1UKVY

Structure of rabgdp-dissociation inhibitor in complex with prenylated ypt1 gtpase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
204
structure length
197
Chain Sequence
SEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secretory pathway GDP dissociation inhibitor
publication title Structure of Rab GDP-dissociation inhibitor in complex with prenylated YPT1 GTPase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 63
structure length 197
sequence length 204
ec nomenclature
pdb deposition date 2003-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ukvY00
2GEDA 2A78A 5HZKA 2VSFA 2ODWA 4R2HA 5L3VA 5DYIA 1OIVA 2VIIA 3VAAA 1UKYA 4PAQA 3SYLA 1HUQA 2AWNA 2D2FA 1BS1A 2SHKA 3K8YA 1UKEA 2R62A 5EXPA 1E2DA 4RKEA 3UANA 2WKPA 1G8GA 2B8TA 4B43A 5IHPA 3GP8A 1S9DA 3MWKA 4MGIR 1US8B 3UATA 1D6JA 1Z0JA 3HR8A 3AF3A 1E9AA 4JLNA 3VU9A 4Z1MD 3LAWA 1IN6A 4NH0A 3AVVA 1GRRA 3CWQA 4NCHA 3KX2A 4U7DA 2CVHA 1N5JA 3KXIA 4GNKA 5GVRA 4LYFA 1XPOA 5AJXA 2AX4A 1JAHA 2PZEA 3AH8A 4KSBA 1J99A 4BZPA 3OEHA 4NTZA 1UKVY 5TMPA 5KYKA 1CEEA 5LBIA 3I73A 1I2MA 3B1YA 3A1SA 4M2LA 3DOEA 1NVVR 2WM9B 3GJ4A 4PAMA 1CKEA 4IDOA 4OI1A 3I3SR 3HPRA 3PV0A 5KPJA 4U02A 2OE2A 4Q7JB 4WZBE 2JLXA 1XU4A 5HPYB 5GJWC 1AS0A 4OI2A 3KFXA 2B6HA 1JQJC 4RZUA 5SZJA 4QKQA 4KSCA 3CBQA 4KHZA 4CW7A 1JAIA 5CDFA 3KTAA 3AGPA 4Q03A 1E32A 3GLHE 4IOJA 521PA 2ZJAA 1TUIA 3TIFA 1T6NA 2V9PA 3PIRA 1GG2A 1DG1G 1Z47A 1WXQA 4LJ7A 4HUQB 2XOKA 2R6AA 4B2LA 2QU8A 4CT4B 5HE9A 2IHYA 4TL8A 1HT2E 4TL6A 3KKPA 1G291 4IVQA 1N0WA 4JBXA 2FEOA 2OILA 2WKRA 3EIHA 5FPHA 3SFZA 4Q7MB 1IM2A 2NO6A 1QHGA 1Z6GA 4MGZR 1W44A 1XWIA 2YWGA 4L9SA 1P5ZB 1QG4A 1MABA 1N6PA 1E9DA 4HLUC 2ZAOA 1LF5A 1MT0A 3PUZA 4JLDA 1G7TA 2GVZC 1X86B 1R5OA 3MJHA 2ZM5A 1E2PA 2ZR7A 1P6XA 4TMVA 1S9HA 1OB5A 2F1JA 2H7VA 1GOTA 4AC9A 2JLQA 1Z0DA 5P21A 2R8RA 1XJCA 4IEIA 3ZIAD 2CVFA 3CNNA 3K53A 2Z83A 3EAQA 2C95A 4RZ3A 1ZJ6A 1ZYUA 3K0FB 1C1YA 2BKEA 2VLIA 4U00A 3CR7A 1DADA 5BYJA 3K9HA 1J8YF 3KKQA 2GNOA 4PPFA 5ANRB 1XZPA 5FTJA 4D0GA 2CNWD 5FUXA 3FPAA 5L3SA 2O8BB 1G41A 5FTKA 1EG7A 1GILA 2OAP1 3LQRA 3AP1A 4KFUA 4NCNA 4QBIA 4LJ4A 2BBOA 1K6MA 3A4NA 2JLWA 4P33A 1K5GA 2PCLA 3AKYA 1MO4A 2D7DA 4A36A 4G1UC 1F2UB 4DEXA 1IY2A 4P4SB 2O8DB 2BHRA 5FR1A 5FOVA 3QG5A 2ZVPX 4TMZA 2WWGA 3ADBA 1MABB 3P1JA 1KNXA 1VIAA 2OBLA 2OESA 5CJPA 1JI0A 4ESHA 2LWIA 1K5DA 2BBTA 2PX0A 3W5JA 4LBYA 3VR2A 1JPNA 4BE7B 3SHFA 2YOGA 2AK3A 3CO5A 5FI1B 4RFSA 1KI6A 2G1KA 3CM0A 3TSOA 1S3SA 1AQUA 4JL8A 3R20A 2Z0MA 2ZVQX 4OI0A 1JR3E 4EJSA 5KTYA 3TKLA 2ZXUA 2B92A 5JJIA 4LJYA 4MRVA 1E2QA 1NY6A 2R2AA 4E03A 1D2MA 3E70C 3CRW1 1WE2A 2KI5A 3BAFA 3KKOA 2EWWA 5EP4A 1KK3A 2BV3A 2YZ2A 3DM9B 2QEQA 2A5JA 1AJEA 3QVVA 3BE4A 1VECA 4BUJA 4MKHA 4QXAA 3FHOA 5EXXA 5F98A 2J7PA 3C4JA 3A1TA 1M2OB 1Z3IX 2KBFA 3QBTA 4GI7A 5B57C 3QXCA 4TLDA 2OCBA 2W2VA 4C0SA 2ORIA 1FP6A 3NBFA 3O8BA 3AF0A 4RD2A 4E09A 1Z6XA 1NJGA 3C5HA 2ANCA 3TSWA 3U4QA 1E4YA 1KSHA 1A7JA 1G8YA 4IVRA 2N42A 3GEIA 5JWOA 1S0UA 4M8NE 1ZBDA 5E7MA 1TX4B 4NYJR 2CCJA 4Y0AA 3CRQA 3UXMA 4FD2A 4POAA 1Q0UA 3NH6A 3TQFA 2ZI3A 4AG6A 3QE0A 1KK0A 1OXUA 3TSZA 2DHRA 3JVVA 2JLZA 4D80A 2WWHA 2W6ID 3EA0A 4HLCA 2XNDD 1J70A 4A92A 4UQOA 3D31A 4W9MC 5SZKB 2WJGA 1G21E 1Q1ZA 3TW4A 1W47A 3ZVNA 3K1JA 1H8HA 4QM7A 4G5SA 1S8FA 3K9LA 1ZIOA 3Q85A 2QE7D 3I32A 3W8NA 3WHKA 3IUYA 4CYMA 1NBMA 1X6VA 1Z2AA 1Z6TA 2AFIE 2HLDD 2IEZA 3Q7QA 3U3JA 4Z51A 2Z4RA 5FPSA 4GSYA 4Q47A 4WA7A 3LQQA 4XVRA 1VIYA 1XBTA 1LFDB 3BK7A 3CNOA 1EFUA 3BH6A 2ODNA 2GJ9A 1IHUA 4KYUA 4N0DA 4UXIA 2WJJA 4PHTA 3NIBA 4D0NA 5FH9A 5JRJA 2CEAA 4DSOA 4MRPA 3U4QB 1G6HA 4F4IA 5TXGA 4BFXA 3FFAA 3I8XA 4MRSA 4CDGA 4LHVA 3EZ9A 4DSNA 4V0KA 2GA8A 1PLLA 2YNMA 4TZ6A 1U90A 2VO1A 4B6FA 4CEIA 1WF3A 1KO4A 2FFHA 5F9FA 3OIUA 3L43A 3T1VA 1XTJA 2PJRA 4TMXA 2I1QA 1JALA 1X8KA 4B75A 1ZUHA 4DT1A 2N1BA 3BJIC 1G1MA 4XWAA 5K8TA 2J9RA 4PPNA 3GJ7A 3L0SA 2G83A 2OUKA 1YR7A 2Z4SA 5JECA 1TQ4A 2G9NA 4DSUA 4EKDA 1B0UA 2F43A 5CIQA 4TMTA 4B76A 2FV8A 5JSZA 4GT1A 2IWRA 2YJTD 5F2EA 3IQXA 4A0GA 4RCYA 1YZNA 1JR6A 3N2EA 4LI0A 5DH9A 3GLIA 3VX3A 4O2RA 2J46A 5HCNA 5B30A 4OK3A 5A5GA 1U8AA 3ZQJA 4FWIB 1S4QA 4LDJA 4DLTA 1XJQA 1COWA 2H17A 3AB3A 3THYB 3KKMA 3PUVA 1SKQA 3QPUA 1EFCA 5H8WA 3CR8A 4Q01A 3X2SA 3M4YA 4DKXA 5TV2A 1IN8A 3FDIA 1N25A 5DIFA 4R98A 2ZJYA 1NVUQ 2BEKA 2F7SA 1G3UA 1GRQA 2ZJ5A 4P31A 3VR3A 5BYKA 4H9GA 4JVLA 4N3NA 1D9XA 4M1KA 1G3RA 5A0FA 3CRMA 3EPLA 1E9BA 3IIMA 4DT1B 3GLGB 5LB4A 5K8IA 3IEVA 4ACBA 4Q9LA 3V00A 5CITA 1J90A 1XMSA 3PEWA 2JA1A 1T3LA 1MOZA 3JZAA 5FOTA 5IDVA 3B6EA 4W5WA 1F5NA 1U81A 3KB1A 2FPMA 4JT2A 3B85A 4FW9A 2A3RA 1P75A 1SZPA 1FFHA 4I1OA 3MAAC 4LBZA 1Q1BA 2QZ4A 4LJ9A 1OE0A 1XTKA 2XAUA 1DO0A 2IT1A 2ZRBA 2AR7A 4ZDWA 4Q4AA 5KSZA 1T4GA 1Z0FA 3WXMA 4L9WA 1SVKA 5H68A 3U3OA 4PQRA 5FI0B 3GJ8A 4A1FA 1WCV1 4NU0A 2VEDA 1WDTA 4UJ3A 1AKEA 4FCTA 2F9MA 2XB4A 5CDFE 4KLNA 3X1DA 4B34A 1II0A 1QG2A 3GFTA 3MWYW 3ZZUA 1ZVQA 2QAJA 5BXQC 2ZS8A 5CIWA 3Q8XB 2A5DA 1CS4C 1KO5A 3FKSD 4UNPA 1XXHB 1Q21A 4YXWA 1EX7A 2CCKA 4M9QA 2NGRA 4RKFA 3LW7A 3RABA 1NVVQ 4CEHA 5L3QA 1T3HA 2ZJ2A 4LK2A 3RDPA 1SKYB 4OJKA 4MYUA 