1ZJJA

Crystal structure of hypothetical protein ph1952 from pyrococcus horikoshii ot3
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
MVAIIFDMDGVLYRGNRAIPGVRELIEFLKERGIPFAFLTNNSTKTPEMYREKLLKMGIDVSSSIIITSGLATRLYMSKHLDPGKIFVIGGEGLVKEMQALGWGIVTLDEARQGSWKEVKHVVVGLDPDLTYEKLKYATLAIRNGATFIGTNPDATLPGEEGIYPGAGSIIAALKVATNVEPIIIGKPNEPMYEVVREMFPGEELWMVGDRLDTDIAFAKKFGMKAIMVLTGVSSLEDIKKSEYKPDLVLPSVYELIDYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein PH1952 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords hypothetical protein PH1952
total genus 88
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1zjjA01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1zjjA02
1TE2A 3L8FA 4KX3A 3QGMA 2YJ6A 1ZD2P 2MSNA 4Y2RA 3PCTA 4HYTA 1L8OA 3IB6A 4DW8A 3SKYA 3WK8A 4NABA 2AGVA 4UASA 3B8EA 3L0CA 5AVTA 1RLOA 4HGQA 2RBKA 5AK6A 5AM2A 2JAUA 4NFLA 2AMYA 5AKEA 3KDPA 4HAIA 5AESA 2P11A 2W4MA 1WZCA 1SU4A 5AW7A 5AHXA 2QYHA 1CQZA 3E8MA 1RMTA 2GFHA 4UATA 1L7NA 5AK5A 5AK4A 4HGNA 1U7OA 3ZW7A 3R9KA 2B0CA 1RLMA 1XPJA 2CFSA 5AKKA 5AVSA 2JGAA 3QXGA 2WF7A 3N28A 4Y2XA 2OA0A 5ALNA 2Q5EA 3EF1A 3N5KA 5AM5A 4BKMA 4EEKA 3I76A 2YMMA 3U13A 4UAUA 1Z4LA 2QLTA 3IJ5A 3BWVA 4C4SA 2G80A 1PW5A 4G9BA 1QQ7A 1XVIA 3NUQA 4UARA 1ZD4A 1FEZA 1J8DA 4IG4A 4AP9A 4B6JA 1Q91A 5ALJA 4G63A 1Z4MA 5AKGA 2JARA 2Q4TA 3QU9A 4XPZA 2RARA 1ZOLA 2C8KA 5AVQA 4BX3A 4CNQA 3QYPA 1NNLA 3ZTYA 2BDEA 5ALRA 5AKHA 3AR3A 3EF0A 3ESRA 4FFDA 3WKBA 1EK2A 1Z4IA 3ESQA 3AR6A 3WK7A 3ZX5A 1RKQA 5AW8A 3QNMA 2NO4A 4BX2A 1Z4PX 5AI9A 2EAUA 1SWVA 4L6AA 5AIBA 3WK9A 1VJRA 4DFDA 2ZBDA 4KNVA 4C4TA 1RLTA 4JDPA 4NV0A 1U02A 5IT0A 3UMBA 2ODAA 3B9RA 2W11A 1RKVA 5AVUA 2G08A 4RESA 4HGOA 3MC1A 3FPBA 2YFYA 4JB3A 3ZVNA 3SF0A 1NF2A 1J97A 4YCMA 5AI8A 1KYTA 2I33A 3UMCA 1O03A 4KNWA 3R4CA 3RF6A 3QX7A 4MWOA 4RETA 2ZBFA 2I55A 4UM7A 2G1AA 1Q92A 2C4NA 3L8HA 2P69A 5ALDA 2FDRA 4BNDA 1RMQA 2EATA 4L6CA 2IOHA 3UMGA 1TJ5A 4OD0A 1AQ6A 1RQNA 3DNPA 5E0OA 3ZU6A 5ALIA 2FEAA 4BX0A 2HHLA 2I34A 3MPOA 1RPZA 3EWIA 4YIKA 3WKEA 5AKLA 2HO4A 3FZQA 2C88A 3QU4A 1TJ3A 3NALA 3IRUA 4Y2YA 1WVIA 2GHTA 3CZ4A 4H1WA 1T9ZA 2WM8A 3AR2A 4YGYA 5ALWA 1L7PA 2G09A 5ALPA 3ZVLA 2YBDA 3SLRA 2RB5A 3WKDA 5ALOA 5AI5A 2DQSA 4UMFA 4KYTA 3TLMA 5AI0A 4DWOA 3QU5A 4BBJA 3ONNA 4C4RA 2C8LA 1N9KA 1ZRNA 3KD3A 3A1CA 1LTQA 5AICA 3WK5A 4AS3A 4J2TA 3NASA 5A3SA 4CF3A 3OCUA 3L5KA 2YJ3A 2AH5A 3PDWA 1Z88A 4DCCA 4J03A 5AW9A 3L0YA 4UU0A 2VKQA 1N8NA 2EARA 3KZXA 4NWIA 2B8EA 3OCWA 3W5AA 3FPSA 2IOFK 2JAWA 3AR7A 2I54A 5AM0A 3S6JA 3DAOA 3SD7A 2HSZA 4QJBA 3UM9A 2YY6A 3U7HB 2YJ5A 3OCVA 4UW9A 2NYVA 5ALTA 4ZEWA 2NO5A 3L1VA 2YJ4A 4HGPA 3A1DA 5AM3A 1YS9A 2YMPA 4CF5A 4Y2VA 2CFTA 3NRJA 3M1YA 4GXTA 5ALHA 2OYCA 1NRWA 1VJ5A 1K1EA 4EZEA 1ZJJA 4UM5A 2FUEA 2PQ0A 4UU1A 2BDUA 3L1UA 5IT4A 3AR4A 4FE3A 4Y2SA 2FI1A 5AW3A 4YH1A 4UMDA 4Y3UA 3U7FB 1O08A 2YMQA 2X4DA 4UMVA 3QLEA 3HYCA 2IYEA 5ALSA 4BEVA 5ALVA 4QQFA 3KC2A 2HCFA 4I9GA 4FYPA 1RRCA 2PR7A 1Z4NA 3OCXA 2YN4A 3OCZA 2ZG6A 1SWWA 3FGOA 4IFTA 3RFUA 3WK4A 4OCZA 4ZEXA 3KOOA 2B30A 2WHEA 1EK1A 1L7MA 2HF2A 3I6BA 3U7EB 2OBBA 5ALQA 3ZUPA 3U7GA 5ALLA 1F5SA 4YIHA 4NAVA 3ZX4A 3OPXA 4EX7A 3QUCA 3QU7A 4AS2A 5AVXA 4XE5A 2G0AA 1WR8A 3AR8A 3NAMA 2B1QA 5AM1A 5T41A 5A3RA 5AW2A 2OM6A 1CR6A 5AM4A 1U2SA 4I9FA 1YDFA 3WGVA 3E58A 4E88A 1XP5A 2IA5A 4Y2UA 3W5DA 3EPRA 2MU1A 1Y8AA 5ALEA 2B1RA 1Z4KA 2WFAA 1S2OA 3SMVA 5AVWA 3I28A 3J7TA 1Z4QA 3CNHA 5AW6A 2HX1A 2O2XA 3BA6A 1YNSA 5JJBA 2G07A 2HF7A 2WF9A 5AVRA 1LVHA 3NIWA 3VAYA 3ZWKA 1Z4JA 5AKXA 3QU2A 5A3QA 1U2TA 2FPRA 2GHQA 3N1UA 3K1ZA 3GYGA 4CF4A 1L7OA 4Y2PA 2GMWA 3AR5A 5IS2A 2ZXEA 3AR9A 1RQLA 5AVVA 3L0BA 5FP0A 3E84A 3ET4A 3MMZA 3E81A 1ZS9A 2Q4RA 4EENA 2R8YA 2IOFA 4Y2TA 1JUDA 5AKJA 3WKCA 4EX6A 4XQ0A 1TJ4A 2FPWA 4ZEVA 3W5BA 4Y2QA 1IWOA 2P27A 5ALKA 5ALGA 2BY4A 2FUCA 3HLTA 1QYIA 2HOQA 5AW0A 5AK3A 3QUQA 4EELA 2FPUA 3L7YA 3ZWDA 4MUMA 3B9BA 5AKIA 1YV9A 3W5CA 1ZD3A 3M9LA 3ZTWA 5ALXA 3U26A 2ZBGA 5AW1A 4UAVA 3OCYA 2R8EA 4BNDB 3P96A 2WF8A 3F9RA 1L6RA 5ALMA 4F71A 4YCLA 3U19A 1ZD5A 3DDHA 4HGRA 1TA0A 5AKZA 2ZOSA 2R8XA 4GIBA 3QUTA 4CE6A 2HI0A 3QUBA 5AKYA 4YCNA 2WF6A 2CN1A 2I7DA 5AI6A 2C9MA 1S8OA 1U7PA 3WKAA 5ALUA 2JAOA 4BYGA 1Z4OA 2W43A 3ET5A 1MH9A 5AI4A 2HEGA 5AIAA 3N07A 2D2VA 4F72A 2CFRA 3FVVA 5ALYA 4O8CA 3I1YA 1T5TA 4BEWA 5AW5A 1L8LA 3MN1A 3OTQA 1RDFA 1Z5UA 3SKXA 1RKUA 3ZI4A 1RC8A 3A1EA 3R09A 3ZVMA 2RAVA 3N8GA 2WF5A 5AW4A 1X42A 4Y2JA 4OFZA 5AVYA 4UMEA 4KX5A 2GO7A 1QQ5A 5ALZA 2FPSA 3WGUA 4KN8A 2O9JA 4L57A 3L8EA 1YJ5A 3ED5A 3L8GA 1VFPA 3PGLA 2B8JA 1QH9A 5ALFA 1WPGA 2HDOA 2PKEA 1QQ6A 4XOUA 3SHQA 2G06A 4PNHA 2AUTA 3KBBA 3WK6A 1ZRMA 4OHFA 2ZBEA 3D6JA 5AVZA 2FPXA 1Z5GA 2R8ZA 2B82A 3DV9A 3NANA 1T5SA 3A3YA 3FM9A 1YMQA 2YMLA 2P9JA 2I6XA 1RMYA 3PGVA
chains in the Genus database with same CATH superfamily
