1CKEA 1DFGA 2EFJA 4QVKA 2C7OA 3SDZA 1NLUA 2P90A 2RG1A 3P9NA 2JBWA 4GLBA 3BL8A 1R4MA 1N6IA 3DFMA 4XAQA 3NV9A 2DRIA 4IM7A 2OK8A 4ECAA 1JMKC 3TTWA 1G16A 1P9NA 4DA6A 2JI7A 3ZWXA 4H1WA 1XTSA 3JQRA 4NL4H 5AW3A 2IPNA 1KEZA 4Y2HA 2FJPA 1L3BA 4CG0A 3QBTA 4DQDA 1U8CB 4EBFA 4EZIA 1L5OA 2C77A 3VR2D 4YRZA 4LQCA 3V6LA 1E5LA 1R6TA 1UQUA 2NU7B 3DBRB 3VOTA 4CFZA 1JYEA 4GS5A 2GCPA 3CVJA 4MYDA 4QEZA 3ZEIA 2VF4X 2X19A 4DARA 5A7HA 2CVQA 1WQ4A 1V7ZA 4AP5A 5AM2A 5CFLA 3FPGA 1K7FB 1TQ6A 4BUZA 1SA0A 4BMOB 4FFWA 1V7CA 5GONF 5IW8A 1BX3A 2FR0A 3KWJA 1DC7A 4GZLA 3TD9A 4OLAA 4FZJA 5ALFA 4ZAXA 3IDFA 4Q6WA 4BTEA 4Q9NA 3VZQA 2PZFA 2GK4A 4JQZA 3PJDA 1Z4JA 3U7GA 4PRKA 1XTPA 2V54A 4BOYA 1PYOA 5I9NA 3W8EA 4HGQA 3HRHA 1FY2A 2EJBA 3KEOA 3LZ6A 4QYMA 4G1UC 1KI6A 1E3QA 1M1UA 4HQRA 4M2LA 3X0DA 1T9DA 3BSFA 4KQHA 5SZJA 4LFAB 4M22A 3TLZA 1S0UA 3TCNA 4UJ5A 2J3EA 2J41A 5IN4A 1SUIA 4PFSA 4PGGA 5IJWA 2NT3A 4GX2A 4NXNB 4CM5A 3BT7A 1TADA 4Y8VA 3O31A 3CYFA 1Y3DE 3MWDA 4MROA 4HXYA 3VKFA 3ER9A 1CP2A 3ZU3A 1TTTA 2YFHA 2EKPA 3CH5A 1KJ8A 3LUAA 4CETA 5IEJA 4QHYA 4YS6A 5C5IA 3FJOA 5I7HA 1O95A 4G23A 4FD2A 4LXYA 1CZLA 2AKYA 1L7RA 3WOHA 3VYSB 1YAHA 3I92A 4H6PA 4M0KA 4BBAA 4EHFA 2PUEA 3MS7A 2HA0A 3I05A 3MGBA 2DKOA 4X7PA 1MX5A 4PLVA 4QXQA 4X91A 2WKQA 5DXFA 1B4DA 2PD4A 4G25A 4CV3A 5FKJA 4EYKA 3FNIA 2E85A 3TL6A 1GCAA 4M1KA 3GLVA 1LZLA 4LY0A 4XCXA 3UENA 4I4CA 1NVWQ 3QMVA 1KSGA 4R51A 5DTRA 4GYYA 4Q3NA 5EMMA 4UEQA 4MUJA 2VT2A 5THXA 5G0TA 4JI0B 4KQCA 1NF9A 1TJ3A 4Q00A 3A6FA 1J0CA 3HP7A 4OSPA 4LSMA 5D51S 3IMCA 2G80A 3A1VA 2C4MA 4OBXA 3REOA 1RPNA 5B1EA 3M2PA 1T8PA 4EMSA 5C1BA 3WS7A 1F0PA 4MVJA 5FA5A 2UAGA 3IUYA 1JNYA 2FZEA 3D8BA 1IXRC 5SY6A 3AKYA 3WG9A 1TA9A 5TS3A 3ANSA 3LT4A 3X1ZA 2HQSA 4UBMA 1EZ4A 2ZRLA 5ADHA 3IO3A 4HWTA 1COWD 2QVYX 3TNFA 5CBPA 5BOVA 4Q6BA 3NM4A 1CULC 3C3AA 3LY7A 4GMHA 1F6BA 3BG5A 4IJ5A 1WA5A 1K6IA 4HLNA 4K40A 1TKBA 2VPWA 4EECA 3SEQA 1IE3A 2C0CA 3MPUA 2GXQA 3EW9A 3K9LA 3KR0A 4F97A 3F6PA 4ZEMA 2BGUA 2QROA 1FX1A 1W88B 1JXMA 2OECA 4NU0A 3V7FA 3LHSA 3U7QA 2Q99A 2V7EA 3ZCXA 4JLJA 2V1UA 3HTXA 2VAPA 5KTMA 2JANA 4LOIA 3T5MA 3OFND 3OIYA 4OGKA 3GFPA 1X2EA 3OCXA 5B37A 5THKA 1F8FA 3EG5A 4BWYA 4Z0NA 4MDFA 2UXBB 1RJGA 1E6WA 1JDBC 2RKBA 4F72A 2HK7A 2H9AA 3KE8A 1PFGA 3DCYA 5ER9A 1JR3D 1PWXA 3CRVA 3U61B 2OD2A 2JF0A 2QUJA 4TTJA 4TZ6A 2VF5X 