1UKVY

Structure of rabgdp-dissociation inhibitor in complex with prenylated ypt1 gtpase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
204
structure length
197
Chain Sequence
b'SEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secretory pathway GDP dissociation inhibitor
publication title Structure of Rab GDP-dissociation inhibitor in complex with prenylated YPT1 GTPase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 63
structure length 197
sequence length 204
ec nomenclature
pdb deposition date 2003-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ukvY00
2ZJ2A 3G0HA 4B71A 3QXJA 4TL7A 2EFCB 2JLSA 5FTJA 2XZOA 1P2UA 3BBPA 3KKMA 1YZGA 4MH0R 4Q47A 4DB4A 4MQBA 5LD2B 1II8B 1P73A 3TKLA 1WE2A 4B6EA 2F43A 1UDWA 1DAIA 1KI2A 3I8SA 4XOIA 1KAGA 2AD5A 2WMOB 3D8BA 1FUKA 1XTRA 5FTLA 4PHTA 5F2EA 1L7VC 2EVWX 4WA7A 3ZS9A 2C9YA 2JIZD 4LPKA 3DZDA 2XNDD 5G3YA 3K0CA 3PVSA 1PLKA 3MWJA 1JB1A 1Z29A 1RKBA 4KVAA 2Q0HA 3T1VA 1U0JA 3WBJA 3CH5A 4HSEA 1HA3A 2R65A 2ZJAA 1Z0FA 4TL9A 1VG1A 4WXRA 1G8GA 3L8YA 3RS5A 1HV8A 1N6HA 1X3SA 1XDBA 3U5ZB 3ADKA 4XWOA 4M9ZA 4QHSA 4M1SA 2R9VA 1CJTC 3AF4A 3AVVA 1VYTA 3AKEA 4MRRA 4BFXA 4PQFA 3LNCA 4Q9HA 4N0DA 4YMWA 1G1MA 1G3MA 5IHPA 3SYKA 3FMPB 1R5NA 3ZYCA 2RGNC 2F43B 5DLQC 4BLPA 2IA5A 5HZHA 2Z4SA 1EFHA 1Q44A 1T5LA 1IJFA 1Z5ZA 1TQ2A 5FOUA 1IM2A 1R0XA 3ZZ0A 1OH7A 5AUPB 5EUMA 1YVDA 3I61A 2ZREA 1RYFA 1BS1A 1T5IA 3U7HB 1E2QA 3B60A 2FN4A 1R10A 3N70A 4TSFA 5J4YA 4X8HA 3NIBA 5DI3B 1D2EA 3KXIA 4A82A 1TX4B 2QMEA 1W47A 3BH6A 4Q7LA 4C7OA 4UXIA 2VL7A 1P9WA 2ZRDA 1VG8A 3UMFA 3QI2A 4D4JA 4IDOA 4LOAA 3VHLB 1P7CA 3QBTA 4WW0A 1BKDR 1QHHA 3LXRA 2VHCA 4WOPA 1KSFX 3HDTA 4N3NA 2AXPA 5EZ5A 4MDFA 1UPTA 2IYRA 4DUGA 1NVXQ 3LXXA 2VHQA 4D2IA 5JCPA 4DSUA 1DS6A 2H57A 3SZRA 3GLHE 4X8LA 1HTWA 4M1KA 4YMTA 1OXXK 1U9IA 3K8YA 1OLOA 1S0UA 4HDQB 4H1VA 2CE2X 2O52A 4MUAA 4R71A 1MO4A 2NG1A 3K09A 1PUJA 1IY0A 1GFIA 2WM9B 2RGDA 4KBFA 3V4FA 3QVUA 1AM4D 1CR1A 5AWFC 5FOVA 1SXJC 1JECA 2R2AA 4R2IA 2ZTSA 1W2HA 5TVKA 3OAAD 4JLOA 4YDSA 1AIPA 4AD8A 1US8A 4YONB 5CLQA 3AF1A 3UXMA 2V6IA 4C7OB 2ZROA 4O2RA 3W3AA 3SBDA 4V0KA 1VYVA 4TTRA 5DN6A 1KDPA 3B1WA 2C8VA 2H18A 1G291 3WBKA 5JWRA 1QHHB 2QP4A 4Q4JA 5HKKD 2X8AA 4CEJA 3HP1A 2ZRJA 1VG9B 1Z0JA 2PJZA 3O47A 2NPFA 1L2TA 2W6JD 5AUQA 3BJIC 3VX4A 1OFTA 4K46A 4C0LA 4M1YA 5C4GB 5IK2A 2GAAA 3KJGA 3ZH9B 2E1RA 1NLZA 4LSGA 2NMVA 4MGZR 1VKJA 2C5LA 1GSIA 4IFEA 4TLBA 1KJYA 3S1AB 3VKWA 4CRWB 1KK1A 1DAFA 2HJGA 3GD7A 3ZIAA 2ONKA 4XVQA 1EXMA 2XTMA 1ESMA 2O8FA 4NL4H 3ZQ6A 2E9SA 3CBQA 5C4MA 1P75A 3P4YA 5CM8B 1FNNA 4C30A 1SVOA 1J90A 2BMEA 4KFTA 2VHJA 1G41A 3PV0A 5E7JA 5GJBA 1XRJA 5CK5A 1D5CA 3RWOA 1KDTA 4DLTA 1US8B 5JHGB 2PCLA 4PSAA 5KDOA 3HYTA 4EPRA 2W6IA 4LHZA 4KU4A 1SVLA 3V00A 3IUYA 4XTRA 5DYIA 3CNLA 2WZQA 3TNFA 2QTHA 3BERA 3FE2A 3S1AA 3CRRA 2VEDA 4CEJB 1XPOA 3A58B 2LCFA 2AD1A 2NIPA 3LRPA 4E03A 3I72A 1QHNA 1W49A 3LA6A 3DOEA 5UKDA 4L9SA 2WAYA 2QQ0A 2OG2A 3ZQJA 1OF1A 2OLJA 3M0EA 3SC3A 4AKEA 4URXR 3LX5A 1J8YF 5JS8A 4P3YA 4ESVA 2WMNB 1HE8B 3BOSA 1OFUX 2JJ2A 1QVAA 2O8FB 1SKYB 4PX9A 4E22A 3MGCA 2PT5A 1XMVA 2XB4A 3A37A 3THOA 1ZNXA 2WWXA 1FTSA 1TQ6A 2QY9A 1K5DA 4MITA 1COWD 2WWGA 5AUNB 3TE6A 4GBMA 4LYJA 3RDPA 2ZEJA 4XIGS 1S9DA 2HT1A 3SE0A 1S3GA 3U6KA 3ZVMA 2GXSA 4B43A 4AKIA 1G8YA 3I3SR 3QG5A 4B76A 3QY0A 2C9CA 4M1OA 1E9BA 2FH5B 2SHKA 3IPYA 4G5QA 2WICA 5AJZA 2H5EA 3DO6A 3EIEA 1KO1A 5J4LA 4PHFA 2ZR7A 4V0ME 1Z6AA 5KSOA 5JI2E 4EPVA 2X2EA 1GKUB 4DJTA 1E98A 3CR8A 4A0GA 3O8CA 5FFMA 4BRUA 3EPLA 4QL3A 2JA1A 3W90A 4KSBA 1AJEA 4OQFA 3BFKA 5TXGA 2Z6VA 4WXPA 1IN8A 2V4ZA 2WOOA 4W5HA 5JS7A 1EWRA 4EJSC 4YLGA 1E69A 1QRAA 3IBGA 4Z8YA 5JFGA 3DM9B 1VECA 2O0JA 4YC7A 1O87A 3I32A 2G77B 3EA0A 3K9GA 4MYHA 4KYIB 5FUXA 1F2UA 1JQLB 3TGPA 3PUZA 3PUYA 5FH9A 4L15A 2FDCA 5JEEA 1IQPA 2V7QD 2CK3D 2ZPTX 3WMFA 4FCWA 3BFXA 1J7KA 1SKQA 1FQKA 2F1IA 3MJHA 4MKFA 3AVQA 2C03A 4UNRA 3VMFA 3EC2A 3D3QA 2ZRMA 3IQWA 1A2BA 2ZM5A 3ASZA 2QGNA 4C0SA 2ZE8A 2ZS8A 1U90A 4D25A 3GEIA 1Z0AA 3KJEA 5GADl 2BBSA 4HYYA 3PIRA 3MAAC 3KQKA 1G4UR 2VF7A 2MMCA 1SXJE 2EQBA 4RD6A 4A8JA 2JLXA 4K8OA 3AUXA 3WMGA 4DZZA 1E3MA 3FPAA 2QTVB 2XAUA 4ZV4A 5FL7A 1F2UB 4DIDA 1H8EA 1VCNA 4NBSA 3E70C 4GOXA 6Q21A 3T1TA 5F9HA 1KO8A 4UXJA 2BMFA 2XZPA 1FUUA 2GETA 1W4AA 3UK6A 2NZJA 221PA 3OIVA 1TF5A 4JVLA 4CT4B 2OBLA 2PZFA 3TAUA 1AS2A 1Z06A 2AN9A 5KUTA 5JJLA 3P32A 3BXZA 2HDNB 3QEJA 4V02A 1D2NA 1NVUQ 2DFNA 4GZMA 3UANA 3VR6A 1OFHA 5TB5A 4LV8B 1M2OB 1G7TA 2BBTA 4IDPA 4Q4AA 1I4LD 2GWHA 2YWGA 3ZVLA 1E94E 4AYXA 1YHNA 2EWVA 3LO5A 4Q9JA 1PLJA 2IYUA 4ZKEA 2GJSA 4MYCA 5BQ5A 3W6OA 3B85A 4IDNA 5DIFA 2VLIA 3B9PA 2BBWA 4Q21A 4US2R 3U4QA 2GEDA 2XGJA 3CZPA 4LJAA 3AH8A 2V9PA 3NC1C 1G6OA 3DHWC 3I62A 3GLIB 2ODBA 3CRMA 2P5TB 4DCSA 4LHVA 1JALA 1KI1A 1LVGA 4IDHA 1ZC4A 3KJHA 1Z22A 3AVXA 1MO6A 1ZM7A 1GNPA 4DLVA 2J59A 3K9NA 4OQLA 4Q66C 4O3MA 3JVUA 4DEXA 2OILA 1NVVQ 4LV5B 2J1LA 1R0YA 2IYLD 1UBEA 5J4KA 4LHYA 1P72A 3IIMA 4ZO4A 1Q22A 3Q7PA 4UJ5A 2XZLA 2FPKA 2P67A 2ZANA 4URUR 3EARA 1B23P 2VH5R 2ZYUX 2PEYA 3LBHA 2OUKA 1E2DA 1JEDA 3P1JA 2HYIC 1G5PA 1Z6YA 1KOFA 1P61B 3FKSA 