1SR8A 3QGMA 4Y2RA 3MMPA 4RADA 2XDYA 5I7UA 2PBRA 3I32A 2JJQA 2CUNA 5EXDA 3P9IA 1UODA 1NJ1A 2YXPX 3LPCA 3MJ4A 5DM60 5I7AA 2P2SA 4NABA 3H75A 1QVZA 3II6X 2HQOA 4PSCA 4PZ9A 1B76A 3MMNA 1D6NA 2Q2OA 5TRTA 4D9CA 4LDJA 1MB0A 1AKMA 3T7KA 5DASA 3WQSB 2WJ6A 1CULC 3LF1A 5FFFA 4EITA 1G3QA 3P9XA 2Y27A 4U6SA 4YRKA 1YTUA 2DHDA 3BSSA 3GVIA 3M6XA 3EFOB 1RACA 2FZCA 4P34A 1PNOA 5E7QA 3DB1A 4CV3A 3AHGA 2C1EA 1G1AA 2X8LA 3FKSD 1DBQA 2QWXA 2P2LA 1QFMA 2GFHA 4CKBA 1TU0A 5J58A 4Y9TA 3UATA 3BRQA 5AK4A 3VBCA 1NP3A 2XVYA 2Y3IA 1SVUA 3SHTA 2WQ6A 5K8VA 5E6RA 1PWZA 4AQDA 2J9FA 1RJDA 3CW2A 1PG0A 3DBHB 4G41A 2IH2A 3K2BA 2WJZB 1TMGE 4OHMA 3FPLA 1YE5A 4A5OA 1RWOA 1TAHA 2PQ2A 4LKOA 1NTOA 5DYTA 1KU0A 2VI5A 4RC9A 3P19A 3WLFA 4NCAA 1JA1A 1VYTA 2J07A 3OUTA 4QULA 3TRHA 4D0RA 2YW2A 1KKUA 1FFEA 4LECA 2VJDA 3ANLA 1NVTA 4PAWA 4C0WA 2QN2A 4LA4A 1UJBA 2Y1WA 2QYTA 4HQNA 2E4ZA 3L4JA 4XTCS 1PL8A 1LQUA 5JNUA 3PQ5A 4XQEA 4D74A 3CNQS 3JY6A 2V3CC 2J3DA 3D6HA 1J8VA 2OKGA 3RS5A 3AL2A 1FXUA 4Z53A 1G5RA 4UBOA 1CUEA 1JG4A 1W36B 3EMKA 2YWEA 4CTOA 1Z2PX 2GVNA 2BCEA 5KSYA 4L5AA 4Z1OA 4WN3A 5KOHB 3DA8A 2R85A 3OT1A 1ATIA 5KNBD 4KXVA 3I23A 2C9OA 2BDEA 4PLTA 4B7XA 1JKIA 4TSFD 2QI9F 3E5RA 1ZK1A 4NFYA 1I1QB 4B71A 5H3HA 1KMIY 1E5LA 5IH7A 2G5TA 4FDTA 2WFMA 2W6NA 2V58A 2H6EA 4K9PA 3ZX5A 1N2BA 2JGMA 2CF6A 4GDFA 1SPBS 2OG1A 4BO3A 3VDNB 2CHFA 1MOZA 3LECA 1P29A 2ERYA 1PK7A 3DT8A 1ESNA 4QICA 3EVDA 4W99A 4XYLA 5FA8A 3FMVA 2V03A 5A03A 2PRZA 1MA3A 1KR5A 4FFMA 1OYVA 4ZVQA 3U09A 4GP6A 3OJFA 2K4MA 3IP5A 1BWRA 3DMHA 1IONA 1Z26A 3JQEA 5IT0A 1Q3HA 3B9RA 2D7JA 1RJ9B 1WXFA 2D2FA 3TLEA 4O4HF 4XR4A 1RPTA 1V8ZA 2PLWA 4AJNA 4B2PA 1Z2NX 1N75A 4MMZB 3AK4A 4YRBA 2F7SA 1U99A 4CTMA 3GCGA 3HWRA 1FFCA 1NOJA 4XCQA 1H3NA 3N0RA 4FYKA 4TLCA 4YJ3B 3RVMA 4C29A 4M9QA 3CEJA 1XIVA 4DKXA 4IO0A 3G2PA 4DBVO 5A7GA 4DV5B 4PPQA 3RC3A 1CZKA 3QY0A 1OIVA 1K7CA 1KQPA 4RQUA 2AE1A 2JJYA 2ZRBA 4AU1A 4P9NA 4C6TB 4FDVA 3LDUA 4DZZA 4MDFA 4KI0A 2P69A 1FVFA 1VMEA 4A15A 2FZWA 3LX6A 2QE7A 1ISHA 5BQOA 3M5WA 2F59A 4PHTA 2VN8A 3C4VA 3EXG1 4ZZ3A 4JI0B 2K2QB 2J9FB 2ZYGA 2GEKA 3ZI7A 3OC0A 4FIZA 3H2GA 3O3MB 3Q3EA 4J16C 4ZTBA 2AC2A 4BVBA 3L2OB 2XITA 4YX9A 1I1OA 2AKAB 3Q15C 4MR9A 4S1WA 4ZOLF 4CIYA 2LP4Y 1M6VB 2O19A 3RLIA 4CU5A 2I2XB 3NDJA 3D7MA 3LFTA 2X0DA 2F8LA 3EWIA 3KTFA 4J4TA 5AKLA 3QK7A 3IIKA 3B7GA 4QDZA 1TCCA 1WKCA 1Y0BA 1YDMA 1SBTA 4P1ZA 5EPOA 4GT1A 3ZE8A 3KKPA 5EXEA 2AT1A 2WWYA 4DRXA 4Z8XA 1Y3BE 3KOUA 4JT9A 4II7A 1Z2AA 3NHJA 1XNHA 2B35A 1N8KA 3FZGA 3A9SA 4K40A 5LZ9A 3L46A 5E7JA 4MARA 5CLIA 2OC9A 3L01A 4LV8B 3K4PA 1JX6A 2JD1A 3D6VA 1KZHA 2HPHA 1FYEA 2R7MA 4ED9A 4H6WA 4YY3B 1T8PA 5AI0A 3QMMA 4YJKA 4F2HA 2UV8A 4F45A 2VQ6A 4FUTA 1N2SA 3FE2A 5FTLA 3MQFA 2XQGA 1PQ4A 4ILEA 5C1IA 1POXA 3BHIA 4L5JA 4AS3A 1KSFX 4CG0A 4OBXA 3UAZA 1XD2A 1QFXA 1ZUHA 3HA3A 4L4SA 3AW9A 1IRXA 3OCUA 3WSVA 2NVOA 2ZAOA 1CU1A 4IMRA 4FONA 4RK1A 4HAWA 3IR7A 4UNQA 1U3UA 4AJLA 3H84A 5BMVF 2QPAA 1FS4A 4JS0A 1LI4A 5JAOA 5LMNB 5FLXA 1F7UA 1O9BA 1SOUA 5AO9A 2B1GA 4OOEA 5F73A 4HFJA 3UBTA 4DKJA 1AGRA 1GCAA 3BK1A 2VCEA 1QANA 2QG6A 2FUNB 4U2CA 4D4LA 1BN6A 1Z62A 1LA2A 1S8NA 2VQFB 1O57A 2VWHA 2D62A 3RBAA 1J7KA 1AQUA 3TR5A 5KC9A 2TRSB 4B3MB 1M0TA 3T4EA 1GDTA 4MZXA 1AURA 2F8SA 1H3FA 1I3LA 4X62B 1OFUA 3EJ6A 5IJ0A 3C6YA 1TU3A 2NV2B 2ZJOA 3LPLA 4QGHA 1V7CA 3OT4A 4WOJA 2NG1A 4Q9DA 4BZPA 5EE9A 4GVPA 1GUBA 4IJWA 1GQSA 1YULA 4LRXA 4FINA 2Q3LA 3GDHA 3L7CA 4FC7A 2Z3WA 3F6SA 3HP7A 4LCJA 5EMJA 1L4BA 3WGKA 3DUWA 5B4TA 3MYRA 3SS9X 3SDSA 1SBCA 3FPEA 2UZ1A 2CMFA 5JCZA 1FDWA 3PNPA 4QUDA 2VSFA 3AL0C 2IXTA 2Q9BA 1ZZEA 4CKWB 2BDUA 2ZI4A 4X1OA 4B7ZA 1AKVA 5CGQB 5JRDS 2YJTD 2RG7A 1F2TA 4MVJD 4N01A 3UWMA 1EFRD 3G6WA 1OA1A 1PEAA 1HDGO 2HJVA 2IDMA 3HUTA 4ZAZA 3R0QA 1FRFS 1YZYA 1GSIA 3R76A 5A4JA 3M4YA 4GYYA 1YKFA 5IDYA 2HLNA 3QV1A 2WMOB 4G4SP 1IB0A 3D0QA 2AD1A 3GP8A 3OZXA 2RAFA 4LS3A 1D2HA 1FDOA 1XSEA 3IBYA 3OF3A 4HX2A 2FUG1 1KFBB 4OQXA 2CYCA 1N33B 3HYNA 2ERXA 5K6AC 4DNQA 4L9SA 4C1BA 2FEOA 2DT8A 3U6BA 1RRCA 1DELA 1LK5A 2Z6AA 4DCSA 1GGHA 1NHGA 3MTIA 2QORA 4S1TA 3RFUA 4JI8B 1BMDA 2IZZA 4MRAA 2WABA 3P9RA 4MIOA 2RBGA 3DKPA 3ORYA 4KMOA 1JMKC 1ISMA 1CUWA 3A37A 1L7EA 2I0FA 3PFHA 3UHOA 3WO0A 4BNKA 3LO8A 1YOBA 1V96A 2CT8A 1YC5A 2HK9A 3LXMA 4EY6A 3EAFA 3ESDA 3CA8A 1UWCA 1YJ8A 2IIQA 4NOJA 4BX9A 1RQ7A 5TIIA 1T25A 4ARIA 3W2TA 1DIAA 2V6GA 4PYLA 4XE5A 1G21B 1VHQA 4CDGA 2B1QA 4ZV9A 1MF7A 1NL3A 4Y9SA 3EH1A 3I61A 3UC5A 2XQVA 1PZGA 2WG0A 5KWIA 1YGPA 4OP2A 2M1ZA 1M6YA 5IK2A 4UEKA 1HQDA 3NYIA 3W9UA 3LCCA 3WC4A 1VPTA 4PY2A 4MUAA 3EZ2A 1Z0KA 2MU1A 2AMVA 3DMGA 3CWZA 3TZCA 4BCCA 4FX2A 4Q3BA 3IXQA 1NW4A 2Q62A 4BNFA 3DZDA 4CF7A 1XZMA 3CF0A 4KZPA 4AQ7A 5H3CA 4DDHA 3E03A 3TIFA 3K8QA 3ZY3A 2YNMD 4RVDA 3OM8A 1EVEA 3BA6A 1CVIA 3LGXA 3Q7IA 4A16A 4PR0A 2FZ4A 4BMSA 2IDJA 5TV2A 1CNEA 1FL9A 1PSDA 1QKKA 1T4BA 2PT6A 3K2QA 4V0RA 5DLQC 1LVHA 1O97C 5A3QA 1FJGB 1TZBA 2PS1A 4QDTA 1U2TA 5EEHA 3X1KA 2QSJA 1GAQA 1A27A 1MFZA 2YWGA 4WXEA 2PY6A 4DC1A 2I4IA 1D7AA 3H3JA 1FQOA 1W25A 3VZCA 3PR1A 4P82A 2JVJA 2IV2X 2IXBA 3OURA 1E5DA 4ID3A 3KSUA 4ITRC 3VPXA 1EM8A 4HZIA 2RC5A 3NDBB 4LFBB 1P7ZA 1PNVA 3GLGB 4LBZA 3M81A 3N5CA 1DG1G 2QKYA 2VJBA 3FB4A 3G2NA 1LRJA 4QOHA 3DGEC 4L9RA 3N9IA 3NU1A 3B1XA 1RPJA 2NO1A 4F3KA 2CXRA 1JTEA 3BHJA 1KDZA 2BGNA 4C87A 2HLDD 2PRJA 3T4PA 1JZQA 2B4KA 3QPDA 4Y2TA 1M2VA 5GZ1A 2HN9A 3ZYZA 2GBLA 4UM8B 4ZCPA 3DGFC 5JMWA 3WL8A 2WSYB 3UMYA 4NARA 3C3XA 1TW2A 3MZ0A 4MVCA 