4XWKA 3UG6A 2EYQA 3AP2A 3MUFA 2BIFA 4US2R 3W3ZB 2HV8A 2CL0X 5CYPA 1MRSA 1RRFA 4DB4A 3TK1A 3B13B 2P5TB 1OLOA 2UZIR 1OIXA 2X2EA 4PC7A 2ONKA 4EQ6A 1I2DA 1SXJC 1AN0A 3K0AA 1FQKA 1LTQA 3LH5A 3ZS9A 2F3RA 1DG3A 2WKQA 1F2TA 2LKDA 2XTNA 4FN5A 2VHJA 3NDBB 1F3OA 4ITRC 1GIAA 1GNQA 4CIDA 2XZLA 4PTLA 2C9YA 5JZVA 4QGHA 4MYHA 1R8QA 4D25A 2JEOA 3MGCA 1E0SA 3A36A 3T1TA 3U7GA 1SVLA 4OHYA 4XVUA 4XWOA 3MCAA 5EP2A 3IILA 3VKGA 3K70C 3P26A 3T1OA 3HU2A 2OCAA 5DE3A 2W2TA 4TTPA 1L8QA 2FOLA 5L3QB 3U60B 3FOZA 1OH8A 3IPYA 3C14C 2V54A 4B74A 5KDDA 1WBBA 1DOAA 1OXVA 1OH5A 1G5TA 2O8CB 1KO7A 3VKHA 1GM5A 4A2WA 1E0KA 3RS5A 1OXSC 2O0HA 1KDRA 3CZPA 4ZKEA 4B3XA 5EUQB 2OBMA 1Z6AA 4BPBA 2WSMA 4A0FA 3I5XA 1NLYA 4BZXA 3BERA 1WMSA 2ATXA 2BEJA 1U8ZA 1NMXA 3K0AB 2ZJ8A 1KYIA 2CNWA 4WIAA 4LWZA 5EP3A 2QMEA 1YRAA 5FBVB 1YZKA 1FL9A 4GBMA 1M74A 5FOUA 3OEED 1KAOA 2IYTA 2ZR0A 1HA3A 2IUTA 1NI3A 1ZM7A 1XEFA 4A6PA 5C18A 1FUKA 1KO1A 5E7JA 3C15C 2RCNA 2AD1A 5CLQA 1A1VA 3QXSA 1JEEA 3W6PA 4X8LA 2J7PD 3QNUA 4LC0A 1KI9A 4DXAA 4IOKA 2A5YB 2CHGA 2CDNA 1D2EA 1Z63A 4FCVA 3ONWA 3VR5A 3SJBA 3R9XA 1TQ2A 4LJ5A 5EQTA 1T3SA 3R9WA 3FMFA 4WAUA 4KLZA 5CK5A 1OF1A 4DLZA 2ZRPA 1GAJA 1G8HA 3FMIA 4QJ3A 1UJ2A 3TVTA 2GHIA 1VCOA 4BFUA 4WOPA 1J2JA 1SVMA 3WMGA 4KBGA 1LW7A 4RSGA 2V6IA 3ADDA 2YC4C 1HE8B 5TVKA 5C4GB 1U0JA 4XSHA 3P32A 4Q1DA 2GBLA 2OFWA 3G5UA 2R65A 4GZLA 3TR5A 1JJVA 1CR2A 3SHWA 3IBGA 3ASYA 3RS7A 3LD9A 4P0TA 4BLPA 1TTTA 2L0XA 3A1WA 3AV0B 4W5JA 3OHMA 5EE5B 3D6TB 4ZCLA 4XD7A 5AUOB 3AUXA 3DMDA 5FOWA 5FTMA 4F91B 3AF4A 2CE7A 2ZEJA 1PUIA 4Q9HA 1QHSA 2IYYA 2OLKA 2ZR9A 1W49A 2FFAA 3ND8A 1CR4A 2VP2A 4D0LB 2YC2C 1NBMD 2V6JA 3NWJA 3HP1A 3T1QA 4HB3A 3BB4A 1KDPA 4JLMA 3EARA 3ADKA 3KFVA 5CM9C 3PEYA 3NXSA 2GXAA 2QQ0A 2G6BA 1QHYA 2ERXA 4XOIA 5JCZA 2G77B 5BN3A 2DWQA 1W4CA 3OIVA 4EAQA 4C7OA 4G3XA 1P62B 4HZUA 1Q20A 1OHHD 1M7HA 3QKSB 4DLRA 4TZ0A 3AGQA 1W7AA 2GJ8A 2XEXA 4JBWA 2X1VA 3PUYA 1NMYA 2RGDA 5BN4A 3KQUA 4LUCA 1ELOA 2ZI4A 3EPJA 4RZ2A 3QF4A 1VCMA 3BH7A 3LW8A 1W0JA 2XTMA 3QF7A 2QE7A 1ESMA 2BCJQ 1LF0A 2ZI5A 4PC6A 1Q44A 2I3BA 1GWNA 2HLDA 4RZXA 1B23P 4ZPXA 2W83A 1PVOA 1M34E 3Q72A 5HE8A 1RJ9B 3AVYA 1XCGB 2WWWA 3RS0A 3QEJA 1OXXK 2BMDA 2CL6X 2FPLA 1SVOA 2ZI6A 2PLFA 3GLIE 4K8OA 1NLFA 1NMZA 2GCNA 1FZQA 3K0CC 3B60A 4A8JC 1Z07A 3GCGA 4HDQB 1OH7A 3SN6A 3PQCA 1AZTA 1KDTA 4NYMR 3VKWA 5DI3B 3X1XA 5UKDA 5GJCA 1ETUA 1KI1A 3CRRA 5FPTA 1GL6A 2QY9A 1KGDA 1US8A 2P6NA 3VNUA 2CHQA 2QRZA 2R6CA 4KBFA 2EQBA 4CGZA 2E1RA 2R6GA 1F48A 2FJUA 4YMSA 4B35A 3LVRE 4M9SA 4UNNA 4A82A 2WBLC 3AKDA 3QXXA 4C0HA 2JLYA 1R0WA 3R7WA 4LY6A 1EX6A 5EXSA 4ERNA 2AXPA 4JYCA 4L15A 4DUGD 1P4SA 1NF3A 2GILA 3CH4B 3SE0A 4MKIA 4YLGA 1PV4A 2QENA 4O3MA 2QPAA 2FDCA 3OF5A 3IPXA 4HAXA 2R6FA 3RS3A 2OT3B 4ZDIA 2VSOA 1BH2A 4XSGA 2YVUA 5KPDA 1E0JA 3B8HA 2Q0HA 3RSLA 3EC1A 2ZTSA 3GFPA 1YJ5A 5EP1A 3ZGXA 4AKGA 1JPJA 3QEOA 4EFMA 4H1VA 1XPUA 4LHXA 4URZR 2B8WA 3R8FA 4HUQA 1E96A 1U0LA 3HJNA 3NEYA 2QSYA 3SJZA 4QM6A 2P65A 4DWJA 2ZRDA 4YDSA 3CPJB 3EWSA 3W6NA 4Q00A 3W9YA 1XTQA 2WJIA 1YE8A 3V4FA 3B1VA 1K8RA 5SZIA 1T5IA 4CEJB 1W4AA 5JWHA 4OYHA 1P3JA 1IJEA 4YXWD 1CR1A 4KFRA 3LO5A 2GWHA 5JCPA 2OG2A 2DCUA 3QKUA 2BVNA 3R7WB 4V0NA 2AKYA 2QTHA 3EW9A 4TN1A 1HV8A 2ZUBA 1DAEA 3FWYA 2CCGA 5TY0A 4TT3A 5FL3A 4CZ2A 3K09C 4ILEA 3M1IA 3NG1A 4BFTA 4BFWA 3IBYA 1SXJB 4YMWA 3GLFA 2OLJA 2ZS9A 4LOAA 1KKLA 4TLCA 4KAXA 1H8EA 4OQLA 4JSYA 5KUTA 4QC2A 2C03A 3K0FA 1VDZA 1KY3A 4DCVA 3B82A 4QBFA 2O5VA 2FN4A 3FKSA 4LHWA 3RS4A 1S2MA 2F55A 4JLOA 2HEIA 4IOMA 3KJEA 2CL7X 4M1MA 1YZGA 2ZI7A 5E95A 3D7MA 1UDWA 5JHGB 2P3SA 1L7VC 3P20A 3K70B 4K46A 1CRQA 3O8DA 4MKFA 3VQTA 4DCNA 1F2UA 1QZXA 2DWPA 1KSFX 2H1LA 3P27A 4P4SA 3SJCA 2O8DA 1U9IA 2ZRMA 4PAOA 4PSKA 4B3CA 2QUZA 1CR0A 1VG0B 1ZCBA 2D7CA 2OM2A 3ZDQA 4M1YA 1GDDA 2P0EA 1R0YA 1D2NA 2WOJA 3WY9A 4O25A 3R9IA 3CH5A 3ZVRA 4LV8B 3P4YA 4GP7A 4ZKDA 3HWSA 1TQ6A 2O52A 4P4TA 3GEEA 2O0KA 2ZREA 1DAIA 3NH9A 2VP0A 4IXMA 3REFA 2FNAA 4MYCA 3OAAD 1KSJA 1G20E 2OHFA 3I72A 621PA 3GLFB 2ZSBA 1KOFA 2RGNA 3EC2A 2C8VA 5D3MA 4IEEA 3WYFA 3BOSA 1UBGA 2WZQA 2IXGA 4OJQA 3I8SA 1P2VA 2P6UA 1WBDA 1NG1A 1AGPA 4JL5A 4RD3A 2HCBA 4C4PA 2J0QA 4BFSA 4E07A 4E5UA 4V0MA 1FMLA 3MD0A 2IHBA 3Q3JB 4KV9A 3PJRA 4GPTA 4IW3B 3F5FA 3FMOB 4AKHA 2ZSFA 3F8TA 4P32A 5CK4A 2D74A 1G4AE 4PHHA 4MUAA 4EIWA 4Q4HB 1J8MF 3NC0C 3Q5EA 4MA4A 1KJZA 1YQTA 2MSCB 2F9LA 4HEJA 3DM5A 1ZD8A 1ZUNB 2FH5B 1TF2A 4K81B 2Q6TA 1Z08A 1QVAA 1DE0A 1ZAKA 2NIPA 3MWLA 5KOYA 2NO1A 1IN4A 3PUWA 1DPFA 1DELA 4PO8A 1U99A 4A0RA 3TR0A 2IYQA 3LX8A 4QHYA 1W1WA 3I62A 1NLZA 2HCJB 4BEBA 5D3MB 3OEEA 4UXHA 1D9ZA 4II7A 3QKRB 1BKDR 3J81k 2BMFA 4GFDA 1MO6A 2V1UA 1E98A 3THXB 1RE0A 1QHHA 4RFVA 5CM8B 4ZV4A 4TYPA 3B9PA 4YDHB 1GKYA 1BMFA 2B7CA 4DSTA 8OHMA 3RANA 2A30A 1KDOA 2TMKA 2V7QA 4NCJA 4AKEA 1E0AA 2QBYA 1O3YA 1I4TD 3IHLA 4TYQA 2ZIAA 2F1HA 1Z8FA 3RWOA 2A2ZA 4IHQA 1HE1C 1CJUC 2V3CC 1XEXA 1SVSA 4XD7D 1CJKC 1VMAA 2ZI9A 4DVGA 1GP2A 1RKBA 1E2NA 1FP7A 4BFYA 1DS6A 2OBNA 4KVAA 3GJXC 1G16A 1SGWA 5L8VA 1VYVA 4N1AA 3L2OB 5H1YA 1XTRA 2NO0A 2B21A 4LJAA 5AR1A 4B44A 2IS2A 1IXRC 2VHUA 3S1AB 2QP3A 4PX9A 4JJKA 2RHDA 