1UKVY

Structure of rabgdp-dissociation inhibitor in complex with prenylated ypt1 gtpase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
204
structure length
197
Chain Sequence
SEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secretory pathway GDP dissociation inhibitor
publication title Structure of Rab GDP-dissociation inhibitor in complex with prenylated YPT1 GTPase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 63
structure length 197
sequence length 204
ec nomenclature
pdb deposition date 2003-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ukvY00
4UKDA 821PA 4MYUA 2ONKA 2QSYA 2J3EA 3F5FA 4TSFA 2JLYA 3WRXC 2QSZA 3CBQA 3VNUA 1D8TA 1LNZA 2ZROA 4LJAA 1CS4C 4IVQA 4PPFA 2QTFA 3RS5A 1F2UB 3ETLA 1R4AA 3GD7A 5FL3A 2F3TA 1HEIA 3TH5A 3UMSA 2WJVA 3SYLA 4LJ5A 2IYSA 1E0JA 4QJ5A 4QXAA 1KZ7B 1U94A 1G19A 1NBME 2BBOA 5CYOA 1N0UA 3AH8A 2ZRGA 4FN5A 2FF7A 1KSFX 4OI0A 1G20E 2A3RA 4O0MA 2ZJZA 3HP1A 3BIFA 3AVTA 2JJ8A 2ZI3A 2VP5A 3LW7A 4NH0A 1F3OA 1VCOA 2BKUA 4KU4A 1G6HA 1W0JA 4P4UA 1II0A 2QROA 1KI1A 3VR5A 4A0FA 4F92B 4OI1A 2C77A 5E3HA 3H2YA 1XTJA 1E9BA 2BHRA 1RIFA 3TUZC 1MO6A 3WNBA 4YMVA 5F98A 5DYIA 3L82B 1KI9A 1ZMXA 2IYZA 3AB3A 2EFDB 4Q9JA 3VU9A 4W9MC 5FI1B 1ZCBA 4PPNA 1FNNA 1DADA 1XBTA 4PSAA 4TL8A 3R9XA 4M1YA 3H0KA 3V00A 3X1ZA 1G7SA 2QY9A 4HAWA 4NCHA 4QGFA 5AUOB 4P4SB 1EGAA 5AJZA 1W36B 3A1VA 1C4OA 1YQTA 3IHWA 621PA 5LD2C 1EESA 4Q9LA 3Q7PA 5GVRA 2J46A 3I32A 1FPMA 4M9QA 3MJHA 1ZNYA 1V5WA 3A4MA 1KY3A 2PX0A 3FPAA 4ILEA 3LBNA 1XPRA 1G9XA 3FMPB 4TN1A 1IAQA 3SFVA 2ZYVX 1VCIA 3FMIA 5J5CA 2R65A 4B6FA 5FI0B 4R2HA 3UMRA 4P0TA 4Q7LA 4D4KA 4JVNA 3PEYA 4EFLA 4ESVA 1XCMA 1Z07A 2A9KA 2REOA 3B85A 3EPKA 5J47A 1C9KA 2ZSBA 4HUQB 1L2TA 1G21E 3U7EB 3THYB 2CLSA 1GILA 3TSOA 4BECA 4AG5A 1PVOA 2GF0A 4ASUD 1K8RA 4O2RA 2WSSA 4ACBA 1NI3A 1IY1A 4D4JA 2IK8A 3W6PA 3ZS8A 2KB0A 4LUCA 3GJ4A 4F4IA 5ANRB 2J0UB 4QBGB 3P32A 1QHXA 1R5NA 2W6JA 1X8JA 3TUJC 2JIZA 1P9NA 2H7VA 4V03A 4B35A 1VTKA 4X8OA 3IILA 1G6OA 3KFVA 3T06B 5FUVA 4A0GA 1SGWA 3BB1A 3OF5A 1XXHE 1D2EA 1QHSA 2CVFA 5CYPA 4CT5A 1HUQA 2PJZA 2QG6A 2Z4RA 4LBZA 3TLXA 1GL9B 5FTLA 1HV8A 4Q9HA 1OHHA 2RHDA 3QOFA 4TMXA 4BEBA 3PQCA 1H8ED 4QBHA 2CCKA 4DB4A 2QQ0A 1ZNZA 4P4TA 1W48A 2AWNA 4O3MA 3K9HA 1KMHA 4W5HA 2ODBA 4LHVA 3K0FB 4EKDA 2N42A 3NG1A 1OKKD 1KJWA 1OLOA 3NHBA 5EE9A 1FX0B 1P61B 2J1LA 4NYJR 1CJUC 2TMKA 4OQLA 2WOOA 3DZDA 4D82A 1P72A 3TE6A 1KO1A 2RGBA 3MJRA 2G9NA 2VF7A 1B0UA 3QKSA 3BH0A 4D6PA 3K1JA 3QF7A 4FINA 3ZDQA 1GL7A 1NMYA 1Y3AA 3FMOB 2B8TA 4DIEA 2HF8A 3MSXA 3TW8B 4POAA 4JBXA 2A30A 4PAOA 4GFDA 4ZKDA 4Z51A 1KJZA 4GPTA 1KSJA 1FQKA 2PLRA 1HE1C 3CR7A 2FPMA 1E0AA 1LFDB 1UPTA 3HDTA 1A1VA 1XX6A 2O8DA 1XEFA 1RRGA 1OSNA 2KWIA 4AIIA 4PTLA 3A58B 1TX4B 1ZU5A 4QHSA 4FCWA 4KFRA 2BDTA 1EFRA 3L0IB 3OFND 3DVLA 2VLIA 2QAGB 1QHIA 2XNDA 4LYJA 4PSKA 1Q1EA 1UKYA 3GJ8A 1H8HA 2DFNA 2IUTA 4PPQA 5HCNA 2WPDA 4QBIA 1WF3A 3U7HB 5G3ZA 2GBLA 1Z6GA 3AGQA 5CITA 4XIGS 1GRNA 2C03A 4NU0A 4NCJA 2PH1A 2Y8EA 3LBHA 1MABA 1PZNA 4NHOA 1UDWA 3IEUA 3VTKA 1KI3A 4BLOA 1X86B 4BFUA 2ZE6A 4PQRA 4M1SA 1E2QA 1L4YA 3H1TA 1PLLA 3K70D 4LYHA 1QHHB 2ORWA 1WB9A 4XTRA 5DISB 2GKSA 1E9DA 5J4HA 1F5NA 4KFUA 4WIAA 3WHLA 1SKYE 2WAXA 4URZR 5FOWA 3M4YA 4RFSA 1UEIA 1MH1A 4UNPA 4A15A 2LKCA 1ZBDA 4N0DA 2BEKA 1LB1B 1K5DA 1XTRA 3K0AA 3EZ9A 5F9FA 1XU4A 1EFTA 3ZD6A 3LA6A 2EFEB 1N5LA 1CBUA 4OQNA 1COWD 1JXOA 4HEJA 4PC3A 5LDDC 1E1RA 2BJVA 4KYUA 421PA 1S0UA 3R20A 2ZVQX 4Q01A 1KK0A 2GF9A 2ZSFA 3CRVA 1TAGA 3LXRA 4IRUB 2C96A 1E2EA 2IHBA 1US8B 4TZ6A 1M34E 4IDQA 3WRYC 1SVKA 1DPFA 4AYXA 3CRRA 1OFTA 3O47A 3NWJA 1Z2CA 3T61A 2OLJA 2ERYA 1YR6A 3B78A 2FGJA 1II9A 1XXHB 4YONB 3QEJA 4TT3A 2QP3A 3OE7A 2GXUA 4MGYR 3DOFA 5EP2A 2EYUA 4IJMA 3QNUA 4KFTA 3FHOA 1E2GA 1Z0KA 4A6PA 2V4ZA 1IN4A 3GJ0A 4IDHA 3RS3A 3VQTA 2ZIAA 3WP0A 1RVDA 2A7QA 5FBQB 3GJ7A 4XWOA 5JLJA 2BKEA 3K8YA 1G7CA 2NTYC 3N70A 2OUKA 3U6KA 2X19A 3L0PA 2WM9B 4PR0A 1WBDA 2O8CA 5FR1A 3P26A 4ZI2A 2ZI4A 4Z1MD 4LV5B 1VIAA 2YVUA 3U3RA 5L8VA 3MMPA 5KDDA 4M0LA 1KHTA 3Q85A 4MYCA 4LY6A 3VR6A 1XD2B 2G83A 1Y63A 2YYZA 2G77B 2GJAA 4QGHA 3AUXA 3TKLA 2FSFA 3I5YA 1DTSA 3U6BA 5AJVB 4YXWA 3DMNA 1OIWA 3GLHE 1Z6XA 2QM8A 3HR7A 3V9PA 2IS2A 5TY0A 5CK5A 4DUGD 2P2LA 3D8BA 4ARZA 2J45A 5GJVC 3BOSA 4EJSC 2P6RA 2PX3A 4L15A 5KTYA 1KO4A 1KI2A 2DY1A 4HLQB 4I1OA 1OV4A 1N5KA 5C4MA 1E9CA 5KSOA 2ZRJA 2QRZA 3MAAC 1YHNA 1S2MA 4XVQA 2IWRA 1M2OB 4F38A 1GSIA 1OIXA 2IF0A 2PL3A 3JVVA 3PUWA 1CIPA 1XJQA 5HCIA 3PV0A 2D3WA 4M9ZA 4DSTA 2BMJA 1R2QA 3CH5A 2F1IA 4D4LA 2ZUDA 4NYIR 2Q0HA 3W34A 2L0XA 3TW4A 3QIAA 5C18A 2KI5A 3W6NA 2HJVA 3SBDA 5JRJA 1B23P 4FMDF 1E2LA 3UG6A 1YJ5A 2RHMA 4LHXA 2WTUA 4YMTA 4HB3A 2W6IA 2XSZA 1IXZA 1CTQA 1F2TA 1KK2A 2ZJBA 1A5TA 1JQLB 4Q4HB 3CO5A 4GZLA 3B13B 5LD2B 1N6HA 3FFAA 2FSHA 2ZEJA 4PX9A 3R8CA 2R6AA 3B60A 3NTUA 2RGNC 2HXSA 3BC1A 2KBFA 2CVHA 1NLFA 2ECKA 2H16A 3UMFA 1Z63A 1E98A 1G291 3CZQA 5J4YA 2BMEA 3KQNA 3IDQA 2ZTSA 1SXJD 4HATA 3B6EA 4C4PA 1YZNA 1AS0A 2OHFA 4ZDKA 3NHAA 3Q9LA 4HLCA 5KYKA 2OAP1 4B75A 1DOAA 1TTTA 3BE4A 5KSYA 1TUEA 2N1BA 1GNQA 4MKGA 3TSWA 3QXXA 2RGEA 4RKFA 