4Q4AB 4B35A 1E2MA 1Z63A 3R8FA 3MCAA 2CHVA 2A2ZA 2GCOB 1QG2A 3GJ4A 2WKQA 5FR1A 4GSYA 2JJ1D 1N25A 2OCYC 2X19A 1WRBA 1JPNA 4E5UA 3U4QB 2HCJB 2ZR0A 3FWYA 2ODWA 2JEOA 3F8TA 4JVMA 4DLYA 3ZS8A 2GJ9A 2Q9AA 4XH9B 4FWIB 3GJ0A 2PZEA 4Q4HA 2FSHA 1E2JA 1XP8A 2O5VA 3MFYA 4EPWA 3KKQA 2VP4A 1RJ9A 2QA5A 2BKUA 2HXSA 2QMHA 1N0UA 5IRCD 1WBDA 1YR9A 3BH0A 1IY2A 2GJKA 1KO5A 3KKNA 1TQ4A 1YRAA 1G7CA 1KZ7B 2VSXA 3SR0A 3LWNA 2TMKA 3H2YA 1YR6A 1TF7A 2WJGA 3NH6A 4NTZA 2P2LA 4B33A 2GK6A 4RZ2A 2YOFA 4Q1CA 3TSOA 3A1WA 2DWPA 4JLMA 1R7RA 2ODEA 4OI0A 5EP2A 2IW3A 4Q4LA 3CRVA 4Q7KA 3AB3A 2E87A 3ADBA 1T6NA 1GVNB 1CP2A 3ZVRA 5JEDA 4DXAA 3U44A 2G9NA 4TL8A 3EXAA 4DCUA 3NBFA 2QBYA 1KZGB 5FUVA 1YZTA 2AKYA 5HCNA 4GL2A 2EW1A 1CIPA 4C0HA 2B8TA 4LV6A 4AC9A 4DHEA 4NYMQ 3THYA 4MYTA 4DT1A 5J4HA 1W44A 4CEHA 1XCPA 3IQXA 4DLZA 1JR3E 3PEWA 4RZ3A 1E79A 2A5DA 4CVNA 1KSHA 1PVOA 5FUYA 5L3RA 1CF4A 1AS0A 4TT3A 4FD2A 4GOJA 4BWYA 4A1FA 2OZEA 1BMFD 3B82A 3R9XA 4HAXA 4I1VA 1Z47A 4L5BA 4NPHA 3QENA 3VKHA 1N6IA 3AGQA 4ZDWA 2ZAMA 4Q19A 4ZI2A 5B30A 1A4RA 1LNZA 3AVPA 1FP6A 4PO8A 1E0JA 3GLGB 2B21A 2KSQA 1P9NA 2BVNA 4U00A 2NTYC 4PSVA 4WZBE 1OHHD 2Q9BA 2VYFA 4RKFA 3CX8A 4C4PA 821PA 2VTKA 3CNNA 2B7BA 1CRQA 1S96A 4DDUA 3V9PA 3EW9A 1N6NA 2J0UA 1E1RA 3KFVA 2BJWA 4HB3A 4YDHB 3SJZA 2F55A 1RRCA 3EPKA 3D6TB 4RD0A 1W5TA 4MRVA 4QGGA 4RCYA 3THYB 2XJ9A 3NBZC 2ZRHA 2V55B 4QBHA 4CEHB 4LC1A 3CRQA 3BB3A 4F4JA 2ECKA 4TL6A 4QNMA 2G88A 1L4YA 4FMBB 4WZAE 1E96A 4B32A 4F38A 2ANBA 1GG2A 2V8OA 1ZM4A 3W9YA 1ZRHA 2QT1A 2R62A 4BFYA 4WAUA 2F1RA 2PBRA 2ZRFA 4DEYA 1A7JA 3B7GA 5KSYA 4OL0A 1P3JA 4HLUC 4NCJA 5E7MA 3NH9A 1EWQA 1BOFA 2Z0MA 4Q02A 1E9RA 4BPBA 3K9HA 3EZ9A 4M9XA 4ACAA 4JJZA 5EE5B 3WNCA 3W8NA 4Q9LA 1XNJA 3THWB 3SDZA 5GVRA 3IDQA 4AI6A 1DADA 3DVLA 3DZ8A 2EFHB 4KHZA 2RAPA 1NKTA 4US0R 5FUWA 3TVTA 4GNKA 4GZLA 1AK2A 1TEXA 1G3RA 3FYHA 5GJVC 3CB4A 2YINC 4JT4A 2J0UB 4PC3A 3VAAA 1AGRA 3QVVA 3P20A 1IY1A 4A4DA 1M74A 4KODA 2OXCA 1FMLA 1DO2A 1UEJA 3N2EA 5A5GA 2QROA 3LH5A 1F60A 4CIDA 1TU4A 2KBEA 1Z08A 2IXGA 4HAZA 3GMTA 4JLJA 4TMXA 4QG7A 4Q1FA 4JS0A 4QJ3A 1WBBA 2EWWA 3PFIA 1G7RA 3GFOA 2W00A 2FFHA 1W0JA 5HE9A 4ASUD 2UKDA 1OIXA 4IRUB 3ICEA 1HQCA 1N3BA 1OIVA 4NCNA 1OW3B 2ZI4A 2GXAA 2WKPA 1ZNWA 1Z8FA 4BLTA 4D0GA 1N5LA 1GNQA 2JASA 1E9SA 621PA 3B5JA 2RCNA 5G41A 1NG1A 3AM1A 4LZZA 5BN4A 1JNYA 3TQCA 1P2VA 5B64A 4EFMA 3Q5EA 3TR0A 1L4UA 2RMKA 2GJAA 3MUFA 2VHUA 5IDVA 1R5OA 1Z2CA 2G83A 5GJWC 4LYAA 3ZD7A 1G16A 2RGNA 3U3JA 5C1BA 1QBKC 3L0SA 1OB2A 1SGWA 2NZ8A 3NHBA 3O8DA 1Z3IX 4V0MA 4DSOA 5AUOB 1TTTA 4QNRA 1VDZA 1UBCA 1FTNA 2ZJ5A 2OFOA 2QRZA 3U3OA 4N1AA 5CB6A 2GTPA 1DAMA 1VHLA 4PO1A 4NH0A 2A30A 2L0XA 2REXB 1H8HD 1U0LA 4PPNA 2CNWD 3UPUA 4Y0VA 4DCNA 2H16A 2R8RA 4QGAA 1KIMA 2HEIA 3GLGA 4OQMA 4AKGA 3QPVA 3TAHA 4DLWA 2IEYA 2GBLC 1E2KA 1G8HA 4QBFA 5GJCA 3TQFA 3FKQA 1RRGA 1QHGA 4TQ9A 1T4GA 3LLUA 4NDZA 3TW8B 5KNBA 3EAQA 3RRNA 2ZXUA 3RLFA 4MUBA 1OH5A 1QVRA 2HLDD 3KXLA 4GI7A 1M7GA 4M1MA 4W5JA 3T5DA 2XSZA 3BB4A 4R2HA 4B34A 1AA9A 4GPTA 3SN6A 3OESA 3NBXX 4TLCA 1KO7A 3FHCB 1X1RA 2G1KA 2OCBA 4D80A 3DL0A 1KI7A 2O8BB 4BLRA 4XWKA 3GLFE 1RYHA 2BCJQ 4BLQA 2DBYA 2KI5A 1UDXA 2VBCA 2VQSA 5L8VA 1EFRD 2RHDA 2V1UA 1SXJA 1HUQA 4U02A 2GESA 2IWHA 3U3KA 4BUJA 2Q6TA 721PA 1A1VA 4O0MA 4TQUS 3PG5A 1XTKA 3CUEF 4CGZA 4PPQA 2ZE5A 2GVZC 4QBIA 1W46A 2CL7X 1R8SA 4NKRA 4QGFA 1TNDA 4H1UA 1GILA 4AYWA 4AKHA 4OHXA 4B48A 1YZKA 4TTPA 3ZZUA 2CJWA 3BIFA 1G7SA 4QHTA 2EFDB 4YMVA 1W36B 4LYHA 3T06B 2VP5A 2W2XA 1E2IA 3AKCA 1P62B 3CX6A 1E1QA 1W1WA 2D2FA 3K0EA 1XPRA 1W5SA 1G3IA 5KOYA 5FOXA 5JJKA 3UG7A 4A15A 2G3YA 3TUIC 4IXMA 3ND9A 5KYKA 3F0TA 4JBYA 3H86A 1CULC 3FMIA 4L9WA 5H70A 1GZSA 1ZM9A 2HXYA 3PEYA 2D3WA 4EQ6A 4D4LA 5J4VA 2OHFA 1FX0A 5AJWA 2WJIA 3OE7D 2JLZA 1I4DD 4FIDA 3SS8A 2P5SA 2C9OA 2QZ4A 5BN5A 5L3QA 3Q5DA 1TL7C 3CH4B 2C04A 1I2MA 2IEZA 2RGXA 1HYQA 4L16A 4M4SA 3CZQA 3MMPA 2O0KA 3VR5A 1MT0A 1CXZA 2IHBA 3WRYC 2GKSA 3FB4A 2OEPA 3AVWA 2DFLA 5H68A 3LQQA 1E2NA 2AFIE 1RE0A 4PANA 2CJWB 2VP6A 3WYAA 3NTUA 2BDTA 5FOSA 1Z07A 3IKJA 3X1YA 3I4LA 1II9A 2PL3A 4K81B 3OIYA 5FPYA 1WP9A 4LHWA 4PZLA 3SOPA 2G1JA 1XCMA 2IUUA 3RS0A 2G0TA 3T15A 2A7QA 3I8XA 2AX4A 2H92A 3AQ4A 2ANCA 4DIEA 3QXHA 3F5FA 1KTVA 1ZU5A 3AP2A 2ZS7A 4DRZA 1Z0IA 2CL0X 3UMRA 3CF0A 3K0AA 3FOZA 1JPJA 2BC9A 3EZ6A 3BWDD 3KB2A 4FWTA 1OH8A 1PJRA 1U2RA 4PFSA 4EQ6B 1XMSA 1FX0B 1IOZA 3Q9LA 2CLDX 2GZDA 5FPTA 3NG1A 1VCMA 5L3QB 4FXPA 2RGBA 2OV2A 1T0JB 3A1UA 3LLMA 4NCIA 4XD7D 3TW4A 1TUEA 2W0MA 1GL9B 4U7DA 3T1QA 2J5XA 3IILA 1IN5A 1LTQA 4QM7A 3KFXA 3L0PA 4CZ2A 2D4HA 3GEEA 3QIAA 4IOJA 2O8EA 4UQOA 4OI2A 1EFTA 4DDVA 5EP3A 4II7A 3SNHA 2QTFA 4W7SA 3JVVA 2A3RA 4P0TA 5E4FA 2OE2A 1EFCA 1R0ZA 2AHOA 2H1LA 2EFGA 2QNRA 1GDDA 2ORIA 3R20A 1X86B 4GP6A 4JZKA 4ESHA 2CVFA 5LD2C 2WOJA 4ZDJA 3NDPA 3DEFA 2AWNA 2GZHA 3I1FA 4O2LA 4EJSA 2YV5A 5FOTA 1XD2A 3K0AB 1E2FA 5FI0B 2WWHA 3KDSE 2ZYTX 2O8DA 4Q01A 5BYJA 1E0KA 4IVRA 2ZJOA 3KX2A 1N5IA 4C3ZA 1M7BA 2HUPA 1LF5A 3HYRA 1UKZA 4UXHA 1XXHE 1W0KD 2PX3A 1N2CE 4A2PA 3SJBA 5JRJA 2I4IA 1JR3A 3WHLA 3O8BA 3NKVA 4QC2A 1SVWA 1NY5A 3B6EA 3TUJC 1BO6A 3NVAA 2R6DA 1JAIA 