2OBBA

Structure of the conserved protein coded by locus bt_0820 from bacteroides thetaiotaomicron
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
121
Chain Sequence
NAMTIAVDFDGTIVEHRYPRIGEEIPFAVETLKLLQQEKHRLILWSVREGELLDEAIEWCRARGLEFYAANKDYPEEHQGFSRKLKADLFIDDRNVGGIPDWGIIYEMIKEKKTFADIYSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Structure of the conserved protein coded by locus BT_0820 from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 30
structure length 121
sequence length 124
ec nomenclature
pdb deposition date 2006-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2obbA00
1Q92A 3RFUA 2Q5EA 5AICA 1L8LA 2FPRA 2BY4A 3DDHA 4CF3A 1X42A 2PQ0A 4ZEXA 4DWOA 3QU5A 2I33A 4BX3A 4EZEA 4OCZA 1FEZA 2C9MA 4BNDA 3AR4A 2FI1A 3PDWA 3WKAA 3QNMA 4E88A 2NYVA 5AK6A 2W43A 1MH9A 3J7TA 2B30A 3M1YA 5ALGA 2ZBDA 1LTQA 3FVVA 3W5BA 3I76A 4UASA 2QLTA 3E81A 4I9GA 4BYGA 4FE3A 1QQ7A 3CNHA 3OTQA 3EF1A 4NWIA 3AR5A 5IS2A 3KZXA 3VAYA 1U02A 4YIKA 3BA6A 2OBBA 1TJ3A 4Y2XA 3IJ5A 1RLMA 1ZRMA 1Z4MA 1CQZA 2HEGA 4UMFA 3SD7A 1T5SA 3QUQA 3MPOA 5AKXA 1L8OA 3CZ4A 1O08A 2YMPA 5AM1A 4KYTA 3L8EA 4JDPA 4UM5A 3W5CA 5AI0A 1VJRA 3ZVMA 1YDFA 1J97A 3QUTA 2JAOA 1L6RA 3KD3A 2B8EA 2G07A 1Z5UA 3B8EA 3U7GA 1KYTA 3OCVA 3SF0A 3WK4A 3ZVLA 1CR6A 4BEWA 3ZX4A 1F5SA 4RETA 4BX2A 2I54A 3E84A 3ZTWA 4YIHA 2ZOSA 1Z88A 4L57A 5ALFA 2P9JA 3NRJA 3UMGA 3UM9A 1Z4OA 3OPXA 1Z5GA 5ALOA 2B0CA 5ALPA 2B8JA 4YH1A 2W4MA 3TLMA 4NV0A 2RAVA 5AM4A 3BWVA 2WHEA 1SWVA 3ZU6A 5AKEA 4UATA 2JGAA 2NO4A 3OCXA 5ALMA 2C88A 4YGYA 1U2SA 3NUQA 5ALXA 5IT0A 4AS2A 3ZX5A 4EELA 2G08A 5AKGA 1WVIA 4O8CA 2HF7A 2HO4A 2JARA 1L7NA 1U7OA 1NRWA 3ESQA 3QU9A 1RRCA 2OM6A 3OCUA 3WK6A 2FUCA 3K1ZA 2YFYA 2ZBGA 5AW4A 4UAUA 1IWOA 2WF7A 4Y2YA 2PR7A 2FUEA 5ALVA 5ALYA 2YJ3A 4G9BA 3L0BA 1EK2A 2O9JA 3HLTA 4J03A 4HAIA 4UMEA 3SMVA 3NAMA 1Z4JA 1N8NA 3PGVA 4UM7A 1ZD2P 5AW7A 4UW9A 3PGLA 3WK5A 1RLTA 5AI6A 5AI4A 2FDRA 2AGVA 4UMVA 3QU4A 3RF6A 1L7OA 4OD0A 2HOQA 2IA5A 5AW6A 1Q91A 5AKYA 2I6XA 2YN4A 3FPSA 3UMBA 1K1EA 3I28A 4HGRA 4NABA 3SKXA 4Y2QA 4MUMA 5AVRA 3DNPA 4XOUA 5ALTA 3NANA 3D6JA 5AKLA 2G09A 1RMTA 2ZBEA 3MMZA 1O03A 3SHQA 3E58A 4F71A 3I1YA 4Y3UA 1SU4A 3QU7A 2GHTA 5AKIA 3OCWA 5AVZA 1ZJJA 3L1UA 5ALQA 5AI5A 3FM9A 1TJ5A 3WKBA 2PKEA 4XQ0A 5AESA 1Z4IA 4FFDA 2YMLA 2WM8A 1J8DA 2QYHA 2HHLA 1Z4NA 4NAVA 4AP9A 3QGMA 4IG4A 1L7MA 4L6CA 4DCCA 2WF6A 2GMWA 4GIBA 5AW9A 1YV9A 2B82A 2AUTA 1RMYA 2VKQA 2GHQA 1RLOA 3U19A 3QUCA 1EK1A 5JJBA 2B1RA 2EATA 3S6JA 1ZOLA 1RKQA 4AS3A 3EF0A 4C4TA 5AW8A 4HGNA 3F9RA 2BDUA 4KX3A 2AH5A 5AVWA 4UAVA 3WK8A 4F72A 5A3QA 2C4NA 1WZCA 3L8HA 3W5DA 2BDEA 2B1QA 3SLRA 2GO7A 4CE6A 2EARA 5AI9A 5ALRA 4OHFA 1YJ5A 3OCYA 3NIWA 2I55A 4QJBA 4YCNA 4CF5A 1RKVA 5AW1A 3PCTA 3U7HB 4BEVA 3U7FB 3U7EB 4BNDB 5AVXA 5A3RA 4JB3A 4HYTA 5AVTA 4KNVA 3A3YA 3ZVNA 3WKDA 2YBDA 3ESRA 4GXTA 1XVIA 2P27A 4FYPA 4H1WA 3N8GA 4XE5A 2IOHA 3FPBA 2IOFK 4BX0A 1LVHA 2WFAA 3WK7A 5IT4A 2I7DA 3L8FA 5AK5A 2R8ZA 4UU1A 4EX6A 3U13A 2WF9A 5AW5A 4ZEWA 3KDPA 2OA0A 5AVQA 3QU2A 1PW5A 2RB5A 5ALUA 1T5TA 4Y2TA 3M9LA 4BBJA 4Y2PA 1RQNA 3OCZA 1RMQA 3EPRA 4Y2RA 2CN1A 2YY6A 3KOOA 2HCFA 4I9FA 2YJ6A 4ZEVA 3WKEA 5AW2A 2W11A 3ET4A 4Y2JA 2FPSA 5AVUA 3ZTYA 2ODAA 2RBKA 5AK3A 2ZBFA 3L1VA 5ALLA 5ALDA 1QQ6A 3KBBA 4EEKA 3DV9A 4NFLA 2O2XA 1L7PA 4HGOA 3EWIA 1VJ5A 4DW8A 3IB6A 5AKZA 3B9BA 2G06A 2G80A 3AR9A 3A1EA 4Y2SA 5AI8A 1Z4PX 4PNHA 1RPZA 1S8OA 2R8EA 2HF2A 3L8GA 5E0OA 3AR2A 3ZI4A 1ZD3A 5ALJA 4UARA 3WGVA 3GYGA 4HGQA 3QYPA 1QYIA 3N28A 2RARA 2P69A 5AIAA 4MWOA 2NO5A 5ALIA 3QX7A 5ALHA 1YNSA 4CF4A 5AW3A 3AR6A 4OFZA 3ZWKA 3P96A 2CFRA 3IRUA 2Q4TA 3U26A 4EENA 1YS9A 1RKUA 2HDOA 5ALKA 1Z4QA 1WPGA 2GFHA 3R4CA 3ET5A 3ED5A 5AVVA 3A1DA 2YMMA 2JAWA 2MU1A 2G0AA 3L0CA 2ZXEA 1TJ4A 2CFTA 2C8KA 2FEAA 3DAOA 3AR3A 4C4RA 4IFTA 3R9KA 3MC1A 1TE2A 3SKYA 2C8LA 5ALSA 1RQLA 3WKCA 1TA0A 3N1UA 3UMCA 2HX1A 4KN8A 3ZWDA 3QLEA 3KC2A 1ZS9A 3A1CA 1QH9A 2ZG6A 1QQ5A 2YMQA 5AM3A 3L7YA 3I6BA 5AKJA 4UU0A 4L6AA 1NF2A 2WF8A 2MSNA 4YCLA 1AQ6A 5AM0A 3ZW7A 4XPZA 3QUBA 2Q4RA 5ALNA 1ZRNA 2YJ4A 5T41A 2IYEA 4C4SA 1S2OA 2JAUA 1ZD4A 3E8MA 3HYCA 5ALWA 2FPUA 4KX5A 1U2TA 4KNWA 2DQSA 1VFPA 3WK9A 4BKMA 1T9ZA 2R8YA 5AKHA 1RDFA 5AKKA 2D2VA 3R09A 2X4DA 5AM2A 1Y8AA 2HSZA 3AR7A 4J2TA 5AM5A 2FPWA 5AVSA 4CNQA 1XPJA 5AVYA 2I34A 1N9KA 1JUDA 1NNLA 1XP5A 4B6JA 4Y2VA 1U7PA 5AW0A 4RESA 3QXGA 2FPXA 5AHXA 2WF5A 4YCMA 5FP0A 3ONNA 3NALA 3MN1A 1Z4LA 3W5AA 5ALEA 3NASA 2G1AA 4Y2UA 1Z4KA 3B9RA 3WGUA 4DFDA 1YMQA 1SWWA 2YJ5A 5ALZA 4UMDA 2HI0A 2IOFA 2P11A 3FGOA 3L0YA 3AR8A 5AIBA 2AMYA 1WR8A 1ZD5A 5AK4A 4G63A 3ZUPA 4QQFA 5A3SA 3FZQA 1RC8A 3L5KA 3N07A 3N5KA 2CFSA 4EX7A 2EAUA 4HGPA 2R8XA 2OYCA
chains in the Genus database with same CATH superfamily