1XMJA 4KUGA 4OGLA 5H7XA 3ROPA 4A8HA 3E05A 3PF8A 1MJ5A 1NRJB 2HMYB 1TPZA 5AK3A 1AMNA 1T2FA 4FDUA 4CBVA 1X80B 1IY8A 1C0PA 3CKLA 3C1OA 3CNEA 1UEJA 3WQRA 3OSUA 4O5AA 1N1GA 3FX2A 4RL4A 5DLYA 1OKKD 3CE9A 2CHEA 3HCNA 4LYYA 4X44A 3LDGA 3HA7A 3FNHA 2X14A 2DECA 1WS6A 3BMOA 1PV2A 2AG1A 3DFMA 1HDYA 4FGUA 4RXTA 5FHRA 1EEXB 4RANA 4HAUA 3M3DA 1UFOA 3LX8A 4URZR 4P7JA 4HPXB 3VNSA 5K0JA 4WNCA 1RVDA 4MKXA 3V7WA 3VPFA 2NADA 2WF8A 3NH6A 5K3AA 4TKLA 2VF8A 3RO7A 3V2UA 4Q18A 1PFWA 1TK3A 2P5YA 1OZAA 3B2EA 5E6SA 2R87A 2KHZA 4NDNE 2VUSA 2Y99A 3ENNA 1ZD5A 1XX6A 1XZFA 3U44B 3DLCA 1C9MA 1E1QD 2G36A 4L72A 1AIPA 4LZNA 2R8XA 3O8LA 4KWIA 4LY6A 5KVCA 2D5CA 1SC3A 3SZ3A 3LQ1A 4QQ8A 4U7HA 4BFLA 3ZDDA 1R0WA 2BOVA 1W5EA 2LW7A 3REQB 4JNCA 2JI9A 3D1JA 3MCWA 3R7AA 5TEVA 1D6MA 1SIWA 5JXJA 3EZGA 1GOTA 4GPZA 1DFGA 3CINA 2O05A 3DBRA 2AC7A 3CN7A 3KKMA 2V9CA 1IBCA 1YK0A 4NJEA 1QORA 2CMKA 4BQPA 3K73O 1JRLA 3WLEA 5BN4B 1IULA 3QIAA 3ZWQA 2DAPA 1WPQA 3U3RA 4ZP1A 3VYRB 4B6SA 1I3OA 5I4BA 1NNI1 3A70A 5BUQA 3D4LA 3MJTA 2VYVA 4E3WA 1LQ2A 1KAQA 3V97A 5K0FA 2ZJ4A 4QBIA 1JAHA 2J6CA 1YBVA 5K8JB 2F3UA 2YIVX 5CUQA 1W47A 2Z2ZA 2B4AA 5CX1B 4YCSA 3GDGA 3E7XA 1NASA 1PW7A 1YRAA 1NXVA 5B1YA 3DMDA 1P5RA 1SC1A 4FR0A 1M83A 4PF1A 1T0HB 2GCNA 4G8JA 3W5VA 4YJFA 3C8DA 1O0SA 4IVNA 1DAHA 4X41A 3RFXA 1PDOA 1Y6RA 3CLSC 1GU7A 2FDXA 3TGWA 4A0SA 4YUWA 5PNTA 4W5OA 1VL2A 2VHTA 1BRMA 4V0NA 1KK3A 4KO1S 1RM3A 1V8BA 2D1RA 4B40A 3T0IA 3TSYA 3HSSA 4JLUA 5A4FS 3OIWA 4S24A 3LUCA 2QZSA 3O0DA 1PV4A 1WKVA 2P2NA 3DH0A 1OKKA 1ABFA 4EHHA 4DIEA 4UEWA 1CUVA 2G67A 4X1KA 3GLIA 3RODA 4I3FA 3OQHA 2PZFA 4PNHA 4D3FA 3FY4A 5EHQA 1CRPA 2XZTA 721PA 5EQDA 3UJ6A 3ND7A 4RYLA 1RHMA 2BBSA 4D8WA 1PL7A 4TL6A 3D6JA 4HX9A 4U2BA 2QM3A 2DMRA 1G2QA 5DMHA 5FWDA 1YZLA 5TGZA 3S1AB 2P6RA 2R8ZA 4YRSA 4XWGA 2HGSA 4RMIA 3DV9A 2ACVA 4N5IX 3CSSA 4TV8B 1AO0A 3ZLJA 2G17A 4K3UA 4RULA 4P7KA 3TZ6A 1JA9A 3EDYA 3TLGA 1BFKA 2Z1DA 4WGFA 5LKRA 3QEBZ 1N6HA 4BO2A 1KEWA 3V2IA 4OHWA 3NG1A 4ZI5A 4D44A 3AKDA 2VNKA 1T26A 4HDSB 4FPXA 3P5BA 4ZYXA 3OUZA 5B5SA 3IHWA 1DXQA 3P9SA 3HKDB 3SU8A 4N3NA 3I2JA 5IJZA 2I67A 3TPCA 1LPNA 2GN9A 3CBQA 5DBFA 3RGWS 4BFZA 1EINA 3FDFA 2YZGA 4W1QA 2J0UA 1UMKA 3B1JA 3LCUA 4EPVA 4N8SA 1EK6A 1Z22A 3QTLA 3TSOA 1XVLA 3A4MA 3DXYA 2XY4A 4XIFA 4JKYA 4HXYA 1MO5A 1XLUA 3WZLA 3RUHA 4A2QA 2N0SA 3U17A 5DYIA 4QEDA 3G9TA 3L8YA 4H1TA 4ND7A 4D8UA 2HMWA 1QIMA 1UDAA 1EX7A 4S3MA 1GITA 2X7HA 4I1SA 4M49A 2NTEA 3HNPA 5BMVB 4L7VA 2WD8A 2B0CA 4ZVRA 4IDOA 4EGSA 4LF5B 4XVUA 4JJ4A 4R5MA 2BVNA 2H51A 4CM8A 4IICA 1GGKA 2UYHA 3WS7A 3I37X 3ICOA 1J20A 1EQ2A 2Z1MA 2QLJA 2VYQA 2CHUA 2XWBF 2ZRPA 3OQIA 5J4HA 1TYEB 2BI4A 4PG4A 2AMLA 4DXDA 2C82A 1ENYA 1FUIA 1GQRA 4FGLA 2O57A 3TZHA 1I7PA 4EG1A 5I9NA 5BMOA 3K09A 4C4SA 1F14A 3U62A 4KFUA 1A50B 4P86A 2W71A 3O93A 3C4JA 4RWZA 1F2VA 4WJZA 1XVIA 3EWAA 4L0QA 5BN3A 1QE3A 3LK6A 3ZXUB 2PD6A 3BL5A 1XRSB 3EGXA 1N0UA 5B57C 1ZD4A 2G40A 3KLBA 5HKKA 4BN5A 4P53A 3IAM1 5EE1A 3EC7A 1ODSA 3KS9A 2C3UA 4F60A 3IO3A 4KV7A 2REOA 3R24A 2EV9A 3VJMA 1WA5A 5E3IA 1XWIA 3IPCA 4RTRA 1CRWG 2WWVD 2C5GA 1UAAA 4OHYA 3H4TA 2Z08A 4HNUA 3GAMA 3G1UA 4J90A 1H5UA 4QDXA 3QU9A 1AV7A 3ZK7A 1FJHA 1HNXB 3NT5A 1GPDG 5REQB 1U0OC 3OWXA 1RBMA 4DLLA 2PK3A 3PCRB 1WTAA 4X66B 3HUUA 4EUNA 1VKZA 5I4KA 1H5QA 2FYTA 3PQDA 6REQA 2VJMA 5H16A 3ZIDA 2H2HA 3T5DA 1UKEA 2J4DA 3G2JA 3RC7A 1SZJG 4ZIRB 4YAIA 1Z4IA 2QL5A 3IT2A 4HN4B 3ESQA 1E7RA 4KE8A 4U39A 3PFFA 4IX1A 2NAPA 4TL9A 1RKQA 3VR6A 1L7QA 2H1WA 1E6KA 1Z6ZA 2NO4A 5C4MA 1P61B 4XLLA 1FDIA 5LA6B 2VL7A 2ZATA 4RY0A 3W0LB 2HHAA 4PANA 1JJIA 3BTVA 4J0KA 5JCJA 4B6OA 4M9XA 1OI4A 2E4UA 1YQ9A 1R0KA 2ZJ6A 2X76A 2B83A 2XLCA 2BFNA 4QXQA 5JDIC 4PHFA 1WUYA 1CY1A 1V3VA 4ZRNA 1XZQA 4YO7A 5CBPB 1B41A 4NRDA 2OFFA 2RH5A 3JASB 3L1KA 3R7WA 1OLXA 1ZVQA 2HRZA 2R1UA 4C6SA 4ZVLA 5LQJA 4IKEA 2O3JA 4IGAA 4PYNA 1VYUA 3COZA 3R3WA 1SQGA 2ZE5A 3ZDYB 2PKCA 3KLNA 2HNKA 3DEFA 3S44A 4WY8A 2HSJA 3D7RA 4B44A 4YR9A 2RBEA 1OB5A 4RIFA 1HLFA 2PKRA 1K8ZB 3CX3A 3L41A 4PRKA 3AERA 3JQAD 4NPCA 1EXNA 2GJKA 5FBZA 1WPXA 3ZNNA 2P1ZA 1U0BB 4KAAA 1NE2A 3CZCA 3LY8A 3R4CA 5DBEX 5DHAA 1P7WA 3O84A 1EZ4A 3PEVA 3M4NA 5CLGA 4WAUA 5AOBA 2BEUB 3TXAA 4RETA 4HFRA 1C7EA 1H4QA 3CEAA 2AD5A 1IJBA 3ILHA 1MTOA 5IZCA 4YLYA 3TB4A 3UWKA 2FQWA 5KJ1A 1G20E 2FETA 3M2PA 2QAGB 4L4UA 2VHUA 1WJGA 2HXSA 1YI8A 4LVCA 1ORWA 4S1VA 4ECEA 5J4YA 4RQAA 5G02A 1A0OA 4JI1B 3H18A 3ASUA 3DBLB 3JQGA 1R4ZA 4XCVA 2RKWA 3IDFA 5EIHA 2SHKA 3FF4A 2A5YB 4MR8B 3K70B 1X1RA 4CIDA 5DN9A 3JVEA 3SBEA 2WRZA 3O2SB 3STUA 5BWBA 5EI5A 1KBOA 5FUBA 4OX9B 3VC1A 4HYEA 3TQFA 1LKZA 2HO4A 3QU4A 1KVUA 4WKBA 4YRGA 1JDUA 3ITKA 5J23A 5ES3A 4DL9A 1HA3A 1WY7A 4HF7A 1E6UA 2PKWA 2HHHB 4IKPA 5LPNA 3KPJA 2VC2B 1U63A 2G09A 4V2UA 4PXSA 5JRZA 1JKMA 2XHZA 3AKCA 3LO5A 1PTJC 1T4GA 3BMQA 4TRJA 3WLNA 5ILQA 5B6PA 4D6XA 1GTSA 4DDMA 1HDRA 1E1RD 2F3TA 4XD7A 1QO7A 4ZVSA 3TSZA 3M6AA 5JNLA 5KSOA 4EG5A 1AHHA 2E4WA 3NPAA 4LJ8A 5DO9A 2C7PA 2WFLB 1KNQA 1ZRNA 1E18A 3DHYA 3OJLA 1P44A 2OFXA 2XD9A 3IP8A 3EZYA 4IFIA 4OIMA 5ED0A 5F64A 2IV3A 3H42B 3TNDA 1YQUA 2XA1A 3IH5A 4ZZ2A 2G4LA 4Q3EA 5SICE 4IOMA 3WDSA 2AZXA 3CNLA 3R8CA 