2OBBA

Structure of the conserved protein coded by locus bt_0820 from bacteroides thetaiotaomicron
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
121
Chain Sequence
NAMTIAVDFDGTIVEHRYPRIGEEIPFAVETLKLLQQEKHRLILWSVREGELLDEAIEWCRARGLEFYAANKDYPEEHQGFSRKLKADLFIDDRNVGGIPDWGIIYEMIKEKKTFADIYSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein
publication title Structure of the conserved protein coded by locus BT_0820 from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
total genus 30
structure length 121
sequence length 124
ec nomenclature
pdb deposition date 2006-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2obbA00
2QLTA 2I54A 3ZVLA 4GIBA 3U7EB 1J8DA 2P27A 3ESQA 3QLEA 3I6BA 3OCUA 2B0CA 3KOOA 2WF5A 4DW8A 1L7OA 5FP0A 1T9ZA 5IT4A 5AW0A 2Q4TA 1RKQA 5AW1A 1CR6A 4JDPA 4F71A 4YCLA 2NYVA 4CF4A 2YMMA 1RKUA 2W4MA 1LVHA 5AVUA 3PDWA 2HSZA 5AI4A 4L57A 2NO5A 2ZG6A 1U2TA 3L8GA 4Y3UA 3MMZA 5ALKA 4PNHA 2Q4RA 2G07A 2I6XA 1WR8A 3UMGA 3UM9A 4DCCA 2FPSA 2WHEA 1ZD2P 4FFDA 4AP9A 3AR8A 2I55A 1O08A 1CQZA 5T41A 2HX1A 3N07A 2ZXEA 3U7GA 2G0AA 1U02A 2CFSA 2YJ4A 5AM4A 1Z88A 3ZTWA 2FPWA 5AW5A 3A1CA 3P96A 2HEGA 5IT0A 3N28A 3QUBA 3UMCA 3AR6A 2C9MA 1YV9A 4I9FA 1YDFA 2RARA 4GXTA 2WM8A 4XPZA 2ZOSA 1ZD4A 1U7PA 5A3QA 4I9GA 4BKMA 4HYTA 1L7MA 3ZX4A 2PKEA 5AW7A 4UM5A 3QU4A 1X42A 4OHFA 5ALSA 3W5CA 2RAVA 3ESRA 2HCFA 4YCMA 5AIAA 4OCZA 2IOFA 5AIBA 3S6JA 3E58A 2DQSA 2FUCA 4HGNA 2MSNA 4UMEA 3OCZA 2C88A 2PQ0A 4HGRA 5ALLA 4IG4A 4EZEA 3ZU6A 3L1VA 2BDUA 5AK4A 5AVWA 5ALVA 1K1EA 3WKEA 4BEVA 5ALGA 2ZBDA 4UU0A 5ALTA 3N1UA 3EPRA 4C4SA 3RFUA 2FPUA 3NAMA 4ZEXA 2GHTA 4Y2QA 3W5BA 1ZJJA 3TLMA 5A3RA 4UM7A 4HGQA 1ZS9A 1VFPA 3QUQA 4F72A 5AKYA 2R8XA 1RRCA 2GFHA 1T5TA 2YN4A 1PW5A 4Y2JA 1YNSA 3ZI4A 2HDOA 2I33A 2AUTA 3J7TA 5ALEA 1N8NA 4AS3A 1RLOA 2OYCA 2AH5A 2B82A 3QYPA 5AW9A 5AKEA 2FEAA 1U2SA 1S8OA 2ODAA 2R8YA 4YCNA 1LTQA 4ZEWA 3NALA 4Y2UA 2IOFK 1RLTA 3QU2A 2VKQA 3SHQA 4NV0A 3FM9A 1RC8A 1T5SA 1WPGA 5AI6A 3NASA 5AICA 1Z4LA 3U7FB 2IOHA 4KNWA 3DDHA 1IWOA 3WGUA 2YY6A 3I28A 5AESA 3QX7A 3AR2A 3OCYA 1L8LA 2G80A 2BY4A 1EK1A 1EK2A 3D6JA 1AQ6A 2ZBGA 3FPBA 3U19A 2YJ3A 3ZVMA 4FE3A 3HLTA 3QU7A 1Z4OA 1SWVA 2HHLA 2ZBEA 4UASA 3BA6A 4YH1A 2YMLA 3R09A 3L0CA 1ZRNA 2P9JA 1RDFA 3L0BA 2G08A 3ZW7A 4G9BA 2WF9A 3MPOA 5AKKA 3KZXA 2FI1A 5ALWA 3A1DA 4QQFA 2CFTA 3N5KA 2B1RA 1J97A 3AR7A 5AKLA 1L7PA 3FGOA 3E8MA 4MWOA 1SWWA 3L5KA 5IS2A 2O9JA 3E84A 3F9RA 3M1YA 5AI0A 3NIWA 3ZWKA 5AM3A 1MH9A 2EAUA 2JAOA 4XQ0A 2D2VA 5ALIA 3A1EA 3SF0A 2JARA 3K1ZA 4Y2VA 2FUEA 4C4TA 5ALRA 3ET5A 3QNMA 2HF7A 4O8CA 5AKIA 4EENA 4EX6A 2WFAA 1Z4JA 2OBBA 3L1UA 4YIKA 3FVVA 5AM1A 3DV9A 3U7HB 2O2XA 2AGVA 3ONNA 4OFZA 4RETA 4Y2YA 3QUCA 1Q91A 3PGVA 2WF7A 5E0OA 1NF2A 3GYGA 3UMBA 4CF5A 2RBKA 3ED5A 5AVZA 1VJRA 1RQNA 2IYEA 4G63A 2G1AA 5AHXA 2C4NA 1U7OA 3R9KA 5AKZA 4HGPA 2W11A 3OCWA 3HYCA 3WK6A 3QXGA 4EEKA 2Q5EA 4L6AA 3IB6A 3QU5A 3E81A 1ZOLA 5ALOA 1ZRMA 4J2TA 4XE5A 5AI8A 4L6CA 3FPSA 5AK6A 2HOQA 4CE6A 1QQ5A 1N9KA 2ZBFA 3ZTYA 4DWOA 2R8ZA 1YMQA 2CN1A 4EX7A 3IJ5A 3MN1A 1ZD3A 3L8EA 3B8EA 1JUDA 2X4DA 4BNDA 2GO7A 3SKXA 1TJ5A 2MU1A 3ET4A 4CNQA 1RKVA 1YJ5A 1KYTA 3AR5A 1XP5A 3L0YA 3ZX5A 3ZVNA 5ALXA 1TE2A 1S2OA 3OTQA 1QH9A 1WVIA 3AR3A 1O03A 4NWIA 3ZWDA 2EARA 4DFDA 1Z4NA 3AR9A 4Y2PA 5AKXA 4B6JA 3B9BA 3SLRA 1Z4PX 3QUTA 3WKDA 2HI0A 5ALJA 2HF2A 3CNHA 3WK8A 2NO4A 2YJ6A 5ALHA 1Q92A 2FDRA 5ALQA 3I76A 4QJBA 2R8EA 3DAOA 4YIHA 4C4RA 3IRUA 2JAWA 3B9RA 3M9LA 5AI9A 3WK5A 2AMYA 5AVQA 2BDEA 3W5AA 1Z4QA 1RPZA 4BX3A 4BBJA 5AW3A 1RQLA 1RMYA 2C8LA 3BWVA 2GMWA 4J03A 3U26A 3VAYA 4UATA 1QQ7A 4UMDA 3EF1A 3OPXA 4BX2A 1Z4KA 2FPXA 3OCVA 4RESA 1F5SA 2WF8A 3NANA 3EWIA 5ALUA 1Z5UA 2YFYA 3I1YA 1Z5GA 4KX3A 3PCTA 3L7YA 3QGMA 4BNDB 2CFRA 2B1QA 4UW9A 3NRJA 5AK5A 4E88A 5AVTA 2B30A 4FYPA 4BX0A 5AW2A 1ZD5A 1SU4A 5AW4A 2YBDA 5ALDA 2G06A 3WKCA 5AW8A 4H1WA 4KNVA 2YMQA 4Y2SA 2JGAA 2YJ5A 3ZUPA 5AVXA 2EATA 2W43A 1QYIA 1RLMA 4KN8A 4BEWA 1VJ5A 1TJ4A 4Y2XA 4ZEVA 2RB5A 3OCXA 5AKGA 1L8OA 4YGYA 3NUQA 2HO4A 2G09A 2GHQA 3N8GA 2OA0A 1Z4IA 2B8EA 5ALMA 5ALPA 5AW6A 5ALYA 4XOUA 2OM6A 5AVVA 3FZQA 2IA5A 4UAUA 5AKJA 2I7DA 4UAVA 3WGVA 4OD0A 2B8JA 3WKAA 4CF3A 3A3YA 4NABA 2I34A 1NNLA 2FPRA 3KC2A 1RMQA 4NFLA 4Y2TA 1Z4MA 1Y8AA 2C8KA 1TA0A 3W5DA 3EF0A 1RMTA 5AK3A 5AI5A 3CZ4A 3R4CA 5ALFA 5ALNA 2WF6A 3DNPA 1L6RA 4HGOA 4UMFA 3QU9A 1NRWA 4Y2RA 4KX5A 3WK4A 2JAUA 4UARA 1QQ6A 3RF6A 1L7NA 5AM0A 3L8HA 5AVSA 3AR4A 2P69A 3KD3A 3U13A 3WKBA 5AKHA 4BYGA 1YS9A 3SMVA 3SD7A 3WK7A 5AM5A 1WZCA 4NAVA 5ALZA 5AVRA 2PR7A 3SKYA 2QYHA 3KBBA 3KDPA 3WK9A 2YMPA 4AS2A 3PGLA 5JJBA 4JB3A 4UU1A 5AM2A 1TJ3A 5A3SA 4UMVA 3L8FA 5AVYA 1XPJA 4MUMA 4KYTA 4HAIA 4IFTA 3MC1A 1XVIA 2P11A 1FEZA 4EELA
chains in the Genus database with same CATH superfamily
