1ZJJA

Crystal structure of hypothetical protein ph1952 from pyrococcus horikoshii ot3
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
MVAIIFDMDGVLYRGNRAIPGVRELIEFLKERGIPFAFLTNNSTKTPEMYREKLLKMGIDVSSSIIITSGLATRLYMSKHLDPGKIFVIGGEGLVKEMQALGWGIVTLDEARQGSWKEVKHVVVGLDPDLTYEKLKYATLAIRNGATFIGTNPDATLPGEEGIYPGAGSIIAALKVATNVEPIIIGKPNEPMYEVVREMFPGEELWMVGDRLDTDIAFAKKFGMKAIMVLTGVSSLEDIKKSEYKPDLVLPSVYELIDYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords hypothetical protein PH1952
publication title Crystal structure of hypothetical protein PH1952 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
total genus 88
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1zjjA01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1zjjA02
4KX5A 2JAOA 5AKXA 3U19A 4YIKA 2YJ3A 2I55A 2FEAA 3UMCA 4FE3A 4NV0A 1YNSA 2QLTA 4BKMA 5AVVA 2Q5EA 3VAYA 5AM4A 1SWWA 5ALPA 3MMZA 2R8ZA 3I28A 2WF7A 3B9RA 1Z4NA 3OCUA 3E81A 4Y2YA 5ALLA 1Y8AA 3B9BA 3W5CA 5AW5A 1WVIA 3WKCA 2I7DA 3A1CA 1Z4PX 1TE2A 4FFDA 1MH9A 2IOHA 3ONNA 3SF0A 1N9KA 1RQLA 2CFRA 1Z4MA 3NIWA 4Y2PA 3ZX4A 2NYVA 2P27A 5AK3A 1XP5A 5A3RA 5ALZA 4UATA 3FPBA 3W5AA 4L57A 2YJ5A 5AW8A 1TA0A 3E8MA 3NRJA 1QH9A 2I33A 3QX7A 4Y2TA 2AGVA 3AR6A 1L7OA 2EAUA 2MU1A 5AKJA 3EPRA 1Z4IA 3I76A 3QNMA 3U7FB 3L0YA 2BY4A 2CFSA 2C8KA 3N5KA 1WR8A 3N1UA 3UM9A 1NRWA 1YS9A 1U02A 3QU9A 2PQ0A 3IJ5A 3W5DA 5AICA 2CFTA 2YN4A 5ALQA 2HEGA 5ALMA 2B1QA 3L8EA 3NUQA 2AMYA 2GHTA 2WFAA 2BDUA 3NASA 3WKBA 2GHQA 4DFDA 3PGLA 2WF5A 4ZEVA 1Z4OA 3SD7A 2ZBDA 1Z4KA 2G06A 2WF6A 1L7MA 5ALJA 4BX2A 3OCXA 5ALIA 4AP9A 2HOQA 2ZXEA 4YIHA 1L8OA 2B30A 3ESQA 1RPZA 3ET5A 1ZJJA 1TJ3A 5AM3A 2WM8A 5AM1A 5AKLA 3L0BA 3FM9A 3ZW7A 3F9RA 1Z4JA 3OTQA 3UMBA 3QGMA 3DAOA 3QUBA 4UASA 2OM6A 3R4CA 2FPSA 4ZEXA 2RAVA 1QYIA 3SLRA 3PGVA 3ZTWA 4Y2UA 4YCNA 4Y2VA 4UMEA 1U2SA 4UMDA 3L0CA 4NABA 2R8XA 4YCMA 1RDFA 4UAUA 2WF8A 1ZRNA 5IS2A 3PCTA 1XPJA 4QQFA 3QLEA 4BBJA 2HX1A 2HF7A 2P69A 3ZI4A 4AS3A 1QQ6A 5AKGA 5ALUA 2Q4TA 4KX3A 4MUMA 5ALDA 3ZVLA 1Z5GA 3N28A 4Y2SA 4RETA 1T9ZA 1WPGA 1TJ5A 2C88A 1RC8A 3WKEA 2FPUA 4J03A 4JDPA 2R8YA 1L7PA 3M9LA 4I9GA 5AI4A 5ALFA 4HGRA 2NO4A 3P96A 5AI0A 2I34A 3UMGA 5AVTA 2HCFA 3GYGA 4PNHA 1KYTA 1EK1A 3L8GA 4UW9A 3OCZA 3WKDA 2FUEA 4Y2JA 4Y2RA 3QUCA 3FGOA 5ALSA 2MSNA 4AS2A 5ALGA 1Q92A 2YBDA 3NALA 5ALYA 3U7GA 3ZWDA 4O8CA 1ZD3A 3SKXA 5AI8A 4UU1A 1F5SA 3U26A 4G9BA 3RF6A 2FDRA 2X4DA 4G63A 2ZOSA 4FYPA 3DDHA 4EZEA 2YMQA 3L1VA 1Q91A 3B8EA 3ZVNA 1XVIA 4XQ0A 4YCLA 4Y2QA 5AKHA 2HDOA 3ZU6A 4HGQA 5AVZA 2YFYA 4UM7A 5AW0A 4GIBA 5AW1A 2B1RA 2W4MA 5ALEA 4Y2XA 2EARA 3PDWA 3QU4A 1U7PA 2OBBA 2HI0A 3N07A 4Y3UA 5AESA 3S6JA 1ZRMA 1Z88A 2AH5A 4UU0A 3AR4A 2R8EA 5JJBA 5AKIA 1EK2A 4YH1A 3QXGA 3AR3A 3SHQA 1LTQA 1CQZA 3EF1A 4C4TA 2FI1A 4HGPA 3HYCA 3U7EB 1RLMA 1RMYA 1YJ5A 2W43A 2RBKA 3ZVMA 1YDFA 3ED5A 4BX0A 3AR5A 2VKQA 5ALNA 2HHLA 5AM0A 2BDEA 2O2XA 3DV9A 4BEWA 5AKKA 1U7OA 2HO4A 1J97A 1JUDA 2IOFA 5ALWA 4EX6A 5AKEA 3A1EA 4XE5A 2AUTA 3QUQA 3TLMA 5AI9A 3A1DA 3OCWA 5AVYA 3QUTA 2C4NA 1QQ7A 5AVWA 2FPRA 1TJ4A 1K1EA 3E58A 5AW3A 1IWOA 2JARA 5ALRA 3ZTYA 4H1WA 3QU5A 3FPSA 5IT4A 5FP0A 1RMTA 1U2TA 5AI6A 1Z4LA 3OCYA 1ZOLA 1NF2A 1RMQA 1CR6A 2G09A 2DQSA 2O9JA 4UMFA 1SU4A 4KN8A 4HYTA 3KBBA 1N8NA 2P11A 1VFPA 3KOOA 4HAIA 4UMVA 1RKUA 4ZEWA 1ZS9A 2YMPA 4DW8A 3SKYA 2JAWA 4CF3A 3IB6A 3BA6A 4EELA 1WZCA 3FVVA 1ZD4A 2W11A 1S2OA 3L5KA 4OD0A 1AQ6A 4OFZA 3ZWKA 2YJ4A 4L6CA 3EWIA 3KDPA 3ESRA 1T5TA 3EF0A 2HF2A 2G80A 5AVQA 1S8OA 2B82A 5AIAA 3A3YA 2B0CA 3WKAA 4EX7A 3WK7A 2RB5A 3WK9A 4CF4A 2OA0A 4JB3A 3QU2A 2WF9A 3AR8A 3CZ4A 2GMWA 4UAVA 2YMMA 1L8LA 1ZD5A 2B8JA 2QYHA 1RKQA 5AK5A 2JGAA 2G0AA 2IA5A 4F72A 5AVRA 5ALVA 5AK4A 2FPWA 4MWOA 3L8FA 4B6JA 1L6RA 3FZQA 4DCCA 3MC1A 2P9JA 5AW7A 1YV9A 4NWIA 2YY6A 1Z5UA 2ZBEA 5AM2A 5AKZA 3OPXA 5ALXA 5AW2A 2ODAA 1RLTA 4UM5A 3W5BA 1NNLA 1O03A 4BX3A 2G08A 4XOUA 3KZXA 1Z4QA 1RLOA 2I54A 3M1YA 4CE6A 4RESA 4BNDA 2WHEA 3D6JA 3ZX5A 5AW9A 1O08A 2B8EA 1QQ5A 3WK4A 3WK8A 2NO5A 5AHXA 3AR9A 2EATA 4IG4A 4OCZA 3WGVA 5E0OA 1RKVA 4NFLA 2C8LA 2ZBFA 4CF5A 3KC2A 4J2TA 4BNDB 3U7HB 4QJBA 3U13A 1PW5A 4KNWA 2FUCA 2IYEA 5AI5A 5AK6A 1ZD2P 3OCVA 1L7NA 3WK5A 3AR2A 4KYTA 3BWVA 4I9FA 4GXTA 3R09A 3MN1A 4NAVA 2PKEA 2RARA 2YJ6A 4XPZA 5AKYA 4HGOA 1VJRA 4E88A 1RRCA 2HSZA 3SMVA 3R9KA 3L1UA 3WK6A 4C4RA 4F71A 2ZBGA 3QYPA 3RFUA 3NANA 2I6XA 1LVHA 1T5SA 5AVSA 1RQNA 3HLTA 4BEVA 4BYGA 2FPXA 3I1YA 3NAMA 5AM5A 2GO7A 4L6AA 2Q4RA 3N8GA 4C4SA 1FEZA 1VJ5A 3I6BA 2G1AA 4UARA 3L7YA 5ALHA 3E84A 2CN1A 4EENA 5AIBA 5A3QA 2IOFK 5A3SA 3ET4A 1J8DA 4HGNA 5ALKA 3ZUPA 1YMQA 3KD3A 3MPOA 5T41A 4EEKA 5AW6A 4DWOA 3IRUA 2C9MA 1X42A 3L8HA 4IFTA 2G07A 2PR7A 2ZG6A 1SWVA 3J7TA 2YMLA 5ALOA 2OYCA 4YGYA 3K1ZA 3WGUA 5AW4A 3DNPA 4OHFA 5ALTA 5AVUA 5IT0A 2JAUA 5AVXA 2D2VA 4KNVA 3QU7A 4CNQA 3CNHA 3AR7A 2GFHA
chains in the Genus database with same CATH superfamily