1JR3E 4MGZR 2DYKA 1ZC4A 4NYMQ 4QFMA 4DCSA 2WJGA 4OK5A 4V0MA 3ZQJA 4AKIA 3KQHA 1HH4A 1IBRA 3HJNA 5M04A 1O87A 1KOFA 2QPTA 1EXMA 4N0EA 4TYPA 4MYTA 3QG5A 1F2UA 1NN1A 1Q22A 1OH7A 4FWIB 1E94E 4PO1A 1UBEA 1LVGA 2P65A 3OHMA 4PHFA 3IBGA 3NDBB 2ZE8A 2W2XA 1ZIPA 2WJJA 4DSUA 4A8JC 2VSXA 2FA9A 3IIMA 4XWAA 4ON9A 1QZXA 1JR6A 5FL7D 5BN4A 2GCPA 1W4CA 3CLVA 5SZKB 3IIKA 4BASA 3M1IA 3PXGA 3BFKA 2ZJ5A 4F4CA 1YR9A 2X1VA 4L4UA 2W58A 3SI7A 3VHXA 2VSFA 3GEHA 1KJYA 1JB1A 4PAMA 3QI2A 1Z0IA 1WP9A 1ZD1A 4JS0A 1I4LD 4OQXA 4Q7MB 1WQ1R 3RDPA 2P6UA 4QOSA 3EPJA 4OK6A 5EZ5A 2F6RA 5EUQB 2QP9X 4HZUB 4M1OA 1Z8FA 2F9LA 2Q3MA 1J8MF 1XMJA 1KSGA 4LV6A 5CIQA 3GLHB 4P4SA 4Q18A 2VTKA 4UXJA 4XJXA 1CP2A 4DEXA 3EAQA 4PHGA 4Y0VA 2QP4A 4I1UA 3TK1A 1K6MA 2PJRA 4IDOA 1N6KA 5DHAA 3L8YA 4RD6A 3TMKA 3W9YA 2WWGA 4MA4A 5FTMA 5GJBA 4R9UC 4HDQB 4IEIA 1XJ0A 2HLDD 5JJKA 2IYUA 2VO1A 5KDLA 4WW0A 2J0SA 4Q9KA 4QJ4A 2QPOA 1G8FA 1T8TA 2QQEA 1Q44A 2WV9A 3GFOA 2FOLA 4KXFB 4GI7A 2O8BB 1JQJC 2GRJA 1P73A 1ZUIA 1P5ZB 1IN5A 4PZLA 1NP6A 3O8CA 2XZLA 2EQBA 2UKDA 4B34A 4HUQA 4LC0A 4TQAA 1DBSA 1G5PA 3THYA 4BE7B 4OQMA 3K0CA 4PHHA 4QGAA 3SS8A 3C14C 1VYUA 721PA 2A2ZA 5E7MA 2QM7A 1VMAA 3PR1A 1P6XA 4JMPA 2C9YA 2YWFA 2AFIE 4TSFD 1R5OA 2QT0A 3OIWA 1T0JB 1XDBA 2BV3A 4IFEA 1C1YA 2EFCB 1GITA 4Q4AB 2G3YA 3L8ZA 3MRSA 1KK1A 4TWZA 1S3GA 1CJVC 2IYVA 4II7A 5FOTA 4MDEA 2X2FA 5EZ6B 3KJEA 2H5EA 2BEJA 3KXIA 2GILA 4B47A 3L2OB 1KDOA 2OV2A 2ONJA 1YRAA 4QL3A 5EP4A 4NE2A 2IT1A 3AEZA 3C5CA 3BAFA 3BFXA 1XEWX 3QBVA 2QAJA 3P27A 3LQRA 1D9ZA 3QE0A 2QGNA 3TAHA 2P5TB 1W4RA 3IUYA 4RSGA 3PEUA 1CJKC 1LF0A 4FCVA 2RKOA 4JT2A 2G1JA 1W0JD 3KFXA 4BQSA 3DM5A 4TYYA 3K0FA 1FL9A 4RZ2A 2JLSA 2JLVA 2ASEA 2VPPA 4KV9A 4DC9A 3ICEA 3B1ZA 1AKEA 5EXPA 5BYKA 1FX0A 3UG7A 4D25A 4B2LA 4GZMA 1TADA 1UFQA 2R9VA 3KZ1E 1NBMA 2G0NA 3SJZA 1G64A 3DHWC 3FE2A 3A6PC 3GLIE 2ZUCA 4E07A 4R98A 3I73A 1GNRA 1E4YA 1XFAA 3WMFA 4JLVA 1GRQA 2JLWA 1N5IA 2QMHA 1ZIOA 3ZYCA 1LS6A 1E1QA 4C2UA 5K8UA 3Q7QA 4DRZA 3SZRA 1YZUA 4Q1DA 2H17A 3TSZA 4W5WA 3PUXA 4XTCS 5FOSA 3W5JA 1CRQA 4Q1BA 5LBIA 4TMWA 1X3SA 4G0NA 3VR3A 1BH2A 5KNBA 5BYJA 1G1MA 4HLUC 3A4NA 3O8DA 4TLEA 5ELXA 4MQBA 2IUSA 3KKPA 2QUZA 1EWQA 4JBYA 5TV2A 4KBGA 4C9BA 3LH5A 4PAQA 3DDCA 4LHZA 5BN5A 3BFVA 2P0EA 2RAPA 4KO8A 4V0OA 4B3CA 2WKRA 4BFXA 4IXNA 5F9HA 4N3NA 5FBLB 3ADDA 3SHFA 1N0WA 4D80A 2IEYA 2QAGA 2P3SA 3OAAA 4FMDB 1SHZA 5KSZA 1LF5A 3QEOA 3LVRE 2IA5A 4TMKA 3ZS9A 2ODEA 4JYBA 5SZIA 1E2PA 3EC1A 2ZE7A 4UJ5A 5E7JA 3RS4A 4GMXA 3TVDA 2PCJA 2ZSDA 3I61A 1G3RA 3REFA 1FTSA 2WSSD 4V0KA 4Y0AA 4TMVA 4NBSA 1GRRA 2OXCA 3RLFA 1QHHA 4ZPXA 3PEWA 2A5GA 1TQ4A 3CUEF 2CDNA 1P2UA 2W6JD 3NIBA 2ZRCA 5IRCD 3B8HA 3EASA 2JIZD 3QPWA 3DO6A 5EE5B 2B92A 1M7BA 2PMKA 3CNNA 4H9GA 4KHZA 1Q3TA 3X1DA 4CDGA 2GTPA 1W5SA 3ZIAD 4EJSB 2HXYA 2HJGA 2WMOB 4BLSA 1P9WA 2FSGA 2OCPA 5JEEA 5H70A 5KU1A 1X8LA 4LJ4A 2ZREA 2H8KA 1X1SA 1OF1A 4FIDA 2B7BA 3GEIA 3GLFB 1VCNA 1Q1ZA 2D7CA 4H1UA 4MRNA 2CL7X 2BJWA 4QRHA 2IS1A 1OHHD 2F3RA 1CR0A 2HF9A 5GVSA 4P33A 1KDTA 4JLOA 3TVTA 3SC3A 3M0EA 1W4BA 2UVQA 1BKDR 3CRMA 2AK2A 3RVBA 3TR5A 4AG6A 1Q21A 3A36A 2ZRFA 1RRCA 3LO5A 2REXB 1U8YA 1US8A 3KUDA 3FDIA 3W90A 2NZ8A 1TF7A 2AK3A 3LX8A 3ZZTA 1T5LA 1W1WA 4Z8YA 4AYWA 1XXHA 4LDJA 1ZM2A 1U99A 4O25A 1OXVA 3VR2A 1GKYA 4OHYA 4M1MA 3R9WA 5GJWC 4OJKA 3RRMA 4IXMA 3TQFA 4OQFA 3SYKA 1A82A 2JASA 2NO0A 5A0FA 5KPJA 2XOKA 1NLZA 3OZXA 2EW1A 4JIMA 4JLKA 1W49A 4Z8XA 4ZCLA 4KBFA 5CB8A 2ERXA 2D62A 3DM9B 4Q03A 4NONA 3B7GA 3PUYA 1P3JA 2B7CA 2QN6A 1T91A 2C2HA 2CLCX 2DFTA 4MKIA 3SU8A 3QF4B 3BD9A 2FFQA 4K46A 3AP3A 4GP6A 4DCNA 3GLIB 1ETUA 4TMTA 5FPTA 3VMFA 3WBKA 5D3MB 4M22A 4YDSA 1XD2A 1TMKA 3L0SA 3X1WA 4URYR 3SOPA 2ZJ2A 4FWTA 1EFRD 1NY6A 5FTJA 2XNDD 4JSYA 4DCUA 2JATA 2CHVA 2GJSA 1H8HD 4IEEA 1QHYA 5AUPB 2DWQA 4MKHA 2WPDD 1KIMA 2AL7A 2REBA 4NKRA 4XOIA 3WHKA 4HYYA 1S96A 1S9DA 3CF0A 4D0NA 4KITB 2UZIR 2OLKA 1S3SA 5LB2A 3RS7A 2VYFA 121PA 4R7ZA 4PC7A 2C98A 1KNXA 5FR2A 3U4QB 3GLGE 1R0XA 3FKSA 3TRFA 3R8FA 4A8JB 2AXNA 4C0JA 5KPDA 3FTQA 4UQOA 4EPRA 3FOZA 4ZCIA 5H1YA 5IK2D 1KK3A 2VH5R 2XZPA 4TYQA 3SBEA 2DPXA 5AUNB 1DAFA 2CEAA 1PUIA 1HQCA 2NO6A 4BLTA 5DYGA 4CEIB 4C0QC 2CE2X 3ZVNA 1T6NA 2C8VA 4GT1A 3AVPA 1SKQA 4KCGA 4Q5IA 5SZJA 1E1RD 1GKIA 3CWZA 3U5ZB 2F1HA 2W83A 1AQYA 2FPKA 5CJPA 2FN4A 5C2JB 1XEWY 1YZTA 3GJ3A 5EUMA 3X2SA 3BS4A 5G53C 1TNDA 3E70C 3THXB 1IM2A 1LS1A 5JECA 1WBBA 3ZIAA 2J7PA 2VA8A 1YE8A 1VG1A 4EIWA 3ZVRA 2FG5A 1DEKA 3UWOA 4ZIRA 2D7DA 3KJIA 1E2JA 3KXKA 4QC2A 2CJWB 4AWXA 2FZ4A 1XMVA 1EX6A 2OBLA 3I72A 1F60A 1TQ6A 2ZJAA 4TT3D 2OG2A 3DKPA 1II8B 3OE7D 3TNFA 4V02A 3C7KA 1ZD8A 3RABA 4EFNA 4X8LA 1XZPA 1NRJB 1QVRA 1QBKC 1GL6A 4F4JA 4YMUA 1XTQA 1CJMA 4OI2A 4DLVA 5FUXA 1OW3B 2A78A 2O5VA 2NG1A 3FHTA 2QGZA 2KE5A 2KJQA 4Q19A 1YU9A 1ZW6A 5B30A 2AKYA 1R10A 5B2ZA 3PEVA 5HKKA 4A2PA 3FKQA 3WY9A 2WICA 1CR1A 1SQ5A 1E9EA 3QXCA 5CDFE 3AKEA 1W2GA 5DHFA 4G5RA 1FMLA 3KXLA 1E2IA 1V43A 1JALA 4AURA 2XTZA 4KSCA 4A6XA 1FP7A 1RJ9B 2QU8A 5TXGA 4DSNA 3W5IA 4YXWD 3QSYA 1KMQA 4YC7A 3ZZ0A 2IUUA 4RD2A 3N2EA 1E2DA 2OT3B 5JHGB 2VF8A 1ODFA 3MWYW 1DG1G 1UBFA 3KKMA 4W5JA 2VP2A 5E7IA 