4D97A 1Q1NA 2Q5EA 2Y0PA 2RG1A 1C4OA 4NMHA 3UH1A 5GIOE 1JIUA 3FDJA 3LPLA 4OXYA 1CYEA 1XLTA 4YJ2A 1AV7A 2OCKA 3DBVO 3DDHA 3HRIA 5G0WA 2BFBA 4ACBA 2C9DA 3VM6A 3SQWA 2BM0A 4ZT4A 3T7EA 2OO7A 1OBCA 2SHKA 3MQFA 1UBRS 3T7SA 4HJXA 5F2KA 4RDXA 1UEJA 1ZGAA 2QQ0A 4GL4A 3DJFA 3PRJA 1PEAA 1K6XA 1QYXA 1L7QA 1YH3A 3PKZA 2HA7A 3AI7A 1QR6A 4M9ZA 1CQPA 3WKAA 2ANCA 3SEZA 1G8KA 1KY2A 2XF2A 3FYTA 1VE5A 4C7KA 1RAEA 1PT7A 5L4SA 4MW2A 1U7DA 1CUZA 1U7ZA 4H2DA 3BGDA 3D8RA 1DBQA 3ZY5A 3U3OA 4JC4A 3EEBA 4C0SA 2VVTA 3RTDA 2Q9BA 1CETA 4KXMA 1LD3A 4M8IA 1U3DA 1WS6A 3TFQA 3ESXA 1J5XA 4JLVA 4EA7A 5LMCA 1AJEA 3HDTA 2PAFA 1D2NA 1KJYA 1KR5A 2P9EA 1WF6A 2I78A 3ADOA 3HUFA 4IIVA 4MWEA 5BWLA 5J3JA 5GJBA 2COUA 1U28C 4ONEA 4NU8X 4PGHA 5FPKA 1FP7A 4HUJA 3KQLA 1ZK4A 1E2NA 1KQPA 5KTOA 2J9XB 4C2BA 4I1UA 5EJ9A 3F5DA 1WXDA 4MVXA 3MM4A 5G0TA 1E3IA 1UXGA 3SD7A 1N2BA 3B2NA 1Q44A 5HK8A 1DBWA 5CNKA 1MOQA 1J0AA 1OMOA 1OWMA 5CA0F 4DOMA 2GYYA 1EQ2A 1W52X 1GRQA 1FNMA 2PA0A 3I0ZA 2VZEA 4OFBA 2PT7A 1G55A 2IPOA 2I2FA 2XVZA 3TRIA 4BRUA 4XTCS 3NGLA 4RIIA 1YCDA 4OKNA 3TBHA 3AGQA 1HEYA 1IHDA 4IUCS 2DWOA 1C30B 3TNFA 5BQ3A 3B1JA 3EUFA 1JS1X 5I5EA 3A4MA 4CKWA 3NP7A 4EJSA 1PVVA 3PNBA 5ECWA 4NH0A 1JHMA 4O4JF 2UVDA 4DZTA 2HPAA 2NTEA 2OAEA 3ICWA 4MGKR 4KNYA 2Y1XA 2PFGA 4L5BA 3PXBA 2G8LA 1WL8A 2FHPA 2H2DA 2QYTA 2WJAA 3NIDB 1H8EA 4WLNA 3X1DA 1IHPA 2ZUFA 3FLAA 4KIJA 2HF9A 4HLCA 1XKTA 5J63A 4GQAA 1CQJB 4XUEA 3VSCA 1RQXA 3EAFA 2IXGA 5EVJA 3IOEA 2O6HA 1KVRA 2XE8A 1VKHA 1TX4B 1YCHA 2Z1MA 3D3KA 3DQZA 4P82A 2WJVA 4KLNA 5BNFA 3KXLA 3VVMA 1TGYA 3Q3GE 1YQUA 2OC9A 1G6OA 5LQAA 2VDKB 4N76A 3EDOA 1FXSA 2GEUA 4I6EA 2PKYX 3TK1A 1JHOA 1SKQA 2NO4A 4CLEA 4PLTA 3HJCA 4UCWA 2IOQA 3SSMA 2PBZA 1P33A 3HJAA 4Z6KA 4XIIA 4WX2B 3K94A 3QPUA 4GR4A 3RUIA 3IGFA 2RE8A 1WVIA 5CITA 1UK8A 5LL6P 3FFBA 3T9DA 1T1IA 3ZWBA 2OT3B 1F14A 1JJAA 3ITNA 5HZMA 5T8KA 3OH8A 3ZV4A 4QOIA 4QREA 1MLDA 1WUYA 1JQEA 1JJVA 2R62A 4EMUA 3SQDA 3FB4A 1AKWA 2AVNA 3H4TA 1MJHA 2D8AA 4RVDA 2ZYDA 4U8GA 4RJJA 3GG2A 3UMYA 2I2BA 3HR4A 3LDGA 4NPCA 5TVGA 3HKCA 5BMOA 3CBQA 4GF5A 5DISB 2OWDA 1T5DX 1B0AA 4WESA 4CN8A 1YS2X 2WIAA 2VWHA 1PK8A 1ZUNA 4UBLA 2HDNB 4EY5A 4KIGA 5FI1B 1N9ZA 3WBJA 2O9JA 2QX6A 5HBRA 3SC4A 1WMDA 1V71A 2P2GA 4C08A 3VU8A 3OBBA 1ZI8A 3O3NB 2AK2A 5FTKA 4J94A 4CKEB 5JS6A 2NMVA 4HB3A 5IN5A 3SCZA 3J7AC 1IZ0A 3OM9A 4I55F 2ACEA 1GU7A 1L4FA 4OP2A 4AZWA 5LXTB 4RNDB 3WV5A 1YVUA 2DH5A 1BHQ1 1EHIA 1WMFA 2ZWVA 3PTAA 4GI7A 2ONYA 2PWPA 4ECAA 4B6PA 3SEQA 3AXSA 1KI1A 1A4UA 1NVVR 2RGXA 1JLLA 1H66A 2I5PO 2FK8A 4MQ6A 1ODIA 1P7WA 1PKEA 4KU4A 1PV1A 3GIDA 4HGRA 4LJLA 5BXQC 5HUQA 2RAUA 1W2GA 2W2KA 2PGJA 1BMFD 5LZ8A 1FLDA 3IXMA 1J5PA 3IQXA 4IHJF 1N2ZA 2IS4A 3NHKA 4MZDA 1PIWA 2H6EA 4HNAA 4JX9A 3C3AA 5GPBA 2VYFA 3IAEA 3GARA 4HLNA 4MIEA 2J5KA 4JKIA 1QHHB 4DV5B 2C59A 1SU4A 5F7JA 3SC3A 3TZBA 1E9FA 3IHKA 1OE0A 1S8NA 1X15A 4LYEA 1O9HA 2ZAGA 4ID3A 5EQJB 4AULA 3DVSX 3DXYA 4RHXA 1W0JD 1Z25A 2WG1A 2YS6A 3C5WP 4RVCA 4W1SA 3U0VA 5AJTA 4O29A 4BP9A 4LRQA 3L2OB 3GT4A 3OZVA 4QG7A 4QHYA 4NONA 4TTPA 3NWBA 1P0MA 2WNHA 3PX2A 3ROKA 4QXOA 4Z8YA 4J2HA 1O89A 1J8DA 3EWNA 5DCYA 1GFIA 1QB7A 3X44A 5DM2A 1D9ZA 4HDAA 4OQEA 4MB6A 4R8LA 3PC8A 4H9GA 4I5EA 1WZNA 1P1JA 5J4YA 1RADA 3H99A 4MUIA 3AEUB 3HI6A 2C8JA 3HVHA 3V42A 3T7KA 1H1LB 2GZAA 4YUWA 2WDZA 3DLHA 2IIPA 4LZWA 3B53X 5IW8A 1I3NA 2LR0A 1YVEI 4EPYA 2DGDA 4HKTA 4HL6A 2ODWA 4J76A 4WXRA 1TO6A 2FMIA 3O9ZA 2BMDA 1QQTA 1YA6A 2DHQA 3RVRA 3P0HA 3BERA 2D5LA 1QFMA 1QFJA 4RVNA 5K3BA 1I4EB 5ITSA 1H93A 5JQGA 3MELA 4P7GA 4B7CA 4NARA 1PK7A 3DE4X 4UAVA 1VG8A 3B1VA 4XASA 4UM9B 1XDDA 3DAGA 1ZNQO 2HPHA 4FMDF 1O0BA 3V5NA 4WZAB 3FYUC 4IILA 4JASB 5JIBA 1REQB 3RC7A 1K6JA 5K3EA 3U6KA 2QBYB 5CB6A 1FRFS 3S8MA 2HSWA 1C3JA 4DVJA 2ZKLA 1BD3A 4BKOA 4EUEA 4JJFA 3R9XA 1YJ5A 2JLRA 4GZ6A 2YRXA 4QECA 3EDMA 1QO0A 1XAHA 2X0JA 4C1NA 2CEAA 1UK7A 3MGCA 4UNPA 4MCIA 5HR5A 3GPLA 2JJ1A 2D1YA 3CLTC 2R1VB 3FHOA 3KDAA 1GPLA 1A27A 1GQ2A 3F6YA 1R6XA 3A6ZA 3K35A 2XDQB 4GZ3A 5FQNA 4MDEA 5HYVA 1AO3A 1FW8A 1T8PA 4HNGA 3A3PA 3D2LA 3TIFA 2R25B 1SBZA 2QUAA 2W6IA 2GBFA 2ZVPX 3H9UA 3K9CA 3IHLA 4JGGA 5JO9A 3RB8A 3TIIA 4HNQA 1R0WA 2W2PA 3OZDA 1MX5A 4JNKA 1IE3A 5C46F 2Y0EA 6LDHA 1RAAA 1XF1A 3KALA 1XVIA 2HRCA 2FNAA 1O9BA 1XRLA 2R5NA 3Q98A 4MA4A 5EJFA 2ZAYA 2C9CA 2FFHA 2Q4EA 1NBOA 3CNBA 3LG2A 5FBWB 1NLYA 3QZUA 5EJ6A 2IGTA 3AFGA 4XIYA 3S81A 3MWJA 4QFCA 3B6EA 4MV4A 4ZDWA 1A71A 1FFGA 4NY1A 1IPEA 4Q19A 3ZGVA 4CNBA 3AJAA 1X7YB 1SR8A 1TLTA 4HC4A 2ZDGA 5KJ1A 3U5ZB 2C58A 5AVQA 1BE1A 3K6RA 4FR0A 1BA3A 1WXGA 4MVCA 4X9XA 3D5QA 4M0PA 1QRRA 3T7JA 4BHTA 1U0BB 1K63A 4MCAA 4P6VF 1KJZA 1L7RA 3IEKA 121PA 1RMQA 2YUIA 4E5YA 3KB2A 1X1TA 2Q6LA 3PWSA 4F46A 4LXHA 3A70A 2HA5A 4H6XA 4RMGA 2CHVA 2FPLA 2RHLA 4L7VA 2A0YA 4P36A 2CSXA 1SKYB 2C04A 4U2CA 5B58T 2ZJ1A 1TUGA 1XCGB 1QPGA 1QUFA 3F78A 1DPFA 3IB3A 2NTJA 3C14C 3L8CA 3OPVA 2BRUA 3GY0A 3JYOA 3V34A 3VTFA 2MWMA 3NU1A 4E70A 1WP4A 5B1IA 3PLNA 4POOA 2P9CA 3ETJA 3STVA 2QX8A 4YJKA 3CSSA 2ZRKA 3M6UA 4DMKA 3BBPA 3V7YA 1K06A 4DR6B 2FW1A 3VPHA 4F38A 1PZEA 3Q1LA 3ORQA 3Q85A 3DTVA 4ZVUA 4B0PA 5IKPA 3WNQA 5JXJA 1Y1KE 3IVRA 3L4SO 1KI4A 3KYJB 3LBAA 3U37A 1Q17A 2JFWA 3RWOA 1N1MA 3D1VA 3GZTB 3UHJA 3KTDA 3NPMA 4B3BA 4CEHA 1FQWA 3GUUA 4YEDA 4ZV4A 4Y2SA 5EXDA 5A6SA 3NWEA 4FB5A 1PJLA 3OA0A 4YRTA 3CUWA 1F9EA 1HDGO 1VHTA 1XWIA 4X92A 5COAA 5E0OA 3VPFA 4ERXA 1G5HA 1OA0A 3VI3B 4EABA 5KTPA 2CNWD 3FSRA 1YMVA 1OIWA 3NMUF 4AI6A 4O3FA 2IDKA 3NVMB 4B33A 4WFJA 2R751 2BFAA 2DKNA 4CI9A 1A9TA 1NKSA 3ONFA 5ALIA 