3BJIC 1DJQA 1W94A 3L0DA 4QYSA 4DUPA 4C7JA 1GGNA 4WZAA 5IAJA 1DMRA 2YR0A 4JX9A 2UYGA 4OQ4A 1JEYB 3GUZA 4ZT7A 3HB4X 1HQKA 1ZSVA 2APJA 5AOCA 5H80A 3F4KA 5L3SB 5AJHA 1SVNA 3WIOA 4YRFA 1K92A 3GLFB 2CLSA 1WAMA 2EL7A 2ODQA 1NUTA 2IPMA 1PFQA 2B6NA 1G9SA 2I54A 3CH5A 4GQBA 5AJUA 2IUUA 4B0OA 5A9SB 3HO1A 1CUDA 1PS8A 1TF5A 3G88A 2IIVA 5IKPA 4RKQA 1OLXB 2PEYA 2VBFA 3A1FA 4XA8A 2C5FA 5CT4A 1A5ZA 4CKWA 2Q6VA 2Y8EA 2AE2A 2FSVC 1Y7IA 1K2VN 3DDUA 3IA2A 2FPKA 1X8XA 4LJKA 1EFKA 4I9UA 5ALTA 5KVAA 3IUBA 4TM7A 1WDKA 4CKEB 3ZBUA 4DTCA 2YOGA 3IALA 1RAEA 4EARA 3D6NB 1YZQA 2QF7A 2D2XA 3D0RA 1ZESA 1Q7CA 1GUAA 2YMPA 3O8DA 4BFSA 4UCXA 1GTVA 2QD3A 2ZKLA 4QXMA 4KRGA 4E5NA 2IYOA 3JQ6A 4EB6A 1JQBA 4KGVA 5KCZA 5ALHA 3ZJYA 4LJ4A 3CVXA 3Q8MA 1WOYA 5JD3A 2PX8A 4PG6A 1BEEA 4L5BA 5DTQA 2VPTA 1RAFA 4EAAA 3MJVA 3HBMA 4L73A 4EVIA 1WXIA 2B98A 4A5SA 1NM5C 1U90A 1HQYE 2WWIA 4IIUA 4RVNA 3AR4A 2CUKA 1MVNA 1PJRA 1C3XA 5ECDA 1YL7A 1NLFA 1Z0DA 1OXUA 2O2GA 4QSHA 1N2IA 3FW1A 4GZ3A 1JE0A 4FJ2A 4WE3A 4CU2A 5B12A 5C8YB 4DQKA 1GPYA 3U7FB 3PUZA 5DB4A 1J4AA 3CMMA 5AD1A 2REXB 5IWCA 1P7PA 2Q9UA 2I7XA 3SHOA 2IYFA 2ZSJA 3L04A 4BFUA 2M9MA 3DJFA 3KC2A 1M2HA 1JLLA 4LZWA 4NMLA 1XK7A 2BZSA 4JSRA 3AEKB 1KYQA 3UBMA 2OY0A 5BORA 1SWWA 1XTPA 4NBLA 5BYAA 1LPPA 2LCIA 4BB9A 5JC1A 3EPJA 2ISQA 2H4YA 3OD1A 1W0JA 1V8FA 2P6OA 3T3GA 1ISSA 3CLRC 3PVCA 4PTLA 4FZ5A 1YR9A 4YIHA 1TVKB 2XXAB 5ILOA 4DBZA 5DNAA 5FULA 3DMNA 2WWTA 4KE6A 4A3SA 2WTUA 2DKOA 4OI1A 5KWEA 2BCGY 3QLTA 2Y67A 5AVXA 1TJNA 4AJ2A 5JS7A 3IKLA 4QTUB 2E48A 3AQ4A 1MW8X 1XJQA 6GPBA 4RJKA 4ZJUA 2J8ZA 1QP4A 5DN6A 1NQTA 2VF5X 3GXBA 3N6RA 4UQPA 3ZWVA 2VHVA 4X3CA 1Y7LA 2X58A 3N3AC 3BS4A 2IE8A 2ORYA 2ODTX 4IX9A 3FBGA 4EI7A 4O4LF 3IT0A 3MYYA 4LDAA 1RKXA 4MPTA 4FFWA 2UAGA 3SMVA 5BWNA 1B0UA 2XDAA 1C7IA 1F0NA 4Q5IA 3H1TA 5AVWA 4EUKA 2O48X 3WMRA 1V9SA 3BMOB 1E66A 3PE6A 1O95D 3IC5A 1KK0A 2OUIA 4RPCA 3KQOA 4NFHA 4KTTE 1EK0A 3GL9A 3Q72A 3QFFA 3L8MA 3GFFA 4UBJA 4C2TA 1PGJA 2C54A 5D87A 4RLQA 3P9KA 2HFKA 4HEQA 5IDWA 1FSFA 2CFIA 1N5DA 3I04A 3TGLA 1CQWA 5TPWB 1DC5A 1TQ8A 1FTGA 2BTQB 4H1VA 2DLDA 2LTAA 3DB2A 4QSMA 1X7XB 2RGAA 3H5AA 3EFBA 4O4IB 5A0FA 2PGNA 4A10A 1X6VA 4XVCA 2RHCA 1KA9H 2WM2A 2EP8A 3MMZA 2ZWOA 2BZ1A 5FUQA 1DKQA 3D4NA 5EY5B 4X3PA 4GMGA 2PH7A 1SCDA 5THKA 5BSKA 1PJ8A 3THOA 4B4OA 1ID8A 1OFHA 3USCS 1Y7TA 3PXBA 2MSLA 3KVOA 4E15A 2WSIA 3QW4B 1DRWA 1X38A 4M1TA 2VTEA 5CDSA 1C7FA 1RPNA 1OIXA 1TL7C 2OVBA 1W2WB 3E5HA 4YQZA 3DBVO 2FCAA 2QU7A 2PZAA 1H8EA 3KVVA 4YRTA 2P7HA 4XSGA 1ZCZA 1QOZA 2GWHA 1QGDA 2VNSA 1O5TA 4B82A 1KDOA 4BQRA 4OXNA 5A0TA 3B6MA 1PIWA 4DILA 3FAKA 4DF3A 1RWQA 1R18A 3HJNA 5A6VA 4N41A 3K3PA 4QWMA 5CX4A 2QX6A 3JWPA 3ONFA 1M5RA 1G20A 2I4TA 3QA9A 2QTMA 5L95A 2VDNB 4N12A 4O8ZA 5C3UA 4UAVA 2QB5A 3P96A 3JAWA 4TVBA 2Q7DA 3F7TA 3HRIA 1BS9A 2AXNA 2JLVA 2IYSA 1XFAA 3RPEA 3B1WA 3U19A 3QVVA 1Q1AA 1I6WA 2DKFA 4JR0A 2V65A 2FW8A 3PR3A 5G53C 4W8GA 3OH8A 1F60A 2IH4A 5GONA 5CDTA 4NULA 3H6KA 2VYNA 2FX5A 4TXHA 1GYRA 1RJFA 3RS4A 3HCFA 2C5LA 1RRMA 3SZOA 3IP1A 5IJWA 3DHEA 1VJTA 2XX3A 3D5TA 3KBOA 4LEIA 4Q1VA 1MJFA 4KXLA 2FLKA 4HZGA 4QXPA 2ORVA 1Z5ZA 4H7DA 1ULTA 3RV4A 3DZHA 4QFMA 1UDCA 2OM2A 2YYZA 2W43A 4YMTA 1PQUA 1C2YA 5FPHA 3V8PA 3SYLA 5C8YF 3R7WB 2DUJA 2YVAA 1LNQA 4CMJA 1PHPA 4NOLA 4CV2A 2XMDA 5K03A 2P9BA 3HVKA 3UG7A 5DWVA 3WDLA 2YYYA 4PPFA 1PVVA 2H85A 3RS9A 3EMBA 2YCBA 2YN0A 1JHRA 2JLWA 4PIVA 1CXZA 1TKAA 3TF5A 3S2IA 2W2MA 5DSTA 1GKYA 1RDFA 4B0PA 5FOVA 2A1UB 2MINA 2CBGA 1IOZA 1XF1A 2QRPA 1DAFA 4D99A 5KIAA 5H59A 4AW9A 2J46A 1HLPA 3I01M 4J07A 3PUHA 1TI7A 4Q4JA 1BFUA 1M1NA 1UC8A 2YC4C 1KEZA 3PQEA 3N58A 1EWYA 5TR9A 1TYAE 3MUNA 3WBKA 5CDFE 2KWIA 3AKYA 3DAYA 3E3LA 1QQ5A 3JCZA 4E5VA 1WHTA 3GQBA 1CJKC 4I0WB 5L3VA 1BG6A 3NVKI 4OB7A 4HGZA 4F9FA 3HPRA 4L3OA 3DZIA 3KLMX 3NTQA 1HYGA 3TVTA 4UTVA 1XYGA 1C9KA 1SN7A 1W93A 3E61A 3LLVA 4MR7B 1Y3HA 4O63O 3B9PA 16PKA 1PS9A 4CKXA 5JSZB 2V0GA 1R4NA 4LYDA 4MI9A 4GX5A 3OHMA 4KQ6A 4QL3A 2ZBEA 2G5GX 3HV0A 4HVLA 1B7GO 3V4SA 3HWSA 4KR7A 4UBIA 4CUZA 4LK3A 5K5EA 3ABIA 2PLAA 1Q16A 1DAOA 2DFTA 1L7VC 3NANA 4NBWA 1F0PA 3PBKA 1E9BA 4D9NA 4H3KB 1R9NA 1O77A 1GPLA 1T2NA 1UH5A 3ZLVA 4C2BA 4EW2A 1PTKA 3EAGA 1JF8A 1VLVA 2VT6A 5DXAA 1ICIA 1DS6A 1NXOA 5H9VA 2E1RA 2HJ9A 1HYEA 1OH7A 4CQMA 3OMWA 2BM9A 4ZT2A 2OORA 1IUOA 2Z6QA 1U0GA 2C94A 4LOKA 5JSFA 3ELUA 5GJWC 1HC7A 1AUPA 1OWNA 2ZB2A 3OF2A 5JQGF 4J3NA 4YNBA 1KI7A 4KYVA 3T7EA 4MMXB 2BL4A 3U7QA 3I2YX 2X6RA 4YROA 2ZI6A 1G8SA 5D5QA 5E1MA 3LH5A 3QMVA 1KRXA 2UUAB 4GLLA 4NFLA 2AMYA 3AEYA 5AKEA 3TFQA 3VUEA 4HAIA 4C0KA 4PYKA 1AGNA 3KXDA 1RI3A 9MHTA 5C18A 4NCJA 5AHXA 4UDXX 3BERA 2UYCA 3PNSA 4FWIB 2D5BA 1UPUA 3GWGA 1QGED 3BDVA 5EJ4A 1XO1A 4D97A 1JNYA 1PSWA 3CF6R 1I0ZA 3BL8A 4LE0A 4KR6A 2B4TO 1OBCA 2PJUA 3HY3A 3RJ5A 1NN3A 4HMQA 3EW9A 1APBA 1GU1A 1K7YA 1BS2A 3CIOA 3HL0A 4FSHA 3BB4A 3SJBA 1HEIA 3VMFA 3DSRA 1NTRA 1P8AA 1CDZA 1OB2A 2BEKA 3IS3A 3MIIA 1M8JA 3AV3A 4PZAA 1RWMA 2OBNA 1C9NA 1Z3CA 3DWIA 4V39A 3W4JA 5EFZA 4BFXA 5CDYA 2F43A 3QLVA 1T8RA 2BGJA 1TQ2A 2FEWB 3QF4B 3KAKA 2ZUSA 2PX5A 2V7UA 1G5FA 3IUJA 4KQCA 4JBXA 1UFKA 3RTCA 1XZJA 4EI9A 4ZMBA 2IODA 3WGIA 