5FBRB 3LY5A 1Y3AA 4KI0A 1W48A 4WBSA 3KQHA 1YU9A 2ZU6A 3MMPA 3GEHA 2GCOB 2C77A 4PZYA 4MYTA 2ONJA 2BJVA 4BASA 3F0TA 4F7WA 1E2JA 3MG9A 4HLQB 1TNDA 2O8EB 1QVRA 4IRUB 4B3DA 2FGJA 3U3KA 3UIEA 3LBHA 1P7CA 5DYGA 1XX6A 1L4YA 2VBCA 3BD9A 4NMMA 5LDDC 1OFTA 2KB0A 2VRWA 1QHHB 1P72A 1W0JD 2AXNA 4V02A 4DLYA 3ZD6A 3GJ3A 2YOHA 2QBYB 2IYZA 5D3QA 4RD0A 1OKKD 4RD1A 1XEXB 1W2GA 1NP6A 1W0KA 1R7RA 4AYXA 5DN6A 5CYOA 2AL7A 3THYA 1R4AA 4A8JB 3PITA 1TEVA 5DNYB 4L8GA 3KJHA 1Q3TA 2QT0A 4AG5A 1X1RA 1PLKA 3SOPA 1GNPA 1RZ3A 2YV5A 2ZSDA 3Q5DA 4Q1AA 1FUUA 1OHHA 4BEJA 2QMUA 4AKIA 3CB4A 1N5IA 1N6NA 3VX4A 4HB2A 1JEDA 421PA 4US0R 5C1BA 2WWIA 2QM7A 4TYYA 1CXZA 2QMOA 2WMNB 1Z28A 2Q9AA 3NBXX 3B1WA 3GLGA 5DGXA 4KU4A 4UNRA 2ZRJA 2FEMA 4JJZA 2ZU0C 1JXMA 2EFCB 2WWYA 4R71A 2RGEA 4AYTA 1DBSA 1KJYA 1XD8A 1E2FA 2Q21A 4FINA 2UZ3A 1GTVA 1SHZA 1FX0B 4B71A 2PT7A 2GRJA 2IYSA 1J7KA 1NL3A 1G7RA 2GAAA 2NO7A 1ZP6A 3C41J 2ZQ5A 2GEVA 5FOSA 1W36C 3LBIA 5H70A 1Q1QA 1G17A 1Z0IA 2BMEA 2JASA 2Q9BA 5FBWB 1E9EA 3VTKA 4B47A 1JNYA 3SS8A 4HLDA 2OCPA 3AVPA 4LHZA 3I1FA 1DEKA 1SXJD 2PX3A 4G5GA 4BLRA 2Q3HA 1R5BA 2ZS7A 2ZRFA 1X8LA 1P9RA 3CX8A 2Y8EA 3WBJA 5JJKA 2HYIC 2NPFA 4LSGA 3B7GA 3SI7A 2H18A 2XNSA 1KY2A 2PEZA 1H65A 3GQBA 4HYYA 2JLVA 1FNMA 1BOFA 3K9GA 1M7GA 4PC2A 2Z5FA 1S96A 1XXHA 4S35A 5DHFA 4I1SA 1Y63A 5KNDA 4UNSA 1RRPA 4PSVA 3K9NA 5DLQC 3QG1A 1SHKA 1E94E 4HLUA 3K70D 4NKRA 2RGCA 3KL4A 4DUGA 4PPQA 4DIEA 1OV4A 2H5EA 2QTFA 2KE5A 4S2EA 5JI2E 1E1QD 1EXMA 3SEAA 3KKNA 1ZC4A 3CKLA 5KSYA 2BM1A 4WXPA 3C7KA 2GKSA 1XPRA 1T8UA 1FNNA 1N5LA 1VYUA 3WYGA 2IX3A 5F9HA 1DAFA 3DDCA 2P67A 1KNQA 2JJ2A 3Q7PA 3DVLA 3K0SA 3G82C 1ZIPA 3UKDA 4DLWA 1EGAA 3PENA 5GJVC 1XMVA 1AIPA 3LVQE 4TT3D 4IFEA 1QHXA 1YR8A 3H1TA 2PL3A 1E9RA 4IDPA 2GZHA 3QOFA 2AFHE 2NOAA 2JLRA 1QRAA 1LNZA 1E9CA 3Q9LA 1EFHA 1UDXA 3C5CA 1H8ED 4B6EA 2BC9A 4X8HA 4XTCS 4B32A 2OSBA 4YMTA 2Z6VA 3JZMA 2IS1A 3GJ5A 5J4YA 1MRNA 1XJ0A 2C99A 3U7HB 3W90A 4D2IA 1CLUA 2IYLD 4KO8A 2VP6A 4TLBA 2C04A 4DCTA 4NCKA 2KWIA 3VR1A 4C0AC 3PEUA 121PA 1ZD9A 2IXEA 5AJVB 4V0OA 4TWZA 4KCGA 1X1SA 1KJWA 4ACAA 2YYZA 3CZQA 4PZZA 4JL6A 4KFTA 2ZRHA 3OFNA 4HAVA 4KVGA 2O8CA 1IOZA 4BLSA 3AVTA 1W2HA 4LC1A 3K0EA 4OHVA 2ANBA 4OL0A 1CRPA 4BECA 2IUUA 5EXTA 1N6LA 1E2EA 1X3SA 4OI4A 4MRRA 2FZ4A 2OCYC 2ASEA 3DEFA 3P4XA 4RD4A 1SQ5A 2X8AA 2VP4A 2ZYUX 2BOVA 5GJBA 1N0UA 5FUWA 3F3YA 4Q1BA 2GTPA 3BXZA 3EA5A 2PZGA 4AK9A 1CU1A 1QDEA 2HT6A 1YZQA 1Z0KA 4HI0E 2OZEA 4WXRA 3CPEA 4TQUS 2ZSEA 4DCUA 4P3YA 5AJYA 4TYWA 2IS6A 2BDTA 2WAXA 1VHLA 4URWR 1HY3A 1AKYA 1W5SA 1GFIA 1WA5A 4O0MA 4LYAA 1KHTA 3AF1A 4Q02A 3WRYC 1GVNB 1KIMA 4D4JA 3ADCA 2GF9A 3UMFA 4M53A 5A4JA 5G3YA 2GXUA 3L0OA 4LYJA 3H4MA 3IO3A 1IJFA 4RJLA 1ZNWA 5J4VA 4X8OA 4YMUA 2GVDC 2QTVB 3OAAA 2I1VB 1FW6A 1TADA 3MWJA 1RIFA 2ZRGA 1KSGA 4IVPA 5JBQA 1LS6A 3ZLJA 3LNCA 4QHSA 1YZTA 4Q1FA 1QF9A 2AKAB 1IONA 1JJ7A 2CE2X 2LCFA 4IDQA 2WTUA 3SYKA 2XX3A 1ONBA 4IKEA 4JLBA 2DB3A 4I1UA 2XITA 4M22A 3LXRA 2H57A 4Q19A 4D4MA 4JVSB 2W58A 3ZYCA 5FPKA 2IYRA 1PZNA 1XEWY 1DAGA 4NZYA 1R2QA 1CTQA 1YR9A 2PMDA 4QNRA 3TUJC 2JJ1A 3BRWD 3TAUA 4CT5A 1VG9B 2DFLA 3IO5A 2HDNB 4WW0A 3GLHB 1LS1A 4P4UA 4QNMA 3ZVLA 3D3QA 1BMFD 1ZCAA 2AHOA 1RYHA 4TQAA 2UVQA 2V7QD 3X1YA 5EE1A 5G3ZA 4GMXA 3THWB 2IXFA 1N6HA 2QT1A 3PEVA 3N2IA 5AUPB 4GL2A 2C5LA 2ZUDA 4LPKA 1QHNA 5CB8A 2C78A 3RAPR 2JGNA 4M1SA 1SVWA 4NE2A 4UNQA 1QHIA 4EPTA 3UG7A 4ZIRB 2A5GA 3U3MA 1NY5A 4EPRA 2NZ8A 4MKGA 5AWFC 2FA9A 3RC3A 1F6BA 5KSPA 3VFDA 5L3RA 5KDOA 2QQEA 1GKUB 1DAMA 3QKSA 3I61A 1ZU5A 3TVDA 1G9XA 1Z29A 3FMPB 1JXOA 4OQFA 2HXYA 3LLUA 2IWHA 5FUVA 1UPTA 2JLSA 2GETA 1ZNYA 4EPVA 2QAGC 4LJ8A 4U5XA 5TARA 1OFUX 2BCGY 2IYWA 2O8FB 1JR3A 4NHOA 5DISB 2VSXA 4D82A 4KFSA 4QJ5A 2HJGA 1FTNA 2GK7A 2KBEA 3U7EB 1XD2A 2IUSA 3V9PA 4GRAA 1XB2A 4MGYR 4Q9JA 1CBUA 1RJ9A 4QGFA 5JS7A 4PO1A 1G3MA 3B2EA 1KZ7B 4FMCB 4H1UA 2RGGA 5FL7A 1Z22A 3QY0A 2GEUA 1G3QA 1NBME 4HAUA 2DR3A 3WNBA 1W0KD 4NYJQ 5K8LA 4PQFA 2KJQA 5GVSA 1YZUA 2X77A 5DN6D 4MDFA 1A2KC 5KHOC 1U98A 3HYTA 2FWRA 3GD7A 5DI3A 4BQSA 4F4CA 3PXGA 1C9KA 3W6OA 3AVXA 4FIDA 3WP1B 4FMCF 4IXNA 2VL7A 4UKDA 3LX5A 3ZH9B 4BWYA 4QHTA 3DMNA 4FWTA 4Q5IA 2DFNA 3JVUA 1TQDA 2ZITA 4M1TA 2V8OA 3EIQA 1E2LA 2CLDX 3GLGE 4F93B 4MRNA 2FX3A 1Q1EA 4TMWA 1G18A 1NKSA 2EU8A 2ZSAA 1OKKA 3VMFA 1OB2A 3VR6A 1I4DD 2ZRAA 4XJXA 1D5CA 4FXPA 1LB1B 2ZAMA 1XD2B 3CX7A 3QPWA 2XZOA 4JVNA 3T5DA 1W36B 4BFZA 4EJSC 2FPKA 2W0MA 4PPGA 3H2YA 2CJWA 2QL6A 3ASZA 2X2FA 4MDEA 4URVR 4JLVA 4DDUA 4M4SA 1ZU4A 2PZFA 3QQ5A 2AK2A 1SULA 3CF2A 4JS0A 4QJ4A 5JHHB 5M04A 2PMKA 3A58B 2VP5A 1P9NA 3WYAA 2RGXA 4PR0A 4Q4LA 1UF9A 3OIYA 3HU1A 4GDFA 1O87A 1EFRA 4W5HA 5BWMA 3BFXA 3A6PC 2WIAA 1Q12A 2XSZD 4L4UA 4GP6A 1F60A 3U61B 1XDBA 1M6NA 1ZINA 2HF8A 3MRSA 4CEJA 4WZ6A 3AKEA 2P2LA 3KJIA 3QXHA 4B3BA 3W3AA 4M9XA 4C2UA 1XXHE 2JCSA 4ZCIA 1ESNA 1KI4A 4ARZA 4AYWA 5JEDA 2OFXA 2WSSD 1Q57A 1P2UA 4G0NA 5FUYA 1SKYE 5IRCD 1M8PA 4HZIA 2IS4A 2EWVA 1VG8A 2G1JA 3SQWA 3T34A 2QRNA 4BLQA 2X19A 1M7BA 1SXJA 1ZRHA 3QJYA 2P5SA 1MH1A 3CLVA 2CJWB 3RLFA 2HT1A 2JJ2D 3EZ7A 2J0SA 2K5UA 3KXKA 3QI2A 4QGAA 4C3ZA 1DVRA 5J40A 1YR6A 4EFNA 3O8RA 4PXAA 