4D9EA 4J4TA 1H2WA 4MQEA 1NQAO 1WV0A 2O2HA 2NUTB 3AI1A 3Q6MA 4AJPA 1NQOA 1P3JA 2DR0A 2G7ZA 2XYHA 1NYLA 4FC7A 2XRFA 4FI3F 4JXKA 4NF2A 1RI4A 3PFKA 2A5LA 3PF8A 1DDOA 3OIFA 4NBLA 1MFZA 3QFTA 3Q9LA 3EIHA 1DC6A 2BCEA 4DCMA 5KJCA 5AJHA 3KT0A 3HCAA 4Q18A 2PUCA 1T3GA 3CLVA 1R5OA 2BFFB 2E18A 1KIFA 1TU3A 1T4MA 3IKLA 4OY3A 5KSYA 2WKRA 4MW1A 4EG5A 2JFYA 1QV6A 3Q5GA 3FROA 1IN6A 4ZOBA 4DV7B 3D5EA 2CLSA 3VR5H 4ZOCA 2EKZA 1G20B 1CRQA 4G89A 4NNPA 2DRIA 4M7RA 1I10A 4ZCPA 5IP5A 2ZI3A 1Y33E 2GM3A 4GE0A 1JFFB 2SCUB 5C31A 1LNSA 2FEKA 4JB2A 3HGMA 3LQRA 2VXYA 1UCFA 1B1CA 1XD8A 2QRQA 3QENA 1NIPA 1DAHA 3L06A 4JMLA 4Q1DA 4V0MA 4WA7A 2WVGA 3LH5A 4BBZA 1I7PA 1SH7A 2ZIGA 4GMDA 1E7RA 1OT3A 2B25A 2QTBA 3QVWA 2VT7A 3E9EA 4N0MA 4U2BA 1H1TA 2II6A 3PICA 1NF2A 4Q1FA 4AJ9A 5CEEA 4AQYB 1DLJA 2XUAA 3BCUA 3I83A 1T0JB 4HMPA 5JS2A 4PZLA 3W6PA 5JWRA 2PEZA 1LDNA 3SFTA 2P4EA 1MN6A 1HTTA 1GGVA 1J99A 2BI8A 2P3SA 3B51X 3HACA 2EZ9A 3N8NA 1EWYA 2R6R1 3PFWO 2ZU6A 2FZWA 4IDPA 4CTNA 5IXSA 2PCJA 3SHWA 3AFOA 2C84A 4TWBA 2O20A 5L6LB 5C37A 4OLHA 3KPJA 3NNNA 3SYLA 4BVJA 1XTIA 2FR8C 2Z2YA 3WGZA 4O3MA 1R16A 2FPUA 5HTOA 3N2ZB 2FPOA 2K5UA 4H08A 4GYWA 1EB9A 1YB4A 2B99A 4X1IA 4Z7NB 1WTCA 3PHJA 1T9ZA 2OK8A 1Z83A 5JSZA 3ZWMA 5CIWA 2RSLA 4CQMA 5IM5A 2OHFA 3MWKA 2XMCA 3H2ZA 3NH9A 2X4DA 4O4IA 3ETHA 1IIRA 1BTOA 1XRPA 4INAA 2P0YA 2JIBA 3GJRA 1OD6A 3X1ZA 1WW2A 2AVDA 4BTLA 4FGSA 1L7XA 1E20A 3GDHA 4PS0A 1PJSA 4Y2HA 3RWMB 4BFZA 3ETCA 3DTYA 1XU7A 2QNBA 2EZ8A 1BH6A 3MD0A 4U2KA 3W9BA 2H57A 5AFSA 2PUVA 3BUSA 1SQ5A 3PENA 3KSDO 4FEGA 1E94E 4HDMA 4MEBA 1I80A 2WT9A 4BFTA 1E2UA 2WW8A 1UBGA 2NO7A 2JCBA 1YAJA 3QE2A 5GONF 1U7PA 1OFVA 1T1GA 2A5YB 3WHLA 2FWAA 2Z95A 3P9PA 3JRXA 3C24A 3RRFA 2W8BB 2MYPA 2QI9C 3HRKA 4XCXA 3SJBA 1DQYA 4PBTA 4KC0A 2JFVA 4KQ9A 1V3TA 1OZFA 2WTBA 3ICEA 4TRJA 4KJZA 4GYYA 3SZLA 4HYYA 2ZXFA 1WB9A 5KUTA 2KMLA 5KJ6A 3IL2A 4KR2A 1FY2A 1SWWA 3JTEA 1RWQA 3GLFA 2HMAA 3LA6A 3EXHB 4WERA 1C7QA 5LYJA 1CZOA 2IUSA 3JTMA 3TQTA 2PZBA 4C0KA 3ZWPA 3HA7A 4UAJA 3JVUA 4FZVA 2F1KA 5BYAA 1DL5A 4XFJA 1G38A 1ZD5A 2JHCA 3A9VA 3UZUA 2OAGA 2WLSA 5TJHA 3RSHA 2DG2A 3WLRA 2OGZA 3K32A 1H2HA 4JYZA 4HNVA 2OLEA 2R2AA 3JU3A 1OTHA 3NGXA 4M0KA 4RKEA 1F6DA 1LF5A 2EKBA 4BLPA 5BW6B 2XKKA 3GFOA 3KXDA 3MTJA 1NW8A 1L8LA 3EGIA 1PLKA 4TLDA 3CH6A 5K3FA 4DA0A 3L41A 2AK3A 3ESBA 3WWPA 4P83A 2VRNA 1M54A 4YMIA 2ZRNA 2C9MA 3R3XA 1MHTA 4RQBA 1NI5A 1GDDA 1GQFA 3NDPA 4PC1A 1P5HA 3AUAA 3AL0C 2OL4A 1C1HA 3DBHA 5AK6A 4I3HA 5CVTA 2GESA 1BWSA 1RYNA 3BMNB 1ABEA 3LO5A 3QI2A 4HWTA 4NTZA 1ODTC 5DV9A 5HW0A 3WGIA 1YASA 4MQUA 2ZBQA 3T3OA 5GIPE 1FFDA 2JEYA 3GJ3A 5CA1F 3F9IA 3HB5X 1RWPA 4Y30A 5B30A 1KH1A 4D9CA 1LI5A 4NNJA 4QNMA 4U00A 4XR4A 2AWOA 3SZMA 4DLSA 3BMOA 4DLYA 1Z5OA 1TM1E 4G67A 4UASA 5B7PA 1PSWA 1Q22A 2VNJA 3HKEA 4GM4A 10MHA 2BFEB 5EMHA 1SCAA 3ROFA 3ODGA 1PV2A 1QQ7A 3X1MA 4YR9A 5CD1A 3H5WA 1ZM4A 4J43A 3EVGA 3OIVA 5SY6A 3KZXA 2AFIB 1VE1A 3SQLA 3V3KA 1HFKA 2RD2A 2QT0A 3DV0A 3T0IA 4BOYA 2HWWA 2JI4A 1IH8A 1S4MA 1UANA 4RTMA 4UMFA 1LSOA 5ITZB 2GYWA 2FPGB 3CZ4A 3PJRA 2QPAA 3PC2A 4R1QA 1IPFA 1QKJA 2FWNA 4RK6A 4UM5A 2JGDB 3I58A 3VJLA 4MKHA 1TI7A 3D8BA 1OI7A 1V5EA 1DC3A 3L4BA 4JY7A 3WL8A 3IPRA 1HBJA 3AVOA 2NPFA 4H0NA 4UJ5A 1YOVB 1NP6A 4OHMA 3SX4A 1QG2A 1V47A 3QQPA 4EKDA 3B36A 1F8UA 5F2EA 2UYOA 3HJFA 4HXFB 3LUCA 3LBIA 3I64A 4NJEB 2FR1A 1T0UA 3AZQA 3HADA 3MS7A 5TPWB 1I94B 1C8VB 4UBKA 2H1WA 4OKSA 5KNBA 1T2AA 3L6OO 3W8FA 3FCEA 4F3YA 1W29A 4Q3DA 4L57A 4AC9A 3HCEA 4F06A 2QAIA 5MGBA 3D4PA 2LVBA 1K08A 4RK4A 1QBKC 5HFAA 2J33A 2J0UA 3DUFB 1GG9A 4DA6A 2QZ4A 3FZNA 1UDWA 3VNVA 1N9GB 2XUPA 2V6BA 1EVQA 4I4CA 2OCGA 3IA7A 3PFBA 4ZI7A 2Q5HA 4W5QA 4MW4A 3MB5A 5CP8A 3NXSA 5J2UF 4N8DA 3DBLA 4A5SA 2I65A 2NV2B 4WOPA 2O8VA 3TL3A 2WG2A 2RAPA 2NO6A 1WE2A 1G5IA 2QPTA 1ZU4A 3IAXA 2L19A 4NEQA 2WI8A 1KO7A 4M83A 5AKEA 4UTPA 3H7AA 1TKAA 1N2JA 1TQ2A 2EC5A 2ZI6A 3IESA 3IT1A 2P7IA 1MDBA 2FP4A 2IYRA 4BFLA 4EW1A 1OX4B 1UZNA 3EG9B 3PEYA 1ECLA 1DDIA 1K66A 1K7CA 3TYXA 4RF2A 2QTTA 1ODKA 1UDRA 4GWKA 4XSHA 3QM1A 1ISFA 2OSVA 4O2AB 4URFA 1NTRA 2RB4A 3FH0A 2JGJA 3W0LB 4B3CA 1RLIA 1XK7A 3IPCA 2H85A 3RRMA 1P2UA 2IXFA 4LSZA 4LBVA 2HZBA 1A04A 2MDTA 4KUHA 4OU4A 2HTEA 3H8WA 1T8SA 2WKSA 2F43B 2NPIA 3GQVA 3AU8A 1XPOA 2G4LA 3C3DA 2JFOA 2BEVA 5H8WA 3COJA 1KSJA 1Z0IA 4OHBA 1HG0A 2Z1DA 2WF7A 1WJGA 2A57A 4GDMA 3VGJA 5DXFA 3KKOA 1U8CB 3A4NA 4HAOA 3ZYZA 4BNWA 1NE7A 1YBMA 5ALVA 3KZNA 4LGMA 1Z6QA 4M7WA 5KO2A 3ZZTA 1K4KA 4X6YA 1FNDA 3EMKA 1BXKA 1RZ3A 4LPKA 1DBPA 1E4EB 3CRZA 1LBQA 4P0PB 1LBHA 4UM7A 4BNZA 4Z4CA 1ZD2P 2R7NA 2HGZA 3VH2A 1TEXA 3ONDA 5JMOA 4RC9A 2HU2A 3B38A 5B3JA 4TT3A 1HE1C 3FWHA 1ATZA 4RK5A 3ROPA 1ZVVA 1AXGA 3HBJA 5BOVA 2VWQA 3GFFA 4KR3A 3COSA 5KVVA 1Y8RB 5BR4A 2AMVA 3SYKA 1CJKC 5EJ5A 1NT2A 2YN4A 1ZGZA 3GLGB 2AJ8A 5FB3A 1M74A 3WLHA 3BGIA 1FFXB 4H1HA 4XOUA 5DK4A 3KQYA 2ZRCA 4O4LA 4YVFA 4CUKA 1A9SA 1LPMA 3LP6A 3MAGA 3K8YA 1MT3A 3ETLA 4IVPA 2X1VA 4GR9A 2PJRA 2HA3A 2VPQA 2P75A 4R9VA 1FDSA 4KYIB 4Q3CA 2WJJA 3I1YA 4ND8B 2F7SA 1MAAA 2QRMA 4Q7LA 2FQYA 4IGAA 4NMLA 5CDGA 1JW9B 1V3QE 1PFQA 3GLHA 1OXMA 2XVYA 3DZCA 4NQZA 4IPTA 3ECCA 3AWIA 