3H05A 3IQWA 5F98A 3P4UA 4EYGA 2XBMA 1PJQA 2AFHE 2H5LA 1UPCA 1U4SA 2XKAA 3GRZA 4UNSA 3ZGXA 4PN7A 4B09A 5I8ZA 3KZKA 3EQ2A 4ZEMA 1G5IA 3TLZA 2QUBA 3PRJA 5CVDA 3HVUA 4ZQHA 5LB2A 2V0NA 1CR4A 3FMIA 5J2UB 1CJCA 2XJ4A 2XGMA 1W9MA 1WUKS 4C5AA 1S2MA 2FPMA 1MQAA 5LQMA 2HA2A 2QRJA 4PW0A 3D5QA 3VSCA 2X0JA 5K4AA 4HFNA 4BNZA 4M1WA 2VHJA 2Q0HA 4C6RA 1XN4A 3FPKA 1HH4A 2I8CA 3LVRE 4UHJA 5FOXA 3VAZA 3FMOB 2CLMB 3H0CA 3E0XA 2AKEA 2I3BA 1D5CA 3ZDBA 3RYIB 3WGNA 1I1HA 2GKOA 3PVZA 3R3ZA 1SKYE 1D0SA 2GM3A 4HADA 3V4PB 2XKJE 3ES9A 5LLSA 1BVRA 4XUCA 3ZIAA 1FFSA 4O1MA 3NEYA 1R37A 1PS0A 2FW9A 3F90A 4YAFA 1TM7E 1PLJA 5CEJA 1UM9A 3QV2A 3HNOA 1NF8A 1RBYA 3TTTA 3B1FA 4DVJA 4LVUA 1RXEA 5JTUA 3E3MA 3QYFA 4YRRA 2HZBA 4KVZA 4DR1B 1E4VA 5BYKA 4M8NE 3W04A 2QG4A 2ZRCA 3GJ5A 5LN1A 4GC9A 3KR0A 2XQJA 1M76A 1YQXA 3V4OA 3WWPA 4QUBA 3HFGA 5C7OO 3W9YA 3G5TA 3L7JA 5IXJA 3ZEAA 3EVEA 2BLNA 5JRJA 4C08A 3LPAA 1FXSA 5EMLA 1JMYA 1XD9A 1Y4SA 2ZU6A 3CUTA 3HDYA 4Q9JA 5GQSA 1IFXA 4NNJA 3JTMA 3AB8A 1UJNA 2CL6X 1NSYA 2C2ZA 5DNVA 2QQFA 3A2NA 1FK8A 1TGVA 1JFTA 3K35A 4ENPA 1YBFA 4MS4B 5DTEA 3WG9A 2ZUEA 2FX2A 4UFOA 2ZM5A 2TYSB 2ZDGA 3OF5A 2UVPB 3I09A 3NMUF 1W19A 1XZ8A 2IYXA 4CMKA 3HXKA 1A2OA 4WLNA 3WZ2A 2C9CA 4OBEA 1L7AA 2REBA 4QDOA 3H5OA 1ZH8A 1E1CA 2I3GA 2IP1A 3T3MB 4DB4A 1CY6A 1PGQA 1XP8A 4OP1A 1XQVA 1ADCA 1EG2A 4H59A 5D6NA 1YCFA 2PL9A 1J0AA 3MTGA 3TSAA 3BHMA 2GFIA 3MPOA 5LUBA 3T1NA 4LJLA 3FH0A 4JC4A 3A4VA 2C88A 4XKJA 4DR5B 3NALA 1UBOS 1ZRHA 2J3IA 3ZXYA 4A6DA 5K20A 4BLPA 1NUHA 2X13A 2ZYIA 5G4KB 2ZB3A 2I62A 1T9ZA 4BKPA 1DKOA 2ZRNA 4LDNA 4E5KA 2J7PA 3KEQA 2JC3A 3QA3E 3TNYA 3RFCA 4DJ5X 1DXOA 2XHEA 2E5FA 4PICA 2XXJA 4JVSB 2VDOB 3JQ7B 3KU4A 1PR3A 3DBIA 3AY7A 3UMRA 2FSFA 2PUWA 2SKDA 2O8NA 3NUZA 1I2BA 4OU4A 4R2IA 4EJMA 2P9YA 2X5XA 1FP7A 2B2NA 5A9RA 1DZ3A 1R16A 1U2GC 2OFPA 4C4RA 1UZNA 3KPWA 2DFDA 2YV1A 3AEZA 2DH6A 3DYVA 4MLCA 4EHBA 2PUHA 1QRRA 1RYEA 1MCZA 4UPVA 3NASA 3ONWA 2YXNA 3WTBA 5ERYA 5EOVA 2H9IA 3BJRA 1KYXA 3CG4A 1DIBA 3FCXA 3IQIX 5IEJA 1ZY2A 1U1FA 3H1EA 4PAGA 4WEOA 5LZ5A 1ZJZA 4AIIA 3CLTD 3TI9A 1D2NA 3DULA 4OUKX 4Q34A 5A5DA 4HDCA 3NTVA 1KARA 4PGMA 2ODWA 1S9DA 1C29B 4ADSG 1NI5A 4BV2A 3GLGA 4RK5A 1YB4A 2ADOA 3AESB 1FP4A 2J48A 5JHGB 2EARA 3KZXA 4OYRA 5AQ1A 3NV7A 1HUQA 4WFKA 3TAHA 2HA4A 4EDFA 1AN9A 1NVXQ 5IJXA 2WD7B 3HB0A 2NXWA 2HSZA 1JXMA 4HAYA 2JJMA 4KVAA 2OGTA 1IZZA 3SQMA 2PAFA 1A4RA 1VLZA 2A5FA 1SKUA 2Y1KA 2ZRIA 4GQAA 3U7HB 3ICQB 3FYHA 2Q9CA 1W4ZA 2D6FA 4ATNA 1YASA 1U0FA 1QZXA 1V9CA 2JFUA 1U11A 1EA5A 3LM8A 3ICWA 1IHPA 1KO5A 4IHJA 1JPUA 3VNRA 2FTKE 1CY2A 2YJ4A 5JQWA 1IJFA 5LQKA 4H17A 4UBKA 4MPJA 2A9VA 4EJ0A 1RLJA 3ANYB 1HNZB 4O2RA 2GAAA 3CZAA 3MWEA 2WM3A 3ECAA 1SCKA 3UIEA 3HSKA 4I1YA 4AG3A 2M6SA 1BXZA 1JQDA 4Q9LA 3U3DA 4G2NA 4CFSA 5FQNA 3K8YA 3G6KA 1QXSA 1RABA 3P2KA 2H9AA 1FFHA 3HKDA 3WXMA 2ALJA 3EGCA 2B25A 1USVA 2DWUA 4PC6A 4G01B 1QG6A 3OZCA 4DWWA 2O5RA 1P0CA 1REQA 2B5VA 4M8KA 1VJCA 4HFMA 3E2IA 3C3DA 2V7QA 3GROA 2BFDA 1UWLA 2AWNA 2PFGA 4FBGA 5EE0A 4C0QC 1B0AA 3IMEA 4MVJP 3OZSA 1JLLB 2RIPA 1OXSC 2ZAYA 1YU6A 3A6HA 3AHFA 4Q3LA 4OQQA 5JJKA 2HCFA 3J7AC 5ANRB 1EGVB 1ACJA 1B4DA 2HRCA 3UXEA 5LUAA 4LC0A 4I2NA 4HXGA 3R5KA 4KQIA 1DQSA 3PC6A 2B3TA 2HEIA 1JFRA 2VPIA 3LL4A 4OMFG 3ETNA 2CDAA 4KI7A 3WR5A 2P5TB 3LTNC 3UAXA 1ZUIA 3EF3A 5L7YA 2OO5A 3ZX4A 4QM7A 1V1MB 2FSGA 2PGIA 3EVCA 4A8JB 4PO8A 1EBFA 2XR1A 2FPIA 2ONKA 2WVJA 1CRQA 1Y1KE 3DMTC 1YQDA 3JR3A 3KO8A 3RS0A 4ARSA 5CM2Z 2XZDA 3H9QA 4AS2A 1YR8A 5FNVF 3TX6A 4RTJA 1DWPA 4GVXA 3TI7A 1DTWA 4GEGA 3WL5A 1VECA 3PIIA 3EBOA 1CR6A 1UJ4A 2EGHA 5F77A 5IH3A 1NBEA 1FFWA 1FU4A 1IBSA 1LC0A 4FYXA 4AKIA 4F7DA 3G8CA 3E9DA 1PUXA 4BNGA 2OBFA 4JC8A 4QU0A 1YJAA 4B34A 4ZU3A 4YRMA 3LXXA 3DO6A 5ALEA 4L02A 4P83A 1Z4KA 1GA1A 3F1KA 4H1HA 1JR3E 5CYPA 4JGIA 3I28A 2BSXA 1JIVA 4TKMA 1QWOA 5BWOA 5HRUA 1QQTA 4WDQA 1FNMA 5EKXA 5CM9C 2EKDA 3EDQA 3QENA 1XEWX 5LQUA 4HQLA 4JVMA 3I52A 4HB3A 1VI5A 3OQ1A 1AA9A 4HSGA 3E70C 2OBXA 4RDIA 3VAYA 2H1LA 5AKXA 3QU2A 5BY2A 3FDZB 4OXYA 4XX0B 3Q88A 2GHQA 3AHIA 3GRAA 4DMKA 2JHAA 2KLBA 3OY7A 2EIXA 2XVZA 4JYPA 1RIFA 1QFJA 2VP6A 3AEKA 2PWAA 5H81A 4AKEA 4KQXA 4HQ6A 2PN1A 1OXTA 4RF2A 4URFA 3EY9A 2BSAA 3P45A 1H6BA 4CEJA 1TT5B 2X7XA 4H31A 2XMZA 3CVWA 3PEWA 2A9QA 3CZ5A 3BAFA 4E1AA 1NMQA 1XTTA 2YVQA 4R0NA 3RSSA 2CUZA 4OGGA 5DM4A 3DAHA 3RS2A 2P4SA 3T8YA 4AFNA 3H11A 2O52A 2XYPA 5AJXA 3CS3A 4WIAA 1UCFA 3LIPA 4R1LA 2BEJA 3AY3A 2BTEA 5IJ9B 1F51E 4KEAA 1NZJA 1QZUA 3PYXA 5BVHB 4BP1A 1NC3A 3JW8A 3U0BA 4ANFA 3DMPA 3D7SA 2H4JA 1EU1A 1FRNA 1H2RS 1VYVA 3D64A 4NU0A 4PZPA 4X63A 3TL3A 5B55A 2HV8A 4H9GA 1JSXA 4BTLA 5L6LB 4OY3A 1CDEA 1LTKA 3PPYA 1LK0A 3B9QA 4FZVA 4MQUA 5C5IA 3HWX1 1GPUA 3EXG2 3W2GA 1GGMA 1GCIA 2DJ5A 2FWMX 4ZYVA 3NVAA 5IKEA 5CXUA 3SZRA 1TFRA 2C92A 1VIDA 3RE1A 1D4ZA 2W37A 4MEBA 3HCAA 5FQOA 2XNHA 3UW3A 2I2BA 4G23A 3OE1A 4DNFA 4Q4JB 3E7DA 1DC4A 3IDZA 1E63A 1UADA 3IAXA 3DE6X 4J7CA 3SR4A 1G3MA 4B9AA 3T1YB 1L5HB 4YRZA 1FC0A 2Q21A 1PZXA 2I2DA 3KWLA 3N2IA 2YHBA 4A0GA 4YRPA 3NV9A 2AOWA 1HDCA 2ICAA 2Y1OA 3IPRA 4OGFA 4ZOBA 1SG6A 1RYHA 3P2IA 4UNIA 3IPYA 1SZPA 4FI3C 4LE1A 4KSCA 1PFUA 4L78A 