1YS7A 4KGDA 2I2AA 1E4YA 2FSVC 1FFEA 3K2QA 2DUNA 2CZGA 2W93A 3JQ8B 1I6WA 3OLYA 5KYYA 1JBQA 5B6PA 1W1WA 4X0EA 3UMCA 1DKNA 2YNMA 5KNLA 2NM0A 3DLBA 5DNVA 1D5WA 5CM8B 1P1HA 4BKMA 2PVCA 4PRKA 5GY7A 3DBRA 1HDEA 4DBZA 4J3JA 4OPMA 2HPHA 3R76A 3QWAA 5JCJD 2VZ9A 4I50A 1T1SA 4WA7A 3GEPA 3MMZA 5JZBA 1OFUA 2YWBA 1P7PA 3NGMA 3RBZA 1Q7CA 1RSZA 3D4PA 1OFHA 3VYTB 1ITZA 1GAEO 1P19A 1NUSA 4O4LF 1UEXC 1P7VA 1QH8B 2XYGA 3VVCA 3F97A 2WPNA 4H6PA 2VSQA 3WLRA 1DELA 5BVGB 2OXEA 5AW5A 1WW2A 1P6XA 3MOIA 2CXNA 4ZVPA 2X23A 4E4TA 4JV5B 4QE3A 2GSDA 1T0HB 4YRZA 3KQKA 1N5JA 1QZTA 2D1YA 3GBVA 1A5SB 2PS9A 4MUYA 2X9LA 2NU9A 1RQLA 2RH8A 3WOVA 4BQPA 4IHQA 3N3BC 1VDMA 4IR7A 3L9WA 4X6LA 2V5AA 1IJEA 2NYVA 2ZSJA 4NATA 4DCSA 3STYA 5KEIA 3MUFA 1BDHA 2R4TA 4U7GA 4GL2A 3L82B 1GIAA 3OF5A 4K9KA 4NFSA 5H5JA 1M1ZA 5TF0A 4YJ3B 3RGWS 4D74A 5I45A 2J9XB 2PL9A 3LBNA 3ZDQA 5COBA 1G60A 4R2LA 3F73A 5K45A 2Q1SA 1QH9A 3IT1A 3VOBA 1XALA 2Q1UA 3CIOA 5FEMA 1VGRA 2ADMA 4PSVA 3BHNA 4BWGA 1EYZA 2XNDD 3OOHA 4WADA 4M55A 1SD2A 4FFBA 3VI3B 1BX3A 1OOEA 4MQEB 1ZVQA 3W3AD 4R1NA 2JBAA 4QEDA 2D0OB 1RFLA 5L7WA 2TECE 3M9WA 1Q83A 2R6GA 1VHTA 4ETIA 1XZGA 4QG3A 1LX6A 4D80A 4R5MA 3L1JA 1J2TA 4CV3A 1T9DA 1E99A 3ZIDA 3LPMA 4BQQA 2OQVA 4IS2A 3CE6A 1DRUA 1JG6A 4UREA 4H60A 2K2WA 1SKYE 3D8TA 1I6KA 1N5MA 3HBLA 4F06A 3CR8A 1K3FA 4L8GA 2VYVD 5BV0A 3SYMA 5CX4A 2YXBA 5I9LA 3GRFA 2GHTA 1X39A 2OZEA 3KAQA 1YB6A 1GZHB 3WYFA 4EABA 1W7AA 1CF2O 3R5TA 3ICQB 1XLUA 3IULA 2V7QA 2ZJBA 2FG5A 1BKYA 1NVBA 2GCNA 3GRYA 4MV6A 4TT8A 4CG2A 3PFBA 5ALJA 4RZQA 4N9QA 1FS5A 4NNPA 2I3BA 4Q4AA 2JFHA 5TMBA 3SZLA 1IHOA 1KTIA 3ETGA 1UKCA 3OPYI 4MAMA 2XDQA 3O7WA 2EIXA 5B1EA 1UAGA 2Z2KA 2JW5A 3W5SA 4RKWA 1Z13A 1TF7A 1T8UA 1V5GA 1EE1A 1MVNA 1NF9A 5JPIA 1AA9A 3OLCX 3U3KA 2X5XA 1JEEA 2CNKA 1IZ7A 3L77A 4HAXA 3VOSA 5BV7A 2WUDA 1RPZA 4BNGA 1S8FA 1YVEI 2GLTA 3H84A 2I91A 2PWBA 2RHLA 4GWGA 2GVZC 4CG0A 2QRLA 3P0JA 4JOCA 4QUEA 2GSWA 3DM5A 3L0BA 5F51A 5SYNA 4DF3A 1UZUA 4AT1A 1LK0A 3UMBA 4G8CA 4F97A 1P2GA 4X61A 3VUEA 2IP4A 2PX6A 4P4NA 3VZDA 2OCKA 4LTMA 1N4DA 4AP5A 3DL2A 1LBIA 3NONA 4ZEXA 1KBOA 2VAMA 2FR8A 4R6XA 3D2BA 3A2MA 1PCXA 2VQ3A 1W5FA 2JGMA 3CR7A 1SBYA 3G0DA 3RQSA 5J4YA 2H17A 1XDZA 3B36A 1HPLA 1QFSA 2AG1A 2V9PA 1JIXA 1P4AA 2BFDA 2Y1EA 4FSDA 4BB0A 3ZKAA 5IKOA 1CQIB 2LGJA 3JPYA 4JI5B 1QQ6A 1A0OA 1HYGA 3R7AA 4HWOA 3L7JA 2ON6A 1THMA 3NJRA 1TK3A 1QKKA 4IQFA 1BMDA 3SBDA 3HO8A 3CH7A 3SP1A 4D9HA 3FYUA 3GGSA 4RETA 1O8CA 2WQ7A 2I6TA 2PK3A 1FSFA 3I9NA 4MTCA 4EI9A 1KEKA 3LP8A 4KSBA 1J0XO 2NUPA 2GJKA 4EUKA 1YL6A 3D7LA 3OECA 4IGAA 1O9BA 4TTRA 4W5TA 4I9GA 4MQBA 2WTXA 1NQTA 3T7IA 4LZWA 4AJJA 2DERA 2IHBA 3E0QA 3BWYA 3PHLA 3BL8A 4OB8A 1E1QD 2VJMA 3PD0A 3VR3A 1YU6A 2MYPA 3BE4A 3N7UA 3Q0EA 1TYAE 2I1LA 1G5TA 1F17A 3MLBA 4MCIA 3JQ7B 1PLKA 1RCUA 3A37A 1XMXA 5BV8A 3OE7A 1ECJA 4LF4B 3NHFA 4Q00A 4DCGA 1QVAA 1RYHA 1SBHA 1GSHA 3CZPA 3IV9A 1CF9A 4DYDA 1MENA 1ZLYA 5FI5A 2MSNA 4DRXB 2EG5A 2PX3A 1GGKA 4TUYF 5IAOA 4JIGA 1CR4A 2ERCA 4EJFA 3ZGOA 4HWKA 1AUQA 2WKWA 3F0TA 5DW3A 5IN4A 3RF6A 4DCNA 2C2KA 3A2LA 2FZ4A 3JU3A 5JSYA 1QIEA 5K6AC 2B1JA 3ETLA 3X3HA 1OBOA 2IHJA 3AUXA 5F3DA 1P4GA 3AFOA 4YP9A 2F8TA 4GI5A 3OH8A 4IDDA 2HK6A 1GTG1 3B8EA 4G8DA 5DWDA 5FJIA 5ARBA 3IAS6 1SQ0A 1U5AA 1X7DA 2VYCA 4Y2QA 3TOVA 3TGPA 1NZDA 3FCEA 3OQIB 4NMWA 2F8MA 1X0XA 3QKRB 4AYTA 2OGUA 1PR1A 2CVZA 3JQBA 3MNFA 3W7AA 3FJYA 4EG5A 4PIPA 5HGJA 3AF5A 1KPHA 3X1KA 3E9YA 4Y2XA 5JJIA 1NRXA 5H83A 1ELOA 2VHUA 1ZH2A 1WG8A 1N32B 3D3JA 1ZK2A 4R01A 3WQQA 3WHLA 2RAUA 4YPFA 1BCRA 1Q3KA 3LC2O 1B26A 3MJTA 2R7KA 3ER6A 5D3MA 1D9ZA 3F96A 1MO3A 3G2MA 3ZYZA 3TLEA 2RD2A 1O54A 1TM7E 4FEEA 1SIWA 3RIYA 5I47A 1NR1A 2ID8A 5T64A 4KOEC 3GLIE 4M1KA 5CR9A 3VNUA 5F2OA 2PUDA 2I2DA 5DDIP 4YAFA 4HRYA 4DARA 3EF1A 2PT9A 3INYA 2AG6A 5EP3A 1H6DA 1QNLA 1XRPA 2W6ZA 3RAPR 3IYLW 2VN8A 1TZKA 2P3OA 3G17A 4LDPA 4OAQA 4YJ2F 5FPTA 3AR5A 1N1EA 5JWRA 4IX9A 4UJ5A 2OHVA 4B33A 3ILVA 4EHBA 1PDWA 1KC3A 4EQ6B 2HHHB 1K8QA 1VSQA 1NYRA 3QA9A 3QVTA 2XGGA 1A1SA 1JQJC 1TA4A 2RC5A 3NO4A 4WY8A 4YA6A 5BOVA 1UXIA 3COWA 4WNAB 2QX4A 1Q15A 1BDBA 1RHRA 3GEDA 4L5BA 3EG5A 1W47A 1E7WA 3ZXYA 3A1DA 3QBTA 4CMJA 3DKRA 1SBQA 2CLFB 3QUTA 4TMTA 3ZQJA 4D8WA 2UUBB 1KL7A 1CTQA 1DADA 2FPRA 3WYGA 1K1EA 1M6EX 1WUYA 4WX2B 5F5XA 4EYKA 1AHHA 1QWSA 4Q1CA 5JY6A 3CSDA 4HXYA 2NZXA 3U6BA 1H0HA 4ZU6X 1KK0A 2JD2A 1NJGA 3I42A 2VPQA 3KTAA 1URPA 1FTWA 2IDZA 1Q12A 2O2YA 1XWWA 3QLJA 4M22A 4PGMA 1FOEB 4EEXA 5LIPA 4FFNA 2YIMA 3K1AB 3ONWA 1WXGA 2FW6A 2C3UA 4LRWA 2WHPB 4EFLA 3RADC 4PSUA 1C14A 4BLOA 3VNAA 3RHFA 4JJGA 2Q3FA 4C87A 3ZWYA 1B23P 3DDCA 5DJ5A 5TDHA 1T6ZA 2ZTMA 2ABWA 2OO5C 1T3TA 3KZCA 4TMXA 5CXXA 2X5JO 1L5ZA 2YWFA 1T9GS 2AHOA 2XUJA 3CLTD 1YJBA 3O75A 4KXFB 4YJKA 4YBZA 1N33B 3MQ4A 1O58A 4PLYA 4I4TF 3KJZA 1EFPB 1RTTA 5TPZA 1WP4A 2Q9UA 4O4IA 2ZUWA 5K3EA 4QJ5A 4WRRA 5FLXA 3NNSA 2ZFUA 1MP0A 1G38A 3AGQA 1V5IA 5DTJA 1N2SA 4AWAA 5BNZA 4ZT3A 4L72A 5HR5A 4QT4A 1OLUA 2A1TR 2VWPA 1RR6A 8ATCA 4WXEA 2EBWA 5KWSA 2GXAA 4GRDA 2CWWA 1FJXA 1OPXA 1JT2A 1X0VA 3KQYA 3D3KA 4NG4A 4HTFA 4O8ZA 4YMIA 3N2KB 1K5PA 5EEHA 4IDNA 4IGIA 3UC5A 2X7XA 3CF4G 3QE3A 5J2TF 3SQOA 4GLLA 5MHTA 1GTJ1 1FSGA 3CLRD 4CFSA 5IMSA 1TTHA 2HQ1A 4B35A 1JMKC 1G4UR 4YRKA 4Q4HA 4BX9A 3LNTA 3WKAA 3O3NB 5DU2A 3H5RA 3VKHA 2GN6A 2ZE6A 1XI2A 2FZEA 2QORA 3QTTA 3STHA 5HJ5A 2P0YA 2HZ7A 4YV2A 2WF9A 4NC9A 1RHJA 4ZU1X 3HI6A 4Z1MD 5FTLA 4H1UA 3PVCA 