1UKVY

Structure of rabgdp-dissociation inhibitor in complex with prenylated ypt1 gtpase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
204
structure length
197
Chain Sequence
SEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Secretory pathway GDP dissociation inhibitor
publication title Structure of Rab GDP-dissociation inhibitor in complex with prenylated YPT1 GTPase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 63
structure length 197
sequence length 204
ec nomenclature
pdb deposition date 2003-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ukvY00
1N5LA 4RD1A 3TIFA 1N6PA 2FWRA 1ESMA 3GLGA 3NVAA 1KSHA 1JEDA 1Q22A 1ZVQA 2OEPA 2RKOA 4BFXA 3DDCA 2E87A 2WWFA 3W8RA 1JALA 4DSUA 2F6RA 2X8AA 3TJZA 4P4SB 1TX4B 1G6HA 5A4JA 2IW3A 4TMWA 1CEEA 3IEUA 1U9IC 2YOGA 2ZJAA 2ZRAA 3KKNA 3NXSA 1II8B 1WA5A 1TQ2A 3I8SA 2IF0A 5DNYB 1DAKA 2WJVA 3EA5A 4OQNA 3V4FA 3P27A 3BAFA 4PHFA 4B48A 4C0SA 1JR3A 3CPEA 1G64A 5B2ZA 1W47A 2WTUA 3AF1A 1DAHA 2GXUA 2ZAMA 3QBVA 3RS4A 1E1QD 1E9DA 2QMEA 4BLSA 4AIIA 3G5UA 5EE5B 4WXPA 2ONJA 2I1VB 1ZNWA 4HUQB 2Q9BA 3FMIA 3Q3JB 4UXHA 2IA5A 3IIKA 3QPUA 4TT3D 4BLQA 5BYJA 1SVSA 3PENA 2IYTA 3G82C 1EFCA 3IEVA 4DT1B 4ITRC 3R8FA 4BFUA 2Q3MA 5F3WB 1GTVA 1FNMA 1LTQA 2V3CC 3PEYA 1AIPA 2YJTD 1AM4D 2Z0MA 1G5RA 2BCGY 4Z8XA 4Z1MD 2GESA 3CZQA 3W90A 3T15A 4M1KA 2KWIA 4KYUA 2BMDA 4GMDA 1SZPA 3TBKA 4OQFA 4JMPA 4QM7A 1UKYA 2OSBA 3QENA 1EFRD 5KDLA 2PCLA 3BERA 1RPZA 4CEIB 2GZAA 1L7VC 1NMYA 3CF6R 1NN5A 1NI3A 3BORA 1G18A 1HY3A 3AKEA 4KBGA 4P4SA 1NLZA 2IWRA 3L82B 4BFVA 1VCMA 3WMEA 4TYPA 2IYRA 4QJ3A 3B1WA 1CF4A 4UXJA 1II8A 2VIIA 1VYUA 5C4GB 1Q44A 1R6BX 1QG2A 4BZXA 2QPTA 3I32A 4IDPA 4D0GA 1RRCA 4BRWA 4NPHA 4BGDA 1LS6A 1Z22A 1ZYUA 1DAEA 2JLWA 2GXSA 2ZYUX 3KXLA 1WMSA 3Q5DA 1U81A 3MRSA 3WBJA 1PJRA 3GLFA 2Z43A 3TQFA 4RZXA 3IQXA 2PH1A 2WOOA 3A36A 3B9QA 2XNDA 1EFHA 1Z0DA 4GT1A 4HUQA 3CZPA 2GJSA 3UWKA 4GRAA 5FPSA 2Q0HA 4TN1A 3DZ8A 3QJYA 3BH0A 1UBFA 3IIJA 2W0MA 5JZVA 2YC2C 4DT1A 1A1VA 3FHTA 3HPQA 4TQ9A 2ZYVX 3HU3A 3QKSA 2MSEB 4W5WA 3EARA 2GEVA 4WZAE 1W5SA 3AV0B 2G9NA 1GG2A 4DWJA 1PLJA 4QBGB 1TF2A 1TQ4A 3K09C 2D3WA 4V0OA 1P7CA 5EUMA 5HCNA 3ZH9B 1N3BA 4NH0A 5FL3A 2DHRA 2C04A 2NOAA 5FUYA 1D9XA 3D8BA 4CDGA 3UMFA 2QEQA 3HJNA 4GP7A 2QG6A 2NPFA 1P9RA 2ANBA 1OH8A 4LYJA 5CYOA 2CLCX 1KI3A 4EPYA 2V8OA 1XU4A 3SEAA 5BWMA 1NVVQ 3BH6A 1MH1A 2PBRA 4CEIA 2CHGA 2AD5A 3M4YA 4GFDA 4NE2A 1OV4A 2QSZA 4IEEA 1S3SA 2F3TA 3EA0A 5E3HA 5JJIA 3SDZA 1XPRA 2CVHA 3WYGA 1GWNA 4DJTA 4IXMA 4D26A 2H5EA 5AK0A 4URWR 1S4QA 1JB1A 221PA 5E7IA 4TL7A 2R6CA 1E2FA 1MT0A 2FEOA 3FMFA 5AJYA 3PJRA 5DI9A 2JLUA 4KFSA 3EZ9A 3QXJA 3B5JA 2OXCA 4PO8A 1GKYA 2YVUA 2YZ2A 4EDHA 2RMKA 4LY6A 1W49A 3B2EA 4QGHA 1XZQA 1IY0A 5KU1A 2CLDX 3KUDA 5CK5A 1ZRHA 4IOJA 3AUYA 4LZZA 3SJBA 2V1UA 1GKIA 2ZYWX 2VHQA 4Q00A 5J47A 1KSFX 5ELXA 4DUGA 3I3SR 3QBTA 2IHBA 2CK3D 1ZD8A 3PEVA 3BRWD 4HLDA 2QI9C 5KYKA 2WPDD 3RS7A 2ECKA 4TMTA 2PZEA 5FR1A 4DC9A 2CLSA 2ZE8A 2ZRIA 5JJLA 4UXIA 4RKEA 2IX3A 1V5WA 1QHSA 3BOSA 5EJEA 4M9SA 1X8JA 4EQ6B 5E95A 3SHWA 2Q6TA 4LYHA 1R10A 5HR5A 4E07A 2C78A 4HB0A 1O87A 1RRGA 1SHKA 1NKSA 3A58B 4G5SA 4LYFA 2EW1A 2IYZA 2XZOA 3GLIE 2KE5A 2WSSA 1UFQA 2I4IA 5BN4A 1E4YA 3BH7A 1CR4A 4BASA 2J59A 1W2GA 3C16C 4JLNA 3OE7A 5KOYA 5FL7D 1G7SA 5IF9A 1C9KA 2FZLA 1AKYA 1KHTA 3CRRA 2BOVA 4YMTA 4PQFA 4ILEA 2WM9B 2IYLD 1KSGA 4Q21A 3JVVA 3Q85A 1LW7A 4X8MA 4Q9KA 1P61B 5BYKA 2WKPA 1AN0A 1P9NA 4PTLA 1Z8FA 1JJ7A 1MABA 2GK6A 3PITA 4TQUS 3LW8A 1G19A 4KV9A 3K53A 2CL7X 3AP1A 4YXWD 4OK5A 1XZPA 5SZJA 3SI7A 1RIFA 2JLQA 5KSYA 4NMMA 1W4BA 1CS4C 3FHCB 4HAUA 4PSAA 2WJHA 4HDOB 3CF2A 2J5XA 5L3RA 2RB4A 4I99A 3NIBA 3CF0A 3U61B 3THYB 2DFLA 1E99A 3W6NA 1E94E 4AYTA 4TL8A 2FDCA 4HAXA 1H65A 4LHYA 3O8CA 4YDHB 2F9LA 3QSYA 2OXRA 3EWSA 4LC0A 2RHMA 4I1UA 4Q9LA 2XSZD 1DVRA 4B75A 1T4GA 1KK0A 1W5TA 3PG5A 1IN8A 4FMCF 3T35A 5LD2B 4D0NA 1FW6A 5CLLA 5FUVA 2XXAA 3D6TB 1OH7A 4IFBA 1OIXA 4OI4A 5BXQC 1HEIA 4MRNA 3R7WB 2DPXA 4B32A 1W36D 5CB6A 1EX6A 1NNEA 3D7MA 3CX8A 2JDID 4AY2A 2OLJA 2ZJ2A 1T3HA 3RAPR 1XMSA 4D0LB 4ACBA 4PQRA 2ZRLA 2CCJA 1M74A 4DLTA 4JVSB 4WOPA 5SZHB 1M8PA 1YU9A 4OQLA 3GEHA 2GZDA 5G53C 5GJWC 4H1VA 4RCZA 2B21A 1OSNA 2RGAA 4LBWA 4LV5B 1VG1A 3TGPA 1NVXQ 2ZRNA 4BFTA 6Q21A 4C0QC 4XIGS 2DR3A 1ZM3A 4B44A 3KXIA 4Q7JB 1KDOA 4QC2A 2X2EA 3EW9A 3H1TA 2OAQ1 2HCJB 5UKDA 3NEYA 1X3SA 3U7GA 4GSYA 1X1RA 1N25A 1R0YA 4LV6A 2FJUA 3IBYA 2QL6A 4FCVA 1FNNA 1E96A 1U8AA 2QNRA 4LJYA 3T06B 3A1WA 3VR6A 5TXGA 4ZI2A 4LBYA 1SXJB 1XCGB 3THYA 2JASA 1FTNA 4QM6A 1BMFA 4QBIA 2AFHE 4F38A 3WHLA 4W5JA 4JLKA 3KXKA 3NBZC 3EIHA 5GJBA 2QGZA 4RSGA 4A82A 4A9AA 2ZR7A 2W2VA 2JJ2A 1SKYB 1XBTA 3K0SA 4B3BA 5DLQC 4AG6A 1RYFA 2ZSBA 3U60B 3DZDA 1OB5A 2CNWD 4HB3A 1YZQA 3I5YA 1G8PA 4D25A 1EXMA 1P2VA 2VF7A 2E9SA 3NHBA 4NCHA 2ZXUA 2GVDC 2X77A 4IDHA 3R7WA 4DHEA 4KO8A 4GZLA 3HR7A 4Q1BA 4TMKA 3WMFA 4E09A 5BN5A 5F9HA 4MKGA 5AUQA 1GM5A 1F48A 3I92A 1IN5A 4PHTA 3KQUA 3AVTA 4PQYA 4DLRA 4KVGA 2DWPA 2C03A 1OJLA 1UJ2A 1JECA 2KB0A 3EZFA 1KSJA 3TK1A 4V03A 1UBGA 3QG1A 4IW3B 1Y3AA 4B2PA 3TRFA 4BFWA 4DLWA 4NHOA 5CIQA 2RAPA 