2OBBA

Structure of the conserved protein coded by locus bt_0820 from bacteroides thetaiotaomicron
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
121
Chain Sequence
NAMTIAVDFDGTIVEHRYPRIGEEIPFAVETLKLLQQEKHRLILWSVREGELLDEAIEWCRARGLEFYAANKDYPEEHQGFSRKLKADLFIDDRNVGGIPDWGIIYEMIKEKKTFADIYSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Structure of the conserved protein coded by locus BT_0820 from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 30
structure length 121
sequence length 124
ec nomenclature
pdb deposition date 2006-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2obbA00
1WPGA 2I6XA 2ZBFA 1ZRNA 5AW3A 4I9GA 3U7EB 2JARA 2YBDA 3QU5A 1T5SA 1QQ6A 1YS9A 2R8YA 4G63A 5ALPA 1VJ5A 5ALRA 1KYTA 2RB5A 4CNQA 5A3QA 3W5DA 2HX1A 2IOHA 3AR2A 2ZBEA 5AKGA 1O08A 4BNDA 5AW4A 2I34A 4EZEA 4Y3UA 1RQLA 3SF0A 3QU9A 4Y2TA 4YCLA 2DQSA 5AI9A 2ODAA 4O8CA 4RETA 1RLTA 2AH5A 4KX5A 1RC8A 1IWOA 5AW8A 4NV0A 2CFRA 2HF7A 3I76A 3L8EA 1U2SA 2HHLA 2WHEA 3L5KA 4MUMA 3FGOA 5ALOA 4BX2A 3E58A 4G9BA 2AMYA 3NAMA 4J2TA 5AK3A 1TJ4A 5AW5A 4C4RA 3ZVMA 3QNMA 3QXGA 3DDHA 3NANA 2HCFA 5ALHA 3SKYA 4UU1A 3FM9A 3WGVA 4YGYA 4FFDA 2AGVA 5ALEA 3RFUA 3A1CA 4UARA 3PGVA 1L7OA 3W5AA 3ZVNA 3FZQA 1MH9A 1YNSA 3HYCA 3L8HA 3OCXA 4EENA 4IG4A 1RQNA 5AVTA 3QUTA 2YJ6A 2BDEA 2OBBA 1L7PA 2B82A 3L0YA 5AVZA 2GHQA 3IRUA 1SWWA 3SMVA 4AS2A 4BBJA 2EARA 2FUEA 3B8EA 5AICA 2I7DA 2IOFK 3S6JA 1CR6A 4Y2XA 2FI1A 2G09A 2ZBGA 4EX7A 3PDWA 4DWOA 2EAUA 1WR8A 4GXTA 3F9RA 1YMQA 4OFZA 3FPSA 1Z4PX 1K1EA 2B0CA 4UU0A 3MMZA 3PCTA 3D6JA 2FPUA 5AKYA 5ALNA 5AVYA 3WK5A 5ALLA 3N8GA 3ZTYA 3PGLA 2FDRA 5AVSA 3OCUA 3FPBA 2ZXEA 3QU2A 5ALQA 4BEVA 2WM8A 2PR7A 3KOOA 1PW5A 4KNVA 3UM9A 2ZOSA 3RF6A 4EX6A 3L0BA 5IS2A 5AKLA 3BA6A 4OHFA 5A3SA 3DAOA 2YJ4A 4EEKA 2BY4A 3A3YA 1WZCA 3L1VA 3A1EA 3QLEA 4CF4A 4BYGA 3OCZA 4Y2UA 2W43A 2Q5EA 5ALJA 2FPXA 2JAOA 3EWIA 3OCYA 5AKXA 3WK9A 1Z4KA 3U19A 1LTQA 2B30A 5AKIA 5T41A 3ZWKA 2ZG6A 2WF8A 3QUBA 1F5SA 1YJ5A 5AM1A 1Z4QA 5AM0A 4AS3A 3AR3A 1S2OA 2IYEA 4FYPA 2OA0A 3QGMA 3AR4A 4L6AA 4I9FA 4ZEVA 3OCWA 5ALKA 5AVWA 5AM5A 5AW2A 3NALA 3QUQA 3B9BA 3L7YA 4ZEWA 4KNWA 1ZD4A 4UMFA 3KBBA 2HO4A 1Z4IA 1U7OA 5AKZA 4YH1A 2PQ0A 5AKEA 3E8MA 2GO7A 1AQ6A 1ZD2P 3L8FA 5AIAA 4XOUA 3SLRA 5AVUA 3N28A 5FP0A 4BX0A 5IT4A 2QYHA 5AI6A 3I28A 3W5CA 4OCZA 4UMVA 5AK4A 3MN1A 5AVRA 5AVXA 1L7MA 3AR6A 1SWVA 5ALGA 1RRCA 1QH9A 4UMEA 2QLTA 4YIHA 5ALDA 1YV9A 1RMQA 2HEGA 1RKQA 3KDPA 3MPOA 3ZVLA 4CF3A 2WF5A 5AI5A 2AUTA 1RLMA 5AI4A 2CN1A 4GIBA 1XPJA 3CNHA 5AKHA 2YJ5A 1YDFA 5ALYA 2W11A 3B9RA 3E81A 2G80A 2GFHA 3QU7A 4BX3A 1JUDA 5AKKA 1Z4MA 4AP9A 4C4SA 2B1QA 2MSNA 5ALTA 1RMTA 1N9KA 2YN4A 1VJRA 5AK5A 2RAVA 3U7GA 3WKAA 2FEAA 2HSZA 1XVIA 3AR7A 4MWOA 3WK4A 2X4DA 1ZRMA 2C9MA 2ZBDA 4Y2QA 2FPWA 3IJ5A 4NWIA 3N1UA 3ET5A 4KX3A 3DNPA 3E84A 3ZUPA 1T5TA 3WKBA 5AHXA 2Q4TA 4UASA 4NFLA 3WKDA 2YFYA 2OM6A 2JAWA 2C8KA 3K1ZA 2Q4RA 3ESQA 2P69A 2FPRA 3R09A 3SD7A 3ESRA 3R9KA 3SKXA 3P96A 3HLTA 5ALIA 4J03A 1RMYA 1O03A 1NF2A 2FUCA 2HOQA 2YJ3A 2WF7A 3VAYA 1NRWA 3KZXA 4JB3A 4UMDA 3ZX5A 3U7HB 5AIBA 3OTQA 4Y2YA 1WVIA 2C8LA 3EF1A 4FE3A 3U13A 1TA0A 3U7FB 3N07A 2G07A 3FVVA 1QQ5A 3ZW7A 5E0OA 5AESA 1ZD3A 3QYPA 4QJBA 5ALZA 4NAVA 5AM4A 2YY6A 1ZOLA 1L6RA 3MC1A 4UAVA 1Z4NA 4EELA 4C4TA 5A3RA 3UMBA 3R4CA 1ZD5A 2RARA 3QUCA 3A1DA 4HGRA 4L57A 4XPZA 4XQ0A 4IFTA 2HDOA 3NASA 2G06A 1RLOA 4YCMA 1Z4OA 2O2XA 4YIKA 3WK8A 2VKQA 1EK2A 4BKMA 3UMCA 2B8JA 3BWVA 3ZTWA 2OYCA 1Z4JA 3QU4A 4HGPA 3AR8A 3AR9A 4BNDB 2P11A 2P9JA 1U2TA 3CZ4A 3QX7A 1ZJJA 3DV9A 5AI8A 2WF9A 4UM5A 1Z88A 4UAUA 3N5KA 3ZX4A 1X42A 2W4MA 3AR5A 1J8DA 5ALMA 5ALFA 2NO5A 1N8NA 1SU4A 1Z5UA 1ZS9A 2RBKA 2EATA 2JAUA 3KC2A 1NNLA 2P27A 1L8LA 3NUQA 2YMLA 4DW8A 4UM7A 4L6CA 2YMQA 2I55A 2R8EA 3M9LA 4HGOA 3I6BA 2HF2A 5ALVA 4OD0A 1Z4LA 5ALSA 1EK1A 4UATA 5JJBA 1S8OA 5AW1A 4NABA 5AW9A 1VFPA 4RESA 2MU1A 4CF5A 3NIWA 2NO4A 3EPRA 2JGAA 4KN8A 4HYTA 1Q91A 2CFTA 5ALXA 3U26A 3I1YA 3M1YA 3ZI4A 4BEWA 4HAIA 2GHTA 2IOFA 3WKCA 2CFSA 1L8OA 4Y2SA 1QYIA 4Y2PA 1RKVA 2HI0A 5ALWA 3L0CA 2B8EA 3EF0A 4UW9A 4ZEXA 5AK6A 1U7PA 2PKEA 4PNHA 3ONNA 1TE2A 3SHQA 4DCCA 3L1UA 5AKJA 4CE6A 2G08A 3KD3A 5ALUA 3ET4A 1QQ7A 4JDPA 2NYVA 3ED5A 3J7TA 1L7NA 2IA5A 2GMWA 4YCNA 1Y8AA 2I33A 1RDFA 1U02A 2I54A 3GYGA 3WKEA 2O9JA 5AW7A 4E88A 3NRJA 1RKUA 2G1AA 3L8GA 3TLMA 3OPXA 4HGNA 2C88A 4XE5A 2G0AA 5AVQA 3W5BA 4Y2RA 2FPSA 1XP5A 2WF6A 4HGQA 4QQFA 2R8XA 1TJ5A 5AI0A 1LVHA 4Y2VA 2R8ZA 3ZU6A 1TJ3A 2WFAA 5AW6A 2B1RA 3UMGA 4Y2JA 1T9ZA 3OCVA 4KYTA 1J97A 2D2VA 3WK6A 2C4NA 4F72A 5IT0A 1FEZA 3WK7A 3ZWDA 5AW0A 5AM2A 1RPZA 3WGUA 4F71A 4B6JA 5AM3A 1Z5GA 2YMPA 1Q92A 5AVVA 2BDUA 1CQZA 2YMMA 3IB6A 4DFDA 4H1WA
chains in the Genus database with same CATH superfamily