4XGNA 2YFHA 3ACDA 2VVTA 3ZHTA 9ATCA 3P9CA 4HGRA 4DM4A 4PBTA 3R9XB 4FLMA 5TPWA 4EHLA 2FRXA 4AY4A 4S0ZA 1CWUA 5F4BA 1SCBA 1X7XA 4GZLA 3S40A 1SGWA 1KDPA 2OCBA 3DHNA 3E2PA 2CN1A 3RKRA 6CHYA 3DKRA 3NEAA 5LQNA 3RSCA 4Y6RA 3HY4A 4MKIA 3JZFA 3ET5A 2UYOA 1GZ6A 3HA5A 5U1PA 5FAKA 1V3UA 4R9RA 3C5WP 2FN7A 5AIAA 5DZSA 2P78A 3VGPA 3KDSE 1O6GA 3P26A 2CKMA 1UOEA 3M5CA 3AKZA 1UBJS 4QVGA 2ZBPA 2IX3A 4QPJC 4D4JA 3PTLA 3C3MA 3TRFA 3MWDB 3CF4G 5JECA 3WAJA 3V8EA 3GUCA 1MU0A 2YJGA 4EPRA 1ZOOA 3NT4A 4RLHA 2N3ZA 4YI5A 5KTSA 3QXHA 1XRRA 1NC1A 2F9LA 3Q8XB 3I6IA 4H7JA 1USIA 1NW8A 1AD2A 3DS8A 1ZD1A 3T5TA 3KE8A 3U7QB 1GPNA 1RC8A 1FS5A 3H2KA 2AYXA 5DM2A 5FUMA 1Z36A 2PYDA 4WNYA 2J3MA 1HKHA 4W1PA 3QXSA 3SKVA 1G17A 2ACEA 5AW4A 3FTPA 4N0EA 2QE7D 4OFZA 3IOCA 2QN8A 2R8OA 3K9HA 3E9CA 5EKUA 4FMCB 2ZB8A 2LKDA 3FSJX 2CXNA 5E9QA 1E9DA 3VOBA 4B85A 4WVLA 1T2CA 3DVAB 2DKNA 3QI2A 2ZANA 3D8HA 2CY0A 2Z2XA 3E15A 2GN2A 3UQZA 1KQGA 1RFLA 4KBFA 1Q83A 2WVAA 2BBTA 1ZL0A 3KEMA 3F2IA 3RABA 1DX6A 1E1CB 2J6HA 2Q5LA 3H9UA 1Y1LA 4OHRA 2RCNA 3O94A 5CJJA 4AWAA 4EB0A 1JQAA 4WJLA 4B43A 5LNK6 4UREA 1ZRSA 2EHJA 3D2LA 1XTQA 3G2KA 3FTFA 1XZIA 3FWHA 1XCJA 2C97A 2YRXA 2AUTA 3KBBA 4K81B 2WB4A 3N2YA 4U2GA 2YQZA 3ENKA 1DBRA 1GU0A 1J1ZA 2FPGA 3BQNB 3E82A 2W2LD 1M0EA 2UUOA 2I6TA 2FPXA 3VHQA 3K0FB 3H1FA 5DULA 2VHWA 1HZZA 1U0LA 3A58B 3NM4A 4DLWA 4F3NA 5BMVA 5C0OE 1E0AA 4G1FA 4FU0A 4UNNA 1DJOA 3B60A 4P0QB 1WZ2A 1Q1GA 2OBYA 4C0BA 3PT9A 3VTZA 4EVRA 2I6XA 4B87A 5EZSA 2VIIA 4PPYA 2WMDA 2OLJA 2F4NA 2HGZA 3RSZA 5JROA 2H8GA 3SFVA 3ZJTA 4RVUA 4GM4A 4HYTA 5JISA 2D2IA 1NF3A 2QW1A 1EWRA 4BRZA 4KQ1A 1V43A 3B8HA 1DQNA 2CCGA 1G63A 2C2GA 1QDEA 2ZRDA 3QOXA 4RENA 5EP4A 3CGGA 4BY9E 4X24A 2F90A 3B8EA 2PH5A 1IBMB 3A4YA 1T2DA 4RTKA 3STXA 3W5JA 4FHEA 4OA5A 4KQ2A 3RW9A 3EBLA 1YZ3A 2JAUA 4R31A 3LF2A 3V2HA 1NYTA 2IEAA 3KP1A 5KSPA 4BV9A 2R79A 3NTRA 3AF0A 2P11A 3LHIA 2V0CA 1N5LA 3EVAA 2RKBA 1XQ6A 3I1IA 5G2OA 4K2AA 3PEEA 4RO0A 2X1VA 4EM6A 4OQNA 2HCRA 3G2IA 4QU8A 5ADWA 2XMBA 3IEXA 5MFZA 1CC1S 2CJWB 4DBLC 4I1VA 4MRMB 2D1QA 2B92A 1P81A 5JXGA 2R7NA 4FIDA 1NSFA 1YC2A 1ZN8A 1FTQA 1WX1A 3FCEA 3PQFA 4LDPA 3V1KA 3QVXA 2C8VA 1HTTA 2QZZA 2TMGA 3CTMA 4WZ6A 5WRFA 1KI3A 2OR3A 3HE3A 3NHSA 3N8NA 3RJ9A 4EZIA 3A9RA 5IHPA 3AUYA 1ZH2A 3I76A 4WY5A 4JSTA 4UAUA 2QLTA 4Y0AA 3RKUA 1XEFA 3UQYS 4D92A 5JBNA 3ESXA 5AFSA 1MRNA 1QQ7A 4N7RA 4PEVA 5AXDA 3BGIA 4RBNA 1KJJA 4UARA 4A6XA 1QJ4A 1UQTA 1I01A 1JTFA 1U7TA 4YJ3F 1H2XA 3UY4A 4CM4A 4R3NA 1C4OA 3BK2A 3ADKA 1B8NA 1Y3FE 1KXZA 1RR6A 1ES9A 1VE9A 2IYUA 4LPSA 4JIGA 1NXPA 2WKRA 2JLSA 1BDHA 2KBEA 3BFVA 3PJGA 5BWLA 1X1DA 1XEAA 1Y8RB 2WSLA 1BWQA 1MTZA 2DUMA 1J99A 2XTMA 2MSKA 4TPKA 4N8EA 2NV0A 2ZRJA 5DEOA 4AUEA 1R2QA 2OMKA 3LRXA 3EZXA 1D1TA 2I87A 2VPWA 3I2FA 3QTTA 2XWQA 3T99A 2YFKA 4K9KA 3A25A 2AW5A 3JX9A 3G7UA 2D3TA 2CVFA 4KBGA 3EF0A 3VZQA 5LXTF 3JWEA 3K6RA 4A8TA 1B15A 1XKQA 2CMHA 4YP5A 4QREA 4MJ3A 1YCGA 5MGNA 1VG9B 3WOVA 3TW0A 5BSFA 4P98A 1CR1A 3UW1A 4X7MA 1G5PA 3OOJA 3AI2A 1K6JA 4JYBA 5HOEA 5DM0A 2MSDB 1KFJB 4QODA 5D85A 4EKYA 1Q7EA 2KMLA 1BDBA 3C39A 2HKIA 2ZYAA 3IBGA 5DMXA 1DMSA 5L3RA 4IZIA 4JDPA 5EIBD 2BPOA 4MI6A 4AKSA 3UH1A 1U9IC 1HEYA 1U9JA 2H1OA 1DFIA 2W11A 1HFKA 4MGKR 4OEHA 2W2QA 2GZ2A 4TQUS 3DOEA 4PFJA 3WBJA 2WJGA 4MDYA 4ZOAA 1NVGA 5AVUA 1IUNA 1K75A 2C3MA 4WNIA 2AOXA 1SUFA 2QP9X 3I9OA 3TWOA 3QX3A 1MOPA 2ZT6A 2VRCD 3WQBA 5IMBA 4AC9A 4C7XA 1H85A 5I8PA 1SXGA 2VSXA 1CY7A 5SYMA 1J5XA 3STTA 1QP8A 3IUPA 5IRCD 4ZRMA 4XM0A 1OXXK 3NBKA 2Q1TA 4RMJA 3OEEA 2BEWA 4OU5A 1H9AA 5AI8A 5HK9A 4FYHA 4UULA 2Q0SA 2Q5JA 2Z8YA 3F8SA 1MIHA 1NI3A 1OX4B 1SHKA 1VDMA 3K09C 4BE7B 5C32A 3EEYA 3BILA 5E9WA 3OZBA 4Z2AA 3VVCA 4PLGA 1JE1A 4UQLA 5JZVA 5EZ5A 5B37A 5TMEA 2HF9A 2VRWA 3L7NA 2LWIA 1P0PA 1X2EA 5G3YA 2XB2A 2CJWA 3ZHUA 3VHXA 1RD4A 1ADJA 1DZIA 4GU5A 2O6HA 4UUOA 2E5LB 1Q77A 4TZTA 4AQYB 4I5DA 1SKAA 1JTVA 4OKNA 1VLHA 2C2YA 4RD4A 3FOFC 4L4XA 3FUXA 4OD0A 2R6ZA 4BKOA 3ZW9A 5ALIA 1XEXB 1NKSA 2B2XA 2A3RA 2Z2KA 4DZTA 4OB6A 2CV0A 1ZCBA 2OGUA 1J8MF 2PKYX 3BWXA 5GTDA 3PQ3A 4HLQB 4L9WA 2QTVA 1G8GA 3OZFA 1B93A 4ABTA 5EMHA 5K99A 4OQEA 1TAQA 1QYWA 1R0BA 3IDOA 2PE5A 1F3LA 1TQHA 1DJLA 4KO3S 5CXSA 4UOZA 1OILA 5DU2A 2W6ID 2OT3B 1G9TA 1X7WA 3BBPA 2VYVD 3OZ7A 3WK9A 1B6SA 1TUBA 2F6RA 1TA4A 3KFXA 4R2KA 4B6PA 2C99A 5ALPA 3G5AA 1L4KA 4AJIA 4YPFA 3JU3A 5JY6A 1BW9B 2Z6UA 3L7LA 4FHCA 5F5LA 3V6LA 4B2LA 4GWKA 2ZTUA 4TTIA 3ROFA 1JT2A 3DE2X 3FNQA 1P60A 1U8TA 1Z5NA 2R60A 4H4CA 3VKHA 4INAA 4TUYA 2RH4A 2OK7A 1WCIA 4FYWA 3NGMA 4FZRA 3GOHA 3ONNA 1FLNA 5M5BA 3F97A 4MKRA 3FWZA 1JDBC 2AX3A 3A26A 4G6ZA 4YJ2B 1QGAA 2GCPA 4XEUA 3WK5A 2LE0A 3ZCUA 3HJBA 1K88A 1VG8A 2ZS9A 2EWWA 1QUEA 2QRNA 2XUKA 4GVLA 2C3OA 4MTLA 1JN0A 3QWHA 1GVNB 4DHEA 4CIAA 1MDFA 1DI0A 5FWYB 4I4NA 2WU3A 1YK1A 2AA3A 1F3OA 1OXMA 4L95C 4LYFA 3PQ7A 2AJ8A 4EW1A 4N18A 1VCNA 1USKA 2OCDA 1XTSA 4JA2A 2FR8A 4MINA 3SN6A 1R5NA 3VFDA 4KPUA 3W6PA 2H0QA 1DCMA 4AJEA 1IVSA 3T1QA 2WSSD 3CF4A 3ENWA 3AUTA 4XOIA 3S2FA 2SCUB 1WP4A 3MWYW 2Y6VA 3N7TA 1GA4A 3GLTA 1YOVA 4OJKA 3SE7A 5BV7A 3SNHA 2EFHB 1ZIOA 1RWNA 1B00A 3MWFA 3TKYA 1OSNA 1VJ1A 3PD1A 2FPPA 2BHLA 1KI4A 