2ON6A 1H9BA 1VJ5A 4RANA 1OGJA 1TMOA 3A25A 3AEUA 1E5VA 4OJQA 2VLBA 1PT5A 1KWKA 3SQLA 1KJNA 3OOJA 1FP4B 1RACA 2P9CA 4C9BA 5KSYA 1DADA 3O9ZA 2OCPA 3PXUA 3S1LA 1KI3A 1E7WA 2KBEA 3PPWA 2QENA 1A4XA 3HC7A 3JYLA 3R4CA 2ETVA 4R3UC 1RWMA 5BN5B 5SV2A 2ZBPA 4CLXA 5KYYB 3BE8A 1I80A 5L95A 1BXRB 2EHDA 1N34B 4WN3A 1AKQA 1QYXA 1XDSA 4JUFA 2GDZA 2VTBA 5LOVB 2WWYA 1AG9A 2DFTA 3E18A 1NMQA 4QGFA 4QQ8A 2JARA 4MB0A 4IJQA 4DCJA 1TLTA 1AKVA 1Y1SA 3KS9A 4TRMA 1LSSA 5ULLA 1GVNB 3KR1A 4CT0A 3EA5A 4GLJA 2XKKA 3OLWA 4HUTA 5A4IS 5KTPA 1SXJE 3HBFA 1IZYA 1TK9A 2ZSHA 3K8OE 5JCJA 3H5OA 4LHSA 1H6DA 5AQ1A 3UWPA 2XOXA 3EFOA 3L1JA 2NSDA 3CWCA 2R1VB 1KBOA 4CQLB 4CR6A 1WPRA 4F6LA 3TZKA 5TLSA 5LQUA 4PZLA 1O95C 5DE3A 1CJCA 2VDWA 3G82C 2BDUA 4NE7A 5FOQA 3X1XA 4YRGA 4RV5A 2IS1A 3PSAA 2C5SA 3SICE 2RGNC 4DIKA 1G19A 3F8SA 3OQNA 3KPVA 1BXGB 4HRVA 2NX2A 4N7RA 2WTEA 1N0UA 4N7JA 1FK8A 1D09A 4QQKA 2FF5A 3BDVA 2I1VB 4Q82A 4ZRMA 4F3TA 4LWOA 3N2EA 1F6DA 5H3LA 2X4LA 2WYHA 3HYLA 1GOTA 4LDRA 4CTNA 1NFRA 5AIAA 5FBWB 4XCQA 3SC2B 4F1JA 3UNXA 3RSGA 4C6RA 2HK6A 4YALA 5CPFA 3N2NA 3PDCA 1JQLB 3EJ6A 5C0OE 1XMJA 1I2MA 1M2OB 1UR5A 3L7MA 1C3OA 4PW0A 4WD3A 4J6FA 4P38A 4ZO8A 2HMAA 3L0SA 3RRNA 2HHJA 2R11A 3Q5DA 4G0YA 1ZRMA 3DLTA 3BZWA 1L1FA 5FWYA 4U8GA 3EJWA 2OAEA 5HK9A 3WWPA 3G89A 2IEYA 2R6GA 1QOZA 3HBAA 4O4HB 3TBHA 3W5IA 1Z73A 2HPZA 1GV0A 1G6KA 1S2DA 3E48A 1F2VA 1G20B 4DRXA 3ZLVA 1X80A 5CT8A 1ZFNA 5BSVA 3WYEA 2HMWA 1CQJB 1Y3CE 4BO5A 2YTZA 2Q9UA 3QYPA 1YXMA 4IEEA 2XYPA 5HF5A 2JGKA 4TWIA 2G0AA 1XEWX 3HKDB 2I6GA 4P36A 1FTSA 1A9QA 1XEWY 2CXHA 2ZI5A 3CXRA 2ZBVA 1EB9A 2ZU6A 3NC1C 3RBVA 3O82A 3TPCA 3W1VA 3PXAA 4GPD1 2HN9A 3VHQA 3T7IA 1XD9A 2QWXA 1R6DA 4ISBA 1BVYF 4Q24A 3TOSA 1C0EA 3PRYA 2CVZA 2NIPA 3IVRA 1JEAA 5CU7A 5TQ2A 2BT4A 4GQBA 5AXCA 3DTVD 1NW6A 1VMKA 1SZDA 2R7KA 2UVPA 3DAHA 4YIHA 4OO3A 5HX7A 5IABA 3GGCA 2FW0A 2W2VA 4W7HA 1BS1A 2C2YA 421PA 1RAIA 5K6TA 1SUFA 5BVHA 2FSVA 4RBNA 3DG9A 2HK8A 3GAZA 4RZSA 2CXPA 5D1NA 1BH6A 4MVJI 3A58B 1SCDA 2L82A 5CBKA 2C8KA 4W82A 2WJPA 3EXG2 2GPJA 2WTNA 4CM1A 4MWBA 1ULUA 1ANKA 4PIVA 2PH7A 5REQB 5ISMA 7GPBA 2RONA 4V2UA 3GEIA 2ZWAA 1E5TA 3L7BA 4IHQA 2VUSA 4JVSB 2DSNA 3JQ8B 3WOVA 5CHYA 2PL9A 1PGPA 4WHMA 3UWOA 4QGHA 1A0OA 1SHUX 1L9KA 2G1KA 3EIWA 4GBED 4AKEA 1KZ1A 3T7CA 1XXLA 4ZREA 3MGAA 1CZHA 1S3FA 1CDDA 2GPAA 2MU1A 2PUWA 