1G21E 2O8EB 1KI4A 1OYYA 4C9BA 2ZYVX 5BXQC 5C18A 1Q20A 4F7WA 3OIUA 1AN0A 1IAQA 2NO7A 4BECA 5DI9A 3EA5A 4W5WA 2O8CA 3ASYA 2QE7A 3OFNA 1OKKD 2CL6X 4GMXA 1W7AA 1AGPA 1SHZA 2IYYA 1Q12A 4FCTA 1Z6GA 1KDOA 2CCJA 2LKCA 2WKRA 4Z54A 2D2EA 1ZNYA 3QKSA 2PH1A 4GOKA 3FFAA 3TSWA 1VYUA 2AL7A 1K6MA 4ACBA 5JSZA 1XD2B 1PUIA 3W5JA 2YOGA 4HDCA 2FU5C 4AG5A 2O8DB 1D9ZA 4A36A 3REGA 2OO7A 2QI9C 2J45A 2DHRA 2IBMA 4HAVA 4JBXA 1O3YA 2ATXA 4CDGA 3NBYC 3J81k 1ZIOA 1KAOA 1T0HB 4Q4JB 2C99A 1NMYA 1M34E 4CEIA 2ZUCA 4D6PA 1ETUA 2BMDA 3H1TA 2QEQA 1UKEA 3CF6R 5JCZA 3OEED 3CR7A 4B3XA 1YZQA 4YXWD 4LPSA 2ZRIA 2YZ2A 4C0JA 4LBVA 1N6LA 1WDTA 2AKAB 4I1UA 1DAEA 2Q3FA 4M9SA 1R2QA 1PLLA 4KCGA 4ZPXA 1KY2A 4D4MA 1JR6A 2IL1A 1FL9A 4QXAA 3RS2A 4DBLC 3BS4A 1XF9A 3EIQA 3QKSB 1ZD9A 1HT2E 1NSFA 1NBME 4OJKA 4DCVA 4TMTA 2REBA 3W34A 2P65A 4P31A 4OKSA 4XSHA 4DVGA 1VCIA 3SYNA 2GVDC 4QOSA 1C1YA 1KI8A 4KLZA 4AYTA 1EK0A 4M8NE 1NBMD 3LDAA 1GL7A 3WXMA 4B44A 1DEKA 1LFDB 2QPAA 1JI0A 2WV9A 3E5HA 1IN4A 5CLLA 3DKVA 4CEIB 1T8TA 4EAQA 2VRWA 2J7PD 4GDFA 4KSCA 4AG6A 1L8QA 1G19A 4HUQA 2JDIA 5TARA 3BAFA 1KO4A 4TWZA 4MKGA 1S4QA 2D06A 1ANKA 1XZPA 2HYDA 3HU2A 1SVSA 3LQRA 3LW7A 4RVCA 2OLKA 1QHIA 1HH4A 3UATA 1OPXA 1D2MA 5EXSA 2IK8A 4MRPA 1XX6A 3VHXA 1KI6A 1E2HA 4A92A 3MRSA 2XOKD 5DSZA 2ZVPX 1G20E 4N0EA 4MGYR 4IKEA 2CMKA 3N2IA 3U3RA 2GRJA 5L3VA 2ZU6A 1EX7A 1ZU4A 2XTZA 3WY9A 5SZIA 1E32A 3DDCA 3A6PC 1NG9A 4CW7A 1ZD8A 1HY3A 1T9HA 3LW8A 3B1XA 1ZYUA 4PZYA 2NPIA 1CJVC 2B7CA 2FX3A 1XEFA 4A6PA 3GQBA 4EFLA 4EFNA 3K70B 5FL3A 1YZNA 2HF9A 3AKYA 2WPDD 3DM5A 3N5CA 2OAP1 4C0KA 1N6PA 1X6VA 2YWHA 1KYIA 2ZVQX 4AURA 4B73A 4XSGA 5KPDA 5HPYB 1W36D 4B47A 1G18A 3BK7A 1KI6B 4EPXA 3U3MA 1XU4A 2C95A 4URWR 1RW4A 4TMVA 4GMDA 2J7KA 2JLVA 1Y3AA 3FVQA 1GRQA 3B1VA 3JZAA 5B58C 4DB2A 2ZE6A 2RGCA 3KQUA 4QGHA 5D3MA 1HQYE 3AP3A 3QXCA 1RZ3A 1HEIA 2Z83A 1F5NA 4D4KA 4Z1MD 1GRRA 5FTMA 3PCRB 3W5IA 2HF8A 1UFQA 2DFTA 2QPTA 3NXSA 4TYWA 2ZIAA 2EFEB 3EZ7A 5SZJA 1RFLA 4EKDA 3KKPA 4HAYA 4TYYA 1XTJA 3AVOA 1E0AA 4RKEA 4MA4A 4TLAA 3CPJB 2BEKA 3GJ7A 2FSIA 1ZJ6A 4FN5A 4MKHA 1GOTA 2FJUA 4BZXA 4I99A 4BFSA 3AUYA 4A8JB 5DHFA 3B2EA 2X1VA 1RPZA 1GWNA 2QT0A 4P32A 5CITA 3QEOA 2XB2A 1CKEA 2JIZA 4RZUA 2XNDA 1Z6TA 3DOFA 1XEXA 3AEZA 1UKYA 2QAGA 3G82C 3WNBA 4HLDA 4BFWA 3TJZA 1YZLA 3LBIA 2YNMA 2Z43A 2KJQA 3C7KA 1DTSA 2C98A 4JLNA 3EZFA 1NN0A 1K8RA 1DG3A 1R8QA 4HB0A 3OIWA 4M22A 3SQXA 4G5SA 5D3MB 4IJMA 4LY6A 3K1JA 4JL5A 4KITB 2ZJ8A 4HLUA 2ZUDA 4LYFA 2AK2A 3PENA 4BE7B 1VHTA 2WWYA 4C2TA 3B1ZA 4B3GA 2IYZA 4A9AA 1XCGB 1X8JA 1E4YA 2Q3MA 4MDEA 1OXTA 1VTKA 3GJ3A 5EXPA 2PX0A 5E7IA 4DDWA 2XXAA 4D82A 4HATA 3I5XA 4AY2A 3VFDA 3VR2A 3C5HA 4DKXA 3U7GA 2BBOA 3M1IA 2IF2A 1SULA 2EU8A 3LVQE 4D0NA 3ICQB 4UNQA 1E99A 1IN6A 4LHXA 1XEXB 3ADCA 4DLXA 3RVBA 3KQNA 1SVKA 5EE0A 2GEUA 2QAGB 3EC1A 3PJRA 2F9LA 1DAKA 1S1MA 2F7SA 1JXMA 1WCV1 1NVWQ 3P27A 2MSCB 2GCPA 1BH2A 1MO3A 2QU8A 4P4TA 4B2PA 1EX6A 1LS1A 3JZMA 5J47A 4NYIR 1OXSC 4LJ4A 2QN6A 1JJVA 2YVUA 4TSFD 2QL6A 1CJKC 2FGKA 2Z5FA 1GNRA 1NN5A 3LFUA 1AZSC 1CRPA 3IGFA 2F3RA 4KFUA 5GVSA 1M8PA 2HV8A 1KKMA 2PMKA 4TZ0A 4TMZA 3TLXA 4QJ5A 2ZU0C 2IXFA 1KDRA 2R6FA 3Q7QA 3VQTA 3QF7A 4LCBA 2OESA 2OFXA 4UNSA 2J3EA 3MWYW 4RFSA 2ERYA 4RD1A 2XXAB 4BFTA 1KGDA 2O0HA 3IBYA 4QRHA 1DVRA 5SZKB 2J0QA 1OH6A 3W6PA 4DUGD 1UBFA 1QG4A 1VIYA 1WF3A 1X8KA 1ZAKA 4PAOA 2GILA 3GLHA 4M21A 2JLRA 2UZIR 4Q4HB 1FP7A 5B57C 3ZD6A 5FPKA 2KWIA 2ORWA 1XZQA 1RJ9B 4A0RA 1E9DA 3OAAA 5JJIA 2ZYWX 4LJ7A 3T34A 2ZI6A 3WP1B 3U6BA 4V0LA 3NEJA 4JLAA 4XVUA 4BFZA 4ABYA 1V43A 4Q7MB 5KSZA 3QOFA 3QUSA 1NP6A 5EP1A 5FOWA 4ZDIA 4PC1A 5FBWB 2DPXA 4G1UC 2FFAA 5EXXA 5HKKA 2GBLA 4HB4A 4S2EA 3GCGA 1FW6A 1F2TA 1JEEA 1F6BA 1I2DA 2I1VB 2W6JA 5HCIA 5DN6D 3U44B 3IO5A 1UEIA 4TMKA 1XXHA 1ZNZA 4D81A 4IOLA 3AVTA 2QBYB 3KQHA 1N6RA 1IN7A 4GRAA 2DFKB 4IEEA 4RFSB 5J5CA 3SHWA 5FPHA 2GNOA 4DT1B 5K8TA 2QSZA 4LDJA 2WJYA 1YJ5A 4LGMA 5C2JB 1S8FA 3P26A 1OKKA 2WJVA 3GLHB 5IK2D 8OHMA 4HB2A 2AXNA 4I4LA 1SKYE 1Z6XA 1U81A 3RSOA 2WSSD 5AR1A 1XD8A 4HZUA 2BEJA 4JKIA 2XJ4A 1AQUA 1G5RA 4A2QA 4JLDA 3ZIAD 1VG0B 3T35A 3BE4A 3LY5A 2YC2C 1XJQA 2BJVA 1EG7A 1ONBA 1YR8A 3B13B 4U5XA 1S3SA 4JVSB 2BM0A 2QAJA 4GP7A 3FGNA 2RHMA 5JZVA 4ZDKA 2FG5A 2P3SA 4EPYA 4OHVA 1FPMA 2W2TA 2W6ID 2P6RA 1J2JA 1CBUA 1Z2AA 4WVFA 1TAGA 2IYSA 4LBYA 1OIWA 1YZUA 2FNAA 4X8OA 5JHHB 4JLKA 2V6JA 4NU0A 2XTNA 1XTIA 3M6AA 2OM2A 4KBGA 4PPFA 4QHYA 2VSFA 1Q1ZA 4D26A 2ORVA 2IC5A 4NCKA 4OBEA 4F4CA 4NCHA 1GL6A 4NZYA 1COWA 3B9QA 4BFUA 3I5YA 1AKYA 1OFIA 2JJ2D 4JLVA 5EXTA 2AFHE 4FW9A 3NWJA 1NL3A 2ZETA 4C0BA 2IWRA 5KO2A 5ELXA 1U8YA 2WIAA 2P6NA 3NC0C 1E2EA 3K0FA 2IHYA 2DCUA 4DLRA 3SJAA 1E2PA 4LJ9A 3EPHA 1TUIA 2D74A 3QKRA 4IXNA 4BFVA 3BH7A 1NI3A 4PSKA 4KI0A 4TZ6A 3KUDA 1E2LA 1N6KA 3L0IB 2FZLA 2ZSFA 1I4TD 3KXKA 4FI3C 4I1OA 2IS4A 1YE8A 4Q1DA 4X8MA 1TPZA 2WSMA 1ZM2A 4L8GA 2V3CC 1S2MA 4TYQA 5CJPA 5K8IA 2IYXA 5FPSA 2C2HA 3AGPA 2BMJA 4NYJR 4Q7JB 1DAHA 421PA 3C16C 4DCTA 4D0LB 2QP9X 3PUWA 3K70D 4F4IA 1FQJA 2D7CA 2GK7A 2FSGA 5JBQA 1MABA 2V7QA 4S35A 1DPFA 4DLSA 3TR5A 4B3FX 2CK3A 4PR0A 1T91A 2FSFA 3QKTA 2GA8A 3PEVA 1CJUC 4FMCF 