2O8CB 4NCJA 1T0JB 2JLYA 3B85A 3LQQA 5JJKA 1QZXA 4BECA 2FPKA 4M1SA 4DB2A 1E79D 1LNZA 1XCPA 3QQ5A 1NSTA 3GD7A 1NVWQ 1NJGA 3PIRA 2FFHA 2FSGA 2GJ9A 1PVOA 3ZVNA 3W3ZB 5DO9A 1B0UA 3A1VA 1E2PA 2I3BA 1COWD 3ECCA 1NSFA 2Q21A 1SXJA 5FBQB 2XZPA 4RFSB 5HE9A 3EASA 4X8LA 1XF9A 4B3XA 1IQPA 1E9FA 1GNRA 4L5BA 4ZIRA 2GKSA 3PEUA 1F2TB 2EU8A 3FKSA 3X1DA 4EPWA 1LF5A 4FMCB 1QRAA 4MYTA 1UAAA 4A2WA 4URUR 1R0WA 1BOFA 1E0JA 4HAZA 1QHHB 4JT4A 5FPYA 4L8GA 2FMXA 5C18A 1YZUA 2WWWA 2VYFA 2YYZA 4U02A 1NMXA 3EC2A 1G5TA 1P73A 4B3FX 5C46F 1S9DA 2J7PA 2NG1A 1FPMA 3J81k 3D31A 4JLDA 4JS0A 4JLJA 3LNCA 2W6JD 1ZD1A 2C9YA 2D2FA 2FPMA 3QVUA 2AWOA 3I62A 4A15A 2IC5A 1G16A 3LBNA 4FINA 4EJSB 4DIEA 1XD8A 2YHSA 2QMHA 2RH5A 5G40A 3C5HA 1XX6A 3KB2A 5JRJA 3CH4B 3C41J 3DVLA 4D4KA 5FTMA 3FTQA 2EQBA 1T6NA 1VCNA 1N5JA 2AR7A 3KJGA 3AH8A 4G0NA 3CRVA 3SU8A 1UEJA 1G20E 1U94A 2ZS9A 1D2NA 2H18A 2YWFA 1EX7A 1D9ZA 2JLSA 1R5OA 3AB3A 2OCYC 5KNCA 1H8ED 1QHIA 3TSZA 2GAOA 1GZSA 3UG6A 3EG5A 4BEBA 3ZZTA 1MV5A 2WKQA 4RFSA 1Q1QA 1Z0JA 2REXB 4OHWA 2W6IA 3U7HB 4YONB 2RGCA 1MRNA 2XOKA 2GJAA 3CR8A 3U44B 1W0KD 2Q9CA 3A1UA 2ZETA 1TU4A 1VHTA 3ASZA 1FUUA 1SVMA 4R98A 3C8UA 1QHHA 1AS2A 3QEOA 4XVRA 5JWRA 1G6OA 3A4MA 3AUXA 5DN6A 2FN4A 3EIQA 4MQBA 4Q4AA 4CT4B 1KJZA 2ORIA 3R20A 4PC2A 1UDXA 1HQCA 4N0EA 2ZR0A 4Q4JB 3C15C 3AKYA 1GAJA 3TQCA 3SNHA 4PZYA 4CGZA 4NKRA 4Q9IA 5AUNB 4JZKA 4CEHB 4EJSA 5J4VA 4K46A 1KOFA 4UJ5A 5JEDA 3AF3A 3CX6A 1R8SA 2ZJ5A 1GRQA 2N46A 4IXNA 4US1R 4IVRA 1P2UA 3OAAA 2OFOA 1TEVA 3TSOA 4P4UA 3NBXX 3RS2A 3W6PA 1XMIA 5K8LA 1E1RA 4YQFA 2EFHB 1JAHA 4LK2A 3TUZC 4TYWA 5AJZA 3VR2A 4JKIA 2YV5A 2VRWA 3TSWA 4O2RA 1DG3A 1GNQA 3ZYCA 1CBUA 1OLOA 1N0WA 1KDTA 1NY6A 1NG1A 3FE2A 3TW4A 1R0XA 4Q1EA 3WP1B 2G1KA 4QJ5A 1XXHE 3B6EA 2CVFA 5D3MA 2ZSFA 1L2TA 5FBVB 2A9KA 2JEOA 1OT3A 2RGGA 2WHXA 3SJZA 2HT1A 3EPKA 3E2IA 4AKIA 1SKQA 2KI5A 3U44A 1OYWA 3Q5EA 4LJ4A 5G41A 4F4IA 3GJ3A 1CR0A 2OILA 4NP6A 3QKRB 3PUYA 3TKLA 1NVVR 4RZ2A 3U2QA 3UPUA 3ZDQA 2JATA 4P32A 5FBLB 1XD2B 1JXOA 2PEYA 3KJEA 4GOKA 3K1JA 4F4CA 4NZYA 3QIAA 4II7A 3X1YA 4P31A 2JIZA 4HAWA 1WBBA 1BYIA 4Q1AA 1E9EA 4JT2A 4O3MA 2HLDD 3RABA 2CHQA 4TYNA 3K0AB 3SR0A 3GJ7A 1YHNA 1EWRA 1VIYA 4LCBA 4GPTA 5M04A 4JSYA 5FPKA 3OEHD 1G8HA 4LJAA 2OBMA 3EZ7A 5EUQB 2DB3A 1FQJA 2ZM5A 1DAGA 2WVJA 1FQKA 4NCKA 1MKYA 4BLOA 1N0VC 3PFIA 1SULA 1C1YA 3GEEA 5BW8A 1DS6A 3AKCA 1HV8A 1G7TA 3CO5A 4URYR 4ZO4A 2ZITA 4DLSA 2JJ1A 4Q1CA 3U6KA 2VHCA 1CLUA 4JL5A 1IN4A 5TB5A 3QXHA 3NBFA 1KJWA 1Z29A 1AQUA 1N6RA 2QTHA 4OJKA 3IBGA 1W48A 3IDQA 3L0IB 1NN1A 5DHAA 1OFTA 2O8DA 4M4SA 4OQMA 4OYHA 4UNPA 2C77A 4G5RA 5FTLA 2YKGA 4TLBA 3VNVA 1XTRA 1N2CE 2WBLC 2C2HA 3L0OA 2J0UB 2A3RA 3QVVA 3QKRA 5CDFA 4LJ8A 4ZKDA 3VR4A 3LW7A 1TF5A 1A82A 3VHXA 3KZ1E 1XB2A 3OFND 1ZJ6A 4IOKA 4MUBA 3S1AB 4A0FA 1XD2A 5G3YA 2BWJA 3AVQA 1UPTA 3HYTA 4RY2A 5IK2A 3BWDD 3RS3A 4W9MC 2IS6A 2XZLA 3B1XA 4TTQA 4PAMA 3BBPA 1OFIA 4M21A 4R2HA 3GLHE 3LBHA 1U0JA 2WIAA 2ZS8A 5JECA 2QAJA 1W1WA 3HP1A 2OFXA 1ZBDA 3PCRB 1YJ5A 5FBRB 1II0A 4C4PA 2ZS7A 1N6KA 3KX2A 1OKKD 3OIVA 4RD3A 2IEYA 2MMGA 2PT7A 3LAWA 5DYGA 4DCUA 1EFRA 2PL3A 1LVGA 2BJWA 3QI2A 2F1RA 1O3YA 4Q9HA 1BS1A 1Q21A 1U98A 2VH5R 4TMXA 4MUAA 1CKEA 1ZU5A 3CUEF 3T1TA 3R9XA 2NZ8A 4JLMA 1QHXA 1YZGA 1VG8A 1D2MA 2W2XA 3WRXC 4S35A 3X1XA 4D82A 5KSZA 3T12A 4BLRA 5LB4A 5FOTA 4BPBA 3WYFA 4A8JA 1ZM7A 1VYVA 4IEIA 3RYTC 4WVFA 4NCNA 1ZIOA 2GWHA 3FB4A 4OHVA 5A0FA 3GLGE 1KI2A 2VHUA 1E2GA 3E70C 4B73A 1HT2E 4OBEA 3WRYC 2J0UA 2XITA 2IS2A 1JBKA 5AUPB 4UKDA 2QN6A 3S1AA 4BRUA 2ZJOA 1KI4A 1OHHA 1FL9A 1KI9A 1P6XA 2V6JA 5AJWA 4UJ3A 2AD1A 2PX3A 2ZI6A 5LPNA 3GFTA 5FOWA 4HZUB 1BIFA 2ZRFA 3P20A 4JKYA 3MMPA 1N0UA 3CWQA 3NDPA 4MGZR 4US2R 4FI3C 1H8HD 3W34A 3FFBA 1ZMXA 4J0QA 1LF0A 1OH6A 1G3MA 4M1MA 1Z0FA 3QKTA 2KJQA 4ZDWA 3ZD7A 2IXGA 5JI2E 4KBFA 2IWHA 1Z83A 4C7OB 5JS7A 2QA5A 4XWOA 1GL6A 1YR6A 3TAUA 3FPAA 2ZQ5A 1KIMA 3V00A 2P5SA 1GSIA 2HV8A 1SHZA 2J9RA 1ZNYA 3PUWA 3MJHA 3BGWA 1P9WA 4OK6A 1VG9B 1RC8A 4DLXA 1IJEA 4TSFD 2F7SA 2QZ4A 4IVQA 1TEXA 4NBSA 4U7DA 1S8FA 2BBSA 4GP6A 4RFVA 3TUIC 3VFDA 2OT3B 5TARA 2R6DA 2OLKA 1GOTA 3V4RA 3FFAA 1TTTA 4YLGA 4KSCA 2LKCA 1G3IA 1KAGA 4DRZA 1E2NA 5L3VA 2CEAA 2J45A 4XH9B 3U4QB 2QPOA 3X2SA 2QQ0A 2FX3A 3VU9B 1Q1ZA 2OESA 5FPTA 5ANRB 3T5DA 1M2OB 3LDAA 1I4TD 3ND9A 5CITA 2WSMA 4JL8A 3VR3A 1MO6A 2IK8A 1RFLA 2BM1A 3EPHA 1HA3A 1MOZA 2ODWA 1OF1A 3TLXA 1S3GA 3G0HA 5JSZB 2J0VA 3HYRA 5AWFC 1E0KA 4ZCLA 4LHVA 4V0ME 5H1YA 3O8RA 2Q3FA 1A4RA 1E69A 2JJ8A 4EFLA 1XD9A 4MRVA 2Z83A 2ZJ8A 3UATA 2WV9A 3LXXA 3GLIB 2ZUCA 2ZE6A 3A1SA 3I73A 3LRPA 1ZNXA 1U8ZA 3HU1A 4FIDA 3H4MA 4HUTA 2J0SA 2ZE5A 3ETLA 1MO5A 2VF8A 3DM9B 4C7OA 2ORVA 1E2DA 1IONA 421PA 721PA 4A4DA 3CBQA 3GPLA 4AI6A 3GLFE 4HLCA 4KITB 3FWYA 3K09A 1S9HA 4LI0A 1XTKA 521PA 1E9CA 4K81B 4DCVA 2IYVA 1RE0A 1IAQA 3E5HA 2FEMA 3GJ5A 4UNQA 4ZPXA 1W36B 2D4HA 5FL7A 1KDPA 1KKMA 1P5ZB 2WAYA 4QKQA 4U00A 2P65A 5EZ6B 4PPFA 4MKHA 3MD0A 1WRBA 1OFHA 3LX8A 1DE0A 1X8KA 4G01B 5SZKB 5EE9A 1E2IA 2A5FA 2R65A 2QPAA 1HQYE 4C3ZA 1PLLA 1U90A 5GVRA 3AF0A 2BMFA 1Z2AA 4FWTA 2BJVA 1R2QA 2JGNA 4NYJR 1G8GA 2R8RA 4KXFB 2YOHA 1ZUIA 