5C1BA 2CCJA 5DH9A 3W3AA 4DLUA 5TARA 1E99A 4BLQA 2FH5B 5FOUA 3WXMA 2DWOA 1FMJA 4OL0A 5JSZB 3L0OA 3SE0A 4C0BA 2V7QA 2PT5A 4M1KA 2DFKB 1Z5ZA 4GNKA 4DB2A 3P20A 3S1AB 1W2HA 4HZUA 4ZDJA 3Q3JB 4LSGA 3GLHA 4JJKA 1T3SA 4IFBA 5KHOC 5DGXA 5EQTA 4IOJA 5DSZA 1NMZA 2A5FA 4A36A 3GLGB 2VL7A 5DLQC 1Q1BA 4CGZA 3HYRA 4MUBA 2FFHA 5IK2A 4C0AC 3VR1A 3FVQA 4M21A 3KQUA 3SDZA 4LOAA 1TL7C 3EARA 1NJFA 4BZQA 2W00A 3H84A 4OI4A 1NVVQ 2CHGA 5CIWA 2HYDA 2RGDA 2W6ID 2XSZD 1AK2A 2IC5A 2O52A 2ZVPX 4US1R 5DN6A 5C4GB 3U44B 4UXIA 3ADCA 2WBLC 2P5SA 4OJQA 1G8GA 2FNAA 1OB2A 4PC1A 1ZD9A 1XF9A 3WMGA 3PVSA 2O8BA 1OYWA 3AF4A 1UKZA 5AK0A 4ZDIA 2E1RA 1Z83A 3GQBA 4KLZA 2R6CA 3ASZA 1VG9B 1MRNA 3AVYA 4B3XA 4PZYA 1VYVA 3IBYA 3QXSA 2BM1A 3B1XA 5D3QA 3RNLA 2H18A 4LZZA 4D2IA 4XVUA 1HE8B 3EWSA 4Q7KA 3CH4B 3V4RA 3NC1C 3HR8A 1P2SA 5P21A 1XZQA 3PUVA 3N5CA 1VECA 2O8FB 2OFWA 1G41A 4GOJA 1XEXB 4Q4AA 4I81A 1TPZA 4FI3C 3B9PA 2NGRA 4EQ6A 2Z6VA 4PQFA 2XTMA 1BYUA 4AK9A 3WBJA 3P1JA 1WCV1 3FFBA 4RZXA 1CU1A 3EG5A 2GJKA 3BJIC 2YOFA 3BB4A 1YR8A 1JJ7A 1G8PA 4LX0A 3P4YA 4JJZA 3U3KA 2EFHB 5B64A 1W7AA 4LK2A 4M9SA 3EW9A 3QKRB 5KUTA 4LBYA 4CEHB 1JR3A 2XEXA 2RGXA 1GIAA 1I2DA 2BMDA 2FFBA 5JMTA 4XSHA 1E3MA 4E09A 2YC2C 4HLDA 1JXMA 3KJHA 4ZCMA 2OXRA 2JDIA 2W0SA 2J7KA 3AF2A 1N2CE 1U9IC 2FX3A 4B44A 4DT1B 1SVMA 2Q21A 1KO7A 3F0TA 1BO6A 1Z06A 1XMIA 3I92A 4LHYA 1S1MA 2VSOA 3OIVA 1J8YF 1UADA 1R8QA 2FE4A 2ZYTX 3NH9A 4L16A 2NMVA 3K70C 3BK7A 4DCTA 3MD0A 5A4JA 2RGAA 3PITA 4G3XA 4TL6A 2CLDX 2JGNA 4BFZA 1LW7A 4Q00A 1DS6A 1W36D 1G7RA 3AVUA 1OJLA 2WJYA 4PC2A 4IDPA 2FWRA 4NTZA 4A0HA 5CB6A 2J41A 1Z47A 4RD1A 3WP1B 2WWIA 1RKBA 1VCMA 1R0YA 1Z0DA 4LCBA 4V0LA 2ZM5A 1OIVA 1RE0A 3ASYA 2V6IA 4AKHA 3RYTC 1X6VA 4E5UA 1HT2E 2JJ1A 1G16A 3U3MA 1JEDA 1P9RA 2PLFA 1AKYA 3LLUA 1VKJA 2V8OA 3PUZA 4LV8B 1QG4A 1G5RA 5TVKA 1H65A 1ZNWA 2CHQA 2JCSA 2YWGA 4V0NA 3AF1A 3RANA 1E2HA 3QY0A 3U2QA 2XJ4A 3REGA 1GDDA 3QKUA 4C0SA 2WKPA 4JL8A 1SKYB 4RZ3A 1XP8A 4D0LB 1AN0A 1AS3A 1ZVQA 2F9MA 1IN8A 3O8BA 1T9HA 1P2VA 2W2VA 3TAUA 5IDVA 3KQLA 2JJ2A 4URUR 3U3JA 2ZETA 1OH8A 3WNCA 1QHGA 1ZAKA 1ZU4A 2AHOA 2ZRHA 3FHCB 3LXXA 4E22A 5FFMA 4PZZA 5IT5A 5K8LA 1FNMA 4IKEA 4EJSA 3DKVA 2QL6A 3CX6A 2FGKA 2FU5C 1CULC 3W6OA 3HU3A 1A7JA 4KSBA 3AUYA 1P62B 5K8TA 1J7KA 1ELOA 3SEAA 4BEJA 4DWJA 2I1QA 3G5UA 2NO1A 3QKTA 3GLFA 4JLPA 3EWAA 3GEEA 5KNDA 2WIBA 3IIJA 1E32A 2BOVA 2H92A 1GP2A 4DIDA 1DO0A 1OT3A 1IY0A 4HB2A 5E4FA 4K81B 1OXSC 5JWHA 2C99A 3EIEA 3KTAB 4NYMR 2A5DA 4X8MA 3VX3A 3D3QA 2QORA 3LQQA 2H1LA 2FSIA 5FBWB 2JLUA 3C15C 4PPGA 1NVWQ 3T35A 2WOJA 5F3WB 1N6PA 2DHRA 1DAHA 1GWNA 5EXTA 2C04A 3KUCA 4DVGA 1PV4A 1NBMD 1Q0UA 2ZRPA 1GM5A 1S8FA 2J0QA 2WSMA 3B2EA 3GPLA 3U60B 5UKDA 5JBQA 4HDCA 3CNLA 1PUJA 1G3UA 4CVNA 3KJGA 1I4DD 4MH0R 3IHLA 2JLXA 4RD3A 1E1QD 2PMDA 2DBYA 4FMCF 2RGNA 3ND9A 4Q47A 3NEJA 3T1TA 3OIYA 3A1SA 3GJ5A 2Q3HA 1Z6AA 2XAUA 1NJGA 4WXPA 4QM6A 4HAXA 4CYMA 1CKEA 1CXZA 4B2PA 2O0JA 2A5JA 1KDRA 4IVRA 5FPSA 3T5GA 2OCAA 5B58C 2OAQ1 4QG7A 5FUYA 3GLIA 2YV5A 4YMSA 4B3DA 1UAAA 2QRNA 2Z5FA 5D3MA 2ZR7A 4B73A 1KTVA 1SHKA 3NXSA 2QPAA 4BPBA 2R6DA 1PLJA 1XD8A 3OAAD 2O8DB 2NQ2C 2IYRA 1IXSB 1M1YE 3UATA 1G5TA 2CNWA 2OO7A 1QG2A 3ECCA 4MKFA 2IHYA 4A82A 1QDEA 3N2IA 1W0KA 4HDOB 3RS0A 3I1FA 4Q4JB 1AS2A 3NBXX 2DB3A 2IS6A 5G40A 3U4QA 3CRW1 2ZXUA 3SJAA 2EFGA 2ZR9A 4A8JA 3I8SA 5JWOA 3QVUA 4A1FA 2HDNB 3WYAA 4I4LA 1E2KA 1KNQA 1OE0A 1IN6A 1GFIA 5AUQA 4IVPA 1E0SA 1E2FA 3F8TA 1SXJC 2D06A 3TQCA 2YC4C 3H86A 4HAUA 5EP3A 1Z3IX 4LYAA 2XB4A 3AP2A 1AQUA 4ZDWA 1S4QA 1Z0AA 4CEIA 5B57C 2D2FA 1XPUA 3K0EA 4RFSB 4N1AA 1YZQA 2EWVA 1GZSA 1GG2A 2R44A 2C9OA 1HTWA 1IHUA 1IJFA 1X1RA 4LJ9A 1UKVY 3EZ7A 3W3ZB 1HQYE 2G1KA 2G88A 2J0UA 4LPSA 3U7GA 2Z43A 1SVOA 2PZFA 3DL0A 4HSEA 3WMEA 2RMKA 1BYIA 1M8PA 1MO4A 1P4SA 3THXA 1DAKA 4DLSA 2J59A 1NMXA 4WA7A 2I3BA 3K09C 1D9XA 1U90A 1MRSA 1MT0A 2CJWA 1N25A 2X8AA 4R2IA 4S2EA 1AZSC 3W8NA 1CRPA 2RGCA 3GP8A 3GFTA 4IDNA 4Q1EA 1P60A 3OIUA 4Q48A 3CF6R 1II8A 4M53A 3TUIC 1J99A 1M7HA 1WXQA 5KSPA 2GXAA 1RC8A 3SQWA 1E2NA 1NVXQ 2ZS7A 3QJYA 3CIOA 5JRZA 2V1XA 1RRFA 1A4RA 1XTIA 4M9XA 2D74A 4F93B 2XOKD 1ESMA 1TF5A 5DI3B 4DLYA 3IEVA 1KGDA 3CW2A 4LC1A 4UNRA 4XSGA 5BN3A 3U61B 2XX3A 4CEJB 1R5BA 3VHLB 2Q9CA 2O8EB 1ZP6A 521PA 2WAYA 3NC0C 2WWXA 1NN0A 3CNOA 1FTNA 5HTKA 4A92A 4DKXA 2I1VB 4C7OB 2IW3A 2V3CC 2ZSAA 4BGDA 1NG1A 5CJ2A 3AV0B 3GJ6A 5EXXA 3RRNA 5LPNA 1BMFA 3AQ4A 4NMMA 5AJYA 4MUAA 4BLPA 1DARA 1CR4A 1AIPA 2PT7A 3IPXA 2ZRNA 3QUSA 4WBSA 2ZS8A 1R0ZA 4JYCA 2LWIA 1EFCA 1RJ9A 2OESA 4B3FX 3QXHA 1E0KA 2Z4SA 3TR0A 4GRAA 3THWB 4TL9A 1R6BX 5TB5A 4AY2A 4G5OA 3FKSD 2KSQA 3OEEA 2P6NA 5AWFC 2GNOA 1KO8A 2OCYC 2IYYA 4KVAA 5FBRB 4J0QA 2EVWX 2NIPA 2ODNA 1Z22A 5JSZA 4PO9A 4EPWA 4JVSB 1YRBA 4QHYA 3LW8A 2ZJYA 3ADKA 3AVVA 1W44A 1Z29A 3S1AA 3K53A 1G3IA 4WOPA 1GUAA 1Q12A 4KFSA 2OM2A 1N6OA 3NKVA 4JLMA 2WHXA 1EX7A 4HB0A 5JHHB 4AI6A 4TLCA 2ZPTX 4WZBE 2BWJA 3CPJB 1ZRHA 3LV8A 3GLGA 1AJEA 4L5BA 2QE7A 4ITRC 1X8KA 3MWKA 1NKSA 1DO2A 3CONA 3EX7C 1Q20A 2NOAA 4QHTA 3K70B 4DDUA 2ZR0A 3T1QA 5HR5A 4B43A 1NF3A 5K8IA 4MRPA 4QGGA 1XCPA 4LGMA 2J7PD 1JNYA 2GK6A 1MV5A 1KI4A 2FMXA 