1TX4B 3G7SA 4AM8A 1YI0A 1YT5A 2KSQA 4PZEA 2BZ0A 4US2R 1W6RA 4RXTA 3SVZA 4PS0A 3EVTA 1UC5B 1ZRSA 3BK2A 3DE4X 3GR6A 3GZ4A 1HR0B 1TLLA 2QTZA 2C8VA 1L7OA 3MFYA 5BQ3A 2RGUA 2JLAA 3IBCA 1RI4A 1USUA 2VEDA 3OPVA 4KE7A 4Z7OB 2OCYC 2V3WA 1N1MA 5DN6A 4AYXA 5IKEA 4KMRA 1JIJA 4YLYA 1V6SA 2W4MA 4RGBA 1G9XA 2CLDX 4M21A 1RAHA 3EARA 4ZOLF 4D1YA 2BR3A 1E63A 3OURA 4P3NA 3WYEA 4U1RA 5G4KA 5BT8A 1JEQA 1JEAA 3ANNA 1L4UA 4QO7A 1VBKA 3TOZA 4B34A 4CMAA 3T3PB 4K8OA 3UMYA 3A9TA 5EVJA 5KVCA 3GN1A 5T4HA 1BEZA 1I3MA 5D5HA 3UENA 5KU7A 2NMVA 1E3DA 1GUZA 1X0XA 2W37A 3EZFA 4UBNA 4XDZA 1N77A 1VGQA 3A06A 3H6KA 3HKDB 1JNYA 4HXEB 4KIFA 2GEJA 1CQIB 1XRJA 4EB6B 3BMQB 2XAUA 1PUIA 1JVBA 1FVFA 2IZZA 3P20A 3PPXA 4FYHA 1FFGA 2A0KA 3AEZA 4HJRA 3MRVA 2ZI3A 5L53A 4E07A 3ETDA 2XEDA 1ZCBA 3GDOA 4BLTA 4D9KA 5JCOC 3N28A 4CODB 4U5QA 4KR7A 2HYIC 4A4DA 4I9FA 4OB6A 1X8JA 1XHEA 4O4HB 1E98A 3A14A 4NKRA 3WLKX 2E4AA 4H6XA 1GUAA 2I9KA 3L0ZA 3FZNA 3I12A 4CT4B 2XWSA 4F6RA 4P3OA 4B76A 2C2OA 3ZV5A 1EM6A 1UXJA 1W2GA 2OHGA 3VTKA 4ALJA 4H4DA 3THOA 4YEDA 4UM5A 2DPMA 3RYIA 1KNQA 1GN9A 3I45A 2C5AA 3MRTA 2BPOA 2Q6OA 5AJZA 5BQ5A 2IXAA 2GERA 1ENOA 4YAJA 1R12A 1H2YA 1AM4D 1PJAA 2X8WA 4D0NA 2HWXA 1VPLA 2IIQA 3TR6A 8AT1A 3I64A 1RZ3A 2GSDA 2ZT6A 3LNCA 3QW2A 1TW3A 1C8LA 2XF8A 3BL6A 4FFWA 4TZTA 3R7LA 3R7WA 1EFRD 3DNMA 4ZTUB 5HVNA 1NLFA 5LQJA 5ALLA 4GSYA 4HPJB 1CS0A 1Z2CA 2ET6A 4ML3A 5F12A 3M3HA 4C2TA 1H8HD 4HC4A 4ZRNA 3UXYA 5PGMA 2IFTA 5LQUA 3Q7TA 1BU5A 2ZRBA 3RT9A 1UXOA 1YIDA 4RW0A 2ZBDA 2ZUVA 5NULA 3QX9A 2NM0A 1JILA 1QFJA 2WAOA 3QBDA 2Q0QA 4QYSA 4KK4A 2IXTA 3LPLA 2JGDA 3NNNA 1TEZA 2KMLA 3VVBA 2A0FA 4CEHA 1MNQA 1WXGA 5FCDA 2O8DB 1U31A 1PG5A 2FUG1 1NN3A 2HA6A 3KPWA 3W78A 4BMVA 4HHEA 2IEAA 2FOLA 1YO6A 4HGQA 2JI8A 1JR3A 4QREA 3QUQA 1DAHA 3LQ4A 4UPVA 3O7MA 3EGXA 2IC5A 4DCTA 5LBTA 4C29A 2QV7A 1EA7A 1P5HA 3RNOA 2QTCA 5JMOA 1MVLA 1JMKC 3S5UA 1V39A 4FFOA 5I5EA 3UATA 2BGMA 2HJHA 2IQ5A 3INTA 3N6RA 1Z6GA 3FCXA 2ZRDA 3BXOA 3FIJA 4B3BA 3QFSA 1GD1O 5CYGA 1BX0A 1KK0A 3FTFA 4G26A 5TGDA 4IV0A 4U7TB 2R8YA 2WOOA 4HEA1 4TKLA 4ND8B 3NALA 3T38A 4QU8A 2FE4A 4E08A 5C4IA 5E8JA 5KTPA 3CPSA 4MMXB 1BDIA 1UPXA 1P31A 1VRWA 3BHNA 3FM9A 2HREA 5G1PA 2P2DA 3U80A 5KNBA 3RC8A 2R4TA 1DKQA 4MK4A 1TADA 4LQCA 5CFMA 3A25A 1C30B 1L5HB 3IBYA 4H18A 3UXEA 2XWBF 1ENZA 2WHQA 4QUBA 5GY7A 3TN7A 2PEYA 1WZUA 2AR9A 3CO5A 1GEEA 2WP8J 3T3MB 4EHLA 2AUNA 4HH3C 1OJ7A 2ZE8A 1ZXLA 4MEJA 3RUAA 3SHOA 3WIDA 1UBGA 4PYOA 1RZRD 1EK2A 3IO5A 5IFLA 2G40A 4PSAA 3ZVMA 1CY1A 2XVAA 4RPJA 5DGHA 4I6GA 5TVGA 1I1OA 1ZPDA 1W30A 3ZZTA 4YQYA 1F0YA 1LLUA 3H5WA 1VIDA 4K8RB 2A58A 2XYVA 1TRHA 2YMLA 4JKYA 2IU0A 3TEFA 2EV9A 3VKGA 2BSAA 3BMOB 4RO0A 1ZM4A 3ESXA 4KIWA 4IOKA 4G9BA 4IV8A 2IUUA 2YS6A 3K2IA 4PEVA 3R6LA 2EIHA 1GPYA 3ZY5A 1HYHA 3PGMA 1J97A 1OZ0A 2EL7A 1PZGA 2JKYA 2NN3C 5B6JA 1DXYA 2YCBA 1VE9A 1XVTA 5LUAA 3IL2A 3T5DA 2Q45A 2GBLA 4MB2A 1HLGA 1U4NA 3L84A 4DHWA 1LSUA 1QGDA 5JD4A 2H1IA 2QTVA 2NNWB 4MDYA 2EAUA 4D97A 1L9XA 2I65A 2POCA 2C29D 2OCGA 5F2NA 3IXLA 1QUEA 3PEFA 4IOMA 3ELWA 3CXUA 3T94A 3W8EA 4WOKA 1GGFA 3AC0A 4EA7A 3GP5A 2A33A 2FZWA 4OFBA 2C4WA 3F98A 1Z6QA 3EQ8A 4JR1A 5G02A 3AJ8A 2XNSA 2FEXA 4C4TA 4QE3A 4QPCA 1E1KA 4IIFA 3VU1A 2XXAA 4KHPB 3THWA 1TLFA 2BAGA 4WCFA 2X0DA 4X3PA 2QM8A 3IOMA 1NRJB 2HF7A 2Y67A 2CNLA 1CUZA 2R4UA 3EIFA 4IGIA 3UPTA 3AWIA 3LFHA 2VQSA 1C7EA 4ZQCB 1ZSVA 1JFLA 2DCUA 3RFXA 5IN5A 3T1VA 3VOAA 1GHTA 1YUNA 1PE0A 3VSCA 4BJ1A 1QG6A 2DUMA 3PDUA 5BURA 3RTEA 4OQLA 5AJTA 1JTFA 2DU8A 4OKIA 4LQ4A 2RKWA 2QNBA 1UK6A 2FCAA 2WTNA 1E6WA 3KTOA 4K9MA 1EU1A 5TMDA 3TGWA 4D41A 4NI5A 1WCIA 4B33A 3B78A 4DCJA 3MLBA 1NU6A 2RONA 3BD9A 1OXXK 2VHYA 1RI1A 1C3OA 2B0JA 4XFJA 2DX7A 1VYTA 4YJKA 1SB9A 2R65A 3DVAA 3ESAA 5CX1B 3LCRA 1JW9B 3LIIA 2G77B 3JWHA 4JLBA 5CEFA 2YVLA 2IHNA 4O2BF 2WG2A 3EZLA 1U9JA 1K8RA 1T24A 4TV9A 3B85A 4LBVA 1BWRA 1YFKA 3PPIA 3NZEA 4KJZA 2R44A 1WF6A 4G63A 4BFZA 4PCUA 3DMRA 5C2JB 4B7XA 1F9AA 1DBVO 4TV8A 1YL5A 1DX9A 3KQNA 2UYCA 1MJFA 1GKLA 1PVDA 1I1NA 3REQA 3MGBA 3AF3A 2W11A 4QBHA 4GM4A 1UMDA 2IOQA 2QD1A 1V5EA 1OIVA 3KTAA 4I3GA 3WOVA 3SQMA 4EF5A 5FH9A 2O8BA 1AUXA 2OZPA 5BN5B 3LBIA 1IONA 3FKSD 4X20B 4OOEA 4J2TA 2KBEA 1UJMA 4XE5A 2RB4A 3D54D 4QQKA 1QAOA 1YB5A 2XUOA 3ZJ5A 4CE6A 2B9VA 3I9KA 1WBBA 1A9OA 1I3KA 2UV8A 4N47A 4DWOA 4R1OA 1N2ZA 3WZ2A 2F3PA 4LOKA 4R7GA 5DEOA 3L8EA 4F5WA 2PZ8A 3G2OA 4BNDA 1SXJD 3EUWA 3LOUA 4QBGB 5CVEA 1CZUA 2DBVO 4WNYA 2JKVA 3R0XA 4CNQA 3TUZC 2FZGA 3H13A 3L0YA 3ZX5A 1ZGCA 4GW3A 1KJWA 5MFPA 2PH3A 1EFUA 1O03A 1FFDA 1WUIS 1XMIA 2AC7A 3E9ZA 3P32A 4RD0A 3SXPA 4CKEA 5BSVA 3IURA 4YCBA 1VG1A 3SEZA 4FCTA 4Q03A 4CCSA 4DL9A 3NTUA 2HLDD 5HKOA 1JR6A 4B6JA 3NAGA 2I62A 4R41A 1VLJA 4IDOA 2GN4A 1REQB 1KU0A 4TQ9A 5EFOA 2H1CA 1GG9A 3T3HA 3RS8A 3LVBA 2BGGA 2VRNA 4LY9A 2AFIA 1TUBB 4NECA 4ZVKA 3VR4D 4DJ5X 2O7NA 3DM9B 5K45A 3A4IA 2GJ9A 2KB0A 2RGGA 4Q3NA 2K4MA 4I50A 2WUGA 4Y6OA 5JNRA 4FMDB 5DK6A 3KAJA 3JW8A 1U0EA 3MUNA 3SSAA 1E2DA 4GBJA 4D82A 2ACKA 4B7ZA 2JH8A 2ABWA 3HDTA 5A5EA 1FCJA 3IQHX 3ZKWB 4W1SA 1KHTA 4C4AA 4C6SA 4ZDKA 2WG1A 4P4SB 4HDRA 4TKMA 4A73A 3HBNA 2PKRA 5EYPA 1J7KA 3DL7A 5AW3A 2JGKA 3GLQA 1BCSB 2X7HA 5MDHA 4OGGA 3IAM6 3LA6A 4R1MA 5B2FA 3E27A 5CNKA 3LT2A 3N39C 1SCNE 3PTLA 5CP8A 4YREA 2BL4A 3AP2A 3ZCTA 4F21A 2BEKA 5B55A 4YRZA 4JI1B 4JJZA 3RAPR 2EFGA 1TKCA 1TJPB 1NMSA 4NP6A 4LGCA 4ZWNA 4HNHA 5JJLA 2ZVJA 4C30A 5ALUA 3CIOA 5ICGA 1Z12A 1GL3A 2AZMA 1Z5UA 3E22A 2YFYA 3ENVA 4W5HA 5CR9A 4UHFA 2AQIA 1U04A 4UTOA 3KPVA 1T8RA 4KQXA 