4MICA 3LCCA 1VI6A 3R0ZA 4DL9A 5T7BA 1ND5A 3P0IA 3R0VA 1REQA 3L6OO 3Q7TA 3UJBA 3VPCA 4MI1A 2G0AA 2IA5A 4HPXB 4S3MA 4CJXA 1MRNA 2V7XA 2X22A 1WBJB 1XD2A 3WADA 3ZDYB 4CIBA 1D04A 3DDWA 2IZOA 1DKPA 4U5QA 3DFUA 2PKCA 4ILEA 5LUAA 1U0OC 1U6IA 2XVYA 1CZOA 3AW9A 2WD7B 2EX1A 3DV2A 5D6NA 3RS0A 1GCOA 1WKCA 3N8HA 2D8MA 2X0DA 3EUWA 1NJ6A 1BVRA 2IYPA 3BRWD 5FPYA 4ZCPA 1N8SA 3FBGA 3T94A 2QL7A 3B70A 2B0JA 3H8VA 3SSOA 2OXTA 4K0KB 4MS3B 2Q8PA 5IKEA 5AM2A 4FWIB 4F2HA 1R6TA 5IBPA 2BRUC 3R3ZA 5B1DA 3OETA 4GYWA 2IIPA 4R3UC 4KP7A 1M2KA 5CP8A 1C8KA 4Y9RA 3QY0A 3JQGB 2ZITA 2DH5A 3X2SA 3NHZA 3K0KA 4HDNB 2OCLA 2EFHB 1PFQA 3AEUA 5AUNB 1QCDA 4YMTA 3O8NA 3TD9A 3ENNA 2JLWA 1QF6A 4CMHA 3KEMA 3HBJA 4V3CA 5DM2A 3O82A 5TQ2B 4F3CA 4FWTA 3KAJA 3VU3A 2BGWA 2I4NA 5BN5A 3IL2A 3CUTA 2VTVA 2WWFA 4F9TA 5DPMA 1QV9A 1BQ4A 2J8ZA 2C31A 4ZYWA 1FNSA 5F12A 5JNVA 4I9NA 1BU5A 2JGRA 5C7IO 1WB5A 4C7KA 1YONA 4CEHB 1PFGA 2VR1A 5FPPA 2CE2X 4JUBA 5F3RA 5FD8A 3IQFA 4RWZA 1OPRA 1QIKA 3IEXA 3FMFA 3E70C 1PR4A 2BW0A 5DYYA 5P8WA 3VHRA 1A9XA 3UMFA 5HYVA 1Q1EA 2ZRHA 3AI1A 4BNVA 4E2WA 1QO0A 4XX1A 1AVTA 1ZW6A 5DVZA 1ZJYA 3U13A 5L8VA 1DWUA 1PW5A 1TQ2A 2IYEA 4TTIA 2YWCA 5B2FA 1P9WA 3KKPA 3WK5A 1GPUA 1SOWA 4KYTA 1PL8A 2XCRB 1SXJE 1ZNZA 1U04A 3K9BA 1NI3A 4RK1A 2F9FA 5IG2A 2A5LA 2BCGY 2J08A 1C7JA 3HLYA 2RARA 1XVAA 4XVRA 5EE0A 4O2AF 2B4YA 4HDKA 1Q21A 2YV1A 1Y48E 2PTGA 1BD3A 4RVSA 2DMRA 1U28A 1MEOA 2EZ4A 1TAHA 3KR9A 5DHUA 1FMJA 1FQJA 5H3CA 3UAVA 3GLHE 3GCXA 3JW8A 2P9GA 1U8XX 2B2NA 1MJGA 3K1TA 3WYBA 2PFSA 4BNZA 3M33A 2XZPA 4G24A 2WNIA 3IVGA 1E1RA 3G7UA 3PNSA 3QKTA 4EL0A 4OHYA 1JFLA 3C6KA 3DPUA 4JR0A 4OUDA 1O5IA 4BLUA 1I30A 4E12A 4W1RA 4ZYVA 4JLSA 5BUCA 3UWKA 4H4CA 1XQ9A 4PE5B 3WMFA 1YGYA 3K4PA 4I0WB 3MMSA 4ROTA 1MEJA 2BGUA 4JI3B 5D7BA 4OI2A 2WU0A 1I4EB 3AEKA 5J1TB 1PF7E 2GEDA 3B6MA 4GOOD 2OK7A 4MKHA 3T4PA 4D57A 1GU7A 2SBTA 2ATEA 3B5EA 3I01A 5I51A 4J94A 2C84A 4H7PA 4Q3KA 1UMDB 3QVJA 2IEAA 2UVDA 4OKSA 5JHGB 4ZA2A 1DAGA 1PJQA 4J0EA 4WKNA 4A23A 3ZDAA 1W34A 1NC3A 1R12A 2B78A 3NCHA 1SBTA 4O4JA 2Z09A 3A9TA 5A3SA 5JAQA 1KSHA 1IBSA 2HPAA 2LIVA 2ODWA 4Y1GA 3R3JA 5AW6A 5CDFE 1E79A 2C9MA 3BERA 1P7WA 4GRIA 1P0PA 4K81B 4LHEA 4N18A 3VTKA 1WUHS 2ZG6A 3PRHA 2QZPA 3MCTA 5TMDA 1Y3HA 1ANKA 2FDXA 5H0IA 2IF0A 2GBLC 2JCBA 2OYCA 4DZTA 2WAOA 3RRJA 3DNPA 3ER8A 1LPSA 1QOZA 2O3TA 5H4HA 3EPLA 3TM5A 3CFYA 3CMMA 3UK2A 4D79A 3RSQA 4Q1DA 1T36A 1A76A 4D4JA 3MHTA 2YY5A 4U8GA 5G0SA 1FP7A 4R8KA 1QRRA 2CHFA 4EUSA 2FWBA 4CMKA 1M2WA 1MGOA 2EW2A 1JTVA 1NPDA 4KR0A 4ZDIA 2BMEA 2RHJA 5KTRA 4IZHA 4ZXFA 4PR0A 1YKSA 1CDOA 2BBSA 2PJDA 5BT9A 3F47A 4MUHA 3ILSA 3IKMB 4CL8A 5JCXA 3CWZA 4G5QA 2VJBA 1E2HA 4P32A 1DLJA 4M60A 1JZTA 1SUDA 1OT3A 1QHXA 3F6YA 4C43A 5I8PA 1Z2NX 3ND8A 4MP6A 4FI3F 3ASZA 9ABPA 1ORRA 4LV8B 4C0JA 2B5VA 3EZYA 1DG3A 2M6KA 2Q5FA 2ODTX 2WSSD 5HDBB 13PKA 2H3HA 3E81A 4DR4B 1RP1A 2D0IA 4QEKA 4KUGA 3KUKA 1IBCA 2QTHA 2JFFA 3MYRA 2C3MA 3DHEA 2PLRA 5ISMA 2VTBA 2DU8A 1PNTA 4AJIA 4YRMA 2YW2A 4KKXB 1B15A 1B0ZA 5KVCA 3OM8A 1LRJA 1JB9A 5K99A 3MTAA 3ONNA 2II6A 4B3HA 4JI2B 1Y34E 4PPQA 3PXXA 4UOQA 1P0QA 2AFHB 3FFBA 4Y2PA 4Q37A 2ZT7A 4IIEA 3ZYCA 2G7ZA 3RBVA 3DP7A 1PNVA 1NM5C 3W5AA 1R8YA 1IHPA 1WU7A 2FLVA 4POOA 1RI2A 2E1RA 2F64A 3A26A 2BE7A 2CXPA 3NAZA 2ASVA 3U4AA 3NYIA 4P7GA 4RUKA 4B6PA 1K8ZB 4ER0A 3W9UA 3MWYW 1PJLA 1AZTA 3RVRA 1RC1A 1ZA1A 1XZHA 3WNCA 3FAZA 2DC1A 3ZV7A 2CVFA 3QNMA 3VM6A 2BR4A 5HXAA 5F5NA 3TE7A 1B2LA 3D81A 1J8FA 1SU7A 4OH1A 5B57C 1UJCA 3HDVA 3HKBB 3KQMA 4RVCA 4BNMA 1I3MA 2G1PA 3SJCA 3JRWA 4DUPA 4E3ZA 3JWIA 4M7RA 4CIYA 1CIVA 4M8LA 2HMAA 4N41A 1GM5A 1OLSB 3GLHA 1N4AA 3JYPA 1RE1A 1GTL1 1S01A 2Q6TA 1AURA 1ZGCA 3RG8A 2FZKA 4MQLA 4MR9B 5DNDA 4XRGA 2B69A 3FWZA 3EGWA 4LOKA 3T38A 4PPFA 2QRZA 3K20A 4N3CA 3GLQA 2EXXA 4ESHA 2HUNA 3UJNA 3QEKA 5AHOA 1ZL0A 4HHEA 2C5HA 4LWOA 4UCQA 4BMXA 1ZGZA 3DHWC 3I2JA 4D9EA 4DNXA 3EDRA 4L27A 4Z7JA 2GGSA 1PLLA 3AERB 1JLKA 1TLFA 3DZ8A 5ALIA 2QU7A 1HFEL 3FVTA 2GNOA 2ZUTA 1ZC4A 1A9RA 1PZXA 1JDSA 3PCRB 3QMVA 5JQGF 4JGIA 1U1CA 4NF2A 1VCHA 3SG0A 3IBFA 1J33A 2VNJA 3N70A 3RFTA 1FFGA 3LX8A 2R6HA 3OX2A 5TB5A 2BP7A 1QV7A 3GUYA 1XMPA 3PRYA 3ITEA 4JB2A 3E6AA 4GC5A 5CDFA 3VBEA 4B4UA 2F8SA 3ZW7A 2H2WA 4BMPB 4CKCA 3OTQA 3UOAB 3DCIA 4QFBA 3OFND 1Z0FA 1MMFB 1HSZA 4P6VF 2OM6A 4HFJA 4J16C 5LXTB 1KK1A 3AB7A 3AKYA 1NT2A 4NMMA 1RM3A 5H1YA 2XUPA 3OOJA 4ZYZA 3OT4A 5BXQC 5HJEA 3N2IA 1Z7BA 3DE4X 4KIJA 4MWDA 5IJXA 1UKBA 2XMCA 3T95A 1YJ8A 4OY3A 4B09A 3LDFA 4EG7A 2IY7A 2ZUFA 1JR6A 4G4SP 3DBLB 3GGDA 1ZJ4A 1EUDB 4CM3A 4W5JA 4B3FX 2C8JA 1OY1A 1E2DA 2P69A 2Y92A 4OQQA 2VDNB 2MINB 1Z6XA 3OZVA 2FMFA 5AKGA 3X43A 5KYWB 1VRVA 2V6FA 2QUHA 1ZVKA 3FUVA 3HA2A 2Z30A 3JQ8A 2DFPA 1BXGB 2A9PA 5IDQA 1YNOA 2J5RA 1C8BA 5HIAA 3GG9A 2QZ4A 3KO8A 1FU7A 1U80A 4PV7A 3TOXA 3NKFA 1MNAA 3PL1A 4PYOA 3ZXIA 4NDZA 4BO2A 3ZVRA 3LVBA 4B4KA 4G86A 1YMUA 1XB2A 2JHGA 5CJ2A 2ZWMA 4ECEA 2H5JA 1LK5A 4EECA 5BVGA 2HBRA 3ZZ1A 1I3NA 3LYUA 1UADA 2JIRA 2YC4C 4N40A 3ZNOA 4NULA 4BP8A 1EUCB 3G2LA 2LDBA 4X84A 1J5XA 1LEHA 2P6RA 1T3SA 1Y1SA 1PS9A 3VZQA 3IBTA 1VRWA 1XN1A 1RS0A 2C0CA 2WILA 3C5CA 4GF5A 1T9HA 2X14A 2YNMD 3ANLA 1NFQA 