2QMUA 4GOKA 1SVSA 5CM9C 1U0HC 4BRUA 4QJ3A 3EPLA 1T4GA 3U44A 1UKEA 1FUUA 4HLUA 2NO7A 4QNMA 2MMGA 2CXXA 1KI7A 5DI9A 4RVCA 1F48A 2PCLA 2GHIA 2AD5A 4WVFA 3ICQB 2G6BA 1E79A 3IO5A 1ZUHA 1J2JA 4I99A 4XWKA 1FQJA 2FDCA 1SXJE 4I1VA 4R71A 4AKGA 5KDOA 4MDFA 4KJZA 4UNNA 2D2EA 3X1XA 3EC2A 4B71A 1NG9A 5EJEA 4PFSA 2IBMA 2WZQA 2D4HA 1Z0JA 5JCZA 3FYHA 3OEHA 2ZAOA 1ESNA 2O8FA 2VP0A 1F6BA 5EP1A 4Q1CA 1W47A 1XEXA 5G3YA 3UKDA 3UK6A 4FMCB 5HKKD 1P7CA 4OHXA 5C46F 2OILA 2WJHA 4DSOA 1NSFA 3Q72A 3IGFA 4C0LA 4CW7A 2ZQ5A 3SR0A 2E87A 3SQXA 2WWYA 4AD8A 2GA8A 1EFHA 3DEFA 2BM0A 4RKEA 3CPHA 3QKRA 3UANA 1N3BA 1A2KC 1NL3A 4ESHA 4CEHA 1D2MA 2GXQA 4UNQA 4X8HA 2ZYWX 1KAGA 4C0KA 2ZITA 3BH7A 4URXR 3T1OA 1ZCAA 2GEDA 4HB4A 1KAOA 3CX8A 4TLDA 3LFUA 1OXTA 4W7SA 1QHNA 3LNCA 4JSTA 2GXSA 5CDFA 3KQKA 2DWPA 3E5HA 3LLMA 3M6AA 2VP6A 3EXAA 4DT1A 4G01B 2AX4A 3SHWA 2VP9A 2WKQA 3EIHA 1BOFA 2YJTD 3UIEA 2F55A 1XD9A 3MGCA 3AKDA 1RW4A 3QENA 1OXUA 1T3LA 2V7QD 1T8UA 1UM8A 3AF3A 4WZAE 5FH9A 1DG3A 1NLYA 2E9SA 3HU1A 2HCJB 2BBTA 5HE9A 3KX2A 3PG5A 3BERA 4Q1FA 4DLTA 4YQFA 1MR3F 3LVQE 4JLJA 4HAZA 3QVVA 4FXPA 4MRRA 5IHPA 2QENA 1XMSA 4TTPA 2GK7A 4U5XA 3U7FB 2R2AA 2R6FA 2XXAB 2VQSA 2ZRBA 5L3QB 1VPLA 4TLAA 2X2EA 1G3MA 2UZ3A 2ZRDA 5DN6D 3AKYA 3KB2A 6Q21A 1WA5A 5KO2A 3JZMA 3NVAA 3LBIA 3I8XA 2YWHA 1Z28A 2MMCA 4DJTA 1DE0A 1Z0FA 3A4LA 3I5XA 3T34A 1KSHA 1AZTA 1Z6TA 4U00A 2ZAMA 1OYYA 2HT6A 2HV8A 4RZUA 1ZUNB 4DDWA 5J4LA 4KLNA 2ZU0C 3MLEA 4US0R 4BZPA 2N46A 4O2LA 2W0MA 3CKLA 2IS4A 4Q4HA 5FTKA 3IQWA 4LI0A 2XZOA 3A8TA 2CCGA 1NY5A 3HPQA 2VHJA 4GOXA 3BBPA 1CEEA 3EA5A 3CF2A 1J90A 2VHQA 3RWMB 3FWYA 4PQYA 1E2MA 3T15A 2ODWA 2GWHA 2MSEB 3MWJA 4UJ3A 1MKYA 2GDJA 1ZC3A 4PC6A 3B5JA 2F43B 1E9AA 2BIFA 3KKQA 5G41A 3O8RA 2CK3A 1HY3A 1SXJB 3CX7A 2JLQA 3KL4A 4CIDA 3WNDA 3G82C 4M2LA 4EPXA 1U8ZA 1RYFA 4NP6A 4YDHB 5JS7A 4OHWA 4KODA 3VR4A 3QG1A 5CLLA 2ANBA 2PBRA 3ONWA 1JR3D 4C30A 2ZI7A 1W4AA 2GVDC 2ZRIA 3MCAA 2QMEA 3KTAA 4OKSA 4BLRA 2ZU6A 1R0WA 3SJBA 1SVLA 3A37A 2JDID 3R7WB 4EPTA 3H4MA 2ZRKA 4RD0A 3SFZA 4BFYA 1G4UR 2BCGY 3JZAA 1LV7A 2GBLC 1N6NA 3ND8A 4NYJQ 3B9QA 5DNYB 4B3BA 2EYQA 5TDHA 5GADl 1TU3A 4GP7A 2HEIA 5AJXA 1ZJ6A 8OHMA 5L3SB 2YKGA 1FW6A 3NEYA 5IF9A 3LAWA 5JFGA 3SJCA 1PJRA 5DIFA 1QVAA 1TU4A 4A4DA 2Q9AA 4NZYA 4I1SA 3AGPA 4LHWA 1NN3A 2RGGA 2GZDA 1ZM9A 1TF2A 2QBYB 3KDSE 1P2TA 5JWRA 4B32A 3DPUA 1NSTA 3ZVLA 1VDZA 4LJYA 4OHZA 4B48A 4NCIA 5F2EA 4F91B 4Q4LA 2O0HA 1M7GA 5J4VA 3C41J 2JJ1D 1IY2A 4G1UC 2IEZA 3LDAA 4JLAA 3D6TB 2P67A 1BS1A 1JPJA 5DE3A 2VBCA 3NBZC 2YOHA 4B76A 5FPKA 2VRWA 4L9WA 2XB2A 3TGPA 5EE3A 3E2IA 1AA9A 3QXJA 4A0RA 2ZS9A 3A1UA 2OZEA 4XVRA 2QT1A 1FFHA 1FP6A 4Q4JA 1JBKA 1R7RA 3R9IA 5HZHA 2JLZA 2G0TA 4DZZA 3VKGA 2A5YB 1G8YA 4M1WA 1KI6B 4MYHA 3HPRA 2QA5A 3VAAA 2CL6X 2Q3FA 3DOEA 4M8NE 3ADBA 1NVVR 3D7MA 2IYLD 2JAQA 3K9NA 2JJ2D 4RFVA 4A2WA 1J70A 3J81k 4URWR 4TL7A 3T5DA 2XJ9A 4BFWA 2Q9BA 2LKDA 1EFUA 4DLWA 4XH9B 1ZM7A 5J4KA 1YZGA 4PSVA 1NNEA 4JKYA 1W5TA 2YINC 4LRWA 1EK0A 2XTNA 1L4UA 1IONA 1VIYA 2ORIA 3EZ2A 2V1UA 5CK4A 2JEOA 2IYTA 2VHCA 4BFTA 1YR7A 3SYNA 1L7VC 2B8WA 1G3QA 1OFHA 2GCOB 4ASUA 2MSCB 5KNCA 4IW3B 5SZHB 2C78A 1IQPA 1ZM4A 3VX4A 3C8UA 4Q9IA 3IPYA 2R6GA 1OXXK 4UXHA 3VFDA 3ZGXA 3T12A 1K5GA 3HWSA 1M74A 2ZYUX 4LBVA 2Q6TA 3A1WA 4WAUA 1RYHA 2XGJA 1KZGB 4JT4A 3AM1A 3DZ8A 3RHFA 4F7WA 2IXGA 3KKOA 3Q5DA 2I4IA 3A1TA 1BIFA 1UBCA 3VNVA 4C0HA 1JAIA 2Z0MA 1AM4D 1JPNA 1KKMA 2F7SA 1JI0A 1TEVA 1LTQA 5JS8A 5AR1A 4RY2A 4JLBA 2CMKA 1A2BA 1W46A 3C5HA 1H8EA 3EZ6A 3IKJA 4QNRA 5DI3A 5JI3E 3CR8A 1RFLA 2IX3A 1OFIA 2QZ4A 4ZKEA 4P31A 3Q8XB 2X77A 4B74A 1RPZA 3UPUA 1Z6YA 1G4AE 2GEVA 3X1YA 4CEJA 3JVUA 2O8EA 4ABYA 4Q66C 3LX5A 4MGKR 2OBNA 3RC8A 5HE8A 1EG7A 1OKKA 4CT4B 2FFAA 1WRBA 1VG0B 4C7OA 4URVR 2J9RA 4U02A 1HT1E 1QF9A 3NBFA 3VU9B 3AKCA 4ACAA 5FUWA 3PJRA 2FZLA 2WIAA 4HUTA 3SNHA 2YNMA 4LJ6A 4TQ9A 1D5CA 5BXQC 1NN5A 2F1RA 4ZI3A 1U2RA 1VHLA 2OFXA 2CNWD 2GZHA 5FOVA 4HAYA 2BBWA 3TBKA 1XTKA 2GCNA 2ATVA 3K9LA 1W0KD 3MFYA 2HUPA 3THWA 3G0HA 1CR2A 4FCTA 1CLUA 5L3VA 1U0LA 3QPVA 1G17A 1HURA 4QM7A 4JZKA 3C16C 2AKAB 1MO5A 2HCBA 4BZXA 5L3RA 3EZFA 3ZJYA 5J40A 4DEYA 2OFOA 5FPHA 2OCBA 2IF2A 1NVUQ 3OFNA 4KAXA 4HAVA 3AF0A 4IOLA 4QKQA 4DCVA 2BC9A 1U9IA 2GAOA 3B82A 3I62A 3PFIA 2IXFA 3CZPA 4DDVA 5HZKA 2B21A 2OSBA 1DELA 2ZANA 3I3SR 4KI0A 3L43A 2R8RA 2NPFA 3GCGA 4OYHA 4NYIQ 2HT1A 5JCPA 1QRAA 2GZAA 2W2TA 4LJ8A 1G18A 4AC9A 3CB4A 1VYTA 3ZZUA 2PZEA 4MRSA 1YVDA 4MITA 3RRYA 2GAAA 4JLDA 2ZSEA 3NBYC 2ZE5A 2FV8A 2ZJ8A 2VIIA 4PO8A 3T1VA 1IOZA 1O3YA 1JAHA 1SZPA 2WWWA 1OPXA 4ZIRB 2QI9C 4Z54A 1Z08A 2O0KA 1COWA 3FMFA 4PXAA 1JJVA 3BXZA 1EWRA 4RCYA 2RCNA 2IWHA 3U3OA 4DDTA 3UXMA 1DAEA 2OBMA 2CL0X 1KI8A 4WXRA 2NZJA 1RZ3A 4OK3A 2WJIA 2YHSA 1KMHB 4ERNA 1U81A 4D81A 2EWWA 4NDZA 3QQ5A 4L8GA 1YZKA 2QEQA 5FTNA 3EPHA 4EFMA 3EA0A 4GSYA 2F1JA 3EIQA 1LY1A 1GNPA 1W36C 2GJ8A 2J0VA 1DAGA 2ZI9A 1GVNB 4G5GA 4GBMA 1E4VA 1BMFD 1E96A 2ZRMA 1OH6A 2AD1A 2IXEA 4XD7D 4ZO4A 3QKSB 3GMTA 4D26A 1MO3A 4KYIB 2C95A 4DLXA 1XRJA 1RRPA 1DVRA 3BH6A 4LJ7A 3TIFA 1E9RA 1ONBA 5GJCA 2PEZA 1T0HB 3HYTA 3QF4A 5A5GA 1NIPA 4K8OA 3MUFA 1UEJA 2GVZC 