1NM5A 4IIEA 2HAEA 3ZLBA 4M22A 5IANA 4ZEVA 5EIBD 4CLDA 3LC7O 1JEOA 1PDWA 3IVRA 1PQWA 3RVSA 4IOJA 1AS0A 1DRWA 1FYXA 1SU4A 1R27A 1Y82A 1YTLA 2ZQ5A 3O8OB 3WA6A 4DV5B 1PZFA 4ZKEA 4TL7A 2W2NA 2JFGA 5TPZD 2VHJA 5FBQB 4EKDA 2WPDD 4PHGA 5KINB 2OB2A 1X7WA 1CZOA 1UJCA 2H0QA 1DT5A 3IUJA 4JU8A 3RUHA 4L4SA 4R4JA 4C5AA 4D2IA 4CV0A 5HK9A 1AV6A 2ZSBA 2O8EB 1M5TA 3H7IA 3DCIA 2ZS9A 4NFSA 3LBAA 4TLEA 3ZCSA 1S2MA 1X80B 5F1KA 1GRRA 1S2GA 1CEEA 1E2PA 3NB0A 5H3CA 3ELYA 1W7AA 1G38A 2IZ1A 4LNUB 5JNLA 2ZRIA 1NI5A 4JBWA 4BX9A 3K96A 4L75A 4QEZA 2K2QB 4IOLA 2ZI9A 3FF4A 3P26A 1TEHA 2NZ8A 3F1LA 5HUJA 3PGJA 5IF9A 1EXWA 1DPFA 2J3QA 4J0EA 5JROA 1J9GA 4FGKA 4DIOA 3CU5A 1B16A 4NJMA 5AW6A 3JY6A 4ESOA 3IMCA 1BQ4A 1H3NA 3GC6A 4LRQA 2G36A 1JKIA 4JUCA 2FFRA 4EYGA 1X14A 4EG1A 3PIIA 3NT4A 4XWOA 5I48A 1UBMS 5L7WA 1M2EA 2XRZA 2FWMX 1QTRA 3RRNA 4C9BA 4O2RA 1NNLA 2QRMA 4LY6A 1NY6A 1PD1A 4BWVA 1RMQA 5KHAA 3IJEB 1A8IA 4YLEA 3OMWA 4WBSA 4CL2A 1UP7A 1DKOA 4L0QA 1BW9A 2PL3A 3B52X 1Y8AA 3C98A 2WD9A 2J67A 4Y1RB 1YI8A 2V58A 3UFXA 1W5EA 2V9ZA 2PNFA 1EFRA 4F3CA 3IT1A 4BS9A 3FMGA 4PRYA 3UK2A 1NXQA 1OIXA 2GDJA 1AT1A 2HHHB 4FFVA 1AG9A 1RXVA 1H8HA 3Q41A 4QOEA 4I36A 1FBTA 3KXLA 1N0HA 5GAJA 1Q0ZA 5EZYB 1TVKA 2D2XA 2RGEA 4OAPA 4P5EA 4BMXA 4YPOA 4Z9BA 1CF9A 1RYZA 1Q74A 1DO2A 2FDXA 1GSHA 2ZROA 3ENNA 5IT5A 3SSOA 1OTXA 2F8LA 3NDIA 4GMKA 4PBRA 3IULA 1GXSB 1KQOA 3WP0A 1I0LA 3AR4A 1XIVA 4YRKA 3AFHA 1NA5A 4D79A 2H3HA 1A27A 1CQJA 2NUPB 2X2OA 3BWMA 3DE7X 3Q85A 2Y9MB 3K71B 3ZU2A 2QN7A 2YTZA 1DBRA 4LHWA 4IILA 3TSCA 1W36D 1FJGB 3MS4A 5E4TA 1ZCFA 1SD2A 1A9ZA 2AZTA 2OHFA 3COWA 2LKDA 3FWNA 3JZIA 3T7JA 2FWIA 5BN4A 2QD2A 1CFJA 2FPOA 1AY0A 2RHWA 4LMRA 3R7SA 4YT4A 5JI2E 1JG2A 2C0QA 3DOJA 4GXNA 1FXWA 3B8HA 3SC6A 1E7WA 4RU1A 4C0JA 5HX7A 1NVWQ 2BKUA 2HMAA 1M8PA 4P0TA 5BYKA 4KFSA 3EDYA 3MMPA 2O7SA 4M0UA 1NBIA 3TEJA 4GD3Q 3VJKA 3IAM1 1TJYA 3DLIA 2F3TA 5FRDA 2P1DA 5FL7D 4EW1A 3FYDA 3Q3GE 1J23A 1CY6A 2GBPA 2K6GA 4ROSA 5TR9A 4CT0A 1SQ0A 3MILA 4QNNA 1KP2A 3DKPA 4LDJA 5DCWA 2E4UA 4B79A 3Q7SA 1XXHA 2X0KA 1O5OA 2CLMB 2ACWA 2QE7D 2YFHA 3U49A 4BN0A 1QHHB 1FP2A 1MQ9A 4MYDA 2O1EA 1R3DA 4QXRA 1YXMA 2H7CA 2OK7A 3KOUA 2PNJA 1MD9A 1N8SA 4DSZA 2OCXA 2DTEA 2PEZA 4WBNF 1Q1BA 4R1QA 5EFZA 5E6SA 4C0LA 1DEAA 3MLAA 5BN1A 1ODKA 5C18A 2LR0A 3EVFA 2JIZD 1JHPA 2BGUA 1X1DA 2I6XA 2C98A 3GLVA 4CBVA 4F9GA 3Q5DA 3TNLA 2QR2A 3AVPA 1CUGA 5JDCA 1IOZA 5FHQA 4CLHA 4CQLB 2A9KA 3LK6A 4TWIA 4GZLA 2H4FA 3FOAA 3MINA 5J4KA 3PRHA 4F2GA 1KR5A 4O2AF 2HWWA 1X7ZB 3TIGA 4BO4A 3BX1A 4KFTA 1FS4A 4IDQA 4L8FA 4QJ3A 3ZE6A 4Z3DA 2C9CA 3PFFA 4PZPA 1ES9A 1Z88A 2QVBA 1LTHR 2W7TA 3L43A 1T1IA 2FPWA 1XQXA 3D8RA 1MQSA 5CW2A 4D8VA 4BRSA 2JHPA 2G88A 1FFEA 5IBPA 2QMUA 1KO8A 4HZGA 2FX5A 5B3AA 3UMCA 5BPFA 3GPIA 5FBZA 3UMFA 1NUSA 1ULHA 4NYJR 1ZMRA 1ZJWA 4A2WA 4I7EA 3KT6A 1KOJA 4BZPA 1YBFA 1N5KA 1R3UA 2WZQA 4JXKA 3PNBA 3LBHA 5JMTA 3NJ4A 1RHQA 1OE0A 1XZAA 1K7XB 5GADl 3HKCB 1UANA 3RYTC 3GV0A 2RI6A 2YV1A 3FPCA 2V7UA 4LWOA 4NBSA 1XPRA 3H3FA 3X44A 2CCJA 1WV1A 4B6PA 2Z6UA 1OT3A 3E8XA 4MR8B 4FINA 1N8TA 4MVJD 2IOFA 3FHTA 1X2BA 2I0FA 4KI0A 2DQSA 2FUCA 3JARA 1A82A 1YQTA 5A6SB 5HJ7A 3U5TA 1VGRA 2Z2KA 2PH1A 1K27A 2GVZC 3NRCA 5D6NA 4F38A 1U6KA 5F2EA 4L15A 1K9SA 1Q12A 3L1VA 4OH1A 1P3Y1 5C81A 1UK7A 5K05A 4EBBA 3UJNA 1II0A 4A0SA 4EB3A 1FQJA 2JGMA 1JG4A 1T0IA 2XWQA 5AUQA 3KYDA 4EG6A 3OWXA 4RK7A 3PEUA 4BBAA 4BEVA 2CVQA 2YXPX 2A6PA 3MJDA 2WKRA 2CJWA 2OXFA 3EEYA 5SYNA 3WGZA 3R7NA 3HH8A 4ZCRA 1N5IA 4G5SA 2ZB8A 5HPYB 4LRTB 4Y9TA 3FOEC 4IXWA 4KXWA 4AMUA 3T7EA 9GPBA 2GZHA 4LC1A 3B2EA 1GTVA 1EAMA 3DCNA 2AVDA 4KFCA 4UHCA 1MB0A 4AW9A 4INPA 2O5CA 1S1MA 2FNAA 5E1BA 3DLAA 1RPNA 2WAMA 1EVIA 1JAXA 1G8FA 3NBXX 1FDRA 1ZHFA 1VG8A 2E18A 2CNKA 1CX9B 4Q3KA 3ZYCA 5CB0A 2ZIEA 1FLNA 4HF7A 4FMPA 1RE1A 4HB3A 1D2AA 3DEAA 1GZ6A 1C5KA 4EG3A 3FKSA 3WFJA 2JI7A 1XXHE 4ZAZA 2VAXA 5IC6A 4M8LA 1IEXA 4EABA 3ME5A 4DR5B 1EFVA 4FGUA 4BFSA 3NIDB 2Q3CA 1U3GA 1NY5A 2IYXA 2J6IA 2QM3A 3I2YX 3N70A 5DYTA 5BUCA 4ACAA 2E2WA 3D64A 2VTBB 2H4HA 4DHEA 1U28A 1RWOA 1YJAA 4ANFA 1K06A 2JCXA 1RM3A 1NKTA 4NV0A 4QUEA 3SPXA 1XMJA 3GLFE 1ML3A 3PUYA 4PN3A 1UXKA 5ILGA 4RMJA 2GNPA 1QRAA 4ZDWA 2JLXA 3QVWA 1DBWA 2XTZA 3E5RA 1SHKA 2VBCA 3A4VA 1OLSA 5CIWA 3KCNA 1E66A 2W6ID 2Z2XA 3A3NA 1FRQA 1VKHA 2HLDA 2FWPA 1K6XA 2J4DA 3AIIA 3ASYA 4PU0A 5DMXA 4R98A 2G80A 3QKRA 4KL8S 5TT1A 3EWAA 4GOOD 4LVUA 4Z9XA 3GJ3A 1OWMA 2Y1XA 3MWFA 5F4ZA 5A2QA 5FA6A 3ITEA 1E1LA 3EQ6A 3OJLA 4ASUA 1EXVA 3FBTA 3I0ZA 5I7AA 4G6ZA 5EESA 3F2IA 4WFJA 3T1HB 3RRZA 2ZAOA 5AQ1A 2HUPA 4TTJA 1NQVA 2ZRCA 4R2JA 2LV8A 1XNGA 1UOPA 3O1HB 3HCCA 3J81k 4JT4A 4DMRA 4N7JA 2VHTA 2DQKA 4MV5A 2BMAA 1G20B 4LK2A 4XQEA 3A32A 4YAEA 4B4DA 3R0JA 5CDUA 1H6DA 3A1DA 3QLJA 3Q2KA 3EXFB 4MI6A 5CU7A 2H85A 4UCQA 4KBYA 3X3HA 4DQKA 1KTVA 1JU4A 3R77A 5ESRA 3PNMA 5TSDA 4P7KA 1K0FA 2I7TA 4DSOA 3O21A 5HZKA 1L4LA 4K6MA 2OAEA 3L4JA 3BB1A 1W76A 1VZ3A 2GCIA 2GO1A 2XH8A 4MINA 3U9SA 5KOJB 1DTWB 4TTQA 3G8DA 2A4MA 2Q7DA 4DDHA 3JYHA 2QBYA 1YDEA 1QPBA 2WU0A 2XYGA 3EY9A 3DL0A 2GN1A 1PL0A 3DTVD 4G9GA 5D00A 1KJYA 3ABIA 1V9LA 2L0XA 1I4DD 4QUJA 4U7FA 3DMNA 4LSMA 3H04A 5CHEA 