5JCPA 821PA 4OL0A 4L9SA 5KDDA 2GA8A 4B35A 4E03A 2IS1A 1E2MA 3QXSA 4YXWA 1KI6B 2WMNB 3LA6A 4I81A 2ZJZA 4EAQA 4XWAA 2VO1A 3KQHA 3A37A 1KNXA 3MGCA 4DLZA 1LS1A 4V0LA 2UZIR 4HLUA 1A5TA 2ZRKA 1LB1B 2HUPA 4OHXA 4HB4A 2QORA 3GLIA 4MYUA 4W7SA 4B43A 2FG5A 1DARA 3DHWC 1Q0UA 2P6RA 1E2QA 1M6NA 1P72A 3A1TA 4DZZA 3WP0A 2HCBA 3B7GA 4WZ6A 3AF2A 4ZDIA 3THXB 4PO1A 1NVUQ 1NN3A 2D2EA 2HXYA 5GJVC 1UEIA 2XJ4A 3BJIC 1W2HA 2VP6A 5C1BA 4QGFA 2HDNB 3W3AA 2VSFA 2VA8A 3WNDA 3I1FA 2BHRA 2JDIA 5DHFA 3U6BA 2NIPA 5AR1A 5J4HA 1Z6XA 3AVWA 2A5JA 3VMFA 4OHYA 4FMBB 4M1TA 2ANCA 3L43A 3PQCA 5LB2A 2B92A 1FP6A 1NKTA 3DL0A 3BS4A 5J4LA 1P75A 4Z8YA 1QVAA 2O52A 5FTNA 2ORWA 1KY3A 1Z63A 1DBSA 4M2LA 3K9LA 3U3MA 1KI6A 4Q5IA 1F60A 1JAIA 1XJQA 4TLDA 2QE7A 2YOFA 2QGNA 1ZC3A 3TW8B 2C96A 2ZRHA 1WBDA 2WWYA 2BMEA 3EZ2A 3RSOA 3KDSE 2XB2A 5DIFA 4AYXA 2GNOA 4FWIB 2GDJA 1RVDA 5TMPA 1AJEA 4EQ6A 1TQ6A 1GNPA 4LC1A 3CPHA 2EFEB 2ZRCA 1WP9A 4WZBE 4QBHA 3Q8XB 4DUGD 1TL7C 3GCGA 5JI3E 1TAGA 3IO3A 1GL9B 2BEKA 2FGKA 4TL9A 3I5XA 4RJLA 2UZ3A 1P3JA 1Z07A 5FOXA 1Q12A 3THXA 1A2BA 3WNCA 2QU8A 3N70A 4F93B 2NO1A 1WB9A 3MLEA 3MWYW 1GKUB 4NL4H 4QG7A 4R71A 2X1VA 4GMXA 3P4YA 1J8MF 4C0LA 1T9HA 1FFHA 4I4LA 3N5CA 2F55A 2VSXA 4QHTA 3HDTA 1F5NA 2WSSD 1GUAA 3AGPA 1T5LA 3NTUA 4QNMA 3RRYA 4LWZA 2PLFA 4GL2A 2E1RA 2O8BB 2REOA 2Q3HA 4DDUA 3OE7D 4MGIR 4F91B 3H84A 2QUZA 1WF3A 2WIBA 1VECA 4PPNA 4A6PA 1Q57A 1E98A 3IHLA 1XMJA 3OEED 4CT5A 2IUTA 5BQ5A 5FPHA 3ZQJA 3M0EA 2G0TA 3NH6A 1LV7A 4MRPA 4RD0A 2VHJA 1IJFA 2F1HA 1E79A 4M0LA 4DDTA 1NBME 4HB2A 1Q3TA 4WXRA 5JS8A 1WE2A 1L4UA 1LFDB 1Z0IA 4LYAA 2AKAB 4AKEA 1ESNA 1JPNA 2ZPTX 3RANA 4O2LA 2IYWA 1COWA 1S0UA 4B47A 3FHOA 4M1WA 2QAGB 2YWGA 3FMOB 3U3JA 2V4ZA 2JAQA 4DXAA 4H1UA 4CIDA 2GF9A 4PPQA 5P21A 3U5ZB 3F5FA 4K8OA 4M1YA 5SZIA 1RJ9B 2XAUA 1E2KA 3PXGA 3ZZ0A 4DKXA 1ZM4A 4BQSA 5KSOA 1VG0B 1TU3A 2H57A 4GOXA 5DH9A 3RWMB 1G8FA 3RVBA 1AQYA 2ZRBA 4CVNA 3RSLA 2QSYA 4JLVA 2CXXA 3CNOA 3DO6A 4DEXA 1XEXB 4L15A 3ZJYA 1VCIA 4CRWB 3Q7QA 1MR3F 2ASEA 2N42A 5KSPA 5D3QA 2P6NA 5TY0A 3TH5A 3L0SA 3NC1C 2VP9A 2B8WA 1NBMD 2O8BA 2R2AA 5DISB 4ASUD 2HJGA 4JJKA 5IRCD 2RGBA 2O8FB 5DE3A 3AP3A 2HXSA 2R62A 4KFUA 3RS5A 1TF7A 5G3ZA 4XVQA 3AM1A 2OCPA 1M7GA 1YQTA 4NDZA 4YMWA 2BDTA 1VIAA 1Q1BA 1E4VA 2GETA 2OCAA 2QROA 4EIWA 4CZ2A 4F7WA 1W44A 4UQOA 1FOEB 1DAFA 4ESVA 3REGA 3B1YA 1FTSA 2GBLA 2QAGA 2PJRA 2QMOA 1OXUA 3ADDA 2EWVA 4Q9JA 2CL0X 5J40A 1AK2A 1OIWA 1VPLA 3WY9A 2XTMA 4MDEA 3CH5A 2VPPA 5KDOA 3TMKA 1SXJC 4M9QA 1HT1E 3HPRA 4A1FA 1KMHB 4BZPA 1KZ7B 1RJ9A 1FMLA 2W00A 2ZE7A 4NYJQ 4C2TA 3R9WA 4EPXA 2P5TB 2A7QA 4M9ZA 2B7CA 1CIPA 1QVRA 3IIMA 4AC9A 2RGNA 2H7VA 2OHFA 1K8RA 1BMFD 4YMUA 1RKBA 5EXPA 3K0CA 1T5IA 5J5CA 2GCNA 1GP2A 4LUCA 2ZANA 3ICEA 5HCIA 4DCNA 1XEXA 3DMDA 3CW2A 4IKEA 2BM0A 1EFUA 4KCGA 4M9XA 1Z0KA 4BLTA 3QPWA 3T1QA 2QT0A 1IOZA 3F3YA 2C95A 1MO3A 1ETUA 4Q48A 4LX0A 4EPVA 2WWGA 3DMNA 2O8CA 4JBXA 4DSNA 1N6IA 2W0SA 4Q47A 2R6GA 2P6UA 1OYYA 1IN6A 2WJYA 2HJVA 3QEJA 4TYQA 1T3SA 1KY2A 1XXHB 2OAP1 4G5QA 1US8B 4BFYA 4OK3A 3K70B 5KNBA 2GCOB 4DIDA 3C5CA 4MKIA 3FMPB 2GEUA 2G77B 1E2HA 4FCWA 4GOJA 4P0TA 5FOSA 5DYIA 4Q4LA 1OFUX 3RS0A 2IXFA 3K9NA 4C0KA 2BKEA 4P33A 2XX3A 4H9GA 1W0JA 1U8YA 3CIOA 3ZVMA 2C9CA 4A0RA 4M8NE 1CP2A 2V55B 1J7KA 2ODEA 1XEWY 3ZD6A 1F2TA 1E6CA 1KMHA 1NY5A 1SGWA 1UKZA 3GJ8A 4Q7LA 2ZEJA 4DDVA 3KL4A 4B76A 4TQAA 2EWWA 2KBEA 4XSGA 1SXJD 2LWIA 1Z28A 3Q9LA 3VKWA 4CEJB 2OUKA 1JPJA 2Z5FA 4PSKA 4AWXA 1OPXA 3IPYA 4V02A 4URVR 1E9BA 1QDEA 2F1JA 2OO7A 2JLZA 4CW7A 3O8DA 3KFVA 3QY0A 4ARZB 1KAOA 1CR1A 2IYSA 1Q20A 4L9WA 5CB8A 4XTCS 4V0KA 2R6FA 1MRSA 3KKPA 1T91A 4QHSA 1A2KC 4HZIA 3ND8A 5JBQA 1R0ZA 3HR8A 2J7PD 5DGXA 4EJSC 1KDRA 3TUJC 1OXXK 4PAQA 5TV2A 3AVOA 5F98A 2CDNA 3EPJA 1EK0A 2AL7A 2G0NA 2JCSA 1D2EA 2ERYA 1N5IA 2IUSA 4IDNA 5FFMA 4B3GA 5K8TA 1XXHA 3LH5A 3UANA 2XEXA 4JSTA 4G5OA 2GCOA 3ASYA 1XTIA 1XJCA 1IXSB 3THOA 1M7BA 1XEWX 4Q66C 2YWEA 3TVTA 1EFTA 3QXCA 3ICQB 5F9FA 2IS4A 2H17A 2Z6VA 3BFXA 3EWAA 2ERXA 3O47A 3Q72A 5HTKA 1GVNB 2R44A 2ZR9A 1GFIA 4Q03A 4ESHA 1HE1C 1ZCAA 5EZ5A 1T0HB 2I1QA 2HYDA 4XD7A 1F6BA 3KFXA 4DBLC 4KU4A 4G1UC 1DPFA 4O0MA 4Q19A 2ZTSA 1NRJB 3CWZA 3FOZA 3OF5A 3GLHB 4PHGA 2ZI9A 1WCV1 3OFNA 1IXRC 3SBEA 2FU5C 5B57C 4CEJA 4HAVA 4HDCA 2KSQA 4TZ0A 1N6LA 3BXZA 1P2TA 1FX0B 1OW3B 1XTSA 2W6ID 2XOKD 3A4NA 1BKDR 3FVQA 3I8XA 2K5UA 3T34A 4Q4JA 3B13B 4PC3A 3BB1A 4I1OA 3QE0A 4ARZA 4FCTA 3LWNA 1S2MA 1F3OA 2H16A 2ODNA 4CEHA 4Q4HB 2BCJQ 5H70A 5DN6D 4D4JA 3PUXA 2RCNA 2HT6A 4AKHA 4LBZA 3SZRA 2BMJA 1P60A 1DAMA 3R9IA 4C0JA 5IT5A 4JLPA 5H8WA 1JEEA 4RD4A 1OKKA 4JJZA 3LY5A 1TUEA 4KVAA 3EXAA 2YINC 1ZINA 2GHIA 4IRUB 2GILA 2GK7A 4DCTA 1G4AE 3ZS8A 4Q1DA 2LKDA 1PV4A 2IEZA 1L8QA 3H86A 1KJYA 4B6EA 3GLGB 1W4CA 2EVWX 3A4LA 4R7ZA 4P3YA 3RC3A 3IQWA 2DBYA 2RGXA 4FXPA 1E1RD 2AK2A 2FE4A 1W4AA 4KODA 2VL7A 4QGGA 3KQLA 1U2RA 2RHDA 1KO1A 3IHWA 1QHYA 3DEFA 3JVUA 4B71A 2A5YB 2CBZA 2D06A 4IVPA 3MUFA 1E1QA 3FKQA 2C9OA 3P26A 2J0QA 4QL3A 4IHQA 2CCGA 5EE1A 3W6OA 4DSOA 5JFGA 2G1JA 5TVKA 2QTVB 2BV3A 4DCSA 1GILA 4TT3A 1RZ3A 1IN7A 4OI2A 4NYMR 2Z4SA 4TYYA 1FX0A 5BN3A 4GI7A 3MCAA 4JLBA 1NL3A 