3QUCA 1ZBDA 1GITA 3PUZA 4ICIA 5ER9A 1A8UA 2ZAGA 4AK9A 2IOQA 1E1DA 2JLSA 2YZMA 3NALA 1RXCA 2IC5A 1WZIA 3BMOB 3HY6A 4MNTA 4YACA 2X0EA 3ZWDA 5CGZA 4ZAYA 3T4EA 2OP1A 3MINA 1V8OA 2HL6A 2Y1WA 1NMEA 2I4MA 2Q8QA 4MWEA 3IQHX 5JO9A 2RIRA 1BCSA 1NZJA 4YUWA 2LCIA 4TS4A 3DDHA 1LSOA 1PTJC 2Y1XA 3LBYA 3PGMA 1HDZA 2W6IA 4J75A 1GL6A 1NJSA 3COZA 4LJYA 1NWCA 4YCLA 1KEZA 4RA9B 4QJ4A 3MS4A 3ZU6A 4H1HA 4FBMA 5FWDA 2EL9A 5BP7A 4LWZA 4M87A 2NP7A 4GIBA 1MH1A 2AOUA 1WHTB 4KVFA 4OOEA 5U4XA 3HUTA 4N39A 3GFVA 3HB7A 3H9UA 1A3CA 4OBXA 4AAYA 2YCLA 721PA 1CS0B 2ID9A 4EW6A 4P58A 1ONOA 5THXA 3QVGB 1W4AA 4TRRA 1MF7A 1T3LA 1KGDA 1USKA 1Y7HA 3QENA 1YBHA 1NL3A 4RSMA 2QN8A 5H7XA 1TW2A 4QYXA 4A03A 2GEBA 6PFKA 1J4AA 1QGAA 2CKDA 2GZHA 2H11A 4YDRA 4D9BA 5ADUS 1WHSB 4AC9A 1NP3A 4PYQA 4DVGA 2CUKA 4TKVB 1HQCA 3L5OA 5KTSA 1JL3A 1QOQB 4DPMA 4DIMA 4F12A 1FDVA 3AU8A 3WLJA 4KLRA 3STVA 3WB9A 2Q8NA 3AY3A 3QNWA 4HTAA 1OGIA 1M1YE 3DNMA 2KI5A 4C2AA 1QR6A 4I1YA 2FUG1 4EHHA 2EDAA 1EVIA 2R86A 2PQ6A 4RIEA 3BT7A 4NE2A 4YCSA 2O8DA 1X86B 4QJIA 1XTSA 1TZJA 2PT5A 1LGYA 2VLBA 3DOIA 5LKRA 2IH2A 2B99A 4TRMA 4Z0TA 2CHEA 1MXHA 3H2ZA 3U60B 3QIVA 4RSRA 1JYEA 2Q3EA 4BMVA 2Q2VA 2IT1A 2XQKA 5ALWA 4ZYUA 2J9FA 2FN8A 2VF2A 2DBRA 2LP4Y 2Z5FA 2R7MA 4V0SA 2PG3A 3RU2A 2KSQA 3TS1A 4MW6A 3W0LB 2HRQA 4G1UC 1T6NA 4LRSB 1G5RA 1XVLA 2O2GA 4GKBA 4MQ6A 3DMNA 1A4XA 2QMQA 4XSGA 3RS5A 1XRLA 1USUA 1VKRA 4J76A 1DC7A 1YQDA 2EFDB 2ISQA 2ZVPX 3A58B 3L7BA 4LYHA 3L0OA 4X6XA 2JLVA 5KYUB 1A8SA 2FX3A 4KWTA 3QXSA 2Q3LA 4L3WA 1QU2A 1W88B 4R16A 3K0EA 1XRNA 5ITWA 1EWQA 2OSVA 5LZ8A 2RHCA 1JG3A 3PX3A 4FEGA 4IF4A 5LP6F 2NP6A 3F6SA 4FOPA 1CNMA 2Q9BA 3F46A 1LF0A 2M6LA 4EZBA 5KSOA 1TEXA 5ARDA 2Z2IA 1A4UA 2HWUA 4P98A 2G28A 4EHKA 4I5GA 5I9NA 1SCUB 1TIPA 3P97A 1U99A 3DCNA 1PQWA 3QFCA 1CYEA 4ENVA 1XAIA 1P5RA 4HATA 2I8LA 1D7OA 2WEKA 1D4ZA 1J1ZA 1ZU4A 2PWPA 1V96A 5EEGA 1RWXA 2HKIA 3I12A 4NCBA 1VFPA 1F51E 3VZBA 4DABA 3DE6X 1A69A 3EPHA 3ID6C 5A9RA 2ARKA 5EP1A 5KQRA 1IXZA 3ZK8A 4DCUA 3EWNA 4C78A 4K8RB 3DA8A 1X1AA 2OORC 3TQHA 4A27A 2ZM6B 2QZ9A 3II6X 3IE1A 1G18A 4DQUA 1IB6A 1V6CA 3BMXA 3EPJA 3JQ7A 5K3OA 1RAAA 2XY4A 4GICA 1CY6A 3GJ4A 4JL6A 3PYXA 5CW2A 3A9RA 3BYZA 4TLBA 5KTYA 1VPEA 5FTNA 3AVYA 4RHEA 1XNQB 3HLKA 2GESA 3SJUA 3WYDA 3C3AA 4ZREA 1FFDA 5EHQA 1YCFA 2O19A 1LNQA 9LDTA 3M6FA 3QK7A 2F43A 4M9XA 3A2NA 4OREX 521PA 3WWZA 3V2GA 1PR0A 4US0R 4KR7A 2CNDA 3VR3D 2WVAA 4JSTA 1PFKA 4L4YA 4D7AA 1XZ8A 4AYXA 4PAQA 4B45A 3ANTA 1FFXA 1L5LA 5TEVA 1XK6A 5C37A 1LSUA 1GA4A 2PGNA 1ZXLA 2RGUA 5TS3A 1JI0A 1ID8A 2FPWA 1Q1ZA 5A1JA 3GEEA 2E4AA 2C7VA 4MW7A 2HA0A 2P35A 4NWIA 1E9SA 2COUA 3H3FA 4PX3A 4RK0A 3MRVA 1MIOB 2OAEA 3UZUA 2EGUA 2ZJ1A 3HMQA 5J5AA 4RQAA 5TT0A 2DVMA 4E13A 1ZGBA 5FOXA 4ESVA 2W2MA 4EG3A 3PR1A 4OFBA 4MYHA 4DEVA 1R6XA 2HGZA 2PUJA 1MPXA 1IEVA 2FX2A 1OVMA 1IDN1 2WKPA 5AVZA 4D46A 4HMQA 3GK3A 4D97A 2NXEA 4LJSA 1I4WA 3ZE8A 4MUAA 1QYXA 2H63A 1L4BA 4ZCIA 1YUMA 5EUCA 1T34A 1M1YA 2QJFA 5BSKA 1YI1A 1C7EA 4ENSA 4DQXA 4M54A 4KGZA 3D6JA 5A04A 3LIIA 4LTNA 3RRBA 4B3GA 3F1KA 1H0SA 1ZNQO 3B3GA 2PY6A 2YDXA 3UJAA 1EFVA 2NU6A 1KSGA 2YZKA 1Q7GA 2BZ0A 4GYJA 2I4TA 2KQUA 3OP1A 4C0AC 5JSUA 4HMOA 4IILA 3A6PC 1YAJA 4U7PB 2J3HA 2RIPA 4EHLA 2BTEA 3B6IA 3DOUA 3KXIA 2PSJA 4Q39A 3W7VA 2WR8A 4NIMA 5FTJA 5F76A 4OLBA 2H1HA 1D0SA 4II7A 3HCAA 1KAMA 4BCBA 4JWTA 4J43A 1Z6YA 2FUCA 1UFQA 2WA2A 2Y1KA 3F6EX 5JYBA 2PH7A 4DCTA 2O1XA 3ZGZA 3AJAA 4MO2A 1UPXA 2LCQA 3CEPB 1DIHA 1IK6A 2IDKA 1P2BA 3DEYX 1F0KA 2A67A 2J0UA 4MMYB 1V9CA 1NPTO 4OX9Y 2WHPA 4EUEA 2QRVA 2IPLA 2IXFA 2AQKA 3A25A 5ERYA 3RUAA 4JBGA 4CV2A 4Z3OA 5CT5A 3MUNA 2CBGA 2HREA 4QA9A 4QUHA 5IANA 3KSAC 1IHYA 3G2IA 2ZUEA 2BBOA 1WEHA 1XK7A 3UC9A 1KMQA 1Y1PA 3QYPA 4PQEA 2WZBA 1ULUA 1KIFA 3S1SA 2ZYTX 3ZGLA 4YHBA 2CXTA 1M54A 1V16A 2Y1LA 2PMFA 1EAMA 2EOAA 5DM60 1E5TA 3GVHA 1TEZA 5CT9A 2QBYA 1T91A 2Z6AA 2RG7A 1QX3A 1Z0UA 2QW8A 2CKMA 3NAMA 5IC4A 1GG2A 3N75A 4FEYA 1W19A 5EQFA 3JQ9A 4RA6B 3ZHYA 2W2OA 1M0SA 1BKDR 1CKEA 4M1OA 2FX5A 3HZHA 5FL3A 5I7EA 1FEZA 2Q46A 3IH5A 1QIJA 3LUCA 4KGVA 1ISJA 4UUPA 4EMBA 1RM5A 4MGZR 4PPNA 3UF0A 1Z36A 3AV0B 1OMOA 3L7YA 2W0SA 4RACA 4CDMA 5L4SA 2FK8A 1ABBA 1LDMA 2Q21A 4L15A 1SRQA 4EENA 1ADGA 1I1OA 4KFUA 5TPZD 3B82A 5AIBA 1V71A 2CHGA 3DO5A 2G77B 2O8FA 3I2FA 3S68A 4IUDS 3RI3A 3FD8A 4CT0A 2ZS7A 1UBCA 4QECA 3CF2A 3K53A 1STOA 3PYLA 3ORQA 3G0IA 4I8IA 3VVLA 4XD7D 1VZ2A 3BAZA 2PR7A 4HUJA 5B7QA 1AMNA 3AMVA 1I5EA 3R23A 1DP4A 4TLDA 3H16A 4RD2A 5TPWB 5AW4A 4OHFA 1U7HA 5DM1A 3OIWA 1U3FA 2F4NA 1U9IA 4P4SB 4W5WA 3QWFA 4IWXA 2JIOA 1XTRA 2H1CA 2H9AA 3M4ZA 3OUUA 3PHJA 4I14A 3RAFC 2XVXA 3IIIA 3NBUA 3VXKA 3I8OA 1QONA 2YV2A 2IBSA 1L4LA 4G1BA 3VO9A 3AL0C 4FZJA 4A8JB 1DG1G 1ENPA 4ND5A 3RS8A 2X8LA 3GFFA 1R6UA 3TUJC 2QVGA 3GGOA 1NLYA 2HWKA 3I9V6 3VAAA 3N7TA 3ESZA 1FTQA 3PPWA 3NG1A 1Z33A 2MTBA 1OZHA 4FE3A 2UZ1B 1WNTA 1PU2A 1KH2A 2FN4A 4W63A 1NLFA 5DHPA 2HMSA 2ZTUA 4TWZA 5EQTA 1C3LA 3KSDO 4BV3A 4QUBA 5HM8A 2OUKA 2PGDA 2RBGA 4LK2A 5COQA 5BWCA 3I28A 1XUOA 1YB7A 3BVPA 2P9HA 4HDNA 3H8JA 1U2DC 5KZMB 1Y8AA 3MB8A 4EYOA 2JFXA 4ESEA 1SUAA 1X3LA 3K94A 1Y81A 3R40A 2JLZA 4QG7A 2JL1A 4OJKA 5L45A 