1FNDA 2L69A 4AYTA 2F3RA 4CG0A 1IVNA 1UFKA 5A0TA 1LNZA 1QP0A 4RKQA 2R8PA 1OKKD 2UUPA 2Z1NA 2ZRMA 5CBPB 1FQKA 1GUYA 3TAUA 2ZIVB 4KLRA 4X7RA 4ZMSA 3CZQA 3ECCA 3BULA 1G60A 1SC3A 2BT4A 3AEXA 4NU6A 1SUDA 1JQJC 1XL0A 3SXUA 1O0CA 1WY5A 1IB6A 3AT1A 3FVVA 2IWHA 5AM1A 3FVRA 2YXBA 4J49A 4PPFA 2WVHA 3BXHA 1QGOA 1HTWA 1DXHA 3HI4A 2V7EA 5K3OA 1GQFA 2AG0A 4TUYF 5B53A 4L73A 8MHTA 2G4LA 1D4OA 2YRFA 4L8YA 1GU7A 5CUQA 4QZVA 2QRKA 1IL0A 4ARSA 4BO6A 1V11A 3DFUA 2D7CA 2ZT5A 1A8PA 1LW7A 4FDUA 5FI0B 3ZCVA 4FGJA 4JENA 1XRQA 1N2OA 1DDIA 1RJEA 5K3SA 2HC9A 1O77A 2BFOA 3DZ8A 4FLFA 3CGWA 4JP1A 4N9WA 2JHGA 3ZDZB 1E8DA 4UUMA 3RVDA 5LQKA 1RQNA 2I80A 2HK9A 4OEHA 5IUNC 3WGQA 2WTUA 1OZFA 3WR5A 1AH2A 1U8EA 3G2IA 4B2LA 1UOOA 2B61A 3UHOA 2X3FA 1EB9A 5J2TB 4KODA 1PW7A 2CUKA 2G72A 2JVJA 3HZZA 5E2BA 4BE4A 2DT8A 3M7IA 3K0BA 3H5NA 3NPMA 4R6XA 1WKVA 3K6RA 5ICSA 2QP3A 1KY4A 2AW3A 3HLYA 4N03A 3QJ5A 4QECA 3F49S 4R8RA 5HK8A 3A6KA 4HRXA 4JJ7A 1KZ7B 1LQ2A 2FPLA 3DXZA 3I32A 4UM9D 2I6FA 2RSLA 4IINA 1WDWB 4TN1A 4TLBA 5DM2A 5KO2A 1SA0B 1SBTA 3T0FA 1V8PA 4KJXA 4REQB 1KI2A 1IQRA 4J1TA 1M75A 1QZZA 1F20A 3E23A 3GP3A 3RVBA 4K6FA 4QVIA 2VDKB 3BCRA 3ND5A 4JSRA 3U17A 3WYBA 4P83A 1THGA 5LXTB 4G85A 3BDVA 4L51A 3ZHUA 1TE2A 1U2RA 2JD1A 2P30A 3D6MA 1WMEA 5AHRA 3SR0A 4ZI3A 5IWCA 2BBTA 5K8UA 2K7FA 4MIOA 4YRMA 1QDEA 1J70A 5JW6A 5F5LA 2RGCA 2J7PD 2UZ1A 3I30X 3O84A 3NBAA 4RADA 4CM8A 2YIMA 3H2BA 4YRIA 1WLYA 5AKXA 1CK4A 1NJ5A 1S8NA 1DZ3A 3Q0TA 5EIHA 4EVIA 4LTMA 3IPYA 1FMTA 2GBGA 3A1WA 1QB7A 2ODEA 4YRFA 2D5IA 2C4MA 2RHHA 1NVEA 2PS9A 1L5RA 2B8TA 2HT6A 5EE0A 4YP6A 5G41A 3PEWA 2H16A 1O1YA 2MINA 3LFUA 2JLRA 4UUNA 4R31A 4GMFA 1MENA 4YJ2B 3UQYS 3EE6A 1SVOA 1PNQA 1DLJA 2Y66A 1DC5A 3MD0A 4OMDA 1C9EA 1OD6A 2QVGA 1KYZA 2C04A 1M8JA 4OUDA 1B73A 4YHHB 2WOJA 1P74A 4RMIA 1QYDA 5HEKA 2X2FA 3PF8A 2DWQA 1Z33A 1N6KA 3GROA 4OAQA 1UJ4A 3WJ7A 1VSQA 2DWCA 1LBQA 1V2HE 1EZZA 4IH9A 3DYVA 4CKBB 1P0CA 2I03A 3A2MA 3FFBA 4MCJA 3QBEA 2DJIA 3GVHA 3UA4A 2IP1A 1LFAA 5ENVA 3T9DA 5BPHA 1IZ8A 1LF5A 2WJVA 1UZLA 1M76A 1NVTA 4PYIA 4XIJA 2E5FA 5FL7A 1I7NA 2OILA 5HZHA 3FPGA 4YMSA 1M72A 1N7JA 3PHCA 4JJAA 3GT7A 5LP6C 1EZ4A 3JVIA 3BXGA 1ZGGA 1PK8A 4FDAA 3OCVA 5AUOB 1NNUA 2C7BA 1ZN7A 1UWCA 2QE7A 1BVUA 1RYHA 1UP6A 3LO8A 4MGEA 4YAIA 1KDVA 2PUAA 5A4AA 4AQ7A 3GL9A 2UUAB 1K8YB 4EG0A 4KFUA 4GMDA 5DO9A 2CJYA 1G5RA 1QKKA 1WKCA 1EM8A 2H1OA 4GNKA 4RTRA 2Q2VA 1X8LA 2BN4A 3R3VA 1P80A 3KVOA 3IMEA 2XI4A 1TK2A 4NZZA 4JNKA 2F8TA 1AJEA 4RF2A 4OYHA 2R1ZA 2JGFA 4ZJZA 2FR1A 1WW2A 3RF7A 3ZIUA 4G0UA 3AVVA 5EI5A 5IZCA 3RW9A 4NFHA 5ALDA 1U8FO 2G06A 4YV1A 4GI7A 3C14C 4N82A 4YB8A 5J2UB 1CEQA 1XRNA 4E51A 4H1WA 1YVEI 2XA1A 4KNVA 3SHVA 4A5SA 5JCXA 3E4CA 4UOZA 4FZ5A 1M34A 2AYYA 4OJQA 3LU1A 3OQVA 1PK9A 1A95A 3NCTA 5BWLA 2HV9A 2A0WA 4B7AA 5BNWA 1NF9A 3AI1A 1EX1A 3CPJB 3CLTD 2CBGA 1LCIA 3RDPA 5JISA 1LGYA 1ZK3A 3GNQA 4LYJA 2OEPA 5JQGB 2ID4A 4DG8A 4Z8YA 1TJ4A 5P8WA 3W7AA 3A8TA 1EEXB 2YHUA 3HBFA 4K9KA 4R8MA 2O54A 4MJ3A 4XM0A 2IRWA 3H18A 4C08A 2XTAA 4H7EA 3L6EA 1U80A 2ATCA 2TS1A 4PLYA 3I37X 3W2EA 2OVFA 2FMUA 2G09A 3N2LA 5BUZA 5L6MB 1T2DA 3UV6A 3MS7A 2WA2A 1HSZA 2OECA 1NDUA 1NT4A 1ZGZA 1B0PA 4UAUA 1DUIA 3EWSA 2OUKA 2W98A 3MVEA 5HP4A 2ZRJA 2Q0SA 1YBHA 3DKVA 4KNYA 3CX8A 3WKAA 3TMKA 1EX6A 2GEBA 2PO7A 1GPDG 1NQUA 4E32A 4YMGA 1F14A 3JQ7B 3I1FA 2NU9A 3LKDA 4K9QA 4MYUA 3VNRA 4ED9A 4G5QA 4R3UC 1THZA 2FN8A 2G9UA 1GG8A 3CKMA 4D74A 4ZAGA 1BEEA 2C03A 4OQYA 5M7EA 1A3CA 3W5DA 3QBTA 1NYQA 5AK3A 5KAPA 1O96A 1SKBA 3AHEA 3COPA 3PHJA 3QYJA 3ZN2A 5J40A 3ZZ0A 3R4CA 4B83A 4QPZA 2WD7B 3R24A 3V46A 3H05A 3W9SA 3TI9A 3TX6A 2J31A 4B3RB 1O94D 1CBUA 3EG9B 4G84A 3CZMA 4N7RA 1QHEA 4M0DA 4UHHA 4D4GA 4MA4A 3G2KA 1Z0KA 1F4LA 1OREA 2L19A 3WXMA 3VNBA 4AJKA 5LYJF 1CR4A 1KDOA 2VPTA 3KSRA 1RFLA 4E70A 4DWJA 3GAAA 2PV0A 2ZTHA 4ZYUA 1LK5A 1PS9A 4FHDA 2GDZA 2ZWOA 5EINA 4BQSA 4B4VA 4QVKA 4MW2A 3QYFA 2C4KA 2IHZA 5AM5A 1SUEA 1KSJA 1N2IA 1JLRA 1Q0QA 2I87A 4I2NA 2FQWA 2GYYA 2ZYSA 1NVKA 3BMCA 3OO0A 4RLHA 5AUPB 1L7QA 2ZRFA 4MI1A 4X7PA 3ZZUA 4C7OA 4HDAA 4WZBE 2V6GA 1PVVA 4MULA 5E3JA 2ZRGA 2P6MA 2Q1WA 1NURA 1Z7EA 2RHOA 1MEJA 2J08A 3KS9A 3IAFA 3KQWA 2YASA 4KAFA 1MQ8B 1G63A 1JLSA 2FJPA 1P5RA 3OJXA 3MWEB 4NU0A 2Z6QA 1TL7C 2KX7A 1BS2A 1MABA 3ANLA 3GFQA 3TQHA 4FHZA 2YXEA 2JBAA 1DAKA 3QVTA 1VE6A 1CUUA 1DARA 3LZ6A 4M38A 4RGYA 3V4LA 4L08A 2PRIA 3MAAC 1P9LA 1WE2A 2C58A 2PZGA 3NDRA 2B37A 2ZTVA 2ERCA 5C8YB 3VHXA 4Z7QB 4GE0A 4ZAWA 5ILQA 1P4SA 2ZI6A 3N7TA 2BC9A 3HYRA 4TWBA 4WZAA 3YASA 3QEOA 5CIQA 3ADDA 1T8PA 3DEFA 3U62A 1T0BA 1WB9A 2ODBA 3WXBA 3TJRA 4E3ZA 5LQMA 3WWEA 5C53B 1N1GA 5EWMB 3GQBB 4BZZA 4F4JA 2HDWA 2YWJA 3CB2A 2W6IA 3GBSA 4HUQA 1L4FA 4HNQA 1LVHA 1V6AA 1M34E 4MQ5A 1FOEB 3ND9A 3OU6A 3F6BX 3V4FA 2OG1A 1XQWA 2FOIA 2A9PA 1E5TA 2VA8A 1OBHA 1SD5A 1BMQA 2V1XA 2ZB3A 3DHYA 5K0CA 2O8CB 1U9ZA 5DW0A 4H3VA 4BXOB 3PGKA 1E4OA 3KHUA 4ITVA 1OFGA 1KQ3A 2QSUA 4H1VA 3K94A 4BJ3A 4D3XA 9ABPA 4CV3A 1SG9A 3AJRA 5WRFA 5EGSA 4AN4A 1M6WA 4B6EA 5A03A 5ES4B 1AZTA 3GFSA 2XNCA 2VHEA 1B4DA 3OIUA 3GAFA 1N57A 5CFOA 1W2HA 3TQTA 4MA0A 1T8TA 2CY0A 1CDOA 4DIMA 1B14A 4KPFC 4INJA 4V24A 1CUWA 4BNLA 1WXQA 