4CYMA 4LJ8A 4P4UA 2H17A 3KL4A 5C46F 3K0FB 1LS6A 1NIJA 1OYWA 3ND8A 4LBZA 3C15C 4A0HA 1KY3A 2WAXA 1Q57A 4C0QC 3MLEA 1KK0A 2CCGA 2YOHA 1DOAA 4PQYA 5JI3E 4PAMA 4V03A 1SVIA 1ZCAA 2QMOA 1Q3HA 2JCSA 4HZIA 2OAQ1 1R6BX 1A2KC 2YYZA 2VF8A 3BFVA 1T8UA 3LX8A 5DO9A 1XMJA 3GLIE 3RRMA 4MRSA 3UIEA 1T3HA 2CEAA 4BEJA 4DC9A 1XBTA 2YWEA 2LKDA 2Y8EA 3F3YA 2P6UA 4BZPA 1MABB 5KPJA 4P4SA 2GF9A 3RWMB 4DSTA 5FL7D 4BLSA 3FTQA 2JLWA 1H8ED 2GXQA 2N42A 1DELA 3M4YA 2R6AA 3LBNA 4KJZA 3RHFA 4MKIA 2VP0A 1E9AA 1U94A 2CLCX 4LX0A 2CE7A 2RH5A 1OE0A 2YC4C 1D8TA 5FR2A 4TQAA 1OXVA 4B3BA 2BOVA 5LB4A 3B78A 3BGWA 1KSGA 1ZM3A 4H9GA 3FMFA 3SU8A 3RS7A 1E2GA 4GFDA 3SFVA 1ZUNB 3QXSA 5BYKA 1Z0KA 4PTLA 2XNSA 4Q48A 4PC6A 2D7DA 3T12A 3RYTC 4IW3B 2ZRAA 1F48A 3CW2A 4B6FA 5KU1A 2WTUA 3GFTA 5EJEA 1SXJB 1IHUA 1GKIA 4B75A 5DH9A 5K8UA 2HT6A 2ZE7A 1OV4A 2C96A 3R9IA 3EX7C 1NNEA 5HZKA 5IF9A 4P4SB 3C14C 3A8TA 1UBGA 4BGDA 1E4VA 2PJRA 1NY6A 2P0EA 3WMEA 3U2QA 4KVGA 4JJKA 4QM6A 5TDHA 3IEVA 4BEBA 5AJXA 5DI3A 4RCZA 3CLVA 5D3QA 2GF0A 3ZVNA 1XMIA 5LPNA 3HPRA 1XJ0A 2CBZA 2OCAA 1KJZA 2ZI9A 3C41J 3AKDA 4HEJA 3R7WA 1UKVY 1CU1A 3SJCA 4RSGA 4Q1EA 2J9RA 4O25A 4IOKA 4B3CA 1DG1G 3CM0A 4A2WA 1KI9A 5KDLA 2JJ1A 2AK3A 3X1WA 2VIIA 2ZJBA 3PQCA 3TUZC 2YHSA 3K9LA 3AP1A 4KYUA 3K53A 3RS3A 3X1XA 5G40A 3FKSD 1DARA 5A4JA 3R9WA 2B8WA 3GEHA 4V0OA 3QXXA 5H1YA 4OHYA 3CX7A 1TF2A 3KJIA 3W6NA 2ZSDA 1XFAA 1WQ1R 1IBRA 1XPUA 4UKDA 1SZPA 2ZRGA 2PLRA 3H0KA 1UM8A 4B3DA 2FWRA 3Q85A 1G8PA 1NN1A 2DY1A 4MGKR 5AJYA 1XTQA 1N5JA 2BV3A 2QUZA 4HUTA 3A4NA 4M1TA 2RGGA 3GLGE 4LK2A 4QFMA 4TYNA 1Z28A 2Q9CA 3QF4A 2GAOA 4OHZA 1FOEB 2CCKA 2FEOA 2G6BA 4MGIR 4PQRA 4TMWA 3W3ZB 2ZSAA 4XTCS 2W58A 1HT1E 1FNMA 1OB5A 2HCBA 3R7WB 2UZ3A 1BYIA 3EG5A 5EZ6B 2Z4RA 3RC3A 3A4MA 2WWFA 1IXSB 4FMCB 2ZRBA 1IXZA 2ATVA 2GXUA 3EZ2A 5HR5A 3QPUA 1AQYA 1VMAA 3E1SA 1UF9A 1YU9A 1FFHA 4Q18A 3R8CA 4E09A 1W36C 1SQ5A 4JL8A 2N1BA 4HI0E 1R5BA 3WP0A 2WVJA 4PXAA 1BMFA 5JLJA 5JWOA 1GAJA 2DR3A 4QBGB 5EE3A 3LAWA 4KO8A 1E79D 2B92A 2WWIA 2ONJA 1W2GA 2WJHA 1J8MF 1YRBA 1W48A 4TT3D 1QHYA 1W4BA 2OCPA 2FV8A 4B2LA 4G5OA 2I3BA 2A5FA 4BRWA 2XITA 1OHHA 3QF4B 2ZJZA 1NJFA 1U8ZA 2QM8A 3HJNA 3KKOA 3QPWA 4BQSA 2FE4A 3B1YA 2H8KA 4ZCMA 1AS3A 2QQEA 2W0SA 3VR4A 3KQLA 1KK2A 1OXUA 2IUSA 5DHAA 3RNLA 3MJRA 4EJSB 4OK6A 4PC2A 2BHRA 2BWJA 2GJ8A 1AZTA 3CONA 1J70A 1E1RD 3VX3A 1EESA 4P33A 5F3WB 4IHQA 3K0CC 5DE3A 2WSSA 3L8ZA 4E07A 4I1SA 1Q1EA 1P6XA 4KV9A 4LRWA 1GM5A 1II0A 4HAWA 1CR2A 1WMSA 2RGEA 3ZJYA 1NKSA 1X8LA 1P4SA 2JLUA 2J41A 4RZXA 1N6OA 1C4OA 5CIQA 4XWAA 2EYQA 4EIWA 4JL6A 2PLFA 3Q72A 2PEZA 1E0SA 3DKPA 3PEUA 4JYBA 4MRNA 1MV5A 4WBSA 2NO6A 3A36A 3IO3A 4NHOA 1E9EA 2GHIA 4CT5A 2FEMA 5L3SA 4POAA 4R9UC 2O8CB 3EASA 3DPUA 2IUTA 1A82A 2QG6A 3TIFA 4BZQA 4JVNA 3T1OA 1UADA 5KNCA 3TMKA 5JSZB 5CJ2A 3P4XA 5G3ZA 1YKSA 1IXRC 2W83A 4OQXA 4NONA 4G5RA 5FBQB 1NF3A 1W4RA 4US1R 3MWKA 2K5UA 3AVUA 4ASUA 2BCGY 3BD9A 4PPGA 5G53C 4FMDF 1KJWA 5EQTA 3EWSA 3AF0A 4LBWA 3MD0A 1MH1A 1XEWY 1TU3A 1W0JD 3RC8A 2DWOA 3ZDQA 1BYUA 4LI0A 2JJ8A 2PCJA 1U98A 2F9MA 3QNUA 1S9HA 2NO1A 2MSDB 4FCVA 5CK4A 1Z83A 3ETLA 4M2LA 3GP8A 3KTAA 4RFVA 4QJ4A 4MYUA 4OYHA 3HU1A 4WIAA 1NRJB 5L3SB 3PITA 1T3SA 2QPOA 3TSZA 4B2IA 4JT2A 1CR4A 1U9IC 3VNVA 4EUNA 1XEWX 2ZR9A 3K09C 4IVQA 1RVDA 5FBVB 1GIAA 1H65A 1GP2A 1H8HA 5P21A 2CDNA 2CNWA 4IOMA 4ITRC 2BKEA 3RRZA 3TH5A 3SEAA 1G5TA 2ASEA 2GEVA 4Q9IA 3THXA 1U8AA 3H4MA 4BLOA 5HE8A 2FMXA 5F9FA 4Q00A 4ERNA 1ESNA 5CDFE 3DMDA 3OEHD 4JSTA 1ZINA 4IFBA 2AR7A 4ZKDA 5CM9C 4HUQB 2IS6A 3WRXC 2ZRKA 2HLDA 4HDOB 3UWKA 1LF0A 1M1YE 2JATA 4DLUA 1OSNA 3C8UA 1DAGA 3KTAB 1P60A 1ZP6A 4NP6A 4AIIA 2B6HA 4C0AC 1KMQA 5BW8A 2GDJA 3ONWA 2G0NA 2OSBA 3TVDA 1QDEA 3PXGA 5LDDC 1D9XA 4UJ3A 4GT1A 3SYLA 2MMGA 2XSZD 2A9KA 3KB1A 4ARZA 3LVRE 3DMNA 1EFRA 1ELOA 4LC0A 5SZHB 4XVRA 1NJGA 2GZAA 5EUQB 3VR3A 3FFBA 3T61A 1G64A 5LB2A 2ZRLA 2QORA 2PT7A 4NYIQ 3GJXC 2MSEB 1PV4A 1EGAA 5KNDA 3GLFA 2Q3HA 3GLIA 3EPJA 1LB1B 4JIMA 4Q1AA 3THXB 3NHAA 3EIHA 1R0WA 4LJ5A 1ZUHA 1SXJD 2KE5A 5J40A 1ZIPA 1RRPA 4ON9A 1ZD1A 2NGRA 4OK5A 5JMTA 1E9CA 2QGZA 2VA8A 1M6NA 4A6XA 3LD9A 2ZRCA 3IIKA 3CRW1 3T5GA 1JJ7A 2WBLC 2IS2A 3C4JA 1W4CA 1QZXA 2FOLA 3RAPR 3REFA 1HURA 2PMDA 1K5GA 2IYVA 5HTKA 3IIJA 3HPQA 5LBIA 5K8LA 4ZCIA 2JAQA 3IPXA 1RC8A 3CWQA 1ODFA 4ARZB 5EP4A 1E9FA 1IJEA 4BASA 5CYOA 5E3HA 3I73A 2GCOA 1E1QD 1NIPA 2VP2A 3BRWD 4TLDA 1WB9A 1SVMA 4YMSA 3OE7A 3L43A 1N0WA 5IT5A 4IEIA 5CYPA 3GLFB 4R98A 1M7HA 3TBKA 1P2SA 2QENA 4AK9A 4TN1A 1XJCA 1U0HC 3QBVA 3GJ5A 5KHOC 4TYPA 1KK3A 1Z0DA 1B0UA 4LUCA 2VHTA 3A4LA 3UKDA 4TLEA 4JSYA 4KFRA 2R44A 5BN3A 1G3QA 3ZZTA 4PC7A 5M04A 3U7EB 3C5CA 5BWMA 4CF7A 3RS4A 1NMXA 2ZS9A 1Q0UA 3SBEA 4FMDB 1JBKA 1DE0A 4EDHA 2ZRPA 5JRZA 3LV8A 1G3UA 4L4UA 1MO5A 3CPEA 3L0OA 2PZGA 3A1VA 1EFUA 3UG6A 1Q1QA 1TEVA 2FFQA 3K70C 3CF2A 1MR3F 4OJQA 3VU9A 4PZZA 1F3OA 1MOZA 1KMHA 1XD9A 4NE2A 1P5ZB 2BIFA 1C9KA 2DYKA 2W2VA 3AV0B 3HWSA 3PUVA 4OK3A 2JLQA 2XEXA 2WIBA 4PAQA 3SQWA 4XJXA 4M1WA 1IONA 5KDDA 3HR8A 3QSYA 5B2ZA 1CLUA 4Q9KA 3I92A 4XD7A 1NN3A 5KSPA 1YQTA 1X1SA 1NSTA 2KB0A 5DISB 2WHXA 1N5KA 2F1HA 2R6CA 2OFWA 2QP3A 3FDIA 