2VDWA 1WEKA 1KVUA 3FOCA 1MKYA 3PJDA 3O82A 3V8BA 4FJ2A 2BE7A 4D9NA 2XTMA 4UBNA 1QMPA 4OHZA 3WMGA 1KK3A 1T1EA 4U2GA 2Q9BA 4HTFB 3PEFA 3C3AA 3H2SA 3PSHA 1YS9A 16PKA 5IAGA 4V0NA 1QGUB 4KXFB 4ZZ0A 3JWHA 1W88A 5LXTA 1OGYA 3CJQA 1FYEA 1X8XA 2P9EA 3TQFA 5A3QA 4REOA 3AR2A 3GG2A 4NFSA 3W77A 2I34A 1FW8A 3P9NA 4Y3UA 1G16A 4HP8A 1QJCA 4DLYA 1KTIA 4YCLA 4LC0A 1C1YA 3WNBA 1NYLA 2JIQA 3SC6A 3WC4A 4MS1A 2GEKA 1ZD8A 3SXPA 2IE8A 2XMDA 3TTYA 2NT4A 3T1QA 4ALLA 2V5UA 1P62B 2DJIA 4PU0A 1OKKA 1EFRA 1T8TA 2ORED 2X9LA 1NAHA 2CL5A 3EWSA 4FSDA 4V0KA 5H9VA 1U0BB 2EWWA 4DEVA 3OSUA 1G20E 1W25A 2ZI5A 3OA0A 3OP4A 2AMYA 4XUGB 2Z04A 4G1FA 1R3UA 4JBWA 3NHLA 4KGVA 5CA0A 4MVWA 3H1TA 3H7IA 3WV4A 3F6BX 3IR7A 2I2DA 1VP9A 1N34B 3DE0X 4ER0A 4F2GA 2ZITA 2Q7OE 1VKHA 3S1AA 3VH3A 2JW5A 1LI7A 3DOJA 1CJKC 1RQ7A 3C14C 1HE1C 1NUTA 3H2BA 1ZH6A 1NP6A 4XGRA 3WIDA 3SOPA 3WTBA 1CIVA 4FQ8A 4B0OA 4DVGA 1SD2A 2PZAA 3PFIA 5JY6A 4P3OA 2PMWB 3OTGA 4U7WA 1HLDA 2AGVA 1N7GA 3GBPA 3RFUA 4ESHA 3OEEA 3B78A 4JSYA 2YJNA 4DIMA 2FH5B 3IURA 2WTMA 1AQIA 2J6HA 3IV7A 1WEHA 3OZTA 4JR2A 4TTTS 4BNGA 4AAYA 1RXUA 3TLGB 2N47A 1RJ9A 2WM3A 1I7DA 1KQOA 3I9LA 3M6MD 2HU2A 3BREA 3M3HA 1BVYF 1DWUA 4LDNA 1PR3A 2B82A 1G8SA 2MINB 4S2UA 5GY7A 3HVRA 2W2LA 5REQA 1M0SA 1IBMB 1ZCJA 4AX8A 2A1UA 1TRHA 1Z0ZA 2I4IA 4U4AA 4BO1A 2GJAA 3P2IA 4UQOA 5JMWA 4R1SA 3ZE7A 5K8UA 2GJ4A 3CB2A 5I9BA 2JL1A 2EXXA 1HO3A 3VOSA 3C24A 4RTMA 1OT5A 1MIHA 2B2CA 5IDQA 1EGQA 3VKUA 2YQ4A 4TKVB 4M87A 3G02A 4KN5A 4K40A 5IPFA 1Z8NA 2X0JA 1KKMA 1MIOA 3LPLA 2PLFA 2OD9A 3IQXA 3JYNA 4TM8A 4YAOA 2ZSHA 1EX9A 3BGDA 1D2GA 3KZ1E 1WR8A 2WG2A 4PPYA 5AJHA 2JGDB 2OBNA 4PZ9A 2NSYA 4JLAA 1NBME 2DG2A 1ZEJA 2D1QA 2QAIA 3EGXB 4L8FA 5ABPA 5G3ZA 1MG0A 3HFRA 1JAYA 4FLFA 2YV1A 4FOTA 4IDAA 1F4VA 2DBQA 3PCTA 3GA7A 3G0CA 1ECCA 1IZ8A 1UXIA 3OA2A 3O8NA 4HZGA 4KPUA 1SUWA 1SVUA 3WK5A 1QDLB 4ENVA 3NH6A 1A8IA 1E2EA 1EZ1A 2H1OA 5LNK6 1B43A 3WWZA 4FGUA 2IIBA 2IYNA 4LHEA 3X2EA 4AY6A 4MDYA 3GCWA 1X1EA 2H59A 2IKSA 2PQ6A 1P4GA 3SQXA 2HU7A 4ND8A 4KWEA 1IQPA 3E9ZA 4PICA 4HZIA 4HVTA 4EPYA 4QXPA 1O0BA 3EQ9A 5AOCA 4C7OB 1G59A 3E9QA 1POXA 1E6WA 1DBQA 2WMDA 4HH1A 3RSGA 4ZHSA 3PWKA 3TTXA 5IS2A 2VDKB 1GZSA 1QOPB 4RA9A 5PGMA 1CEQA 2JZNA 1EGMB 4OHFA 5AKLA 4ZANA 1Q50A 1ZM7A 3LXMA 5CT4A 5D3MA 2B1GA 1I01A 3O90A 3TEJA 1A8PA 1C4OA 2HUPA 4I08A 2X5OA 4XVRA 5DGHA 3IAS1 5EP1A 7MDHA 5HWSA 2NVOA 4GGPA 1KK0A 2PXXA 3HPRA 3P26A 4UM8B 3VU1A 1LRJA 1NX6A 4D8XA 4LYJA 5IWAB 4G86A 2B7LA 4L0QA 1GQRA 2HW8A 4KSYA 1QP4A 3A6LA 3B12A 2FSFA 4M22A 1KEKA 2JAOA 3GQBA 3OCYA 4ENQA 2TMKA 221PA 4QM7A 4MV6A 1NMYA 1WOMA 3V42A 4RK1A 1XMOB 3ZWKA 2PUFA 3G49A 2WWXA 4LXTA 4RCYA 3AF1A 2IEDA 5BSRA 5BVHA 2BTEA 2CWWA 2XZLA 2W2VA 3U1TA 4CTJA 1W2GA 4RDHA 5FWNA 2YFKA 3TX2A 1VMAA 1Q1BA 5HIAA 4JBHA 2P4SA 2XGSA 3CQ9A 4GOOD 4IWYA 1JWAB 2OHFA 4DUGD 4R8LA 1CD5A 2CUKA 3VSEA 2CXTA 2OORC 2JHFA 3OCJA 2WJPA 1JSXA 2OVBA 5CU7A 1G66A 1YK1A 2HNKA 5HCNA 3UT5B 4DR4B 3BHNA 3U9SA 4AI6A 2IYZA 1BE1A 2PSEA 4BY9E 2C3YA 3QYAA 2AR0A 1FSGA 4E2XA 4WK0B 2HQOA 1LH0A 1XQYA 3PHCA 3RC1A 2MSEB 2IEZA 2VHZA 1N2SA 5FADA 2CV0A 4LQDA 3UJ9A 4NEHB 1FMJA 1O95D 1U3DA 3I2KA 3OFJA 3NX4A 1PJ8A 1W49A 3LLUA 4S12A 1NJ1A 1YQDA 1NJ5A 2Z9BA 2VBIA 4OLHA 621PA 1IOZA 2IV3A 4E32A 2AD5A 5BV0A 4QARA 1QO0D 3OQIA 4O4IB 2BI4A 2Q6LA 1E0KA 2QNRA 2FPGA 2QYHA 2ZRJA 4ARUA 4EFMA 4F11A 2QTRA 1PWYE 1WL8A 1Z0AA 1C50A 3NHWA 4MARA 3K2QA 3TOZA 5HUQA 1ZFNA 4DV4B 5TJ9A 4X1IA 4TTIA 1CUHA 1LFDB 1BDBA 1U6IA 1PX0A 1XEWX 4R2MA 4F0JA 2UV8A 5I5EA 4RH1A 2ASEA 3IMEA 5LOVB 4TLCA 4FR2A 4BVLA 4D2IA 2Z57A 1YIDA 3SZRA 3E1SA 4ZEOA 4H59A 2W2TA 2AZXA 2V65A 3IP5A 3QEKA 1A50B 2R6GA 2V4ZA 4NMMA 5DW3A 3B8HA 2XUFA 3W9SA 4EHFA 3CO0S 5JCOC 1BQ4A 1H8HD 2GPJA 3HVIA 3O1IC 3HJAA 1NNUA 1YNOA 5FOUA 2R97A 2LRHA 3QKSB 4QFBA 3DW1X 1M34A 1QP7A 1X7YA 2PSDA 1TNDA 1LU9A 3OKPA 1PTJC 2EQ5A 3BRWA 1Z28A 4BO8A 3Q6NA 1RCUA 4BKQA 1V25A 3S8MA 4JYBA 2ZIAA 1TC1A 2J3KA 4HAZA 4QPNA 5BPFA 1ZINA 2B1QA 1N9KA 1VJRA 2P7HA 1R5OA 1EQAA 2YN4A 4LG1A 4MA5A 4O2LA 3I2IA 4G0OA 4F96A 4HCJA 3FJ1A 4GYWA 2JHPA 2O8CA 4MRVA 4AP6A 5EHXA 2Q07A 1PF7E 4Y0NA 2AWNA 3ZBTA 2WJGA 4UXIA 4DSTA 1H3NA 4M1QA 3WFZA 1LPAB 3MJVA 3ET5A 3TTVA 2P2LA 1RAIA 2GLUA 4D9FA 4KV7A 2KB0A 4HS9A 4K6FA 3HA5A 1ZG3A 1O94D 1BO6A 2OQ2A 3WKBA 2QBYB 5AH0A 2QJTA 3M6WA 1DX4A 4ROSA 2ZGVA 3QWAA 5LUBA 3REGA 4DPLA 3K7EA 4YRNA 2FFQA 2OM6A 4ZZ3A 4BLPA 3GVIA 4RMNA 2FPMA 2CVPA 1KETA 2JLBA 2O2GA 1OH7A 5DP1A 2QV0A 4K8RB 2P2GA 2RK6A 1SN7A 4MS4A 5K3FA 5JY1A 3ESRA 2O8EB 3HYTA 1T13A 4DREA 4CTOA 3B3JA 2GZSA 1FMFA 1N1EA 1SA0B 1XMIA 2HOQA 3PIDA 4ZCTA 1PGOA 1ZL0A 5JS8A 2PEYA 4ITUA 1SUCA 2L82A 5E9QA 2PNJA 3OEYA 3QF4B 4ARBA 2ZB7A 4G8CA 1NJ2A 4DR5B 1M1UA 4BNNA 2WIDA 3C3MA 1CRZA 1RWMA 2NVBA 4G8BA 4JGGA 1ZAYA 1Q15A 1TEVA 1W4BA 3LYHA 4HQ6A 3GWZA 1XXHE 4Q3BA 3FROA 2Y0CA 2GTPA 1QB8A 5G1OA 3CUKA 1P0FA 2BR4A 3AVPA 4X41A 5LKRA 2D5AA 4HQOA 2ID7A 3D6AA 4NBWA 4ZHQB 4O2BA 5DX0A 4X45A 3SEQA 4F5WA 5H02A 1C3LA 2SECE 3DMFA 1DRWA 2REXB 3FNGA 3K1JA 2P5SA 3KM0A 3ZHBA 1I2CA 3L7IA 4G89A 3O8OA 1AKNA 2RFLA 3LPMA 5F9FA 4IOJA 3M7IA 4FCCA 2BC9A 4D41A 4W1QA 4QNMA 2HPZA 3QA9A 4BX9A 4EFDA 5LZ2A 1Q77A 1WQ1R 4P7KA 4I7EA 4HB4A 1NLFA 4M0LA 3ORSA 4XQ0A 4ZYLA 2DGDA 3LHDA 4LNUB 2Q0HA 1XDZA 1CT9A 4A26A 4B5LA 3DE1X 5GJVC 3ETNA 3RR2A 3K5WA 4J16C 4K86A 1GNLA 2H63A 2AR9A 1GPLA 2VKQA 1JEAA 3C97A 1BW9B 2EC5A 3WZMA 1NE2A 2XKAA 4ZVQA 1D2EA 3EIFA 4DQDA 1GUDA 1M6EX 2F1OA 1P29A 4GFDA 3IOEA 2C8JA 4UBMA 3WBBA 1NQWA 2XD4A 4UTRA 4I1RA 4AYWA 1B7GO 2W8BB 3IV6A 2ZPUA 1JQ3A 2NU9A 