2Q5IA 2WKWA 3CUVA 1LB1B 1ZEMA 4JUDX 4XVRA 4PO3X 2X5OA 3S2ZA 4QLAA 4ZO4A 5KOHB 4RF3A 1UJ5A 1OILA 1CJKC 4OYRA 4RVGA 4NOLA 3BAZA 4N65A 4RPHA 1SMKA 2XYHA 1A8HA 2NTNA 1TYDE 5BW8A 2JJ8A 2J5RA 1PYGA 2IY8A 2QJWA 3BFPA 3HUEA 1JHVA 2OB1A 1RHJA 1NN3A 2OBFA 3OQPA 4MRAA 4PAQA 4Q1FA 2XRFA 1Q95A 2H1SA 4IEIA 3GAFA 4D3ZA 2BKAA 1SCAA 3H2IA 3M6FA 2OYCA 4DXHA 1QYRA 3C14C 3C24A 3WGUA 4G26A 2PR2A 4KTVE 5C34B 4NG4A 1CUSA 3MTEA 1QR6A 3PNKA 5BSKA 1FVHA 1XZKA 4UHHA 4Y2RA 2R00A 3IMFA 3S7ZA 2ZB7A 3G1WA 3LQ1A 4H15A 1JSRA 2C9MA 5LR6A 1ESEA 3WZ2A 4FDAA 4OAQA 3FCSB 4CIVA 4GSLA 4CVNA 2WFZA 4Q9JA 4CMHA 3PUXA 1Y9DA 3PE4A 2XOKD 4M46A 3JALA 2YCLA 1JQAA 1CVIA 2NV6A 1WMSA 2QZPA 5C8YB 5DSTA 3WGJA 4RQUA 3TTUA 3Q8XB 1JNXX 4GVLA 5LD2C 1CNFA 2OM2A 2R66A 4B3CA 2D6FA 3E9ZA 4C3ZA 1ZEJA 1S9HA 2C0PA 2VBIA 3FKQA 1ZH6A 5HCUA 5LQDA 1FW6A 3LCRA 4WCVA 3JCZA 2AHRA 4CTKA 1FUIA 1HQKA 4J75A 2DY1A 1AA9A 3JWEA 3FIJA 4YJFA 1XZIA 5KTTA 1PTJC 3ZD9A 4BAZA 1EKXA 1SBIA 4OLHA 1DQZA 4UMEA 1KI8A 3B3AA 4DREA 3K9NA 2O2XA 1H66A 4MS4B 5EESA 4B0PA 2IS6A 1LPNA 1PJAA 2NU6A 4Y2UA 1KVQA 3ME5A 3RO7A 2NACA 3FYHA 2OV6A 3V1MA 1E9CA 5EP4A 3NBXX 1R8SA 4N0QA 4HO1X 4LQLA 3L0YA 4MR9B 5LQAA 3RYIB 2WSBA 4DYHA 2JCSA 3ZHYA 4F71A 4BBZA 4PNZA 3T4PA 4Q37A 4RIIA 2QGFA 4W5QA 3Q8KA 5AOCA 2ECFA 5IK2A 3G68A 5JH7B 3RFFA 4UTXA 1BJKA 5L3QA 2IQ5A 4Q03A 2H65A 4L4SA 2L17A 3BE6A 4R8KA 3IVAA 3AEQA 1SC6A 4GNRA 3GQBA 1HG0A 4BVGA 1NNEA 1GZ3A 2YXPX 4IDAA 3VBCA 2GF2A 1Q92A 2VJBA 3WLOA 3BF8A 3E53A 5KJ6A 2HMTA 1YCGA 1W2GA 1FRFS 1LUAA 2FSVC 3E3OA 4ZV4A 6ABPA 2Y1OA 5TPZA 1QB8A 3KCQA 4JP5A 5LKAA 2B20A 2PX3A 4MGEA 4TL6A 4YJ3F 1EFRD 4PGFA 1XCPA 3EOBI 2E5FA 1HDYA 1I9GA 1JQDA 3QZUA 2G1AA 1QF9A 2VNKA 1QIHA 4TPKA 3K96A 2EKLA 1UDXA 1L5HA 4IF4A 5BN4A 4ZMRA 3BMQB 3K8QA 4MRSA 4IF6A 3CIOA 1XMPA 2OD9A 1N9ZA 2ZUTA 3WIOA 4KH0A 4UHJA 3LA8A 1I24A 3U31A 1VHQA 4L9WA 4DR3B 3KTAB 1I6MA 3GEGA 4WZ6A 1JDJA 3LM8A 4FFRA 4X8LA 2G77B 3BRCA 1M6VB 2QZZA 3QKWA 1P3DA 4QARA 2QG6A 1Y7HA 1XKQA 5AVXA 1JFFA 1X9HA 1M0SA 1QCCA 4URYR 2D13A 3W3AD 2HDWA 1E0JA 1NMZA 1KZYC 2G04A 2IDZA 2R2AA 3FYTA 3OP4A 3P2JA 1KQOA 4L4UA 4LZWA 4ZI7B 2EDCA 2HBQA 1QQ7A 1T9BA 1U1DA 2RHMA 3L77A 3HFRA 4QYWA 2R8RA 3GGDA 1YVRA 3BMOA 4XRRA 4O4JF 2HXGA 3VPAA 5DNVA 2W6OA 2WHRA 1T4DA 3H8JA 3UW3A 3MK31 3VYRB 2A1IA 1IY0A 2E0IA 3QPBA 5JJIA 4D74A 2OHIA 1WXDA 