1RWBA 1M8GA 1AS0A 1N5KA 5EWJB 4F11A 1NXQA 1K8RA 4ISCA 1B41A 5K0GA 3D4BA 3V8VA 1H9CA 1IEQA 1L5YA 2YMLA 4LK2A 2QTMA 2C77A 4FP9A 1W0KD 3JQAB 2Y99A 5G0UA 5T67A 4YT4A 4ZK2A 3QVLA 1J25A 3IALA 3RGGA 4DCCA 3RUHA 2YASA 2YZKA 3HCPA 4DDHA 4TVSA 5EP4A 3LTNC 1LDMA 3RYIB 4CDRA 2C5HA 1DCMA 3P2YA 3RWBA 2J6HA 2EGHA 2UVPB 1IEWA 3MBKA 4IVQA 4P5DA 3CX8A 4FNGA 1XXHE 1J20A 1KDPA 3V1UA 3C48A 4G65A 2YYYA 3GLUA 2B1RA 4PC2A 4TS3A 1J2JA 1HMYA 1N1GA 2E48A 2FB9A 2NV6A 2IJGX 2FVYA 2RONA 2VFAA 2WNSA 3GRCA 3LUBA 4G8JA 4IZ6A 2DUMA 4KAXA 2OQVA 3SBEA 5J1SB 5L3QB 3T7IA 5JCJA 4C7OA 1QRDA 5DI3B 1E5TA 1CF4A 1M72A 4NBSA 2XUQA 2X41A 5KYUA 3RE1A 2BGTA 4QAJA 5IUJC 4F72A 4G0VA 1WXFA 3IXQA 4W8GA 2RCNA 3H8VA 3PEUA 1WUKS 5BV2P 4LF8B 1GEGA 4FONA 2NX2A 3LPNA 1AN9A 4J3FA 4TL9A 3WBFA 3A2KA 5JE8A 3W5DA 4FD3A 3TTTA 1Z2AA 3QXJA 2BGGA 1CY1A 1OGIA 4ZVNA 4HEHA 4X6LA 5ALRA 3O8CA 4DIBA 1CR0A 4P9NA 4KMRA 2IYXA 4ZZ1A 3GJSA 2GOYA 1OLUA 1JEYB 2RGEA 1XEFA 1Z8DA 1YFJA 1XMXA 1TF2A 4QDZA 4OSOA 2SECE 2RH9B 2GN9A 3K0KA 4HH0A 1XTTA 4HQRA 5AK0A 3VMFA 4DQLA 4DNOA 3BQNB 3S44A 4FHZA 1SXJA 5JJKA 4OXKA 4N6GA 5AD1A 3JQQA 4NE9A 1P75A 2IY8A 4KXWA 4BNFA 4PG8A 3G5MA 3WADA 2A0KA 2CLDX 5DKFA 5CEFA 1Q7BA 4BBPA 3N2GA 1LTKA 3OIDA 1CUAA 1UOQA 2GZDA 2P9GA 1LW6E 2ODTX 3HJTA 2ZAMA 4FYPA 4O08A 4DT1A 1EHYA 3DL4A 4IGFA 3CZMA 3FRHA 4UAGA 3ZY4A 4BX0A 3V80A 3MT7A 3FI9A 2NUPB 2VJKA 3QE4A 4N8EA 4OQQA 3S8YA 2IDZA 2HIGA 1Q3HA 3ZE0B 2BEWB 2I7DA 4GGOA 5EJ7A 4CDNA 1DBVO 3EULA 3GGCA 4UU1A 4CT0A 2ORWA 1KRHA 1VPLA 4P3NA 4XUGB 1NV8A 5JPDA 1JDUA 1R27A 3NRBA 1ZITA 1YBHA 3ROMA 4J7XA 4HDNB 4PG7A 3JPWA 3V1YA 5IAOA 3SXUA 1M6YA 3E1KA 5F4ZA 1Q57A 1QHFA 3C6YA 2UU9B 2GZSA 1DKNA 2YVLA 3I6ZA 2CHQA 1WSAA 3OCZA 4ZHSA 1E2HA 2A2ZA 1VKRA 5JQWA 1H0SA 2WJ3A 4PV7A 3EMDA 3I9LA 2GWRA 3GLQA 4M1KA 4R2WA 5FLEX 2W11A 4JT8A 4Y1RA 5DNUA 4O2BA 2QROA 2ZRJA 2DUWA 2GUGA 2EFJA 4KQCA 1FTSA 2V8OA 3HVKA 4LECA 3UHAA 1VG1A 1D1PA 2CDNA 4KV7A 2QHXA 1HX7A 1RYDA 2H00A 4N5LA 4YCJA 1YHZA 1M7HA 4FQ8A 2BKAA 4IJUA 4B43A 1UKYA 1YDHA 2WIBA 2GEVA 1JHZA 3QE9Y 2PU5A 3NWJA 1Y37A 3Q3JB 4KZKA 5FWYA 5LZ7A 2WMNB 4OX9B 1Z7WA 4X84A 1VBKA 1I6MA 2ODNA 4IM7A 2ZYGA 3MJVA 4PS1A 4R98A 2P62A 3K4QA 4O4HB 2P9BA 1NGSA 4F4HA 1QRSA 1UPAA 4ZCRA 4AW9A 1RPZA 2D2FA 4DM4A 4BLRA 5A2GA 2HF2A 1JFTA 3K0EA 2BFDB 1TRKA 2X8AA 1CX9B 1IAQA 4L8VA 3T5MA 1JIQA 1ZD3A 2CJWA 4H4DA 2H16A 4IGKA 4JC8A 3SC2A 3HMQA 2WY2D 2JAQA 1UBJS 4GICA 1M0SA 3OY2A 4TUYF 2VT3A 2ZB3A 4AMGA 4PAQA 2OCBA 3ESDA 3TFWA 3KQVA 3FTEA 4TXHA 3ZV5A 1P2VA 1P7ZA 2P0AA 5TEWA 2PRYA 4R1SA 3P96A 1XTKA 3BSWA 1QZTA 5FDFA 1E9DA 5HZKA 3AETB 1WDMA 2VPPA 2HDHA 2OYRA 5ESXA 1ND5A 3A4VA 2RH5A 4D6PA 4CHTA 2C29D 3ZWOA 1M33A 2GVZC 1TFUA 5TMDA 2J3QA 1R64A 1QLWA 1WP9A 2WK1A 1DXYA 2MSEB 3KJNA 1U9CA 2ZJYA 3EIFA 4FZ5A 3I2YX 5B3AA 2C8KA 4PQRA 1ZVKA 4B71A 4F84A 1JLKA 1NY5A 2LBPA 4IH9A 4PO9A 4NOJA 2VEDA 3JALA 2FEMA 2QW1A 1IIBA 2QJWA 3SDZA 3TW8B 3QEAZ 2MSLA 2QRLA 2ZKIA 1RQLA 4KEAA 1EXDA 1DG9A 1Z82A 2NXCA 2Q5IA 1NVKA 2E21A 2Z8XA 3QWAA 4RDCA 5GM2A 1L5LA 4F2PA 5G4LA 3ADCA 3M49A 1DAIA 2FPPB 1THGA 4YJGA 5C1OA 3ABQB 1GGHA 1MZPA 1TAUA 4PFSA 2FXVA 3C8ZA 3H5VA 1UXIA 3OZXA 3CUYA 2O1SA 3DXXA 4I5IA 3F6PA 5FUYA 2BIFA 3K5WA 3UF0A 3MQ2A 1M1UA 2ZUVA 1U5AA 4MI3A 1W76A 1JDNA 1TVMA 3QFSA 3R3YA 4H1VA 3L7YA 1WV1A 1X14A 3SHTA 1TUIA 3OQVA 1Z3IX 1JAIA 2WHPA 3R5FA 3TE6A 4HEQA 3W9SA 3OLWA 4QYIB 2G1JA 2MSNA 4DQUA 5B64A 4WAUA 4LMBA 5K3AA 2HRRA 1HYEA 3EN0A 2L69A 2ZU0C 2IWRA 3EARA 2OXCA 2J08A 2NQ2C 2A0WA 2YCBA 5E7JA 1CUGA 1GKYA 2PDAA 4P3XA 5C4MA 3V8MA 4K6MA 4RNCA 5IZCA 4LGCA 4L2IA 4PR0A 3DOEA 1GPJA 1AZTA 4ZMSA 3EOBI 1CJUC 4EAAA 1QCCA 7AT1A 2HUNA 1J06A 4DV3B 1OBHA 3F9CA 1T9BA 2NOAA 3GFGA 4LS3A 2BGKA 3EUWA 1CCWA 4E07A 2G67A 4FWTA 2AD1A 4MV6A 2OGUA 3A8TA 2A9VA 3NH6A 4EKGA 1RDFA 2Y0BA 3PQ5A 4D8TA 4DIFA 1HFWA 3FJOA 3RV4A 2GX6A 4GWLA 5DNDA 3VR1A 4RF3A 1KO8A 1EUQA 1Z0DA 2UXDB 4X8OA 4HYEA 4NHEA 1YBAA 3B20A 5H68A 3VR6D 1M0EA 1KJ9A 2IP1A 5FORA 5FRDA 2ZJ2A 4WBNB 1KMMA 5A9SB 5JXWA 1VKJA 2F1RA 3DVLA 1Y48E 1E9BA 1GM5A 4HNSA 1QK3A 4AY3A 1HE3A 3R0ZA 4TYMA 2XVMA 4CIXA 3I6QA 3OT4A 1XP5A 1JDJA 1XHFA 2KSQA 1VKNA 3IP3A 4MP6A 3CSDA 4Y6RA 4AKSA 1BA2A 3EASA 1IY1A 4RE6A 1R12A 1DJLA 4RYDA 4BO1A 4WZ6A 4WV3A 5K1ZA 2OHOA 2WP0A 4WK0B 2EW8A 4QXRA 5D51S 3GRKA 1DWOA 1EG2A 2FPXA 4R51A 4OXQA 3PCXA 2C83A 1U7UA 2CDAA 2XNDA 2B92A 2ZQZA 2CV1A 3AHEA 2O19A 2ZBVA 2O3UA 5JYEA 3GR6A 1KGDA 1AG9A 1RTKA 5CBPB 1JPNA 3O21A 5G02A 1GNTA 3VC3A 1GAJA 2R85A 3GRAA 2CWWA 5JMWA 2QN9A 2ZYIA 4LTNA 2GEFA 5DHAA 4UOEA 1ZNXA 5CT9A 3WISA 1SQGA 1VE9A 2IUTA 2QM8A 3EY9A 1KI9A 5BV7A 1RYFA 4PZAA 5LYYA 4ZJYA 4WVLA 5EJ2A 2P2CA 1Y6ZA 1XB2A 3L5KA 5DBEX 5SYAA 4X1KA 4DBVO 1FNCA 2QSUA 2EJTA 1L5HA 5P21A 1BS2A 1CUYA 3DOOA 4BFXA 3RAPR 3DT9A 4DANA 1XDSA 2H2IA 2IU4A 2G7MC 3NAQA 4JP8A 2YYAA 4YA6A 1H2ZA 5LBIA 2BY4A 2R1TB 3RAFC 4LJYA 4U39A 1GT6A 2O8EB 4HDKA 4QPNA 4BV2A 5LZ4A 3LDHA 3ADDA 3NX4A 1NVTA 4AZ0B 5C8DA 2RGNA 2PUFA 1NY6A 3RSLA 3S7TA 3AHGA 4B17A 2PR2A 1VZ2A 3GYBA 4DXDA 3LPMA 4NG5A 3RANA 4BIMA 1VPWA 1LCIA 2IQ5A 1J8FA 3FKSA 3HS3A 4IIDA 4D7AA 5FTLA 3DNFA 5K0EA 2CHEA 1DAOA 1QE0A 2OXFA 1C7IA 1FMTA 1M8FA 2VJLA 