2G88A 4LBWA 2DFTA 1E1RA 2BM0A 4D26A 3QIAA 4M9ZA 4PC1A 4X8MA 2ATVA 3CX6A 4A0HA 5HTKA 1N3BA 221PA 4F92B 2BWJA 1XFAA 1NSTA 4JVMA 2C9OA 3QKTA 3TH5A 1TEXA 2CMKA 3TRFA 2XTZA 1E99A 3AVWA 1Z0AA 4EDHA 2ZANA 4OHXA 5B2ZA 5FBLB 5FTLA 5JJLA 3B1XA 1E1QA 1P60A 1BYIA 2WPDD 3AF2A 3LDAA 2VH5R 3EASA 2ZRKA 4DLUA 1UBFA 4ARZB 2REBA 1UKZA 4BFVA 2BKUA 1ZMXA 4URXR 3GJ6A 5JRZA 1GL7A 4C0JA 4JMPA 1DAKA 4NPHA 2XXAB 5CB6A 4DC9A 2RMKA 1VPLA 3OFND 3OESA 3U2QA 2HF9A 1XCPA 3QSYA 3T5GA 4TLEA 1VG1A 3T12A 3PR1A 3AQ4A 2D2EA 3GPLA 4HUTA 3DKPA 2EFEB 2DBYA 2G3YA 1A5TA 1UEIA 2MSEB 4GZMA 4HSEA 5KNBA 2Q3MA 4DZZA 1G19A 4G5OA 1MO5A 1CULC 1KKMA 1KMQA 1W46A 3KXLA 3SBEA 1QBKC 3WNCA 2GAOA 2XJ9A 1RW4A 2J0UB 2O8BA 2AWOA 1R10A 5BQ5A 3U3RA 1TU4A 2IBMA 1II8B 1DAHA 4Q4JB 1EWQA 4MQBA 1PLJA 1ZM4A 3DZ8A 1P2SA 2QI9C 4TYNA 2EVWX 2D4HA 5KO2A 3ZQ6A 4V03A 2RH5A 4FCWA 3RWMB 4Z8XA 4Q4HA 1ZNXA 4A2QA 3EZFA 4ZI2A 4NYIR 4JZKA 2EYUA 3FGNA 4EPWA 3ETLA 1JBKA 2GZDA 1EESA 2J3EA 1AS2A 4Q7KA 2VHTA 3HR7A 2FSFA 1GL9B 2HJVA 2WIBA 4G5RA 1HYQA 5AK0A 5LB2A 3U6BA 2UKDA 3VU9B 1RPZA 2VYFA 4D81A 2WWFA 2JIZD 3QBVA 2CLSA 3KUCA 4I1VA 1KO8A 3RRNA 2J41A 3A4MA 3L82B 4ZCMA 4EUNA 5C46F 1ZNZA 1R0ZA 1UBCA 3X1WA 5JFGA 1D8TA 2QAGA 4OHZA 3QKRA 4B3FX 2HYDA 2REOA 4M0LA 3THXA 4Q18A 4JLPA 3KJGA 3RRZA 3SJAA 2OXRA 3DL0A 4BLTA 3BORA 4HATA 3BC1A 2ZYWX 1A4RA 5SZHB 4QBGB 3V4RA 1GRNA 3WBKA 2C9CA 5EJEA 3IDQA 2A7QA 1G8FA 1ZW6A 4Q9KA 2JJ1D 1S1MA 2PCJA 3N5CA 3RVBA 3TAHA 2DWOA 4DDTA 5G53C 3KTAB 4BRWA 2QSZA 1KI7A 2ZE8A 3AUYA 3BBPA 4UXJA 4HAWA 4RY2A 3FFBA 3LBNA 2RGAA 1UEJA 2GXSA 2XB2A 3WHLA 4KYIB 3E1SA 1OYYA 1WB9A 4HB0A 5IK2A 5J47A 3ZVMA 1XZQA 1N5KA 3NHAA 2W00A 3S1AA 4B2IA 3ICEA 3W5IA 1N6KA 3L8ZA 3B5JA 3HYRA 4AIIA 4OQXA 4ZI3A 2GCOA 2QROA 4MUBA 2GDJA 3E2IA 2J1LA 2NO9A 3TUIC 2QPOA 3THOA 3TNFA 5HKKA 4LHYA 5AJWA 2BJWA 3EIEA 4A15A 2O8EA 3DOFA 3REGA 5JI3E 3TJZA 2JJ8A 1R5NA 4C0KA 5EZ5A 3BGWA 2QAGB 2QGNA 4IDHA 2R44A 2ZE7A 5EUMA 3AKCA 2GCPA 4URYR 3EWAA 1CIPA 1NN3A 2QPTA 1G5RA 2VF8A 4FMBB 2NQ2C 2ZJBA 3BS4A 5J5CA 4DHEA 3IQWA 4XIGS 3SC3A 3KQLA 1P9WA 1GITA 4HDCA 1G8PA 1JR3D 4I99A 4DDVA 4OKSA 4BGDA 1W4BA 1NIJA 4WVFA 3A1UA 4DLXA 4C2TA 1RRGA 2GJSA 4B2PA 3K0CA 4B33A 1W36D 2RAPA 2ODEA 2IC5A 3KB2A 4HB4A 4A8JA 1TMKA 3U5ZB 3U7FB 2WVJA 2J59A 1WRBA 2NG1A 5FL7D 1G5PA 1VCNA 2BBSA 4DBLC 4ON9A 5L3SB 3N70A 4US1R 1RRCA 3AM1A 3RSOA 1NSFA 3RS2A 4LV5B 5CLLA 1EK0A 2FZLA 2QGZA 5E7IA 3WMFA 3GMTA 1GUAA 3WNDA 4Q48A 3MSXA 2NPIA 3FE2A 1LV7A 4DDWA 3PG5A 4C0QC 2IYUA 2MMGA 1OFHA 1Q22A 1Z06A 5FBQB 3TLXA 2V4ZA 4OK6A 4AWXA 3TW8B 3WP0A 4JLKA 2CLCX 1Z83A 4C30A 3B78A 2GESA 4C9BA 4D4KA 3MFYA 1MV5A 2YWEA 4XH9B 3ICQB 4UJ5A 4ASUA 2CK3A 4GOXA 2WAYA 3FKQA 4Z54A 2RB4A 4QG7A 1FX0A 4RFSB 1KI6B 2ZRLA 2ZROA 1BYUA 4Q7LA 3LA6A 1CJMA 5HCIA 1PUJA 1NN0A 1NN5A 3EPKA 1ZM2A 4EJSB 4JLAA 2ZYVX 2WJYA 3LWNA 1AQYA 4RD6A 3T35A 3ZS8A 3SU8A 2W2XA 1YZLA 3SNHA 3TQCA 2YKGA 1W5TA 3RRYA 4DIDA 5C2JB 2JATA 3UWOA 3X1ZA 1JQLB 2IF2A 4QFMA 2WMOB 2YHSA 2Q9CA 4HDOB 2QP4A 3KUDA 3DKVA 3D8BA 5F3WB 2FMXA 1Z6YA 5LD2C 1E4VA 4J0QA 1T5LA 4URUR 3M0EA 1U8YA 1U2RA 4KXFB 1NVWQ 1BIFA 1R0XA 2DFKB 2JDID 2W6JD 1IXSB 1EFRD 4YMVA 1IY1A 1U94A 1E2GA 3ZJYA 1NVXQ 2GXQA 1IN5A 1OSNA 2D06A 4B73A 1OXTA 3RNLA 5TDHA 4PANA 1UAAA 5G41A 1HT1E 5IF9A 5HR5A 2EW1A 3U6KA 4MH0R 4C0BA 4CF7A 3EPHA 1UFQA 1A2BA 3K09A 3C16C 4R7ZA 2XGJA 2J0VA 1NKTA 2IK8A 2HUPA 3BFKA 3E5HA 4R9UC 3SZRA 2GZAA 3CUEF 1T9HA 4O2LA 2ERYA 1TPZA 1NG9A 1L2TA 5IT5A 4I4LA 3ZZ0A 1JB1A 1EWRA 2F3TA 1TL7C 4NYMQ 3ZD7A 2AN9A 2YWHA 4TSFA 1T0HB 3U44A 1IY0A 1YHNA 4AI6A 2GBLC 3IGFA 2FG5A 1SXJE 5JLJA 1VYTA 5DHAA 1UADA 4Q1CA 4NL4H 5AUNB 4BLOA 5J4KA 2XSZA 1C4OA 1DARA 3NTUA 3TE6A 1A82A 3W34A 2J45A 3ZZTA 1R6BX 2VHQA 3H84A 4CRWB 1HQYE 1E1RD 3PVSA 3OE7A 1XEWX 3ND9A 2YWFA 5FPYA 1FPMA 3OIWA 2ZYTX 3M6AA 3PUXA 3ECCA 3LV8A 1T91A 1OFIA 1T0JB 2WSSA 3CONA 4LPSA 3QXJA 4NCIA 1RYFA 2A9KA 3RC8A 1G3IA 5AJZA 2PH1A 4BRUA 2PLRA 3TGPA 1IAQA 1HTWA 3DPUA 3VHXA 2E87A 4EFLA 4PQYA 4CEIB 3FHCB 4PHGA 2ZPTX 3C8UA 4OHWA 1E79A 3T15A 2NTYC 4W7SA 4TMKA 2GJKA 1E9SA 1RFLA 2B7BA 1N2CE 2WOOA 1KAGA 3TBKA 2FSGA 5C4MA 3U44B 3GJ0A 4D4LA 1CJVC 2DPXA 3PCRB 5JS8A 5G40A 1KK1A 4QL3A 4DJTA 4G01B 3GLFE 1KI2A 3LFUA 2F43B 3IEUA 1ZD1A 5CJ2A 3UWKA 2AD5A 1DTSA 4N0EA 3UMRA 5JSZB 3OEHD 3H0KA 1IBRA 5DO9A 5FTNA 1NIPA 3EXAA 4A9AA 5LPNA 1NJFA 2ZUCA 4M1OA 1S1CA 3GLIB 4ZDJA 3T61A 3WRXC 3CNLA 4YQFA 5KSOA 2R6DA 2D62A 2WPDA 2ZJZA 4PZLA 2YOFA 1KZGB 4IOLA 4LJ6A 4PSAA 2WJVA 5FFMA 1PJRA 2VA8A 1TF5A 4V0LA 3UMSA 2IEYA 3NKVA 1LY1A 5EE0A 2ZRIA 4ABYA 5B58C 2OO7A 1GKIA 2OAQ1 1V43A 1IQPA 4ESVA 1SVIA 1FMJA 4LYHA 2GF0A 4Z1MA 5JWRA 1TF7A 1XNJA 2VP9A 2H92A 1Z2CA 1E69A 3QUSA 2DYKA 2FSHA 2QP9X 2FSIA 2XOKD 3H86A 4AD8A 1P61B 4BZQA 5FOXA 3NC1C 1P2TA 5BW8A 1Z5ZA 2FU5C 2ZE6A 3VHLB 1RVDA 721PA 4F38A 1XMIA 2PJZA 5J4LA 3BIFA 1DO2A 3CF6R 1AM4D 4IDNA 1N6OA 2VHCA 2H16A 4QBHA 4LV6A 1V5WA 1IN7A 3IKJA 3AVUA 3VNVA 2OEPA 2C96A 1WP9A 5KDLA 3NEJA 5TB5A 1MR3F 2IW3A 2RGBA 5J4HA 1W4RA 2G0TA 4IFBA 1OIWA 3GLHA 1CF4A 4NYIQ 3FYHA 4M21A 4Q4AB 2IL1A 4GOKA 3O8CA 1UBEA 4V0ME 3THWA 2I4IA 2OXCA 3I4LA 2ODBA 3KZ1E 4FMDB 5KNCA 3SR0A 