1QRDA 4KGZA 2HO4A 4GF5A 4MEJA 2O59A 3H16A 1AUPA 1P39A 3N8KA 1E6KA 4P22A 3LT1A 3DM5A 2OHJA 2WW8A 3LD9A 4L4XA 5BPHA 4JS0A 4Q9DA 3VU3A 3WB2A 1XDWA 1PS0A 3LXMA 4KC0A 4R2WA 3ZWNA 2WAYA 4RYLA 2JEYA 1YT5A 3CN7A 5I4BA 1JQ5A 4N18A 2QAJA 5M2QA 2ZZNA 3LZCA 3RWOA 1F8GA 1OYWA 4QJ3A 5IM4A 3M1LA 1HNXB 1SXGA 1ZIPA 2ACWA 2PH3A 2WE8A 2AEJA 2OV4A 2C2WA 3SJUA 1XALA 4ZOLF 3GP5A 1FNDA 1KJZA 2BTQB 1ZNWA 3IP3A 2EFGA 4C4AA 4MI9A 4Z9AA 3HYCA 3AEXA 4XIIA 1JXOA 5FADA 2C00A 1L4UA 3VYTB 4C0AC 3WSTA 4YLYA 1DX9A 4UU1A 3QVWA 4EPYA 4KDCA 1IXSB 4Q1DA 2HCBA 1NVBA 4TMTA 1QKKA 3ZHBA 1DQNA 3FB4A 5DNUA 1NFFA 2SKDA 2VPXA 1V8PA 2PS9A 3HSKA 4TV9A 4JVNA 3TB4A 1IZZA 1RKVA 4Y1RB 3JQQA 4TSFD 2BC9A 1DAIA 3K15A 4HX9A 3KLPX 5DN6A 4JBLA 2DZDA 3KKMA 4CUJA 5IVHA 3SP1A 3UJ7A 3KWFA 3ZU4A 2QD3A 1SY7A 2J9ZB 3ZWCA 3GMTA 3VGPA 5EHXA 1AKMA 5K05A 1DCMA 3WP0A 1RWKA 1C0KA 4R0NA 3OTQA 2QUAA 4ER0A 5TT0A 3BVPA 2PU5A 5AHXA 2ZG6A 3B5IA 4MQLA 1ZNXA 4PLHA 3HNOA 5HIAA 5C5DA 3EZXA 2J9XB 2I1WA 2MINA 1RI5A 4CMIB 3M6IA 1YQQA 4TV8B 1NHWA 1OVGA 2WM3A 2Y1EA 2EFDB 5DNCA 3WIUA 4EKIA 4RDHA 3V3KA 1DG3A 3BRQA 2OGUA 2QN8A 5BR7A 1DAEA 1YR7A 2IU6A 3IQWA 3T3IA 3DQQA 3TECE 2FG7C 3GT7A 5JVDA 3NP7A 4LKRA 4GZMA 3VSAA 4EGQA 5SYMA 4XJTA 2XGSA 2XUIA 3PUYA 1NW7A 1T36B 2OE2A 2BM8A 1RC0A 5BSUA 2FPWA 3H13A 2L69A 1DPGA 3LY8A 3NEPX 4HXEB 4HP8A 4UVIA 5DHFA 4O1IA 4FYKA 1VP9A 1QIGA 2ZTMA 3ORSA 1SWWA 3ROEA 1RDFA 1HZZC 2XB8A 1F14A 3FETA 4LXQA 4MMYB 4AUMA 5AK6A 1VMEA 3R7AA 3RR2A 1UPBA 4L6IA 4E3ZA 1KJWA 5FI3A 1EXDA 4NJMB 4UTPA 4M0DA 1PWEA 1MORA 2FZGA 2P3LA 4F2GA 4WN9B 2WWTA 2MT9A 2ACKA 3L7IA 3MRXA 3NWEA 2H7YA 2HQRA 3G5MA 4AF8A 1P7CA 1NAHA 1NL3A 1ZNZA 3DULA 3LDHA 4GOKA 4ZYLA 4G0XA 1N33B 2O8CA 2APJA 2C4WA 2YASA 3ED1A 3A6PC 1J90A 2BUBA 3F47A 4LUCA 5AW0A 1EG2A 4CEJB 5AJTA 1K8YB 3PDIA 1ISGA 4D9MA 1VPVA 4KMMA 2A33A 4CM9D 2ZK7A 3JD2A 3V8MA 1JBEA 2P4UA 5KOJB 1RWVA 4BP3A 5LQSA 1VLQA 2P2YA 5A3JA 8GPBA 5EIEA 1CVRA 1QNLA 1FDRA 2PGOA 3L6EA 3LRPA 3BMNB 3VU9A 3M49A 4OM7A 1X39A 2FX3A 2FEPA 2JAUA 1ZISA 3FYDA 3GEMA 3NBAA 2IBSA 3A2KA 1NC1A 2OCKA 2CNWD 4LNAA 4RHFA 1UBLS 3MT0A 2ZIZA 1UKBA 3O8QB 5GIOE 4XRGA 3GGSA 1SKUA 1FSSA 1CIJA 1UBTS 4O63O 3TTSA 2ATXA 5AVZA 3VGJA 1ONPA 3HGTA 1KMCA 4QDXA 2CY0A 4LZLA 5FLEX 3AP2A 2W2XA 3R2JA 4WXYB 2I78A 1OFVA 1KU6A 3E8SA 3U19A 1SVUA 3ENVA 3ESZA 5AJYA 2P4QA 3BHJA 