3HU2A 3GJXC 1U8AA 3OEED 2K5UA 1VG8A 2J5XA 4P32A 1ZYUA 2DCUA 1JECA 2R62A 4Z1MA 1XJCA 4YMWA 4FMBB 2PEYA 1YKSA 3P4XA 2QNRA 3MG9A 2BBSA 4C3ZA 3K0CC 4TLBA 4UNSA 1S1CA 2YZ2A 4TQUS 2IYXA 4CZ2A 1SVWA 1WDTA 3CRQA 2VHTA 4TTQA 4JVMA 4BUJA 3CPEA 3THOA 1XTSA 4B3GA 1KO5A 4DXAA 2VEDA 3QPUA 4AKEA 1FUKA 2MSDB 2AXPA 4NPHA 1MABB 2BCJQ 1T3HA 3LD9A 4EAQA 1TQ2A 2QE7D 1AGRA 4DUGA 3BB3A 1XPOA 3IQXA 5JJIA 4WZ6A 1KY2A 3LWNA 3QBTA 2FEMA 3D31A 4BRWA 1CF4A 2CE7A 2DFLA 4B6EA 2XXAA 3AVXA 1M6NA 3RRZA 5L3QA 4B33A 5FBVB 3PCRB 4C2TA 5AJWA 1N0VC 4JLNA 1UJ2A 5H68A 1D6JA 4DLZA 5JJLA 1CJTC 1DAIA 2ATXA 4B2IA 2VP4A 2JA1A 4EDHA 2OE2A 3ZQ6A 3KB1A 3ZD7A 2FJUA 3WYGA 5KOYA 1OH5A 1PLKA 3K0AB 1FZQA 1ZM3A 2HYIC 1Z2AA 2AWOA 1E79D 2QTVB 4M4SA 3CWQA 4NCNA 4BFVA 1WMSA 3ZVMA 3PENA 4DLRA 1I2MA 4RCZA 2NPIA 2ZI5A 1XB2A 2ORVA 4US2R 2XITA 1I4TD 1ZNXA 4BFSA 3GLFE 2H57A 1D2NA 5JI2E 3OEHD 3AVWA 1WE2A 1G7TA 2WWFA 4JL6A 4TTRA 4V0ME 3SN6A 4ZV4A 4MRVA 1OFUX 2GETA 1DAMA 1GKUB 3E1SA 1N6LA 4M1TA 1TUIA 1HYQA 2NO9A 4EPYA 5BWMA 5E95A 2F43A 4Q7JB 1JEEA 5JZVA 3C4JA 2BMFA 3LRPA 1G8HA 4Q1AA 2PZGA 1ANKA 2ZJOA 3AVQA 1N5JA 4EQ6B 1E69A 1SXJA 1IJEA 4FD2A 3K0SA 3LY5A 2BVNA 4OHVA 2EU8A 4E03A 2GESA 2V55B 3BGWA 1Q3HA 3Q5EA 4L9SA 4A2QA 2OEPA 3RWOA 4RJLA 1KKLA 5BQ5A 2JLRA 2DR3A 2C9CA 2Z83A 4EUNA 2O8CB 1SULA 3OESA 2QAGC 3B1YA 3UWKA 4DBLC 3R7WA 2IYWA 4BWYA 3IO3A 1XCGB 5FPYA 4RD4A 4XD7A 5EE1A 1UDXA 1HA3A 4P3YA 2J87A 3PIRA 4LYFA 1VHTA 3ZH9B 1KYIA 4GMDA 5DO9A 1NIJA 3K09A 4IOKA 1U98A 5L3SA 1T5IA 3ZLJA 1GAJA 221PA 2WWHA 2AR7A 4FW9A 4IHQA 4HZIA 2RH5A 2ZRLA 3RS2A 2QTHA 3F3YA 1P75A 2YOGA 2V9PA 5FL7A 3RC3A 3W8RA 5BW8A 4DHEA 2C5LA 4LPKA 3NH6A 5FOXA 2V6JA 2QBYA 2WMNB 2CBZA 3B1VA 3K9GA 4ARZB 1N6IA 2QMOA 4A9AA 4S35A 4PHTA 1Q57A 2FEOA 4D0GA 3FGNA 4NCKA 2SHKA 3AP1A 3RAPR 2WVJA 1NKTA 1UF9A 2ZRAA 1ZINA 4HI0E 4TYWA 3DMDA 4Q02A 4QBFA 3B1WA 5EE0A 4TYNA 2GEUA 4JKIA 2VHUA 4GDFA 1TQDA 4PANA 1E9SA 2ZI6A 1IXRC 4JVLA 3TJZA 1YZLA 4OBEA 4D4MA 4EPVA 2YWEA 3RSOA 1XNJA 2B6HA 3KKNA 4LWZA 4LBWA 3V4FA 2ANCA 2KBEA 4NL4H 5HPYB 4CRWB 3AVOA 5CM8B 1KI6A 2XNSA 2ZUBA 2AFHE 5CLQA 3CM0A 4CF7A 5TMPA 4JL5A 2HLDA 3RSLA 4AYTA 1F2TB 4G5QA 1Q1QA 4Q21A 1E9FA 1U0JA 4TZ0A 3NDPA 1L8QA 1TEXA 2RB4A 1XWIA 3GFPA 3VKWA 4U7DA 3MWLA 4YLGA 1GOTA 1FOEB 2IL1A 1AGPA 1IN7A 2AN9A 2V54A 1N6RA 3I4LA 4MGIR 1OB5A 3BWDD 1SVIA 5JEDA 4GL2A 4KVGA 1GTVA 4IOMA 2CK3D 4G5SA 1MOZA 3FB4A 1R8SA 1E6CA 1UBGA 3VKHA 3BRWD 2GJ9A 5EXSA 3WYFA 5H8WA 4H1VA 1S9HA 2GCOA 4TMZA 5LB4A 4JBWA 2FPLA 3BORA 2IYQA 1KDPA 2LCFA
chains in the Genus database with same CATH superfamily
1CSEE 4GR5A 1C7JA 4F1JA 1QP7A 1VE3A 4RA9A 4MYUA 3GCXA 5A5EA 3VZCA 3MBOA 4NFLA 5G0VA 5JE8A 2BISA 2QSZA 3CBQA 5CT5A 3ED5A 1KEEA 3URKA 1R4MB 1WHSA 2XKBA 4OKNA 4GM0A 2PZLA 4YRLA 5A4MS 4L0MA 4HRAA 3OQBA 4LYEA 5G0WA 4WNAA 1VRVA 2QU7A 1RCUA 5GZ6A 4EAAA 1A71A 3JQBA 3V8RA 2F3TA 2PYZA 2G5GX 4XYGA 1CUDA 3TH5A 3UMSA 1LPSA 4ZWNA 1E0JA 4QXAA 4A0QA 1G19A 5CFOA 2B1IA 5BSTA 1QE5A 3AH8A 4P1ZA 3TEJA 1W8IA 2FF7A 3CNEA 3OY2A 4PW0A 3B3JA 1RHQA 2OD9A 4FFLA 2P68A 4G8DA 3VI3B 1L4LA 3K9FC 2XMCA 4JVOA 3UHFA 2A3RA 3SIWA 3O7WA 2ZJZA 4DUZB 1PGJA 2HU7A 1VCOA 3I12A 2BEUA 5BVHA 3D0OA 4KU4A 2I2FA 1OI2A 1W0JA 2I67A 4L5YA 4P4UA 1ZH0A 2BCEA 5HS4A 1B00A 3V4PB 5E3HA 3UB2A 5T8KC 1VP3A 4NULA 3VHXB 2COEA 4J03A 4JU8A 3TUZC 5E9WA 2H1OA 3WGIA 2EKLA 3GA0A 3QEBZ 5F98A 1ZMXA 2ZCVA 4MR9B 2Y1CA 3TI7A 1I3KA 4EI8A 3F3KA 3VGJA 1FSSA 3BMCB 3QLUA 5FI1B 4RHYA 5HGJA 1ORWA 5IWAB 1PG0A 3JD0A 4WFQA 4E21A 1V1MA 1KS9A 4PSAA 3AR8A 3AFMA 1G38A 3V00A 1QGYA 1T6YA 1D2RA 1G7SA 1O97D 2QY9A 1NYLA 3GO4A 3DE2X 1PTJC 1W59A 3CJRA 4DBLE 4BEVA 1P19A 4Q37A 1XZHA 1IHPA 4JYPA 1W36B 3FDZA 3A1VA 3C3XA 3LCUA 3W78A 1X38A 5AVRA 1U4OA 3JVDA 4LOJA 621PA 3PQEA 4FHFA 1V3QE 2FN3A 2FAXA 2A1UB 1ZONA 2HR1A 3JWJA 5GVRA 3TB6A 4DCPA 2J46A 3G6KA 1ISIA 3T1HB 1ULUA 4MWGA 1CPYA 1ZJWA 1WKCA 4M9QA 2XUFA 3MJHA 4ILEA 2FUG6 3ZCRA 2PX0A 3F6BX 3GLSA 4Z99A 4D92A 2WYWA 1ECBA 4I50B 2FSSA 1NOIA 4TN1A 3EVFA 1MRZA 3ONNA 4UU8A 3FMIA 5A5DA 3QU2A 4YRPA 4PBRA 4XGKA 2R65A 2ZJ3A 4AZ3A 3CX4A 4QOHA 3UMRA 1KYYA 3INRA 1NFFA 3DNFA 4Q7LA 4CLXA 3WBBA 4UBOA 3U48A 6REQB 2GN4A 4MVJI 4OLHA 1E4EB 2A9KA 1VL6A 2DRIA 2ZUVA 1SURA 4H4CA 2GM9A 1KPGA 3GOQA 4ZCSA 1C9KA 3KR0A 4HUQB 4MWSA 3PNOA 1L2TA 2Y1KA 3H9QA 4UBLA 3UFXA 4DJJA 1PVDA 2CJFA 5B4TA 1K3UB 5CB4A 3THYB 1U0NA 4BECA 4AG5A 5AW6A 3QA9A 2WD7A 1QV9A 2QD2A 1QH1A 2GEJA 2RG7A 4Y98A 4BX2A 3HXTA 1M3SA 2KB0A 3D2LA 3GJ4A 3DWIA 4LUCA 2O7VA 2GZ2A 3F74A 4QBGB 3H42B 1HYBA 3RAGA 4XUCA 3TIIA 4Q4DA 1X8JA 1GZ4A 1SC4A 1YJXA 4B35A 1ULSA 2PAFA 3O8LA 4KB5A 4UM5A 1VE5A 3IILA 2CYAA 4N49A 4D46A 5LQCA 1H4QA 2PJUA 1WF6A 2WZCA 1HX7A 4PYOA 2YWDA 2ZUSA 3LYHA 4JX9A 4WA8A 2LUOA 3ILHA 1GPDG 4AS3A 1XXHE 3O8QA 3LF1A 4MWCA 3NOXA 2PJZA 4L6CA 4OX9Y 2JGLA 2AMVA 2PQ0A 4U8GA 2H0RA 4FOLA 1OGJA 1HV8A 2Q1UA 4Q9HA 4I1PA 3S8YA 1BD3A 2RHDA 1QTIA 1RPTA 1Y3CE 1H8ED 4HS9A 5D87A 3SFTA 4BPRA 4BEBA 3C45A 1I5RA 3K5PA 5CDSA 2WQ7A 4KZKA 5I4IA 5LR6A 3P2IA 3DVAB 1AKVA 2OECA 3GRUA 5DHQA 4IGAA 5FHRA 4O3MA 1N2XA 4G4IA 4UDYX 5ESDA 4MXDA 5KTRA 5JSFA 3INGA 4EKDA 4NJEA 5ALPA 5BV1A 