3LYHA 3PYMA 4XVUA 2HWYA 5C8XA 4J1TA 1XNQB 3DW3X 3OLYA 4XDGA 1G8SA 5DW0A 5GMOA 4ARZB 1QTNA 4CM3A 5IEBA 4KK4A 2R47A 5KTYA 3FHCB 1TYEB 4MW9A 3S3TA 1QGUB 1Y1RA 5HCNA 1QIIA 1RWNA 3DB1A 3F6EX 3JAKA 3N6RA 5IDVA 1X7GA 3SNKA 3UK1A 4B87A 1US8B 3OM0A 3DMDA 4BECA 4B73A 3ZVKA 1KEZA 1IUNA 1OREA 3PS9A 1NG9A 1SD5A 1LA2A 1E2BA 1PO7A 1Y3HA 1C3OB 4ZCMA 4MGYR 2JI8A 3MOSA 3RT1A 1WVGA 2QR3A 3A6HA 5HKLA 5LIPA 2BF7A 4EHFA 4C0XA 3F5QA 4AJKA 2JJ8A 4GC5A 2XCOA 1Z4MA 2HEGA 2HJHA 2Z2KA 3O47A 1NQVA 4RIHA 4DRZA 4QL3A 2FTKE 1OFUA 3EFBA 4V2UA 2AB0A 4MX8A 1KTIA 5KOIA 2CDRA 4CU2A 4AF6A 4E5DA 3DTNA 3LQQA 1ID1A 1QZ3A 4XLLA 4DM7A 3FCUB 4YCSA 4QG3A 1F51E 1NE2A 3AONB 2DQKA 5JARA 1MCZA 1O94A 4MITA 4LNUB 2PXXA 2VK2A 3S2UA 2DTDA 3O3CA 2J9FB 1E66A 3ND5A 5AXDA 5BWOA 5A7HA 1H2YA 1MGOA 3E0XA 2H59A 1VL8A 1PFWA 3ZY2A 5HSGA 3JASB 4JLKA 2W9XA 3IIEA 4KSYA 1RXUA 1SRQA 4RIEA 4Z4IA 5DFAA 1ZW6A 4DBLC 1HSZA 3D7KA 3GP3A 5ICSA 1N3LA 4HYQA 3CLUD 5EXXA 4H27A 5T64A 4Y2GA 2QTHA 5DWDA 3HP1A 4XTRA 3RKUA 1NVDA 3OZTA 3T06B 3HBLA 1WMSA 3RUAA 2PM8A 1T2EA 2GPWA 2JD1A 1P4RA 2WNIA 3ER6A 3IVAA 4D0GA 1WPXA 2UDPA 3LBHA 1U8EA 2BFBB 4ILEA 4KXYA 3UAYA 1WXHA 2GCEA 4PG5A 2Q7OE 4XYLA 1Y63A 2ZR0A 4GOJA 1NDHA 3KLOA 4NS1A 4PLCA 3U9SA 4DDUA 4Q1EA 2MINA 1GZDA 1SQ6A 5H3HA 4QTTB 1J9GA 3W2TA 1GA4A 1G3RA 3BZUA 1HC7A 1JIKA 4N54A 1N0HA 1Z75A 2NW6A 4D0NA 1NMSA 3OM8A 3PNSA 4WLFA 4AS2A 3UJNA 4P0QB 4EFDA 2H7VA 4ZT6A 3UT0A 1KU6A 4YAFA 2FY8A 3SOZA 4MEJA 1U65A 2OFXA 2QL7A 3OU7A 3LC2O 1RACA 2ZRAA 5KWJA 2OXEA 4AKHA 1UBCA 5DIZA 4Z51A 1KEKA 1ZISA 4AN4A 4NDNE 3F8TA 4R69A 3CF2A 5HHTA 3G2IA 4BATA 1PFGA 1TK3A 3GV0A 2BHTA 2OB2A 1O3YA 1ZEMA 3LT4A 3NBFA 4RLSA 5G41A 2OM6A 2WAXA 1RJGA 3TMAA 3H9BA 3WK6A 5LQKA 3FRIA 3TUJC 2W93A 4PO8A 1YZKA 2EBWA 2PZJA 4EZIA 1B8PA 3E9ZA 3KTFA 4K40A 2XIQA 4Q12A 2WD8A 3P9YA 5KB3A 2FJPA 2J3IA 4J6FA 1QVRA 2Q0HA 3BTUA 3KWFA 4WACA 2BGMA 1GCIA 1XZNA 1K8QA 4JENA 2FPKA 4PFQA 5JVDA 3PE4A 3SR3A 1LPBB 2GLUA 3DMPA 1KAMA 3UFBA 4E2YA 1JWLA 1MOSA 4D74A 3DHWC 4LDJA 2VNIA 1OXKB 3I34X 3RC2A 1RLTA 5AI6A 3ZOKA 5BSEA 5BO5A 3TLJA 2WRZA 4NMMA 4B84A 4RD1A 1ND6A 2AA3A 2X5NA 5LDDC 1V2GA 1FQOA 4A27A 3IEMA 1HT3A 4DL9A 1FDOA 4K8RB 3GFSA 4YRQA 4M76B 2ZFUA 4CKWB 2JRLA 1WPQA 2H1LA 4EJSB 2KM1A 1OB5A 2L18A 4DRYA 4RPIA 2V7TA 3V8QA 3THWA 2ZCVA 4LDNA 3IMFA 4PYMA 3KVVA 3ONVA 5F77A 1U28A 3CX6A 5CRIA 3WV4A 5A62A 1KNXA 5D84A 5F98A 2OILA 5BW4A 5KIAA 3LWBA 5FT9A 2ZUWA 1KQGA 2REQA 1IXKA 2PIDA 3MJFA 1N78A 2HC9A 1NYRA 5TIIA 1DPGA 1NX9A 4JZKA 2BEJA 3WGNA 3G9QA 2UUBB 1YRWA 2A0UA 2B7CA 2Y1WA 5TS2A 1RHRA 2O2EA 3JWHA 1TCCA 2Q50A 4N5NA 2ZUTA 3OSZA 4YT5A 3WL7A 3LX4A 5LXTF 5L51A 3VBEA 3W2EA 1KIAA 1MO3A 2EKLA 1K6MA 3KFLA 2WU1A 5FUMA 5HKKD 3NEAA 1YB6A 2PKEA 2HBQA 4FLFA 4R31A 3PWTA 2O06A 3TM5A 4E33A 3TR5A 3QF4A 1Z2NX 1J07A 1PRYA 2JIRA 4PLFA 4M8KA 2GM4A 2Q0SA 4M1OA 4OI1A 1L3CA 4C20A 1JDBC 1K5GA 1TMYA 1V5WA 4YJ3F 4MA0A 2WVAA 3EYWA 1IHXA 1N6HA 2Z04A 1JHDA 1ES9A 4GDFA 2ZBRA 1UPFA 3P9NA 2ZBUA 3NDJA 3C4VA 2E4YA 1EK1A 1L3BA 4B45A 4RFVA 4QPPA 3HKCB 1CZHA 2FPIA 1UJ5A 2PL1A 1V1JA 2WU8A 1BKDR 3OIWA 3NETA 2XGOA 2QD2A 1JQAA 5GJVC 3S6JA 3W2FA 3BXGA 1DIHA 5AW8A 1ZUNB 1L5QA 2RI6A 1PUXA 3F96A 2F3UA 3MTEA 5DIFA 2Y1EA 3KUUA 4TWRA 1R0ZA 3WWYA 2FK7A 5AVWA 1QPZA 2QV0A 5LLSA 5KQSA 1DINA 1Y4ZA 3JX9A 4PZYA 2VLBA 4B5KA 1ZGHA 3AW8A 1X13A 4GZMA 4ND6A 3QE0A 4C05A 2NPOA 4QVIA 1I7NA 1OFGA 4JA2A 2WD7B 3LFUA 1F2TA 4DWJA 4OF4A 4RVSA 3GL9A 4YMLA 3W9YA 2B78A 3GDGA 3B70A 4IJ5A 3PBKA 4KFTA 3VYWA 3ASZA 2HLNA 3I9MA 4GZLA 4HZIA 3R9WA 1YZVA 2BF4A 2O5CA 4HFRA 2WUVA 1A69A 3AJRA 3SS8A 3QLUC 4V0RA 1IXSB 3ZV7A 3P45A 1QFYA 2ZUEA 2QG6A 1JLLB 2DPMA 3EQ7A 4MINA 3JY6A 1AA6A 3AEKA 1FX1A 4UUNA 3S2ZA 1USWA 4FWBA 3VNAA 1I0ZA 2G17A 2FSGA 2R4UA 4ZOEA 1T9DA 5H3CA 2YV5A 3IAAA 4BDTA 1GPBA 4EA9A 2O3TA 4E13A 1EXNA 1P0IA 2WDPA 2DWUA 2Q1XA 4XZ3A 4YV1A 4HNAB 4MW0A 3MRVA 3RRYA 4K81B 1RFLA 4L4ZA 5CA0A 4B32A 1QYCA 4LRUA 3VYRB 3WX0A 2FKNA 3UMSA 1Q83A 2GHIA 4C0AC 3FYHA 1AKVA 1TLLA 3T5AA 4F93B 3UBMA 3ROGA 1Z7GA 3B6MA 3MRTA 3PSHA 3RSGA 2XA1A 3EC7A 1YHYA 2ADMA 4GQBA 2IPAB 2FOIA 2R7LA 3HVRA 5A71A 4CF7A 4D0SA 1SPXA 3T52A 5E9QA 5C53B 1EM8A 1POWA 3GXBA 1KE2A 1PLLA 2W22A 1U9ZA 4CR7A 4QWWA 3W7VA 5F1KA 3MSCA 3HB0A 3FUUA 5AM3A 2BPOA 2HN9A 1TK9A 3NDRA 1U81A 1F1JA 2X9VA 5F7ZA 2X1HA 3L7MA 4HEA6 5DN9A 1V7PC 5HRAA 3Q3EA 1F6WA 4GKBA 5DBHX 2HWUA 2BKEA 5C1PA 2DR2A 1B3RA 2PJZA 2UVQA 3G6KA 5AOAA 5CDUA 5JZMA 1YU9A 2OCIA 2N1MA 2QAJA 3R7AA 4MUBA 3GN2A 2PPVA 1XTBA 4WCFA 3O5AA 3PXAA 4J4HA 5M7EA 3BRQA 2ZM6B 1KEUA 4HFNA 3L7NA 4Q37A 3EPLA 4GP6A 5FX2A 2RIRA 2C9YA 4TTVA 3ZQ4A 4BPRA 5LC1A 2O8BA 3CPEA 2J7PA 4ZCLA 5E2BA 5A6VA 5JQGB 1UMCA 1KE1A 4U3JA 3QI7A 3LDFA 1PWZA 4KI0A 2FRDC 2XB4A 3CX4A 3G5UA 4QULA 5D7NA 3IS3A 3LGXA 4DIEA 1JDTA 1G18A 2Q41A 2IXTA 4G5GA 4Q5IA 4AJLA 1LX7A 1WCYA 3LS2A 4BQFA 4DW8A 3NNSA 2G06A 2ZRLA 2NU9A 2OLJA 1EE2A 3HNPA 3KOWA 4FJ0A 5AI8A 5G3ZA 3WYNA 2EZ4A 1S8OA 2Y2UA 4JUBA 2BSXA 3FR7A 3QUBA 3UGTA 3ZBPA 3QNUA 3NWPA 1ZICA 1UPXA 2K7FA 3ACDA 3IQHX 2C4KA 4DUZB 1GZ6A 1ZP6A 1GNVA 2B83A 2HHJA 2OV2A 1EIZA 1M8PA 1UC9A 3BF7A 4GAEA 5DYTA 2XMZA 1MEJA 4D43A 1BKYA 1F3OA 1NVUQ 1VG0B 