3LLUA 2GJ8A 4MGKR 2AKYA 3K0AA 3WXMA 1V43A 2IBMA 2PZGA 3EAQA 1R7RA 5KHOC 4DB4A 5FOVA 3TE6A 2OBNA 1G21E 2O0KA 4Q4HA 4Z1MA 4DVGA 3H2YA 4R9UC 4KYIB 1E2JA 2G3YA 3NKVA 1E9RA 1S96A 2JIZD 2PLRA 3I4LA 4FN5A 3BC1A 4RD2A 1E0SA 1W4RA 2DWQA 4JBYA 4TMZA 2QY9A 3A8TA 2BVNA 3K9HA 1LY1A 1FMJA 3FYHA 3GJ6A 1Z6TA 3GP8A 3TAHA 3WBKA 2AK3A 2JLXA 4YMVA 4GBMA 4BLPA 4IFEA 3AEZA 5JWHA 3UK6A 2D7CA 3IUYA 2D7DA 3OHMA 2PX0A 3AVVA 1AKEA 2IYXA 1Z47A 3DPUA 3SYNA 4A2QA 2R6AA 1U9IA 2FH5B 4LJ5A 2QM7A 2O0HA 4PC7A 1M7HA 2V7QD 2ZREA 3BE4A 5DSZA 3SBDA 4NTZA 1GDDA 3ZLJA 1SVKA 1NIJA 4KAXA 4LSGA 4MDFA 2MSCB 2RGEA 4GZMA 2AHOA 3LD9A 4A8JC 4RVCA 4TMVA 5HKKD 3CONA 2JJ1D 5E4FA 2NMVA 3NEJA 4JL6A 4HYYA 3AGQA 5DI3B 3D3QA 4RKFA 1NN0A 2G6BA 2C98A 4Z54A 2HYIC 3W5JA 2HF8A 3LBIA 2PZFA 3MJRA 4LHXA 4GDFA 1VMAA 1G3UA 2YNMA 1CTQA 3LO5A 2XGJA 2DCUA 5B30A 3GLFB 1JR3E 4R2IA 4PR0A 3H0KA 1E32A 3CLVA 3GQBA 3ZIAD 1NIPA 2ZSAA 3AVXA 1IM2A 2GTPA 3VR1A 1R4AA 5IK2D 4AKGA 1II9A 1QBKC 3WMGA 1VKJA 1IY2A 4PO9A 4D4MA 2WWXA 1JXMA 3LLMA 2JA1A 2QENA 4URXR 2O5VA 3K8YA 1KK1A 1RRFA 2GAAA 3QKSB 5JMTA 2EYUA 4JBWA 1DTSA 5L8VA 2XTZA 4B3CA 2ZIAA 4QFMA 3VQTA 3F0TA 1NG9A 3M1IA 4KFRA 1AZTA 3BB4A 2GJKA 3K0EA 2ZRDA 4D80A 4C0AC 3B60A 4D4LA 1ZD9A 2H92A 1Z6AA 2VP0A 4HAYA 5HE8A 3VX4A 1ZUHA 5CIWA 3KKOA 3T1VA 5CK4A 1U0HC 4DEYA 2WJIA 1VTKA 1X86B 1XEFA 5FTJA 4L4UA 1Z08A 2A30A 4V0NA 4V0MA 2QP4A 4A0HA 2BIFA 1JR3D 5DI3A 4YMSA 1N6NA 2QM8A 1G1MA 4EFMA 2EFGA 2CK3A 2WJJA 2V1XA 3I61A 2NPIA 2C8VA 4HZUA 2WPDA 4TTPA 4BEJA 1BYUA 3IPXA 2GXQA 1RYHA 2WMOB 3C4JA 4A92A 3B78A 1AGPA 3RWOA 1WXQA 3O8BA 3KKQA 1UM8A 3VX3A 1PLKA 1HE8B 2ZI4A 2VTKA 3DOEA 2GF0A 1YZKA 2ZJYA 3OZXA 2FNAA 4ACAA 2FFBA 1TUIA 2ZI5A 1OHHD 4HDQB 4M53A 1R5BA 1S1MA 5B64A 3SHFA 2A2ZA 4CYMA 2FSHA 3QNUA 1G17A 1G41A 1E9AA 2WKRA 8OHMA 4ZKEA 2CJWB 1ZUNB 1DEKA 5AJVB 1CRQA 1TNDA 3CPJB 3X1WA 4AG5A 3PUVA 2WAXA 2J7KA 2ODBA 3N2EA 4RCYA 2FGJA 1YRBA 1F2UB 1AS3A 5L3SB 2N1BA 4N3NA 1T3LA 1DAIA 2GZHA 121PA 3LQRA 4B74A 5EP1A 4Q01A 1J8YF 4LDJA 2EFCB 1ZCBA 3CRW1 1Z2CA 2CL6X 3RRZA 4B2IA 4DLVA 4LJ7A 1XPUA 2NO9A 2PT5A 1M1YE 2WWHA 5KPJA 1J2JA 2IT1A 5KPDA 1DELA 5F2EA 3IKJA 3W9YA 4KSBA 4ZDKA 4XWKA 3U4QA 4CF7A 5JLJA 2J1LA 2ZI3A 3AVYA 2X19A 3KJIA 3EX7C 3QPVA 3VU9A 1E0AA 1KZGB 2OG2A 4JYCA 5CLQA 2R9VA 2A5GA 3UWOA 2UKDA 3SQXA 2AX4A 2F9MA 2ZRGA 4OI1A 3LXRA 2NO0A 3LVRE 4MITA 2PJZA 4QNRA 3L2OB 5JSZA 2AFIE 4B34A 1PUIA 1ONBA 3P1JA 2D62A 5L3QB 5KUTA 1S1CA 3AP2A 2QRZA 1MABB 4ZI3A 1E9SA 2KBFA 2XNDD 4DLYA 4BZQA 3SFVA 3EC1A 2VLIA 4HLUC 2OBLA 3WYAA 4NCIA 1D8TA 1DO0A 2Q9AA 3GFPA 2XSZA 2GCPA 4O25A 4IJMA 5CJPA 1EGAA 3OESA 3TR0A 1NP6A 4XVUA 2CJWA 2PEZA 4L16A 2CE7A 1XTQA 5HPYB 4NYMQ 4LPSA 1FZQA 4A6XA 3R8CA 5L3SA 1F2UA 2ZRJA 4W5HA 3L8YA 2H1LA 4OKSA 3UMSA 1CJKC 4DDWA 4HSEA 3KQNA 2NGRA 1IXZA 1OXSC 2O0JA 4OJQA 1W36C 1T8TA 4F92B 3JZMA 1KO4A 1VYTA 4KLZA 2XXAB 1YR8A 1AS0A 4XSHA 3GEIA 1TMKA 1UKEA 4PZLA 4NYIR 1KYIA 3MWLA 4EFNA 3OEEA 1J99A 3W5IA 4JLAA 1BH2A 2MMCA 4E5UA 4I1SA 5HZHA 2P0EA 2OCBA 2BBWA 1KK2A 3QOFA 1A7JA 4C30A 5AUOB 4KHZA 5JWOA 5L3QA 1KKLA 3JZAA 2C99A 3N2IA 3QXXA 5EQTA 4TLEA 3C7KA 4TZ6A 4UNSA 3TVDA 1XJ0A 2Y8EA 4MGYR 2F43B 3WHKA 1ZP6A 1HTWA 4BUJA 2ZYTX 2YC4C 3TR5A 3DKVA 5JHHB 2P2LA 5A5GA 1NJFA 4LBVA 4QRHA 2GRJA 3MFYA 1SVIA 2VHTA 3AVPA 2CNWA 3X1ZA 2XB4A 4PC1A 4RZUA 3WNBA 3IILA 621PA 2D74A 2ZU6A 1TQDA 4AK9A 4GNKA 3IGFA 1I4DD 1Z3IX 3DKPA 3VR5A 1IHUA 1Q3HA 2IUUA 1YR7A 4HEJA 4PAOA 1ODFA 3LV8A 4YC7A 5GADl 4US0R 2FSFA 2ZVQX 4LHZA 5CM9C 5FH9A 2J41A 2FFQA 1G8YA 2J46A 5AJXA 2BBTA 1UBCA 1JR6A 1XDBA 5TDHA 2FZ4A 5C4MA 1DO2A 4OQXA 4B6FA 4AYWA 4F4JA 1NBMA 4Q7MB 1BO6A 1K6MA 1XRJA 1CJTC 1NF3A 1SQ5A 3QUSA 3RRMA 4ASUA 1Z6YA 4B33A 2ONKA 4EPTA 4Y0VA 3VKGA 4BE7B 3UMRA 2REBA 4MH0R 4ZV4A 3GJ0A 4WW0A 3MWKA 1IBRA 3ZVRA 5LBIA 2IYYA 1WDTA 3SS8A 2BC9A 1VCOA 2IXEA 3CKLA 3CNNA 4I1VA 2V9PA 4YDSA 2J3EA 5EP4A 3OIWA 1JNYA 4PXAA 4D6PA 1M34E 2X2FA 2VP2A 4B3DA 1OE0A 1VDZA 5FOUA 3ZVLA 4M22A 4PFSA 3KJHA 2F43A 4ON9A 3AQ4A 3CR7A 2DY1A 3PR1A 2WJGA 2QE7D 2OM2A 3KQKA 1XPOA 2NO7A 2ATVA 1KMQA 5FI1B 3SJCA 1Y63A 2ZAOA 1TADA 4EPRA 3OIYA 2O8EB 3HU2A 1HURA 1ZU4A 3U7EB 4C0HA 5E7MA 1FUKA 1P4SA 2DFTA 3QF7A 2WOJA 4JVLA 1X1SA 5LD2C 5IDVA 3B1ZA 4NU0A 2NTYC 1Z0AA 2ZI7A 1KNQA 4ZIRB 2ZRMA 3I72A 3PVSA 3BFKA 4TWZA 3Q7PA 5KNDA 4ERNA 1OB2A 4MRSA 4Q1FA 2RGDA 4X8OA 2W6JA 1K5GA 4KFTA 1UBEA 4P4TA 3UG7A 1KI1A 2EYQA 1OH5A 2AXPA 2FFAA 1P62B 4JVNA 5HZKA 1Z6GA 4PX9A 1N5KA 2OFWA 1Z5ZA 4QHYA 1UDWA 2ZUDA 3GMTA 4HLQB 3RLFA 3W8NA 1GL7A 2ZUBA 1YVDA 5K8IA 3NC0C 4PZZA 2NZJA 2P3SA 1KGDA 4JIMA 3EIEA 4A36A 1YR9A 5FUXA 3ONWA 2NQ2C 3UIEA 5FTKA 3LX5A 4IDOA 1XTJA 4U5XA 3HWSA 1H8EA 1RW4A 2FOLA 3T1OA 1G9XA 4D2IA 2CMKA 1U99A 3IO5A 3PV0A 3L0PA 3MAAC 4S2EA 5K8UA 3NWJA 4LJ6A 4XOIA 2GBLC 2QAGC 3SN6A 1W0KA 1NLYA 2IHYA 1R8QA 3QF4B 5J4YA 4OI0A 1G7CA 4IOLA 4LHWA 4N0DA 2O8EA 3GFOA 3MSXA 1TPZA 3GJ4A 1ZNZA 4LGMA 3FDIA 4URZR 4HI0E 1E2LA 5J4KA 1KI7A 4PHHA 1RRPA 1U0LA 4AD8A 2B6HA 4MYCA 3VAAA 1E3MA 1G3QA 3RRNA 3OIUA 4BFSA 3T61A 2RGNC 2F3RA 4XTRA 1OXVA 2JLVA 2JJ2D 3CX7A 5KO2A 1CXZA 3K0CC 1SXJE 1AA9A 1FP7A 5EP2A 5CJ2A 2G83A 2HEIA 3M6AA 4ZCMA 