2OBBA

Structure of the conserved protein coded by locus bt_0820 from bacteroides thetaiotaomicron
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
121
Chain Sequence
b'NAMTIAVDFDGTIVEHRYPRIGEEIPFAVETLKLLQQEKHRLILWSVREGELLDEAIEWCRARGLEFYAANKDYPEEHQGFSRKLKADLFIDDRNVGGIPDWGIIYEMIKEKKTFADIYSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Structure of the conserved protein coded by locus BT_0820 from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 30
structure length 121
sequence length 124
ec nomenclature
pdb deposition date 2006-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2obbA00
2B8JA 1CQZA 2C4NA 3D6JA 5AHXA 3FZQA 4Y2XA 1Z4JA 5AW4A 1ZOLA 2AGVA 5AW1A 2R8ZA 2OM6A 2YJ3A 2FUEA 2JARA 5AK3A 3SKYA 4HAIA 5IS2A 3L8GA 2YJ5A 2HHLA 2JAWA 1EK2A 2X4DA 1EK1A 3NANA 1LTQA 1TJ5A 4UMFA 1U7PA 1Y8AA 4BKMA 1ZRNA 5AW9A 2PKEA 1O03A 2B30A 2MU1A 5ALHA 4L57A 2FEAA 4NFLA 1SU4A 2PR7A 4KX3A 2EATA 3ESQA 3QU5A 4JDPA 5AKIA 3DV9A 5AM4A 3WKEA 2GFHA 3MC1A 3AR3A 4XQ0A 3OCXA 4DWOA 4CNQA 2G0AA 2QLTA 3QYPA 2HOQA 2I7DA 3KOOA 5AVRA 3B9BA 5JJBA 2OYCA 3W5CA 3PGVA 2YFYA 3EF0A 4KNVA 3N1UA 5AI6A 1Z4NA 1WR8A 4H1WA 2Q4TA 2HF7A 5A3RA 3L8HA 3RFUA 3AR7A 2JAOA 5ALXA 1TJ3A 2ZBGA 4F72A 3MN1A 3U7FB 2G06A 2R8YA 2IA5A 5AI9A 3U26A 3ZWKA 2HO4A 2G07A 3R09A 4NABA 2I34A 2I54A 4EENA 3ZX4A 3DDHA 5AKYA 3A1CA 1S2OA 4BNDB 4UMVA 2EAUA 3L5KA 4UATA 4IFTA 5AKEA 3W5DA 2ZBEA 1VJ5A 1T9ZA 2C8LA 3PCTA 2HF2A 5ALYA 4QQFA 1RRCA 3U19A 3WK8A 3BA6A 4CF4A 4EEKA 1VFPA 2YMLA 3UMCA 1F5SA 4PNHA 3A1DA 3ZX5A 3OCWA 1KYTA 2P11A 3E84A 5AIBA 3QLEA 3L0CA 4MWOA 4QJBA 4YCMA 2YMQA 3M1YA 1AQ6A 1MH9A 2GHTA 3UM9A 3WKAA 2P9JA 4EX7A 1O08A 3FM9A 3KD3A 5ALGA 2IOFA 2I33A 3WK6A 2I55A 4UMDA 1ZD4A 2WM8A 3PDWA 2FPUA 4HGNA 3QU2A 4FFDA 4BX2A 2YJ4A 1TE2A 5ALUA 1ZRMA 1RLOA 2R8XA 2ZOSA 1L7MA 1YMQA 5AK6A 4MUMA 4FYPA 1ZD2P 3NRJA 4DCCA 4OCZA 4HGOA 2FPWA 4Y2PA 5AW0A 3ZTWA 2RBKA 3EF1A 1RQLA 3A3YA 2YJ6A 4O8CA 2HCFA 3A1EA 4BYGA 2W11A 4KN8A 3ZW7A 4BEVA 1N9KA 5AKJA 3IB6A 3EWIA 3OPXA 2PQ0A 1VJRA 3N28A 3AR5A 1NRWA 5AM2A 4C4TA 4Y3UA 3DAOA 4NAVA 1YNSA 2WF8A 2WF9A 4DFDA 4L6AA 3ZWDA 5AI4A 2OBBA 3BWVA 3FPBA 3L1VA 4Y2UA 3FVVA 