3CMCO 3OG9A 3L8YA 4KHZA 4FGSA 2WWFA 4AC9A 2XXAB 1CF4A 4QICA 5HUHA 3DV9A 2PTHA 3PYMA 4YS6A 3SJAA 2I99A 1TM2A 3DV2A 1LDGA 1JNYA 2GRAA 1QBGA 2YWEA 1GVHA 3FBTA 3Q0IA 1GWNA 1RZVA 1V95A 1NRXA 1T35A 1X42A 5GONA 3NBQA 1A9QA 1R0XA 3QTTA 4KXWA 1PCXA 1WUTA 4Q3CA 2QHXA 4Q0MA 5E6SB 5EPOA 3WHIA 3VAAA 1S3SA 3L9WA 2GK6A 1ZXLA 2B5WA 3LU1A 1QAQA 3DAFA 1J00A 3LDAA 3HNPA 2JHCA 1YKFA 2O8BA 5BWOA 3TD9A 4EYKA 5DX1A 4M8LA 1ZN7A 1R0YA 1TD1A 2P27A 4G5GA 2X8BA 4N76A 4URFA 2WYVA 4C06A 3Q8KA 2ANBA 4R3UC 4M9RA 1GA1A 1Z0DA 2NGRA 4HQFA 4GVXA 3Q7QA 2ON6A 2IY7A 4I2NA 3G5LA 4O25A 1XLVA 2ZB8A 3FTDA 2IH4A 1YDMA 5JT1A 1IMOA 3L4BA 3UBMA 2CMHA 2XE4A 5K3AA 2OHVA 4L4YA 1H2HA 1UM8A 2C0CA 3CJRA 3GUZA 4IJUA 4BJ5A 4CF5A 4U3JB 1EEHA 1X13A 1BE0A 1NXXA 3KP1A 2QLBA 3T5DA 2AZ4A 3BMCB 1E2BA 2D3WA 3QSGA 3EVCA 4UUQA 3QLJA 3FN4A 4MLPA 1X9GA 3QFSA 4L73A 2J30A 2ZB3A 4TLAA 4ENPA 1ZSYA 4L0DA 1M2VA 3B6JA 1KQNA 4MICA 3UJ6A 3C4QA 2CKMA 3AF6A 3BIXA 3CURA 3K31A 2ID8A 1R6AA 2EZ9A 2Z58A 3W2TA 2QTWB 2POQX 4LCEA 1Z0FA 1EPUA 3JX9A 4LRQA 3T9CA 4B6RA 1FMLA 3OPVA 2BPOA 4JT2A 3SHQA 1S3IA 3K1AA 4UTXA 4ZXPA 1B0UA 1T6XA 3N2ZB 4EBFA 3ANXA 4DWWA 3CX7A 1X7XB 2IYFA 1KYVA 3ANLA 3N74A 4QBKA 4DKJA 2R86A 1CV2A 1H2XA 1U94A 3F74A 4R8VA 2HAEA 2V7TA 4C7JA 1K8ZB 1UMBB 2FMIA 2OCAA 2P3QA 1RYHA 3ZHXA 1C9NA 1OF1A 1OIXA 4IHAA 1HORA 2VOEA 2XTJA 1T4MA 4RK6A 5IF9A 5HFJA 4G0UA 3GAFA 5BVGA 1N0VC 2BM0A 5EPUA 5JFTA 1PJCA 1H94A 3VU9A 3GFVA 4FX2A 4Q6BA 4YONB 4EPRA 5BV7A 4JQOA 3UAZA 3NNNA 5AJVB 4D9HA 1UDRA 3MSCA 2OAP1 4Y2RA 1LLQA 1A9RA 1POWA 1WPXA 1Z6QA 3G13A 4D9GA 5L6MB 1OKKD 3EZ2A 1C9JA 1W8DA 3DWIA 2DERA 4OHYA 2R8XA 1TT5B 1LVHA 3GMTA 4G84A 4MVJP 1CY1A 2WFAA 5ISMA 2OCYC 2RG7A 3FZNA 3MNFA 1ODFA 4CLRA 4D79A 1WXEA 4U9UA 1IUNA 1OPXA 1XHEA 2ZW9A 5HIKA 2GZRA 3IB3A 2G7ZA 1EJ6A 4OJNA 1XLWA 4KREA 3TLEA 2JFVA 3AF5A 3F4BA 1W6RA 3VZQA 1L5ZA 3KJXA 5IW8A 3KHTA 2Z83A 5C1PA 4RC9A 3GLGE 1FEZA 2RGDA 4MIKA 5EZSA 8MHTA 1A9ZA 1IUKA 4TT3A 4NMHA 2D4AA 2CNWA 3KOYA 4B71A 4CCYA 5AW0A 3ZD7A 3G0OA 1QCZA 3RJZA 2APJA 3X1KA 4PFKA 3TZLA 1XA3A 3T7AA 3IUSA 1WMDA 4YDRA 5D86A 3VYRB 1CQZA 3RGWS 1AKYA 4DFDA 821PA 1NULA 4HY3A 4J7XA 3ICCA 3BULA 4RY0A 1YCFA 2IYWA 3L3BA 4FCVA 5AW3A 4A1OA 5JSZA 2NPOA 1AU9A 3LUHA 3DLCA 1MO2A 2J3MA 1OTXA 5KYWB 4RK0A 2YWDA 1HF3A 4QTTB 4TTQA 5B3AA 1XNJA 3VZDA 3BZWA 3E5NA 2PMBA 4HMOA 4C14A 2QJWA 4EITA 5ITZA 1K6IA 3JQPA 3QUSA 1PWZA 1T5LA 4G4GA 1U1IA 4WA7A 1WHSA 3HH8A 3C5HA 4X5OA 4KBYA 3RRJA 2NUPA 1EFKA 3KKKA 3SF0A 2V7WA 2JLCA 2R5NA 3GX1A 1M1NA 2V7VA 4NYIQ 1W9HA 3CLUC 1UUFA 1QP8A 3T5TA 5H59A 3UIEA 5BN4A 2XDYA 3OTOB 5A0TA 1AHHA 2DYKA 3JCZA 1JJVA 4IIUA 1V0JA 4LSGA 1N5RA 3QOFA 1MV8A 1TZ2A 4ENWA 3DDSA 1XRQA 4LXUA 4ZQIA 2P2CA 5BMVA 1E60A 1JYEA 2WHEA 1FBTA 3F97A 5E1OA 5JS1A 4DGQA 3LZ6A 2D7CA 1WU7A 1X0VA 3ZHZA 1JKXA 4HLNA 2ATIA 2G9UA 4JJFA 2XT9A 1IBSA 1SCJA 2UVDA 3MUFA 3NAMA 1TJ4A 1MXFA 1JG4A 1SFRA 1G6Q1 1UKZA 3EQ2A 1T2DA 4HAOA 3V1LA 4EHDA 3QG1A 1R37A 2J3EA 5EE5B 1PUJA 2IEBA 2M32A 2UYGA 1M8FA 1G38A 4YUZA 5KJCA 1DIAA 4RH3A 5A62A 3WGVA 4U7GA 4YGYA 1ZNXA 1EEXB 4D8TA 2W42A 5A4IS 1BKYA 2GASA 3IV9A 2DBYA 4OYYA 1RXWA 4XR4A 3Q8WA 2WP0A 2Y9PB 5CB4A 1ZSVA 1WPQA 4Q37A 2OUKA 4B4WA 4DQLA 1EU1A 6ABPA 1J8QA 2EL7A 2VAVA 2FQWA 4FGJA 4Q7KA 5FOVA 5A9SB 3ZJ5A 5LA6F 4R6XA 4RVGA 5EKTA 2ZJZA 3BT7A 1E3TA 2CNOA 1Z5WA 1FFYA 1HDXA 2J67A 4QYTA 1G4UR 3A1UA 3GJ0A 2J6CA 2JGFA 3KU4A 3MJDA 3QEMB 2R62A 4QREA 4DJEC 5IYZB 2OCXA 3K4HA 4NFYA 4YJ3B 3WLOA 5K3EA 4B34A 4B33A 4PLCA 2EARA 1UJ6A 5B7QA 2W6NA 2GPTA 3PXDA 2YXDA 1B6RA 1RRKA 3PDUA 1SG6A 3EBPA 1I6KA 1ZR2A 1DVRA 1N5MA 3WFJA 2AFHE 4PNZA 1OAAA 2XXBA 5DOVA 1Z07A 3VSCA 3A9UA 3AJDA 3OQMA 5JYDA 1Y7PA 1H4QA 4GXTA 1B8VA 3URMA 2AI2A 3GRVA 5KEIA 5TMBA 3QLUC 5FA8A 1MABA 3DCNA 4KIJA 2QL5A 2GYUA 1E3WB 1LDNA 2PZMA 3PWTA 4KEAA 4H2DA 1A7KA 4PY2A 2B25A 1HYQA 3IR5A 3W5IA 2FPUA 3BFXA 1A9SA 1EVQA 4EKGA 2ZTUA 2I78A 3Q15C 1FNSA 2BFWA 4XDZA 1JSCA 2X1HA 1Q6ZA 1YOVB 1LZKA 2BN4A 4OATA 3HYSA 1B8PA 1XUOA 2AJ8A 2CUZA 2QU8A 3LGXA 1K6EA 4J1QA 4D02A 4UAJA 2CLFB 4Y9SA 3EGDA 3RVMA 4L9SA 4G4SP 4KVGA 2XY4A 2FUNB 2YJZA 5THKA 2A6PA 2WKRA 1S8NA 4DLWA 1IHXA 1FNNA 1QYCA 2Y77A 4TYMA 4EG3A 5C5EA 1IUPA 4BMSA 3SHOA 1YACA 1GILA 1W59A 4XD7A 4CM5A 2D2XA 1QS0A 3TFWA 4DLAA 2ISCA 2QR3A 1ORWA 4IKOA 4ABYA 3CN7A 1QFJA 1SUDA 1UM9A 2YV2A 3F8SA 3HUTA 5EZQA 3ZD6A 3U39A 5AMXA 3AFGA 1JVSA 2HFJA 1CDOA 4GX0A 3I83A 4FDMA 2TSYB 4DV0B 1OA1A 3DZGA 3A1EA 4BVGA 4TXNA 3VDMA 3K6SA 1FFHA 3RC7A 3M9WA 3DBRA 3AM1A 2GCIA 2QMEA 2J32A 2ZU6A 1VLMA 2GVDC 4QU5A 1UIMA 4KJZA 1KAQA 3TSAA 3V80A 1FUEA 1Z0KA 2NYAA 2EW8A 3WLSA 4BIIA 2CMDA 3RTAA 2F3QA 3KQQA 1GAJA 3ZGLA 3T1NA 3OHPA 3PVCA 1T3GA 2P6PA 5AKIA 2J9YB 3I9NA 4B3CA 2D5IA 4DCSA 6GPBA 2WF8A 5IDYA 4DAOA 3O8LA 4FOLA 4TMZA 3IVXA 2BD0A 2IK8A 4RVUA 1RYBA 5EJGA 3USCS 3H4VA 1TECE 4AS3A 1S2OA 2IYEA 1FP7A 1YC5A 5JAZA 3NPAA 5IJZA 3D7RA 1M9NA 3KPUA 2XUHA 3MQFA 1HTBA 1IY9A 3ENQA 4FYWA 5A7HA 2P2NA 1QORA 1NSTA 4BC1A 1VMDA 5KJ1A 1XD9A 2OC4A 4E4YA 3ONEA 3G2NA 1XZEA 2D0DA 1Z7GA 3KYDB 3QFRA 2ZJ4A 2E89A 3IOYA 1M66A 4QGBA 1N3IA 1F06A 3T3PB 3ZXXA 4B3JA 1K8QA 2RHHA 2VAMA 4EG4A 3IEVA 2E18A 3CX8A 1HK7A 