1NZDA 1S2GA 2P69A 1Y3CE 3HFJA 4IH4A 2HSGA 2QAGA 3OEYA 1W5BA 5I7OA 3V00A 2DFVA 3LHKA 1KYYA 3L79A 3BRWD 3I01A 2VCYA 3KTAA 5HRCA 2B4TO 2CFRA 4GNKA 4JC5A 3OMWA 4OXRA 2Z9DA 4KOAA 1VPVA 1ZPDA 2FMHA 3GX1A 3HV2A 4FYMA 1XNHA 1CUWA 2WPDD 3B5IA 4I55A 3A04A 2MU1A 4ATNA 3JVDA 1MXHA 2IHBA 2CFTA 3Q3VA 3TAHA 4NESA 1PFVA 1FYVA 2FLVA 3JVVA 3ZIAA 2E85A 4J9UE 3V33A 2Z58A 3UH0A 5FNZA 1KFEB 4HTAA 5TC4A 1JN0A 4NP6A 3UMRA 3ZHXA 2HT1A 3UWSA 1OASA 1GTSA 4CETA 3KUDA 4ZAFA 2BGRA 4I9HA 2HX1A 3RVKA 3NHAA 4Q1CA 4J0HA 3EVNA 2AG1A 2D5IA 4IHJA 1MIHA 1OAKA 1L4HA 4MI1A 3ZWDA 2H52A 2I1WA 3KC2A 4MGZR 4ER6A 5F3WB 3FPGA 3K09C 1IEXA 1ORRA 3WGGA 3LO8A 4KUEA 2G4CA 5KC8A 2XR1A 4X20A 1O6CA 2HD4A 3ABOB 3L92A 4BPBA 4HK4A 5FBKA 2XY4A 1D7AA 2GZ3A 4BKPA 1G2IA 2OV3A 3OZAA 4XDYA 2JGRA 3DCNA 2O2GA 4CTJA 4HB2A 4IHQA 5LLTA 4GWGA 1L5GB 4TLCA 2M6SA 3VYSB 3WLNA 2YNMA 4JBWA 3DLIA 3STWA 1U6JA 1T29A 3I1IA 3AVYA 1OZ0A 1B73A 3A1FA 3EOZA 1G6HA 3ES9A 3GAAA 1SOVA 1XNGA 2PZEA 1BHSA 3R3ZA 3OTOB 2I71A 1H3EA 3B1KA 1E7WA 3W5HA 5M2QA 4YRZA 5ICCA 2VPXA 3Q2OA 5FUBA 5A6SB 5E1BA 4FR5A 5JZBA 1IBSA 5KOYA 2JD0A 3AHIA 1EP2B 5K0FA 3RUPA 4LBWA 4M0DA 3T1HB 1HE8B 5AM2A 3C85A 1SXJE 3C6ZA 4I4LA 5BSFA 3E15A 5EJ8A 3ZH9B 4X45A 2C97A 3UC5A 3LVBA 1FTGA 3RLIA 1ST2A 2J4CA 3JZIA 4QU9A 3LVRE 3U81A 4DR1B 3T3HA 2AOXA 4BGVA 4TMKA 3I5UA 2CXQA 2E4WA 3W2GA 4UTNA 2I34A 1UC4B 2IYNA 3E7DA 4AXBA 3B82A 1QRTA 3ZU3A 4RH3A 6ABPA 5K3DA 1GVHA 4AWXA 1JU3A 4OYLA 3RM3A 4B8ZA 4EGFA 3IE2A 5J5VA 1JECA 1GZVA 2P1ZA 2QVZX 3A2MA 1Z6AA 4OREX 3UGQA 3EQ2A 3RS5A 2QR5A 4QNNA 3ABIA 5FWAA 3STHA 3NALA 2F67A 1TA9A 2Z5VA 1CQWA 3NTOA 2F8LA 3BD9A 4IZHA 4ZI2A 2CXPA 3IJPA 4DMCA 3ZGNA 3NASA 1PQUA 4J8PA 5KYTA 4DFDA 3MRXA 3PPYA 5JDCA 2YJ5A 4YQZA 3U44A 5HIKA 3SNHA 2DF8A 1HDXA 3N2EA 2GEDA 4UDXX 3O8QA 4HWKA 2C82A 4JD5A 2QTZA 2XUFA 4QYWA 3T61A 5BQFA 5KVCA 5JHGB 1BU8A 2XOKA 4PF1A 2AJBA 4N48A 2YXNA 3N07A 3P2MA 7YASA 4J9VA 3WLAA 1DAEA 2H2GA 5DP2A 1EDEA 4K6KA 2WQ6A 1NW7A 3KB6A 4HDRB 2GPTA 1R74A 1L1QA 3GQBB 3E7WA 3LHSA 3BCHA 1D2GA 2OYCA 3T7TA 3RIHA 1OPRA 3BYZA 3SYRA 2QJFA 3R5JA 4CR8A 2PT6A 4GOMD 3V48A 3ZD8A 1A9XA 1TKRA 2NG1A 4G85A 1T6ZA 2P2SA 4P4TA 1BWPA 3NATA 4LJAA 2GJ8A 3ENQA 2C7VA 4Q3OA 2JF0A 5G3YA 4AIRA 2RH4A 3WGYA 2A88A 5CM2Z 4DCJA 3I32A 2H5EA 4KLAA 3K8ZA 5KTMA 1I4DD 2QL9A 3DR5A 4DVGA 3DP9A 4YUXA 2IXEA 2FSFA 2X0IA 5D6NA 1DHTA 4EWLA 4XWOA 3CNQS 4W9MC 1W94A 3TNLA 4ZOAA 4XFKA 4X1IB 3ZI7A 2W43A 1SB8A 2GILA 3MCVA 1DP4A 3GG9A 4LVOA 4MWCA 1CY8A 2EL9A 4UUOA 1JHPA 1H0KA 1NC1A 2B30A 2H8KA 1JAHA 5JSZB 1OH7A 4D57A 4CQMB 4WRRA 4ZK6A 1XZFA 3SZOA 3GLKA 3MS4A 4O4IB 4HPJB 1SG6A 3HB7A 4CFSA 3VPAA 1YDMA 1U3FA 2Q9AA 4YRRA 1S9DA 3FD8A 1S1MA 4J16C 3RSCA 1ZUD1 2JLWA 3TZEA 5IC4A 2I8AA 1CC1S 1ZIDA 3KLMX 3VH3A 2O50A 4KOEC 4HDMB 5BORA 4EB3A 2RHTA 3E9RA 3N2KA 3OF3A 1N7GA 2ADOA 4LDQA 3VAYA 4EG0A 3QVUA 2YWJA 3GPIA 3H1GA 4FX5A 2I4TA 3DA8A 3GJ7A 2O4CA 4QD3A 3TVTA 4A8HA 3G13A 4KR7A 3TRKA 1H8HA 4X6XA 1TC2A 3EZNA 1BEEA 1P7VA 2A0XA 4JN6B 4FFPA 4G4JA 5G1OA 3TIXB 4C3VA 5C2JB 1FP6A 4PSUA 4F5WA 3VYVA 2QGZA 6Q21A 2PKXA 2Z6AA 2PV0A 1EAYA 2HNKA 2YHAA 3PIRA 2I8LA 1WSWA 2YWBA 1AUQA 1U0FA 4WUTA 5M3BA 1I2BA 5ELLA 1N57A 5C0OE 2VTBA 1YDFA 3PQ3A 2ZANA 3I30X 1KEWA 3FUTA 4M1EA 4EFLA 3B13B 2B8EA 3GLFB 5CLGA 3K0CC 3MVEA 5LYJB 4I08A 3B8EA 3Q0EA 1KH2A 1F5NA 4L4YA 1MZVA 5IBQA 1YZHA 2JKVA 3FZGA 2V58A 1A98A 1G0NA 2ASEA 2W2OA 4QUDA 4WXHA 5AP9A 2OORA 2X0RA 1Y8CA 2ZRPA 2ZSUA 2EGGA 3DG9A 4L8WB 1UMBA 2YIMA 1EK5A 4DCSA 5I8WA 5KOJA 1XVAA 3USZA 4ALKA 4C01A 1PWXA 1Q3KA 1D03A 3UMGA 3ZS8A 4BV3A 3E18A 1Z33A 4HQFA 2R1ZA 1PDVA 3EISA 2K7ZA 1DVRA 1AZLA 3RK4A 1JU4A 1RAGA 1XPUA 1E5VA 3U1TA 3AIMA 3OQBA 2QRJA 3PGJA 5K3FB 1VJ0A 4BAZA 2J6BA 4AN0A 1VYTA 4UNNA 5F7OA 1ID8A 3QY9A 2W4MA 4YCDA 5FYQA 1NM5C 4YAWA 1Z12A 2YN0A 2NU8A 4FEEA 3OKAA 3UCFA 1AUPA 4GI3A 3WWCA 1BC5A 1SURA 4L73A 4OP1A 2AOVA 1NP3A 3C1AA 4XD7A 3DBHB 1HLPA 1RI5A 1M1NA 3GCWA 4EKEA 3IPXA 2ZPAA 4GP7A 1I3LA 3SSAA 2DXIA 2JIQA 4LF4B 1TADA 2IT1A 2WB4A 1YDEA 3NHBA 1NPYA 1U2RA 3KQTA 4KPFC 4RULA 3EVBA 3WGQA 4QVKA 1CB0A 1J00A 5LU8A 3EXG1 4YPFA 3WP0A 4S12A 3CFYA 2Y27A 3HWX1 5BSVA 4KQ1A 1U7OA 2AFHE 2Q0QA 3BD8A 4LBYA 2I4OA 2UYGA 1KYZA 1L1RA 2BD0A 3BMOB 3NDIA 4QXPA 2X6RA 1PCXA 1N2GA 3OVMA 4LXUA 4EIWA 2Y05A 1CHNA 4GECA 1DFIA 2B8TA 3MJDA 3RVQA 4CPDA 3WA7A 1PFYA 1KVSA 2NSYA 2XGJA 2RHGB 2I0FA 1JQKA 1RI3A 1RQGA 3KL2A 3TMKA 5KCZA 2C5EA 3DV0B 4G9BA 5K8IA 1GA1A 4TZ6A 4A0RA 5CCBA 4KRYA 5JRZA 4NE2A 1FTYA 3PUYA 3VMMA 4E08A 3KBOA 1GD1O 3FCYA 4GGMX 3SVTA 2P30A 1XU4A 1YZGA 1L2TA 1RCUA 3AHCA 3Q7RA 1D07A 4O2AF 3VISA 1BXRB 4JUIA 4Q7MB 1NJ5A 1XKXA 3BDIA 3RVLA 3U39A 5KPDA 4X93A 3N39C 2RI0A 3U6BA 2RC5A 4OD0A 3ZJTA 2QPLA 4MUYA 1FQKA 2OAQ1 1SHKA 1Y1PA 3F74A 3CWZA 2ATIA 3VO8A 3UAOA 2VJOA 3JATA 3O6VA 2N42A 1V3UA 3M7IA 4UXIA 2OHVA 5GONA 4QXAA 4Y0NA 4DARA 3SKXA 1Z29A 3Q7PA 4YQEA 3NOXA 2B0JA 4TKUB 3MWDA 2VZLA 4W7IA 4WNCA 1FE8A 1COWD 4DKXA 1EZ4A 3FFTA 4X41A 5JZSA 3IUSA 2ZBEA 4BU0A 1S89A 1SC9A 1Y8QB 2JGKA 2P2DA 3D43A 1RWVA 3Q7IA 1E2MA 4U7PB 1D5WA 5DYNA 4ZI7B 4LJ6A 3D8UA 3DBLB 4IO0A 1RSZA 4ND3A 4WINA 3SDBA 5CH8A 4PCUA 2HNAA 5AKIA 1IWBB 3O2JA 