3P96A 3F9RA 4BEWA 3QX7A 1LVHA 5AKXA 2G1AA 5ALSA 5AKLA 5AKKA 2NYVA 3PGLA 2GMWA 3ZVNA 1CR6A 3EPRA 5AKZA 3R9KA 3I1YA 1S8OA 2DQSA 2FPRA 5A3SA 3QU7A 3ZVLA 2CFTA 2WF7A 1ZS9A 2FI1A 1QH9A 3WGVA 3OCYA 5ALWA 3IRUA 1RKVA 2BDEA 1TJ4A 4Y2VA 4YH1A 5AI0A 1FEZA 3FPSA 1L8LA 4OD0A 1ZD3A 3CZ4A 1RPZA 4OFZA 2VKQA 1ZD5A 1QYIA 1WVIA 3NASA 4KYTA 1T5TA 3NALA 3M9LA 1U02A 3OCUA 1N8NA 4ZEVA 1T5SA 4C4RA 1L7PA 3WKCA 1U2TA 3KBBA 3OCZA 5AVTA 2RAVA 3OTQA 3SF0A 2O2XA 2RB5A 3QUTA 3FGOA 4CF3A 1NNLA 2QYHA 1QQ5A 2B1QA 1XVIA 3W5BA 3U7GA 4F71A 3ESRA 2B82A 2AH5A 1QQ6A 4UAUA 3ONNA 1L7NA 4RESA 5E0OA 3AR2A 5AW2A 3CNHA 3L8EA 5AI5A 2RARA 3QUBA 3QU9A 3J7TA 1QQ7A 3L8FA 2ZXEA 5AVUA 1RC8A 2B0CA 3WK9A 5AKGA 4NWIA 3N8GA 1RKQA 2NO4A 4Y2QA 2C8KA 2GO7A 2CN1A 4YGYA 4B6JA 1RMYA 2YMPA 4E88A 3U7HB 4IG4A 3W5AA 2OA0A 4ZEXA 1L6RA 4UARA 1TA0A 2G09A 3TLMA 2I6XA 3HLTA 4XE5A 5AVSA 4G9BA 4FE3A 5ALDA 3NIWA 1RKUA 2YY6A 3UMGA 1U7OA 1RMQA 3ZUPA 5AW3A 3WKDA 3WGUA 2CFRA 3ET5A 3QUCA 1L8OA 3K1ZA 1IWOA 5T41A 3QU4A 5A3QA 3NAMA 3ZI4A 2IOHA 1WZCA 2YBDA 4G63A 3L1UA 2C9MA 2HDOA 3L0BA 5ALOA 2NO5A 5AVWA 3RF6A 3ET4A 5AVYA 4HGRA 3L7YA 4AS2A 3WK5A 2W4MA 3B8EA 5ALTA 4YCLA 3B9RA 4UU1A 5AK4A 1YS9A 1RDFA 4J03A 5ALVA 2AMYA 1Z4PX 2FPSA 3SLRA 1PW5A 4EX6A 3UMBA 4HGQA 4CF5A 1RLTA 2GHQA 5AIAA 3U7EB 4UAVA 1RMTA 2P27A 2B8EA 3SMVA 2BY4A 1YV9A 2ZBDA 2AUTA 4OHFA 3SHQA 3VAYA 3E81A 3MPOA 2HSZA 5ALRA 5ALZA 2B1RA 3N5KA 3AR4A 3ZTYA 2ZG6A 4YIKA 3WK7A 3WK4A 3E58A 2HX1A 2EARA 1J8DA 1Z4IA 2R8EA 3SKXA 3NUQA 4XPZA 1Z4OA 4ZEWA 4C4SA 1Z5UA 5AW7A 3WKBA 4UW9A 5IT4A 5AW5A 3I28A 5AICA 3E8MA 2WF6A 4AP9A 1Q91A 4GIBA 4UM7A 2CFSA 4Y2JA 4YCNA 1WPGA 2FPXA 4J2TA 4Y2YA 5ALLA 3KZXA 1SWVA 5ALFA 5ALEA 1RQNA 1J97A 5AVXA 2IYEA 4DW8A 3I6BA 2HEGA 3QNMA 2C88A 1XP5A 1ZJJA 3S6JA 4JB3A 1Z4MA 5ALQA 4I9GA 4UM5A 1K1EA 1Z4KA 3U13A 2O9JA 2FUCA 3ZVMA 2G80A 2Q4RA 2WFAA 3AR8A 3KDPA 4KX5A 2ZBFA 5ALJA 2Q5EA 4YIHA 2YMMA 4EELA 2D2VA 2BDUA 2ODAA 1Z4QA 3I76A 4RETA 5AKHA 1XPJA 5ALPA 3GYGA 4Y2SA 4Y2RA 4KNWA 5AM0A 2G08A 3QUQA 2P69A 1YJ5A 5AVQA 3DNPA 4NV0A 3AR9A 3AR6A 4UU0A 1Q92A 4Y2TA 4HYTA 4AS3A 2JGAA 1Z88A 1RLMA 5AVVA 1Z4LA 3IJ5A 3N07A 5ALNA 3OCVA 1SWWA 3QXGA 5ALMA 1NF2A 5AM1A 2FDRA 4BX0A 5AM3A 5AI8A 4EZEA 2MSNA 1L7OA 1X42A 3ED5A 3L0YA 4L6CA 5ALIA 1YDFA 4BNDA 3SD7A 5AW6A 1JUDA 4I9FA 1Z5GA 4XOUA 5ALKA 5IT0A 1U2SA 3KC2A 2WHEA 5AK5A 3HYCA 2JAUA 5AM5A 2YN4A 4BBJA 5AW8A 2IOFK 4BX3A 2HI0A 3QGMA 3MMZA 3R4CA 4CE6A 4HGPA 3ZU6A 4GXTA 4UASA 2WF5A 5AESA 5FP0A 5AVZA 4UMEA 2W43A