4DDTA 2CJWA 3BMNA 5F2NA 1ZIOA 4DA4A 4E4TA 3CCFA 3JQCA 1W46A 4PAWA 3FZGA 2CLDX 2WD7A 2JFHA 3JYLA 4OHOA 4RAQA 3TKYA 4CIBA 1DIRA 1TW2A 3L7LA 3C7TA 5AVUA 1U7HA 3FYUC 4WINA 4Z2AA 4LBWA 2DX7A 4QDUA 3H2KA 5AI6A 5HR5A 3GZNA 2QI9C 3ZZ1A 3HCOA 3W5CA 4ZVOA 1AV6A 5AVRA 4FYKA 1UAAA 2BYTA 3KXIA 5CVVA 3ICQB 5C8DA 2ONJA 2PRYA 5EEGA 4DA8A 2FDXA 2WJVA 4JNKA 4JP2A 3T7SA 1NQTA 1O0SA 4WKNA 4YIHA 4JKIA 3GLHE 1GO2A 4E5PA 4ENRA 3PT9A 3A4MA 2I1QA 4OQZA 1K89A 2Q5JA 1SULA 2OZPA 3LF1A 1GQFA 1KI6A 4TRNA 3VX4A 2WF5A 3VAZA 1W4ZA 3K0HA 1OC2A 4HDMB 4Q21A 4D25A 1V7CA 4XVQA 4KJXA 5CDSA 2QRVA 4NPCA 4PC6A 3G5MA 5KPJA 3BKWA 4RBNA 2V0NA 1TX4B 4GL4A 4IEFB 2R11A 2C83A 3NHKA 3B3QA 1IVSA 1CF9A 1WA5A 3ZDCA 1GNSA 3CR3C 5AUPB 5K0ZA 1JLKA 3Q9NA 1O87A 4P2BA 4C4AA 4ETMA 3CY6A 1Z7YA 1N32B 3II6X 1Q0SA 2ET6A 1QE5A 4X20B 4F6CA 2WU8A 4M46A 1I30A 4UU7A 5CVTA 3INYA 5G1PA 2QGFA 2OBMA 2QX7A 1T0IA 4M9SA 2PUEA 3ECSA 4YCJA 3EDQA 2FEAA 3AR7A 3R3ZA 4WBSA 2PQ2A 3DDNA 1E4OA 1DWOA 1H4TA 4BQEA 5BXYA 1U5AA 4MQFB 3TJMA 2EFDB 4B6GA 3ER6A 1XQWA 4YRDA 3MG9A 4W9RA 3E84A 1K7XB 1G7SA 3OQOA 1GPH1 3OX4A 1UJBA 5HMLA 5B6IA 3OEHA 3S2UA 5JH7B 1GT91 1THGA 3JQ9A 5JVDF 4ZI3A 3CVVA 3HI4A 1XWWA 2Q4RA 3FPEA 2F55A 4LN1A 1TCVA 3M49A 3K9WA 4OQYA 4UUPA 4F6LA 4LHVA 4D1YA 2PO5A 2WNIA 3O31A 3M89A 1NN0A 2CVHA 2W48A 1YQTA 2CJYA 2RI1A 1O57A 1RLJA 4TV8A 4F2PA 3GPLA 1PQWA 2HXSA 1PJQA 4F1JA 4TS4A 1DAKA 1O6ZA 1P75A 2C9YA 4ZYWA 1ZZGA 4CMGA 2VTKA 1W5SA 4Y9TA 1D6NA 2WJJA 2X2EA 3AUSA 3O2QB 4NMXB 2JGEA 4PZPA 4QRDA 1F2TB 5EJ2A 1RWKA 5A3VA 5D00A 3AWIA 2WC1A 4P8RA 2AWOA 1ODLA 2OTCA 3OOWA 5FBRB 1I9CA 2AN9A 4H08A 1F7UA 4HLUA 2PT9A 4KYUA 5EIEA 1ZVQA 2AZMA 5I7RA 3TDKA 4FE3A 5IX8A 2F1JA 3RD5A 4PYQA 5IAAA 4F4IA 1CB7A 1ZRHA 3UOGA 2HRDA 4Q18A 1YHNA 5CIQA 3HXLA 1L5GB 4GSYA 5SICE 3SBOA 3ZHTA 1OHHD 3ENWA 2XKBA 3SQWA 3OZRA 3E8XA 3G7NA 4P0PB 2JFYA 3F5DA 2LE0A 2HDHA 2PAAA 2YY6A 1Y9JA 3JYHA 1K2VN 3KG2A 2X0RA 4LBVA 1WG8A 1QCDA 2O5VA 3QJ5A 4U2CA 2ILTA 4UCQA 5KTSA 3P2YA 1C9EA 4L27A 4C4TA 2VDUE 4CM8A 5A3RA 2GXAA 5GADl 2YWGA 3V8VA 1DUIA 1U63A 4MWEA 1H85A 1UIRA 4ZJUA 4IQFA 3JAKA 4FR0A 4R83A 1XRMA 1E77A 1KQPA 1KYZA 4RPGA 4KQCA 4NX2A 3SQNA 3U3KA 4Z7OB 4GU5A 1ZK0A 4B3SB 2C5HA 5FOWA 2C5FA 2EDCA 3DEIA 3PYLA 2O19A 1WE2A 4YCCA 4ZVRA 2VI5A 3NEPX 4YEDA 1RIFA 2WHQA 1BRMA 5CEEA 1KBZA 1YFZA 3PXXA 3EARA 3EPJA 1GP2A 5EC8A 3EW9A 3Q5GA 1Z4JA 3T7KA 3CTMA 3DP7A 3DUFA 3KVVA 4J0JA 1AK9A 2UZ1B 4B82A 2GXQA 3OT1A 4MROA 4N5LA 1M72A 4JITA 1B3RA 2EX0A 1RWVA 3COPA 4URHA 4F12A 5B58C 3OPNA 3EXFB 3MILA 4IEEA 4JL6A 2CJXA 4DT1A 3SYRA 4P4LA 2GKGA 3KT6A 2P9YA 2C9BA 3BWEA 3O0DA 1L5RA 1NW9B 4K3VA 1QHGA 5KDLA 3W2IA 3LYUA 5IDWA 3HXMA 4YWHA 4Z4HA 7ADHA 1K9SA 4JIMA 1ESEA 2XQKA 2L0XA 1VJCA 5ALMA 1P5FA 1R0SA 1ECFA 1TKRA 1VB3A 1VTKA 1QRRA 2X1VA 4BNXA 2WQ7A 2BZ0A 2FW8A 5FHRA 1VA5A 3MAJA 1OIWA 4A0RA 4C9BA 4P4SB 3M5PA 2CK3A 3GJ7A 2VDQB 4UUMA 5DCWA 5KSZA 4GBGA 4U6QA 4JBXA 3HV2A 3SSOA 3BM5A 1WF6A 3L82B 1WB9A 2R8EA 1DBVO 5FPPA 5JAUA 2UZ4A 1HZZC 2XYRA 2ZCUA 3DAYA 3DT8A 3M9LA 4EI2A 2UUOA 3KOMA 4ZCIA 3RFTA 2RG1A 3QX8A 2JK1A 1VBNA 1EWYA 3T38A 3CVXA 1V6SA 7REQA 4YALA 2VPIA 2P6NA 3AG5A 4WEOA 2Z8YM 4J3JA 3BWBA 3ESBA 3Q7RA 2C1XA 1L9KA 3OIVA 1DEHA 1YDWA 2JJQA 3L18A 5I4KA 1F0YA 4BLWA 4EHLA 4HGYA 3L07A 2JASA 2D8AA 1QPBA 2O6HA 2X19A 5C5CA 1SR8A 5SYMA 4PXSA 1N9ZA 3WIBA 3BE6A 4TT3D 3UCFA 3A6ZA 1M2HA 3AVUA 4XYBA 5BSHA 5LUAA 4HAIA 1TUEA 2NWQA 3HCWA 3Q88A 3ROFA 4DA7A 2AEEA 3B5EA 3BQ9A 1C1XA 5J2TF 3WB1A 3VYWA 4MIEA 2CXQA 4JP8A 1R8QA 5I7VA 1H4SA 1FPMA 3R7WB 3TTWA 5LMUB 1SQGA 1DU4A 1JDPA 3OWOA 5T8KC 2WABA 5B4VA 1ZMXA 1JXQA 3S68A 5A4JA 3OZSA 5LVAA 4ED9A 2F8TA 3E22A 4J91A 1P2VA 3BE5A 3AMVA 3V8EA 1XDSA 5KYNA 4IS2A 4KXLA 1G291 1KY3A 1L4NA 4FFWA 2RGUA 4RAOA 3JD1A 1Z37A 2GN1A 3QLVC 1JHQA 1WABA 1CY6A 4YLEA 3ITEA 4DS3A 1SRQA 4TTAA 2XITA 2Y1DA 1ELOA 3E82A 5FULA 3GEBA 5FV7A 1FRVA 5DTJA 5BT8A 1TCAA 2FW9A 3ZH2A 4BJ6A 1LI4A 2OSVA 4RTKA 1D0IA 2P75A 4YAEA 4LJ9A 1K6MA 1PFQA 4RPIA 4EKDA 1YULA 2DFNA 3WAGA 1ORDA 5BWCA 3BXPA 1O1YA 3V2HA 4HSEA 4K9LA 2X8JB 1TVEA 3NGLA 2MDTA 4KRXA 3NHMA 2AFVA 2ZZKA 2P5UA 4L9RA 1PZFA 4KHPB 5F7OA 4OGFA 3RQIA 2DLDA 2EDAA 3NEJA 2OXRA 3K4QA 4IDNA 2MR5A 4L6IA 3RF7A 1YVRA 5CAEB 1HDIA 4DQ0A 3U3JA 2A1TR 1T9ZA 2JFPA 1GGEA 2CCGA 1E5VA 3ID6C 4ITRC 2AV6A 4H4DA 3M82A 4RXTA 4XVCA 5HK9A 4CTNA 2OB1A 1L4MA 5JMTA 5FTJA 2P41A 3F0TA 4RHXA 8LDHA 4CQLA 4UEJA 3OTHA 3G2QA 3SQLA 1VI5A 3UMSA 3RHTA 3U09A 1WKVA 4XX0B 3NR2A 5J43A 4Z99A 3TQCA 2OL4A 4LXIA 5LQCA 1ACJA 1F14A 1VSUA 1K4MA 4FMDF 4MRMB 4RFVA 3S7TA 4HBGA 3SYMA 4Q9IA 1FPQA 1XHLA 4LECA 3UG7A 3H2YA 2HU8A 1KSGA 3R5XA 1AIPA 4OMCA 5A5EA 3KSRA 3HEAA 4NYMQ 5HFAA 3A4IA 1UK8A 4MUBA 1WM1A 3PDIA 1Q1NA 2XMSA 2D5LA 3NBKA 3I73A 5JDCA 1ZUIA 2PWBA 3EGOA 1HDZA 1YI1A 3FF4A 3ZJYA 4P4TA 5LLDA 1FFGA 3MTIA 4YJHA 3FUWA 5KSPA 4DLNA 2I2XB 3ZWYA 1VKRA 1O08A 2CUNA 1T1GA 3AFNA 1XA0A 4BMCA 1U1CA 5ECDA 3BXGA 2M1ZA 3NQ41 5LCXA 3IUNA 3W8EA 1HDYA 3NBYC 4CWAA 4O8CA 1NKVA 2BFEA 1GTJ1 3RC9A 2VAWA 3JRNA 4R9SA 2A88A 2AH5A 2NVWA 4OQMA 3FNBA 1Q11A 3PNYA 4J0DA 3JQQA 2J87A 2ZWVA 4LV5B 4O4JB 3ZU2A 5H4HA 4IDFA 1CC1S 4ZT2A 1M1ZA 1K66A 2NADA 3UUEA 