4G1FA 1QC5B 1V11B 5F73A 5CLFA 3KKQA 4RTSA 4MH0R 2NO4A 1DHTA 2J5QA 1YIDA 2VEOA 2ZSFA 3MYYA 3QVVA 1V5WA 3ASUA 3KVVA 2G71A 2HADA 3BDAA 1DEKA 3VNQA 2J46A 1E9RA 2VYNA 5G02A 3PICA 1S2NA 1O94C 5DW0A 1J8DA 5JNRA 3ASYA 4RZ2A 3KKNA 2JGRA 4IHAA 4YRNA 4CIYA 3R8XA 2AWNA 3EZFA 5MDHA 1JFVA 4HWOA 2R8OA 4EQZA 1B15A 2DT5A 1F38A 4OBBA 4ZAGA 4AG6A 4O59O 1E0AA 3T6KA 2PGDA 1H2EA 1G42A 1MW9X 4CN9A 2GZAA 2C9DA 1C0PA 4UCFA 1O87A 2Z43A 2BKVA 4YBZA 1ADGA 4V3CA 3GFBA 2QPTA 3ZJ4A 2O2EA 3G7UA 3OPMA 4OP1A 1T2VA 1YK1A 1KYXA 2UYYA 3GIWA 2HNKA 5HP4A 1JB1A 3KOXA 2E4XA 1QH1B 3FWPA 3X3HA 1OE0A 2QMOA 4BS9A 5EWMA 1D0SA 3VR2A 4LPSA 4RD2A 5L53A 3GCZA 3R9IA 4NP6A 1EGQA 5LOVF 1ILEA 4Q1AA 4PAOA 3EQ6A 1WHTB 2PGIA 2QE7D 1SVLA 2UYGA 3MCAA 2AUTA 1Z3CA 1UBUS 2WD7A 5LJLA 1A27A 3UH0A 4Y6PA 5HFJA 4BZXA 2O2JA 3F71A 3O8CA 5LMZA 1S2IA 4RD4A 3E15A 3RUIA 2R1UA 3PGXA 4LF5B 1NJ5A 4G1EB 5K2MA 4NENA 1B43A 3DB2A 3I01A 1RZRD 2EL9A 4QECA 4ZU3A 2VJDA 1Z68A 1MUUA 3B6ZA 2W71A 2C8VA 4JJFA 4Q7JB 1QHHA 3R1IA 3ZCTA 3WB0A 1JV2B 3KR2A 3PRJA 2I4OA 4GX1A 1BWSA 5JHGB 1W36D 3IEIA 4U7GA 2GHQA 2H3EA 3AJ9A 4M6WB 3WIVA 2FEOA 1JSCA 1U0HC 1X86B 1AK9A 2X9NA 3D1LA 3L6OO 2VUTA 3LO8A 3P8ZA 4KIWA 4LSWA 2JJ2D 1GA1A 3R3HA 4OQXA 1DBWA 3LUHA 4J4BA 4S0ZA 1DQSA 2QHXA 3CG4A 4II2A 3L1VA 1E6MA 2JGMA 4IVRA 1IN8A 3CGGA 2XI4A 3ZG6A 5JZBA 4YEDA 3DYIA 4NYJR 4YJHB 1HDRA 2NO9A 1BE0A 2DTXA 3QKTA 4JBNA 4QAQA 2VP6A 4KKXB 4J3NA 1XKLA 5A7GA 1G6OA 3L4SO 2BFWA 3TLCA 2V74B 4LCBA 4XYBA 4RTLA 1O0BA 1FJHA 4OHPA 1NRJB 3H5VA 1V2HE 4YP9A 1GNQA 3T3PB 5BRJA 1LBHA 2PSHA 3LLVA 1CYDA 3D1VA 1JLHA 4K9QA 3NG1A 3VO9A 2CJYA 1H2FA 1JS1X 1QWOA 1WCYA 3FPLA 3CSDA 4P0PB 3WLSA 3ZK8A 1NI4A 2IVZA 1SUDA 3GJ6A 3O1JC 2VZ0A 2H7CA 2XPCA 4QO8A 1CZRA 4JNCA 3R7WB 2AS0A 3GRAA 2CB0A 4JAVC 3W9BA 4EHKA 3OPYB 2OXEA 1XDZA 4S1PA 4PXAA 3TRHA 1KFCB 2B7CA 1OAAA 3AB8A 3C2QA 3ZW9A 5CCEA 5JSZA 5K0CA 1NE7A 3K1ZA 1NYLA 3OJOA 2CSUA 2KYRA 5ERXA 1SQSA 2AK2A 2FWJA 4IYJA 1XD8A 4KL8S 1I10A 1U7UA 4N0PA 4QBGB 4PQYA 2F8LA 1TM5E 3MWJA 4ZCLA 1WU7A 3ROPA 4CI0B 1YZTA 3FYUA 4YV0A 1N2OA 3JQPA 2BHLA 1EU1A 1FFSA 2O3QA 1PFVA 2ZIEA 3P2OA 3BK7A 4TN1A 3PLNA 4Q4AB 1YBVA 1IAQA 3BZUA 3MN1A 4EVSA 3OTHA 1RT9A 1K97A 1SVIA 4RS4A 4ZCRA 2O5EA 3VPBA 2BV3A 1G3QA 3DCJA 1M83A 3EGCA 4NCXA 1GNLA 5F2OA 2X9VA 1YMVA 3FNQA 1FQWA 4C30A 3T7SA 3LUKA 2BZ0A 1D8TA 3V42A 3N7AA 