3DZHA 1JPUA 3X2EA 1NW6A 5CFPA 5AFSA 1XEAA 1O9HA 2AN9A 4LWPA 2BEUB 5HQJA 2E5LB 2A5JA 4ZV4A 1HOXA 1WUKS 3SF0A 3JD4A 3SSAA 1EGQA 2ZI3A 4HF7A 4MV1A 2ZYVX 4M1EA 1N25A 3QF4B 3PXGA 1JHYA 1HE2A 3BFXA 3DYIA 3UWPA 1M2HA 4WCFB 4LFBB 3QYAA 2AJDA 3Q40A 3RC7A 3VA7A 4QGSA 1U8AA 2D59A 1SZPA 5EJIA 5EKTA 5EKXA 3RFXA 5B3JC 4O4IF 2I80A 4ABTA 2BEKA 4DTCA 1J0EA 1HXHA 3RSCA 2V7PA 3K70D 1ETHA 1W0JA 4BFTA 1ECCA 2HIHA 5BR7A 5HZMA 1DG9A 3HCFA 2PRJA 5BN3B 4MPJA 1J2EA 4BRUA 4FHEA 3UKDA 4V0QA 3EPRA 5BYKA 1Z4IA 2AFRA 3HJAA 4TT3A 4FHZA 4AUEA 5DP2A 4EGCB 3P20A 2L0XA 5KI6A 2XQGA 3SQXA 4YJHA 4YUVA 3R7DA 3W06A 2YHIB 2PXCA 5CCBA 4J1TA 2RGNC 3EN0A 1BHO1 3R44A 4QBFA 3GJ7A 1NVAA 1SVMA 4EO4A 3RLIA 4Q7QA 4BAZA 2XYPA 4U6NA 4DKXA 4M3NA 4V0NA 4YREA 4WBNA 4LY6A 5I4CA 3ECAA 4Q03A 1QO0D 3GYBA 1G6KA 4ZO4A 4PHHA 2ZI4A 4R9SA 2I7CA 2PO5A 2OT3B 4OHXA 3UW1A 2SCUB 2O3SA 3SX4A 1BE1A 1U3GA 3IKJA 3VOAA 2BCEA 2JFGA 1Q0ZA 3PXEA 1FPQA 2GKGA 3HU5A 3HXKA 3MLEA 4EVIA 2VQEB 4CU5A 3EQ7A 3G9TA 2WAYA 4GOND 4MYDA 3FUXA 3REOA 4GMHA 3ZCXA 1JA0A 1XQ6A 4ZC1A 5GWXA 4YRAA 1V8BA 1SUSA 2FZGA 4O59O 3GT7A 4NCNA 1CNEA 4X92A 4EKNB 1SB9A 3HCEA 4GRAA 3KKQA 4Z53A 4KWEA 1N3BA 1G63A 3QFSA 1WCWA 2QK4A 4A6XA 1HNWB 1UMDA 3NT5A 4HOYA 3P5SA 4MKFA 2OBNA 4RADA 3SIWA 2X4IA 4KK4A 5K3BA 5H8WA 3OJ0A 4LJKA 5FA6A 4N3NA 2VDRB 1E1RD 1VLQA 4RIHA 3RK4A 3HXTA 4TWJA 3GAFA 5FNZA 4RY9A 3ORHA 3VNQA 1UANA 4FDVA 1FYDA 2WABA 3WQRA 4KMRA 3U37A 4BCDA 1UJ2A 4UAGA 2G70A 3HDHA 2X8WA 1SM4A 4RS3A 1S0UA 5HIMA 2ERXA 4H31A 5LOVA 4OAPA 2Z1NA 2FPSA 3N0RA 4X3PA 1QYIA 4EK9A 3FROA 4J0KA 1MJFA 5H3LA 4YDHB 4Z5XA 2XITA 1XMJA 3KZVA 3SFTA 2XZLA 2DWUA 3H9GA 4E2XA 2DR2A 1Z22A 4P83A 3W2IA 4YCMA 1JEYB 4UAUA 2C1EA 2WF8A 1C8VB 1BX1A 3L06A 2VYFA 2XKAA 5HGXA 1O96A 4Q4LA 1T0JB 2EDCA 3IVMA 3MAJA 4FDUA 3RC1A 3SF8A 4AZ0B 3IMCA 1B74A 4FFMA 4DJTA 4LC0A 4E1VA 3GUZA 4GUDA 2GCEA 8AT1A 5C51B 1E79D 4DQ0A 1GLVA 3U4CA 2Q2NA 5J59A 3SE0A 2ZRLA 1JQBA 4KVGA 3HJFA 1EFDN 4D56A 1E66A 2RH9B 1P2TA 1U7UA 3HM9A 3R24A 5IZ4A 4Q66C 1PGJA 3MBOA 4D4KA 4E32A 3ZWBA 5JAIA 1Z37A 3RIEA 2IRWA 4OYRA 4LX8A 3JAWB 1SVKA 2ZSKA 4FZ5A 3RRZA 1U94A 2AJBA 3EWAA 4K9OA 2WTBA 2M98A 3MGKA 3RREA 5AUOB 4DCPA 4F04A 5KTPA 4M4SA 1E2GA 3WBFA 1JEDA 2Q6OA 1W5SA 3GFBA 3MTBA 3DKVA 1CW2B 3THOA 2YV4A 3TMYA 2FUEA 3D0RA 4I6GA 1DV1A 4D82A 5EPUA 2AFHA 1QGUB 3MG9A 1I5RA 3FGOA 4MRNA 1Q0QA 2V58A 4YO8A 2HM7A 4AS2A 4GOKA 3TUIC 4ZOQI 4CEIB 4MLCA 1SD1A 5IMBA 4C4OA 3ADOA 2M6RA 1T4CA 2X9VA 3MCAA 1SC9A 1RJ9B 4Z8XA 1KAQA 1YQXA 2PA0A 4HPWA 1UIMA 1VTKA 2ZEJA 4ND4A 5HTKA 4E5UA 5L53A 2YS7A 3NHMA 1ORVA 2ZVQX 1Q5PA 3GQBB 3VSAA 3EEBA 2YMQA 3Q2KA 1SG6A 1J1UA 2RHHA 3I2IA 4MR7A 5M34A 1W36D 3T1HB 1ZZGA 3CURA 3O9MA 2P2YA 3DGEC 2L17A 1PX2A 3C4QA 2HCBA 2LRHA 3ASYA 3A3OA 2A5DA 1Y98A 2B1RA 2SKDA 2XR1A 4IINA 3F5MA 4QAJA 5CA0B 3FOBA 5IJWA 1TMKA 3OU2A 3LWBA 1JG2A 5D3QA 2FY8A 2EFEB 1OLSA 2G6BA 2ZROA 2AD5A 3L0DA 2VF4X 4RKRA 4CKBA 3KD2A 3G0HA 5C4MA 4O4JF 2G6TA 3AP1A 1H66A 3Q5GA 3UAZA 4LRUA 5FYQA 3A9CA 2P2ZA 3BE8A 3KWJA 3WICA 3THXA 1ZC3A 1N6HA 2HU8A 3IUEA 1HYBA 1JYSA 4MQ4A 5DI3B 1VI2A 3KT8A 3MHPA 5B36A 2TYSB 1L7VC 4DJEC 3B1WA 3JARB 1V8ZA 2H1IA 3SHQA 1RRGA 5B5SA 4I5FA 3TL3A 3H5WA 1IXKA 2GRJA 4EB0A 4RKEA 3K4HA 2WUFA 3U7EB 1G8KA 1ZDMA 1RMYA 3D5QA 3AERA 5HE9A 5HW0A 2D74A 2OFXA 1YIDA 1B6GA 1G1AA 1M8KA 1H05A 2FA9A 2AE1A 2OHXA 3CLSD 2HYDA 2DHQA 3GB9A 2YCBA 1QIIA 3IV7A 4UXJA 2VKQA 2RI6A 3C98A 1RAFA 4MJXA 2ZIFA 3DV9A 4G0MA 3DP9A 4BNJA 4DCMA 5E3HA 4Q1BA 3AXTA 2HO4A 1IY8A 4GKAA 4IGEA 1KMNA 3IMKA 3LQFA 1T5OA 3IVCA 3JATB 3KYDB 3ZNPA 4JP1A 4Q7KA 5CITA 4TM7A 1QHNA 1UBGA 2OBMA 2ZVJA 4Z54A 4BV9A 3OQNA 3ELBA 2R1TB 1LSJA 4DM4A 4LFAB 1JQKA 3E27A 4MV4A 3RVLA 4UTVA 5AVWA 4ZICA 2QG9A 2QR2A 4M88A 4ITUA 3ANYB 5LXTA 3UGJA 1XN4A 3AOEC 1U0GA 2NTNA 1P0FA 3D2LA 1RYMA 2BLNA 5EE1A 4F56A 5EFOA 5T4HA 5ALRA 1VE1A 2HXYA 3C3DA 1KKLA 3ESXA 3L3BA 3NWJA 1AS0A 3O8QA 3NT2A 4BO3A 5FP0A 2O8EB 5JALA 2PD4A 3SR0A 5CFQA 3CNOA 3NQ41 1RJGA 4ISBA 4C21A 4DXAA 1IG0A 5EWJB 4BLVA 3EMVA 3S3TA 3ESAA 1K63A 3K0HA 2X8JB 5CVJA 2FE1A 2O8BB 2BSQA 2V9ZA 2TMGA 3A05A 1BXGA 1U7WA 1E3JA 2G09A 2JZOA 5E38A 2ZRNA 1TUBA 2C94A 2AIRA 1NN3A 1MABA 4CM6A 5HZGA 5IAAA 1T0UA 1TRHA 2PKWA 4KRGA 5DZSA 4F8YA 1NF3A 1ZCFA 3AUTA 4FE7A 2F3QA 3BA1A 3UTDA 5K0JA 4JLAA 4HH4A 4FUTA 1X7XB 1Q17A 1FFAA 2HA3A 2ZE7A 4ZQHA 4ADSG 1ZJWA 3I62A 3IKVA 1AH2A 2GQ0A 4E4RA 2H48A 4XQGA 1VZ3A 1Z8NA 3I52A 3ZWOA 821PA 3B38A 1DFIA 3A36A 3N2YA 7YASA 4LF8B 1VBFA 3HK2A 1JDVA 3S5UA 5FR1A 4Q5IA 1TPYA 3UXYA 5EI5A 1KZ1A 1C0LA 2NSHA 4I1IA 4D81A 4EVRA 1H4TA 1NQWA 2HA4A 2AN4A 5JATA 1GTMA 3G2QA 2IPAB 4ZCTA 3M6UA 3P7MA 3B3QA 3LCVB 4U7WA 1Y82A 1JQ3A 2ZJ6A 3WHPA 3DTNA 2OOSA 5D85A 2ZBUA 4LNUB 1JAHA 3D9QX 2GK3A 4PC1A 3ZBQA 2EJWA 1PVDA 3PXCX 1HNNA 4NOMA 1GP2A 1KQFA 1E2MA 5HA5A 5JH7A 4JB3A 3KPUA 4ML3A 1P1BA 2BVNA 2R4UA 1E2FA 2X76A 1QHYA 3W2GA 3WQSB 2NG1A 4B47A 2C07A 3MWDB 5B7NA 3LE8A 3EC2A 2WVJA 3UT0A 3I01M 4M8SA 1I6MA 1YCHA 1MW9X 4UEJA 5FAXA 5AVRA 3AETB 5GJBA 1QP8A 4DM3A 1T5DX 2IJGX 4I4CA 5KC9A 3EXAA 4MWOA 4JKIA 3RSLA 3FZQA 2GDJA 2QM0A 3OU7A 1IJBA 1FUKA 1O97D 3WB0A 4AJ2A 2QMHA 3IC5A 5FTWA 3SXPA 2HT6A 3I9MA 3L43A 