2ZETA 4DMHA 3WE7A 2X58A 4LXQA 4PZEA 2G5GX 4YPFA 5ICEA 4PQFA 2FKAA 2I5PO 1JIIA 5KSOA 4IWNA 1SXJB 2GBGA 5I9SA 1QHEA 1TKAA 5T6BA 4EKYA 4L51A 4OU4A 1Z6GA 2NVUB 1N6KA 2OGTA 3X2FA 1SC3A 1Y8RA 2A0YA 3GT0A 3AO0B 3HDVA 4C7XA 5DNCA 2VXCA 3LQ2A 4MB6A 3WX0A 4X92A 3QW4B 3H04A 2Y68A 3RKUA 3WYBA 3WLLA 1JEYA 3SKYA 4DZTA 1E94E 1D1PA 1Y5IA 2YICA 4D8VA 1WU8A 1QG4A 1MOPA 3PNMA 3TXAA 2G17A 1DQSA 3H4MA 3ZI7A 1CTQA 1ULBA 4AKGA 4P31A 5KX5F 5D1HA 4F4CA 3CO5A 4E7PA 4WFKA 4QPZA 5DH9A 1BVRA 4ACAA 2O8FA 3CEMA 1FDRA 4GI3A 4B83A 1RZRD 1BA3A 1RKBA 3F71A 2O4CA 4N7RA 2QVZX 3B82A 5TQJA 2EX4A 1XMSA 3WBJA 2GF0A 4YMTA 1G5FA 2ZRMA 2ZYIA 3E48A 2ZR9A 4CMCA 3JQRA 5KOJA 1PL7A 2OBBA 5D8DA 2PPVA 3AEZA 1KNXA 4HO1X 4HN4B 2DBZA 1LQ2A 3QVXA 1Z47A 3RVJA 1R0BA 3L2OB 5K4HA 1UBRS 3OM1A 4PLGA 2IUSA 1KEVA 4PG5A 1V5IA 4Q34A 2IIVA 4DJDC 1YZ3A 2G67A 4MGZR 4MULA 3SBEA 3GPIA 4BBJA 4J0CA 5GIPE 3I30X 4IVRA 3IDAA 3PITA 2BHRA 4Q4CA 1QPZA 2QGNA 4V0RA 5ENVA 2Z5FA 1JMYA 3L7NA 2CC2A 2XB8A 3QHAA 1VMEA 2EF0A 2M1XA 3EXHC 1WBDA 3QVTA 3LBNA 3T41A 4WBNA 3R6TA 5AXAA 1OAOC 1OLUA 5CM8B 1OZHA 1AHIA 4GXRA 4OJQA 4ZAVA 2D7DA 4M0FA 1SBCA 2YCLA 5FWDA 5FNVF 3SR4A 3SY8A 2D59A 5B3KA 4HNTA 5JFGA 1WDTA 4OG2A 4RHEA 4FYIA 5DSXA 1N57A 1S8AA 2A9PA 3BGIA 3M70A 4YCSA 4FI3C 2B4TO 2XD9A 2FYTA 2JK0A 3DT9A 4XQGA 4MINA 3BHMA 3ZTYA 3A04A 4CFZA 1KIFA 5G0UA 1Q5PA 2I4OA 2G72A 2H2FA 2ZJYA 1G2OA 2PVSA 1O5TA 3KJIA 4DAEA 4YI3A 1MB9A 4E09A 4XWKA 2WM8A 3L7OA 1UQUA 4MYHA 3RREA 1S2LA 4KBGA 4PYNA 4J49A 5CYOA 5FPTA 4IUBS 1I1HA 5IBRA 3WLMA 2F8SA 3IBCA 1YZNA 1MO5A 4I4TA 3GDFA 5IH3A 3D8BA 3R4VA 4BCDA 2AOTA 3B13B 2L2QA 4ZN6A 3NT2A 4KQ6A 2AXNA 4BJ3A 4WZBB 1EHCA 4IGEA 5LR6A 1GV0A 1CJUC 1JDBB 1QFYA 3O4HA 4NONA 3QLEA 4P35A 5J4HA 5F3DA 5JQGA 3DXYA 4O5AA 2K6GA 3MFQA 2ST1A 3K71B 3H9UA 5DI3A 2Q27A 2HHHB 1X9IA 5JJCA 4QC2A 2WQ6A 3ZZTA 2O50A 3FSEA 3KELA 1FRFS 1U4NA 2ZSEA 5KVQA 1ZI6A 2WV7A 4XTCS 5G4LA 5ECGC 1IHPA 4MK4A 5A9RA 1SKYE 5BSFA 3H2HA 3GMSA 5HS4A 5T41A 1IZZA 2FSPA 4G1UC 1BEEA 3S2IA 4B7UA 4EWLA 1ZA1A 2VT3A 3MERA 5GWXA 1BJKA 1EVIA 1W52X 2Q6TA 1EINA 1X80A 5EXXA 1U9ZA 2E4VA 4R4JA 2R1TB 3A1VA 4LTNA 2A7QA 4IRUB 2R3SA 5HTKA 2YZKA 4LF4B 3L41A 4J4HA 2W6PA 1QVVA 4PTZA 2AHOA 3KFXA 3ICVA 4NJOA 3CNEA 1Y8CA 2AF3C 3ZE8A 3C5WP 5AVWA 1KZ9A 2UVPA 1LJ8A 4IKEA 4IS3A 3LQ1A 4TTSA 1MNQA 2XRMA 1DZIA 3WYCA 2P4QA 1ULZA 1K27A 3WA7A 1XEXA 3KBBA 3V4RA 4WN9A 4OK5A 4XRRA 5C8VA 1HQKA 1TO1E 1WXQA 3EHEA 3MELA 5EIXA 1WXXA 1GDTA 4IHJF 4L2IB 1ZK1A 1JEJA 2Q2WA 2RK4A 1X1AA 3KB8A 1M0TA 3I2GA 3UICA 5BW5A 3HCRA 1IDN1 3MTQA 1SKAA 2GO7A 4NJEA 1PS9A 2CGEA 3OIFA 5AIAA 4GP9A 1E6EA 4ZI7A 3UY4A 1Y4AE 3K8QA 3THWA 4MVJD 1GA4A 4M60A 4DXAA 5K0LA 1MMFB 3AKEA 1BWPA 1MGPA 1N92A 3OFSA 1BXGB 1E3EA 2QKYA 2TECE 4LTDA 1P1RA 4OCZA 1IPEA 2PSJA 1NJFA 1J90A 4I9HA 1YRAA 3SHWA 1C7EA 3AR6A 3GJXC 5K6AC 2E1PA 2QG4A 4H0NA 4IQ8A 4W1RA 3ZY5A 1RACA 2QV7A 3BX1A 4FFSA 5DHRA 5K45A 4AY4A 4K5QA 2YYAA 5E8RA 2VJPA 3Q9SA 5CXXA 4M1ZA 4P7BA 1ZN9A 4FUQA 1FTQA 3A4YA 4QA9A 5TT1A 1EGVB 3VFDA 5ITVA 1PR2A 3FDJA 1JLHA 4ER6A 1OV4A 2BGLA 4LOAA 3ZDDA 2CN1A 4ZA2A 2PFGA 4Q48A 3RYFB 5J4LA 3DQPA 1A5BB 4QDKA 2NUAA 1A27A 3ORQA 3INRA 2Q7XA 1CR0A 2XVXA 2F3RA 3H87A 3M0EA 4CEHA 2BL4A 1UDXA 4M3NA 3WWDA 5C18A 5FV4A 1NJ6A 2DPYA 2YHIA 4I50F 5IXYA 4W7IA 5LN1A 2R6CA 3LTEA 1P0QA 3PF8A 2REQB 4KGDA 4C89A 4H6WA 3L9XA 5BV2P 3E81A 1DTSA 1P2BA 3AHEA 5IZCC 3ZBQA 4ZQEA 4KLZA 3ZZ0A 2EZ4A 4GQBA 3I5MA 3BCHA 4JS0A 1K2WA 3H7AA 2XDAA 3W6OA 2HK6A 3F5FA 3MLBA 3MRVA 4WCFC 4JI2B 3WQQA 4G4SO 1UOPA 2FQQA 3LIPA 5DGTA 5BN3A 3V46A 2VWPA 3QKTA 3UF0A 4ERNA 2A86A 4ZDWA 3IJ5A 2ZRNA 4H7JA 1KDYA 3TN7A 4WNCA 4V1CA 3VISA 3B1JA 1EH5A 4YT5A 2Y0DA 1N1DA 1KFBB 1RFGE 2NQTA 1I1OA 4I55F 2I4LA 3VC1A 4AU1A 5L3VA 1WZUA 4DBVO 3P9IA 1KA9H 4G9GA 2C61A 4NFLA 4CXMA 4FFNA 2BEWB 2C42A 3FYUB 4GWKA 2FRVA 3D4OA 4QNNA 2H4JA 1CJMA 5GQSA 1I32A 4ZDJA 4JUIA 2HKIA 3QMWA 2CMFA 4LYEA 4XLZA 1E1RA 3DWFA 3DOEA 3LBIA 1DFIA 3WJ7A 1EE9A 3HZZA 2NO1A 2W00A 1JEEA 3DM5A 4RGYA 2IYSA 2OCPA 4X9XA 1SH7A 5TNXA 5I8PA 1A9PA 3IUMA 3WNQA 4NS4A 3NV9A 4I66A 4ZT5A 2OCLA 1K98A 2ZWMA 3U4MA 1DXYA 4V39A 1Y9DA 4FFBB 5I5GA 5TY0A 2WRZA 3FKSA 1K7YA 2FWNA 1TMKA 5FF9A 4L4XA 2Z9DA 4Y2YA 2VWGA 2N1MA 2TS1A 4KK3A 3JAWB 1I0ZA 4RVOA 1VIAA 5U4QA 3VYTB 1S7CA 5JADA 1Z68A 2I8CA 2QTAA 3EVEA 3AJRA 3QBJA 3WY9A 2C2WA 4D4IA 3CLRD 3UB3A 4YBRA 3DTVB 4JFRA 1TIPA 4BWGA 3ZW7A 4KRYA 3WJ2A 5C46F 4K9RA 4GUAA 2VJNA 1IXYA 2RBEA 3AVYA 2WSYB 5HKAA 1QQTA 1CEXA 4NAVA 1J1ZA 3DBIA 4GGOA 3VKVA 3VZSA 3LFTA 1ZOLA 3WIEA 1DAHA 2O52A 1OFUX 1P8JA 4EY6A 1VL1A 2EJUA 1N8SA 3HN6A 3IYLW 3EXEA 4JR1A 2FETA 2PZBA 3CNBA 2RD2A 3WGTA 3KTDA 2HEIA 4P38A 1IOWA 5J4VA 1YFLA 3MWEB 1AGNA 3OJXA 4YYZA 1TM7E 2W2QA 1DKPA 4YLYA 1JKJB 1L5WA 3F3MA 5KU1A 2PZKA 1XTIA 1IQUA 2O1WA 4S1NA 4EF5A 4F3CA 1LJUA 1GG5A 1V5GA 3P2KA 4B6EA 1BFKA 3AVOA 3NIGB 2PKCA 4YCMA 4M37A 5B57C 3QHPA 4RLHA 3U4DA 3P0JA 1KMHB 1F9EA 3QQ5A 2FWPA 3A10A 4S1OA 5K3DA 4KDCA 4PX9A 1A3CA 4DJTA 2VA9A 2OYCA 3NOVA 3ZW9A 3INTA 1ZKMA 2VPXA 3ABSB 1E9DA 1FJHA 4GBED 5CMLA 5HOEA 1UL1X 3NPMA 1RM4A 4MRAA 3NHBA 2P11A 3IKTA 1OH8A 1N1GA 3E9NA 4JUFA 3KVNA 3QX7A 1C1DB 5GOTA 2XUZA 