2R9VA 821PA 4TTQA 4Q66C 2OV2A 2ZJOA 3MLEA 2IYXA 2FFBA 3CWZA 2KSQA 3RRMA 2FE4A 2JIZA 4ZIRA 3KQKA 1KK2A 1L4UA 2EFGA 4JKYA 4R2IA 2NMVA 1NN1A 3QPVA 3EX7C 2J87A 2DY1A 4L5BA 5IK2D 2W0SA 1X8JA 1AZSC 2IF0A 4LCBA 1VHTA 2PBRA 4FMDF 3EG5A 3CF0A 1AA9A 1E9FA 4CEHB 2FF7A 1G6OA 3EZ6A 4CVNA 5AUQA 1E2HA 4QRHA 4GMDA 1ZC3A 3R8CA 2RKOA 4C0LA 4Q1EA 1NNEA 1XMJA 5EE9A 4L16A 5HKKD 2ORVA 3DHWC 4RVCA 3VR4A 2RHMA 4NONA 2WWXA 4TLAA 3I5YA 2VF7A 2O8FA 3QENA 2QM8A 4OK5A 2MMCA 3OZXA 1VTKA 4G5QA 3ZIAA 3CIOA 4LRWA 5FR2A 3L8YA 2F1IA 4EQ6B 2WJHA 4DEYA 1OH6A 3BB3A 3CW2A 4YC7A 1NRJB 3L0PA 2REXB 3O47A 2YINC 3HPQA 5K8UA 1E2KA 3AP3A 1F2TB 2QA5A 3UK6A 4JIMA 4JLJA 4OQMA 4OQNA 4QGGA 2VQSA 1HQCA 1FOEB 2BMJA 3DZDA 3FTQA 4A6XA 4NDZA 3EZ2A 4Q21A 4B48A 2XZPA 2D3WA 1E2MA 1U0HC 1TUEA 4KODA 1XRJA 2ZETA 1N6IA 1U9IC 3SBDA 4YONB 3L0IB 3BH0A 1VKJA 3PFIA 4NBSA 4XTRA 1G4UR 1YVDA 2IA5A 4PHFA 5GADl 4TL7A 3TUZC 1CP2A 2QNRA 4JYBA 4AY2A 1XCMA 5BN5A 2QORA 1N6RA 4KITB 4ZO4A 3A37A 3IIKA 4WZAE 4ZDKA 3HDTA 3AVQA 2ORWA 4TQ9A 4LGMA 4ASUD 2CK3D 4JKIA 4LBVA 4EPXA 2ZE5A 2Q3FA 4DB2A 2PEYA 2RGNC 4JT4A 1VCIA 2WICA 4EPYA 2C2HA 2F6RA 2XJ4A 3T06B 1T8TA 4DRZA 2V55B 1BO6A 1XP8A 4LZZA 4DLSA 3UPUA 4JSTA 3LLMA 4PO9A 6Q21A 1HEIA 4NP6A 4MITA 3WMEA 1UM8A 2ZRCA 5LD2B 2EFHB 1Q3HA 1HH4A 1MKYA 5HZHA 3A8TA 1JECA 4DCSA 3NBYC 1H8HD 2ECKA 1S3GA 4KJZA 1I4LD 2BBWA 1EFTA 2GJAA 2CXXA 2LKCA 3NBZC 3B1ZA 5EZ6B 1CJTC 4HAYA 1KI8A 2OFOA 1YKSA 3FHTA 4F4JA 1OYWA 1E6CA 3RHFA 4GOJA 4I81A 1G7SA 1P73A 2WHXA 3CRVA 4LX0A 4AURA 3BB1A 3IIJA 4D6PA 4M1WA 1OW3B 3AEZA 2MSDB 2NZJA 1KMHA 1KI3A 4QOSA 1FTSA 3NHBA 3AVOA 2VTKA 2W6IA 2XNDA 1LVGA 1MO3A 1G64A 1G7CA 2F1RA 1XTSA 1XD9A 3CPHA 1WQ1R 2C98A 1RC8A 1ZUIA 3DO6A 1ZM9A 1KTVA 1ODFA 1YRBA 4MGKR 2Z43A 2JLUA 5EE3A 3NVAA 1GZSA 2JAQA 1XF9A 2J7KA 4Y0VA 3KQNA 3LRPA 4TSFD 4PC3A 3TMKA 2WV9A 3SYNA 2A5FA 2HXSA 3SDZA 2JDIA 2W6JA 2GK6A 1OT3A 3HU3A 3I92A 2V1XA 2IYVA 3KDSE 2FFQA 3RYTC 3A1VA 2G0NA 5DI9A 3A4LA 3SFVA 3IHWA 2FGKA 1HURA 3OE7D 1R8SA 5DSZA 4Z8YA 3FB4A 3MJRA 5JEEA 5E3HA 3BFVA 4JBYA 1M1YE 2EFDB 4A4DA 1COWD 5KU1A 5E4FA 2QMHA 4IJMA 5JMTA 1OJLA 4OBEA 1AGRA 3G0HA 1KMHB 2QN6A 2XXAA 1XTIA 2PT5A 4A2PA 1TAGA 1ZM3A 2VPPA 1II9A 4HZUB 4C7OB 1TU3A 4E22A 5B64A 2QG6A 3LXXA 2H8KA 4RCZA 1FQJA 1E2IA 4DLVA 2P6RA 1ANKA 4HAZA 2ZRNA 2CBZA 1E79D 3QF4B 3B9QA 1GSIA 4TTRA 1E3MA 1AS3A 3QVUA 4PFSA 3GFOA 1OPXA 2N46A 2J0UA 2O0JA 3NDPA 4FI3C 4XVQA 3FVQA 4Q9IA 3W8RA 4B3GA 1II8A 4TL9A 2CHVA 4Q4JA 1GNRA 1IXZA 5ELXA 3SQXA 3BWDD 1N0VC 2J5XA 1AK2A 2E9SA
chains in the Genus database with same CATH superfamily
3RRXA 3S99A 1UBMS 4ID3A 3A2LA 5HZKA 5L3VA 2WSBA 3CNEA 4EJ2A 1GU7A 2VIIA 2QD3A 3L6EA 1POWA 4MVXA 4JYZA 3EDQA 3DHYA 5REQA 4PY2A 3LP6A 2NUAB 2ECPA 1DC5A 4BMXA 5B36A 4YCMA 5EXPA 4K6MA 2B61A 5DPMA 3THRA 2F4VB 3GROA 1WVGA 2JLCA 1YMQA 1BE6A 3OF2A 1E66A 3MGBA 2FEPA 2B8TA 2O3TA 5EZYA 2WIGA 5IHPA 3GP8A 3ZHTA 2ZPUA 4MGIR 2Y71A 4EZIA 5BR1A 3QU7A 3HR8A 1E9AA 5B6PA 2WU8A 1IN6A 3EOZA 2QIOA 2BN4A 2C5SA 4NH0A 4BJ3A 1JQBA 4MAMA 1X94A 2WIDA 4U7DA 2CVHA 3COYA 1GR0A 2GBPA 1ESCA 4O4HA 1H2HA 3WIDA 4CCSA 1X2BA 3MUEA 4LYFA 5IVDA 3OUUA 2GBIA 1JAHA 1VL5A 2PZEA 1YB5A 2JEYA 1J99A 1KETA 3EXG1 4ZRDA 3TI9A 4BZPA 2IU6A 2WJ6A 5C7LO 5KYKA 5TMPA 4P4GA 5LBIA 1WMEA 2ZJFA 1L4BA 4G1MB 2AOXA 1NVVR 2WM9B 3GJ4A 4PAMA 3AUSA 3HPRA 3OZWA 4JHLA 5SV2A 2PRIA 1FFAA 1MA3A 4IXWA 4WGFA 3TTVA 1SURA 4EG1A 1K97A 1JHDA 4Q7JB 4B85A 3E3LA 4ZCTA 2V45A 2QVLA 5GJWC 1KAHA 4RZUA 3KFXA 2AFHA 5T4FA 4PWZA 1TKAA 1CETA 1ZX1A 4FOLA 1PZEA 2QR5A 4TV8A 1DWOA 1BVUA 3CBQA 4CW7A 1JAIA 1EA5A 3N8IA 1AO0A 1W8IA 3AGPA 3HRIA 2CNOA 4NOKA 1M2WA 4MUXA 4K03A 2ZJAA 1TUIA 3OHPA 2QSUA 2O5CA 1GG2A 1DG1G 5ICGA 3Q7IA 5A9RA 3GFSA 1I32A 2XOKA 4HUQB 3UM9A 3V1UA 3KZXA 4JB3A 2A0UA 4B2LA 2CZQA 1VB3A 1QH8B 2IUFA 2XMZA 2Y3IA 4QARA 4XDGA 2HRQA 4CT4B 4HN2A 1BRTA 1HT2E 5IARA 1D1QA 4N7JA 3RU9A 1Y3HA 4RK0A 1NPTO 2IPLA 3HWX1 3RTCA 4WACA 1KMMA 2P9BA 3DTNA 2W70A 4ESOA 1PDWA 1GARA 3O4IA 1J56A 3SFZA 2FG6C 1IM2A 2YJ3A 2M32A 2H9IA 3G1TA 2XDWA 1W44A 1XWIA 3KZCA 2J3MA 4L9SA 3ZBUA 4S1NA 4AJ1A 1X13A 2CEKA 4MS1B 4CIBA 1TM4E 4FLFA 4K2AA 2H9YA 4C5CA 2GRAA 4NDAA 2ZAOA 1JMKC 1LF5A 3BJMA 3PUZA 4H4CA 5IAEA 3BULA 1G7TA 3A7DA 3SEZA 2GVZC 3G0OA 4DCPA 2XH8A 4LVNA 4AMUA 3MJHA 3MJSA 2ZUFA 1PW5A 4DFDA 1S9HA 1OB5A 2F1JA 2H7VA 1VI5A 1PGQA 2R11A 1KOLA 1FNSA 4AC9A 5A9SB 5JTTA 1GLNA 2PBFA 3L6OO 3QVSA 3DOHA 1QKJA 1SUCA 2HK8A 2R8RA 5KYTA 2YMPA 3I04A 4F9EA 1YQGA 5KWEA 1E8NA 3Q9UA 2BHTA 1QANA 3CNNA 1KMNA 1NBEA 1ZGBA 2I29A 2O48X 1THMA 2CZCA 2BKEA 2JFYA 3GWGA 1ISIA 1CNFA 1J8YF 1P0QA 2GNOA 2ORED 1XZPA 3KKQA 3R5SA 4IO1A 3L01A 4J2OA 1HZZA 4K40A 5ANRB 1UJ4A 4NMLA 3STVA 4QVIA 2QN3A 3BGDA 3D8RA 3HL0A 1EG7A 3LHFA 4ID9A 2Z5GA 4W99A 5A9TA 2HK7A 3IE0A 4K6CA 1TEHA 1K6MA 1E1DA 3A4NA 2FQXA 3GCWA 2JLWA 1RXEA 3HJAA 4INZA 1HQKA 1MIOA 4H08A 1MO4A 4YIHA 4EHIA 3KSBC 3ITDA 5E3IA 4A36A 1JQAA 4Z9YA 4G1UC 2JIBA 1MB0A 3CISA 1C8KA 2JI8A 1B73A 1YUMA 2BHRA 3V55A 1TMOA 1W5BA 5FOVA 3QG5A 3WLOA 2PQ6A 2C1XA 4UOEA 2YFHA 2VBGA 5JXWA 4CQMA 3AERA 3PUKA 1M2EA 2CLKB 5DK4A 1DWQA 2PX0A 5TEVA 2WM8A 5FWYB 3IUMA 5KOHB 