4MWZA 3NRCA 4YJDA 3EXHA 5LNK1 3FFAA 3QF7A 2FWPA 1HORA 1Q7EA 2GEVA 3A04A 3E05A 3KUDA 1ODTC 2PFGA 4QTYA 1JSCA 3QBDA 4KBYA 5HBRA 4F5DA 4TX1A 1ONNA 3DXZA 4YI3A 4KH1A 2XEXA 5IJ9B 4UNNA 3C3PA 2W6ID 3L92A 1WHSA 4IDOA 3V7UA 3U5TA 3WDMA 5E4TA 3THSA 3KHTA 3R7LA 3FLEA 2ZPUA 4HDCA 4JC8A 4KDFA 4LA4A 4NCIA 3C74A 4IJWA 3OWXA 2X58A 3ICVA 1T5IA 4KE6A 4OM7A 4RK5A 1PT6A 2D0PB 4YMSA 2VFAA 4QLOA 3G5UA 1QYDA 4P5EA 4OL0A 3M1YA 1SNYA 4JBNA 4RU1A 3IAFA 3RANA 4EFNA 1N2XA 3OPNA 4PPGA 3E0XA 1KQNA 3VQTA 2QGZA 1AGYA 1FFWA 2H1LA 2FW7A 2HJWA 3BCHA 3BHJA 5FA8A 2Z04A 3ZX5A 4MR8B 4ZALA 1LPBB 2VXCA 1G9SA 3W2EA 1GZ5A 2WAXA 3KTOA 3Q9SA 2BSAA 4KFSA 1LRKA 1RKVA 3I37X 3Q1KA 3GGGA 3C8HA 1NBWB 4PVCA 5GONB 3VC3A 2P5YA 3PDJA 4LXTA 4AO7A 3A6EA 4QWWA 1PL7A 4L8VA 1AQJA 1EM6A 1WXDA 2PZ8A 2XODA 4Q7JB 4R0VA 3FDJA 3T8YA 3GJ0A 5AD1A 1TYBE 3SU8A 4WASA 3SHWA 1SBCA 3HMKA 3RBAA 3CX8A 4MDEA 1IQ0A 4H4EA 2P79A 4RORA 1YACA 3L8YA 3WRXC 3SQMA 5K4GA 4MHSA 3D3WB 1E7QA 3DFMA 4N3AA 4DJJA 4RLFA 4G97A 4ER7A 5K03A 4HQ0A 1DUIA 2V5UA 3BB4A 4URWR 5A3VA 3KLPX 4LNAA 2J1LA 2Y67A 4QFCA 1L4HA 2OR3A 3RFUA 1UC9A 2O0MA 1AKWA 1D2EA 5HF6A 3ZWXA 4YRCA 4KPUA 3V8EA 3RJ5A 4IHKA 2BZ1A 2PMEA 1DCMA 2NXCA 3ZHVA 4FCTA 2UZ3A 3ZQ6A 4X85A 3DEFA 3ZS8A 3RGGA 1KWKA 4BPBA 4JT9A 1HSOA 2B1GA 1QHEA 3VHQA 1QDLB 4JJEA 2IUYA 3SBEA 2A14A 4MCJA 2QLFA 2AR7A 1TJYA 4MGYR 4EZIA 2DBQA 2H4FA 4N0PA 4UPVA 5LBIA 1L7DA 2O5VA 4UHEA 4J2OA 1JXQA 2XX3A 1JJVA 1U0LA 3OZ7A 4NICA 4G09A 5BSUA 5KQSA 2UZ4A 1ARZA 2I4IA 5FWNA 1YZQA 1EX7A 3IEMA 1VBNA 1YB4A 1M7GA 2AFIE 1OX6A 1JHOA 3NEJA 1CUSA 1QKIA 1TCUA 1S8NA 1TZ2A 3DZGA 4WBSA 4ZV7A 1G6HA 1ZEMA 2OAGA 2WFZA 4R1QA 3DYVA 4PAMA 2H85A 1O94D 2QE7A 3G0OA 3G8YA 3CC8A 1AKEA 3A7EA 4G5HA 3NMUF 2VK8A 3LGSA 5TS2A 5EG5A 1FFBA 1DAMA 4PQFA 2CLDX 1J8DA 3ORFA 2F7SA 4IQ0A 1KKUA 4K8OA 3TPFA 4ERNA 3P2YA 3WO0A 1OCEA 4RKQA 3BE5A 4WOKA 4Y9SA 2QRHA 2EBUA 4NEQA 1ZUNA 5HIKA 1Z28A 3T6KA 4R51A 1G6Q1 1JLLB 1KJQA 4P86A 2YMLA 5ALOA 4C07A 2RK4A 1O5OA 1QYRA 2PYZA 4I2VA 1CHNA 2ZIWB 4NBRA 4O02B 4XJXA 5E6RB 3IR7A 4C4YA 1C2YA 4ZKEA 2ZAMA 3NW9A 1FJGB 3CQ9A 1UOPA 1BRTA 3PQ8A 3QBEA 2WG2A 2IYQA 4N5LA 1VXRA 2HA6A 2BUCA 1Y0BA 3PIRA 3UFBA 4HDMA 1CZHA 3H9CA 3GFTA 1R0RE 3L4KA 3U19A 1MIOA 2C9OA 2QVXX 4XTRA 4EQZA 2I55A 1E6CA 1LDYA 5GGXA 1TC2A 4RZXA 1JLMA 2AKAB 1U3WA 4B4OA 4LBZA 3RHTA 4ZVSA 1MHPA 3T9FA 1QB8A 3DBHB 5DGCA 2WOOA 5DIZA 4X1YA 1SBIA 2WIDA 4A15A 1I7DA 4NDNE 1P5FA 4TROA 4URFA 4E2FA 4BFCA 5LZ7A 3WL6A 1PGNA 3B9RA 3QVMA 5IVIA 1P4HA 1ZO8A 2XDYA 5KOHA 4CEJB 1JJBA 3A3PA 3LPAA 4WEOA 1X7ZB 4ZODA 3GCZA 5KSYA 1MH9A 1ISIA 4FZ3A 1J7JA 1BNCA 3KYJB 2Q1XA 3BPSA 3NC1C 3UT5B 1U8ZA 4HNGA 4NR0A 3K73O 4XYGA 2CC2A 2Q5JA 1CE8B 2GKSA 2Q28A 3PCXA 3M9XA 1F4VA 1JR3A 4MHTA 5H59A 3EGXA 4KR9A 3SWWA 4DC0A 1DDGA 1F8GA 1B6TA 1SC6A 2CLHB 1GL7A 3FW1A 4RJIA 2IUFA 2PZGA 3I8SA 5E4FA 4QBGB 1EBUA 2WJIA 3ZPXA 3BJIC 3FOCA 1M8JA 4AMUA 2I4LA 2QSZA 1ZOIA 4YN3A 3EA4A 4R7GA 1OZAA 2MSEB 3TXXA 3NJ4A 4IDAA 3AR6A 2VJDA 2N42A 3I58A 3K96A 3NDPA 4ZT4A 3SXUA 1VKZA 2REOA 4NYIR 2ZU6A 4ONEA 4XUCA 4KVZA 1QIMA 4GD3Q 4KJXA 5DLYA 4CUZA 5F98A 1PWZA 2WYIA 4YDQA 1ZJ5A 4YR9A 2WVHA 2CFSA 4TGLA 1W85A 5JDIC 1QP4A 1JLSA 3RAEC 2Z8YM 3IT0A 2WAMA 2HCJB 5JNWA 2VJPA 3GJ3A 3WL5A 2QPTA 1NYLA 5LMCA 1P3JA 1WZ2A 4HLUA 3HWX1 1MOSA 3BTUA 4Z9YA 4JJZA 2OA0A 1I51A 2DBZA 2XB2A 2P90A 2JA1A 3K0AA 5ALMA 1WF6A 3AY6A 3WZ2A 1E3SA 1GGJA 1QC5B 3D6FA 1Y3DE 1ZLXA 2BZSA 4KC0A 4ZZ2A 3TSZA 4KR3A 5KCZA 2PA3A 3LHDA 4K6HA 5CCDA 3L4BA 4D4MA 4Q0MA 1WMEA 5CDGA 2X1LA 3EMDA 1DJPA 9GPBA 1L7AA 1WSAA 4BVLA 5ITSA 2QJWA 2ZBDA 1NMQA 4UCXA 1GPLA 2AFIA 2Q3DA 2A92A 3IO3A 3BFKA 4O5AA 4GLJA 1IUPA 1ZAKA 1YR9A 5HQTA 1WPXA 3CEMA 3UUFA 3RFCA 3JD2A 3EBLA 3VC7A 4KOAA 4IQ4A 4AXBA 2HEIA 4IIJA 4Z51A 3CONA 4ZGGA 3FWPA 1J70A 1W9HA 2FOLA 3Q41A 4FMBB 4HN9A 4JD5A 4YLYA 1QP0A 4NP6A 1HT2E 5BUZA 4QXQA 5DNYB 2WM8A 2NT3A 2PZBA 4KQGA 5JMTA 3KOYA 3DW1X 4IJQA 3KU1A 5FFFA 2FWRA 5HUJA 2GWRA 3KUCA 1ATZA 1QPBA 2G5GX 3CPJB 1SU8A 3FYTA 5JZVA 3HRIA 3R4CA 1DSSG 2Q5CA 4M37A 5TPWA 3RTCA 3T0IA 5KWJA 2GTPA 2IEYA 4Y2UA 1WXEA 1XLWA 3MJVA 3UANA 3KQNA 2PL3A 3ZQKA 2ZI9A 1VKNA 2F59A 4DLVA 1H2HA 1WMAA 4D4GA 4PZ0A 4R54A 5YASA 2ZIGA 4MA0A 4QXAA 2Z8ZA 5CVEA 4TTAA 1ZM2A 2ZR0A 5DLEA 3BQ9A 3G59A 3HDYA 4GE3A 5P21A 4D0NA 4O63O 5J4HA 3DEHA 3HZOA 5BSMA 3TKAA 3UQYS 3G13A 4DA4A 4O2RA 2OBFA 4RQUA 4O08A 3BD9A 3Q3VA 3I5XA 1P3Y1 4MVJE 1IPHA 1HDXA 5J58A 5ILOA 1B16A 1Y3FE 2ZDQA 3C6QA 5D51S 5FYDA 3V1LA 3VSCA 1P73A 4KRFA 3EYWA 1Z5ZA 2ST1A 2UZ1A 4KCGA 3ZZMA 1JEJA 4ZVQA 4LZLA 2WJAA 5I6DA 4OHOA 4EF6A 1Z25A 4EJ0A 4U8HA 3YASA 4TZ6A 4RLSA 3C3CA 5TF4A 3IVRA 3GAZA 4J4TA 2W2KA 1OX4B 4B6FA 2NO4A 4GU5A 4RC9A 2OE2A 4DRZA 2F1RA 2WQZA 4ZGBA 1I7LA 1EP3B 4DQDA 5AVTA 1PZEA 1W29A 2IW3A 1UEIA 3GYGA 2W22A 5FOWA 3BTVA 4OQEA 2C4KA 5B3AA 3QIAA 1QQAA 2G04A 3OBBA 1R1DA 4O2BA 3PHIA 3OM9A 2VTEA 2XGOA 2ICAA 2FJ0A 3LHIA 4GZMA 5EJAA 1Q50A 4MWGA 4M7WA 3SC3A 1KOGA 5TIIA 5M3BA 4F9FA 5DOVA 4WCFA 1AMUA 3QELB 2GNAA 2VKTA 1ZD3A 2D2XA 1J00A 1PJAA 2OXFA 3MGAA 3V4ZA 1ORDA 3IDAA 4FFOA 4P7JA 3TTYA 4F60A 3EXIA 3ANNA 4B46A 4EO9A 1I1NA 1R9GA 1GTSA 4G0PA 1R66A 3HY4A 3ZOZA 4ZK6A 3OOWA 1Y33E 