3H0KA 4BVAA 5G2OA 2QN3A 3K9QO 4Y6PA 3R40A 2PXCA 3Q41A 1KKLA 4S1TA 2BHRA 5LDGA 4XQ0A 1ABFA 1I7LA 2FP4B 2FGJA 2DH6A 3CB4A 1PGOA 2W6QA 2YZ7A 3AF4A 3CLUC 3NC0C 2OHGA 4KGXA 3T5CA 2OO5C 4PM4A 3JZFA 5MGNA 3O9MA 4R1MA 4XARA 1WU7A 3SY8A 3UNXA 4TTIA 3EF3A 2VH2A 5FV4A 4PBRA 4P53A 1EUZA 1A8QA 4EGJA 1R6AA 3M83A 3ZXUB 1XRSB 2H2HA 4JYCA 2B35A 3DXZA 3RO7A 5LD2B 1M2VB 1RLOA 2IFTA 2BN4A 1X38A 3H5OA 2UZAA 3I2KA 3TIVA 3P0JA 1F4VA 2NU6A 3MXOA 3FB1A 2BEVB 4TMXA 4IR7A 1GUYA 1HI9A 2IYTA 1JKFA 5EJMA 1RTTA 4LZJA 3CINA 2B94A 4DIDA 5C8ZA 1C29B 4C4TA 3BF8A 3KJZA 3PFGA 1C4XA 4NMXB 2JDID 4L85A 1EX7A 2WM2A 4K26A 4ZMRA 2E2WA 5IJ9A 2QEQA 5I45A 4X94A 5CT8A 1LVGA 1TPYA 2YS7A 3LZ6A 4A15A 3FMFA 1GDTA 1VJ1A 2REOA 2FGKA 1XZAA 2QMZA 5CA1A 2QD5A 4CM4A 3UT5A 2VWPA 3SLRA 4I1SA 1EUDA 2UXCB 1MOZA 5KSWB 1Q0SA 4TV8F 1UWLA 2Q1YA 1NG1A 4R9NA 4LF6B 2PX8A 2CVHA 3D4OA 1OVMA 2CCGA 1GRRA 3E3MA 4ZAYA 1XCOA 2NVBA 2R2GA 3BX1A 4TSFD 4DCGA 2QUIA 4YCNA 3ETDA 4CM7A 3KVOA 1OOEA 3KO8A 3I6IA 3H9EO 3VOSA 4RPHA 2IGBA 3CRMA 5LSAA 1SHJA 1QKKA 1NUAA 4BNDB 4NZNA 2A1IA 2GBIA 3BE4A 1B14A 1I2DA 4R7GA 1EXVA 2DUUA 5TS3A 5AVTA 2ORVA 5D86A 4ZGWA 2G9UA 3GFVA 4N47A 4O4LB 4AROA 4CZ2A 4DNFA 1CQIA 1IB6A 1TDJA 3CUKA 1T8WA 2YC4C 3QTBA 1N5DA 1AK9A 4OHXA 5CYPA 1MW9X 5MFZA 1R88A 2V7WA 2YUTA 3A7EA 1CFJA 4F96A 3B1XA 5A1JA 4R2LA 1I0IA 4TZKA 5FXMA 3GLHB 1O6ZA 3AH8A 2ALJA 5FI5A 5DEOA 3FNHA 4M98A 4OFWA 4RANA 5C35A 1KMIY 4TTTS 4X61A 4OHVA 4M7PA 1E1RD 2IHZA 1J70A 4DJEC 1M9NA 1JDSA 1I9CA 1UQRA 3Q2IA 1T2NA 1ULUA 3QMVA 2IHVA 4MARA 2OA0A 1DUVG 4MNTA 4QKQA 2X15A 3LWDA 4K8OA 3S7ZA 1GAXA 5BSKA 4BN4A 2FZKA 2OK7A 4QVGA 5BUCA 1F0NA 3A1NA 1EVLA 4Y2TA 4HMOA 5IN4A 1KK0A 3II6X 3TL2A 3CMCO 4B46A 2IU6A 4PC3A 2TMKA 5FTMA 4JLWA 3OU2A 5L40A 2YJ6A 2OOSA 1F8XA 4NJMB 4TTSA 1OROA 1SIUA 1QX3A 1SK8A 3ET4A 1BVHA 5J2UA 1CULC 3FG9A 3P9IA 1UBSB 2WIJA 4JP5A 1KRWA 3L7AA 3P2KA 1YR9A 3UO8B 3UQYS 4TN5A 1ISRA 3ZU5A 2A4MA 2VK8A 3IXLA 4GLFA 2B36A 4HB0A 4PE5B 5ILOA 1VMEA 1GPAA 4L78A 5ALDA 5KYUB 3M1AA 2NZUG 4ZJUA 5I51A 1GUZA 1NOJA 3IVXA 1EE1A 3RODA 4U2DA 6CHYA 2ZI4A 3OHSX 3M89A 2F55A 3JYNA 3T3PB 1KQFA 2H06A 1E7SA 1M2WA 2O48X 2WU3A 3STUA 3FCAA 3CRVA 3IB6A 1BE8A 2JVKA 4F9FA 2VHYA 3ZGLA 2HKIA 2IYWA 3T0FA 3WDLA 1WUHS 3G1WA 5HFJA 1OLUB 4QDXA 1DIBA 2W00A 1AKQA 2LKCA 4OQNA 3DBOB 7MDHA 5LA6A 5KPJA 4MMZB 4KMSA 4R9SA 4Z5XA 1OUMA 2X1LA 1SXJB 2V6IA 1OAOC 3RTBA 5CFRA 1Q5PA 2CJXA 2WAYA 1RXEA 5AW3A 2JHGA 5A3VA 3K0FA 2VBCA 4UTXA 3EMVA 3W5IA 4DC0A 2VK4A 4MW6A 3VNRA 1PE0A 3N2GB 2CUTA 1DUIA 1VTKA 2VUIB 4EA8A 3L7OA 1P4HA 3KPWA 5CAEA 2YZNA 4DT1B 4NAUA 1SBIA 1RXSA 4AG5A 3CM0A 4LC0A 1P2BA 3G8DA 3UA3A 4EUKA 4DQVA 4D26A 5K2MA 4WASA 4ED9A 4V2IA 2YXEA 3L3BA 1RBQA 4RD0A 2YRWA 1GPDG 1RI1A 3A6KA 3AM4A 3CTPA 3Q15C 4ZVKA 3TMYA 4PVDA 3TPFA 4KPUA 4NCIA 1X7WA 1SXPA 1GPYA 3HCOA 2GASA 1ESEA 5ALSA 1JG7A 4RZXA 1NMQA 1MFPA 3HUTA 2AUNA 4OYHA 1ZAKA 3C1TA 4HLQB 2HBZA 3V6LA 3RYHA 4D9NA 3SXUB 5BUQA 4JUCA 3H84A 1KEPA 3QLEA 3U3JA 1RQ2A 1V7QA 3N05A 2ZYAA 1TO2E 1ZS9A 2PUEA 3RT9A 2OPBA 4LNAA 4CTKA 2OV1A 2GD1O 2GK4A 2ZGVA 4FS3A 4Q4HA 4PZEA 2Q6KA 1EPUA 2VDLB 3ESCA 2ONCA 3C39A 3C6BA 3FNFA 4O2BB 1PS0A 4Y1RB 4KIUA 1AE1A 1EFUA 1N5MA 1HQDA 2WPNA 3PJFA 2RC6A 3L6DA 4YP0A 3N0VA 4RK0A 1ACLA 1OXUA 2QD1A 4OQFA 4RA6A 1Z0ZA 1O9GA 3DLBA 1MVOA 3C3MA 4DDTA 3GUYA 1NJSA 2O8FA 3DUWA 3H9CA 2IYEA 2QN6A 3WL5A 2NLOA 4C4SA 5BY2A 3D6MA 3VNSA 1PYOA 2NYAA 4BRSA 4K5QA 4C30A 5LJLA 1FB5A 2Z4RA 3W7BA 3GRRA 3OFJA 1XVLA 1W9MA 4YNBA 4ZYXA 4WA8A 1JIXA 4FDVA 4AG6A 3CBGA 2JGIA 2ZIAA 2FR0A 4MGEA 2O14A 4ZC1A 5K09A 3O8LA 2CJWB 1CZKA 1XKLA 3QP9A 1VPEA 3JSAA 2I4MA 3P9XA 3FFXA 4HRYA 1O96A 1X19A 2XF8A 4PNZA 3SC2B 5FUVA 1E6WA 4BKUA 5A9RA 4MJ3A 5CJPA 3ONWA 3RBXA 3MLAA 1B8VA 2H18A 3OOEA 4FB4A 2GLTA 1HQYE 2R8BA 4LMAA 3S4YA 3EXFA 1FLNA 4QTYA 3VSBA 1CUIA 2CNOA 1UP7A 2CVOA 5J43A 2WWTA 3IQZA 2VYQA 4GMGA 3IPAA 5FR1A 5G1NA 3EPKA 2C5BA 1JQ3A 4W1QA 3BTSA 4U7DA 1BE6A 5ED4A 2YQZA 3FIJA 4QA9A 3S5UA 2BISA 3BXPA 1MC4A 2RHWA 3C0KA 4J75A 1U2ZA 4KWIA 4ND2A 3TQQA 5DMHA 3L0SA 1X8KA 2VYNA 4GI1A 2O2IA 4O0LA 4G5RA 1DADA 2ERXA 5CFZA 2WWHA 3JALB 1J4AA 5BQOA 4W5RA 4B3DA 4ID9A 1BE0A 4ADSG 2V4UA 2OD7A 3NBAA 1VL2A 1IY0A 5IUNC 1P7YA 5JY1A 3COPA 4CDGA 3HN7A 5LQDA 2NVWA 3PJDA 4WWHA 1PVOA 4WBNF 3OPNA 3IP1A 5ECYA 4C78A 4OXIA 3A4TA 3ACCA 3M6MD 1MU0A 4JBLA 5SV2A 4H6PA 4YJGB 3WJ2A 4UHHA 4C0JA 3EIXA 4OAPA 3QVSA 1RI2A 1VE6A 2L17A 1U98A 1RC8A 4WNIA 1Q1QA 2Y2VA 3HJUA 1EX6A 1PNQA 4JMPA 3T3MB 4B1FA 3F97A 5BMVB 2Q3FA 3O3OB 3U7QA 5HA5A 4EX7A 1S7GA 3KHTA 4MW7A 5KSZA 1ZA2A 2EFGA 1GOTA 2V6GA 3JR3A 1V4BA 4DLKA 5JYDA 1NPDA 1ZEJA 2W48A 2XGSA 5CIYA 2WT8A 3OLXA 1XA4A 5BSUA 1GZ3A 2J87A 3N76A 3KUXA 4U2GA 4EVQA 3I2HA 2ZTLA 4WKNA 1FVHA 4E2WA 2R86A 4DS3A 1L5OA 1ZKMA 1Y4DE 4FKMA 4CKCB 1KAOA 2IUEA 4L2IB 4CI0B 3VZSA 2FLKA 4RAQA 1DCTA 2J0SA 3EHDA 1F6BA 1ISGA 3UAZA 3VI4B 1EFVA 1ZBQA 3PHBE 1DS6A 1NW9B 2YV2A 1DIGA 3U16A 3S0JA 2ATXA 2IX9A 4Y9SA 5REQA 1K7YA 5DLEA 1EDBA 5FD8A 4B9EA 5E38A 1OBFO 3FVVA 2I22A 4O1IA 3EVZA 1VYUA 4LMRA 4OX9Y 3WMWA 2BBSA 2I6GA 2AJCA 2VH1A 4HRXA 4XWGA 3EVCA 4PNEA 3H2JA 1TD9A 4E94A 4ETMA 1ABBA 1VL6A 1V1RA 1LLUA 3AR5A 