1X8LA 4UNRA 2L0XA 1XNJA 4Q4AB 3RHFA 3BFVA 3SC3A 1SKYE 2DFKB 2O8FA 4PC6A 4B2LA 3SFZA 5FUWA 3RNLA 4D81A 4ABYA 3U3KA 3B1VA 2FSIA 1UADA 3CB4A 1J90A 3NBYC 3ADKA 2EFDB 3E1SA 1JI0A 1CJUC 2SHKA 2F1IA 3C14C 3BK7A 2FV8A 3K9GA 3KKMA 1XCMA 1QHGA 2A5DA 3AF4A 1G4UR 2B8TA 2ZJBA 4QBFA 3VKHA 5JEEA 1CJVC 1DOAA 1W46A 4WAUA 1XMVA 5JRZA 2FA9A 4LPKA 1CR2A 2BBOA 2HF9A 1YZNA 3SJAA 4JVMA 1E2EA 3AKDA 4NYIQ 1GRNA 3QF4A 1YKSA 2IL1A 3CNLA 5EXXA 3B82A 4FD2A 1OXTA 1EWQA 3CRQA 5CM8B 2W83A 4E22A 2BEJA 5D3MB 2V6IA 3ADBA 4JYBA 1IY1A 1KI8A 3K0FB 3FKSD 2IYQA 2Z4RA 2VSOA 3PUZA 2GXAA 1UF9A 5GJCA 2HLDA 2QT1A 4LRWA 4AURA 3VNUA 3UKDA 1JJVA 1SVLA 3SOPA 2WZQA 1XP8A 2GEDA 3SQWA 1EG7A 3KB1A 1ELOA 4A2PA 1AGRA 2JLRA 5B58C 3OEHA 3U7FB 4FMDF 1HUQA 2QP9X 5IHPA 1N6HA 1YZLA 3LVQE 5H68A 1KK3A 4LJ9A 2FF7A 4DLUA 1HH4A 1SVOA 2DFNA 5CYPA 1CU1A 2IYUA 1US8A 3GJXC 3A6PC 3NHAA 4N1AA 1Q1EA 1J70A 4HATA 3ADCA 2AN9A 2GVZC 1N6OA 1JQLB 4QGAA 2WWIA 1MO4A 2QMUA 2V54A 2QQEA 2C5LA 4C2UA 4KLNA 3ZS9A 3K70C 1AZSC 2QRNA 5GVSA 3BD9A 5EXTA 1YRAA 5FR2A 1I2MA 1YE8A 4BWYA 1K5DA 1D6JA 2QTFA 2TMKA 1P2SA 4IOMA 4MKFA 1GITA 3DOFA 1L4YA 1QG4A 5JHGB 3RC8A 4C9BA 3FGNA 2PCJA 1R5NA 2LCFA 4XJXA 3SE0A 2DWOA 4TTRA 1W7AA 3TNFA 2CE2X 1X6VA 1HYQA 2VQSA 3SYKA 1W0JD 3QKUA 4A0GA 5EE3A 2OV2A 3KUCA 3CM0A 4Q02A 3KTAB 4LOAA 3AVUA 2ZSEA 4KJZA 1G5PA 1ZIPA 1GRRA 3K0FA 4UNNA 1G291 2FPLA 4PANA 2O8DB 2ATXA 4TL6A 3T5GA 4EKDA 3THWB 2ZRPA 1YZTA 2DYKA 4Y0AA 2VP5A 1NLFA 1QHNA 1PUJA 2ZU0C 2G88A 5C2JB 4QXAA 4QOSA 1ANKA 3CRMA 1I2DA 2CHVA 4JLOA 3B8HA 3LFUA 1ZM2A 1Z06A 2XTNA 3MG9A 2QBYB 1CRPA 3REFA 3UXMA 2ZVPX 3DM5A 1CJMA 4X8HA 5EXSA 4C0BA 3EPLA 3VTKA 3V9PA 3ZQ6A 4TLCA 1OIVA 4Q7KA 4PSVA 4POAA 4RD6A 1SVWA 2BKUA 2VP4A 3NG1A 2YWHA 5FBWB 1DADA 1EESA 2OZEA 3OAAD 4Z51A 4ZCIA 4G5GA 5LDDC 2WICA 3BB3A 3NDBB 3BIFA 4M1OA 1KO5A 1ZAKA 1JQJC 4IDQA 1UKVY 3VHLB 4OHZA 3PEWA 1KO8A 1C4OA 3P32A 3B9PA 1ZM9A 3U3OA 1CULC 2V7QA 3K70D 2B7BA 3RDPA 4Q18A 4WA7A 4WIAA 4LV8B 2XNSA 5JCZA 1B23P 5HKKA 1ZW6A 4MYHA 4QJ4A 4RZ3A 1I4LD 3ZGXA 3GLHA 4EUNA 1G7RA 4FW9A 4MRRA 2J87A 2W58A 1WQ1R 3KTAA 4G3XA 2PMKA 1NMZA 4DSTA 4BFZA 3QG5A 4A8JB 5EP3A 3EZ6A 3ZZUA 2NO6A 1D5CA 1KO7A 2QP3A 2W2TA 2AXNA 3THWA 4XD7D 4KI0A 1H8HA 2VBCA 3U3RA 2UVQA 2H8KA 1QF9A 2MSDB 2PMDA 1PZNA 5EE0A 5FI0B 4NONA 4FMDB 3ZIAA 1XWIA 4WBSA 3NH9A 5E7JA 3SYLA 2QBYA 5CDFE 2IF2A 1DG1G 1GIAA 4MA4A 2ZROA 2CCKA 1ZC4A 1T8UA 2A78A 2P67A 2VEDA 3F8TA 4ZDJA 5KTYA 3MWJA 1XFAA 1G3RA 1VHLA 3L8ZA 1KTVA 2AWNA 2ZSDA 2XJ9A 4TLAA 2OE2A 3P4XA 4PPGA 4TSFA
chains in the Genus database with same CATH superfamily
1N5LA 1VHWA 3OCWA 2HO4A 4TGLA 5DWQA 1IBCA 5T8KC 3PLRA 1ESMA 2VDPB 2JEZA 3TS1A 3KP1A 4X63A 1DKLA 1WEHA 4K9RA 2E87A 2PH7A 3F90A 3HA2A 3Q4GA 4H7HA 4EK9A 2NQ8A 3QPAA 2PGLA 4R8VA 2LZ0A 2F6RA 2X8AA 1E1KA 4CCAA 4YCCA 5AM0A 2P41A 4OUKX 1G6HA 2K4MA 3BGSA 2WT9A 3VDRA 2RKBA 4DREA 5JXJA 2F4NA 1CEEA 4M9CA 5AD1A 5P8WA 2FMFA 1UBTS 2ZRAA 3NXSA 4LDNA 4HSGA 3WRXA 2OGWA 1MFZA 3LUPA 4OM7A 1GPDG 3I8SA 1BXRB 2HTFA 4OIMA 2FSSA 1DAKA 2WJVA 4RACA 1JIUA 1UJCA 3PNBA 1Y9DA 3BAFA 4K0RA 4X20B 1QRUA 4B48A 3CCCA 4Q24A 5B2ZA 4QBKA 1W47A 4L57A 5I9BA 1DAHA 1KDYA 1ZCZA 5I9IA 2VUIB 3CSSA 4WK2B 4AF8A 2OYSA 1E1QD 4Q12A 1E9DA 2QVLA 1E2UA 2R8OA 1FS4A 4TXJA 3FBWA 1J0DA 1OLXB 5FV7A 4BJHB 1FBTA 3EHDA 3TQHA 1OQAA 2G06A 2IE0A 4TV9B 2GHRA 4IIXA 1GAWA 4UXHA 1XYVA 4OA5A 3B7PA 3QPUA 1PK8A 3N0XA 3RIYA 4BLQA 3JQRA 1ORDA 1BQ4A 1G5IA 3FIJA 1WU7A 1MQ9A 1ADBA 3IP5A 4DT1B 3AERA 1I5RA 3KV1A 4BQPA 2AC4A 3ZV4A 3P2KA 3VISA 4BNUA 1ZKDA 1LTQA 3NLLA 3UQZA 4RTRA 3TTUA 4HFMA 3BCUA 1ECCA 1G6Q1 1SKUA 4Z8XA 4I1PA 1U7XA 2P5UA 3NRBA 3EF0A 4TLMB 1X42A 5LQSA 3V2UA 2RHHA 2WTBA 3T15A 2JZOA 3W5UA 5I7EA 1UJ6A 2KWIA 1YMVA 3CE6A 3D1JA 3E7XA 4U8GA 1Z36A 1T5BA 5JARA 1K4YA 1SZPA 4XRRA 4QM7A 4EA6A 2WFLB 2OSBA 3LQYA 3QENA 3QEMA 1EFRD 1KH3A 2PCLA 2GZAA 3V1MA 1NMYA 1HRDA 1PTJC 4DQDA 1OAOA 4DPMA 3IJ5A 3AR8A 3BORA 1S8NA 1HY3A 3AKEA 3WMEA 2GZ3A 1GGHA 2IYRA 4QUIA 1P8JA 3PPVA 4QDXA 4B9EA 3PSAA 1GR0A 4UXJA 5LYYA 1ORRA 1II8A 2VIIA 3DR5A 1EYZA 3LRXA 1QTIA 4UBJA 9LDTA 4F2WA 1VYUA 5HJ7A 4INAA 2P9TA 3FCEA 1R6BX 1QG2A 3V8NA 2QPTA 4BX9A 2GH1A 5TT0A 1GTSA 4HDAA 2MINB 3TDKA 5C51B 3FTCA 3STWA 2AV6A 1WLYA 3G0BA 3LQ4A 4I7EA 3WLJA 2X7JA 3CF4A 2FY8A 5DM0A 1PNOA 1SUBA 1WMSA 3JWGA 3K1YA 3Q5DA 4F60A 1Y3HA 3MRSA 1DLIA 1SPBS 2AG8A 3DP9A 3GZJA 4AS1A 3NTVA 2BFPA 2PH1A 4AJIA 3B9QA 2XNDA 1M2VA 4L3VA 1P5FA 3N2YA 1H6DA 5FPSA 1HMPA 1C3LA 5FWNA 3RCBA 1IEVA 1X2BA 4YAOA 3HVRA 4R8MA 5JZVA 4CV3A 1LPNA 1W76A 1U2QA 3HPQA 3FHTA 1BEZA 2ZYVX 1VBKA 3G5MA 5T57A 2YXLA 3TX6A 3WADA 2HBRA 2YCLA 2PSFA 3EARA 3ZLTA 2YBDA 1W5SA 3TLBA 4BKPA 4ZK2A 4OHOA 4ZGWA 3K09C 2D3WA 3DEZA 5DM1A 4YDQA 2D0DA 3IRVA 4UEJA 3HMKA 4IJKA 3I9JA 5FUYA 3H5LA 4NOJA 1TM3E 5JY6A 2ZBEA 3RVMA 5JVDA 4CKXA 5CBPA 2BEUA 2ANBA 4NBKA 5DBFA 4EL5A 3CLRD 5HWSA 4DWWA 1YD7A 2BZSA 2PUVA 4ND5A 5BWMA 3NBUA 2QVXX 3BH6A 2X7XA 3G2JA 4O63O 5BNWA 1RR6A 5IFKA 1MJNA 1T9KA 5JBNA 1GGJA 1QO0D 2NU6B 3Q6MA 4GFDA 4CMIA 4UTOA 1OV4A 3P2IA 3TQIA 3CURA 5LXTA 1GYQA 3N8GA 3LT2A 4G2NA 4C78A 4YRRA 4MVJA 4XXHA 3PHBE 5DIZA 3KWLA 4DJTA 4F96A 