5KHAA 4F45A 2PGNA 2AK3A 1X42A 2I5PO 1K6JA 3SQLA 5FI1B 4KVFA 4LVOA 1S3SA 2WW8A 5H5JA 3R20A 2ZVQX 3BQNB 1PKEA 2WG2A 3BPSA 3BTUA 2WQZA 4B6GA 2ZXUA 1O57A 2B92A 3HJCA 5JJIA 1FJHA 1JG1A 1OYVA 3JWJA 3QFCA 3A32A 1B6GA 4JGBA 4RJJA 1RTTA 1DINA 1D2MA 4YRPA 1VSBA 3R0XA 4Z86A 3C7CB 3TQRA 2YZ2A 3T99A 4AKTA 4QGBA 2A5JA 5L4NA 4U5QA 3UJCA 1C5KA 2WDZA 3GARA 4TV9A 5M29A 2WNHA 4U2CA 4QXAA 1JZQA 1CD5A 1GEEA 1CRZA 2HN9A 3E9QA 3IKVA 4KO3S 1ZH4A 3NTXA 1GDTA 4X60A 1N2XA 3E0XA 3A1TA 4KQXA 1FLAA 1X1AA 4AT1A 1AXGA 2ZBUA 4NU8X 4GI7A 3VVBA 1TA0A 1ZK3A 3QXCA 1IJKA 3J7TA 4YJ3B 1QQ6A 4EOGA 1C3LA 3BCHA 4HGZA 4LOJA 4WLOA 3UB4A 1XIVA 2IOFK 2W2VA 2XZDA 5I45A 3O8BA 1SZDA 2ZB3A 4CR8A 1PJLA 4WKGA 4J49A 2GTIA 4JC4A 2Q7DA 4E09A 2VBFA 1ISSA 3TSWA 1E4YA 2ZSIA 2ZWVA 2ZB2A 2R1VB 2LW7A 1KSHA 1WB5A 1A95A 2X9NA 3GEIA 1L0BA 4CMJA 2FE1A 1S0UA 5CX1A 3NIDB 4OP1A 4M8NE 1N2JA 1ZBDA 2WHEA 5JANA 3CRQA 3S1LA 3SS9X 4X3CA 1FDVA 4Z5XA 5C81A 5CXXA 4BCCA 2OGUA 4ZICA 3E3AA 4G25A 1B0AA 3KSUA 3RS9A 3U39A 2I4OA 4FGLA 4AN1A 1TYBE 2JLZA 4EUFA 3LRXA 1NMSA 2IPOA 1MEOA 2FSUA 3D31A 1J4AA 1Z75A 3F74A 1H2XA 4J0EA 2QJTA 2YJ4A 4KQ1A 1G21E 4GKBA 2HMUA 3WKDA 1XVUA 2IYFA 1ZIOA 5LJIA 1FDSA 1X7DA 2XPCA 4GVLA 1YS7A 4REMA 3W8NA 4NHEA 5A3JA 4CYMA 3VISA 1X6VA 3OD5A 2IEZA 1H4QA 4HYQA 1V4VA 4GSYA 4Q47A 4EA8A 3LQQA 3HUEA 2Z1NA 3AHEA 1Y0BA 1FXWF 3O4FA 3Q2OA 1Z4MA 1UJCA 1IHUA 4DB2A 2WJJA 5FH9A 3BMNA 4D0NA 3B53X 5JNUA 2PUTA 5JRJA 3Q7EA 4KR6A 3O03A 1L5FA 1TT7A 1V8BA 2O2EA 4F4IA 4BFXA 2VYNA 3I8XA 5F73A 4YPFA 1SOMA 1U2DC 3PIIA 1RP7A 2JGFA 4S1OA 1A7KA 2EFYA 1U7UA 3IQFA 2OB2A 1FRZA 3O4JA 4NENB 4V0KA 1U90A 3K5PA 1LZKA 1WF3A 4QDZA 1QGAA 1XV5A 2FFHA 1W29A 3QX3A 5KSWB 1JALA 3PU6A 4FNOA 1X8KA 3RG2A 4MDHA 3B12A 3BJIC 1QP4A 3MJVA 1E20A 4WNCA 1Z5VA 2D6FA 4CLXA 2DZDA 2ISQA 3K6JA 1O6CA 2WZDA 1AKVA 3T3OA 3EEQA 3PJEA 5FWAA 4NXMB 1AKRA 2G83A 1O96B 1LJLA 5EFZA 2F43A 3Q7RA 2AYZA 5JMOA 4DR5B 5JSZA 4B76A 3O1JC 1CF2O 1XVIA 1WUHS 2QVBA 1CE8A 2EG9A 3PDHA 4LZJA 4A0GA 4I50A 2B0JA 2X7XA 3D8NA 4LDPA 4E7OA 4RORA 5DH9A 5AW3A 4QXRA 3WRWA 4H7EA 1WDLA 2E1PA 3W77A 3WV5A 1U8TA 1ULUA 3QELB 4JFRA 3KEQA 4JXXA 4FWIB 5ULLA 1S4QA 3GEDA 1XJQA 2X0RA 3OCUA 4MO9A 3THYB 2ZBFA 4JQZA 3WSWA 3KKMA 1J0DA 1SKQA 3QWIA 5IP5A 4FK8A 3FVWA 4QEZA 3MMNA 3K35A 4MQUA 3ESYA 3H5IA 3DDSA 3V4SA 3FDIA 1ML4A 5DIFA 5E3JA 4DY6A 1F8GA 1RMYA 3L8FA 4TLMB 4XUDA 2BONA 3DV9A 3RHSA 2ZJ5A 1BN6A 1RZRA 2OV8A 1CSEE 3VR3A 1RBZA 1WG8A 4H9GA 4JVLA 3BTVA 5TJHA 1QR2A 1YS4A 3JD2A 2ZTLA 1D9XA 1U1FA 4ZAXA 1JFVA 4QDJA 3PL5A 3B3AA 4WBNF 3WLRA 4ZZ3A 3FPEA 1Y34E 1D1TA 2F64A 3I0MA 4XXHA 1EUZA 4JKOA 1N4AA 2EOAA 4IXDA 4J90A 4ZYYA 2JL1A 5F1OA 2JBAB 1NBIA 2JLAA 2Y92A 2XYPA 3RC1A 2PD3A 3K5IA 3D5TA 3LWZA 1XMSA 3PEWA 5FOTA 2EC5A 4D4GA 2XUPA 2H1SA 5IDVA 5JFOA 4FZRA 4KG7A 4L28A 3IALA 1OILA 1PFQA 1WCYA 3IXLA 3G6KA 3KV3O 1ZSYA 5HJ2A 4FS8A 1M5TA 5I5EA 3B85A 1L7XA 4P7BA 2A9VA 2A3RA 3DMPA 4NPCA 1DOZA 3VJRA 4U7HA 3KQVA 3W5VA 1P80A 3B9BA 3DT9A 2RBEA 2IZ0A 2YV2A 3I2HA 1OE0A 2BFFA 1O8BA 4P5PA 3WYNA 2CKMA 1WDMA 3D3WA 4XASA 3K1YA 5LZ8A 3R7SA 3V80A 5KSZA 1UINA 3VPBA 3O31A 4OKNA 3LP8A 1SVKA 4R84A 4NNPA 5AYVA 4AUNA 4OUKX 2FSSA 3BJRA 2VEDA 2SNIE 4FCTA 4EAAA 2XB4A 2PZLA 5CDFE 4ZHQB 3X1DA 1II0A 1QG2A 3BD7A 4OXNA 3QE9Y 1UPBA 4B5KA 1N2IA 1XZAA 1ZVQA 2V59A 5DYTA 1SHTX 3ORSA 1J2UA 4YP1A 2QY6A 3NZEA 2ZS8A 1C0PA 4DV4B 1NTRA 3OPYA 1CS4C 5DOVA 1GUYA 1HM5A 2AT1A 2Y1OA 1Q1GA 1S2DA 4MPTA 4UNPA 1Q21A 3DAPA 1EX7A 3RARA 2QV0A 1GGVA 1Z0UA 1GGHA 1NXTA 2CCKA 4YYEA 1AVTA 1DC3A 4EELA 1WTCA 5FUBA 4MW0A 3RABA 3WZ2A 4RANA 4B31A 4NLLA 4P5EA 2ZJ2A 2Z04A 2I2WA 3RDPA 3ON5A 4OJKA 1CB0A 1M9NA 1UMDA 2NV0A 2I2XB 2CL5A 2CD9A 3UJBA 4YCBA 2EYQA 3O6VA 2QRJA 3MUFA 1D04A 1QE5A 3BMXA 5IJ0B 1FJGB 1LWNA 1XALA 2Q6LA 1JG7A 4I3FA 2G28A 1EXNA 5J3JA 1ODTC 1T24A 4KLCA 3PRKE 2O3RA 3RIXA 5BSHA 1K88A 1OLOA 2UZIR 2HXGA 2X2EA 2CMGA 1K3FA 2WHRA 2YY7A 3CFYA 2GGSA 2J31A 1I2DA 3SIXA 4OKIA 2CXUA 4B3HA 1AN0A 1GU0A 1RI2A 3ONEA 3ERCA 2X7HA 1R8YA 1XUOA 3LYUA 1E2BA 4DLBA 4FN5A 3KR2A 1IOVA 4JI6B 3R7DA 2FFJA 1F3OA 5BUQA 1J21A 4F3KA 4CIDA 4L5CA 1LC0A 4PTLA 4BDSA 1UP7A 4QGHA 3GZNB 4C7VA 3PXDA 2I1LA 4M76B 5C8DA 5DTEA 9MHTA 1GZDA 4ZT6A 4QYSA 3TL6A 3CRNA 4JYAB 1E0SA 3A36A 2X5KO 1WVIA 3AW8A 4MEAA 4B3BA 4ZYVA 3T1TA 3K16A 3U7GA 1B6SA 4NFHA 1RXYA 2QTRA 4XR9A 5EP2A 4ZOBA 5B3AA 2DLDA 4MI3A 2OCAA 2OBBA 3MT0A 4TTPA 1L8QA 4ES6A 3T5MA 1FZTA 3ECAA 3JD3A 3PC3A 3IPYA 4Q34A 3L1HA 1KYQA 2Z3VA 4RMNA 3C6ZA 3JAMA 3HCCA 2QVCA 1KZHA 2ON6A 2PXAA 1KP2A 2AF4C 5CIYA 2O8CB 2IHJA 4YAWA 3VKHA 3OPXA 5DJ5A 2VXBA 2HO4A 1WIWA 4MMZB 4AECA 1QDLB 1E0KA 3CLUC 1Z5WA 1G20A 1OXSC 1J5EB 3TSYA 3TLZA 2I87A 2JIMA 2O0HA 1P7ZA 2WT4A 2VWHA 3CZPA 4HUJA 4ZZIA 4BC1A 5EUQB 1VKNA 4FQ7A 4XGQA 3WL3A 1ORVA 4AICA 4CKWB 3WTCA 2HCTA 3GWZA 4BPBA 1O6FA 3DC2A 1YL7A 4XLTA 1NLYA 2P2GA 4QOIA 3BERA 4BZXA 3I5XA 1K2WA 2YFQA 4O4IA 5K6AC 4BQQA 1KYIA 3SSMA 4PYJA 3KKZA 3S2IA 3U7JA 4EH1A 3O8OA 5I7VA 1JDSA 2RH9B 2VHYA 4EEZA 3FD8A 3GAAA 4KQWA 5FBVB 3WICA 4Y9TA 3RSQA 2JFWA 2X5JO 3ZCXA 2IBSA 1M74A 5DZSA 1SCIA 1BJKA 1KAOA 2IYTA 4HDAA 2DETA 4BO3A 3ZR4B 3SDSA 2V7VA 9LDTA 1HA3A 3CLRC 4OA5A 