3L77A 5A2QA 3ZC3A 4WT7A 3YASA 5DM0A 1FX0A 4PICA 3TLYA 3TTXA 4IMIB 1MD9A 1JQBA 1SXHA 3Q40A 1L6IA 3L7DA 4M8LA 3TQRA 3SWWA 2NQ8A 5M5BA 4ARUA 3OFSA 2XDAA 3CLKA 3IVGA 3ANYB 3CA8A 3NHMA 2B3TA 3KAKA 3VR4H 4ZGBA 4L9SA 4H7IA 2AI2A 3WXMA 3VKVA 1DWQA 1T1EA 4D9FA 5KYWB 3SGLA 2QZSA 1QF9A 3M8KA 1WCV1 1J97A 3OETA 1SU8A 5EKSA 1NZFA 5HFNA 1F7VA 2Y66A 1K68A 1K6IA 1UWKA 1UJMA 1YR7A 4TUYA 2GBCA 3MAAC 4L16A 2CY0A 1W4LA 2VA8A 2VBIA 3MWFA 1A8SA 3OJLA 4TZTA 2FCAA 3QKSA 2W6PA 3K1YA 4PLZA 5CMLA 1RABA 3W3ZB 4CIDA 2EERA 2QT1A 4N3GA 4YIHA 5IT9A 2RKWA 5DCWA 5EIEA 3DV2A 4NYIR 3D6UA 4X1KB 1L5HB 4OJKA 3ZJYA 2EGUA 4JLPA 1GFWA 3WOVA 4Q47A 3DBRA 1IXZA 1E9VA 4X90A 3C5HA 4L28A 3OPXA 4I4IA 1D1QA 3KLBA 2CMHA 1UPCA 2ODEA 3E2MA 2O5RA 3CY6A 3LZDA 4K86A 4Q3EA 1LQUA 5CFLA 2IY7A 2CNWA 1PNRA 1F3LA 2FX2A 4FHGA 2W58A 4HDKB 4QYTA 4R1NA 2C07A 3Q0TA 1SVMA 3E4DA 4L5AA 1GCAA 2OBFA 3W5VA 1A7UA 3LBFA 3BH0A 3N75A 4G56A 2YW2A 2XYQA 1E59A 1E4VA 1HLGA 4XX1A 5ALMA 3D8TA 4URHA 3IEVA 4D4GA 1E2QA 3GMDA 2DPLA 4KYVA 4EMSA 1R4NA 4YRAA 1TQ8A 1AKTA 2Q27A 3GDOA 1ISMA 3MJHA 5FJJA 5CDFE 2Z6UA 4DMLA 2HF7A 2ONZA 5I4IA 4K6CA 2FMFA 1D8AA 4ZU6X 4XLTA 4LXGA 3U49A 3OEHA 5HJEA 1X3SA 3VNUA 3ESQA 4RY2A 3VKWA 5K8TA 3JAKB 4AMZA 2C2WA 3T15A 3CEHA 4D82A 4K6GA 1YB1A 1U2EA 3Q88A 4OMDA 2XADA 2ZSDA 1WD7A 2YFYA 1CR4A 2PV7A 2ZBGA 3FPEA 4MHOA 4X91A 4LRYA 5FHQA 3V8RA 1TMGE 4A9AA 5CBKA 1CR2A 2FWBA 2OBXA 2NSJA 4AUNA 2PR7A 3REGA 1EVYA 3CG4A 2DTXA 2G28A 3MIZA 4OA8A 3L0BA 1VZ3A 5TB5A 3HEAA 3WSTA 3EXIA 4LQDA 4GNRA 5DF1A 4F2DA 4CIBA 2QP3A 3VC1A 3WQBA 4P1ZA 3ZHUA 4L0CA 3CWQA 2WM9B 3IBYA 3C16C 4GYKA 1JLMA 3MCTA 4HDCA 4I8IA 4RJLA 4QARA 1I1NA 3PGLA 3NC4A 1H85A 1O2DA 1NI4A 5JDIA 2E49A 5FPYA 1K86A 5CTJA 5JRJA 2H0QA 4Z1MD 1DT5A 5FOVA 1TT5A 3DZ8A 1ZO8A 2Z98A 2HOQA 3OE4A 5LDHA 4IIHA 5H5JA 4BL5A 5IU6A 2P5YA 3R7SA 5J23A 3THYA 3M3HA 3DLTA 1BROA 1QDUA 1TMKA 1WULS 2V65A 4BRZA 3CURA 4KACA 5CLQA 1V39A 1MAWA 2H4YA 3GFBA 1VB3A 2V3WA 4RVHA 4JYBA 3B5EA 1GP2A 1MB2A 1FP4A 3QEMA 3P9ZA 3EZ6A 4ND7A 4Q6BA 4QIHA 4XLZA 3TH5A 4PIVA 3MJTA 3M6LA 3F73A 1IFXA 3MGGA 4EW6A 2WTXA 3GRZA 2JC3A 5B57C 1IAVA 4IXWA 2ZJAA 4N82A 3WIUA 4B74A 5GQSA 3C4QA 3X2EA 3IIKA 3MF4A 4TYQA 2WVHA 5EKDA 4FGLA 4A5OA 2X19A 4E11A 2ZI9A 1FMFA 3O1JC 4G6ZA 1U3CA 2CUKA 3OCWA 1NW3A 4GRIA 4BTVA 5ALQA 2MINB 1W30A 4B3XA 1LJ8A 4BVLA 2IPMA 2OC4A 3PTZA 5EIBC 1C5KA 4WN3A 4FE4A 3WIEA 2HHLA 2PKQO 4BLTA 1Y4SA 1XMJA 3DMGA 4M6WA 3H65A 4ENVA 1Y82A 3ZJ4A 4G1CA 4EATA 4LNHA 5KDDA 1I5RA 4BJ1A 3I62A 2ECPA 3CH7A 2A67A 5B7GA 2DFNA 1YV9A 4YDHB 2VRBA 3EPHA 4XD2A 3E9QA 1BDHA 4C4PA 1ZWLA 3MPUA 4URXR 2A1TS 2IXDA 1UFOA 3CUSA 3H04A 4WFKA 5KWEA 3LPAA 3WJAA 2XZDA 4KW7A 5DNEA 5B3KA 3EBOA 1LVUA 2G4VA 1MVLA 4QU0A 1RJ9B 3TOCA 1QFZA 2PYIA 5EE5B 3FWYA 2VDJA 3O75A 3CCBA 1NXTA 3KQPA 2A92A 3PV0A 4EGCB 1HNWB 3A28A 3ZDRA 3BXXA 1UJ6A 1X92A 3CLSD 3F46A 5JVDB 5DGDA 2PVSA 2WV9A 4A4DA 2CL5A 3FI0A 5JD6A 3CSUA 4P31A 3D6TB 3OTHA 2B37A 3U80A 3NBQA 2Z0MA 3ONEA 1LSUA 1G5QA 4P22A 2ID9A 1AMUA 3U1VA 3COYA 3NIWA 1W36D 1J2TA 4LYGA 4IDFA 2AD5A 1N2XA 1POXA 3DKVA 4G0OA 4KE8A 4NFHA 4Y7DA 1MA0A 2C2YA 2EJCA 2V1XA 4QJBA 1SVOA 1AXEA 1QH0A 4NC9A 1SO8A 4PIMA 2FJ0A 4BMOB 3RC9A 4PLGA 1I36A 5EG5A 2AHOA 4HAYA 4ZJZA 3AG5A 3DZFA 5HF9A 4AZTA 4C03A 4AQ7A 2VSOA 2GVNA 2JIOA 1TJNA 2GBLC 4BU1A 4CW7A 3HE3A 4HYTA 2XWSA 2F9LA 2XXJA 3T1TA 3HUEA 3Q8MA 4TZ0A 2R7AA 5AVOA 3RS9A 3OC0A 4K28A 3E5MA 4MOWA 3TO5A 4DC9A 1U8YA 4XGIA 2Y1KA 3ZVNA 1DEHA 3O4JA 2REQB 1OBVA 2OHIA 2QN2A 5IYZA 2OHHA 3DCIA 5C4GB 1RJFA 2PS0A 3P20A 1PT6A 4JCCA 2PFKA 1L5RA 3KDSE 1E8NA 2QYOA 2J3LA 3P4XA 4MAFA 2PS1A 4N4AA 3GFRA 4RPCA 3KJXA 4ND4A 1KEVA 3VVBA 1NYQA 3WL3A 4B3TB 1WW3A 3AUXA 2ERCA 5F33A 5KYNA 3GEBA 2CZCA 4C5AA 5H0IA 2DM6A 1E3MA 4X0EA 3JD0A 4QRHA 3CQ9A 3QF4B 5IRCD 5DXJA 1FDWA 1PHRA 5KNDA 1DAFA 4JXJA 3CH5A 4KL8S 3FVQA 2G6TA 4PANA 4Q3BA 4DLVA 1W4AA 2HLPA 3HZHA 3OICA 1HOXA 4ANFA 1FMJA 4LDPA 2QUZA 2LXNA 1CJCA 4F5DA 3KOOA 4I9FA 1MABA 2YR0A 1IY8A 1EINA 5AW2A 3H0CA 1QIDA 2O3JA 2AN3A 1XZEA 3CEAA 2FPIB 5A7GA 2O1WA 1WABA 5JS8A 5H9VA 1QWSA 3IHTA 1N3BA 4PRZA 5F1YA 2ZWAA 4CU5A 1W5TA 1PR9A 4H35A 5AK3A 3FRJA 3W3AD 2X2OA 3SBDA 2FN8A 1NQXA 1P0QA 5LUAA 1QQ6A 3H19A 2VAWA 1P2DA 3PUWA 2IRWA 1KZHA 5HTKA 3ITDA 1E6EA 3DV9A 4WZBE 4RTQA 2QRHA 1I1QB 3HA2A 2PX0A 3UV3A 4BO9A 4OGGA 1OYOA 4MXDA 2XTAA 4YB8A 3WLOA 3FSGD 1TC1A 3FE2A 4IS2A 4NOMA 5FTWA 5I8ZA 3GP5A 4O0MA 4BV8A 3D2AA 2EHJA 3A1EA 1CQJA 3R76A 1NMZA 5EZ5A 3RLFA 4O8ZA 4WKCA 1E9RA 1OAAA 2DC1A 2R6GA 1Z2OX 2RGAA 3TQSA 3NNDA 2VF5X 1CZNA 3AVXA 5LQSA 3USES 1N5JA 3IAM6 4FZJA 4XW2A 4ITUA 3ASVA 2Z8YM 2YH2A 2BV3A 3D0KA 4HGQA 4MULA 1ZK2A 4Q9LA 3AEKB 1JAYA 3RHFA 4ARAA 3LX8A 1YZNA 2QE6A 5I7UA 3Q7EA 5IXYA 2VNHA 1E63A 5ALHA 5JQGF 1D1SA 1MJGM 1FMCA 1H2RS 1KAEA 2HQSA 2VC2B 2JBWA 4PFKA 4QOHA 2V7QA 3P5SA 4JI8B 3NVKI 3V7WA 4B82A 3RFCA 3IERA 1AUOA 1AM4D 3TZKA 5CU7A 1C8LA 4A16A 2AR9A 4CLXA 4IVNA 3RHZA 1SQFA 3DO5A 3KJFA 1UAYA 5AUQA 3TX6A 1T9KA 2J41A 1KAQA 1EVIA 4QPZA 3FNQA 2F1IA 1E4OA 2JHFA 3O26A 1V8ZA 4X8HA 2A3RA 3HJHA 3K53A 4HUQA 4BMDA 3WYFA 2HXGA 2MT9A 4D02A 3GP8A 4X62B 3GN1A 3UT6A 3BE6A 3FBWA 3G0BA 3UJBA 3WLPA 1TA0A