3VTKA 4ZIRA 5JECA 5CB8A 3MG9A 1OJLA 4JBWA 3WNDA 2ZI5A 3PR1A 1UJ2A 1NMZA 2F3TA 3BORA 3KUCA 3AVYA 4YQFA 3TRFA 2EYUA 3D31A 1D6JA 4LJYA 4A8JC 4IVPA 1DBSA 4KFSA 2QM7A 3VU9B 3GPLA 3B8HA 1KMHB 1ZW6A 2ZRNA 4G5GA 4B74A 1V5WA 4G01B 4RD2A 4TTQA 2CHGA 3FMOB 4Q5IA 2X2FA 1WA5A 1CJMA 1Y63A 4URYR 3ADDA 1CTQA 2FF7A 5DGXA 5F98A 1FZQA 1W0KA 4UNPA 3GJ8A 2VPPA 4HLCA 1JAHA 1G4AE 1KKLA 2VP9A 1YR7A 2N46A 2NO9A 1ZBDA 1LV7A 3A1SA 4RD3A 121PA 5TY0A 1GKYA 4LJ6A 1P2TA 4YMUA 2R6GA 1NVVR 2IS1A 4F91B 1JR3D 2ZI7A 3UMSA 1UAAA 4ZIRB 1RIFA 4RJLA 3VKGA 1RRFA 4LWZA 3D7MA 1G6HA 1KSJA 3OF5A 1ZCBA 3E2IA 3THWA 2FA9A 1GITA 1MKYA 2DWQA 2XX3A 4NYJQ 2YKGA 2DB3A 3BC1A 4HLQB 2JLYA 1G8FA 3X2SA 3HU3A 1E6CA 1ZC3A 2FZ4A 3OFND 2QE7D 1BIFA 4JKYA 1XTSA 1TQDA 3QKUA 4PO9A 2QAGC 4OI1A 2ODNA 3MWLA 2IYWA 2GCNA 3WYFA 4AWXA 2I1QA 4PHGA 3RRYA 2OBNA 1F2TB 2WJJA 1VIAA 5A0FA 2CVHA 4W9MC 5AJVB 1NLFA 1XXHB 3OEEA 5EE9A 4YXWA 1ZMXA 2A5JA 1J99A 3OZXA 3AF2A 3WYGA 2QMUA 4Z8XA 1VPLA 4OQNA 4Y0AA 2JGNA 4DSNA 4URVR 2IF0A 2ZSBA 3AF3A 1GTVA 5ANRB 1LW7A 2REOA 2AWOA 3Q8XB 4C2UA 4EPTA 2C77A 3U60B 1QF9A 2VO1A 2LWIA 2ZSEA 4WZ6A 1OT3A 2ERXA 3X1DA 4KXFB 1ZVQA 4HZUB 521PA 1KHTA 1S1CA 2J87A 4OI4A 3ZGXA 4URZR 1PZNA 2IYQA 2V54A 3EWAA 4NYMR 4M53A 3TK1A 1MRNA 2FPLA 1G17A 5E95A 5TV2A 3CWZA 4A0FA 1GUAA 1G9XA 1NBMA 1CR0A 4PHHA 4V0NA 1CS4C 2CXXA 5JWHA 1KI3A 2NQ2C 5KTYA 3GFPA 4Q1BA 5FBRB 4G0NA 2J0SA 1SHKA 4QKQA 5TMPA 2V1XA 2OT3B 2J7PA 2ZI3A 2ZJYA 4F93B 2A5GA 3NDBB 1KNQA 1JQJC 2ZITA 3X1ZA 3SHFA 5H8WA 3KZ1E 3FHTA 2OXRA 5EE1A 1HE1C 3G5UA 4ZCLA 4RD4A 4Q03A 2JDID 3L82B 2A5YB 1JXOA 4NMMA 1GRNA 2IT1A 1T3LA 2D62A 5CIWA 1LY1A 4DWJA 1DO0A 1CEEA 1N0VC 3MSXA 4JLBA 2RB4A 4UNNA 2HJVA 5AK0A 3K0SA 4DDTA 3OHMA 1MRSA 3IHWA 4G3XA 2Q21A 1NLYA 1TADA 2XOKA 1U99A 3BB1A 4RY2A 2IX3A 1R4AA 2BM1A 4I81A 3VNUA 1QHSA 1KNXA 2J0VA 1TMKA 2UVQA 3QG1A 5FTNA 4KAXA 2NO0A 3SI7A 2O8BA 3CO5A 4JMPA 4ILEA 2F6RA 2NOAA 3QJYA 2FFBA 3QKRB 2VSOA 3RABA 3FHOA 2FGJA 4FINA 3Q3JB 4KLNA 3OEHA 4J0QA 3WHKA 4Z51A 4IDQA 3IHLA 3CKLA 2QSYA 1Q21A 2ZQ5A 2X77A 3GJ6A 3RANA 2RGAA 1Q3TA 2YWFA 3QE0A 4HAUA 4M9QA 3SFZA 3PUXA 4JYCA 3VR1A 5DYGA 5CDFA 2A78A 3O8RA 2QRNA 2KBFA 3CPHA 2OBMA 1P9RA 1II8A 1XB2A 2J46A 2WPDA 1VCOA 2C78A 1WXQA 3L2OB 3ZLJA 1XWIA 2RKOA 3A1TA 2IXEA 2WWWA 2ZUBA 3CNOA 4JLPA 3ECCA 5FI1B 2FPMA 5FTKA 3UWOA 2IYTA 3CIOA 3IEUA 1Q1BA 3U7FB 3QQ5A 1AKEA 3NEYA 2H7VA 3H84A 1FMJA 3HR7A 4Z1MA 4R7ZA 4OHWA 1ZUIA 2YJTD 1QHXA 4ZI3A 3V4RA 2F1JA 2ZAOA 4M0LA 4F92B 3U61B 2CLSA 3RSLA 5DNYB 3W8RA 2CHQA 5FBLB 1A5TA
chains in the Genus database with same CATH superfamily
5LVAA 3Q98A 1A04A 2YW9A 1M2FA 2B9VA 4B71A 2YTZA 3QXJA 2EFCB 4U9HS 2OQVA 5AKZA 1GPLA 2BFEA 4HWKA 4AROA 2JBWA 3BBPA 2YJ4A 3UCXA 2KMLA 4A73A 4MH0R 3BRCA 4Q47A 2XQIA 4OMCA 3ZHQA 3COZA 5LD2B 1DX4A 2ZWMA 3QBEA 1JFTA 1WE2A 3I28A 2F43A 1WXEA 3U17A 1UDWA 1HLGA 4B6EA 3P0RA 1G4HA 1RR6A 4LGCA 2B7LA 2E85A 1KAGA 1NX9A 1SMKA 1UEXC 2WMOB 4GQAA 1XTRA 4N9WA 2HW8A 4QYSA 3CS3A 4PHTA 2XLBA 1L7VC 1QFJA 4EEZA 1FYEA 1YTUA 1SUAA 3UB2A 5TSDA 1UPFA 4GBED 4KDRA 3JQAA 4KN8A 4GI1A 1BXGB 3K0CA 3FXAA 3KQTA 3B6KA 3M5PA 4FFLA 1Z29A 1EVQA 5EERA 5ESDA 4AQDA 1RKBA 2XXBA 4PS1A 5EKDA 3RIEA 2A0YA 5AM2A 1TGYA 2ROQA 4QEZA 1W94A 4MX8A 3DCNA 2ZJAA 5EIHA 2SCUA 2WG0A 4LJRA 3GLKA 4RVUA 4RV9A 1NJ8A 1VJ5A 1VG1A 2C7PA 4GP9A 1HV8A 5I8PA 3FY4A 1XDBA 2DETA 3FTPA 3D4IA 4QHSA 4M1SA 1MGPA 3KETA 2YZMA 4TXNA 1CJTC 1U1CA 3AF4A 2DPYA 2I6SA 4BFXA 2BFEB 2V98A 2VR1A 3A6DA 2AW3A 4M37A 4Q9HA 3ZU5A 1OROA 1UFKA 2VUUA 2H2DA 1L4EA 1WXFA 1G3MA 2RGWA 4JLSA 4BO0A 3MS4A 3VNRA 1BMQA 3UO8B 1GCIA 3F8WA 3IVGA 3FMPB 2R79A 4PAWA 3SYKA 1TA4A 4FJ1A 2RGNC 3IAM6 3V97A 3O90A 1KYVA 1OFVA 3DWGA 1ADFA 1BEEA 2F43B 2R25B 3OZGA 2AVDA 1O03A 2H9YA 3RF7A 2FWJA 5BSHA 3ZY3A 1T5LA 5E1OA 1MD9A 1Z5ZA 3LJKA 5FOUA 3GAFA 1WL8A 1RABA 1WHSB 2JAWA 3VR2D 3KM0A 4QD3A 4DGQA 5CBPA 3GNQA 1HFJA 2BGTA 4OQZA 1GZ3A 2ZREA 3JQAB 2DLCX 2WTEA 1KVUA 4X63A 1I30A 1T5IA 3VVBA 4PYMA 2JHAA 3TFOA 3SR3A 5GZ3A 4YJGA 5CURA 1R10A 2O48X 3NIBA 4CPDA 3JZFA 1SCUB 1UBNA 1YBAA 4A82A 2QMEA 3WLFA 2DC1A 4LXHA 4UXIA 3ZU6A 5BPHA 1P9WA 1EXNA 5DLPA 1J06A 2ZBRA 4DNFA 1IB0A 3EIOA 4B3TB 4K9KA 5SY6A 2IU3A 3KJFA 4OIMA 4WW0A 1E3IA 4HQOA 2QN7A 3LXRA 3RYIA 1IY9A 1N7GA 1UM9B 2CLHB 4WFJA 8GPBA 1F5SA 5EZ5A 1Y37A 3RVPA 1LWNA 1CIVA 2YVLA 1EIZA 3DE5X 2X5XA 5C7OO 1I5RA 1P4HA 1U1FA 4ZT6A 1JJBA 2GPTA 4MWGA 4PLWA 3SZRA 3SX2A 3HNOA 3FVTA 4M1KA 2B4QA 1G66A 1SBHA 5I45A 3DW3X 4G0WA 1X14A 3DLTA 4CMAA 2QJTA 3NDIA 2IPXA 3GGJA 1EFDN 3GK3A 2BT4A 5DCYA 2FRDC 5CBPB 1P17A 5AP9A 1GFIA 3GLQA 3A6HA 3GLVA 4G0QA 4KBFA 4Q0MA 4TS9A 3QVUA 5I4BA 5KOIA 1U9YA 2RC6A 3S1SA 3KOYA 1EGQA 1ZONA 3GRPA 4ZT4A 5FOVA 2JK1A 4LISA 1R9GA 4YJGB 3CLHA 3IUQA 4JLOA 5AKHA 4YONB 4ENRA 4P86A 1MTOA 1T9GS 3RTDA 4HNSA 2ZATA 2IEGA 2V6IA 3FNFA 5FXMA 4O2RA 5E1DA 2VF2A 2ZYDA 4TTRA 1S2NA 4TXMA 1KDPA 2OP0A 4AF6A 3C6YA 3O94A 5K3CA 2H18A 3CQ9A 3V7NA 4FDLA 4TGLA 4CKCA 3L9WA 4IIFA 5A6VA 3PEEA 5JYCA 1O5IA 2D2IA 2ZRJA 1MO2A 4RVOA 3A2KA 2VDJA 3ZV4A 1R27A 2Q1XA 4RTNA 1DEHA 5B5SA 1OFTA 4MIOA 1A9PA 1E7WA 1WKCA 3Q9UA 4MQEA 4L6CA 4OJTA 1EDEA 2H51A 3WIOA 1P7PA 