3SSOA 2VZLA 3OZ7A 4KZPA 2IUTA 4BVJA 1ZM7A 4TVBA 5C18A 1Q7BA 1M8GA 3T1HB 1ZK0A 5E7JA 1Y4DE 2RCNA 1MFPA 2AD1A 3RYHB 3LQFA 3LT4A 4RA6B 1A1VA 3IJEB 4X64B 3U0VA 2A4MA 4JELA 4X8LA 3GZTB 2TMYA 3N0VA 4IIEA 4LC0A 3WLKX 1IHPA 3DUFB 2ZWPA 4IOKA 2CDNA 1D2EA 5JPIA 4AJLA 4F71A 1Z63A 1PYOA 2VRCD 3ONWA 4L50A 4NOJA 4ONEA 4X94A 3SJBA 1ZN9A 3RVSA 2P4QA 1JV2B 5HGJA 4J07A 2X8WA 4LJ5A 5EQTA 4RE5A 3M34A 2UXCB 1TJYA 1Y1KE 3EB9A 5JPCA 4Y6LA 1RLJA 4DLZA 1ZHOA 1OF1A 3UOAB 1G8HA 2MINA 3EVTA 3TVTA 3RVPA 5F1YA 3V97A 3H17A 2YXDA 3DHNA 1NHWA 2XWJI 5B2EA 3B3QA 1LW7A 4EATA 1JT2A 2V6IA 4M0KA 4Z1OA 3U17A 3RYCB 3GP5A 2CWDA 3P5SA 4LFCB 3P32A 1V9SA 3ZWXA 1YTUA 1A9RA 5JNRA 2FWNA 2VXOA 5BPFA 4LZWA 1CR2A 5AI8A 3IBGA 4RU1A 3LD9A 3M33A 5DHPA 1O9HA 3N74A 5EKXA 2BKVA 3A1WA 5PGMA 1BQ3A 3I37X 4LK3A 3OHMA 2VJLA 4XB6B 3D6TB 5BOSA 1MTOA 2AGVA 5F2KA 1QGYA 1EYZA 1JS1X 5EIXA 3SZGA 1RJFA 5TNXA 4F91B 4MW5A 2NUPA 4Q9HA 1M73E 4QDKA 2IYYA 3DZKA 4RAOA 2FFAA 4IIBA 2A5LA 4O0LA 4DRXB 2O3UA 2VP2A 3D6HA 1GYRA 4LF7B 2HPVA 1L7MA 5TPZD 2AMFA 4PTYA 3MQ2A 2MDTA 2XMRA 5JAUA 3T1QA 5YASA 2HJ9A 3FXAA 4K9NA 1CDOA 3ADKA 4KN8A 5TVGA 1EVEA 1JKXA 2HQRA 3UGJA 1TAHA 2Z1DA 2AA3A 3K9WA 4WXMA 2COUA 1KBZA 1QHYA 1EVYA 2VRNA 2ZATA 4BU0A 4CLHA 3C87A 3MUNA 1VJRA 4QFBA 1ZH8A 3RYIA 1MRZA 1WLSA 1AC5A 4I1IA 4MVCA 4C7OA 1CEQA 1P62B 1WD5A 1Q20A 2IOHA 2EF1A 2IZ5A 1M7HA 2X13A 3OECA 2FP4B 4UM9D 2C20A 2JVJA 3LYAA 4JBWA 5EIEA 2X1VA 3KQUA 4XQCA 5ISMA 1ELOA 3EFEA 5JDIC 4ZP1A 4JI7B 1B76A 1VCMA 3BH7A 3LW8A 4L8FA 1XA0A 5EKDA 1PK9A 1ESMA 3DUWA 2JVIA 1FUEA 1MDFA 3PXBA 2BEVB 3GBSA 3KZMA 3SHTA 2I8AA 3ZTTA 1O94D 3D4NA 4KNWA 2W83A 3C97A 2YH2A 1M34E 4FX2A 3IL2A 4FUTA 2JK1A 2MYUA 1XCGB 3HB4X 1PR0A 3LY7A 3DMTC 3QEJA 5EN4A 2PLFA 4MQFA 4ZT3A 2A9FA 4G07A 1K75A 2CLHB 3BKWA 5TGZA 4B8ZA 1MVOA 5BNFA 1T0BA 3AHJA 4A8JC 1V26A 8AT1A 4IICA 2R00C 2OR3A 4G0MA 4ROTA 5LXTB 2FEXA 3IEPA 1AZTA 1GUFA 2CXTA 4CN8A 1BD3A 2VZ0A 3VKWA 4QG3A 3JWHA 3ZI0A 1Q17A 8GPBA 2H85A 3TPZA 1TXGA 3GCXA 2H4JA 3FOBA 4Z4CA 3CRRA 3QUTA 4HVLA 1GL6A 1UR5A 2QY9A 1X7GA 2ACVA 3TCXB 3QTBA 3WWDA 1HKHA 2BGRA 3IUQA 2QRZA 1ZITA 1VE3A 4CGZA 5EEGA 5LVAA 2R6GA 1VOTA 1F48A 3U7QA 3OFKA 2GH1A 3EEIA 2FJUA 1BA3A 1E92A 2H5JA 3PGJA 4Q12A 4WXYB 5DM60 1P4RA 4AMZA 2CXRA 4I4TF 1U0OC 1DFIA 2YIDA 4ZI5A 1JVSA 3M3PA 3G0IA 3P0HA 5ICEA 1CCWA 4C0HA 4Y2PA 2JLYA 3EGDA 4I0WB 2B1RA 3R7WA 4OQDA 5BVGA 5AOAA 4DUGD 2ZBRA 3PSHA 3SE0A 1O9GA 5GTDA 1U2GA 1KEEA 1DB3A 1PCXA 1IVYA 3BCUA 3OF5A 3IPXA 1WW3A 5FB3A 4ZARA 2R6FA 1Y6ZA 3M6FA 2OT3B 3RS3A 3AOEC 4KMOA 3PIDA 3VNQA 2QLBA 3H4TA 4LY3A 1GFSA 3LKVA 1P0PA 1G38A 3EC1A 4CIAA 1P5RA 3KT6A 4I5EA 1YJ5A 1UZNA 4AKGA 3QEOA 4EFMA 3UJ7A 1EUCB 2BI8A 2R25B 4P80A 3F67A 5E9JA 1XZDA 4BV9A 3UPDA 3R8FA 3DE2X 4MW7A 4MPDA 3KZNA 1UC5B 4GWGA 1HEYA 2NXNA 1T5TA 1YIDA 3CB2A 3R7AA 3KB6A 4O4LB 1RU3A 4Q3KA 4UFPA 1WETA 3P0EA 2GRUA 4XLZA 4OBXA 4PLFA 3TJRA 5B4UA 4HNAA 2C7PA 1JHAA 4R51A 1T5IA 5SZIA 4BY9E 2QJFA 1W4AA 2JGKA 3A1EA 1J06A 1R9NA 2EJTA 3FHLA 2I3GA 3PCXA 1EK6A 1T6ZA 1AU9A 4BU1A 1CR1A 3RVNA 1VGRA 1EP3B 4CCYB 1X7XB 3ABRB 4ZK2A 4V0NA 1YHYA 4A16A 5CEFA 2HU2A 1RHJA 2AKYA 2QTHA 2HWWA 2P4EA 3HG7A 4HFJA 1HV8A 2P35A 2YIJA 3PVCA 1UC9A 3GK3A 4GBGA 2CCGA 4JBHA 3VNAA 3WGTA 1XYGA 2YTZA 4OJMX 4R9SA 3K09C 5FYDA 3EVEA 4ILEA 4N0QA 5LUBA 3W5HA 3QVGA 4OHCA 1RWMA 3M9XA 3VI4B 3ISVA 4YH1A 2OLJA 1M2JA 2ZS9A 5FA8A 2HBQA 3TEMA 2NXEA 3BG5A 1FCJA 5FAXA 5GAJA 4UTVA 4K5QA 1B2RA 1GCAA 2C03A 1A8QA 1GAEO 1RM3A 1KY3A 1LPPA 3OT1B 5GM2A 5C8YB 1EDEA 1LSSA 9GPBA 4QRIA 4N3CA 1D1PA 1C9MA 4LHWA 5JJ5A 4KYVA 4HCJA 3C6MA 3RS4A 2D0IA 3U0BA 1DFHA 4YV1A 3P2OA 2HEIA 4HPWA 4OGWA 3OZAA 1EUDB 1YQ9A 2CL7X 1YZGA 4N5HX 1GT91 4XQ0A 4ENQA 5FD8A 1KYYA 3D7MA 3K70B 1O5OA 1NF9A 1QGUA 2VA9A 3KV1A 4DCNA 4X6LA 5ILGA 1XQYA 2O7QA 2BEUA 3QU4A 4P4SA 3TEFA 3VYRB 4B9EA 1U9IA 2X9GA 2ZRMA 3A70A 5BQXA 4U2BA 2QUZA 1CR0A 1DKUA 1OAOC 5ER9A 2J5RA 3DE6X 2WOJA 4DZTA 3OLWA 4QTYA 4KXLA 4EECA 1OFVA 2FRDC 4H1TA 4LV8B 3IP5A 4ZKDA 1BZYA 3B2QA 1Y42X 1TQ6A 2PLAA 2O4UX 2VDLB 3EXEA 4C6SA 1N2CB 1FFEA 5IUNC 3BDIA 1N57A 4L74A 1PGPA 2HBYA 2QW0X 5GM1A 4CM9A 2VP0A 5EJMA 5BMVF 4UCWA 2F8TA 4EKGA 4MQ4A 4B3FX 5FPQA 1TEZA 2B2XA 1BW9B 1M0SA 4RV4A 4XAQA 4Z7NB 3TLCA 4IEEA 5KTNA 3SIWA 4C7JA 4GR4A 3BOSA 1RRVA 4PYOA 2XBMA 2WZQA 3KOYA 2IXGA 3R7BA 3L4EA 4BVFA 4OJQA 4X20B 1R9MA 3A3NA 2YZ7A 3ZWQA 1EVIA 1HXHA 3OU6A 5ALZA 4CG2A 3U56A 3R0IA 3USCS 1VP3A 2J0QA 3PNLA 2V7TA 4X45A 3U4GA 5DNWA 2P9CA 2O3JA 2OZLB 3OX2A 4E5UA 1KC3A 1XU9A 4M0UA 1FMLA 1T2EA 2IHBA 4MVJI 4KV9A 4WVLA 1GUZA 3PC2A 1N75A 3D7RA 3UT5B 2XUHA 4EW6A 2NTNA 4F4HA 2ZSFA 1QF7A 3BGIA 3NYRA 4P32A 5CK4A 4IR7A 3DBLA 4UVHA 4YRCA 3LP5A 1BG6A 4Q4HB 1J8MF 3GELA 5EHGA 2KYRA 5BT8A 2A1UB 2MSCB 3U09A 1U7PA 2Q29A 4EX7A 3S2UA 2W2OA 2WWRA 4XIIA 4TYMA 4Q24A 2J9GA 3GRAA 1TF2A 2VHZA 4NMWA 2AHRA 3MBOA 1U3CA 1K6IA 1MC8A 2JBHA 2XUKA 1IN4A 3L1VA 3PUWA 4ZAGA 1DELA 2QN8A 4JJ8A 3TR0A 1B7GO 3ZE7A 5I7FA 4QHYA 5EHQA 3URMA 1UM9A 4NRDA 4NAVA 3CH6A 4G0PA 3IA7A 1FU7A 5D3MB 1LWOA 1FS6A 1SBIA 2WINI 3PA8A 4UXHA 4BO4A 1VSQA 4II7A 4RPLA 2Y4OA 2ZSHA 4MA5A 3IAXA 5LL6P 2BMFA 4ZAFA 1TAUA 4P4LA 1E98A 