2B9VA 3KVOA 4PN3A 1UKVY 4BNTA 4UM5A 4U7DA 4GWGA 2W4QA 2CFCA 1WLYA 3GRUA 3MCVA 1AS0A 4UAUA 4BNVA 4F9EA 3EGVA 3TG8A 1M2OB 3HB1A 3PR1A 3IEKA 4Y7DA 4E5UA 4HD8A 3FUUA 1PK8A 3HO8A 1C29B 1II9A 2VDPB 1JVNA 3JWGA 2P0AA 1JFRA 2R79A 1G41A 4FFPA 3SS8A 1LPSA 1J39A 1DKUA 1DRKA 2VNKA 1MJFA 2P2YA 3K70C 1QK5A 1QGAA 3W0LB 4NRDA 4C78A 2RBKA 1CF2O 4DUZB 2EATA 2BUCA 3T12A 4TL7A 1JRLA 5TC4A 2P78A 1AC5A 5JEEA 2BMVA 1AG9A 4NOLA 3IAHA 4NBTA 1NBIA 2QTTA 3E70C 2QLNA 1I4LD 1US8B 3L6UA 2Z6UA 1TT7A 3VYUB 2RH9B 3PFCA 2C2OA 2BFFB 1M2JA 4F8YA 1AA9A 2XUDA 4D97A 5E6RA 3RKRA 3CC8A 1U1FA 4QRIA 2IITA 5LC1A 6AT1A 1NF3A 5CH3A 1YHYA 2D5CA 2OBYA 3D4IA 3K9GA 5AW9A 1W4CA 4M1YA 4I8DA 4LE2A 2D06A 2KS6A 4E22A 2MU1A 3T1VA 3V00A 3R3VA 2QDXA 2OMEA 3JATB 5CYPA 1P45A 1KORA 2AG1A 2Y3IA 4YN3A 1NVVR 3ISVA 1FDIA 3QVVA 2Y1GA 1UK6A 3GLTA 4WKBA 5M2QA 1KFEB 2DFTA 3EPRA 3K0FA 2WIKA 3SIRA 5DCYA 3FPGA 3GJSA 5I3ZA 3GXBA 2B98A 4RE6A 2EX1A 2ZUBA 2AMFA 4HUTA 4GPZA 1AURA 1PW7A 5KYYA 3D7SA 3VR5D 3HB4X 1W1IA 1CQIA 2XODA 4HMQA 2OZLA 1UWVA 1Y1LA 3Q3CA 4M0CA 4YP9A 4D4LA 4OMUA 1IJBA 4M1MA 2BFAA 3H6GA 1Y7IA 1E4EA 3L0CA 1P7YA 3UPDA 3D4PA 1OOEA 4TTPA 4N01A 3ETLA 3LC0A 3RYTC 3TRFA 1R27A 3TK1A 4DRXB 4F97A 2QROA 5EUCA 3PA8A 3KD3A 3NBFA 1P77A 1FFXA 3AL2A 3W6UA 3T0GA 1KSHA 2WTNA 1D2HA 2CVZA 4Z5XA 5LWQA 1IC6A 3D1JA 1N7JA 1E7YA 1U0OC 2IDJA 3B1KA 4N39A 4RV9A 2PE5A 2DKNA 1EFAA 4OHVA 1Y8AA 1C30A 2PGLA 2ATXA 1D2MA 2C9DA 4M7RA 3AZPA 5GP1A 2ZE8A 3I09A 5SZJA 2BFDB 1RKUA 3CE9A 3NTUA 1FJXA 2GEDA 4F5DA 4DMMA 5TRTA 4ERXA 1VL6A 4KRGA 4WNYA 2WM9B 2OGUA 1J2EA 4MJ3A 3BG5A 3HJGA 4HDNA 1VIMA 3T6KA 1ORHA 3KKOA 5G0WA 3PQ2A 4BVJA 1MZPA 3QBVA 1TD9A 5LYJF 3S1SA 121PA 5IJAA 3PUWA 1Q95A 4MRSA 4R1MA 5AW6A 5L3SB 2C9ZA 2I3GA 3CPEA 5MGNA 5EGSA 1VZ2A 5EVCA 1RZ3A 1E9EA 2LNDA 2QX9A 2I7CA 3K0CA 2D0PB 4HQLA 4HTAA 2I76A 5DNAA 4KR9A 5K0FA 3GPDG 1KQGA 1VSTA 1X9HA 3STVA 3STTA 1ECGA 1ZH4A 1J97A 2GYYA 3EDOA 1H66A 3C3EA 1VBKA 2VP4A 1M83A 2Y2VA 1JQKA 5LZ9A 1QV9A 1C4XA 2NXWA 3MBKA 2Y4OA 3PC8A 5FOQA 3H18A 4DHEA 3DONA 1RWPA 1S9HA 1V39A 1PP4A 1RVDA 2PKQO 1OX4A 4CI0B 5LQDA 3FX2A 2IS4A 1T0PA 2HCBA 2P5TB 4QEZA 5CITA 5FAKA 4MO2A 3OETA 1GN9A 1EXMA 3Q2IA 1TF2A 3WL5A 1R0RE 1ZXBA 3R24A 5AVOA 3OE4A 1L3CA 5CFNA 1E1QA 4EUKA 4CEJB 5JCPA 2ZBFA 1ZRNA 4Q9HA 2GCGA 2J0UA 2WMYA 2EJWA 5A0FA 3IIMA 3EB9A 1DBIA 1P31A 4PZAA 4EIWA 2VHWA 4EYQA 2O7QA 3G1UA 2H07A 4B6PA 1UKYA 1HFJA 2WAAA 4XD2A 5G40A 3KTAB 5H8WA 4DLTA 2ARKA 2R4TA 4N3GA 2FN9A 4CU2A 2D13A 4PXAA 4X85A 1HQYE 3LT5A 4POAA 1QC5B 1VKOA 1TYDE 1ESCA 8AT1A 1SD1A 3LYAA 1KPHA 3TF5A 4V0LA 2QAJA 2HA4A 4DEYA 1RC8A 1EFTA 4HZUB 3H2GA 3NB0A 4TN1A 3IPYA 4IOKA 5GM1A 4AIRA 1NLUA 5JQWA 1H5UA 3W3AH 3U1BA 3COVA 1BTOA 1CLEA 2ZJ5A 3IAS6 1ST3A 4HBZA 1P1CA 2OV6A 2WUWE 2C4WA 3SHTA 3UA3A 4AYTA 1D6MA 4DQKA 3FR7A 3QVGB 3T35A 1LW6E 2IGBA 3E15A 2X5KO 1T1IA 2VKTA 4EAQA 2QNBA 5CJ2A 4ARZB 4FGLA 4R2LA 1CRQA 3OQHA 4NYJR 1CFZA 3FHJA 2A67A 3D7LA 2Z6AA 2HO5A 3KV1A 2YV3A 5BO5A 5A1JA 5LBIA 1MEJA 3AM5A 2PL1A 1SBHA 1M1YB 3DOFA 3VDRA 1AUQA 2HCFA 4MV7A 1RJWA 3ZWNA 4DPKA 3JAMA 3MUEA 4L5CA 3MM4A 1X7GA 2C5BA 4RV4A 4O1HA 1MVLA 1JF8A 2AQ8A 2WHXA 5EIBD 1JB9A 2HWYA 1RQGA 2LCFA 1TK9A 2ZRAA 2XT6A 4LAFA 2CXRA 1D0VA 4R68A 3I5XA 4RD2A 3CNNA 2DR0A 3PNLA 2OK8A 4AMYA 4RD1A 4G97A 4OOFA 1AMNA 1CUYA 3QPUA 4H7PA 3F2VA 2PHZA 2XWSA 1EBBA 2ZAGA 1SQ0A 2WM2A 2FR1A 5KYVA 2VDJA 3U3OA 1E1YA 4RKYA 3RRYA 4NU0A 4Q4LA 4QJIA 1A8SA 4CLEA 2Q8NA 3VR4D 4CV0A 1XR3A 1M76A 3WMEA 2VFAA 3TRJA 4A8JB 5KNCD 3CR8A 4JLWA 4YMHA 5KC8A 5K8TA 3C4JA 4XSGA 4A73A 5H3CA 3ZTTA 4JENA 4MUKA 4KSCA 5IMBA 1Y6QA 4QPDA 1YASA 2YDXA 1I94B 3FOZA 2QTCA 3QE4A 4CCWA 4JK3A 1SVWA 4E1AA 5AHWA 1ZNYA 5AQ1A 2FI1A 3BFPA 3I12A 3NOOA 4GSKA 4Q24A 3IALA 4M7WA 4PC7A 3RB8A 1Q83A 3T9BA 2AIRA 3R8CA 1I7SB 3IMFA 1Y8QA 5E1MA 5G3YA 1GDDA 2NAFA 2X8AA 1DBWA 4GYKA 2O3UA 4AF6A 4JZKA 3DAHA 1VLHA 4RX1A 4GR5A 3SBXA 4ZO8A 4Z4EA 3IUJA 3SXUA 1HLGA 2ZZMA 3HYNA 3ZBPA 1R16A 1U99A 3KFLA 5MN6A 1E2JA 4Y8VA 1T4GA 2FMTA 1ZW6A 1JJAA 4H18A 2P4HX 4FX5A 3SNHA 1T9CA 3ZU5A 4MGKR 2X9QA 5TB5A 1XNGA 2VYCA 3LVQE 2CZGA 3LUDA 4UHCA 4BWVA 1MO3A 3MMNA 4KO4S 4R6WA 4WCDA 3PI6A 4B2LA 4ZJPA 2VTVA 4QLOA 5IANA 1YDEA 3LCCA 1SGWA 4IGIA 2J9XB 4I3FA 5PNTA 2VYVA 3RBVA 2PR7A 1ZCBA 4DSOA 1A9XA 3ADDA 2PMCA 3ZWPA 2TYSB 2O2HA 3UM9A 1FJ2A 1U3VA 1W6UA 3RF6A 2XUQA 1X8KA 4G5HA 1NVUQ 4LDRA 5A4MS 1EUZA 1KDRA 5E8JA 3BA6A 3R7NA 3G8BA 4QGHA 4P81A 1AQUA 5DLYA 3G2LA 3R6GA 1WZCA 2X7XA 3NXKA 1OX6A 4MV8A 1VI6A 5BQFA 4H77A 2XJ4A 3B1XA 1UJ2A 4IINA 4MR9B 4PRYA 5C8ZA 2NU8A 1P1FA 1A2BA 4GVLA 2A5DA 5GPBA 5KHAA 2JKYA 5KYKA 2XCTB 5EG5A 4QQ8A 1EFPA 1V8PA 2FPXA 2G1UA 4Q4HA 4WV3A 4E1VA 5CRIA 3ZXIA 1YBAA 1G21E 1FP6A 3CUYA 2RHWA 4AMUA 2OAQ1 1TUBB 3ETDA 1JXOA 1UQRA 4ID3A 3K94A 4RSHA 3RABA 2V9CA 2PSSA 1ZHFA 3F47A 1ATIA 3FWPA 5IYZA 3X1YA 2V0GA 3CX3A 1E2FA 1G5QA 1IBCA 1RXVA 2P35A 1UPCA 3TUZC 3AOEA 1U9IC 4X64B 5EIAA 4XFDA 3RIGA 4YBZA 1B14A 5MGBA 1LDYA 2CW5A 4KAFA 4BPBA 1HOTA 1SKQA 5C7LO 4MMXB 5MN4A 1TLLA 3WQHA 1A8HA 1Q1ZA 1ZC3A 4PPQA 1HRKA 4ZOAA 4ANFA 1Z15A 2QY6A 3C3DA 3L8ZA 3U44B 2RIPA 1I51A 1K63A 1OVGA 2XNJA 3AF2A 3ADBA 1QHNA 1K5HA 1PBTA 