1TYZA 4H0FA 1ZKDA 1DWQA 2CK3A 2GFQA 2O3SA 3W4IA 2B4YA 2DFNA 2NAFA 1Q0TA 3I62A 1S9HA 1ZEMA 3GRCA 1ODTC 3EYWA 1DPFA 4EUSA 5KDLA 3WYAA 1I80A 4N3CA 1R8QA 4G0UA 3NWOA 5G4KA 3LUDA 4CTJA 4EYOA 3RAGA 1HL3A 2BKEA 1Q95A 4IIGA 1ULBA 2G9ZA 4MMYB 4Q9IA 2M32A 4RORA 5A05A 3S4YA 1Y48E 4MA5A 1W44A 3WB0A 2PJRA 2G82A 5GOZA 4HPWA 3VPHA 4BUCA 3WXBA 3NRJA 1T0PA 3ROTA 3AFHA 4CHGA 2UZ1B 3IHKA 3JAMA 3K0HA 2IHNA 1H23A 1YZHA 1LV7A 1LF5A 3CVOA 4G1CA 4Z51A 1EP3B 3HKBB 4PCAA 1TM2A 1K8XB 1OTXA 1ZN7A 2B1JA 3WMWA 2B99A 2BHTA 2ZIFA 2NWQA 3SBDA 3U9LA 4B74A 1QAOA 3L1UA 4DT1A 5K0GA 1CF4A 4AUNA 5C51B 2IS1A 3NRBA 2F3SA 4HUTA 2C58A 2RGXA 3T9DA 3L1HA 2O6LA 4KPFC 1E5TA 2KB0A 3GLIE 3EG5A 4ZRDA 2XEXA 2WZQA 5LL6P 1ZJWA 5CT8A 5BRAA 3RV3A 1ADFA 1BCRB 2R1TB 3DP7A 3MIZA 1IBRA 1MB2A 2OD7A 3LWZA 4IDGA 3RNLA 4EO7A 3DHWC 4MLZA 1MEOA 3D3QA 3ZPXA 2R97A 3AXTA 4RSGA 1ACLA 2QI9C 3FMPB 1S1MA 1XDDA 2GTPA 3DE7X 4Q4DA 2B30A 5PGMA 5M34A 1L7MA 2P8SA 4F8JA 5B7GA 1JLRA 3ZGOA 4HI0E 4X65B 3STHA 5DVZA 3GGCA 3C7AA 2ZRGA 4NE9A 5MF6A 3L40A 1WHSA 2ZUWA 2Q6LA 2CV1A 2QJOA 2HWXA 2XNDA 1U7HA 4WOKA 2XOEA 1Y9ZA 3M4JA 3MB8A 5HKKD 1MAUA 1W87A 2IW1A 5FXMA 4GNKA 5ADHA 4JKOA 4BMYA 4BQSA 1U2DA 4UDOA 1QYCA 5G1NA 3U9SA 3EEFA 1JNXX 1YB5A 5K0EA 1BHJA 3QX9A 3S81A 4MQ6A 3GPLA 3KQUA 4LF9B 4HZUA 1IN7A 3OWOA 4PCVA 3DXFA 5IFLA 3KPYA 1DX4A 1MN6A 1URPA 2PGAA 3CX7A 3B3AA 1II8A 2GLXA 3K94A 4BOYA 5KTPA 1Z33A 1ENPA 5CH8A 1ESDA 3K5PA 4RABA 2XZOA 5TGDA 3GMIA 4M21A 3ETGA 4LQDA 1QGUA 4PU0A 2NLOA 2VDWB 3L9XA 1ZGBA 3MRSA 2FSSA 5LC1A 4HQKA 1YWGO 3OZEA 2ECQA 1B1AA 4CMGA 2FZGA 2JFBA 5G3ZA 3DE0X 1U2ZA 1SCUA 4U2EA 2WNHA 2AR7A 3KOWA 1N77A 2O20A 3HV2A 1P1KA 4D56A 5JSZA 3GRUA 1BCSA 4EPYA 1KPGA 1OJ7A 3PFGA 2YS7A 4E3ZA 2JBWA 4BMNA 3NHAA 5TQ2B 4C04A 3SXJA 4Y2PA 1AKTA 1MVLA 3LJKA 1Y5MA 3L93A 1V47A 4MUXA 4QGBA 4R3UC 4IOLA 2FK8A 3FLAA 4HB4A 4EKIA 4FHZA 3KSAC 3RTEA 2EW2A 2ZTSA 1OASA 4ZREA 1KRWA 1H4TA 1XJ5A 2CVZA 3EUAA 3EVNA 3NORA 4YMVA 1L5QA 1UK9A 4OOFA 3AUSA 4Z54A 4RA9A 3GLFA 3HU1A 2ZJ8A 1ZS9A 5BUZA 2OORC 1NBHA 3M3HA 3I72A 4EKGA 1X7YB 3HXTA 1M6VA 3JYNA 1TKCA 1V5GA 1JAXA 3PDHA 3Q41A 1U31A 3BHNA 5FI3A 3BD6A 1KH1A 1T5BA 2P1DA 3G85A 3O2NA 3F5DA 2WU0A 1KVQA 1TO1E 2GBCA 1BDJA 2FP3A 4TTPA 2P1RA 2HH9A 3OPVA 3IBCA 3JWIA 4EOGA 2R6CA 3AGQA 3FB1A 4QOGA 1IC6A 2DQZA 2G7ZA 2BFBA 4EECA 4DRXB 2C59A 3CVUA 2KM1A 1IQUA 3UUFA 4M7PA 1TK2A 3RBVA 2NZUG 5KHOC 3H97A 3SICE 1G8YA 3ZWDA 4BJHB 2IBTA 1HE1C 5F1PA 4EYQA 4YV0A 5T67A 4GLJA 3RC2A 1T3LA 3IUEA 3QI7A 4QRIA 4HRXA 4H3VA 5HFJA 4DCTA 1UMCA 3QHAA 4DCVA 1PDVA 3DMTA 4PZEA 1XMXA 1QM5A 4P7FA 4P31A 2H3HA 1QHNA 2X19A 3CO0S 2PVCA 2GA8A 3AO0B 3HGMA 4JT8A 5BSTA 1C3OB 4CJXA 5DNCA 3PJFA 2XUIA 4G9GA 1E2QA 4IUDS 1ZQ9A 2R8EA 2VWGA 2A1UA 1RZVA 2MINB 3FWYA 1AQYA 2WJYA 3HHPA 4MVJF 4TWAA 3ROGA 5FWAA 1EFPB 2NTYC 1CG6A 1U2PA 3HI4A 4XB2A 4BVJA 1DWOA 4KHZA 1N7GA 4WCFA 1XMOB 5KDDA 2D0OB 1XXLA 1LTHR 2RGBA 2YV2A 3DLAA 1GPWB 2ZTMA 1PJ4A 5EJFA 2AG8A 2UXCB 1TEHA 5CVEA 1DADA 2JDIA 2QLLA 5I7WA 1A2BA 4JOBA 5F5XA 1JHAA 1E2PA 2EP5A 4DYHA 2Z4TA 4FK8A 3V1YA 2PUBA 3DQPA 3H17A 3F98A 2FEKA 3PDUA 1ZFNA 3I83A 5DCYA 3RBZA 4CR7A 4DR2B 2GH1A 4O1HA 3DAGA 4DQXA 3ZG6A 1BFDA 1O89A 5AI4A 4GO1A 1II8B 2C42A 1IWPB 3LUAA 5FBHA 5TVGA 3FPFA 5F51A 5BVHA 1X39A 2GASA 2V7VA 4FZJA 3RHZA 1MB4A 4BU0A 5BSWA 3WTCA 1UC9A 5HUJA 2XMCA 4ZDKA 3GA0A 1WQ4A 2VDWA 2BISA 5ALYA 5IXYA 1CEEA 5LQSA 5EJ9A 5HXAA 5MHTA 4P3YA 1O5OA 4PONA 1PT8A 4IGKA 1AKNA 3EA4A 3PFCA 5CLHA 3WB1A 2MOKA 4DPLA 2JL1A 4ENQA 3BVPA 3ETJA 3UT6A 1E3TA 1YR7A 1JEAA 2QAGA 1DTSA 2FKAA 2QG9A 2FX3A 2V1XA 5IAKA 4OHCA 2IHKA 3L02A 1Y4AE 4EH1A 3BWDD 1Z25A 3CN9A 1KEPA 5ESWA 3O1IC 4GF5A 4CLHA 2GO7A 1YMUA 4UPDA 2L82A 2Q49A 2ODPA 3B3JA 4IIHA 4ZANA 5FR2A 3WNBA 3ZU3A 5L3SA 4WLVA 3U48A 4QO8A 1Z56C 2C5EA 1H0SA 4IJ5A 3ED5A 1QMPA 1VFPA 2OHHA 2OLEA 1THGA 3N0XA 2GK6A 4ER7A 1FXWA 1O87A 4M1YA 4XOUA 4S04A 3DZFA 3CPSA 3Q2IA 2E89A 1C3LA 2C5HA 2Y1DA 2A5GA 3CCFA 1UFRA 3HCCA 3TLJA 4Q7KA 1DARA 3U3XA 1KO1A 1ZLXA 2VDMB 4HTAA 3LOPA 3A6KA 2V6BA 4F3TA 3PGA1 4JP8A 2DC1A 1NVVR 4YT4A 3Q3IA 2DFKB 1E9SA 4M53A 3S1LA 1YZKA 3WBFA 2QT9A 1F48A 3IELA 3M49A 4OYYA 4YJDA 1JAIA 3UT5B 1ODIA 5CIYA 3ZD7A 1ZZGA 2Y1GA 3MBKA 3NCHA 1CB7A 4NI5A 2BKLA 3RSHA 2NQTA 1PQPA 1KVRA 5KPJA 4H08A 1WCXA 3PTZA 4K88A 1A9RA 3NC1C 3FLMA 4U3JA 5J9FA 4R68A 2NO6A 4XYEA 4UASA 4MAAA 3L0CA 3P1JA 1EFUA 1D2EA 5CFOA 3NYQA 2DWOA 3S8MA 3UGTA 2VXCA 4Q3OA 3F8WA 1U8CB 2OV3A 2P2ZA 4NEGA 1V25A 4MROA 1CJBA 5JO0A 2XUQA 4AG5A 4H77A 1EVQA 3AUUA 5ITWA 2BFDB 1B42A 4LMAA 4CIBA 1JSCA 1RXIA 3A0RB 5K0NA 3OM9A 4Q82A 1UM8A 1A1VA 5DCUA 4U0JA 1D1PA 4FYYA 3MBOA 4JEUA 4XSHA 3TTWA 1QUFA 1FE8A 3VHLB 3OESA 4AKTA 4M7WA 4X8LA 1F8UA 2EJCA 1M0SA 1PX2A 1DKRA 5ED4A 1ISGA 4P4NA 2XV1A 2C9BA 4Y1GA 1ZMRA 4PR3A 4DGQA 3HP4A 4KUEA 1UUFA 3Q0EA 3ISJA 1MH1A 2JGJA 5AKKA 5A5FA 4I50A 1SKYB 1J0XO 1U8FO 4E22A 1W1WA 2AJBA 4O4JF 4B33A 5HF6A 3CIFA 1MR3F 2FJUA 4IGEA 4EEKA 3OSZA 3AHJA 3U13A 1ZK0A 3KQSA 3RG2A 3MT7A 3LIIA 3HA2A 4WV3A 3TOXA 3MOIA 3VJLA 4BNWA 3CLKA 4G9BA 2EFJA 4D4MA 2A1TS 4DQUA 1HLGA 2QVLA 4KK4A 1NUSA 3VQTA 2QQ5A 3GEBA 4I6GA 3SOZA 4UDYX 4YRCA 3R9IA 1E92A 4C21A 1C8BA 