2EARA 4MGZR 3TD9A 5JNRA 4Q34A 5FORA 4K86A 4AZTA 1KK1A 4M1OA 4NICA 3RQSA 3L02A 4TKLA 3ZIAA 3OOSA 1EXMA 2OQ2A 3KPUA 1ESMA 3TQSA 3ZQ6A 4ND2A 2VH1A 4PLVA 1V5GA 5KX5A 3GNLA 4GECA 5CNMA 2BMEA 1QWSA 4UM8B 1T9ZA 1QPZA 3B12A 5CK5A 3RWOA 4ETNA 1KQFA 2RHCA 3WV4A 4YWHA 2PCLA 4CMIA 4F0JA 5KDOA 5B3JA 1FVFA 4KQFA 4PG5A 2WILA 3EHEA 1M72A 2W6IA 5K0LA 3CURA 4KU4A 1NXPA 5DM2A 5F76A 3VNQA 1CDDA 3CNLA 4NX2A 3AKZA 5DDIP 3BERA 4NNJA 4QUGA 4PZ9A 3N75A 3CRRA 4CKCB 2XRZA 1W8DA 1Z8DA 3FWZA 3HLTA 4LMAA 3SYTA 2YHBA 4A7PA 5JDCA 5FIUA 2V7GA 1EGMB 5K5EA 4CLOA 4NU6A 1A9ZA 4ZQBA 3ZCTA 1WB6A 3PPIA 1K86A 2O2ZA 4UHFA 1T24A 3GLTA 4E03A 4MQEB 4RV4A 4MW6A 5J3JA 2ECPA 2H65A 1I6LA 2I4LA 2Z3VA 3BF8A 3OETA 2OG2A 3AINA 2ZBDA 3KQPA 3ZQJA 3TG2A 1ZK3A 2OLJA 3W6UA 4FT2A 4AKEA 1Y33E 3JALA 4AF8A 3AHIA 4ZRMA 4YV7A 2WMNB 4N5DA 1HE8B 3OJWA 3AZQA 3V4PB 2O2DA 4K9PA 2DAPA 3R0QA 3RHTA 5T6BA 4ZHQB 2GTIA 2XIQA 5KX5B 2OXFA 4C5BA 1QE5A 3A37A 5BUSA 1N77A 3DTNA 4LS3A 1JR4A 5AVSA 5D2CA 3U7JA 3IEIA 4M8SA 5C31A 3M5WA 4CMIB 3NWEA 4XVCA 2P2CA 2Q0SA 5ILQA 4FEAA 3A6ZA 2HPVA 3GAAA 3AR4A 4UEKA 3ZVMA 3CZ5A 4B43A 2A9OA 3AXSA 3DZBA 3QG5A 5CYGA 3Q3CA 2C9CA 4ZVOA 5J23A 1FU4A 5J4LA 4Y2JA 4IJ6A 3DO6A 3EPRA 3QVMA 1Z6AA 4KXNA 2A9FA 2X2EA 1HPLA 3JD0A 4ZZ0A 2WUGA 4CLOB 2QRPA 5FFMA 1JRLA 4NBKA 1KPHA 3RTBA 2ADOA 4KSBA 1AJEA 4DA7A 2FUNB 4CTNA 3FNRA 2UVPA 3UMYA 4W5HA 1Q0TA 1KGSA 1EWRA 1EE9A 5CTAA 3C7DB 5CVDA 4D6XA 2NUAA 1QRAA 5JFGA 4R3NA 1U8UA 1U7XA 1Z36A 3DM9B 3QKIA 1MIOA 2CWWA 3UFBA 2X6QA 4G1CA 1EP3B 5CVUA 5ALEA 4JI1B 2GD2A 3WLJA 2XHZA 2HADA 4MYHA 1F2UA 1JQLB 4M46A 2WU8A 2R48A 3EQ6A 3PUZA 4LVCA 5KHLB 4ID9A 4L15A 2KYRA 3UMMA 3I1IA 1I7DA 1IQPA 3QVWA 3UCFA 1FFBA 2IDZA 1TUBA 2I2DA 4P53A 1LJ8A 1JA9A 1RZVA 1ZNQO 2CXSA 1KEKA 3L7KA 1GZ7A 4IGFA 4ZCRA 5ALUA 2PIDA 1J7KA 1SCKA 1SKQA 1FQKA 4GL4A 4ZU3A 4X92A 4C87A 2EL7A 3A4TA 1U65A 3E1GA 5DWQA 1M1ZA 2A1UA 3EC2A 3D3QA 3IAEA 2VXBA 4X62B 4Z4EA 4PWYA 5LOVA 1V1MA 1W19A 4S1TA 2HBZA 3SSAA 2BZ0A 3D2LA 1QS0A 5EHXA 3NHFA 1Z0AA 1D0SA 1FYWA 1JG3A 4TS1A 1ZK2A 4C5AA 5CEJA 1UZNA 4S0ZA 4TUYB 4QPZA 4WDRA 1G4UR 1QTQA 4QGBA 4EG0A 1SXJE 1Q17A 4L8FA 4AWBA 4UTVA 5CAEA 2PS3A 1A97A 2C4MA 3EWIA 3E3NA 1B8UA 3KKKA 4QLOA 2NUAB 4DZZA 2I3GA 1VJTA 3ABZA 1MIOB 2XAUA 4EO4A 4J1TA 1J1ZA 1BS2A 2WV7A 3ACDA 3AIOA 1F2UB 5FL7A 1SUSA 4NBSA 3TTUA 5F9HA 1EAYA 2VHYA 3C1TA 4PXSA 1I6KA 4F2PA 2XZPA 4MYDA 2GETA 2E5LB 1WM1A 2VS1A 5SYMA 2XTAA 3FDXA 1BKYA 4JBNA 4QYMA 5F77A 3UAVA 4MS1A 2FZKA 5THXA 4D74A 1E3WB 2BJHA 2OBLA 2PZFA 3HUFA 3K2EA 3S2ZA 3TAUA 5JJLA 4MW7A 4L7VA 3ZQ4A 2PZLA 3CN7A 5F4ZA 3IS3A 2G8NA 2A1UB 3OIGA 1ZAYA 3QEJA 2XE7A 1NVUQ 5SY4A 4KN5A 2Q3EA 5D3ZA 1AO0A 3UANA 4HQKA 5LOVB 1V1MB 4XYBA 4MIYA 4LV8B 3WK8A 2CJXA 1I4LD 2H11A 3ZVLA 1YHNA 3LO5A 1SZJG 4GPIB 1VSUA 4R5MA 3T7AA 4QQ8A 1NURA 4MYCA 5B6IA 5CAEB 2HUNA 4CFZA 4RXUA 4KACA 3STWA 4LJAA 3ONEA 5LDGA 6YASA 4J1NA 1C3XA 4I5FA 3CRMA 3GLIB 1JALA 2X4IA 3ASVA 2FQYA 3CCBA 3QVSA 4U2CA 1N2BA 3KJHA 1ZM7A 2DY0A 1WIWA 1VE9A 2JKVA 4ZEXA 3DE4X 2NV0A 2J59A 5CVVA 1QIGA 3EF1A 1L6IA 3LA8A 1PZFA 3PL5A 4ICIA 2J6IA 3X2FA 1YIDA 5HUJA 3C2QA 1NVVQ 3RJ9A 4E5KA 5LBTA 5I01A 4MS1B 3D1VA 2B1IA 4J0HA 3A70A 1A95A 4ZO4A 3IIMA 3E8MA 2FPKA 2P67A 2ZANA 1V8OA 3EQ8A 5ALHA 1M2VA 1IVSA 1DBPA 1NTRA 4PYLA 4B3SB 2WU1A 2ZYUX 1E6KA 2PEYA 1T4CA 3Q6MA 1CY8A 2GPWA 5DB4A 4MYRA 1N8SA 3H11B 2R5FA 1E2DA 1JEDA 4NECA 4PLTA 2HYIC 4WUVA 1Z6YA 1FDUA 2F4NA 3URMA 4DG8A 5K20A 1SXIA 1E2MA 3DFKA 2R68A 2EHDA 1R6VA 1A2OA 4CLRA 4CIXA 2CHVA 4L51A 2A2ZA 3X2EA 2M32A 3GJ4A 5KREA 4GSYA 1R64A 3NP7A 1N25A 1WP4A 4N39A 4DBLE 3ENNA 3A6JA 4GQBA 1MA3A 2HJRA 5FLXA 2JEOA 1SIUA 4HK4A 3ZZNA 4FC6A 3BIJA 2GJ9A 3AL0C 3K1YA 4XH9B 2X41A 3OE1A 4C7KA 2PZEA 1GGJA 4LRXA 1E2JA 3PYLA 3PC4A 1FPQA 2FMFA 2X1MA 3CIFA 4NNPA 1SM4A 3NTRA 1CZHA 4ZT7A 4YUZA 1P0PA 1VGVA 2EFYA 3IH5A 2XKKA 1N0UA 1XTVA 3TGLA 1KO5A 1JT9A 3QYFA 4CHGA 5GONF 2RHJA 3ZGOA 3SR0A 1EFAA 1UINA 3J7AC 1UC8A 1YFZA 1XP5A 4UUAA 3VVMA 4NTZA 1SD2A 4JENA 3I0ZA 4B33A 4D3XA 5DLDA 1B2LA 4Q1CA 1Y1RA 2DWPA 2YBDA 3F1KA 2HHJA 4JEHA 5IJWA 1M2VB 3PVCA 2XCLA 4NK5A 1EP2B 4N0MA 3OLXA 1K0FA 1DJMA 2BRUA 1RM5A 1QH8B 1RKQA 1GVNB 3MTBA 1BVYF 3H1PA 4LRTB 1BE8A 1M2HA 3PQ8A 3WOHA 1NM5A 1OTHA 4CLRB 1KYYA 2JC3A 1YZTA 4RKWA 5HCNA 4YWJA 4IYJA 2YRFA 1QAQA 2HMUA 2WLSA 5FUMA 4DHEA 4MYTA 3K8QA 4AMVA 1W44A 4P08A 3ZGNA 2XB6A 3OWHA 3PRHA 2BGNA 1JR3E 2CLLB 4P34A 4W1QA 3V1MA 1K6XA 9ATCA 5FUYA 3V2GA 5ICCA 2WMYA 4KX3A 3HB7A 3ZPXA 1USVA 4GOJA 1FLVA 4FEEA 4BWYA 1WDKA 4FR0A 4LNAA 1XKLA 1CUEA 4I1VA 1NASA 3GJSA 1TE2A 2VDVE 2IY9A 2DVMA 3QEAZ 2NM0A 2YHAA 3AWDA 2AS0A 3BX1A 2CXRA 2DPGA 5BMOA 3MOIA 4FB5A 2B21A 3NKFA 2HFJA 1PS0A 2BN4A 2KSQA 4MQUA 4Z7QB 1P5RA 4MV3A 3FTEA 821PA 4C4PA 2VTKA 4C7VA 2AR0A 1CEQA 1ZN2A 2NV2B 4RVNA 2X5NA 3IODA 1IHOA 1CRQA 3ODPA 5IASA 3QVTA 2HNAA 3EW9A 5JAQA 1P4GA 4HB3A 3MELA 3O8QA 4JIGA 4YDHB 5K3BA 3SJZA 2QTGA 3VR4D 1P4RA 2EKPA 3D6TB 4DR4B 3HFSA 1W5TA 5DM0A 1KRWA 1UOPA 5KBYA 2XJ9A 1ECBA 3NBZC 3OQHA 1SBYA 3D5EA 5HIIA 1GTL1 3A1CA 5A6SA 2C7OA 3CRQA 3MJ4A 3WSWA 3JV7A 4F4JA 3FOFC 1SCAA 4QNMA 4PBSA 1IPHA 2YNMC 1L4YA 4PR3A 5AOBA 4REMA 4B32A 