5C1PA 3L1VA 2IHZA 1Q91A 4GOJA 1V8PA 4CV0A 3TTSA 2EKQA 4D6YA 4XQ0A 4ETNA 3NTUA 3UK0A 4ODIA 5GJVC 3F9IA 3DMDA 4LYDA 5BSRA 3ROKA 3B13B 3HJCA 1C5KA 1V2HE 4XFKA 1KJ9A 1SVWA 1X15A 1XG5A 5AHRA 3DD5A 1M2JA 3NETA 1C2TA 2W4MA 4MWTA 1CERA 4U7DA 3OQHA 5F4ZA 4QQNA 5DTIA 2QR5A 1Y3CE 1N34B 4X97A 2I62A 5LM3A 2VNIA 3W79A 3ZY2A 3OCJA 1AHPA 3IIJA 5DFAA 3CE9A 5AESA 1P44A 3S6JA 4ZVLA 1W0JD 4KN6A 2IEBA 4C14A 4MW2A 2I3ZA 1PKEA 4RE5A 2IH4A 2NSLA 3U40A 5HKKD 4UOZA 5DSTA 3KEGA 1K98A 4K9LA 2BEWB 2IYXA 3KKMA 1IZ8A 1KY3A 3DF7A 3QE4A 1ZJ6A 1ST3A 1T24A 2CLKB 4TT3D 5TVGA 3EGVA 4BAUA 2CJWB 4Q21A 1E2JA 3NTLA 5DXAA 1QRUA 4G0UA 4F6RA 1J0AA 1SHLA 4HGYA 5DHFA 4ZI5A 2ZWVA 1ZA2A 2GD6A 4IY1A 4J49A 2BTOA 1WQ1R 3JZIA 3OJFA 4LVCA 3VBCA 3LUPA 3R9IA 3O4RA 2YVAA 4A7PA 1LW7A 1RI5A 1UBEA 4D4IA 5FBHA 3I53A 5JXJA 4HYQA 4MW9A 4PN7A 4CZ2A 1L5VA 2CCKA 4X7BA 4YI5A 5DNEA 3C3XA 4JJFA 4A92A 1PRYA 1SCAA 2PVSA 3QUQA 5JIBA 4NBSA 1U7XA 4S0ZA 4CMEA 4DAEA 4NZPA 1MVOA 1RXSA 5AI9A 4TKMA 3JZDA 3UB3A 5AUPB 4C7BA 4F3YA 2O8NA 1LJ8A 2DRIA 4X63A 2QY9A 3FHCB 3LV8A 5LDDC 2ZT6A 4IJMA 3PYMA 3REQB 1ZY2A 4NBVA 1PN3A 3CZ5A 5EWMA 2GWHA 4OMCA 4X41A 5H70A 3FPSA 2I6GA 4YMGA 5CFRA 2OCDA 1JEYA 3IQIX 2QGFA 5I4IA 1KEEA 2YVKA 2PMDA 4JASB 4QYSA 2VNKA 2GN8A 3IXQA 4AJEA 4WK6A 1H4QA 3V1TC 5BQXA 4RYDA 3W4KA 4AZ0A 2QTWB 3KYIB 5A4MS 1XA4A 2L18A 1ZOOA 3MS2A 4MVJA 5DCLA 2PH1A 4ZQEA 1DAFA 1PSDA 1JR2A 1Z7WA 2V7VA 1I13A 2H7VA 4GX2A 5I9BA 3CUWA 2JI8A 1TVKA 3ENWA 1Q0TA 4M0LA 3DWEX 2EC5A 4I5DA 4G25A 4A82A 1YQ9A 5GV7A 1ZINA 4K03A 5FNVA 1GXSB 1LLDA 1MEEA 3LSYA 5L7YA 1DTSA 7GPBA 4KWCA 4LY0A 4IG9A 1PEAA 3TSAA 1JIKA 1VE7A 3CUVA 5SICE 3V55A 1ISPA 2ZAOA 4QOEA 1HUQA 5CPBA 4ZEWA 4G0VA 4DV0B 3SKYA 3MGCA 2DWQA 1Z18A 3AGPA 1GHTA 4BP1A 4RQTA 3ZH9B 1DC4A 1PJCA 2ZPTX 2FB9A 4RHCA 3TIVA 1K92A 3P2OA 5TX7A 4NHEA 1WY7A 4HVAA 6GPBA 1AQ6A 2C2XA 1DTEA 2NQTA 2QD3A 2R8BA 4NG5A 3S2GA 3ZWKA 3UN1A 3T1TA 3ESRA 4HNSA 2XXBA 3I5MA 3S2EA 4DLWA 4E5PA 1NMYA 2XMGA 3DHVA 3MGGA 3MPUA 1FRFS 5A7HA 3SPXA 2G80A 5J40A 3SQNA 3CV3A 1XTTA 3DDUA 4BJ5A 3T9EA 3WGNA 5AVQA 5DRYA 1OE0A 1DOAA 3BXPA 1VLLA 3RIGA 4MQFB 4AW9A 1GFZA 2BTQA 5CB4B 3KKNA 4X00A 4M36A 4BN5A 1LBQA 3MCUA 4NEHB 4FDMA 1KH1A 4S35A 4W7IA 1I1QB 2K7ZA 3A0UA 4JJ6A 3K6KA 1AQYA 1II0A 3OEHA 2A0YA 5C7OO 1KR5A 4PC7A 1XZNA 4RDIA 3RYFA 3ZWAA 3UHPA 2ZIUB 4PO9A 2QAJA 3R3SA 3ZHXA 3R9XA 2E18A 1SA0A 2J48A 4XQEA 5E8RA 1A1VA 1RKQA 2X2OA 1KEEB 1WVGA 5AK5A 4QOSA 3SJBA 4ALMA 1THTA 5DRTA 3AHJA 4RPLA 4CQMB 3JZMA 1L6RA 3H17A 2VI5A 3WNQA 2X1HA 4DS3A 3P4UA 1JFVA 1N7IA 3HDQA 3PQ3A 5E9AA 4DLNA 3M6MD 1NFFA 4Y1EA 3TW6A 4G26A 4G5XA 9LDBA 5EVJA 1OYYA 1GJRA 3G2HA 1VL0A 1UR5A 2ZE8A 3ES9A 3IHKA 3DMRA 3GUUA 4ZD6A 5JFOA 4KN5A 1ZN8A 3FCSB 2E3JA 2ODAA 3E3OA 2FW0A 5GZ6A 2JHPA 1JDTA 5DI3A 1EJ0A 1RWOA 2Z4SA 3MJCA 3UJCA 3GNTA 2RDMA 3JARA 4X1KA 2GAFA 2JGJA 4FFSA 2RHRA 5IARA 3JTMA 3RVOA 3I6YA 1SOMA 3TFQA 3KZXA 4DRYA 5CA1B 1OIVA 1B73A 4KG7A 4B6JA 5JAZA 1C81A 1Z62A 1C9MA 1N7HA 2ES4A 4H6XA 1NXOA 1US8A 3V1NA 3W5UA 1WOMA 3S2IA 1QCYA 3ZHQA 1Z0DA 3UMSA 1UZNA 1LPNA 1XZQA 3SX2A 2D5IA 1TKRA 1Q0PA 1UK7A 3AHIA 4UXIA 5COAA 5DW0A 5C2JB 1NUQA 2VNHA 1WNFA 1QYWA 3FBWA 1MB4A 2C04A 2QP9X 4IG4A 4QDZA 4G85A 5CJPA 4F38A 3K4QA 1NW9B 2ZBFA 1V9SA 3QXJA 4ZHQB 5B7GA 3VO1A 1FRQA 2R6R1 4X20A 1KMHB 3GOQA 4RMIA 1I10A 5F21A 4FQ5A 5CEFA 3CN9A 2CMGA 3BKWA 5KSZA 1VJTA 1Z45A 3KJEA 5CB4F 4WACA 1KEUA 3GP5A 4JXJA 2WM2A 3EDQA 3MAAC 5EJ5A 2OEPA 3CSUA 4QICA 4RTRA 3D64A 4DKJA 1YFLA 1DE0A 1ZH8A 1CDDA 1R50A 4ZDKA 4O1HA 4MCHA 4ZOEA 3VJKA 2UXCB 1H2XA 2HV9A 5AKYA 1VJRA 5IP5A 4YUYA 4LTDA 5JAOA 3GVXA 1ZVVA 3FDZA 3NUZA 1GV1A 1WMBA 1B8VA 1SHUX 5DCUA 3MUEA 2FRXA 4D44A 2UXBB 2H2DA 1L3CA 4MQ5A 1X80B 1NBAA 3AZPA 4JC0A 2BI7A 5DT2A 4D45A 1RYDA 1Y4AE 1ZGHA 3GCDA 5H68A 3SYLA 1IFXA 1GUBA 4MWSA 3R75A 4R2WA 2JK1A 5BOSB 3AUYA 3EEQA 2JIMA 4JOBA 2G88A 3U5ZB 5D00A 4P3KA 2B7LA 3KPVA 4BNHA 3GMDA 4K3UA 5DYIA 3ONEA 5LWQA 1U0TA 3PUXA 3DVRX 3LA8A 5FOVA 4ID3A 3I6BA 1RD4A 2DLCX 3PENA 4POAA 5FWXA 5C7YA 1FU4A 1E1NA 1O77A 1Q95A 2R1ZA 3MQ2A 2PZEA 3OZWA 4UARA 3LAWA 3OAAA 3DXFA 2Y8EA 3LFTA 3UMRA 5CLFA 1UK9A 1QZUA 3B3JA 4LDQA 3WZLA 4YPVA 1QBGA 5CA1F 4KODA 1TADA 4XEHA 1H2YA 2E4ZA 1FXUA 3V4OA 4XYLA 3M3PA 5HOQA 1GCIA 2IOFK 1RXUA 1H2WA 2BF7A 3ROTA 2O2HA 4HWSA 5AJYA 4QXPA 1F5NA 5T41A 3ELUA 4GO1A 1DXQA 3M1IA 1DRJA 5B1IA 2CNBA 1IHXA 4EVQA 3IDSA 4WT7A 2FSHA 3WYNA 4ZMBA 3KFXA 4MPDA 2R6DA 3IUQA 5K8JB 1OXMA 5AJZA 4ZHQF 5HFAA 1YZGA 4YGYA 2YJNA 1Z08A 2JVJA 1IM8A 1KP3A 1GLGA 2OM2A 2POQX 2OV2A 3AUFA 1HZZC 3OFKA 3OURA 2G9RA 4TYYA 4DT1B 3FB4A 3EZGA 2AC2A 4C0BA 3CNHA 3F6RA 3R6GA 3W8NA 4W9NA 1TUEA 1RWQA 2ZVDA 1Q14A 1U9YA 4KXLA 2H4WA 1TPZA 3D4BA 1YL5A 3L07A 2Q4OA 3MMXA 1X94A 3LPLA 4N5HX 1YC2A 1Y5RA 2V3VA 3H0EA 2A4KA 1Q2UA 2HLNA 4FGZA 2QLTA 4NV0A 2CXUA 1MKYA 4QAQA 2P6OA 4OB6A 2B8NA 4B74A 2H3EA 1GG8A 4FFLA 2MSDB 4OXQA 5CMLA 5AM4A 3VYUB 3ZDEA 1JV2B 3AQIA 1A2OA 4R9NA 2NUBA 4BMCA 2CD7A 3A4MA 2DQ4A 2R8ZA 3NC0C 5A9SA 4P84A 2PSHA 2ZYUX 5SY6A 5LMUB 4PIVA 3U44A 1Z8HA 1Q0HA 5ALLA 3IAEA 5E8JA 1VJCA 3ZWCA 3FRJA 4WLOA 5KWEA 5KYWA 4KNYA 3EVCA 4PEVA 1GZ3A 4KQ1A 2HCTA 3UHJA 3ZK9A 1R4MA 3PNVA 2AOXA 