4NABA 1W76A 5FD8A 1FX0B 3JQ7B 2WV7A 2J1LA 3HKDB 5GV7A 2HL6A 3E9RA 2WOOA 1IK6A 2AYZA 2E4UA 3D7SA 2FZCA 3W7VA 5IKXA 3ILSA 1KY4A 3P96A 3FXAA 1DL5A 4JBGA 2HA0A 2J08A 1GZ6A 4BVAA 4DNXA 2VF7A 2PD4A 4E2WA 1OWLA 1Q6YA 2OM6A 1KRXA 4FINA 1QCYA 3A9TA 3UYLA 4DRYA 4FSDA 2GUGA 3TRIA 1WTCA 4M7PA 1E5VA 3FMOB 1Y3AA 3WLHA 4F6RA 3OE4A 2Z6AA 5JNWA 4DIEA 2HF8A 2OXFA 3TJRA 5IT4A 4X7MA 3MSXA 4WQMA 3TW8B 5B12A 3EODA 5JROA 4GECA 3I04A 4ZEWA 1S8AA 2XUHA 1LI4A 4ZKDA 2D7JA 4L0CA 2DHCA 2EEPA 4YO7A 4ALLA 3AY7A 3R5SA 2YN4A 4GC5A 2VBFA 4NESA 1H3FA 3PTLA 5JD6A 4KR3A 4KR7A 1T26A 5TPWB 3LX4A 1MXFA 2XCLA 1T4CA 1OU4A 1N9GB 3GRFA 3HDTA 4BGUA 5ENVA 1ZVKA 2AJBA 3FZEA 5AW1A 3PNSA 1A27A 3A9RA 4KFRA 2W6OA 4UBMA 4HDMA 2WF9A 2VLIA 3E3NA 3KQVA 4K5QA 1Q1EA 1UKYA 3LUGA 1A98A 2DFNA 1EVYA 4IV5A 5B37A 4RVDA 5HCNA 5MN6A 2VDJA 1NX6A 4PHCA 3ILXA 2AMJA 2GBLA 2FXVA 2R86A 2UDPA 3AGQA 3HUEA 2WP0A 2ZYIA 3O95A 3R6WA 4RK0A 2SCUA 3GPIA 4NCJA 1BN6A 2Y8EA 2Z2ZA 3H7AA 3E5RA 3IEUA 1VLQA 1KI3A 4ITUA 1X86B 4PZDA 2ZE6A 4PQRA 4BFUA 1ITZA 1F2VA 3C4VA 1E2QA 3K70D 1PLLA 3M9WA 3PGKA 4C6TA 5C8XA 4XUEA 4E5NA 4JI0B 4JBNA 3A7DA 1WB9A 1T36A 1J97A 2Q6VA 4UTZA 3NHZA 4NZMA 1AKTA 4WIAA 4HPWA 3A6FA 4ARUA 1GNLA 1SKYE 3BXGA 1N2JA 2EKBA 4I4CA 2JBAB 3ZNOA 3M4YA 4RFSA 1UEIA 3IBFA 1LNSA 1BD4A 2D5CA 5A03A 2P3LA 5JLAA 3O73A 2QRGA 1C1DB 3AY6A 4MTCA 4EG0A 1P0CA 1C9JA 1P5FA 1YI8A 1I0IA 7REQA 3EZ9A 3VAZA 4RGQA 5SYAA 4HJXA 5NULA 3WSTA 3COSA 1XQWA 2V96A 1E1RA 2BJVA 3GARA 2CXHA 2PUCA 4KYUA 4B6PA 1S0UA 1TA4A 1ZHHA 4KQ1A 2FJ0A 2DG2A 1Z68A 1PP4A 1ID8A 5DMHA 3ZLVA 2XIJA 2R8OA 4GBGA 5F1PA 4K88A 4S1WA 4UU7A 4EKNB 1W0CA 4YT2A 4Y6QA 4YYEA 4BGEA 2ZSFA 1C3XA 3LXRA 1TAGA 2PGJA 1XQ1A 2C96A 3HKCB 4GYYA 1RM4A 3D59A 3HY3A 2DFDA 4YJHA 2XZDA 5IP5A 1M34E 4IDQA 1J42A 1V41E 1SVKA 1V6AA 1DPFA 1I01A 2I87A 3A6HA 3O75A 4HXFB 1OFTA 4FFVA 4U9HS 3RVLA 5A3QA 2YFKA 3NHJA 2OLJA 5BSKA 2ERYA 4R83A 4U7GA 1II9A 4A03A 4YONB 2P79A 5H16A 1R66A 4UEOA 3C8DA 5IBCA 5IYZB 4MGYR 3DOFA 4U8HA 4HVAA 5EP2A 4PXSA 1U7ZA 4C4YA 1X0XA 1Q0SA 3KJNA 4UTPA 3GB9A 2IGTA 3IV7A 4F4DA 2QLMA 2D6FA 2YMMA 2KHZA 4IDHA 2Q7DA 4E3WA 1RVDA 3NWOA 3OA0A 2XB6A 3GJ7A 3I6IA 5JLJA 3O2QB 2BKEA 3G0GA 3K8YA 4DJAA 2W11A 5JXJA 3NGXA 2JJYA 1IBLB 1I1QB 2OUKA 4YMIA 3N8GA 3U6KA 1RHMA 2H5JA 3L0PA 1OXKB 3MQFA 3ABSB 3MTBA 4U2KA 3PLNA 4PR0A 4I8XA 3GLRA 5FR1A 5A9SB 1WBDA 3HK2A 3GYGA 1Y7PA 1TLLA 2BKXA 1H2HA 1YZFA 2GHTA 5K3DA 2YVUA 4U5QA 3CW8X 3TL6A 2KLBA 2IU3A 3ZCSA 1Q83A 5KDDA 1H23A 2FUKA 3OX3A 1KHTA 1WUIS 4M0LA 4NHEA 4ZICA 1R15A 3OZCA 2LZ0A 1XD2B 2B61A 5CVJA 3PBKA 1ZOOA 2G83A 3HU5A 3QMVA 4QFCA 1IZ9A 3TKLA 2YYZA 1W5BA 1E7RA 1D4ZA 2GJAA 1Y4AE 4EO9A 5JJ5A 3TF5A 1DEOA 4OA5A 3I5YA 1ZHOA 5A0VA 4J29A 1T0PA 5AJVB 2R4QA 2ONZA 3QW2A 3DMNA 4G37A 4UBJA 2R85A 1WUJS 4YXWA 3PF8A 5HF9A 1MNAA 1NWCA 3W2GA 3HR7A 4J0EA 2BFPA 2D54A 4JI8B 4OGFA 5IWCA 1YJCA 2XQFA 5TY0A 3D8BA 2NT3A 2J45A 1AHPA 2P6RA 2CL5A 3BE8A 4IXDA 4YIHA 2DY1A 3LLSA 4M7RA 4P7KA 2AT1A 1NI4B 1OV4A 1E2UA 1M1YA 2KM1A 2QRZA 1F8FA 3EJ6A 1CUIA 1ZIYA 3MAAC 2NYVA 3AEKA 4F38A 4JH0A 3ZQ4A 4LWPA 1OIXA 4U0KA 2PL3A 3M33A 1OFVA 2I6UA 2Q3DA 3PUWA 5BO5A 3UAOA 1UBMS 2Q07A 5HCIA 3ZWMA 2D3WA 3DHNA 4M9ZA 4DIMA 1EP2B 3W4IA 4ZAGA 1E1KA 1JS1X 1XLVA 1LWOA 3PRHA 4DCGA 5KYTA 4RVNA 4WBNF 3GCDA 5H81A 3TXYA 3O1JC 1TM3E 2YFQA 4Z7QB 3A9WA 4X61A 4RHCA 1YB5A 2Q0HA 3FNBA 3OLZA 4J0DA 5C18A 5AYVA 2XRYA 1ULAA 3W6NA 1EE2A 4PZ0A 1EA7A 1S5PA 2OBFA 2QD1A 3H17A 4UDNA 2HPZA 1QIMA 3QE2A 1H6CA 1K6JA 2RHMA 1M2NA 4OATA 1ZSVA 5D7BA 1V26A 3PU6A 1HDZA 4Q34A 1VL8A 1ZGHA 3PC4A 1KK2A 2ZJBA 2H08A 4HYQA 1R16A 1A7UA 1XHLA 2O48X 1N6HA 2PD6A 1KYQA 2FSHA 1KF0A 2ZEJA 2DKOA 1ORTA 3B60A 3DR3A 3GZ4A 2ESRA 2IHJA 3GEDA 2RGNC 3BC1A 1U1IA 2JRLA 3OLCX 1UXIA 3GVPA 4H3SA 3F5QA 4D9HA 2CVHA 3H9BA 5C9ZA 4N3GA 2ECKA 1QK4A 3PXDA 2E5LB 4N9QA 3UMFA 2C83A 3WIDA 3TX2A 1AO0A 1G291 2KLHA 4F97A 3KQNA 2OHHA 3LPLA 1SXJD 4DWOA 1YB6A 3B6EA 3P71T 1NAIA 4C4PA 4IS2A 4EHKA 2HA6A 2VOEA 3AI3A 2NLOA 5KYKA 3Q9SA 4HQNA 2I78A 1TTTA 1YUNA 3IPRA 4CIYA 4TXMA 1GNQA 4MKGA 2C5HA 2VUHB 1N7IA 2RGEA 2X0JA 1JP7A 4S0XA 2DYKA 2PE5A 1V8FA 4DCSA 4OK5A 4EJ0A 3H2SA 2WD8A 3A6DA 3JZIA 3GEGA 5EHQA 3KPJA 3U7QB 1R4MA 2PM8A 3S7ZA 3ESZA 3HJNA 1KOFA 1MAVA 2AUMA 4R2XA 4N0EA 2IV3A 4RJ2A 3CZCA 2X9VA 1NN1A 1Q22A 2Q4TA 3G0DA 3C3YA 1E94E 2GF2A 4PO1A 4DQDA 2V9ZA 3OHMA 1CV2A 3D5TA 4NV1A 2YJGA 4PHFA 2GK3A 1KAQA 3UHPA 3EC7A 4L8VA 5E1OA 2YQ4A 3NDBB 6GPBA 5B7NA 2HJRA 3A3OA 2WJJA 4BV2A 4DSUA 2OV4A 1OUMA 2BUBA 3U62A 4BVFA 4N47A 1VQ1A 3IIMA 4ON9A 4WKOA 4CLOB 4LRSB 1BMTA 1BJRE 1ZL0A 3DW3X 4K9SA 4XCQA 1JR6A 2C9ZA 3MUNA 3IIKA 3A70A 2AUTA 4D42A 3FCYA 2NTNA 4AJOA 4X3OA 2VDUE 4F4CA 1YR9A 1E61A 3CUSA 4L4UA 4LRYA 4GPEA 5EVCA 3VHXA 2VSFA 3DE6X 4DMLA 5KYGA 4EF6A 1JSCA 3H9GA 3T7CA 3H9EO 2C5BA 5DLYA 5DTJA 2Q6OA 4MR9A 2DU8A 3QMWA 4PAMA 3QI2A 3TZKA 5K8VA 1QJCA 2RKWA 3U3DA 2A1TS 2JFFA 4UEJA 5EIEA 4AQDA 4QOSA 1DJQA 3STYA 1U0EA 1IK4A 1SG9A 2F6RA 4DMFA 5BSHA 2I0FA 2YBDA 1Z8DA 3E15A 4Y2SA 1DJOA 3ZCXA 4FN4A 2WU4A 4WY5A 2D1RA 1L7NA 1XCBA 4XXHA 1IUNA 1H94A 3LKBA 4NXNB 3F6RA 3A25A 4DEXA 1DJNA 4Q39A 3SZUA 3Q8LA 2QP4A 2I33A 3TK1A 4JWTA 