3TTSA 1Z37A 3RG8A 2JGJA 4C0XA 1GG2A 4XOUA 3RVRA 3W9YA 1UT6A 2CLMB 1ZRHA 2QT1A 2ZTUA 5FWNA 2PBRA 3I6QA 1AKMA 2J9GA 5F1PA 4OL0A 3AESB 2A0FA 3QWIA 1P3JA 4HLUC 4FXOA 1PKXA 3V6MA 3USZA 3VISA 4E08A 1R3DA 3KO8A 2A8YA 1S89A 4IZHA 1BOFA 5C8YF 1XVVA 2NVBA 2DKFA 3HCNA 4UUQA 1AQJA 4HYEA 4BPBA 1KXZA 2OAGA 2W6NA 1Z17A 3E18A 4Q9LA 2H00A 2AUTA 1N8TA 4QFBA 4IWYA 1I24A 2OZPA 1DADA 1P4JA 2EFHB 3DZ8A 5F52A 1Y98A 4US0R 2RAFA 3OTIA 4GNKA 4NQZA 1UXIA 3PXUA 3ZHRA 1G3RA 3E9NA 5KIAA 5A5EA 4JR2A 1YS2X 2YINC 3P0HA 4KAAA 1NP3A 4J6FA 4PC3A 4FNGA 5HJEA 2ODAA 2WVGA 4RHTA 3DL7A 5JMOA 3R7SA 3O8QB 2VRBA 2X15A 2OUIA 3IRUA 5E6SB 2OLEA 1TYDE 1GV1A 2OXCA 2VRCA 3KSDO 3TW6A 4DTIA 4LNUA 2GBCA 5KJEA 5KNCD 4R8KA 3R7AA 2P2NA 2IXGA 4KR0A 1WXDA 2OENG 1I2AA 3GMTA 3OM9A 4L5YA 2RBGA 4Q1FA 1SBNE 3D9QX 4JS0A 2X23A 3A10A 3PFIA 2R00C 4C88A 4QJ3A 4UM9B 4COOA 1EINA 4RK4A 1NYQA 3EDCA 3KR9A 4LXUA 1NW5A 3ZWPA 4IRUB 3ICEA 3ODGA 1H5UA 4BJ3A 1OZFA 4NCNA 5IAKA 1XWWA 3RC7A 2WKPA 4BZWA 1ZITA 4OHUA 4Y2SA 2GXAA 3ET4A 1RM0A 3OC0A 1EGHA 5DM4A 3GG2A 1YFLA 1E9SA 4FFVA 2EP8A 3DOJA 5L6MB 1KMMA 3GDWA 4NEGA 1DQRA 4X0EA 2VHXA 1QIKA 2AIRA 3BWEA 4JHLA 5EKTA 5DGTA 3TQCA 1TO2E 2QRMA 3CLUC 1CT9A 5B64A 1FTWA 4E2YA 3TR0A 1L7RA 4AY6A 1A88A 1FFWA 1L4UA 1NUAA 3MUFA 2E2WA 3QNWA 5GJWC 4LYAA 3MCZA 4P6VF 2RGNA 1HE3A 3U3JA 1IH8A 3WLIA 1OB2A 2HSEA 3O8DA 1PW5A 1N2GA 4ZDIA 2QT9A 1TTTA 1VDZA 4LZWA 1F8UA 4KE8A 2OFOA 4LNUB 3RTGA 1U2SA 5CHEA 5EJ2A 2Z8ZA 4PO1A 4NH0A 3UVEA 3PQEA 1JA0A 3RQIA 1BOOA 1VHQA 3D6AA 2B2NA 3FNIA 1E1YA 3KYJB 3H4TA 5BSKA 3WAJA 3UPUA 4DCNA 1Y9ZA 2H16A 1GV0A 3AEUB 2R8RA 1U2DC 1O8BA 1KIMA 3ESQA 3GLGA 4OQMA 4UEOA 1ITZA 2VDKB 3QPVA 5T57A 4QTTB 2P0AA 2IEYA 2DKOA 3KZCA 4PCUA 2PKWA 3I53A 3M6FA 4IDDA 4QBFA 6PFKA 1NRXA 3FKQA 4TQ9A 3WE7A 1S2IA 4C05A 5CT9A 4ZHSA 1T4GA 3LLUA 4U2FA 1ICIA 3C7TA 4NDZA 4BQPA 5KNBA 3AM3A 1FFDA 1O58A 1PJSA 3RLFA 2J5QA 2AFRA 4Q93A 2HLDD 1FXWA 4W1PA 3JRNA 4M1MA 2XQVA 3T5DA 3DBRB 3ROFA 3IOMA 3ZGYA 3NFRA 2BE9A 1KRXA 3SKYA 4E13A 3BB4A 3ZOZA 2VJQA 1QMPA 3UHOA 1U0FA 4C7OB 3EXEA 4BP3A 3NBXX 3RHSA 3RYCB 1JHQA 1KBZA 3O73A 4XCXA 3EEOA 4TLCA 4N54A 4J4BA 1K06A 4ZQHA 4RNDB 1KO7A 3FHCB 3SJUA 2WFAA 4KPYA 3KKLA 5DP2A 1X1RA 2G1KA 4DAEA 3F90A 4D80A 4DUPA 1PUXA 1KI7A 4GKBA 4INPA 2O8BB 4Y1GA 5HMLA 2IV2X 3P8ZA 4IIUA 3WO1A 2FRDA 1RYHA 4XWKA 2KI5A 2VQSA 1X70A 3DHVA 3N53A 5G0WA 1EFRD 1EFKA 1J5XA 5EZYF 3B53X 3T41A 3VR3D 3TIXB 1O89A 3OTGA 2EKBA 3U31A 3LIPA 4J90A 3A9TA 2IWHA 4K0KB 1AD2A 1GQ2A 1OAAA 2G7ZA 3DKRA 3TEFA 3Q7SA 3QWBA 1CDZA 4D7AA 1A1VA 3IBFA 4HFNA 2IP2A 2IYEA 1H6AA 4YCLA 2ZE5A 4QGFA 1TNDA 4I2VA 2RHTA 1GLVA 3W3AH 1K63A 1ZCJA 1NI4A 1H9BA 1TT7A 1WF6A 4IXWA 1YZKA 4QDTA 3FPEA 3ZZUA 4CUZA 3D2AA 3N07A 5ALTA 3G79A 4KYTA 3NS7A 4D9JA 4IIXA 5C7LO 2YJ3A 4QDUA 3SXPA 3AKCA 1E2IA 3DDUA 4GW3A 2ZQYA 4O5OA 3WTCA 4F85A 1W1WA 3K0EA 4EYOA 1DBVO 1W5SA 1G3IA 1YACA 2I2CA 2G9ZA 5KOYA 1OGIA 3IRVA 1ZXBA 2TMYA 4BV3A 2DOKA 4DNPA 1VPWA 4IL5A 2OV3A 3TUIC 3LF1A 4IXMA 5TQVA 3FMIA 2QZSA 3IA2A 3MXOA 4YJ2A 1ZGCA 1OXMA 3N2LA 2OHFA 4YV1A 5BR8B 1Q95A 4MP8A 1VL6A 3SS8A 2PRYA 2QV7A 4KQGA 4LTDA 2QZ4A 5BN5A 5B3AA 1VMKA 3Q5DA 1V35A 3W9BA 4IPTA 1TL7C 1LEHA 1PW7A 4N49A 3CH4B 4I36A 3K31A 1I4WA 1I2MA 3FZEA 2VJCA 1FNDA 2VHWA 2LW7A 1C0LA 3MMPA 3VR5A 4U7GA 1GJRA 1CXZA 4UW9A 1NHWA 2WJAA 1OLXB 5H68A 2VPQA 3MTGA 3U0BA 2C9DA 1E2NA 1HTBA 3MQ4A 4UHHA 3WYAA 3NTUA 1CFZA 5EEHA 3EXG1 4HYTA 3I05A 3I4LA 3RAGA 3UOGA 4K81B 3B70A 3DAFA 4KXUA 4UPDA 3VV2A 3QMWA 1CX9B 1VM6A 4BTEA 5J2TA 2X9NA 3M33A 4PZLA 4LZNA 4BV8A 2G1JA 1IZZA 1OAKA 1OI4A 3A3NA 1OQAA 2G1UA 4BJ1A 2A7QA 3OTOB 3I8XA 4JZYA 3SHVA 3QX7A 1U5BA 2D3TA 3QXHA 1ECGA 5BV1A 3AFGA 2ZS7A 1Z0IA 2CL0X 4GM4A 5F5NA 3UMRA 3KU1A 2ET6A 3Q3GE 4POOA 3NOOA 1FY2A 2X0EA 4Q7QA 3DNMA 2PGXA 1OH8A 2GAFA 4YJ2B 1JGTA 3EN0A 3KSAC 1X80A 3DAOA 3Q40A 3SP1A 3K1TA 3TTTA 3DG9A 2WD8A 1ENOA 2GZDA 1YDMA 5HS4A 3U19A 2E6UX 1VCMA 2XDAA 3MGKA 3PNYA 5BN5B 2J07A 2RGBA 2OV2A 3I23A 3LLMA 4NCIA 3L7MA 5JCJA 1FJGB 3A0RB 4GI5A 1WMAA 4KV7A 4YRNA 3PSHA 5EJMA 3L0PA 2ZUFA 2R6HA 4ZO9A 3QIAA 1PI3A 5DU2A 4Y6PA 1EFTA 2XQFA 3IR7A 1N7JA 4Y6LA 3CEAA 4II7A 4L22A 5EP3A 3JVVA 4X85A 2CF6A 1W52X 2XVYA 1EHYA 4HLNA 4KGZA 1NBIA 2EBUA 4O2AA 2IZ7A 5E4FA 4ZCTA 3GWGA 5B6PA 1R0ZA 8ATCA 2AHOA 4V38A 1U7PA 2EFGA 2QNRA 1GDDA 2ORIA 3GUCA 3ZUPA 4ESHA 5J2TB 2CVFA 4BO2A 4ESOA 3I9KA 1UC5B 3OMWA 3RT7A 3L3BA 3MCWA 3NDPA 1XAJA 3WNQA 3P9QA 3JQBC 1USWA 1FMCA 3I1FA 4F2WA 3L92A 1P7ZA 1U5BB 4TKUA 4YRJA 3ZVKA 2QMQA 1YZHA 1UFVA 1C8BA 2WWHA 3C3BA 4L3OA 3M2PA 2C2GA 2WUFA 2ZYTX 2XAAA 3H5IA 3O4HA 1RU3A 2KM1A 3P2EA 4Q01A 1ISHA 1DUSA 2AN4A 2OOKA 2V7EA 4CV1A 4M38A 1ABFA 2JG3A 2E21A 4TYMA 1GQQA 3IULA 1XXHE 2BSAA 1W0KD 2PX3A 2I91A 1N2CE 2OCKA 5I7OA 1T36A 1QOQB 2AMYA 3JVEA 4CQJA 2NNWB 4QC2A 1HDXA 3H1EA 4B0OA 5A2GA 1XU9A 4H4EA 4DL9A 1XA3A 1MB0A 1BO6A 1C3OA 4I55A 5FQNA 2PH5A 1QH1A 2Z2JA 3UV3A 1KI4A 1LW6E 1OYYA 2C4KA 5HIKA 1JLHA 4RH3A 2GBGA 3KQQA 2CDCA 1AN0A 1IAQA 3R5HA 3WNZA 2NO7A 4O2AB 1SQ6A 3O2SB 5DI9A 3UK2A 1ZFNA 1VL8A 3OX2A 3PEFA 1OZHA 3WL3A 1XZDA 2QE7A 2Y77A 3D6VA 4LY9A 4OJNA 4WN3A 2O6LA 1GR0A 4DQVA 1SHZA 2I22A 2IYYA 4FCTA 