2ID4A 4KNWA 4B43A 4G65A 4TZ0A 4HPJB 1CS0B 4UMFA 3TVYA 2Q6OA 5JTTA 4S04A 2GCNA 1Q21A 2EVWX 2VHYA 4LJ8A 3L77A 4ILKA 5JYBA 1ISSA 1JJFA 1QKIA 1S01A 2GA9A 3EJWA 3M33A 3WRWA 2J31A 4CIAA 1VLQA 1VIDA 2YC4C 3EH2A 4Q15A 3W3AA 1UPFA 3IUQA 3ND9A 1CE8A 1KQ3A 2Y66A 4XOUA 5L45A 1DZ3A 2BTQA 3NC0C 3AUUA 1KMNA 3DNFA 1DQNA 1ZJYA 3L46A 4BE9A 1JEQA 4V0MA 4YMLA 1I10A 5LXTF 3FUCA 1VPTA 3C8UA 4FR5A 3SC2B 2ZQZA 3EMDA 2Q5FA 3ROEA 3EZ7A 3VMMA 5LQNA 2VBGA 4UOZA 1TFUA 1VKZA 4L50A 1YE8A 4B2IA 3RS7A 1DADA 3JWPA 2WWHA 4JJ6A 4H9GA 1T5HX 3RV4A 4DHWA 3G68A 4GZ6A 4BKPA 1GQSA 4WI1A 2PM8A 5LA6B 5FL7A 2H9YA 1QRDA 3D59A 4H6XA 4JJZA 2A9KA 2E3JA 1BCRB 2FCAA 5HF5A 1NMSA 5BNWA 5KREA 1VPVA 2XVYA 4FBLA 3V97A 1QU3A 3G6KA 3N2GB 2Q50A 2PT5A 5AOBA 3IIIA 3KQUA 1V41E 1MAUA 4RQTA 3ASZA 3HKEB 1L4LA 3ELBA 1KR2A 3FWHA 4YRFA 5TS2A 1JKMA 4Y2GA 1Y6GA 2AB0A 5CA0F 4Y9DA 2ZCVA 4G0YA 4UM9D 2WVJA 4H3VA 5DWDA 3SVLA 1REQA 2G9NA 4TV9A 3S70A 2H7VA 3MJEA 1HQDA 2HQRA 3WNDA 1U2GA 1XMPA 1EVJA 4EUSA 4P7GA 2XCSB 2RAVA 1IN6A 1FX0B 3OZWA 2AKYA 3LPCA 2C7RA 5IG2A 1LK0A 2PKYX 3B7GA 4ZVKA 5CFLA 2ZZNA 4RV5A 4X6XA 2X4DA 5H5JA 4DJJA 2YVLA 3KDSE 4MLZA 5BSUA 4ZGGA 2AD1A 4Q3OA 5MFPA 4NWIA 5KO2A 4CUKA 1LXCA 1VKNA 1DRUA 2RHOA 2BI7A 1YI0A 4P4UA 1XRPA 4A2CA 1SCQA 5CDYA 2ZIFA 5K8IA 2OV2A 1E18A 1HTWA 4QYIB 3SC4A 3SYLA 1Y1TA 3HYLA 4Q00A 1JDNA 3MCWA 1OLSA 1FP4B 2VF8A 2VT6A 4EB8A 1Z25A 4IX1A 3HP1A 2WAMA 1KY4A 4KE6A 5AUQA 2QEQA 2WFLB 2QX6A 5FIUA 5KOHB 3H05A 3STUA 2EZTA 4QE3A 5GIOE 4E6EA 1B16A 2JZOA 3HEBA 1FL9A 2O3QA 4HSGA 4LHSA 4LMRA 3HM9A 4RZXA 3ZJTA 2PUBA 5CGZA 4JR0A 5DWVA 2KHZA 3U4GA 1BNCA 4BB6A 2NQ8A 1N5OX 3L0ZA 4GXQA 1V11A 2Q1TA 3OZDA 2ZSIA 1O77A 2FHPA 4FP9A 4G5FA 1OQAA 5A9TA 3FOEC 3AVWA 2NUTB 1TYEB 4FKZA 5HF8A 2VDVE 2LUOA 4PHGA 3FNQA 4FS8A 1TVCA 3OF3A 1DX9A 3NEYA 1CHDA 4N7JA 5HGXA 1NI5A 1C4KA 1DEOA 3BAZA 2NXJA 4KMOA 3T94A 2NMVA 4YDQA 2HA5A 2FJ0A 2X22A 4L9AA 3ZQKA 4MA4A 2M6KA 4F9TA 4KH0A 3N07A 4CI9A 5CB6A 1PU2A 1PZXA 1QX4A 1LSOA 5HKLA 3W2EA 1F38A 1JSZA 3G2OA 3NJ8A 3ILHA 3CSUA 2KQUA 3JQGB 4JC0A 4XIFA 4ZZ1A 4L4UA 4RTRA 2DWPA 3I34X 2PZGA 4WCFB 4KZPA 2FWRA 2NN3C 2IW3A 2OV4A 3AEUA 3DTTA 3G8DA 1PZEA 3MC1A 4MIOA 1GGHA 3TJZA 4MCAA 4P5DA 2GXSA 1JTEA 1ESZA 1LUAA 4MI9A 1X39A 2RARA 4JJ8A 3WLEA 4TYNA 3E5MA 3F3KA 4L57A 2MSWA 1NF9A 1SOUA 1V1RB 3AHHA 1FC0A 3CIFA 3EG5A 3N0WA 4MPRA 1F0NA 4IR7A 3NASA 1UT6A 4C3OB 2IVFA 1U7ZA 3QHQA 3IJPA 3S3TA 4XSVA 4CMEA 5IKMA 1EGAA 1LSSA 2XA1A 3A6GA 3K6JA 4M1WA 1WP4A 1Z4OA 3UUGA 5DM1A 4Z0PA 5JPCA 1EK2A 1ULAA 1W1UA 1Z6YA 3TE7A 3UMCA 4KZKA 3TL6A 4E94A 3UGKA 4BE4A 1JA1A 3V33A 3HS3A 4XFJA 2OKCA 2XEDA 2OGSA 1LSJA 5FPKA 2FZEA 5J5VA 1LLFA 3ETEA 4QSHA 4BNDB 2P9JA 1K4KA 1DNPA 4MCJA 3VPSA 5FBKA 5F52A 1E4YA 3BHIA 4PYOA 1SBYA 4OF4A 4WESB 4RTJA 3W06A 4OX9Y 4GVPA 5FT9A 2PUAA 3CV3A 2YH2A 3RFVA 3OZIA 3KIPA 1JHYA 1SOVA 1MFPA 2Q62A 1DKOA 5C3MA 3EA0A 2Y76A 4GR4A 3G7UA 4RFSA 2FF7A 5F64A 1OU4A 3QYJA 3ITKA 4NE9A 5AHKA 1SAYA 3B1ZA 2EW1A 3IVMA 1E5TA 1W5AA 2A84A 5JAPA 4DV3B 2PBLA 4MDHA 2GEFA 2RHCA 3R2JA 4IQ4A 3HUDA 2AG6A 3KSZO 2ZJ0A 3AILA 3AUXA 1XCBA 4M0MA 5TLSA 4CLOB 2IYAA 2QX8A 1GQQA 3OC6A 4EOGA 1X86B 2HHCA 4C87A 1JQAA 3LUKA 2G1PA 3PWZA 2AOUB 4EQ6B 4AUEA 2O1SA 2A9OA 4OD0A 3COYA 1M2NA 2LTAA 2PSHA 4XX1A 2QM7A 4KQIA 1KAGA 3BWDD 5KOYA 1KJIA 2PGOA 5AW1A 1C4WA 2HWWA 2XYGA 1BCSA 5JXWA 4UHHA 3AIOA 3G3EA 3ONDA 1NNEA 3Q1LA 1T91A 4P7FA 2DETA 4YJGB 4R1UA 4L78A 1LZLA 4XYMA 3VZPA 4RPLA 4HYTA 1OLXB 5JLJA 2FZ4A 1G17A 4MUEA 2QP9X 2VTDA 4TWZA 3V7WA 3HU5A 3TQIA 4GOMD 3EODA 2GOYA 4EZIA 2HHJA 3VM6A 1NR1A 3QF7A 1DQRA 2JGDA 1RAEA 1Q7CA 1TI7A 3B85A 1ZBQA 2HCRA 2DMRA 4KB5A 4P92A 5T4HA 3E53A 3SF8A 3ZXSA 1ODKA 5TMEA 2PLRA 1QYIA 3CVUA 2Q4OA 3FUVA 5DM60 2BP7B 1W85B 1CPYA 2OFPA 2RGNC 3PZRA 3IJRA 1KP3A 1JFLA 1QIHA 3TW4A 5IUNC 1QHIA 3ONNA 4TN5A 4WZAB 4Z0HO 2W6CX 3RLFA 4PXYA 5DHAA 4AKIA 1XDDA 4PG6A 2D8MA 2Z8XA 2HMUA 4YHHB 4KO2S 4K9SA 3TOSA 3FLAA 3N76A 4HAYA 4QBFA 3FYCA 3T7EA 2GMWA 4DNFA 1FTGA 3NHRA 4JB0A 5KS2A 4RXMA 2XHZA 4FLEA 5JZBA 5CH5A 1KZ7B 3HJRA 1PL6A 3JQAA 4KPYA 1LEHA 3MJHA 5I6DA 1P74A 3GW8A 2CMKA 2ODWA 2FR8A 2GK4A 5L9AA 1OGIA 2YXNA 3B51X 4IF6A 2GEUA 4K26A 1MORA 4JT9A 2EOAA 2BBSA 1J2JA 5ETJA 5TPZA 5U1PA 3ABRB 3SYTA 4I2VA 4ECAA 1A9OA 9MHTA 1UXGA 3O3NB 3TM5A 3L6EA 4BVFA 2DCUA 4Y2VA 4C1NA 3ZV5A 5HIJA 4JHLA 1SXJD 3AB7A 4D82A 2GBLA 2IYOA 3VUFA 4TLBA 1Z2PX 3ZDXB 1Z18A 3SM9A 2WAYA 4IF4A 1GPDG 3VGPA 4QUKA 1JLRA 3IEPA 4M88A 3T4XA 2G7MC 1GZ3A 4KYIB 3O8QA 2H5JA 4IXWA 3MINB 4UHJA 4IIFA 1W0JD 1TQHA 4XARA 3MTGA 2O2YA 4QHSA 1BWSA 2FZCA 1SUIA 3MJSA 5KVCA 1KK1A 3R9XA 4RHYA 1GPNA 3C3PA 1R3DA 4B4DA 4DMRA 4BFYA 1PJZA 1W0KA 1YRQA 2DRIA 3H11B 4GMKA 4IIJA 5H3LA 3S2EA 3V1TC 4IUYA 2CCKA 3KYIB 1F3OA 4KPFC 2ZIXB 5AXDA 1YL7A 1JECA 1WQ4A 4B75A 1KI7A 4R9RA 1KXZA 3VU0A 3QTLA 4HDQB 3JWEA 2L19A 4I9GA 4UFPA 4ZYXA 2W6ZA 3NATA 2IX3A 4RPKA 1NT2A 1OU0A 3AI3A 4IXDA 1QG0A 5J2UA 2JI6A 1ONBA 3KFVA 4XDYA 5KAPA 1W2WB 2ZWIA 3NBUA 4QFCA 1DCMA 5ALRA 2P4EA 1GFSA 3GI1A 3D5QA 2YOHA 4O2BF 6REQA 2HX1A 3OZXA 1RABA 3HP4A 3DF9A 1IHYA 1Q1AA 3ANSA 2R85A 4A6PA 2CLIB 3ZYCA 2Q3HA 2Q2VA 5EYPB 1JL3A 4ZARA 3P1JA 1TZBA 2I3ZA 2ODAA 