2VHZA 1N2HA 3IPRA 4M8KA 4HMQA 3VO2A 1I24A 4CCAA 4HZIA 4D8TA 3R8CA 1XRLA 1ZU4A 1E4EA 1VECA 1NLUA 1AN9A 3TFQA 4WDRA 1F0NA 4A0RA 5JXJA 2O19A 3H8VA 4M9ZA 1Z6TA 1CUCA 1ZWLA 4YFVA 3ZDQA 3F90A 1XGKA 1UM9B 1DU4A 2CMDA 3FTNA 1P72A 4DGQA 2QJOA 3BG5A 1E7SA 3LQ2A 3UJHA 5FEMA 4MW0A 4GYWA 5B4TA 5FWXB 5GIOE 4QM7A 1DTEA 5AO9A 2CXPA 4HDNB 4Q15A 4RY2A 1BMDA 2EFEB 1U7ZA 4NFYA 2WP0A 3NUGA 1TEXA 4AZ0B 2ON6A 4PGGA 3ZDRA 1CVLA 3OZFA 4E13A 1XTZA 9LDBA 1ENYA 1A5AB 3MUEA 4FN4A 4IJUA 1T9GR 3C6ZA 3FCOA 4UM8B 3HO1A 2R1VB 2XQVA 3EQ2A 3QHQA 3WQHA 2RCNA 4J91A 4GDMA 3D7KA 3FROA 5K4AA 4MB0A 3ANXA 1IJKA 4Z99A 1FDOA 5CXQA 1MFZA 1GIAA 1Z8NA 4DLVA 1N8KA 2B36A 3PFKA 4R81A 4HRAA 5CJJA 3TDMA 2H08A 2IPXA 1U4SA 2QN8A 1H05A 5HZMA 1YZQA 3E3MA 4RJLA 4A92A 3OQOA 1WTCA 4HS9A 4I4IA 3WKEA 4CF7A 4BV8A 3S2YA 1DMSA 3CLUC 3JRNA 3FYUA 1LPSA 4QXMA 4UU0A 1QORA 3LI2A 2CXHA 5CITA 3W5IA 4EYSA 5ADVA 3IOCA 3D4LA 4HTFB 3U4GA 2JKZA 2QORA 2EF0A 1GDHA 3KJXA 5DI3B 4RY8A 3U3ZA 1DG1G 1PCXA 1ECGA 5KDLA 2X3YA 2CYBA 3VO1A 4D3SA 1QIMA 4G4GA 4ROTA 5G40A 5CA1B 5CA0A 3PHGA 3GWZA 3VJLA 4BWYA 3H75A 1GNSA 3L1JA 1ETUA 4V0MA 1ZS9A 3RK1A 4CG3A 5KNDA 4US1R 1H4TA 2HBRA 4OSEA 2CLLB 2J0VA 4QX6A 4RYLA 2YFQA 4BNIA 4EHBA 1GO2A 2GF0A 3K9HA 1PZNA 1E9CA 4J16C 2ZJ3A 1E0KA 3HZHA 1SVLA 4QLAA 1SU8A 5ALEA 3TNJA 4AS3A 2B82A 3W4KA 4HMOA 4B2IA 1ZITA 5CJ2A 5BW8A 4B3JA 2RHRA 2DUWA 3L7JA 4WZAE 3ZR4B 4YQFA 1EFPA 2EJUA 1KMHA 3F74A 1NZFA 3V9PA 3W7BA 3SDBA 4AWAA 3BMXA 5BMVB 3T3DA 2GBLC 5JJ5A 3L4SO 1I5EA 3TD9A 5KJFA 3H17A 2WUVA 2XUAA 4TMWA 4GHWA 4R05A 3SOZA 2EEZA 3WL6A 1EXDA 1CQWA 3N8IA 4KDEA 2J3DA 2YWDA 4G5OA 3WLIA 3GVCA 4QFMA 4Z0TA 3F6EX 3KQUA 1Y9DA 1KI6B 4JI4B 3RC3A 4RSMA 5AICA 1KI8A 3WTCA 3GLKA 1CJBA 2BR4A 3UJBA 2J7PA 3ELBA 2VK4A 2YY6A 1IN6A 1T34A 2RHBA 5B7GA 1F3OA 1E2FA 5C1DA 3OCYA 3MSXA 1U99A 2VPXA 3D4IA 4J76A 1C4WA 3ZJUA 5EJEA 2IF2A 5BW6B 1AQ6A 3HXLA 5JY6A 1RXSA 4EZBA 1WBDA 3I4LA 6ADHA 4I5EA 4RAQA 2AFRA 3HLTA 3Q8KA 5ITVA 4HDSA 1T8UA 1SCBA 1E7QA 2R79A 1EJ6A 3L01A 4AAYA 1WB4A 4BIIA 3JZDA 1QX3A 4YI3A 1EP9A 1R0SA 1ZK1A 2NO1A 4I8DA 5FL3A 5TF0A 5KYTA 1VJ0A 3LQFA 3HADA 5LYYA 3W6ZA 3F71A 4BB0A 4ZYXA 3HVIA 4YMHA 2QMYA 3N75A 4QQFA 4RSHA 2F48A 3OIYA 4KQEA 1G41A 4XB6B 3AR7A 3PNPA 1R6XA 2QT9A 3D3WB 4GOKA 5ITWA 2O3QA 3EODA 2WM9B 2HNBA 4HNGA 1TT7A 3AFOA 4H1UA 3TVYA 1VPEA 5DT2A 1CQPA 5I9BA 1R4NA 4TOIA 2C5EA 2FPGA 3F9RA 4WBNA 5JSQA 1W88A 3ZCPA 4RGVA 3TL2A 2HRRA 1SKQA 2HA5A 4ZI5A 5FO1A 2FWAA 1MAHA 2I2BA 5JPIA 1OH6A 1RWVA 4GXQA 4IKPA 3UPDA 1B3RA 3OPMA 1Z63A 5FT9A 1ZESA 1EIWA 4BKPA 1J20A 1MG0A 2CNBA 3FFXA 3LGAA 5DSZA 4RL4A 1HFEL 3WHPA 4FKMA 3KJEA 3ANSA 4YPFA 1Q7TA 2LDBA 1T0HB 3Q2IA 2ETVA 3R23A 3UC5A 2FPMA 4AP5A 3CONA 3ND8A 2BFCB 4XQGA 3A0UA 3KLPX 3WYAA 3K1YA 3QNWA 4EKNB 3P27A 3OEYA 2BR5A 2PSJA 4OJYA 3TTWA 3LWBA 2G9NA 2JIRA 2YQ4A 4FBLA 1EDEA 4KO3S 4MX8A 4X41A 4C3UA 1L4NA 3K4HA 1VCIA 2MR5A 5DBFA 2VH2A 1O6ZA 2WICA 4YHBA 3B3GA 4ER5A 3H0EA 1X19A 2IKQA 2ONYA 5DGTA 3BAZA 2BGRA 2REQB 1ODFA 2C00A 3VPSA 2Y6UA 4OYYA 4V0ME 2XHZA 5JVDA 3I8OA 3UKDA 4EHHA 4IDGA 4MVJP 4N54A 2NPOA 1A5SB 1H3FA 3NTVA 4OUKX 4QRDA 2FMKA 4GQIA 4YGXB 4EW3A 2GZ2A 2D13A 2G1AA 4QC2A 1TU4A 4X61A 2Q1YA 2ONJA 4WMLA 1P7ZA 1V8OA 2BUAA 3V34A 3WGYA 1V3TA 3TLJA 1YR7A 1DP4A 2HN9A 1JDUA 1ZK0A 5LIPA 1JZTA 4FOOA 2PGXA 1W0CA 2Y76A 4U2CA 2PFSA 4DR4B 4RPLA 5M04A 5BN3B 2VUUA 1AV7A 3H87A 4QEDA 3WNVA 4MMZB 1HYEA 5B12A 5LVAA 3QFTA 4J7XA 1YZUA 3UTDA 4UNSA 4XYLA 4OQDA 2XDWA 2Z56A 2Z6VA 5SY9A 4DJTA 2NV0A 1NVAA 1PEDA 3VYRB 4ZODA 4CR6A 4IW3B 4BUZA 1KWKA 1YFJA 1ZM3A 4QSMA 4D46A 1TQ8A 4H3SA 1KEWA 2ZAGA 3S27A 4B7CA 4RTQA 3KJGA 5I4KA 2ETXA 2PBZA 4V2IA 1O94A 1QPGA 1RKVA 4E15A 1YACA 4NDAA 4AJEA 2OV4A 4HWGA 2GETA 4YS6A 1NM5C 4LDPA 3RS2A 1QH9A 2VSFA 1G9TA 1IOWA 4YASA 2PUGA 2YFKA 4R9UC 4IUDS 2JFUA 1DO0A 3RV4A 2FSSA 2ZJAA 3C7AA 3BH7A 4M6WB 4JI3B 3FLAA 3JYPA 4TKVA 4HNAB 4D6YA 2WABA 4IHKA 3TXAA 3TLKA 4EEXA 4PPNA 3GLHB 2ERXA 2FFAA 3DKKA 1SVKA 1J0XO 2O05A 2ZJOA 2W8BA 1ONOA 1GNVA 3I4FA 2XZDA 3AF1A 4CIDA 4LVOA 5EJ2A 4LBWA 2GHIA 1FQOA 3KVNA 2NSLA 3KJZA 3VDXA 2YJ6A 5FNVB 3VNQA 3GZJA 1V7QA 2OHIA 1E3LA 2X6RA 4OX9B 1CSEE 3F8SA 1TYCA 1ZCAA 2R8EA 3DBLB 3HVUA 3I2IA 3MWLA 1ID1A 1FPMA 4RYDA 2YC2C 2WE7A 2A1TS 3E61A 3H9UA 3ILHA 1BWQA 2XDAA 5FUXA 2BFFB 2IYZA 1XELA 4DIKA 2ZSAA 1Q3HA 4CKWA 3E5MA 1TUEA 1PI3A 1XTRA 2NG1A 4IEFB 3KJQA 5TRTA 1XTQA 4H7FA 3VAYA 3G5UA 4D9CA 1QQ7A 1FFYA 1E6MA 2PMBA 3QBJA 4N39A 4AULA 2BKXA 2R62A 5H8WA 2H07A 5E1MA 5LQNA 4WY8A 5THXA 3LUJA 3T52A 1LPNA 3TGPA 1BVHA 4X9XA 2HEIA 4LOAA 4HWPA 2H4ZA 1B8OA 4GNRA 4Q4AA 3WRYA 4EF6A 3AEUB 4BNZA 5HKKA 3OZVA 1JEDA 3RH0A 2XOEA 4RLFA 1USWA 2J5XA 2M98A 3L7YA 1HDOA 1GNLA 4Q4JB 3QGMA 4GEKA 3SX2A 2BM0A 2QEQA 3M5DA 3TAXA 3NHZA 3UQZA 1BCRA 2F67A 4F86A 2ACEA 3ZH9B 4OQPA 1ZD5A 3DE1X 1M66A 4MP6A 1SKAA 3KM0A 4DEVA 2VP4A 1O6FA 3AO0B 4WI1A 4WZ6A 1O0BA 4LDAA 1PLKA 1Z0JA 1Z82A 2G70A 4KH0A 1LPAB 4Q18A 5GJVC 1XYVA 5HF8A 4UNQA 3H8SA 1Z13A 2PMEA 3KQKA 2GXAA 3P9ZA 1V7CA 1N3YA 3WNBA 3ZDDA 5KDDA 1UK9A 2C3OA 1RRPA 2BMFA 1GSIA 4WXHA 1C1HA 2EATA 1DI0A 2H1VA 2QJTA 1O5TA 4YCJA 3VNAA 3EGCA 1EGQA 4WK4B 3W8NA 3B1YA 1SELA 2BFDA 3MTJA 