4D97A 3EEIA 2VOJA 4URWR 5AKEA 4D26A 2D8AA 3LPDA 2W70A 3ZDXB 2YUTA 4G36A 1AH2A 1SD2A 1E2FA 2R6CA 3FMFA 3A6FA 3K5PA 3E9MA 2VLBA 4O1MA 1XTTA 4A0QA 4KFSA 4BKOA 4ZOBA 4BUZA 3R3YA 2X9LA 2YVUA 4L6IA 5EMLA 2WNHA 5BSKA 1W49A 4QGHA 1EXDA 1XZQA 2HSJA 2INGX 3KUDA 3N8HA 5I8WA 4K9QA 5BMVB 5JMPA 5JAOA 4IDEA 3OY2A 3REQB 2VHQA 3TIGA 3CVJA 4PYJA 5FFFA 4LFBB 3JQBA 4DUGA 2C5GA 2V7EA 3QBTA 2CK3D 3PEVA 2ONYA 2UXBB 4HLDA 3OOJA 2QI9C 3D3NA 3VDMA 3BDVA 5LYJF 2ECFA 3EZXA 4P6VF 5CT5A 5BV2P 4IDCA 3QOWA 4YRTA 3FOWA 4QQKA 1RYEA 4MDHA 3TPZA 1WQ3A 5FPPA 1O9HA 5JJLA 3CWCA 5CLJA 2IX3A 3BOSA 5BSHA 3OF2A 4MHOA 4BWFB 4PW0A 2PGJA 2Q6TA 2BLLA 3ECAA 1R10A 4R8SA 3SHWA 1URPA 3CX4A 5I7RA 2C78A 2XT6A 1U5AA 2GLXA 2NSHA 4RADA 3SICE 4H0CA 1SHKA 1YTLA 3T0FA 3F5SA 2JIPA 4OFBA 3A58B 4LYFA 4B3IA 1GN9A 3N39C 2WSSA 1CRZA 5H4HA 1K3FA 5G1NA 3I2YX 5DTMA 3CVVA 1KZ6A 3E61A 5TEWA 2AN5A 4MP3A 2XUZA 5FL7D 1G7SA 1RADA 1UBKS 2IIQA 1IH8A 2OOKA 2BOVA 1AK1A 1IWOA 2ODPA 4J1TA 1Q15A 5LP1A 4PQFA 3MJVA 4ILEA 1M34B 1U4NA 1Z5GA 2WM9B 3CHYA 3MILA 1SU8A 3B48A 1GT91 2JIBA 1E3TA 2PFGA 3JVVA 2HO5A 4X8MA 4QFBA 5BYKA 4ARBA 1J2RA 2W98A 4BNFA 1J2EA 3Q7IA 4DIUA 1PEAA 1JJ7A 1RXSA 3D64A 1IJKA 2X9GA 3H2HA 1NLUA 4HN9A 5H82A 2P4EA 2JAUA 3RVQA 3STYA 3ZBQA 5B7GA 2IUFA 5CNKA 1XZPA 4KIJA 4KXMA 1UK7A 2JLQA 1I5OA 2J3HA 4BVEA 4DARA 4UE2A 1RTKA 4Z7JA 5JFOA 5DWVA 1N75A 3OQMA 1RD4A 1CDOA 5ICFA 1Q83A 4QXQA 5L3RA 2NUPB 1D6NA 3IUSA 4Q39A 4I99A 3NIBA 3K1AA 4IQ0A 3ESAA 1Z7YA 1MX5A 1C8LA 3CF0A 4JR2A 1E99A 4JELA 1E94E 4JI3B 4GO1A 4TL8A 1H65A 4LHYA 5LSAA 4LVCA 2QRJA 4JODA 4KR9A 4UDNA 3LFHA 1KP3A 2NTJA 5BNIA 1ZZEA 4OAQA 2RHMA 4S1WA 2XSZD 1WUJS 4WCDA 3V3KA 4B5LA 5FYDA 1IN8A 4N01A 3K6KA 5LD2B 3CSDA 3A05A 4Y2RA 1M66A 3QVOA 2PH5A 3MTJA 3M82A 4JUDX 2XXAA 4IFBA 3HQ4O 1OIXA 3SDSA 5JZOA 8MHTA 3EMVA 3FX2A 4WTOA 2Z57A 2EL7A 4ND8A 3WDMA 4AZVA 2AI3A 1SBQA 1JW9B 4FM9A 1ZLYA 3CX8A 3ID6C 3K6SA 4UEQA 4AY2A 4PLZA 2J48A 1KYXA 1HDYA 2AFRA 4HDMB 1HMYA 1U1FA 4D0LB 1DJMA 3V4VB 3AU9A 1C7JA 1M74A 3IHTA 4U2EA 5IDWA 1I1HA 2R1UA 3OPYI 3UV3A 5ABPA 5SZHB 3C24A 4MO2A 1YU9A 3MS2A 2OYRA 3E05A 3JVIA 4YPOA 3D7SA 3ROXA 5EHZA 4FZJA 3GLTA 1F2DA 1OSNA 1UIRA 2RGAA 4LRSB 3T3OA 4GYKA 2P1DA 3I1JA 3M81A 4J7AA 4LF7B 1NVXQ 1TAUA 1EAMA 2XW6A 1V1RB 1IL0A 2V65A 1ZM3A 3F3SA 3KXIA 3NV9A 4PX2A 4XIGS 1KDOA 3BK1A 2E3JA 2PPLA 3F71A 3HJCA 1NTOA 2HCJB 1MMFB 4FDVA 1JAXA 4GRIA 3U7GA 4G1MB 1L7NA 1X1RA 1N25A 4ZAZA 4WJLA 5J1SB 1FDSA 3BXFA 4MAAA 5TPZD 4Z4HA 2P2NA 4QELA 3WQRA 1VIVA 3T06B 1KAQA 2Z1NA 4AWAA 1TM4E 3R75A 1RFGE 3VR6A 5TXGA 3S2GA 1AO0A 3THYA 1FTYA 3IP9A 4V39A 4V1CB 1ZK1A 1FTNA 1NOKA 4B9AA 1ID8A 2I6QA 1Y5IA 4RNCA 3BHNA 4JLKA 3JARA 2FZGA 2XDQB 3DBLA 1ZAYA 2X7HA 4PGGA 1M6WA 3DVAB 2W2VA 2JJ2A 4O3FA 2NSDA 2UZ0A 4WINA 4PFQA 3DZDA 3MMXA 2CNWD 4HB3A 5KU7A 3QVTA 4AW9A 4E1BA 2MDTA 3NV7A 1EXMA 2J5QA 4QYMA 2E9SA 3NHBA 4NCHA 3DXXA 3C1UA 3PPIA 4PIVA 5EESA 3L5KA 3ZE8A 4E7PA 1VMKA 3ES9A 2GVDC 2X77A 1ODIA 3I8OA 2ZGVA 2ABWA 1JEOA 3ANXA 3EULA 2VAMA 4FNAA 3I92A 4HJXA 4MKGA 4TN5A 2Q29A 2FMKA 4XLTA 4PQYA 2PBLA 3AVTA 2OXFA 2QU7A 1TZ2A 2C03A 1RWBA 5BSRA 1JECA 1XA4A 2KB0A 2R4UA 3FNEA 4M8IA 1KSJA 4M1EA 3AQIA 4ARVA 4DQUA 4CKEA 1J0XO 1HYEA 2CLEB 2HH9A 4JI1B 4JY7A 3I01A 1LV8A 1Y3AA 3PX3A 2CXHA 3ISVA 4B2PA 4CCWA 4UQLA 4ZVLA 2O8CB 4NCJA 2X2PA 1T0JB 3DG9A 2JLYA 1NAHA 4LSWA 2J6BA 3B85A 3LQQA 5TF0A 4I9UA 1Y6FA 3VPAA 1YQ9A 2IELA 4G0WA 1K7EB 3DEKA 4GYYA 4M1SA 3IALA 3O95A 1LNZA 3IT3A 2MSWA 3PWZA 2G5CA 3HSSA 2GJ9A 3ZVNA 3R4VA 5DO9A 4JP2A 3RU3A 1B0UA 1W6RA 1QH9A 1W52X 4WNCA 5LYJA 3T3GA 1W96A 2A94A 3ZBPA 3ZI0A 3ECCA 5C37A 1AZLA 3TM5A 4RPCA 1NSFA 1JIJA 2Q21A 4A0SA 1H93A 2FJPA 2XZPA 4RFSB 1YE5A 1ESDA 4X8LA 2KX7A 1U80A 1XF9A 1IQPA 2QX4A 2PDAA 4PNZA 2GD6A 4QATA 3V34A 3GJYA 5HQ3B 1CIVA 1C0PA 3PEUA 1UT6A 4P5DA 4FFWA 1KWGA 2JFBA 4H27A 4EPWA 2XLCA 1UAAA 4NMLA 4PNPA 5H9WA 4A2WA 4OG2A 3FDZB 1PX0A 3C4VA 1R0WA 4JC5A 2NTNA 3DFIA 4E2YA 3NVDA 2Z9DA 4ZAWA 1BOFA 1E0JA 5FPYA 3LF1A 4F86A 4ZCTA 2FMXA 1YZUA 5ITVA 4Y6GB 1SHUX 2JFQA 3VSDA 2WHRA 1DT3A 3KVVA 1N1MA 1DJQA 1TA0A 5I6DA 1MIHA 5GP1A 5C46F 3ESDA 4EKGA 2BFCA 1RBMA 1WS6A 4L8FA 5K6TA 5HRUA 3FUUA 4JLDA 1SB9A 2GYWA 4JLJA 3LNCA 4J0GA 1QSGA 2AG5A 2D2FA 1D4AA 2NZVG 3CB2A 3QVUA 4A1OA 1IBSA 4DANA 1LTKA 3I62A 4W5TA 4QFCA 4ENRA 4FINA 1YZFA 1OAKA 3VZBA 4GBED 4QAQA 3FOEC 4WD3A 5DYYA 5FUQA 1WUIS 2FX5A 3IE1A 2EG5A 2QMHA 3LQ1A 4JB2A 1DOHA 1Z3CA 2J9GA 2OP0A 3LKDA 2O2JA 3RPEA 1PW7A 1CJCA 3PPYA 4MUMA 5HM8A 1RZUA 3D6FA 2XA9A 3AZPA 3SHTA 1G8SA 1O0CA 1EE9A 4UCXA 3L7IA 5FEMA 5F2KA 2M6SA 2WTXA 2EQBA 1FIUA 4KQ6A 1XCJA 2PRKA 4I9NA 1GXSB 2RBEA 3A04A 3AH8A 3BTUA 3NHYA 3RAJA 3RVJA 1UEJA 2MR6A 1U94A 2QLNA 4EI8A 4EI2A 1UKAA 4L0QA 1OBFO 1C9JA 5BOSA 1Z0ZA 2Y2UA 1QCZA 1QZ3A 2EBUA 3AB3A 4FGLA 1IBLB 1L7XA 2VJMA 5KNCA 1QHIA 2B2XA 3KOZA 3EG5A 2P9QA 4X71A 2BGTA 3UMCA 3WO0A 2OG1A 1GHTA 1NT4A 3LECA 4YCAA 4OHWA 3C8ZA 3I0NA 1YTUA 3IMEA 2RGCA 2FB9A 2VDWA 2VR1A 2EGGA 3WMWA 3ZLUA 1N7JA 1RS0A 4JB8A 4QTUB 5FADA 3V46A 3TFOA 4FFBB 1VHTA 3ASZA 4R98A 1EDBA 1IRIA 4OQDA 4RSRA 4X6LA 2NUTA 5A3JA 1KJJA 4XVRA 1G6OA 3R3UA 1L7EA 5HUJA 3H13A 4DBZA 1KH1A 4KQWA 