4GDMA 1U3DA 4JR1A 4MPPA 4NLLA 1EWVA 1XA3A 3H8SA 3ZXXA 5KWJA 3P27A 2PMFA 4HB0A 3IESA 2XYRA 3VZDA 4D46A 4K8RB 4XD2A 4DCGA 3NHFA 4TLAA 4ZVTA 1NQUA 4LC1A 1C9EA 1F6BA 4W5HA 1QHHB 4D6YA 1JVBA 4DCUA 3KHKA 4FFPA 3U7JA 3NW9A 2WI8A 5DTMA 4YPVA 2R9VA 5JS2A 5BUCA 2D06A 1QB8A 3BGDA 4N6NA 1GNPA 1QS0A 4RTQA 3FZYA 1XTUA 1U28C 2X22A 4B5LA 1C0KA 4BX3A 4BWVA 1ZK2A 2NXNA 5COBA 4R8KA 4N5LA 3VH2A 2XQIA 4OLJA 1KH3A 1OU0A 3QG5A 1JFFA 4UJ5A 5AKHA 1SEPA 5FYQA 2G9RA 2BM8A 3AC0A 4BLSA 3ONVA 4MW0A 2XTAA 3P4YA 2TMDA 2PA0A 3FCSB 2DY0A 5KYXB 1ORVA 4K9RA 4M38A 4QVKA 3WK7A 4BNNA 1UBKS 5GVSA 3FJ1A 4DLSA 5IK2D 1OYWA 3P9ZA 1SVLA 3EG9B 3NTLA 4CQLA 5CW1A 3RSOA 2OK8A 3SIRA 2VPPA 1J1IA 3A3NA 3I3OA 5HS6A 4YMSA 3PEFA 3GNTA 3K53A 2XVAA 2Q1XA 4U7FA 2XRFA 3SZGA 5AHOA 4RTMA 4MV4A 2CZGA 4EDHA 3M6LA 5BPHA 4KNVA 4LY0A 4WT7A 4H3HB 3WMGA 1MO3A 2C0QA 5KX5A 3E7PA 4V3BA 4TWBA 1Y89A 3DZGA 5I01A 4BC1A 2EFGA 1PEKE 5E9JA 5BVGB 3WNQA 3FOAA 1M1YA 3M70A 1V1RB 2VTVA 5D5PA 3R20A 3SOPA 4MQ4A 1E0DA 4E2WA 1CX9B 1E96A 1WCIB 3BFXA 3ISVA 4IJUA 1P9WA 2ATCA 4K0RA 4S1PA 4WXMA 2JJ1D 3E7FA 4PX5A 3BORA 1QHXA 1KJIA 2EKQA 3WLOA 3RVKA 4YCMA 1BZYA 4D4IA 3LLSA 3L4BC 1VJGA 3LLUA 3FNBA 3ETHA 3F2VA 2GPJA 2DPGA 1SD2A 3MK31 3SY8A 5EJEA 1SY7A 4ASUD 1KNXA 1Y5IA 2L2QA 2PXXA 4ESOA 4DXHA 3BYZA 1R9MA 3RRZA 3HR8A 4DMCA 5ALDA 1Y9DA 1KR2A 2VZ8A 1XWWA 3KXPA 4I55F 3I64A 9LDBA 1KMCA 3ZDQA 2FRDA 1AKUA 2DQKA 1C14A 2F8MA 3EGVA 4YAWA 4PX9A 1TJ5A 4ACBA 4DSTA 1OFVA 2MYUA 4QNRA 1S4QA 3OUUA 4F5YA 1UT6A 3OLVA 3KQNA 4D80A 4Y0VA 3PUYA 4HL6A 1Y1TA 4YIKA 1BO6A 4C01A 3WV5A 3QEAZ 1SHTX 1AS3A 3ZK9A 1TJ3A 5CITA 1JLHA 5FA5A 4Y2YA 1U1DA 4Q7JB 3AUXA 1XA4A 2CL0X 4G8DA 2ON6A 4O4JA 4QRDA 5LCXA 2JHGA 1TUBB 1UWVA 3ISTA 2RIRA 1VBNA 1YTLA 2Q4EA 2ZE8A 1TD9A 3D3WB 4US2R 1Z8DA 3N8KA 4KQFA 3NKFA 4LF4B 4PC1A 5B3JC 2AMFA 5JUWA 2HIHA 6ADHA 1GL6A 2PUDA 4MHTA 5F23A 3GVXA 1NBIA 3E27A 4UMFA 3S1AA 2VNHA 1ZR2A 1NPYA 1NP7A 5L7TA 4N1AA 1U04A 2CW5A 3OQJA 2NVUA 2X5JO 2M2IA 3QPCA 4J0HA 2R1VA 3X44A 1PDWA 4MVXA 3F6YA 2MT9A 1MJGA 2DB3A 4TRNA 2P2CA 5I7VA 1VG0B 3OETA 4Q1CA 4FJ1A 1NNUA 1UMCB 3DEZA 3UK0A 3SZMA 5IU6A 3BGSA 4CEIB 5KNDD 3TG8A 1W5FA 1WHTB 2XUHA 3E2MA 3GQBB 4PGHA 2GAOA 3H9CA 4CEHA 3IKVA 5CD9A 3RD5A 2IJGX 1SB9A 1HBJA 2B7BA 1MPTA 3MSCA 5DCWA 3FKJA 4ZA2A 4ZCSA 3UXYA 1JHVA 4K6HA 2CFCA 3ZCXA 1NNSA 4IIVA 4B6FA 4C7MA 3ANTA 4ETIA 4NWIA 5ESRA 4G86A 4X64B 1HGXA 3ETCA 1PWXA 3I6MA 3BQMB 3LUKA 4YJHA 5DH9A 3RRYA 1YOVB 2J5KA 2IOFK 2J33A 2R8PA 1LNSA 3E3NA 2C98A 3PXCX 1SUWA 3CVJA 5T8KC 5CA1A 2WSBA 3WGHA 3RHTA 1KIFA 3Q9LA 1RW4A 4WX2B 3KYCA 3H2IA 3WLAA 2YJ5A 3SS7X 4WJKB 1LX7A 4HNQA 1KAGA 1CP3A 3UAYA 3VYTB 4JJGA 2Y93A 3D54D 4L76A 4C4OA 8LDHA 1D4AA 1XFDA 1YA8A 3MOGA 3N76A 4IDNA 1BTOA 4MVYA 2AL7A 5D7NA 1GSHA 4JP3A 2GJ9A 1G60A 2WAYA 4HNGA 4U7TB 2AQIA 4XARA 3CZPA 3LQKA 5FT9A 1HDEA 2OZLA 5CDFA 4K1XA 5JXIA 4HN2A 1DKLA 5LYJF 2PGLA 2A86A 2CFTA 2IHBA 1QCZA 3HCPA 1RQ2A 3C3WA 4ROTA 3MTQA 5D3MB 1EEHA 3VKVA 1BKYA 3D8TA 3I9MA 1ZNQO 3GLGE 2FSHA 4H35A 2WK1A 3ROMA 1XBTA 2OQRA 2CLEB 3LPDA 2A33A 4L8WB 3AUFA 3FFTA 5DYYA 3P52A 1TYCA 2EW8A 1NY6A 1UBTS 2WTAA 3UV7A 1X1BA 5DV9A 2Z04A 4N03A 4ZOLB 5T4HA 4UMDA 3N0VA 4JBLA 1SCAA 4UUNA 3WIDA 3BN3A 4K9SA 5K3SA 1FSPA 1CHNA 4R8VA 3I53A 1T3TA 3NT2A 5EA2A 4UU8A 4RAQA 4Z3DA 2PU7A 4BFVA 3UJCA 4U5QA 1BE8A 4ZEOA 3TGPA 2WUEA 3DE4X 3KXIA 1BJKA 2DPMA 1IHXA 1PEYA 2P2YA 1FDVA 3NBZC 2I29A 2IPOA 3P7MA 4FMCF 4MEJA 2KI5A 4AY3A 5JNVA 2XF8A 4HN9A 4F6LA 3R8XA 2AJCA 2ZJ7A 4WSOA 2JFGA 3X1XA 2IYTA 4N8DA 2VJLA 1X77A 1XCLA 1F5SA 1J2TA 3DOJA 1WHSB 2YHSA 1ECGA 2GZRA 3CKYA 1VL0A 2HADA 2VXYA 3CURA 3C74A 3PNVA 4K9DA 4L15A 4TLDA 4AF6A 5CBPA 4ZHQF 3QG1A 1X92A 5DI3A 5KVQA 2M6LA 1T1IA 2MYTA 3LZCA 3U1TA 3KKOA 4OUDB 5K8TA 2C2XA 1DJNA 1QCCA 4EUFA 3GPIA 2OVFA 1Q84A 1LJUA 2MSWA 1YB1A 3H9JA 5T41A 3VR4H 3WRWA 2ZROA 1J2JA 4B3HA 1NWCA 4BRWA 1E9CA 4R1PA 3B85A 2G63A 2O2EA 2ZYUX 2EZUA 4GOOD 1XP5A 3H9EO 821PA 3ZZNA 3UGKA 4EG4A 3RYCA 4CEIA 3OEWA 3BIJA 3DO8A 5EIEA 4DEVA 2B1RA 2QTNA 4IMJB 2ISCA 3SC2B 1KWGA 4YQFA 1U8UA 4O1IA 3E5MA 1RJGA 4QUKA 3ZZMA 1E1NA 1H1LA 2IKSA 1N2CB 1G8JA 2C5SA 1T9CA 2V7TA 4FQ7A 4Y8VA 4QYMA 1S5PA 1I5RA 2DR0A 2VXOA 2OESA 2KE5A 5TT0A 3VPCA 1XZKA 5F1YA 2BRUC 2JGRA 2G07A 1G3IA 3I4FA 3IUMA 1W5SA 3SHWA 2FZ5A 5EHXA 2YL2A 4DY4A 2OHIA 2WQZA 3H2JA 3CEPB 4RXMA 4D9JA 1HPLA 2V98A 4Q3NA 2BT4A 4JQZA 5KSZA 1CJVC 3KYCB 2IZ1A 3AVYA 1ADYA 1JDSA 1Q0ZA 3MAJA 5CT9A 1I4DD 1C81A 1OLSB 2FE4A 4K03A 4TV9A 4O2BB 3AR9A 3GA5A 5J4LA 1V0JA 3GNLA 4RPLA 4RYDA 1EXDA 2VK1A 4DXAA 3K9GA 2JK0A 4YHHB 1SVOA 3TQOA 1EPUA 3WIEA 3VA7A 1VTKA 3PA8A 3EGOA 2I7CA 4EG0A 1K0FA 4QGAA 4G9EA 4AL4A 1RWPA 3WSWA 1NUPA 1U2GA 2PT7A 3ZV5A 5HKBA 1C80A 4R8RA 2O5CA 1H4VB 1NLMA 3QKWA 4MK4A 3BH0A 5DX1A 3GLIB 1JDNA 1BKDR 3MJFA 4WLUA 2F8TA 5IJ0B 4QAQA 1JW9B 5CFZA 1ECCA 1KETA 3NNDA 2PKQO 5I4CA 4IHKA 3FDXA 1XNGA 3JQDA 4JASB 4QNNA 3E3AA 2IYRA 2ZJYA 4MO2A 4FGSA 5DBHX 5EGSA 3VR6D 2H5EA 1ZHOA 1TZMA 3WB9A 1Z16A 2I91A 2ZIWB 4DCOA 1U3WA 4MV7A 2Y6UA 4LIPD 4BFCA 3U61B 1ZCJA 2RI1A 3NC0C 2AZTA 3ICPA 3ZU2A 4PHGA 3ZWNA 4PM4A 2F1HA 3TJZA 1SOAA 3VU8A 4DG5A 5EMMA 1R1DA 4Q02A 5FAXA 1DPGA 3E22A