4CNBA 2FSGA 2WA2A 4FXPA 4QU5A 4M83A 2E37A 2M6KA 4RA9B 4J4TA 3QVSA 3IIJA 4I55A 4JX8A 3CT4A 4XYMA 3IIEA 4P35A 3WMWA 4E7OA 4E03A 1JKIA 3NBZC 3WR5A 4RULA 5A6SB 1COWA 1P2TA 3LGAA 1G9TA 5C1PA 2GB4A 2IIVA 4ZO6A 4GYWA 3WJAA 1CK4A 1AQYA 1PS8A 1RYBA 2O3TA 2VI5A 3AG6A 4K8OA 4KFUA 4XWYA 2JHPA 2JIBA 1M72A 4ZVTA 3LTEA 4R71A 2D3TA 3LQRA 4M9RA 5DHRA 2E6KA 2EZTA 3CUTA 4AKGA 3Q85A 1QRUA 3MZ0A 4FCVA 2X0JA 3OCJA 3GT4A 4UNIA 5B53A 3W7AA 3ED5A 1GDDA 3LRXA 3AUFA 3WGOA 2GX6A 3K6RA 3K7EA 2W43A 3AV3A 1QIEA 1TCAA 3OD5A 3QP9A 3R5SA 5D3KA 3WK8A 4CKWA 5CCBA 1XEXB 3DJFA 3OFNA 2Q0QA 3AMVA 3NTQA 4LDZA 3LLCA 4RJJA 4UDOA 2NU8B 5JEEA 4F2DA 2F6RA 4ZEWA 4M1MA 5KSWB 1EM6A 5GJBA 4H59A 3C6YA 4PR3A 2F64A 4KLAA 1JR3A 3THRA 4HMPA 4QO7A 2XQVA 4MVJM 2GM5A 1IJFA 2DVMA 4KE6A 5AHRA 4G07A 3IAS6 3V4FA 4A6XA 1XZFA 1J33A 1O7JA 1XR3A 5JO0A 2XZPA 3CZAA 4J0QA 5EKXA 4C0QC 2IHVA 2O0JA 1HEYA 2FMFA 4FINA 5FPYA 3U5TA 3H6GA 3OF2A 4LIPD 5FLKA 3WLPA 3HO8A 2JIQA 4AM8A 3IAM1 1G4AE 2QTNA 1MHPA 1DRKA 3DLAA 2I2BA 3IH5A 2X7JA 4G37A 5EKDA 3S2SA 3GRKA 1LDBA 3X2EA 1FDIA 1KMHB 4BLQA 4DJ5X 2M6RA 3KQKA 1HX7A 2BD0A 3UT5B 4QPZA 4O6VA 3C3WA 4MDHA 5TV2A 2YINC 2Z4SA 2RGGA 4X84A 1YTLA 1AGPA 4BQEA 5DYGA 1YSCA 2OO3A 4Q19A 4XASA 4CKEB 2X9GA 4ND3A 3NVMB 1SIBE 3AGPA 5K03A 2OGZA 1CY0A 1OMOA 2ZIFA 1Q7BA 4RCZA 3I4LA 1UPTA 3BXPA 1T1JA 2ZQ5A 4QRIA 1HPLA 5I5GA 4D8YA 3L8EA 4YFVA 2PYIA 5TR9A 4F86A 3FGZA 2X0DA 1JHUA 1WXXA 1N8TA 2J9GA 3DD1A 4S35A 3VV2A 4ND8A 4RA6A 4JI5B 1TYZA 3HR7A 3KAQA 5DMXA 1U9YA 1NUUA 1B26A 1NPTO 3FCOA 1G7CA 1D8AA 3FN4A 4FDLA 4YUYA 4KPEC 4GYKA 1BDBA 1OWPA 1KYIA 3BL6A 2IV2X 1TGVA 4K2AA 1KMIY 1NBOA 1GADO 1RQPA 2MR6A 1B2LA 3RTEA 4IINA 1H5NA 2ANCA 5I3CA 2GN0A 4R2JA 3INYA 3DVAA 1C30A 1GRNA 4EVIA 1IIBA 4N8DA 2E4ZA 3HKEB 2AJDA 3FYUC 1XVAA 1QMGA 4XUDA 3L8FA 4F46A 5KS2A 3IUEA 3TD2A 3UUWA 2GK7A 4MP6A 3AVWA 5FNVF 5B2EA 1ACLA 3DD5A 2H29A 3IRUA 4KB5A 5HIMA 4JZKA 1ZIXA 3ANYB 3NHAA 3DNPA 5JO9A 3ZZ0A 2CL7X 4B45A 1YONA 5IDQA 2G1UA 2E82A 1Q77A 4ZK6A 2JFHA 3N8HA 3Q1LA 1XG5A 3WGGA 4BX8A 5B1HA 2AH5A 3I23A 5JY6A 3WMXA 3H2HA 1TM4E 4RH1A 4CDRA 2XRZA 2QD4A 2VNAA 4WGFA 5CH5A 3AKZA 3B6IA 5IMBA 2XNKA 4UAVA 4BXOA 1ENYA 2WD8A 3AI7A 1SIUA 4CCYA 2UU9B 1F0NA 1RQRA 3B36A 3ZE6A 1TEZA 3GEDA 3F3KA 2YOFA 4IGAA 3PUIA 4F1WA 3I30X 3D2AA 1EE9A 3KUDA 2ZAGA 3ELWA 1HYBA 4M98A 1UDAA 3AZOA 