4Q4AA 4WOBA 3FPJA 1KJZA 1CNMA 3BHJA 3R20A 4RY8A 4YJGB 1UBRS 1F38A 4GX5A 1X80A 1TCUA 1GU1A 3CLUC 1HQCA 3GH3A 1MH9A 3OJFA 4R9RA 5ETJA 1Y1LA 2D0IA 2EKQA 1GPJA 3T7IA 3B2NA 3H9EO 4L0DA 3ZE0B 1SK9A 1DRJA 3K3PA 5BORA 1BGVA 1LA2A 1UPUA 1KOFA 2Z8YM 3F5MA 1OFUA 3AF3A 3CX6A 3KT8A 3TDNA 5EMMA 4MJXA 4CR8A 4IVRA 4MQFB 2R7NA 3VNSA 3OAAA 3GPDG 1P39A 2OFOA 4P9NA 3LGXA 4P4UA 3TSOA 1L7DA 2PWYA 3R5XA 3RS2A 2D0OB 2W48A 3W6PA 1XMIA 2VPYA 3BMNB 1E1RA 2ZDGA 3NIGB 1GFSA 2I3DA 4YQFA 4LK2A 4X90A 1NUSA 4Z86A 4MWZA 3SZGA 2OQIA 1JX6A 1WX1A 2PN1A 4LRYA 5DOZA 4O2RA 4YFVA 1GNQA 4IRMA 3PU6A 5D3ZA 4AY4A 4ZMRA 4Y9TA 4AJHA 1U2DA 1YA4A 3P2JA 2I2XB 4K9SA 1ENPA 1MP0A 3TXXA 2Y1DA 3OQJA 4EMUA 5KTTA 4NENA 2PSEA 1MJHA 1XNHA 5HW0A 1XXHE 2ET6A 2JGMA 1RZRA 3PFCA 1Z2PX 1R3UA 4Y3UA 3WG9A 4Y98A 4D4GA 3EPKA 2B1GA 1SKQA 3QU5A 4N9QA 1OYWA 1A5SB 1SUSA 2ISQA 2PRYA 2XDYA 3PUIA 4ZOLB 1WG8A 5G41A 4V0RA 1VM6A 4C7KA 4CF6A 2Y0PA 2WJAA 1QTRA 1OWNA 2WSIA 3GV0A 4R2JA 4Y7CA 5G02A 1J33A 2WAAA 3LOQA 3QV1A 3V8VA 3ZDQA 2Y93A 3HCAA 3NASA 1XD2B 1OBVA 5FBLB 2PEYA 4MEAA 4E6PA 5DNUA 1U7PA 4RVGA 3KJEA 3T5MA 3NTOA 1EVEA 3QIAA 1N2EA 3X1YA 4A03A 5THXA 1E9EA 2FCAA 1QO9A 1L7RA 4O29A 2N75A 2B1QA 1P17A 1V1JA 5JQWA 5IWAB 2NZ2A 3SR0A 1ZJWA 5FLXA 2XUDA 3DBRA 3GJ7A 2D8MA 3ANYB 4HEQA 4ZRMA 2PX6A 2A86A 2PMWB 2F2TA 1EUQA 1CYEA 1DX9A 4JSYA 4EELA 1YZ3A 2FWAA 4W6ZA 3TEJA 2PUHA 3AIKA 1JJBA 4GC9A 3TQQA 1QS0A 3TLGB 1AV7A 2PH3A 5CDSA 3ZDFA 3BX1A 4K86A 2C9ZA 1RXYA 4QTZA 1ZXXA 3KTFA 2W2NA 2ZM5A 1DAGA 4U5QA 4NCKA 1MKYA 3PFIA 1X7WA 1R6XA 1I6WA 1P44A 1M54A 1SFRA 3DHYA 3K5IA 2XIQA 1N7HA 3IP1A 5HGXA 4EB8A 2ZITA 5GOTA 1OY1A 2C3MA 1BW9B 1E59A 1H3FA 3TBFA 4IH9A 1P5RA 1U1DA 4I9GA 4EABA 1ICIA 3EGXA 4KKXB 3U6KA 2XCSB 1VKNA 3CMMA 3CGGA 1E8DA 1PIWA 2AI1A 3ETNA 1IN4A 4JL5A 4J4BA 1A8HA 5TB5A 2PX4A 3ER8A 4ISBA 3WZLA 2PZMA 3UH0A 4FGKA 3LBAA 4YRBA 1N6RA 3L0IB 1W48A 3IDQA 3EGCA 1CV2A 3WWPA 2AC2A 1M73E 2FG6C 3HFJA 1DIAA 4OQMA 4ZXFA 3NFYA 4ZK6A 3S2EA 3QNWA 4UNPA 1HF3A 2NXWA 4PG6A 1XTRA 2WBLC 3L0OA 2C2HA 1K5HA 2VDNB 1DRVA 3BIWA 3MMZA 4G2TA 4D9BA 3DMRA 1PEDA 4KN6A 4QOHA 4WKPA 3QUCA 4A0FA 3A7DA 3VJMA 1S4MA 5F9MA 1FDIA 5G3YA 3UHPA 1X1TA 3AVQA 1UPTA 3IP8A 3HYTA 4WERA 2XT0A 5IK2A 4Q93A 1DI0A 3DYVA 1N9GB 3FFWA 4ZTUB 3BBPA 2QUKA 2W6PA 4C3UA 2YXDA 1J00A 1K92A 4JQOA 2C7OA 4R2HA 4JI4B 4F97A 5KYUB 4LQCA 4LZLA 1Q17A 1E0DA 1AMNA 1VBNA 1YU6A 3Q1LA 1LJ8A 2WIAA 4HNSA 4UUQA 5M34A 1B16A 3UQYS 3HP1A 4F3KA 1LQUA 3GUCA 1YJ5A 1AN9A 3HCOA 3UHAA 5JJCA 2J9ZB 3O9VA 2Q1UA 3NP9A 2R6HA 1S6YA 4C4PA 1G8KA 1J1UA 1PQWA 3OIVA 2J30A 3ND5A 2Y2VA 4LDPA 4N7JA 5ILOA 2IOQA 4RH3A 1ONSA 5DYGA 1VI5A 3RT7A 4X95A 3VAZA 3WB0A 3DDSA 2WVGA 4YMHA 1X7HA 2BJWA 4UUMA 5AVVA 1GRVA 1O3YA 3WS7A 5FKJA 1Z0SA 2VDLB 1OA0A 3M49A 3MGGA 1JXAA 3O8OB 3KE8A 1XNGA 3L7AA 4HWPA 4TMXA 5ADHA 1ZU5A 3CUEF 3T1TA 1N36B 2NZ8A 1KEUA 3GAMA 1QIFA 1HETA 4N6OA 3WRXC 4H0NA 3ORSA 1JT9A 5KSZA 5AKHA 1P2BA 2QNIA 4R51A 4BPBA 5TPWA 3WYFA 1L1FA 4IEIA 3GWGA 1LZKA 4WVFA 1XQXA 4X7PA 5J1TB 1QANA 1W88A 1RJDA 4HS9A 5LNK1 2BGUA 1IB6A 1LTHR 1L4EA 4UM5A 1DMRA 4IIVA 3E70C 4B73A 4MQEB 4KO4S 4L6AA 1HT2E 5SY4A 2XITA 1CY6A 3IQHX 1RMYA 2YNMC 3V8BA 6REQA 2Q27A 2YQ5A 4KDRA 1JKJA 1TLLA 4R6XA 1WLSA 4BRUA 5BURA 2CFIA 1NLMA 2WTMA 5C8YF 2ZI6A 4FNOA 2V9ZA 3RU2A 3IXQA 1Z4NA 3KLOA 3S0JA 2IPAB 4LF9B 1BIFA 1Y1RA 2AUNA 2CBGA 2I8LA 2Q3BA 2VJAA 2XPCA 4WE3A 3NDPA 1N0UA 5CVVA 1QP4A 1LPMA 1J9GA 3U81A 4J2HA 4G5YA 2C7PA 4ONEA 2H00A 1LF0A 3FZGA 4RESA 3R0VA 2HF7A 5CT4A 3GT0A 3RV4A 1GQ2A 1DGQA 2CF5A 2VT7A 1SA0B 3ILYA 1EUCB 3BXXA 5FULA 3ZD7A 4C5CA 3OCYA 1EPUA 2QD5A 3EQ2A 4BX8A 5BRJA 4UU0A 4C7OB 1X94A 3QSGA 2ARKA 2IU3A 1WKBA 2WG1A 2BFBB 4YBRA 2P5SA 2HV8A 2WR8A 3WWZA 3S8EA 1MGPA 2QQ5A 4BN0A 2VZEA 1E3IA 1P9WA 1U6IA 4M0EA 1IJEA 4PCAA 1OAOC 4IVQA 3ZY4A 4IMJB 1VDMA 1THMA 1S8FA 2BBSA 1P19A 4GP6A 4K6HA 5C81A 1PGQA 3INYA 4YUZA 4M89A 1X0VA 2AEMA 3EOAI 2UZ1B 4S24A 4YH1A 4ZYXA 1TTTA 4K9MA 3ZVKA 1V9LA 4X1KB 4YLGA 5CX1B 1QXSA 1GKKA 3PWSA 3ROPA 5AM4A 1MOSA 1H66A 5LP6B 3U4QB 1K7XB 1JU9A 3NC4A 4QDZA 3X2SA 2ZIVB 4CTJA 1YGPA 3BTSA 2COUA 3PL1A 5DHTA 3GY0A 1CZHA 1DINA 4NATA 4PBRA 4ZCQA 4W5RA 1Q1ZA 4BAZA 4G1FA 5ANRB 3T5DA 3VHRA 3H0EA 2H08A 2P77A 2BM1A 1QDUA 1AD2A 2ODWA 1OF1A 4I3HA 3S81A 5NULA 3JD3A 1E4EA 4KJXA 1DKMA 3IKLA 4FYHA 3O4JA 5FP0A 4F11A 4I2NA 1VIMA 1CQJA 5I51A 3NB0A 3IDFA 1XR3A 2YNMD 2Q3FA 1A4RA 3BRWA 1KZ1A 2R85A 1XCBA 4EFLA 4F5DA 3OOSA 3FNHA 4FKBA 3JD1A 1L5GB 3UATA 5ALMA 2NU8B 1SUIA 2XUIA 3KETA 3UN1A 2ZE6A 3D0QA 3A1SA 3I73A 3KAKA 4Y2UA 2WB4A 1ULSA 3HU1A 3WL7A 3QP9A 3E9QA 3PDHA 3TWOA 5IJAA 4AQYB 1YQDA 4BCDA 5JDIA 1JIXA 1JVBA 1E8MA 2WFLA 3K0KA 4X41A 2QX9A 2PRJA 3GPLA 2AB0A 4M7RA 1NDQA 4HLCA 4KITB 1XMQB 2XTAA 5IHXA 4LI0A 1EZZA 1W4LA 1YOVA 3IVXA 1S2LA 4Y1RB 3RFFA 4KGXA 1RE0A 1YCDA 2FEMA 3HO6A 3R3JA 4FS8A 3E03A 3R3VA 4K7JA 4ZPXA 4B6RA 2COEA 4Y9SA 5C7OO 2YWCA 4O1IA 5EZ6B 3ZHBA 3PUKA 4MKHA 4WESB 4WXHA 2Q5HA 5U4QA 3LX8A 2OXIA 4OX9B 1X8KA 2Y05A 4WOKA 1V8ZA 4M6WA 2Q3CA 3QI7A 1D2GA 3RR2A 2E6UX 3DAYA 4JUIA 3UXHA 1DZIA 3QKWA 1T2AA 5IXYA 4DLLA 5L3ZA 1JEYB 2JRLA 2P62A 3FCYA 5GONB 4BO5A 4FWTA 3WWEA 3RSCA 