2FAXA 1O6CA 1ZYUA 4J3NA 4G8JA 3WOHA 3AIOA 1HTTA 1GOTA 5EWLB 4XPIA 1JI3A 5SZIA 3ADPA 1FLDA 1N6RA 4CIAA 1GM5A 1NT2A 4ZK2A 3HP4A 5AKGA 3D7LA 1L8OA 3RVPA 3H19A 1GN8A 2M6KA 2NYAA 1YIOA 5EKDA 4MUAA 1ZL0A 3EW9A 1NW7A 5ELLA 5EP4A 2OA0A 1O9HA 2Q1TA 3EZ7A 4V3CA 3IHKA 1P7PA 5IH3A 3UV7A 3A10A 3B1ZA 3BCHA 5A0VA 1GZVA 2QPTA 3JD4A 4P4GA 3SYNA 4PGAA 1HOTA 5H16A 4B5LA 1DX6A 1WW8A 3PJRA 2RAUA 2FFQA 2GM4A 4S1VA 3H5VA 1CEXA 5J5VA 5ITZA 4MJ7A 1ZK2A 3BTSA 4WJKB 2B99A 2P2YA 1U2ZA 1P1FA 4Q9AA 3IALA 4KEAA 1D4AA 4EA6A 1FLVA 3RPEA 5T5QA 2AKAB 3IVCA 4X91A 3OQNA 4ZCIA 1SZDA 1PQ4A 1RMTA 2X9VA 2BJHA 2ZZMA 3HSKA 2V6BA 5KTKA 4L5JA 4V02A 1SKUA 2BEWA 4M9CA 4RENA 4GP7A 2BFBA 2G9VA 3FMFA 5ICEA 1ADYA 2H2WA 5HM6A 2BTOA 2ZW9A 4LV6A 3HYNA 3HXOA 1X1AA 1EDZA 5B4VA 3A2NA 4G1UC 1RQ7A 2RGAA 1GAEO 1L6IA 3KFVA 4LN1A 4CHGA 4BTVA 2HGZA 2HSWA 3I23A 1YI1A 4JJGA 4O4HF 4F3YA 2GPYA 2Y05A 1YHYA 3CE6A 2VYVD 3QTLA 2C8JA 3OBIA 4Q7JB 2DHRA 1JDSA 2GAFA 2E21A 4R9VA 5CVCA 1ZGAA 3KXPA 2OAGA 1QHXA 3K32A 5IDVA 3KD3A 2BMVA 1FU7A 2OZLB 2OO3A 2ZSDA 2P7IA 4LI3X 3UCXA 1TFRA 2SKDA 3F47A 3ICOA 4JLDA 4BAUA 4PC1A 1QKJA 4H31A 1QP4A 4C88A 5JDCC 2C3YA 4UPEA 5CEEA 1KI1A 2G8LA 4R8LA 2QMHA 3JALA 1QU2A 3NFYA 1DAMA 4JKOA 5IAOA 4BO2A 2YMPA 1PLJA 2N3ZA 1L9KA 3HDHA 4Y30A 1AXEA 1CY0A 2EBHX 2EYUA 1ORVA 2FEOA 3ETCA 4TXHA 5IVIA 3W34A 3G85A 2C97A 2QTRA 3QEKA 4MQFB 4KYIB 3LF1A 2WILA 1PAUA 1YVUA 4KYTA 1G21E 1SKMA 1N36B 2HRZA 3DLTA 1J49A 2D0OB 3WS7A 2RGXA 1ZQ1A 2H0RA 2P11A 4DYHA 3QQPA 1BHJA 5I6DA 4C4PA 4E5PA 1MX1A 1ZH4A 1SNYA 3NBYC 4K1LA 2QLTA 4KGDA 1F8GA 4U2EA 1MAWA 4P86A 2P1RA 4X95A 4O4IA 1M83A 3I6BA 1ESNA 5GPBA 5I8PA 3F6CA 2PSHA 5EWJB 4QGGA 2ZM5A 3QE9Y 2RBEA 3AU9A 1T9ZA 5J59A 1BO6A 5F35A 2PT5A 2HIAA 5GGYA 2MYUA 3OA2A 4D4KA 5AW0A 1FY2A 3GG2A 2EP7A 4ZRDA 4URVR 5CM8B 4Q02A 5C37A 2EG5A 5FTJA 2WZCA 3CXRA 3P9CA 4PLWA 1QDUA 5L7TA 1ST2A 1DJQA 1Z74A 1LWOA 2WTBA 3EIHA 2CUZA 3P0JA 1GVNB 4K9OA 5B57C 1Z8DA 4MQUA 2ZT8A 3V55A 4DCCA 5JS6A 2Q5LA 2ZZNA 1E18A 2R97A 3UM9A 2FPSA 2GARA 3AZPA 3TFOA 5JADA 4H60A 4MWCA 3IDZA 1OH5A 1P9NA 1E1CB 2BV3A 1TT5A 1RBQA 2FEMA 1ZKDA 3ID6C 2AQKA 1V4BA 1Y7PA 3OBBA 4LWZA 3CRVA 3IKTA 1R0LA 1QVRA 2W6JD 1R4MA 2B4YA 2Q5JA 3AG6A 2AXNA 3N8NA 3THRA 2OTCA 1EYZA 3LCUA 2EKBA 4JLNA 5TEVA 5JWRA 1NTOA 1A9SA 2G8NA 3D81A 1IQUA 4JLSA 4MVXA 2PL5A 3PFCA 4N4AA 3WLNA 4DQDA 5JECA 1TECE 3T7TA 4HB4A 1P7WA 3AVXA 2QUKA 2QJFA 3N8DA 4PINA 4DJDC 3DUFB 3IP7A 2JCVA 2RFLA 1BDJA 2O8NA 3LC2O 3P96A 3M82A 4I8IA 3IDAA 4M1KA 5IM4A 2G4CA 1OFHA 4GX0A 2QMOA 2XKAA 3HKBA 4PICA 4MVJF 2OHOA 2Q99A 4NULA 1IZZA 3GFRA 1JU3A 5D1NA 2VXCA 1PSDA 2JASA 2TSYB 1P73A 3DOFA 4TQUS 2LVBA 2R0QC 1C9YA 1F4PA 4JXJA 4JQCA 1CD5A 2HZBA 2M6RA 3PDJA 4D9JA 4Z51A 3GGSA 2YVKA 4K6GA 4MUJA 2PKEA 3P2OA 2B69A 4P33A 1YZVA 3QA9A 3PNSA 1CUIA 3ON5A 4D3FA 3CH7A 1E6EA 4M1YA 3DMGA 4EJ0A 1PFWA 3S8YA 1DV1A 3GXBA 1XZJA 1UBUS 3LE8A 3IPXA 1MAVA 2VJDA 1JHDA 3AJ9A 1E2KA 2MSNA 4R8SA 5CGZA 4WESA 3ZHCA 2AV6A 4E94A 4L4XA 2W22A 3PLRA 3GELA 1UEJA 3IB3A 4UXHA 1KNXA 2JGJA 2Y4NA 3C3MA 3OM1A 3HO8A 2R5WA 4IDDA 4QU5A 1FYVA 3DYBA 1PJSA 3DWEX 1FP4B 4O4LB 3KDSE 1XZMA 2H92A 4C07A 5KOYA 4Z2YA 1JH8A 5AJYA 5DM4A 5JHGB 5ALTA 4S24A 4BJ6A 3GGGA 5TMEA 3ROGA 1RPAA 4BKQA 3RFUA 2BHNA 2YXDA 1AO3A 5JV5A 1JB9A 1XNHA 2JGNA 1G19A 2WWWA 1MIOB 3OI7A 4QICA 4F9EA 3W5BA 2I7VA 3HDGA 3IXMA 3A9RA 3P9SA 2C1ZA 4KQJA 3EGEA 4CCYB 3TB4A 1E89A 3K2BA 4QA9A 1ZOOA 1CHDA 4MW5A 2Q3MA 1HT2E 5AOVA 4ZVVA 4DNPA 4F9FA 1QF6A 4EKYA 1ZJZA 5FPPA 4F72A 1KK1A 4ZOEA 2J3JA 3D4OA 1ITZA 5EERA 1BDMA 1QAMA 2GFHA 5KU1A 3S8EA 3UB2A 3FWHA 5JXIA 4FS8A 4L6IA 3F5MA 3DOOA 5AVKA 1OLUB 4TVOA 1ZD8A 4F45A 4NRDA 5KQRA 5AW9A 1XNJA 2DUUA 4RORA 1D4FA 4MGKR 1OH8A 2OB1A 1RPJA 5JZOA 2KYRA 4MW6A 1VRCA 2NQ2C 1P60A 2ODAA 2OP0A 2QXTA 3EAGA 3W79A 3U44B 4CHTA 1XDWA 1ULTA 4ZQBA 3VR3D 1NQWA 1O54A 5LLDA 2JLUA 3QEJA 4EZIA 4GKJB 3T0IA 3H1PA 2OCBA 3P9KA 4OBWA 3ETLA 4ZIRA 2IYTA 3QA3E 1R5NA 2C7GA 1NPDA 4NJOA 4NPAA 3NC0C 1T36B 3NASA 4G1BA 1E1DA 5KHLB 2XZOA 1C7FA 2O3JA 2JGEA 4DPKA 3EJ6A 3U3DA 3U7FB 1XMOB 1QE3A 3LPDA 3PD1A 3DDHA 5EIBC 1EFDN 1B43A 3EMBA 2R751 3L8MA 4I08A 3OLWA 2GPJA 2WJ3A 4TQGA 2BGJA 3OZRA 3M4XA 1XMXA 2ATXA 3B13B 3CFYA 1ZXBA 2CNWD 1HLFA 1JEEA 3GFVA 3QX7A 4POAA 5HQ3B 3CSDA 2BY4A 3RKUA 2FFJA 2F1OA 1XN1A 4IVNA 4LXUA 5T64A 1NVGA 3WLAA 3HB5X 1NE7A 2R6HA 3MCWA 5AXBA 4IY1A 3DL4A 3ZWQA 4AJLA 1NFQA 6AT1A 1CZLA 1UPUA 1ZR2A 2IYLD 2VLBA 3E7WA 3HCNA 1AK2A 1NI4A 1YVRA 3A6HA 4BFWA 2F43A 3HCDA 1ZMTA 3L0CA 1HEIA 1JN0A 2O2EA 2IY8A 5DLDA 2PGNA 3VC3A 4DLXA 2HMVA 2TRSB 2ZI7A 3GF4A 4MS4B 4DRZA 5M2QA 3HSYA 2E4XA 3AY6A 1FUEA 2FSHA 2GUWA 4NYJQ 1U1GA 5GZ3A 1SXQA 3WSVA 1HE5A 2FG6C 2AMVA 2CHVA 3CZCA 3FSEA 5JBIA 3PHIA 2JFOA 5JCPA 1PYOA 4XCXA 2X19A 3CLRD 4B09A 4RMNA 2WHPB 4RA9A 2VJCA 3SQXA 3DW3X 4OI1A 4V03A 3E84A 3M1YA 5LPNA 4D0RA 1LF0A 3EEQA 2ZTMA 5HQTA 3NIWA 3V8MA 1QH8A 2PLRA 2LCIA 1YKFA 1UBCA 4H4EA 3ZNQA 3AVUA 2PBLA 1MC4A 3N2KA 2RHCA 1V6CA 1NMXA 3AUYA 3SS7X 2DBZA 3OZTA 4AO8A 5K01A 1IAQA 2VTVA 3I2FA 4XQ0A 3WGOA 2R7LA 1N1DA 3R6GA 3WLSA 3K2EA 1ZBDA 4S04A 2PV7A 4RFLA 3BFPA 2KJQA 3IUEA 1T3LA 4MP3A 3JQBA 5IEJA 4FMDF 3LCVB 1M2FA 