1E3WA 3SDSA 2PS1A 1TF5A 1JHMA 4XWTA 5HF6A 4E5VA 4D44A 3HZZA 2WPDD 1Z4QA 3DTVA 1SU8A 4WY2A 4MRMA 1ZC3A 5FT9A 1CF4A 1USKA 2PJDA 2W93A 3STUA 4BLSA 5BUSA 4Z4QA 1H8HD 1KP3A 3ABSB 3K1JA 4ITRC 3K0AA 1LVGA 5TF0A 3OPNA 1GILA 1KYYA 1UOEA 3FY4A 2FCRA 3CUYA 1R88A 1ZPDA 3OAAD 4ZU6X 4BBJA 1L4BA 2Z08A 1M0TA 5AVJA 2HUPA 5EJEA 1AB5A 1FUYB 5CM9C 1X1QA 1WUJS 2GTHA 5HMLA 4HT3B 1T3GA 1L5WA 1Y7LA 1SUBA 3DEIA 3TQTA 4YQEA 3TSWA 1G8GA 1QNFA 2VR1A 2X14A 3AFGA 3GRYA 3JWHA 4Q01A 3MJFA 1G63A 4JK3A 4ITUA 3T35A 4BEVA 3P2EA 2Q6IA 4UFPA 4XDHA 3WADA 4HF7A 4DJAA 4FGUA 3CLRD 3QU2A 1I7PA 3M8KA 3AF3A 4DDVA 2GPWA 1QP8A 4UU7A 3G8BA 4QTXA 4V24A 5JCXA 2CK3D 3QI2A 2D1SA 1FS5A 3UPDA 3ORYA 5CFRA 1LJ8A 5A4AA 4MQEB 2NU9B 4UREA 4YI3A 1PQWA 2PEYA 2WWIA 1KVRA 3TQCA 4B7UA 5CNJA 1XDGA 5AW1A 2AN5A 4RENA 3L7KA 3TQFA 3M33A 1NW5A 4ZQFA 3TOXA 1W5BA 2FSSA 2WBLC 3H42B 4PF1A 4ZANA 4U39A 4BIMA 4LXHA 1VE5A 3W9UA 5DHSA 1Y3IA 3I6BA 4ITVA 1GYPA 1U8ZA 3KBBA 3B70A 5F7OA 3PXDA 3HB9A 3TAUA 5EJ8A 1JEOA 3ND7A 4PR0A 1IM8A 4X92A 3T7RA 1D4FA 2QM0A 4M0FA 2RKOA 4ONEA 2H5IA 3QPCA 1FUEA 1JR6A 2XWPA 1V4NA 3L41A 3FFTA 2M9MA 4XUCA 1HE3A 1Z0DA 1G0OA 1FTGA 4D45A 3RC7A 4IQGA 3F7MA 1JQBA 1P6XA 5BV1A 3OSUA 5U4XA 5FPSA 2XOKA 1XVTA 4EJMA 5CDSA 3OUZA 1HR0B 2I9KA 1Z4LA 4BATA 1CJSA 2GNPA 2V96A 3LOPA 3F1LA 2OC4A 2ZT8A 1R66A 1XB2A 3NOXA 3Q9NA 1EHCA 4N3GA 2VSYA 1NUQA 1NZJA 3KZMA 4IJKA 4BZPA 1V8DA 4C7JA 1E7YA 1NT2A 2N75A 1Y3HA 4J43A 2P9YA 2C2ZA 4ARZA 1JMYA 1EJ0A 4KCGA 2I6TA 5AI9A 1II8B 3BGSA 5TMBA 2XXAB 2P41A 1Q11A 4FN4A 4RVOA 2J85A 3DV0B 2NVUB 2VWHA 3A4VA 1M1YB 1YOVA 4PU0A 3KJGA 1U0RA 1Y81A 2H5JA 3L3BA 4FUTA 3LTNC 5ALZA 3T5GA 4AUEA 3FPEA 3KHTA 3CVYA 1EK2A 3KLOA 1UIRA 4MAFA 1U8YA 2W2QA 3EYWA 3RU7A 2NYUA 3GJ7A 2B8EA 2XCUA 1Y6ZA 1G2QA 2YN0A 2HQ1A 3DO8A 3ESXA 3P2YA 1CS0B 4WINA 4A6DA 2RHCA 1LBTA 1JBKA 1T3TA 2FPKA 1SIOA 3HDYA 4RZUA 1UWVA 2YYSA 2XIJA 3MTQA 4FJ1A 5JWHA 1X7GA 2GN8A 1EK1A 2DU8A 3FGPA 2JLAA 4ZAZA 4IJ6A 2ZWIA 3JAMA 1ZWKA 2JGEA 5A06A 4MCHA 1KE2A 3ADDA 3G8AA 3OA0A 4A6EA 2Q27A 1M74A 2YV3A 3OU6A 4KO3S 1JVSA 3AM3A 1IIRA 1MC8A 1NXTA 3BRWD 5CX1A 1WETA 3GEHA 5GWXA 1ORRA 3KKOA 2I2WA 3T4XA 4HDQB 4JSTA 4CM4A 3SE7A 1T2UA 2BKEA 2GPTA 3CO5A 1IONA 5TQ0A 3DHEA 1G1MA 2ZJ4A 1K63A 2DUWA 3PFIA 4IJUA 4FDMA 3AI2A 4HRAA 3LYHA 1W49A 3MOGA 2A7XA 4ID9A 4BO9A 3AERA 3HP4A 4QNRA 4WCFC 