4COKA 4Z54A 3IDZA 2IH5A 1P1CA 5DGDA 4Z0NA 1IL0A 1HDYA 2AHRA 2PH1A 3PKJA 4GOKA 4TKUB 1VYUA 4Y67A 1K6MA 1TC2A 3L1JA 1FJXA 4LF5B 1N1MA 1PUIA 1UPCA 5D51S 5FAXA 2BGMA 3B51X 1TCVA 1TJ3A 3REGA 3DNPA 4BJHB 3TXAA 5KCZA 4HAVA 4J94A 1NV9A 3ND7A 3NCHA 2PTGA 3NBYC 1PJ4A 1KYXA 1GKLA 1I36A 5LC1A 5K3SA 3S40A 4LYDA 2FLKA 4LMBA 1WTAA 1JHDA 1T36B 4Q4JB 3IA7A 2VOJA 1NMYA 3FDZA 3ROMA 4IINA 1TEZA 1YS6A 4FSXA 1NOIA 4UM9D 2OORA 3ZWXA 4D6PA 1ETUA 1C3OB 3H1TA 1A7AA 3PQ5A 2P6OA 4H77A 4I55B 4IRMA 1UKEA 3IKMB 4H27A 1QH1B 5JCZA 3OLCX 3IAM1 3CR7A 4O4LF 3C3DA 1YZQA 4AMYA 3N59A 4BATA 4YXWD 3SVLA 2YZ2A 1W6UA 2AI2A 3EGEA 4LBVA 1N6LA 2AKAB 4OHRA 1DZIA 4ZYXA 4EHJA 3JD2A 5C5EA 3HA2A 5C5CA 2IVZA 2Q3FA 5GOTA 5J1TB 3VR6H 1Y1PA 1SG9A 2HWUA 3E15A 1XV5A 4LZJA 3TINA 4DBLC 1C9DB 4NS4A 1DFIA 1ZD9A 1NSFA 2GHQA 1NBME 4OJKA 3NHMA 4W99A 1ZZGA 4YT5A 4QPJC 4HAOA 4X3PA 1VJGA 2REBA 1THGA 2UVDA 3GCZA 4XQEA 3W34A 1CY2A 4C01A 1QHEA 5AI6A 1VCIA 2JIDA 1HL7A 2Y1DA 1D7OA 2GVDC 2YUIA 4J4HA 4GIBA 4BYGA 4E12A 3I01A 1DEAA 1KI8A 1VHDA 3PI7A 3GPCA 1DKRA 3TPCA 1PT7A 1GL7A 3LDAA 2ZIWB 4B44A 2VKTA 5AQ1A 1RT9A 2QPAA 3WLAA 4HVCA 1JI0A 4YAEA 2FMUA 3FDZB 4RL6A 3ADPA 2D7JA 4P3OA 1V41E 4CQLA 2J7PD 1ZOSA 2P4EA 1AURA 1NNI1 2C29D 5BQPA 1KH1A 3TQTA 3S81A 1T4MA 1KO4A 3LZCA 5IAOA 1S4QA 1JE0A 4AECA 1ANKA 3AJDA 3LQRA 1RM3A 1H0HA 2M2IA 3FR8A 4NH4A 4YQZA 5ESXA 3QELA 1U3FA 3FAZA 2E4AA 4H3SA 1HR0B 3AR3A 1HH4A 3KZKA 2B5OA 1CS0B 1Z2OX 5EXSA 5TPZD 1E6UA 2OZVA 4EVSA 2IK8A 5EVJA 2PHZA 2Q4RA 3VHXA 5HFJA 2FQ1A 5T8KC 4BGVA 2OP1A 1DQYA 2P3LA 4RQBA 2D1TA 1U3CA 4BWVA 4JROA 2BCEA 3PF8A 2ZVPX 3ZU4A 5GMOA 4FB4A 3IP8A 4KVZA 4LMRA 5B7QA 1AB5A 2GRJA 2WHRA 5CCDA 3TZBA 2NU9A 5CH8A 4DQDA 4GE0A 1ZU4A 3ZBTA 2J3IA 2WTMA 1N34B 1L9XA 2P0YA 3ZK8A 1NG9A 3AILA 4AO6A 1ICEA 1CHNA 1T0UA 2DT8A 4CQLB 4EMBA 2WT8A 2ZJFA 1OWNA 2H52A 2O8NA 1JFLA 4HUJA 4PGAA 5JT1A 2OXTA 1ZYUA 2OVFA 4ZALA 1CJVC 3H8SA 1GYRA 1DP4A 1ARZA 2B7CA 2YN4A 2F8MA 1HYGA 3HSYA 3WGUA 4KC0A 4A6PA 4DJEC 1QF7A 3CH7A 5A5VA 2EATA 2ZT6A 3U62A 4EFLA 4FGLA 4FU0A 2ZCUA 3K70B 3DHNA 4BV2A 5CVTA 3QELB 5FL3A 2PZAA 3FOCA 2J6CA 2WPDD 3DM5A 3C74A 2FLWA 4UBJA 5C3MA 3GXBA 4WY2A 4FK8A 4MV8A 4NQRA 1XUOA 2YVAA 1PBTA 2PBFA 4NFHA 1XLUA 2J5RA 4S1WA 3CVYA 5E38A 3LFTA 4EPXA 3U3MA 2IPAB 1XU4A 3LF2A 1DKQA 4JEUA 4TMVA 3WYBA 2JLVA 3PHIA 4FC7A 2H31A 2QS9A 2VI5A 4YBRA 4DB2A 5AXAA 4F5WA 2BEVA 4RELA 5M29A 1HEIA 2YUTA 1I2BA 1MOSA 3P0IA 4D4KA 1GRRA 3LP6A 2ZWOA 5D5HA 5FTMA 3W5IA 2NU9B 2HF8A 2JFPA 4AL4A 3BL6A 4Z4GA 4XASA 4RABA 4MA5A 4LF6B 1VBFA 4LF9B 1GQOA 1XZ8A 2HK9A 3QVXA 5KKAA 2GWRA 4TYYA 1XTJA 3AVOA 2Z8XA 4MA4A 4TLAA 4CCAA 3SCZA 4K9MA 4IV0A 3PX3A 1MJFA 4MKHA 4BZXA 1B8NA 1PBNA 1M0TA 1PL0A 3PXDA 5DHFA 4BEVA 1CWUA 3B2EA 1RPZA 3WLHA 3ROKA 2LGJA 2WKWA 5C5DA 5CITA 3T94A 2JIZA 3OOJA 1I5OA 3ANMA 1PWHA 3Q87B 1Z6TA 4N3CA 3DOFA 1PTKA 1UJ5A 1Z7GA 2QAGA 4YY3B 4IZ6A 1RWWA 1UH5A 3TJZA 4CV2A 4N8DA 5A4DA 2YNMA 2Z43A 1L5FA 1WZUA 4PRKA 1VSBA 2PIAA 4EHIA 4JLNA 2AYYA 3OOHA 1QO0A 1O8CA 1NN0A 2JI4A 1R8QA 4WEOA 1TYBE 3E3MA 4LY6A 5JS2A 4EJ0A 1K6JA 2ZJ8A 3PLNA 2QB5A 3PB3A 3R0XA 4HLUA 1FUEA 3E9QA 4JP1A 3JYNA 4YIKA 3PENA 3NJRA 2Z57A 4F5EA 1M2EA 2W7TA 1VHTA 2QTLA 4QULA 4HXYA 4YR7A 5HEKA 4WRRA 3H9QA 3BICA 5AW2A 1W5EA 3RD5A 2C1ZA 2JIPA 4RS3A 3VAZA 4YT8A 2OWEA 1E4YA 3IEPA 1ZHFA 3N58A 3O4JA 2QQGA 1VTKA 3GJ3A 4KRGA 1IUNA 4RPCA 3PQ3A 2WU4A 4RUKA 4UHJA 5E7IA 2P6MA 2YFHA 2X7XA 2J09A 4Y6QA 4AY2A 1E6MA 5ALJA 2V3VA 2QLMA 1EX1A 1K8XB 2J4DA 3KE9A 4G0ZA 1IN6A 3L05A 5I7AA 3DDSA 3RVBA 1O97D 1O5TA 1GYQA 1S2GA 2QAGB 3DB2A 1PK8A 4G67A 3VUFA 2F9LA 3UT0A 5FLEX 4IZOA 1S1MA 1GGEA 1JXMA 1NVWQ 1V9CA 4HZGA 5FRDA 2WM2A 7REQA 4P4TA 4B2PA 4D3SA 2DWUA 3JZMA 4JX8A 2R00A 1PV1A 3S3TA 5M34A 4NYIR 2AXQA 1OXSC 1J0EA 3M6LA 2QMZA 1XHLA 1A5ZA 3IT2A 2QN6A 1JJVA 2L82A 1GU7A 5EA2A 3UGKA 2Z5FA 3DCJA 2Y05A 2IYPA 1M2WA 1NN5A 2IJGX 3KHTA 1YVEI 3QFSA 3GI1A 4G24A 4QUHA 4OGLA 3VZPA 5IZCC 2HV8A 1GZ5A 3F6CA 3IAAA 3NBAA 4GXQA 3CLKA 4O1IA 4TMZA 4A03A 1PP4A 2PKXA 1V6CA 2G9UA 1HDCA 2IXFA 1KDRA 2R6FA 2XVAA 3L04A 4MR8B 4MV7A 4S3MA 5AI8A 3QF7A 3MCTA 3U3DA 2SNIE 4HNTA 5JXGA 2OESA 1YMQA 1I32A 1LTKA 2A1TR 1O9HA 4AJLA 4R81A 4P58A 3MWYW 1Z13A 2FN3A 2X4LA 4RFSA 4RD1A 4Q3BA 1LNQA 2G9QA 2BTQA 4KQEA 1J09A 2C2ZA 5L7YA 4XSHA 1YIOA 3D81A 1UBFA 5BXYA 2E5FA 5H3CA 5I47A 2WG1A 2GCGA 1A9YA 2Z9CA 1SU4A 4ER5A 1FP7A 1NXQA 2HIAA 3NT2A 4F2GA 3ZD6A 4LY0A 4B4DA 2I1LA 1RJ9B 3I52A 1E9DA 1HWYA 3MGBA 4MW5A 1FB5A 4WSOA 2ZYWX 4ZOCA 4Z0TA 4PN3A 4QT4A 5ADUS 3CSSA 2F9FA 4O08A 3WP1B 5EGSA 10MHA 2CN1A 1SB9A 7REQB 4F56A 1NAHA 2R97A 1K7SN 3OPYA 3QOFA 3QUSA 3TZKA 2DFPA 1TCCA 3GAMA 1W85A 4R41A 3OPYI 4O4HA 3D3EA 1U2DA 4IR7A 5DEOA 1XCLA 4B79A 4C4OA 3F5SA 3HXKA 1AKVA 1VI6A 3RODA 5ELXA 1XG5A 1OZGA 5HKKA 4F3NA 3OSZA 2XA1A 2H2IA 4HB4A 5BNZA 4UBOA 1T2CA 1X7DA 3FB1A 4D02A 3MUOA 4OF4A 3IP9A 3U44B 1B41A 2FF5A 2Q5LA 3WSTA 1YF3A 1L7EA 4RYDA 1K27A 4XPIA 4IQ4A 2V6GA 4ZXFA 4D6YA 5BV0A 4I9UA 2VHZA 3EMKA 4DC0A 1JHYA 4IEEA 1KOJA 4RFSB 3SHWA 1NUTA 1LI7A 3MN1A 3OQ6A 4HO1X 5EG5A 2UUCB 2BTQB 5K8TA 2CLOB 2JFNA 3BTOA 1FSZA 3N86A 2RB5A 4LDJA 1WULS 5HDQA 3FPHA 4M55A 4JGIA