1CQWA 1YUBA 4RETA 4BCCA 1BXKA 2H1WA 2BUAA 1V4BA 2DHDA 4COKA 1H2BA 4M8IA 3IO3A 3A2MA 3QKWA 1LVUA 3QKRB 5LOVA 1O95C 1OFTA 1T5IA 1ZQ1A 4I4IA 2XNKA 2XQVA 4OQXA 1X2EA 2VVTA 4C29A 1ULSA 1W94A 2BKLA 5B36A 3H5TA 3IMCA 1YR1A 1D4ZA 4XWWA 1PV2A 3JVEA 4F3KA 5AK3A 4LI3X 1EDDA 5AW5A 4RIFA 6Q21A 1Z45A 1YCHA 2RHGB 3E3NA 1A4XA 2DHCA 3OQBA 2H8GA 4X95A 4CKBB 5DK6A 1TAHA 1RCTE 4IRMA 3TLYA 1JHDA 1T3LA 3WMRA 2Z2ZA 1IY0A 5J40A 3DEAA 3JASB 4PR0A 1YI8A 3HXTA 3RAJA 4PHCA 3SGLA 3ZWOA 2V7QA 3DBLA 5CURA 3BAFA 3FAKA 3WGZA 1SXPA 5LSAA 2BEUB 4BO0A 3PRHA 2ZJ1A 4LF8B 3KYBA 3PGVA 4FUTA 3EAGA 3I01A 1UXHA 4X91A 5GONF 1GG9A 3ZJ4A 4GBMA 3FZQA 2BH2A 2WYIA 2P5YA 2YVUA 4DMFA 3ORFA 3DD5A 4BC0A 2JBHA 5J2TB 2EKLA 3LIIA 4URUR 1HNNA 4D9MA 4BXOB 2OR3A 4WKOA 4W5NA 4EY7A 4O2RA 2UUAB 3RCBA 3BEDA 3GFOA 3WHPA 2XMRA 1DT3A 2JCGA 1XAGA 1V8ZA 1A5TA 2BGUA 4AJJA 1PEDA 4YVFA 2CZCA 2VH1A 3IRUA 3W34A 2H0RA 3J80A 4CT4B 3B60A 3PP8A 5AO9A 4WE3A 5E4FA 1Y1KE 3N7UA 3LRXA 5G53C 3QPBA 5BOSA 3LA6A 3MWDB 1WZNA 4Q1VA 2QPAA 3L8DA 2GAIA 1P72A 5IEJA 1IBLB 3QVLA 1E1LA 1KIAA 4HATA 4L8YA 3AVXA 5GAJA 4LOIA 4AJIA 3A25A 3DA8A 2ACVA 3CUEF 2JEZA 3D3KA 4PVCA 5LQKA 1N0UA 2PUJA 1Z0SA 2FPKA 3DJYA 1EM8A 3FCOA 3UKDA 1QTRA 3WLFA 4YRGA 1TZJA 2G4VA 2O0MA 2P9HA 1G8MA 1KMMA 2ZT6A 2WKQA 4K6KA 1U2RA 1VLJA 2D1TA 4QBTA 4AIIA 3PEYA 1O94C 3NYIA 4C76A 1E7MA 2AC4A 2WA1A 3P4YA 4C08A 1NUSA 1TK2A 1CJSA 3UH0A 3GLIA 2R47A 1I0LA 4B80A 2H4HA 1U2ZA 1RP7A 3QF4A 3QU2A 4YK7A 2N0SA 5F9HA 3PK0A 5LZ5A 2X2FA 3LQFA 1ZH0A 3MPUA 2EFYA 5JE8A 2QMOA 3KOOA 3ONFA 4UXJA 1SKUA 3HRKA 1KMQA 3W3AD 1OFUA 4GW3A 2XBLA 4LDAA 5TS3A 5K0EA 2GR9A 2QR2A 2XB9A 3OC0A 2Z3VA 4Z7JA 1MB0A 3HJBA 4BVKA 1JBEA 2JFGA 3IAFA 4FJ0A 1WTAA 2FK7A 1QH1A 2BZSA 3RU2A 2UYCA 5HM8A 3R0ZA 3PUVA 4FMDB 1BDJA 4UD2A 3V7FA 4IJ6A 3TI7A 4Z1OA 1COZA 3KLMX 3QPVA 1O9BA 1K5PA 4DQUA 5HW0A 3MZ0A 3FFAA 1IL0A 1U7WA 3IDZA 1U11A 3B6EA 2C92A 3L0SA 3LAWA 1J9GA 4A27A 1N77A 1KRHA 3EMBA 3PEUA 3TJRA 3F3YA 2J0SA 3IAM1 1LGYA 2IUTA 5E9AA 3IAUA 3N0TA 1UDWA 5EMLA 3C6QA 5LQRA 1FQWA 1PV4A 3NOXA 2V7GA 2QM0A 4QGSA 1NGSA 2RC5A 1YJ5A 4LJKA 2WZQA 3DYVA 1YKGA 3L92A 4ZAWA 1M5UA 2V55B 1T8PA 4HEA1 2H2HA 1WV0A 3H99A 2H0AA 4Q4JB 1KO8A 2A59A 3OPYB 2IYYA 3FIJA 3FVTA 4JXKA 5CLLA 5A03A 1U28C 1SO8A 2YQZA 5I7EA 1E98A 1I1QB 4A1FA 1KFKB 2XXAA 3OFND 3KEOA 3GRPA 1V4VA 1VCNA 3E7PA 1CZNA 1MAAA 1WCWA 1C0PA 2KBEA 2PV0A 4Y1EA 3DZFA 2HJHA 1OXVA 3B9BA 5DYTA 3IP1A 4AYXA 3W6NA 4QUBA 4B85A 4KMSA 3ZDZB 3D5TA 3FUTA 4N0MA 3ODPA 2OMKA 1DAOA 1Z4IA 2QUBA 1S6YA 4XOIA 3ELUA 1ZH8A 4YV7A 2R00A 3PHGA 4GP6A 2CZQA 4X90A 1M8JA 5D84A 4HNQA 4G5RA 1QF7A 5LWHA 3LX5A 3GROA 3OAAD 1ZVVA 1U0GA 3AEQA 1Y33E 3GGDA 4B2PA 3PI7A 1T36A 2RK3A 3D3WA 3HCDA 4NECA 4EW1A 5L8VA 3L43A 1CETA 3PVSA 1C3OA 3AUYA 3IA2A 3P0EA 4H0CA 1VE5A 1IY2A 1O96B 1ISFA 4G0VA 1N5KA 5DTIA 4X1KA 3EIUA 4KFSA 3RBXA 3VVCA 4QUGA 2IP1A 2C20A 4YRAA 1UAYA 5ICFA 4F5YA 1L7XA 1BHQ1 1V1MA 2VNAA 4GLFA 4HH4A 5LIRA 2Z3WA 4ECEA 4MWCA 2QY9A 3DPUA 3RG8A 4LBYA 3B70A 4TYPA 3ZHCA 1Y37A 3SMQA 1BE8A 2HEGA 1NVEA 1H1DA 3R6WA 4QVKA 4Y0VA 2EKZA 4NESA 3UJNA 4A0FA 4EYEA 4WERA 5AI5A 4MR8A 4D5EA 2AUTA 4X44A 5EHGA 2IIPA 5I8ZA 4DV7B 4B81A 3GDHA 1DO0A 3IILA 3JY6A 1FRQA 4XPZA 1HDRA 2QL7A 3RTGA 3UWMA 4BGDA 5IM4A 3PUKA 1WSBA 3DZCA 4LRSB 2BJVA 1Z2CA 1RHKA 2QXTA 4WK2B 1T4DA 5TVKA 1KARA 1PR1A 1UXKA 2ZSDA 4JYCA 1PZMA 4OGGA 4DR3B 3OJOA 5JCJD 3MMSA 1W1WA 2WE8A 4N18A 1XLTC 3F5SA 3DTVD 1P44A 4ZZ2A 2H6EA 3I3SR 2PRKA 2A0XA 4I6GA 4OSEA 1TA4A 1DLIA 5EWLB 1BH6A 2ES4A 3NDJA 3P45A 4NEGA 1IEXA 1GN8A 3NIDB 3UO8B 1HNXB 4KQGA 3UAYA 3SHFA 3ZK9A 3GGJA 3I62A 1Z29A 5JECA 1EMDA 1KYYA 1UT5A 1Q6YA 3M9XA 3BGWA 4Q47A 3UTDA 5E3HA 4R71A 3O9ZA 3E9MA 4MKXA 2WT4A 9ABPA 4LZPA 2HBYA 1WSWA 2AXPA 4WECA 3UQYS 5KQPA 4L5BA 2KI5A 1X77A 5CB4F 1Z3CA 3EQ8A 3F90A 1RZUA 1IIRA 4JODA 1OJ7A 2YFYA 4Z51A 5CLQA 3FNFA 3ROTA 1NQVA 1GFZA 5GZ6A 3WYNA 3EFOB 4KP7A 2JAWA 2GEJA 1JEDA 4H7HA 2CDAA 4U6SA 4ND6A 3ESQA 2NTJA 2C2MA 4MUFA 5DKFA 3WOHA 4E2FA 2Y67A 1TT5A 5C7YA 2HJWA 3MIZA 4Z0NA 3EEOA 2B6HA 4IW3B 3H3XA 1LBEA 1UKEA 3TW8A 3GP8A 3RYHA 1XTVA 3T06B 1QOQB 4MYDA 5I4IA 1BGVA 3HR7A 4XZ3A 5L40A 5TIIA 1OA0A 1YUMA 1YBHA 3H8VA 4TGLA 1LB1B 1WNTA 4ETIA 1AKQA 2FUCA 3EXG2 2JHAA 4A6DA 3LUCA 4IMJB 3H5IA 3OUUA 2H48A 2GKOA 2XLCA 2N46A 3C6XA 3OIYA 4I6EA 2RMKA 3KNZA 3QX9A 3BK7A 2FG7C 4FT2A 4RNDB 3TAHA 4AMBA 4ESEA 7MHTA 3KJHA 4P5EA 2AEJA 1WVIA 3U48A 2ZRLA 2B4AA 2IF2A 1HDCA 5DBGA 1SU7A 2ISSD 2PMKA 3EFHA 4OK3A 5K01A 5C9ZA 1G8FA 4W5RA 2O57A 2F8LA 3BKXA 4W5QA 3ER9A 4UEQA 1R4MB 3ZNPA 3LP5A 2FW6A 4LZLA 5C7IO 1BJRE 1XK6A 2HMYB 2M6RA 4WOCA 1VL5A 1UOQA 1NKTA 1M75A 2I6SA 2ZANA 4HMPA 1K0FA 2XTZA 3K8YA 3AJEA 3IBSA 5CCEA 4JI6B 3TSCA 5ECYA 3BWCA 5DHUA 4ZJZA 4IV0A 3PLRA 2ZSUA 1ISHA 4PO3X 2GBIA 4PTYA 1T43A 3NV7A 1ZD5A 4HB2A 2HY7A 2HB6A 3GB9A 2UAGA 4JBLA 5L3QB 4LRXA 5DNYB 1FRZA 4BNZA 1TCCA 1HFWA 1U04A 2WLSA 4F6RA 3W2FA 5KJEA 3OM9A 4IHJB 2Z9CA 1UEIA 4MW0A 3DMHA 3ZXUB 4URWR 1HDOA 1SHZA 2ZT5A 3GDOA 2PYDA 4DLXA 3WI7A 4RA6B 1IRXA 2A5JA 4GMDA 1CVRA 3ZS9A 2YKGA 4PSDA 2F6RA 3PPXA 4FS3A 4URZR 5D6NA 2HREA 1JTFA 5ARDA 1F0KA 4EKEA 1NWCA 3ZDYB 4UCFA 1JA9A 1U6JA 2MSKA