4F56A 4IFBA 1KDRA 1R9GA 1OY1A 3DA8A 4XGRA 1MLDA 1R18A 2WINI 3W8RA 2ZXEA 2QD2A 1IOLA 1DVRA 5DWQA 4YAOA 5DNYB 2ZJ7A 4EPXA 3KQUA 2HF9A 5SICE 3W4JA 5CT5A 4DZTA 2MSNA 5LQRA 2ET6A 5B1SA 1NMSA 2WP8J 4EEKA 4WA7A 3DOIA 1W35A 3NI2A 3GW8A 3BILA 4R1OA 2R0QC 4COKA 3CWQA 4L0QA 4RCVA 4BWFB 3C7CB 1R10A 1XMSA 3PLAE 3UXEA 1IZ7A 2D00A 1E2LA 3A1FA 2VT6A 1LWNA 3W3AA 3KB8A 4GW3A 3SE0A 1CDOA 3VO8A 3ZGXA 2JG3A 2GYUA 5SY9A 2AXNA 3AVYA 1SZCA 2BEKA 4IO0A 2NUAB 1T5OA 1GCIA 1AN9A 4LDAA 4XIYA 5HILA 4CU2A 3U4QA 5LP6A 4MR8A 1TJ4A 4BC1A 2QN6A 2QU7A 3GVXA 3MCZA 3PNOA 1YL6A 2PNFA 3FRIA 3RC9A 3T9BA 1GIAA 3D8SA 1D3AA 4JBWA 1VSVA 5HQJA 2OCIA 1U0JA 5CB4F 5HK8A 1UMKA 2WU8A 4DKJA 4M7OA 2P9ZA 3UTDA 3CSUA 2Y3IA 3IEKA 4QOFA 1LBEA 1ZD9A 4LCEA 4YCSA 2RGXA 3C7DB 3DBIA 2D06A 4PAGA 1N8SA 1MTZA 1BFDA 3ZU6A 3NWJA 1XYGA 4X1KB 4JX9A 3P2KA 1OI4A 3I2GA 3D3KA 2WDPA 3USZA 3GC6A 4DTCA 5JAQA 5HM8A 5TIIA 2HWKA 3FOWA 4RELA 1BS9A 2NO0A 1DL5A 3IXQA 1OXBB 4G0PA 2O2YA 2AFIB 5TDHA 1HLPA 3GVIA 3QLUA 4EM6A 1C4WA 3A0UA 3C6KA 1Q7TA 3K92A 1U1EA 1A76A 5EFOA 1U1IA 2B30A 3S44A 2WT8A 2B1RA 2JA1A 5D84A 1T9HA 2C1ZA 3NDBB 1AT1A 1NQOA 1M33A 4G1BA 3KAPA 4KGXA 1SQFA 2OT3B 5CRIA 3RWBA 2PCJA 3SYLA 3ZVRA 3H9BA 4X00A 2XE7A 3EHDA 4IUDS 3LS2A 2MIIA 3M2TA 3N6VA 4XW2A 5FTLA 5H68A 4PPYA 2CD7A 4ILKA 3KYDB 1AGRA 4KNYA 1AZWA 3MUOA 4B4OA 4W1SA 3H9EO 1KRXA 3T1YB 3G1TA 5EJFA 2L42A 3SK0A 2N47A 3E7WA 2ECKA 1P2SA 2GBIA 3NTVA 3CX7A 3EUEA 4G4SO 4ON9A 4L8WB 4JGBA 4UCWA 1C9EA 2P2ZA 2PKQP 4HKTA 4JSRA 2C7GA 1PR2A 2ZUVA 1FTQA 3KJEA 1V1RA 2REXB 3FPBA 2FNAA 1O6FA 3K8ZA 4M8SA 4MHOA 4YA6A 3ROQA 3IPAA 1Y80A 2QS9A 4RVUA 4HI0E 1T3SA 1E18A 1NI5A 3ZBPA 1R5NA 4J94A 1PGNA 1QO9A 3G2HA 4WBXC 2XJ4A 2AMJA 2O0KA 1VIAA 3EVNA 4OM8A 3H9JA 3COSA 1IHOA 1P0MA 4Q34A 3VR5D 3R9XA 2VXCA 4R9UC 4DIFA 1TDJA 2QN1A 3ASZA 4Z51A 1QPBA 1R5BA 1K68A 1UANA 3ONFA 3H9UA 3HV0A 1E1NA 1QYWA 3N07A 4AG3A 4AURA 2OBBA 2NO7A 1FFXA 3DEZA 3KNZA 5LC1A 1ZR2A 3UF0A 4TYPA 1J2UA 3DL7A 3RRBA 3J81A 4HQ6A 2ZWOA 3KSDO 9GPBA 2HJHA 3ZXIA 1U3CA 1JG4A 1HXHA 3HGMA 4NEGA 3H8VA 4PS0A 1K4KA 3LQYA 2O8DA 2HJVA 3MTIA 4RESA 1AV7A 4MA5A 3QNUA 4TWZA 5CEJA 1HWYA 1Y3BE 1PKXA 3OZWA 3G6KA 4GGMX 3KD2A 2R8YA 4NHOA 4OD0A 4OIFA 1OLUB 1YI8A 1A7UA 2GZ2A 4J0GA 5IVKA 3DVSX 3BTUA 3SF8B 1EUDB 4B5KA 4IMRA 3H0CA 2J33A 1TU4A 2XDQB 2ZRQA 3RTCA 5I8PA 2AEFA 3D7LA 1QRTA