3B1KA 5L45A 3THXB 1PWXA 1ZA1A 3FG9A 1DBWA 3S2YA 2D0PB 2MYPA 1JJAA 1O5IA 4G8DA 4TYPA 3L4SO 4S3MA 1GKYA 2B7CA 4YCNA 1SWWA 4NCJA 2GLUA 1ZQ1A 2XMQA 3IB3A 4UHJA 4YUAA 2EW8A 2V3CC 2JHPA 1WZ2A 1AXRA 4D96A 3DMTA 3JASB 1SVSA 3S0JA 1T8RA 1CJKC 2VRCA 3NHJA 5IBRA 4D9BA 5WRFA 3IUPA 1N33B 2VOJA 1Z35A 3L0ZA 1EEHA 2BSAA 5D8DA 4BFYA 2GSDA 3ND5A 4F21A 1C30B 3H97A 4AJHA 3H9JA 3RNOA 5BOVA 2X3FA 4HQRA 4ZTUB 1XTRA 1J09A 2NO0A 5DBHX 2I99A 3FN4A 3TRKA 4FGUA 3WKBA 5ADHA 1P0CA 4GO1A 1IXRC 4FQ5A 3T7JA 1XI2A 1A9XB 3M6LA 1QCZA 4WI1A 5G4KA 9ATCA 1BWQA 2R96A 1RKXA 2QUHA 3C5VA 2FR8A 2Q5QA 4LN1A 3DR5A 5BR4A 1VMIA 3G9XA 3VR6H 4PZYA 4MYTA 2ONJA 1Q7RA 3MA0A 3X1KA 2RHRA 3F0TA 3I9KA 3RCBA 3ZGOA 4C4AA 4F7WA 1L3BA 3MG9A 2FEWB 4ZC1A 3TEJA 4ND3A 1Q84A 2IQIA 2QRMA 4GXTA 3GLQA 1PJAA 5T7BA 2BR3A 2IEDA 1BDHA 4H3VA 4CF5A 4RTPA 2QD2A 1P7CA 4J7CA 1XX6A 3GMIA 3BD9A 4NMMA 4RDHA 3RYFA 2BM9A 2HBRA 3KQYA 4MGHA 3UAWA 2A0YA 3R7NA 2M98A 3CVXA 2GPAA 2GPTA 4WXEA 1W0JD 2I7TA 3ZD6A 1ULBA 1TCCA 3GJ3A 1KAEA 4NJOA 4S1VA 2YOHA 1Q2UA 5TPZA 1KIFA 4B5LA 2IYZA 4RD1A 3QM1A 4FHDA 2VYCA 2L18A 1R7RA 1E1KA 3VMMA 3SSNA 3UWOA 1SUEA 3HLKA 5DN6A 5EZQA 3EULA 1R4AA 2VFAA 2BH2A 3PITA 5DNYB 4MB2A 3ICOA 3CT4A 3OBIA 5DCUA 1FYXA 4P7GA 4AG5A 8ATCA 4YNBA 4KUEA 1G2IA 2DG2A 2DTEA 1X1RA 4FX5A 5EINA 3O1IC 4BX2A 1TVMA 4UZSA 2I6GA 3CLTD 3HVKA 1N5IA 3M9LA 5CVDA 1SB9A 2D5CA 3ZE6A 1WR8A 4JJIA 4RIHA 3VX4A 1U0EA 1LVHA 1GZVA 1JEDA 1L1RA 1RCFA 4NFSA 5KOJB 1GV0A 4M1QA 3UXHA 5C1BA 1WB6A 13PKA 2QM7A 3MK31 3SHVA 4F3TA 2ZCJA 4C07A 1HL7A 1LBIA 2MJLA 5C3UA 2IHVA 1I94B 2QMOA 3SIRA 2Q9AA 4H7KA 1PR1A 5DGXA 2PVPA 3LUPA 4KU4A 2ZRJA 4ZOLB 3IAHA 4JJZA 2ZU0C 5FPPA 2M6LA 4UMVA 3NDJA 2R8YA 3DV0A 1O94A 1H2ZA 1VL0A 2FPOA 2XBUA 2YFYA 3N2KA 1E62A 1RAGA 2GVNA 4WZAB 3ZJ4A 4R71A 3Q8MA 1LX7A 4MEJA 1E2FA 2BZSA 2Q21A 2JFZA 4FINA 1TZBA 3A4VA 1GTVA 4GI3A 5TGTA 1GN8A 4KR3A 1K8XB 1XKXA 3N0XA 2Z2IA 2OORC 4ZANA 4BXOA 3L1KA 5BRNA 4B71A 4DDKA 4L0QA 4I2VA 1J7KA 4TM7A 4HC4A 5B4VA 1NL3A 4GKJB 2NO7A 2WM3A 1TM2A 2ZQ5A 3BWCA 1W36C 4FHFA 1V47A 1Q1QA 2P6OA 1G17A 1QH0A 2RKBA 2JASA 3VTKA 4B47A 1E9EA 1QSGA 1W87A 1IK4A 1JNYA 2JRLA 3AVPA 3EOAI 4MLPA 5KYYB 3I1FA 3WL4A 1SXJD 2GHTA 3R6LA 2PX3A 1P45A 3KDPA 4H77A 4L57A 4U8HA 2HU5A 4CLDA 5HX7A 4YJ2A 2Q2OA 4IUCS 1K9SA 1KFBB 1X8LA 2FHSA 1L5RA 2QUKA 3PTZA 2Y8EA 3K9QO 1WSAA 3WBJA 2NPFA 1GA4A 1WY7A 2D7JA 3MB5A 4DIMA 1I4WA 1XTUA 2OC9A 2NUAA 3KU1A 1WDWB 2VK1A 4HYYA 3BMCB 1IDN1 4ER7A 4QLOA 2Z5FA 4S35A 5EGSA 5D5HA 4UNSA 4IIVA 1RRPA 4PSVA 2FY8A 5AW9A 5DLQC 1JAZA 1KAQA 2QLNA 1QV7A 4LDAA 4DUGA 2VPXA 2BMVA 3UPTA 2QTFA 4GHWA 2VEOA 2KE5A 4K3VA 3TQIA 1NXOA 1EXMA 2FRDA 1Z82A 5J5AA 3T7CA 2QUIA 3CKLA 4CG0A 3C8DA 4WXPA 1CUAA 1KF0A 5GOZA 5F5XA 4AS3A 1RIIA 3R40A 2H2GA 4YRNA 1N5LA 2XW6A 1F0PA 5IG2A 1KNQA 2FPIB 3Q7PA 3CMMA 3EQ9A 3PRHA 1RBQA 3G82C 5D00A 4KGVA 4EA6A 5KJFA 3K0SA 2O4CA 2C54A 3RWBA 1Z88A 1AIPA 1PAUA 3LVQE 5TE9A 1YR8A 5C52B 1J2RA 2VWPA 3H1TA 5B7QA 2G5TA 5DCWA 4GBED 3QOFA 1XZKA 5TF4A 2AFHE 4JLUA 3MJDA 4I2NA 5LOVB 1EGVB 5TQ0A 1SQ0A 1BX0A 4FE4A 2BEWA 3H1EA 4INAA 1TIPA 4MJXA 4X00A 3SQDA 5IDQA 3G6WA 2Z6VA 1GA1A 2A1TR 1L4HA 1LI5A 2ZYAA 3C1TA 3JZMA 4OM8A 4W9RA 5TPWA 5DLDA 4E5DA 3W5CA 1K06A 3W90A 2C2MA 4D2IA 5JTUA 1EWYA 2C04A 1LRKA 4DCTA 4NCKA 2WV7A 1CQJA 1H0SA 3TTTA 1RM4A 3OCYA 2VCEA 3EF1A 3H8VA 4MXDA 2FLWA 4Q9AA 4YRJA 1ZLYA 3L40A 1RC1A 2QZ9A 2Q07A 3AHDA 3F9RA 3NT5A 4JR2A 1MORA 1ZD9A 2C07A 1TYAE 4JYPA 7ABPA 1DJNA 5AW6A 4KCGA 3VZBA 3ELWA 1X1SA 2ZQZA 3N58A 3OKCA 4L0CA 1LSOA 5AM2A 1U6IA 4QXQA 1SXGA 2P8SA 1TD1A 4PZZA 3H5WA 3OFNA 2FX2A 3ANYB 3OM9A 1A4XA 4R01A 3AVTA 2PSFA 3IJPA 4OFXA 1ZXBA 1PG5A 2JFUA 5K0CA 4KQHA 2X3YA 4QBKA 4BECA 1Q0HA 1FTWA 2W4QA 4YT8A 2C8JA 4KQKA 2ECFA 2C97A 2HZ7A 4CV0A 2X14A 1N6LA 1IY8A 3ELUA 4DIFA 5EMKA 1ONSA 3GDGA 3NR2A 4MUFA 3PX2A 3MERA 4OFZA 4B17A 4E11A 4ENUA 2P41A 1EJ2A 2IXBA 3BIWA 3W6ZA 2GT1A 3T41A 3VPAA 4BIIA 4HDRB 3LOUA 3F3YA 3SLGA 4QZVA 3NHSA 4WRRA 3BXZA 4MVJG 2PZGA 3C6QA 3B5EA 3PQDA 1FFWA 4YCDA 1HBJA 2YXBA 3WLEA 3IVAA 1IEWA 3UMYA 4TYWA 4EITA 2WAXA 1JIUA 3NUZA 4GUAA 4FFMA 2H9AA 3E6AA 1OH8A 3S28A 1AKYA 1O0SA 3JXEA 1GNTA 3WRYC 1GVNB 2M1XA 1KIMA 4V1CA 2GD1O 2Z2XA 5JYDA 1QP8A 2GF9A 1MXFA 1GRCA 2DR2A 2VJMB 5A4JA 5G3YA 3WK4A 4D8YA 4F2WA 3K73O 5B58T 1PK7A 3DZIA 1LK5A 3FWKA 3H4MA 4FSHA 4X5OA 5ESWA 4CU2A 5B37A 4RJLA 2ZSKA 4LRUA 3I45A 1ZXXA 1ZH2A 1DBRA 4YMUA 1YE3A 2RCYA 1Y1SA 2I1VB 1LZLA 3GX1A 1HDIA 2A9JA 1SY7A 2OV6A 3OJ0A 2ZRGA 1KSGA 2X5NA 1WMBA 4JB2A 1WTAA 1W581 5AI5A 1MC5A 4BKUA 2QJRA 3NRBA 4OHMA 1T2VA 4HGRA 4CQLA 1LCIA 3LQYA 2DFPA 3MTBA 4HTAA 4QHSA 5C5DA 5K05A 4Q1FA 1YRQA 4QYIB 4R2LA 1QF9A 3VDMA 2CE2X 2WTXA 3IULA 3Q7SA 3D0QA 4BS9A 4JLBA 4OO3A 4RDCA 5H9VA 3AFIA 1T9GS 1Z2OX 2X4DA 3JU3A 4M22A 1HF3A 2H57A 1PX0A 2PL9A 2EL9A 1AB6A 1R4ZA 2W58A 3JX9A 3MBKA 4N6NA 4BX9A 4D4MA 3M4ZA 1MX9A 2JFFA 3HHPA 1DAGA 1JDVA 1TAQA 2GPYA 3AUJB 4HS9A 4WKBA 4QNRA 3TB6A 4EP1A 3RUFA 2E89A 3R3JA 1VG9B 4K0RA 4ZEVA 2C0QA 3LUAA 2HDNB 2OPHA 4J1SA 4N01A 4DTIA 4XJSA 2Q2NA 1ZCAA 2AHOA 3NJ8A 1K8QA 3EF3A 1TK2A 5G3ZA 4GMXA 3THWB 4J7XA 2ZUDA 1E59A 3EY4A 1ZUD1 3N2LA 4BNIA 1CZLA