1JI3A 4AU1A 3S8EA 2A1UA 2ZYAA 5AK3A 1K7FB 5DHAA 4B40A 1NW7A 1N2EA 1YASA 2YY7A 3Q8WA 2XHEA 2LW7A 3FG9A 2OO5A 5K0GA 3ZHXA 3QFSA 1GTJ1 1C9MA 2F48A 4I50A 4M0DA 3FR8A 5D01A 2VO1A 4ZOEA 3UOAB 4D9FA 4WW0A 2V3VA 1CY1A 1YQDA 1P29A 3A6EA 3GRCA 4CM7A 4QJ4A 2QQEA 1BCSB 5FNZA 3GJTA 4O1IA 2EF1A 4LSMA 2O8BB 2WUGA 3OT5A 4IH1A 6REQA 1E4EA 4I3FA 4QOEA 3CF4A 3TZHA 4QA9A 2CGEA 1WY5A 1U8FO 2NV6A 3DOOA 2BLNA 4UOEA 1TKBA 3QEKA 4HUQA 2V45A 1N5OX 2EX1A 4FDUA 1K89A 1EGHA 4IQ0A 3THYA 1LRKA 3DTVB 4F9TA 2AOUB 1XT6A 1A50B 4LF8B 4FOTA 1VYUA 3E2MA 2XUGA 2A2ZA 4YLEA 3A1EA 4S24A 1JVBA 5E7MA 1VMAA 4HD8A 3DEYX 3L05A 4R31A 3R7NA 3SMQA 2C9YA 2FKAA 3DR5A 3OD5A 2AFIE 3B36A 1R5OA 1VE7A 2XUDA 3AJEA 3OIFA 1T0JB 4LQ4A 4EP1A 1B8VA 4H60A 2DQSA 1C1YA 1U0GA 3AZOA 3GGSA 3IVXA 1K5HA 3CZ9A 3TXAA 1YNSA 4MROA 3VVBA 2G3YA 3PDCA 2IZ6A 3BZWA 3MRSA 4JUDX 5DZSA 1D0IA 3I6ZA 4DC9A 3N2KB 4TWZA 2IYVA 1GGKA 3QUTA 1EVIA 3BWMA 4MDEA 5H83A 3ONDA 4ALMA 1ZICA 5BURA 2PGDA 4DTIA 4RF5A 2FPPA 4M9RA 2H4XA 3SQOA 2GILA 3RUFA 2J9YB 1KDOA 3L2OB 3HVHA 1YRAA 2OSVA 4O2BB 3G49A 5EP4A 1RQPA 4NE2A 1KDVA 2C07A 4EVSA 1XUOA 1TCBA 3BFXA 4C0XA 3EH1A 3QBVA 4G9GA 3TLGB 4A16A 3P27A 1XTTA 3AR6A 5LQUA 4BMSA 2P5TB 1EE9A 4MUNA 3IUYA 3DVAA 4HR7A 2NXEA 2PD3A 4MO9A 1LF0A 2R00C 3BUSA 4HNQA 3F5MA 4JT2A 2G1JA 1W0JD 3KPUA 2FCAA 3DM5A 2HIHA 3M2TA 4Z4QA 3NFRA 2JLVA 2VPPA 3CE6A 4DR6B 3DBIA 2N47A 1SU4A 3ZWVA 4CIBA 4NMHA 4TZTA 3K8QA 1FX0A 3OJLA 4XOUA 3JQ7A 3HKDA 2H59A 5K0FA 3L1KA 1JHRA 1NBMA 2G0NA 1IZZA 2NW6A 5J2UB 4ISBA 3S0JA 1VZ2A 3HRHA 2XA2A 5BYBA 3A6PC 5A6SB 4E07A 3DZBA 3FZYA 1VLHA 1GNRA 3O31A 5GZ1A 5C31A 1C0IA 2R7LA 1AB6A 4PLPA 3ZYCA 1LS6A 3KJFA 4FEAA 5K8UA 4R9NA 4TXHA 3Q7QA 4PYKA 2Z57A 3KQPA 2Q2OA 1NZJA 1UMBB 1ZMRA 3LZ6A 4J2TA 2IITA 2H17A 3ELUA 3KUKA 5FOSA 4XTCS 3CSUA 4YT8A 3V1MA 4Q1BA 2SKDA 3ZK7A 1X3SA 3TQIA 5JVDB 1G1MA 3WWPA 1TA0A 3VZBA 4I6GA 4TLEA 5JDIC 5JYBA 1Q2XA 3VOAA 1VRWA 1BS9A 1UK8A 1WU7A 1FDIA 4W6ZA 1EWQA 3PA6A 1U0SY 1TE2A 4IL5A 4IF4A 1OCEA 2E3JA 4C9BA 1QIKA 1DIHA 5TPWA 3ACDA 3OFVA 4IGFA 4P6VF 1N9GA 2W8BB 4YRRA 4QXMA 2ACWA 2DUUA 4J0GA 4TZKA 5KQGA 4Z5XA 1AV6A 4B3CA 4D9CA 3L3BA 4S3MA 5FBLB 2PANA 4FFOA 1BCRB 1DKMA 4ER5A 3O82A 1SUBA 2PUWA 4FBMA 1N4DA 3F6SA 1LF5A 4Q05A 3LVRE 5AI4A 4TMKA 3DOUA 3ZK9A 3AL2A 2DC1A 2ODEA 5SZIA 5TQVA 1L5MA 1B6TA 3MXOA 2UYCA 2QRLA 1C81A 3BF7A 1Y3HA 3DZGA 4QODA 3CSDA 1DINA 1R6UA 1EYZA 3I52A 3KV1A 2J4CA 1SZCA 3EQ7A 2BMWA 1G3RA 5BR7A 2DVMA 2ZTMA 1PJLA 3AXTA 5JATA 1J5EB 1GCAA 1QX3A 4XQCA 4Y0AA 4JCCA 3F9RA 1GRRA 4TMVA 4EY6A 4F4HA 1Z5WA 3WLLA 3ZGLA 1VI6A 2A5GA 4NPAA 4ZCPA 2BI4A 1JU9A 1XFDA 3RJ5A 3ZQUA 2JBAA 5IRCD 4MV7A 4MQ4A 1IPHA 1CZHA 1ZZEA 3DO6A 2B92A 2YJZA 1HFKA 1M7BA 3HCOA 3L6UA 1QOQB 3RARA 4H9GA 4OH1A 1O8CA 2VDMB 2GTPA 3H2GA 3WLPA 4EJSB 1C1DA 2WMOB 3R24A 4H17A 4BLSA 1P9WA 2OCPA 4INAA 3IMFA 6ABPA 1U1DA 2CV1A 4R6XA 2EBWA 1X8LA 2RAUA 1MA0A 2Z9DA 1EK5A 1HDCA 2RSLA 3FYUB 2R8PA 3GHHA 3BRSA 2CXRA 4PGAA 1QHEA 4HVLA 2OHGA 3GLFB 3GUZA 4BNGA 4QRHA 2CL7X 1O08A 1YRWA 2HDOA 1SCNE 2HBQA 5GGXA 3PC6A 3P9QA 2EGHA 2HF9A 3KJXA 2CMHA 1ISHA 1KDTA 4JLOA 3BIWA 1W4BA 3DBRB 3QELB 1LK0A 4ISCA 1A9QA 1ENYA 4DBZA 2XECA 3HKCA 5JYDA 3IVRA 4CTNA 3GDGA 1IYZA 3RIMA 4B82A 3FDIA 2WUDA 3DQQA 4BQQA 1UWVA 2AK3A 1Y4ZA 4XDZA 3ZZTA 1SG6A 4MRAA 1W1WA 3OT1B 3PRKE 4H0CA 3ZLBA 5DT9A 1PJQA 4QLOA 4XGNA 4B6GA 4AYWA 3T4XA 1AG9A 1VE9A 1HETA 1U1FA 2ODPA 2A58A 3WYNA 3ZCUA 1G42A 3D6FA 4Y8VA 2OQIA 5IYZA 3LCRA 4G4GA 3KSAC 1GKYA 4YDQA 2D1FA 4YBRA 1VJGA 3TMYA 4GWGA 5SY9A 5KWSA 3RRMA 2O23A 1W87A 3VDXA 2HSDA 5CT9A 3SKXA 1NXVA 2DLNA 1A82A 2RFLA 2JASA 3EWIA 3UUFA 2F2TA 3ZYZA 5JNTA 5KPJA 4FWBA 3JVEA 5BSWA 2WTMA 4EY4A 3L7AA 2H9AA 3OOWA 1QYCA 2APJA 4K6MA 5G1NA 2D62A 3WIOA 5CB8A 3DM9B 2HPVA 1C9DB 4PX2A 3QX7A 4RK7A 3B7GA 3GLTA 5JSQA 5A9SA 3FLBA 3WLAA 1P3JA 2B7CA 3F97A 2ZWVA 3NBAA 1TKCA 3H5NA 1RKVA 2VWPA 2Y2VA 3K4HA 1RJGA 5A62A 1JFVA 3BG5A 2JH9A 2FFQA 3BD9A 3E48A 3GFSA 3AP3A 3OFJA 3QF4B 1MC4A 5D85A 5FO0A 1Z34A 5EI5A 3GLIB 1EU1A 4ND1A 2OQ2A 4TMTA 3WRXA 3VMFA 4BAGA 4LF4B 4U2GA 4YDSA 1XD2A 3AWDA 4NV0A 4URYR 1OI3A 2ZJ2A 4U7PB 3L6BA 1ZOIA 4YUWA 4FWTA 1NY6A 1Z0ZA 4WSOA 3IBCA 3TCKA 3N8KA 1KGSA 1M5RA 5ALXA 3OP4A 3L7KA 4BCBA 5AUPB 1B0AA 1T3TA 1V1RB 2REBA 2J67A 3WHKA 1NPTO 5CVTA 5F73A 3AOEC 1V48A 2UXBB 1JKIA 3ENKA 3UGJA 2W2QA 1S3SA 3RS7A 3I1JA 4LNAA 3TQOA 4PC7A 4ER7A 2C98A 2WPNA 5CCXA 3QBDA 2XT0A 1R0XA 2B5VA 1UJ6A 2DBRA 2VNHA 5ARCA 3IJPA 4ZT7A 2V5UA 3ZV6A 1BJKA 2VF4X 3LC1O 5KPDA 1JKMA 2ECPA 2XMSA 3RRJA 1NI4A 3NAMA 1W94A 2W6QA 3OG9A 3P5SA 4BIMA 2XZPA 4TYQA 3SBEA 4ERXA 5IK2D 4AJ4A 3V1NA 2JJQA 4WFJA 4P3KA 5AKYA 2PWBA 2ZVJA 4C4SA 1Z5VA 1SQSA 2CEAA 1LC0A 1YL6A 2QVGA 2NO6A 2VP3A 1GXSB 2VS1A 3GZTB 3KD2A 3L6DA 2RGYA 1YFZA 3LDUA 3CVJA 1L5FA 2NZYA 2ZVDA 3PQ4A 3ZVNA 1GNTA 1V5FA 3P0HA 4M8LA 2WC1A 1SKQA 4KQEA 4KCGA 4MYDA 4GU5A 4Q5IA 3RNOA 4UD2A 4AY5A 3QX3A 1BWSA 1E1RD 3CUKA 3VO1A 1GKIA 1XU9A 3CWZA 1V37A 5SICE 2IZ1A 3DMFA 5JV5A 3HADA 1LC3A 1F8XA 1XEWY 5CGZA 5EUMA 3X2SA 5K20A 1E1YA 1GN9A 5G53C 3THXB 2UZ4A 1IM2A 1MJ5A 1W75A 1WSBA 2QXYA 1M2HA 3OLVA 4WWHA 2ZB2A 4XVHA 5BNTA 2HQRA 3HJHA 5CFQA 3STXA 