1US8A 2F00A 4JC8A 1V3VA 3IEKA 4ZJUA 2AN3A 1WV0A 2XVYA 4O8CA 3ZK9A 1XA4A 3ELDA 1UF9A 4KE8A 4LNHA 1SRQA 4J1TC 4FR0A 4MWZA 4H7KA 4O59O 1SOMA 1CU1A 1OZAA 1SY7A 4R5MA 5F33A 1ZCZA 1UPTA 3UCEA 3OT1A 3WDKA 4LZOA 1K92A 5GV7A 1ML4A 2VTKA 1IMJA 3DVQX 4INZA 2A9VA 1O6BA 3B2NA 1U3UA 1QGZA 5U4QA 1GDDA 2OENG 1YOBA 1FU8A 2FXVA 1VJCA 1FDSA 2F3UA 5EMJA 4C6RA 4FZJA 4GL2A 4UQOA 4AKGA 4NS4A 3V7WA 4MEBA 2UXDB 1GZ7A 1BXZA 2IKSA 3IPAA 4M0FA 1B41A 1NF2A 4NCIA 3C4QA 1LDMA 1B2RA 5DP1A 4MVCA 1XWIA 2XGOA 5K4HA 5LFAA 4R54A 4BNWA 3SOPA 2FN9A 1MO6A 2IY9A 2A0XA 4PHTA 1W36C 3DLCA 2XB8A 5FEUA 1JJAA 3A6ZA 2XF2A 3MB8A 3NTXA 1X38A 4R1UA 4LV5B 4WXRA 5CB4A 4AL4A 3J81A 2P9ZA 3MM4A 4KSYA 1F06A 4I3HA 1IIBA 1ESCA 3CNBA 5B1HA 2B6HA 4Q3CA 1RSZA 2OXRA 2Z4SA 4IUCS 3C8HA 5L6LB 5C7YA 4HLCA 4CMHA 3BSYA 4PS1A 3ST7A 4MWBA 2NV2B 3ZWMA 3PIRA 1INLA 4K3UA 3GGCA 4GGOA 4KI7A 3IT3A 2CHQA 1LUAA 1T6ZA 4WN9A 2IW3A 2NSJA 5AI8A 1U5AA 5AK6A 4D8WA 1C7RA 1R0BA 3COZA 1CDZA 2HLNA 2ZQYA 3JWPA 2IXEA 3TW0A 4L16A 3PSHA 1N9KA 4C6TA 3N53A 3S44A 2ZSKA 2VZ0A 2I2FA 1VHTA 4UBIA 1VPWA 4B0PA 3PUWA 1ZD3A 4KLAA 4P54A 4ZYLA 2DBQA 4LHEA 1KOLA 1ORIA 4E2FA 4E21A 1OYOA 4MV4A 1MZVA 1YJ5A 1DWPA 2JK0A 2QRVA 2VJMA 3TLZA 1RFGE 4N5HX 3X1ZA 1Z45A 2FSGA 2PZMA 3CSSA 2W6PA 3SM3A 1J5EB 4INOA 2OO7A 4H08A 1D2NA 4IMRA 4UEQA 1D1QA 3N5CA 5FLEX 1LBSA 2EARA 1YDGA 4K9PA 5EQJB 1N7IA 3LDHA 5EIWA 2VXYA 1E1QD 1W1IA 1Z7BA 2VYQA 2XMBA 3B9BA 4KIJA 4N0PA 5DE3A 3KQTA 3PDIA 4OM8A 1IEVA 3ZHZA 4FDTA 5IZCC 3WAJA 2F8MA 1L4HA 2Q7XA 3WISA 5JR3A 4FX5A 4I55A 5LKRA 1QXSA 4OK6A 2BOVA 2G7MC 1KPIA 3FLBA 4HLNA 1N2GA 3NNDA 4M83A 5SICE 1RM4A 3UO8B 3EZXA 3KOWA 1XCOA 3NHJA 4DR7B 1WUJS 5A04A 2NO4A 3CR7A 4CM6A 1KJJA 2JDID 4L4ZA 1JF8A 1VA4A 3PXDA 1CJCA 2HBZA 4WVLA 3UWPA 2AFHB 1FSGA 5J43A 1EK5A 2R6FA 1DJNA 4DILA 2BBSA 4NH0A 4ABTA 3GMTA 2DSTA 4F4DA 2P2SA 1TQ6A 1XC7A 2HA7A 4GKBA 1ZH0A 2C78A 1NW5A 1WU8A 5HE9A 1PYGA 3WK5A 1MC1A 2QRUA 3JYQA 3HUUA 1SUAA 3I6MA 2XBLA 3JWGA 4G5HA 3TR5A 1M6HA 4FSDA 4RHTA 3V2UA 3VPBA 1C81A 4YAGA 3C3YA 2YY5A 2J6BA 1QGUB 4ISBA 2ODTX 2VKTA 3CRNA 2HCRA 5EMKA 5EZYF 2H2GA 1SVWA 3W06A 4BE9A 3E7PA 4ER3A 2B25A 2PT7A 2XUZA 2NZUG 3FNHA 4UATA 1URPA 2GYWA 4G86A 4GR4A 2QRZA 2B35A 2G04A 4B1FA 5FPHA 1D7AA 2EGHA 1Z0AA 3LDFA 4V39A 3UJCA 2ZBQA 3S68A 2JEYA 3EW7A 3PLAE 4J2HA 3NYRA 1N9GA 1JXQA 1NWCA 3K1JA 2CJPA 1EP2B 2AEEA 2ZYWX 2BEUA 3O4FA 4X7MA 1YS1X 4BFUA 4L0CA 4ER0A 5BRAA 1DKLA 3T9FA 1Q0UA 4AY6A 1Y1LA 2TMYA 4MUBA 2O2CA 2DXIA 2CFRA 5AK5A 2JH9A 5HG0A 3T5GA 1NLYA 1U0HC 1VKNA 1WVGA 3QEMB 2H3EA 5U1PA 1GPKA 4AK9A 1EA5A 1NV8A 1VMKA 2WWHA 5BWCA 3WBJA 2GJAA 3DEYX 1GTJ1 4LK3A 2QF7A 5HTKA 4COKA 3FOZA 1BQEA 4KMOA 4X8MA 5E95A 3JQEA 4RCZA 4URZR 3G0HA 2ZWIA 1W52X 2ZUFA 10MHA 1T2FA 2YMQA 3D6HA 3JQAB 3AYXB 2SBTA 2GK6A 1GKIA 3I04M 4K9SA 4QUGA 2W6JA 4XB2A 1N6OA 4FXOA 4IDFA 1DRUA 3V80A 1G5HA 5LQRA 4Q00A 3QPUA 1ZUWA 4O1IA 3ROFA 3T5MA 4U7DA 5FA8A 1D1PA 4FFMA 5JBNA 4DC9A 1NRXA 2X5XA 5MHTA 4DCGA 2W2LD 4MQEA 4OQ4A 2RB5A 3OESA 1IBRA 4U3JB 1PBTA 3B38A 3O95A 4PANA 2P2CA 4X6XA 4P5PA 4B3TB 3GJTA 3DS8A 4DCMA 1P7VA 1KORA 5D7NA 2C7VA 3ORSA 2TYSB 3OEHA 4RVDA 3QE3A 4JMLA 3CW2A 3FDIA 3OX1A 4BBPA 2IBSA 2WNIA 2ZATA 1I2ZA 1V9CA 3ADKA 3O26A 4N0QA 1TKRA 1ZH8A 4UJ5A 1GUDA 3FCUB 2GVNA 4QOJA 5LBUA 2DLCX 4IHQA 1YB1A 2J9YB 1S2IA 1YDMA 1LI5A 3FJYA 4KUGA 3CEJA 3C3BA 4GI2A 1JQ3A 1T9CA 2DY1A 2Y9PB 1NR1A 1RW4A 2OAQ1 4OHKA 4YJGA 5EP3A 4BMPB 3CUWA 3INRA 3LMKA 1BA3A 3BFJA 3NDBB 2ZIGA 3W2TA 2C9DA 1HLDA 1QIFA 1GQRA 2PMKA 3SR4A 2XE8A 2ZREA 1VHJA 2ZIAA 4WD3A 4WFIA 3NWBA 4OATA 3H1TA 5ADHA 4E5MA 1GVHA 2MYTA 3Q4GA 3KB1A 3SFVA 1J0BA 3DBHA 4ZHQB 4CGYA 3NO4A 3K9GA 1UQUA 3OE1A 2AXPA 1Q11A 1VB5A 2OR3A 2SECE 1ABFA 3S1LA 4F4CA 3T3OA 1W0KD 2ZJBA 2XWJI 4L3VA 1C8KA 1VYVA 1LWNA 2GZSA 2LIPA 2H5LA 1QHIA 3BC1A 4FIDA 3TMAA 2VAVA 4FW8A 1QAQA 3K5HA 4MVJG 1QQ6A 1NN5A 1K98A 1YHNA 2QYOA 5DFAA 3THSA 3DT8A 2BJVA 5EIAA 2HPAA 2XZPA 1NXOA 2QRHA 3GZNA 4H6PA 4HS4A 1T4CB 2D3TA 3R8FA 2O2YA 1OI7A 1Z3CA 1WG8A 2EERA 4HFNA 2P69A 4JFAA 4GM1A 3PWTA 5DHQA 4AMBA 3DPIA 3BMNA 3ZWPA 2I71A 4GR5A 4AG6A 1YS9A 4JROA 1BJRE 2WT4A 1WZCA 3CT6A 3IKLA 4BCBA 5EXTA 3P2YA 5G4LA 5KCMA 3WGKA 1NQTA 2V9CA 3OFJA 2P2NA 2QR3A 1Y37A 1KAGA 3JPWA 5DISB 1UCFA 4BGIA 3FPHA 1UT8A 2R86A 4JB3A 4YJ3B 4JOSA 1E9VA 1JDBC 3RUEA 4E1VA 5LOVB 5I8ZA 4CMEA 3G2LA 1QO9A 3A1VA 3DV0A 1DPGA 4TRRA 1MO3A 2ZRLA 3CLHA 3IQIX 3WL5A 1GKKA 1AHIA 4Z6KA 1Y9JA 2VI5A 4LZNA 1Y9ZA 5CMLA 2Y1KA 1DRVA 3VR3A 1IHDA 1C7IA 1XVVA 3SQWA 1KFBB 2NXWA 1JLLA 2WVAA 3E2MA 1YD7A 1LTKA 1UMCA 4JXZA 3JATA 4IH1A 4X63A 4FYVA 1WEKA 4YWHA 1NN1A 2GWHA 4EK9A 3ZOKA 1FSPA 1VIYA 1KQPA 2B5VA 3LHKA 4M8IA 4QUDA 4HEQA 3SIXA 4IHJA 4OLBA 3MD9A 2NYVA 2ALJA 3NBUA 4CF4A 2GZMA 5IASA 1M0EA 4WAUA 2CNWA 3R44A 1K8ZB 1K66A 3UH1A 4LXQA 4EFMA 4ZI7F 1A1VA 1Z0FA 1WD5A 3NHUA 4HG2A 2P6NA 3PQEA 4L9SA 5F7JA 1F6WA 1RM5A 5F9MA 5HE8A 3VYWA 1AQYA 1W49A 2LXNA 4NOJA 3AM1A 5EMMA 5JLJA 1IBCA 4EIWA 5JAPA 3C5EA 1OBVA 1RAIA 4MROA 4ND3A 5BORA 1CEYA 1M2KA 1W9MA 4G4IA 2WAYA 1HL3A 1Y1SA 1A9QA 1EBBA 2ZKLA 3FPLA 2BSXA 3TZHA 1QOQB 4QBIA 3EVAA 4WINA 4AN0A 4BGUA 5IZ4A 2IS2A 1N2BA 4FFSA 2Y71A 3FYUC 4OBXA 3RU7A 