4ID9A 4FI3C 1ULBA 4K28A 1Y6QA 2H0QA 3GRCA 4DB4A 3T7AA 3DMFA 4DIUA 1WDWB 3K1YA 3OLZA 1Y9EA 2O3UA 4A0FA 1FB5A 3EFBA 1CJVC 1YKGA 2NACA 3P32A 4G65A 3D3NA 3WIDA 3FPBA 3L05A 4RXMA 5GONA 5IYZB 3OE4A 1QO9A 1T8SA 3PUWA 2XXAB 4A2CA 2AOTB 1E4OA 3M34A 4UHKA 1N8KA 3UBTA 1FZTA 2GJ4A 2EFCB 3ADPA 5MN6A 3BX1A 2I33A 2UV8A 3QVKA 4NZYA 3PD7A 4GYYA 1NKVA 2CHVA 5EMLA 5HWSA 1QVWA 4JEUA 1HT0A 4PRLA 4UPDA 2ZRJA 4LOLA 4W7HA 2QRMA 3WDSA 5K5EA 2I67A 2YOGA 1KDVA 2WFLA 3HR4A 3E5NA 3RVNA 2C1XA 5IPFA 3WYEA 1CU1A 1M5RA 5IJAA 1KERA 1R18A 3KDAA 4ZHSA 1QLJA 3EVDA 2GO1A 2CL6X 5U4QA 4ZCMA 2KMLA 5F23A 1ONPA 3W6PA 5LJIA 2H06A 1KDOA 3AB8A 3BXEA 1T25A 1DEXA 2HNAA 1OWNA 3H97A 1OWMA 1RPNA 3QSGA 4BLWA 3HN7A 1WZUA 2RK3A 1E7YA 2O3RA 2WUEA 3IKLA 4RS4A 2O3JA 4P5DA 5AICA 4US2R 2CFTA 4X60A 5FLEX 1FVFA 2Z3VA 3KJIA 2P2NA 2OWDA 4KXXA 7ADHA 3VTFA 3QLVA 2VUSA 1ZI6A 4YRFA 4ANFA 3IT3A 1UWKA 4G0QA 5D3ZA 2XVZA 3U1VA 4DNPA 2BDUA 4J3NA 3AX6A 4FXPA 4P82A 4TKZA 4MGHA 4D8TA 5SY4A 3U1BA 3QPBA 3KQHA 1JJFA 2QRNA 1ZNXA 3A7DA 2CDBA 3QFRA 2G06A 4Z3KA 1L7MA 2ECQA 1LJLA 2QTAA 1MZVA 1PTKA 3QVWA 4TZTA 3QPWA 4EPXA 1Z6TA 1EINA 1A2BA 2C5SA 1GNTA 3U4QB 5BQ3A 3P0FA 4GGOA 4JVSB 5CVUA 1WLYA 1IG3A 2B37A 4QVKA 1YA6A 1RLJA 1X8LA 3PDUA 4HCJA 4PTZA 4DR2B 3OZUA 3TSCA 2EYUA 4BQEA 4CTMA 5IUNC 1PK8A 4TV9B 5ITZA 4COOA 4IHJB 4M9CA 5IKXA 1PK7A 4P36A 1LD3A 1ORHA 2XLBA 3N59A 3CZCA 1NF8A 1WSBA 2E87A 3CA8A 5KJ1A 1G66A 4M89A 2XZTA 3M6AA 4R2MA 5IYZF 1T3ZA 2J67A 2RAVA 1DOHA 2ZRIA 3LHFA 3PZBA 3T5DA 3QVLA 4CCAA 2G25A 2CVHA 3AKCA 4R1LA 1W1IA 1TQHA 5E6RA 2PNJA 3B48A 1TLLA 2H92A 2QDXA 4QELA 4QXRA 5DYWA 2OCGA 2OYSA 1FNDA 4U0KA 3X1XA 1P81A 2C1ZA 1C7IA 2QE7D 2GR9A 4L07A 4QTZA 2BLLA 3P9RA 2D54A 3LS2A 3Q7SA 1VPLA 3H5LA 4R1UA 3RUEA 4FSXA 2JHCA 3RS7A 3D1LA 3LUFA 5EHNA 3ST7A 4D26A 5HVNA 2GXUA 4LXGA 1KZGB 1HURA 4L9AA 2CXQA 1ZISA 3T34A 2V59A 4AQDA 1ZCBA 4KQXA 2REBA 4BN0A 3KNZA 1F8XA 2G1JA 3NFRA 3S29A 4RM2A 3C97A 4WKOA 5EJ9A 1U4OA 4L78A 4BCCA 4HNAB 5I4BA 4DV6B 1F8UA 3SBXA 1SZDA 1QVZA 3D54D 3GEMA 1RAGA 3FRHA 4BGIA 4P93A 1TZCA 5TQVA 5D5HA 3TXYA 4LUCA 3PD1A 3PQ6A 4F92B 3LUDA 4C6RA 1GDTA 1UXGA 1LDEA 1F3OA 1UDBA 1QJ4A 3AUKA 1YZLA 1XIVA 3H2KA 4FHGA 4JS0A 4JBXA 4MKGA 4TQ9A 4NBLA 4AY6A 4B7XA 1CJMA 1UQUA 4UUAA 3EH1A 4UW9A 1D0IA 1L5KA 3OCZA 1XQWA 1U2PA 3CEJA 1K5GA 1R4NA 2P41A 3A6DA 1WMDA 1CE8A 3EDCA 5EE9A 4BWYA 1B43A 3LL4A 2Q5LA 4QBIA 4I4LA 4N9WA 5HJ7A 2Z6UA 3PXDA 3AI2A 4RAQA 2NW6A 1DNPA 1ESEA 3SICE 3M1AA 4KQJA 3QVOA 1G291 5GAJA 5K3FA 4C0XA 4WIAA 5JPDA 2RKBA 5AI8A 4EFKA 4Q4JA 4KV7A 1L5OA 3A4VA 5TSDA 1KFBB 2LD4A 1I80A 2J33A 4JCOA 3SDSA 5J4LA 5JRJA 1ZWKA 3BGWA 4JP3A 4RKFA 2H4XA 4IHJF 2ZJOA 2JEZA 4JLJA 2ZGVA 3QFTA 1XMQB 2EWWA 3O8CA 2YRFA 4UTNA 2JAQA 3LT0A 4EJSC 2V9CA 2HDOA 4PSDA 1CEEA 4HGQA 3CSSA 4JUIA 1XCBA 2BM9A 3HVJA 5EPOA 1PQUA 1JR3D 5FIUA 2IEIA 5HQ3B 5EHIA 1RRFA 4OQYA 5I9SA 4EATA 1HQKA 1XRJA 1WOYA 4NBKA 4WK2B 1FDIA 3AYZB 4U2CA 1PS0A 4G5OA 5FUMA 1XGKA 1HTTA 2FRDA 1EH5A 4I99A 3W04A 1I5OA 2AH5A 2B34A 3R77A 4XQCA 4KRYA 1RI1A 1KORA 2A9KA 2R8OA 5LQMA 1BDIA 1SHZA 2R8EA 2RGYA 1XZAA 2CK3A 1P61B 1VIAA 4II2A 4B8WA 2I29A 1AGRA 1E32A 5EE5B 2QMYA 2TMYA 2R9VA 4Z9XA 4OP3A 4Q3CA 2OQRA 4BU1A 1D9XA 4HNQA 5JD5A 1W581 4B3MB 5AJWA 1T15A 3BUSA 4REQB 3GFRA 5FWYB 2BISA 1KZ4A 2PLAA 4GXNA 5CYOA 4YV0A 1AQNA 4A5OA 1YS6A 2V5VA 4LGCA 3F8WA 3TNLA 2WUVA 2FPGB 4Q6BA 2YYAA 1WDTA 4Q47A 5A2GA 1U7OA 3EZ7A 4N54A 4BKOA 3COVA 2GXSA 3D0KA 3GT4A 2VWGA 1Z83A 1EQUA 3U4IA 2PUEA 2FPLA 3B6ZA 4PWYA 1X1SA 3BMNA 3BZWA 3KQQA 1GY8A 2ONCA 2OFFA 1V7ZA 2WHXA 3B1XA 4FGUA 4BB5A 1TGYA 4WDQA 1MZPA 2DP4E 3FYCA 3E58A 1MN6A 1WKVA 5DT9A 4JB8A 3QVVA 2QX8A 4WCVA 3DSRA 4XIFA 1PJ8A 4KPFC 1AN0A 3TDNA 3WFIA 4BVJA 4CXMA 1U8EA 2W5UA 2CW5A 3O2QB 3V80A 1DXHA 2WHRA 1RQ2A 1LS6A 4PYKA 2ZANA 3IP6A 2H18A 3QOFA 4WZBB 3P0RA 2OFWA 3JTEA 4ZC8A 1KMIY 1WW8A 4C7XA 3LJKA 1L9XA 3FX2A 1EZZA 2QLNA 1IXYA 1IU9A 3UXHA 3PWSA 5I7HA 2G82A 2VA8A 3O2SB 2MSCB 1NGSA 1CX9B 3BAFA 1N6NA 4YAJA 1PR2A 4TXJA 4E6EA 4ZK2A 4HZUB 5EERA 3DULA 1A2QA 3EEIA 1BH2A 3PE3A 3D6HA 4H7JA 1Z0SA 5LP6C 5EC8A 2Q5QA 3L49A 4ARUA 2XTMA 4MPPA 1S96A 1C80A 2ZULA 3GAMA 2JIDA 4U6QA 1QBKC 1S3GA 4X94A 5KX5B 1DPGA 3OQPA 4BGDA 3EXG2 4XGRA 4ZPXA 2MR5A 4JJ8A 4A6PA 2I6UA 4EELA 5KNDD 1P6UA 3BORA 1C30B 5DWQA 1AG9A 2I87A 1PWEA 1UDAA 2QV7A 3MTDA 5ITVA 1H8EA 1HDIA 2HLHA 1QZZA 1EBBA 1GILA 1ZSYA 2JGFA 3AESB 4JUDX 4RJTA 1P29A 4ZI7B 4BQNA 3OPMA 1JQDA 1ODSA 2MSWA 1X38A 3QX8A 2AW3A 4ZOCA 1GRNA 5BR1A 1YZHA 4S1NA 3PB3A 3UAXA 2ZSDA 2XB9A 2PMCA 1TO6A 5THKA 1EMDA 3E7WA 5D6OA 3WQBA 4XLTA 3WRYC 2DE0X 5KO2A 3CHYA 2CMDA 3IQXA 2WA1A 2DTDA 1C3JA 1SG0A 2JKVA 4LAFA 3M4YA 3OX3A 4LE2A 1X87A 4HDRB 3NBQA 3ZGNA 3KEOA 3H42B 5E1DA 5EKDA 3CCBA 1I8TA 5L40A 4PHGA 2VSXA 3ZLVA 4F11A 5JWOA 1A96A 3L9XA 1PR3A 4CRWB 3UWDA 1V35A 4WDRA 3Q7RA 1ZD5A 1I7PA 2B8JA 2FN7A 1ACMA 2V4ZA 3G23A 4KAAA 4WKCA 2QRQA 5F73A 2C00A 1DAOA 4KXUA 5ALVA 3OY7A 2Q3MA 2P91A 3QYFA 3VR6H 1RYYA 1YHNA 3T7SA 4AECA 1DWQA 2GK4A 3CZMA 5CEEA 1XD8A 1ZMTA 2HPZA 1LJUA 3CF0A 2NYUA 2NPFA 1COZA 2CDCA 1NIJA 5C3UA 2HU2A 3L7LA 4IIJF 2GPYA 3L84A 3DZDA 3IAXA 3BIWA 4CN8A 3AH8A 1H23A 5ALXA 2VL7A 4IW3B