2IHNA 4MJ7A 2PX8A 1JBQA 2QLTA 2JB9A 3A1DA 4G0XA 1DEKA 3WDLA 3HVRA 2B5WA 3PGJA 1ENPA 3KJIA 4QC2A 5HRCA 4EA9A 4ARIA 4F2PA 1CY0A 1XMVA 2R25B 2ENUA 1EX6A 3OKCA 4R5HA 4IIJF 5CA1F 2P2GA 3I72A 1F60A 2ZT5A 1KZ4A 1OPRA 2EARA 2HK7A 1QE0A 2JKZA 3AJAA 5DTEA 1GPH1 4QFDA 3C7KA 5ESWA 1RJWA 2ZYSA 3LKVA 2GASA 1TO2E 1GYPA 1HOTA 3EOZA 3DE5X 3I30X 3P9CA 4Y2QA 3HXKA 4X41A 1A69A 4A8HA 2I54A 2B8NA 4O6VA 1GL6A 4YMUA 5KWEA 1MBZA 2FUG1 4LN1A 4MWBA 1OW3B 4RSMA 2GOYA 2NG1A 4FOOA 5CPBA 3I5UA 5DNWA 1YFLA 3P2EA 3JYHA 3P19A 4PSCA 4S1TA 5BN3B 5KNCH 1HT0A 1YU9A 1N75A 5B1EA 3GA5A 2FP4B 4ZHQF 2FMFA 3OO1A 1Q0TA 3BA1A 1O97C 4J1SA 5ELMA 5KREA 3PEVA 2GLTA 2NU9B 4B4UA 3WY9A 4H6XA 4UCXA 3HFRA 3ZWQA 1E9EA 3NTQA 3AKZA 5TF0A 5CDFE 1W2GA 5DHFA 1T5HX 4WJLA 4G5RA 4IDFA 1M6YA 3VZDA 4AVYA 2DQZA 4WVLA 3IQGX 4DNFA 1FMLA 4WXEA 3RIEA 3X3HA 1JALA 3WGQA 3KYCB 4FNAA 3D81A 1E6KA 3FUTA 4JXJA 1GLGA 4GKKB 4RF4A 1FP7A 2UV8A 3L8DA 4NY1A 3ZXSA 4F8JA 4CLOA 4YXWD 3SNKA 3ZZ0A 4AZVA 1N8KA 3ZN2A 3AB8A 1YMUA 3GCWA 3NXKA 3ZCQA 3GN1A 1M1NB 2WG1A 5HJ5A 5ICCA 1G1AA 3ZWNA 1OBVA 5C1BA 5AI5A 2M9MA 1VKRA 3UJNA 2CCJA 2NO4A 3B9RA 3CS3A 3ROFA 1E77A 4YAJA 1G8AA 4UW9A 1E99A 3IV9A 3VPHA 4BLQA 1YQEA 1JG6A 2RHTA 3PE4A 3ZHTA 1X19A 4GOMD 2DWOA 1ZH8A 3FVWA 4OL0A 5FOUA 4C4RA 5JR3A 4KRXA 5JSZB 3SE0A 1BWQA 1Z18A 4MUFA 1EGQA 1P8AA 3GROA 4P38A 1JXQA 3H9UA 1D5WA 2DMRA 2AQ8A 3F6YA 2PFGA 3QLEA 4J07A 4JJ7A 3N8DA 3S1AB 5KC8A 1L7RA 1CHDA 2QGFA 3ID6C 1Z6QA 4F86A 3HDVA 3FX2A 3VNSA 2KMLA 5HBRA 1R64A 2HLHA 3I39X 1ZXXA 4P35A 2JD0A 2Q5OA 2DGDA 1B2RA 3O3OB 3JQAB 4IOJA 3N9IA 5DSZA 1NMZA 3QWIA 5IULC 1FRFS 4CMCA 2Q1YA 3HYRA 3URMA 3MIIA 2FR0A 1DC3A 4AMGA 3MS2A 4GXQA 3KQUA 1QB8A 4NDAA 1TL7C 3KDPA 1NJFA 1UC8A 3OZBA 3H84A 4BZQA 5LZ2A 2CHGA 1PEAA 5CIWA 2VJNA 3HZOA 2BGLA 3Q40A 2ZVPX 4NAUA 3TLKA 5C4GB 3U44B 3ADCA 1C8VB 3HACA 1G21B 1V3VA 1TJPB 2BI7A 2P5SA 1BCSA 3D7KA 3K31A 4OJQA 4UM9B 1ZD9A 2O8BA 1OYWA 2WHQA 1N1DA 1G0OA 3PNVA 4RLQA 5AK0A 5IUJC 1ACJA 1EJ2A 3LYLA 2VDVE 2H4ZA 3AVYA 1RBYA 1WD7A 1WXHA 1VYVA 2AI1A 2K2QB 2J3MA 4KRFA 4PQEA 1ODIA 1C3JA 1JPUA 2H18A 2B94A 2AOUA 2UUPA 1WVGA 3DTVA 3KZKA 4H7JA 4LZZA 4U39A 5CT6A 2LIPA 2X4DA 3RVRA 1HE8B 2YV2A 4ARAA 1H9CA 3CH4B 2FYTA 3V4RA 3MBKA 3CSSA 4G0QA 5ILOA 3CZ5A 3G9XA 3N8HA 3PUVA 3A27A 1LKZA 4D96A 2OFWA 2PG3A 1G41A 4ECEA 1XGKA 5ALQA 3TR6A 2Y4OA 4FI3C 3B9PA 3MHTA 2NGRA 2NU7B 2TMDA 1CQIB 3ECAA 3N2KA 1P77A 2IXTA 4GPIB 3G5AA 1KEPA 1YB2A 4P4NA 3EE6A 1QAQA 3LK7A 5HILA 2IIPA 5DDIP 1DT3A 1UQUA 1CU1A 3NUGA 4GZ3A 2P8SA 4LNHA 3OQIB 1FYDA 3SOZA 2YOFA 3FFWA 2Z2IA 1LWNA 2BGMA 2FCRA 1AXGA 4O2BA 3IC5A 5TJ9A 4LX0A 4AN4A 2B9EA 4JJZA 5LIRA 3GELA 4JP8A 2MYTA 4YV0A 5AW2A 3TLGA 4MP3A 1W7AA 4I4TF 5KUTA 4LBYA 2CFCA 1JR3A 4CEHB 4W7IA 3ITNA 4O59O 1GIAA 4CE6A 2FFBA 2QD3A 1PN3A 5JMTA 3HLTA 4E09A 2Q8PA 3FSEA 1LVHA 3KJHA 4R8MA 3V2IA 2QL5A 1WO8A 4P98A 4YASA 3OU6A 2JDIA 1PX2A 2W0SA 1U9IC 1QR6A 2FX3A 2VHXA 1E4OA 2ZTLA 4ZPJA 5DNEA 2GHRA 1KO7A 1CETA 4IAOA 1BE1A 3SIRA 2HC9A 3BN3A 2Q0XA 3I92A 2ECFA 2GJ4A 4NNPA 3WNQA 5J2UA 3CRZA 1R9JA 5T67A 5A6SA 3UMBA 1UADA 1R8QA 2PV7A 1W5AA 4M76B 4YMGA 1L5WA 3NMUF 3LPMA 4NZZA 3K70C 4CUZA 1WZNA 4GBED 2CMFA 2V3WA 2RGAA 3VI4B 3I1YA 1UMBA 2JGNA 3KE8A 1TW3A 1OYOA 4YMHA 5JSKA 2P27A 1W36D 1DS6A 4B3MB 4I2VA 1RWKA 3SEQA 3MCTA 4N41A 4IDPA 4K1XA 4YP9A 5JVDA 5CB6A 5D1HA 3DG9A 4YRSA 3TNLA 1XL0A 3HEMA 1Z7YA 1XR3A 2E89A 3AR9A 3HCDA 3EG9B 3SDBA 3WP1B 1C4XA 1R0YA 1Z0DA 2C2XA 4GAEA 1RE0A 1AJEA 1TU0A 2DFVA 3N2GA 3HBFA 4AKHA 2H4FA 4E5UA 1CYEA 2JJ1A 1G16A 2XXJA 1YJAA 1U7HA 5JW6A 1A4XA 1EG2A 1G5RA 4TRRA 4YEDA 1U9CA 4ECAA 4DLLA 5BMOA 1BCRA 2Y77A 3OCYA 3AV3A 2GLXA 3OTHA 3V6MA 4BO5A 1TDJA 2C7BA 1QGED 1CY8A 2JHGA 1ATZA 2OC4A 3HB5X 3HWX1 3B5IA 3REGA 2V98A 3TZ6A 3HH8A 4MB0A 2WKPA 4JL8A 1QS0B 2DPMA 2BF7A 3WIUA 1PQPA 1WOMA 3W04A 2WFMA 1XP8A 1MQAA 2REQB 1K0FA 2VR1A 3E7XA 4W4TA 1AS3A 2F9MA 3WKDA 2I1LA 5HP4A 4H27A 3O8BA 5C8ZA 1BKYA 4QO7A 1ZVVA 1LW6E 2W2VA 4TWRA 5GONF 2BELA 2HTEA 2YV3A 5FO1A 5B1DA 3U3JA 3DFKA 3GFGA 3KPWA 1L4MA 1N7JA 1ZU4A 2ZRHA 5FFMA 3FW1A 1T6BY 4YP7A 1CE8B 1RR6A 4IKEA 1VFPA 4OB8A 4D4IA 2IODA 5I7SA 4EJSA 4YHBA 2X0RA 3HU3A 4BX0A 4IILA 1XQ6A 3FYUA 3WLRA 1P62B 3GL9A 3ZW8A 3BIOA 4K6CA 4CN8A 3GT3A 3G5UA 2QUHA 1CUVA 2ZPUA 3GLFA 2GFIA 1JDTA 3Q7SA 2WIBA 2YXDA 2Z30A 4O1HA 3KXPA 3OZIA 1OT3A 4L3WA 2JFNA 4QZVA 1ZXLA 4CF3A 3DBRA 1I2ZA 2XVZA 3LQ2A 3QELA 3QFRA 2A5DA 1Z4PX 1PT7A 1S2DA 2WU3A 4IJWA 4MJXA 1B1CA 4Q4CA 2QORA 4HT3B 2X2OA 1PZGA 1PBNA 3H0EA 3LQQA 2FSIA 3T35A 3OPXA 1X7HA 4M0CA 4QOJA 3OT1A 1VLMA 3GMDA 1DAHA 1FBNA 5GAJA 3EISA 1AKRA 5AHOA 1TJ4A 1QLHA 4HK4A 5IN5A 1NBMD 5H5JA 1GM5A 3PYLA 1DTEA 4OTZA 4YUZA 5BQOA 2B4AA 2RBGA 1BHQ1 2CFIA 2ABWA 1OWNA 2HZBA 4YJ2B 2I91A 5EHIA 1XV5A 2JLXA 3FWHA 3IHLA 4C1BA 1A2QA 2PMDA 3GLVA 3JASB 4EGJA 1JF8A 4Q47A 2WTBA 3QU4A 3F4LA 3OIYA 4D41A 1UOQA 2JZOA 1DEHA 1KJ8A 2Q3HA 1Y1SA 2R1VB 1Q7TA 4MW9A 1VA4A 4K0KB 4L73A 3PRJA 2WI8A 3CZRA 1D7OA 2WTNA 2X0FA 4HAXA 3TEFA 4QELA 3ZE7A 4UNIA 3M82A 4L74A 1ISPA 4BXOA 2IV2X 4KXLA 2P9BA 1YRLA 2FRDC 5B58C 5AT1A 5FNVF 1P7YA 3COJA 3QHAA 3MJVA 4DR1B 3GLIA 2B4RO 2YV5A 4BVGA 4PS0A 1PQUA