4MB0A 4KXFB 2YOHA 3EBLA 1EFAA 3FWPA 4MR7A 4L9SA 2EZ4A 4MW7A 821PA 1M2OA 5EIFA 4E03A 5KDDA 1E2MA 4YXWA 3SS7X 1T9AA 4WH0A 5CVDA 1KI6B 4I81A 1NV8A 1SHTX 2XQGA 3P2EA 4WN3A 4EAQA 3CSUA 4AF7A 3QMMA 2GAFA 3A37A 4GR5A 1KU0A 1P2DA 1HFEL 2ZSIA 3DBHB 3MGCA 4DLZA 2NVOA 4OFXA 1LS1A 3N2KA 1KJQA 2UZIR 5DXJA 5CEJA 4HLUA 3JQBC 4UZEA 2R5NA 2CEKA 2CB9A 4OHXA 5KYTA 1X1DA 4HB4A 4QUEA 1LK5A 1RWNA 2O3JA 4E6EA 3G59A 4W7SA 2RDMA 5LCXA 3EGEA 5C8XA 3U3ZA 4INZA 1F9EA 3AFOA 3DE1X 4RULA 2RC5A 2Y67A 3H2JA 4Q4DA 5DP1A 3VDQA 5C1DA 1IIRA 4FGZA 4KQMA 2OBBA 4ZI7B 1KVQA 1RI3A 1TC1A 4OSPA 1DTWA 5DPMA 3B7GA 3LWBA 4BLWA 2XUFA 3MIZA 4WZ6A 4RS4A 3ICCA 3Q7RA 1DQZA 4ZDIA 1SZCA 4BZZA 4ZN6A 1ZR2A 5K0NA 4PBTA 5TGDA 2Q7OE 3BWXA 3C7AA 2FUCA 2VP6A 3VZDA 5A5DA 5AIBA 1DBVO 3UJ3X 4BS9A 3EBPA 3L6OO 4DR2B 1PWEA 2UU9B 3S40A 2BHRA 1ENOA 2JDIA 3U6BA 1S2OA 3WIVA 1RP1A 5J4HA 1EBUA 1Z7GA 2A5JA 3VMFA 2J9YB 5EZQA 1Y3CE 4J1TC 3FPSA 4TMFA 1E7MA 1OBHA 1QUEA 3S1SA 3W6ZA 1N1EA 2GPAA 4C87A 4GLFA 3KLNA 2C2MA 1WCIB 2FWJA 4E51A 3W5DA 4KQ2A 4O8CA 5DCUA 3H9CA 4KGDA 4MVJD 4TSKA 5J23A 2GERA 2JNWA 1QVAA 2O52A 3NAGA 1R4NA 3LC0A 2O1WA 5CBKA 4M2LA 4RABA 2JCYA 4PX5A 4V3BA 4QBTA 2DP4E 4U7GA 2DG2A 4K9OA 5NLLA 3U3MA 4TLDA 3ZWWA 5BUZA 3GRFA 1NUAA 2AFHB 4Q3BA 4V2IA 1KYWA 4HDNB 1JSLA 1K8QA 2C96A 2RHRA 2WWRA 5C8YA 1NI4B 4DMLA 2CDCA 3ZXXA 4LMBA 2P2DA 1Z0UA 2DCMA 3Q3IA 4IWXA 2BMEA 2CZCA 2WWYA 5I45A 3GJRA 4KC0A 5IKOA 4KOAA 4LNUA 4MUYA 1LX6A 3WLSA 1Y1TA 4FX2A 4KQXA 2WF6A 5TMPA 1AJEA 3E9EA 3O75A 1ZNQO 4O5OA 5CIYA 1L5MA 3SIWA 4QBHA 4DUGD 4Z9FA 4DIKA 5JI3E 3ER9A 1XAHA 2NO4A 2XMZA 1QFXA 2FGKA 2FPIB 5FAXA 2O2HA 4RJLA 1BCRB 1P3JA 3PFHA 4GMHA 3IIIA 1V8BA 4B0PA 2X5XA 3I1YA 1XO1A 4C01A 1Z16A 10MHA 3HY3A 5D2CA 1A2BA 1BQ3A 1N32B 2P78A 3B36A 4R8RA 2I9PA 3N70A 2SNIE 5DK6A 1WB9A 5ARBA 3MLEA 4NL4H 3ML1A 1ZJZA 5C0OE 4IF4A 2JD1A 3OX3A 3PPXA 1KETA 5DASA 3UJ9A 2BM8A 1M34A 5DGCA 4C0LA 1FFHA 1VE9A 3NWOA 4LKOA 5IAGA 1KPGA 4QHTA 2WSSD 4OD0A 3DMPA 5JY1A 5CDGA 3CLSC 4XGQA 1FVFA 3GRAA 2P3LA 4XUCA 1JWLA 1KQPA 2PLFA 4NEHB 2E1RA 1LC0A 1DUIA 2I5PO 4CM9A 3HKEA 1FMFA 3CUKA 1UPXA 3DKKA 4MGIR 4F91B 4XKJA 2WIBA 5IX8A 3HVUA 2R8XA 1UZUA 2P2YA 3OEED 4I4IA 2IUTA 5DF1A 1ECLA 3DF7A 1JH8A 1O5OA 2O14A 3EJ6A 2D5LA 3CZ5A 3PX2A 4RD0A 4R1UA 4RLHA 3C48A 1XZCA 2VHJA 4DV2B 3OZCA 1BJTA 4FR5A 4OQEA 4Y6SA 4WXRA 5FIUA 1YWGO 1EM8A 2H2AA 2YZNA 3P4XA 4LYAA 4OHKA 1U0RA 2V96A 3LCVB 3ETHA 2XA1A 1XU9A 3SEQA 2H9YA 2ZUTA 1JPNA 3RANA 2O48X 1IHPA 3EZNA 1YIDA 3W1VA 3MWEA 3I5UA 1T9CA 1UFVA 2H4ZA 2YZKA 2JAQA 5ALYA 1VLHA 4CIDA 4PPQA 5P21A 3MXOA 3O5AA 1ZOOA 2QD4A 2A84A 4NCXA 4BGUA 2ONZA 4OSEA 1Y82A 2QYSA 3PXGA 2J8ZA 4G37A 2YJ4A 5DYTA 5IBQA 4FFMA 1WAMA 1ONOA 2XNKA 3MQFA 1TU3A 5K0FA 1SKBA 3BGDA 4DA7A 1R8YA 2GRUA 4GOXA 5DH9A 4D9FA 4M8KA 4ND1A 3LQ2A 2VEOA 2FW1A 1PWXA 1PKEA 3GN2A 2QSYA 3FNRA 3VR5D 3C5VA 4BYMA 1DBRA 4JLVA 3K71B 1RC0A 1XDGA 3J80A 1H42A 3AOEA 3CNOA 3CE9A 4L15A 3PEEA 2M6RA 1XYGA 2IQIA 4BVBA 3GFGA 5KYXB 4P0QB 1MR3F 4E1VA 1JLMA 3UPDA 1WULS 3S2FA 2QDXA 3ZKWB 2P6NA 3GHHA 3TH5A 3RIXA 1MB0A 5LQAA 1T8YA 1F14A 3WLRA 4WCFB 1I7QB 2VP9A 3O38A 1DNPA 2R2AA 5DISB 3FZQA 4U2KA 4ASUD 4AZTA 1R4MA 3E9NA 4BVKA 2UVPA 1ACLA 3PNOA 4AVYA 2BUBA 4O1HA 3AP3A 2NPOA 3CLSD 4PLVA 4C4OA 4KFUA 4QFDA 3P19A 3RS5A 3ICWA 2IOFK 1I3LA 1TOAA 5ALHA 1M7GA 2E5FA 2FPPB 4U63A 1EKXA 1KFKB 1YXMA 4XX0B 4EJ0A 5JSQA 2ZUFA 1I4WA 4KDCA 4F2DA 1HLGA 1XZBA 2FKNA 2GEFA 1GTL1 3FPEA 4P3KA 4MUNA 2GETA 2PA3A 4IIJB 4RVHA 4TS1A 4K9NA 5U9CA 4UQOA 2HK8A 5AVKA 4O2AA 1FTSA 4UHDA 2PJRA 2EQAA 1U3FA 2HA4A 4YECA 3AV3A 2CL0X 4Z53A 3WK5A 1Z2DA 2XTMA 4EA9A 2VPPA 3FVRA 1E63A 2FFJA 4J6EA 3TMKA 1Q11A 1NFRA 3D2BA 1MXHA 4MWSA 1KZ7B 1RJ9A 2GSWA 3VI3B 4IZHA 4NYJQ 3WHPA 2VNAA 2PU5A 4UAGA 5BW6B 1XVLA 3EEBA 2A7QA 4IV8A 3MJ4A 4EPXA 4Q7QA 5E7QA 1CUXA 1KP9A 2EXXA 3IIMA 2V74B 5DNWA 5M7EA 3BWMA 3NHSA 2RGNA 2G71A 2OHFA 1K8RA 4WT7A 3ZWDA 2FVXA 2B4AA 4ND7A 3K0CA 4FJ2A 1M8FA 4NABA 5KNDD 1T8SA 2JGFA 4DLPA 1A96A 1GP2A 4HXEB 2FQ1A 2IHJA 1EFDN 2E4XA 4IKEA 5ILQA 4HNAA 2BM0A 3UEOA 3KZXA 3N6VA 4M9XA 5PGMA 5CXXA 4KMSA 2QT0A 4A6DA 1IOZA 4POOA 4DWOA 4HX2A 4NG4A 2C95A 2OKCA 4RO0A 5LQRA 2X1LA 3G5LA 1V2GA 1QP7A 2O8CA 1MUUA 4JBXA 4L5IA 1LBEA 1BFUA 1NPYA 4OFZA 4Y7DA 5JNWA 2P6UA 1QOQB 4KO2S 3G88A 1IN6A 4S2UA 1JSZA 2IYNA 4EVSA 2XOXA 5CFLA 3OTOB 3EHEA 3KQQA 3ADPA 3QEJA 1KY2A 2ZSJA 4TTTS 2QW1A 3KEQA 1YL7A 3K70B 2GCOB 4MKIA 3D7KA 3L7DA 3SXPA 1XZGA 3E81A 3KT0A 3KHKA 4GOJA 4C89A 1WV1A 5DYIA 1W85B 3OPNA 2PUFA 3V80A 3ZW9A 2CNLA 2A92A 2A59A 3CIOA 3ECSA 2C9CA 1JDNA 3GRRA 1CP2A 2XCLA 4M8NE 1BAPA 2Q6KA 5L7WA 1ULBA 4G97A 4NQZA 1IMOA 3V1LA 1P1HA 1MB4A 1PS8A 1X0XA 1KMHA 4HPXB 4KPUA 1ZPDA 4BU1A 3P0JA 1O9GA 3DE2X 1N7GA 4W7IA 4P4GA 2R47A 3GPCA 3VH4A 4Q3CA 1EEXB 4X24A 4C1NA 4XSGA 5CDHA 1FMCA 4ME6A 1TZKA 1U3CA 4WFIA 4MQMA 2TYSB 3COZA 4X6YA 5EL0A 3VNBA 4EUHA 3PNSA 3F8WA 5ERXA 4D6XA 5JNLA 3ON5A 4LMPA 3IPYA 4URVR 1QDEA 1M76A 2F1JA 4MGHA 2QTNA 2Y1XA 3JASB 4BDTA 3COJA 2C61A 1SELA 4PFJA 3UT5B 4AUMA 5CB8A 2OC4A 2IPLA 1J5XA 2R6FA 2OC9A 1J5PA 1QKJA 3TCKA 3VYUB 4YCMA 1QB8A 3P4UA 4P81A 2DQYA 3QX9A 1A2KC 2B5VA 1Y4SA 1YS6A