5IU6A 1ZVKA 3JQGB 4PYKA 5JSZB 4UEJA 3NCHA 4UCXA 2X6QA 4AZWA 4TMTA 3EFOB 5CM9C 1D09A 4PRKA 3LYHA 2QD3A 4JH0A 3T34A 2IZ0A 3IUYA 1D0SA 4NQRA 5T4EA 1BSVA 5FWNA 1A2KC 4DA9A 1D6SA 1OPRA 5JZSA 5IKOA 3DBOB 3QXXA 4KVFA 3KJHA 2BTQB 2WM8A 4RDIA 3HBAA 4E3WA 3GA7A 2QY9A 2II6A 3PNYA 3ZQ4A 3K9LA 4KU4A 4RTMA 3F97A 1C0LA 5BW5A 1MORA 4OB7A 2N42A 4MAMA 4BVAA 5FLXA 2I3AA 2R7MA 1DS6A 2IV3A 3EBPA 3GY0A 4Z4EA 4XIGS 1CKEA 2VHQA 1XLUA 3BGIA 3P45A 1CE8B 4R3NA 2A14A 3LH5A 1GADO 4RNDB 4YCSA 2A1UB 1QS0A 2BELA 2IZ6A 2Q28A 3OZSA 1JHOA 4P53A 5KTOA 4R8VA 1D1TA 2XNDD 5CT4A 1Z83A 1FNNA 3NP9A 4P0PB 4BVJA 1IXZA 1V3QE 1NVDA 3RTCA 2F64A 4BC0A 1ZMXA 2JVIA 1M67A 3E58A 4P4NA 1OA0A 1Z62A 1ETHA 1Y98A 2CNNA 2PFGA 1XU7A 4M0CA 4IQFA 5EGNA 2JLZA 3W8RA 1NUAA 3M1AA 4HGRA 4U00A 4E03A 3VPCA 2VRBA 1W4CA 4DCPA 3KWMA 4E46A 4EZEA 1K6MA 1N4DA 1EE1A 4BO0A 5DWQA 1BFKA 1SBHA 3SF8B 1YU6A 1KI4A 1Q1AA 2QG4A 4MAAA 1AHHA 1W96A 3A6DA 3IOYA 3KR2A 6REQB 1SPBS 2YV2A 4HZUB 5G53C 3UW1A 4NZ9A 1YS2X 1T5LA 1W34A 3FNGA 3MWDB 1M2HA 2Y1EA 4IUBS 4X0EA 3TIVA 5ADWA 2H1RA 1NSYA 2ZUTA 2ZVDA 3ADBA 1PYDA 3ZGYA 1FYEA 3K70D 4TLLB 2IHYA 2R48A 1FSSA 5DF1A 1XDDA 1P1RA 1WDTA 2WJWA 4KP7A 3MAGA 1QJCA 3BS4A 2CMFA 4PZ9A 4GBGA 1TAUA 4F1JA 1J2JA 1J8FA 4PYNA 5G1NA 3P1JA 1QQAA 3T9EA 3NOQA 1FU4A 5B58C 1KZYC 2WJZB 3NNSA 4BMDA 4QHYA 1YMUA 1VJDA 4P4TA 4KRGA 1G2IA 2WIDA 3R6TA 1GPBA 1Z3IX 4MUYA 4CVNA 1E1NA 3R9XB 2XQIA 2H9AA 1KMIY 4CMCA 3PQCA 1CQIA 4EB6A 3BMQA 4B8YA 3ZI4A 1VG9B 3DPUA 5JNWA 2WIBA 1YFZA 1ZBQA 3DG9A 3TZLA 3J80A 1FS6A 1HWYA 3FPEA 2OYCA 3V8QA 2XD9A 1SU6A 2PIAA 1MG5A 1GQOA 1ADJA 5JCJA 1OFIA 1UDXA 1H3EA 1A96A 2PX2A 4NCNA 1EUZA 1VKZA 5ESWA 3SX0A 5KYUB 3TSWA 3HMQA 3T5AA 1UZUA 1TF2A 4TGLA 1KZ9A 4HFJA 4O4HA 4X65B 2YIJA 3QU2A 4H35A 3EXAA 2B20A 2IIBA 3U4QB 1IN8A 1XO1A 3O8BA 4QPDA 5FOXA 3UB4A 2EKQA 2O4UX 2D2EA 1DINA 2X22A 2H5EA 3BDIA 3TRJA 3VGPA 3WLOA 3CV3A 1USGA 3QFRA 3UJ7A 3VTZA 5AESA 1E1QA 2OCKA 1JWBB 2WFLA 4TTVA 1OYVA 5J2TF 4AG3A 3JYNA 1K4MA 4FLMA 3WHKA 1Z2NX 3K73O 3G5MA 1JSCA 5FV7A 2ZBGA 1UBHS 1LPBB 3IYLW 4Z1MD 5CCBA 5EXEA 4MR7B 4CG2A 3PZRA 3BILA 4S3MA 4CLRB 4NZMA 4YN3A 3I9V6 3LIPA 4C01A 2CMGA 1KEVA 2E9SA 2Q3LA 2JDIA 4HQRA 2WWVD 4MPRA 3C87A 2GN2A 4DV2B 4Q4DA 5GIPE 1TO1E 1YKGA 4Q24A 1UXHA 4XA8A 4QGSA 1FRNA 3CLTC 4M9QA 1E4YA 1Z5WA 3KLOA 1O0SA 1U7DA 4UDOA 5L3QA 3UWKA 3BFXA 2IYFA 2DWUA 3N2GB 3LM8A 1HH4A 2MHCA 4KHZA 4M1SA 4WEQA 2RH5A 3L49A 4WASA 3DDSA 4GE3A 4YR7A 1E5LA 5JNSA 3WYGA 3KD2A 4MDFA 2O06A 2N0SA 3AQ4A 3HFJA 1KP3A 3U09A 4LJ6A 4WX2B 3KQOA 4HH0A 1EPUA 4OO3A 3PR2B 1SH7A 1I7PA 4W8HA 1O57A 2ZSEA 2ZAYA 3SC3A 2GFQA 3K0EA 3ND6A 2BMWA 2MCFA 1WULS 1M10A 2V8BA 2NUAB 4DWWA 5LIRA 2DLNA 1WXHA 3P7MA 2WJPA 3HSSA 1G6OA 2B5WA 5C34B 1Q95A 5B7NA 5DNUA 2EX1A 4D0SA 3STWA 4YJ2F 2WV7A 3W2GA 3D1LA 1PJZA 2ONZA 3OTGA 4Q66C 3T3EA 4OOFA 3SXJA 4RDXA 4L07A 2BUCA 1K08A 1RXUA 4CQMD 3BORA 2IJGX 3IDFA 4C3OB 2QZ9A 3BL5A 2UZ0A 1F4VA 4PAOA 3M2TA 3QPVA 1DKMA 2W6ZA 1G8HA 2YH2A 3B2QA 3LHSA 2XB9A 1O2DA 3OZ7A 3VZSA 3ZGNA 1O94C 4Z4GA 4EH1A 4TVSA 1C30A 1BA2A 1L5HA 2IH4A 5HR5A 5FULA 3STXA 2ZKIA 2QAGA 1BHO1 1MT0A 4OIFA 1NQAO 3VFDA 3QWHA 3L7KA 5K8TA 4PZCA 2ZTUA 1SCDA 1HRDA 3L7CA 1U65A 1EWYA 2YJTD 1TTPB 2BE7A 2JD0A 2W2LA 2PRJA 3A3PA 2MT9A 2RDMA 3R5SA 1ZHHA 3IP5A 4Q1FA 3JD2A 2OYSA 3BTUA 5FR1A 1BE6A 1T13A 3HQ4O 4ZREA 1NKVA 5B1EA 5CPFA 4BB9A 4F7WA 4IMIB 2VBGA 5E1OA 4YONB 2ZPUA 2XGGA 1AKEA 3BGWA 3G7UA 3G49A 5D3MB 4AJ9A 5KC8A 3IOBA 1XT6A 4J3JA 1U0LA 2O2ZA 2VZLA 5BR8B 4G97A 2QRGA 1DKNA 1WSWA 4LBYA 3GPDG 1PKXA 2QE6A 2Q5EA 2Y1FA 2X8AA 2I6UA 1OH7A 3JAMA 2FKAA 5KQPA 1A7AA 4ZZIA 4W5NA 3HUDA 1R0CA 3ENZA 1KAOA 4I4NA 4PLPA 3TLBA 3I5XA 2AMLA 1W35A 2W2XA 1V5FA 2XMZA 4CJXA 2YZ7A 2HU2A 4IF6A 5LLTA 3D0RA 1ZU5A 4X6LA 5KUTA 1LSSA 2PGIA 3DNFA 2WG0A 1GNQA 4BUJA 3O8CA 2H7VA 1UIMA 2ZYVX 4BN4A 4OAOA 5HFNA 3UZUA 4E2YA 2ZYRA 4X1YB 2H11A 4M9UA 3IJ5A 4UULA 2QS9A 2QXUA 1XVLA 2CNOA 2DP4E 2R6GA 4Y1GA 4F7DA 5JQGF 4WGGA 1DXQA 4JK3A 3RVKA 2QNRA 4XD7A 1PD0A 2H7XA 3UC9A 2YJGA 1PFQA 1XG5A 3FETA 3M6MD 1KYTA 1WJGA 2W2MA 1W0KA 4GGPA 4UKDA 3WRYC 4TYPA 1PS8A 5KIAA 3VV3A 3U0BA 3ZGZA 4DA8A 1I80A 4CDMA 1Z39A 3AR3A 1H2WA 5L4LA 3REOA 3ZDAA 1RCTE 2OY0A 4RK6A 4RACA 2NQ8A 3PA6A 4KK3A 3ZE0B 4XYBA 5BVHB 1M6NA 1R5BA 3ORHA 1C7QA 3DONA 4L4YA 4IZ6A 5J1TB 1NR5A 4YRLA 4QU0A 3EGDB 5LLSA 3WK8A 2HF2A 3I9V1 3MT0A 3R5XA 3S2ZA 3CRQA 5EXDA 3RADC 5DTRA 1H2ZA 3F6PA 3HU1A 1SBQA 3IRVA 4I4TB 5EY5B 1T1RA 4OHXA 2C07A 4G5YA 1DV2A 4Q0MA 4ZVLA 3QY9A 2JGIA 4GOXA 1Y7LA 5B58T 4CW7A 2B8WA 3NM5A 5ALQA 4BWGA 3KAQA 3O94A 4Q9JA 5F78A 3UHAA 2AOTB 4MO2A 3JU3A 3U7QB 3N6XA 1DIOB 4WKOA 2QRJA 3P71T 1VMIA 4NXMB 1DC7A 1D0VA 3SCZA 1RABA 5E6UB 3FCSB 1X13A 5A5GA 3W5AA 1PIWA 1RPZA 3NYQA 4G8BA 1PT5A 3CTPA 1NP7A 4P82A 4L76A 1DFGA 1H5UA 2DPGA 1GPAA 5KQLA 1SZCA 4HKTA 3WL8A 1UAAA 1JL3A 1TCVA 1XTKA 3GVIA 3KB2A 4JYMA 1GG5A 2M1ZA 4M1EA 4XW2A 3UJ3X 1DLIA 1LI7A 1YQGA 3T9BA 4ESVA 4BX2A 4AQYB 2WINI 2X5JO 1PR3A 5HMMA 3W9UA 3ZBUA 2BYTA 1U0GA 1Z17A 1BRTA 5BQXA 1SIBE 3UJPA 1F5SA 4G0NA 4L3OA 2WIKA 2ZBUA 4HTAA 5THKA 1UMKA 4BLRA 3GMIA 1C4XA 2O7VA 3VZPA 2XTNA 1SC9A 3WC4A 3BEOA 5AVRA 1PT9A 4GLOA 4X20A </