chains in the Genus database with same CATH superfamily
5K8LA 4Q4JA 1FXWA 2QRPA 3OMXA 4X1YA 1XZNA 2C4NA 5EFZA 3SBEA 5CK5A 4C22A 4RNDB 4EKGA 1HYEA 4ZMRA 1J20A 4QDUA 4PIMA 1Y1SA 4OQNA 2OM6A 1ORWA 1Z83A 3EODA 3PX7A 2O7QA 2P4SA 2A9OA 1EDDA 7REQB 3E35A 3EQ8A 1YONA 3F2IA 1V8PA 5JE8A 5I7UA 1HV8A 1CY1A 1GAQA 2BMWA 1XZFA 3W3AA 4KPEC 1DLIA 2PS3A 1UBOS 4NK5A 3UXHA 2PWYA 3PK0A 1UMDA 2J32A 4RTOA 3OX3A 4QAJA 2ZRNA 2YASA 4N3GA 5JCOA 2HBYA 1NV8A 3V7FA 3M81A 1C3OB 1K66A 1RKXA 1O1YA 4YRNA 2IU4A 3O2QB 5LXTB 2JATA 1CR2A 4MUKA 3GH1A 2CMHA 4JSRA 4QODA 5ILQA 4UMFA 1WCYA 1Y8AA 4YS6A 4A4DA 4XRGA 1JFSA 3FD8A 4KMOA 4BKMA 2Y6UA 5DM1A 5CVTA 5HZHA 4MS4B 2ATXA 2B30A 4V0LA 4GS5A 3L8CA 2G67A 1XOIA 1OFGA 5CVDA 1VL0A 2NTVA 2QUAA 3ZYZA 2QMUA 5KC9A 2BFMA 5TIIA 4LTDA 4JMLA 3WP0A 4EZBA 1K4YA 4RWEA 2DFVA 1ZN8A 3JQGA 2CL6X 2FN9A 5G41A 3OESA 4QC2A 1MENA 4O2BF 3WIUA 4DM4A 4P4GA 4AIRA 3OZSA 5E2AA 3CN9A 4PPYA 2F59A 4DT1B 1XB2A 2PCLA 1G8JA 1KY3A 2GZSA 3CZAA 3LQ1A 4FX5A 3CJRA 5FH9A 2I7DA 4ZTUB 2O3UA 1TJNA 3ZVRA 5AVRA 4BXOB 2H1WA 2NTJA 2FF5A 3DL2A 1JHMA 3FE2A 4FNAA 2O0JA 4XWAA 3TZ6A 7ADHA 3B13B 3JAKB 4PAGA 1RHMA 2AG6A 1OI2A 2V6JA 4PW0A 4ISBA 4ZVKA 5K4AA 1T4DA 2ZJ5A 4GW3A 1MJ5A 3AI7A 3ZH9B 4M2LA 4Y9DA 3FYHA 5HE9A 2QZJA 1IEXA 1HMYA 1GQOA 1SKYB 3I1IA 4PLVA 1ODCA 5AXAA 4PAMA 2EQAA 4KU4A 4AQDA 3OHMA 4FJ1A 2RGRA 3LA8A 5AJWA 3RVJA 2V5VA 4EJFA 2YTZA 1Y5RA 1EBFA 1TK9A 3TDMA 1NQVA 5DYGA 1RSZA 1V4VA 2I1LA 3IESA 3OA0A 4MS1B 1DEHA 4DEYA 3DBOB 3HC7A 2X15A 4N39A 2GASA 2ZWMA 2VJQA 3PQ5A 4FQ8A 5ELXA 13PKA 2NIPA 3KLPX 1QGUB 4B7AA 1BEEA 4HAXA 4YJ3F 3FR7A 3PGMA 2D0IA 2QL5A 3VMMA 3Q0TA 4EVSA 4G26A 1OVMA 3TRKA 1N4DA 3NHPA 2LE0A 2I54A 2AW5A 2WWXA 4JVSB 4WXMA 5F7JA 4JHXA 4IUCS 1HDCA 5KTSA 3F6BX 2UZ3A 2G4LA 5EP4A 3ROZA 2DU8A 4A36A 3OM0A 5LNK6 3K70B 1VPWA 2B8WA 4HAZA 4CUKA 2W4IA 4C1BA 3D8UA 4M0LA 1EUCA 1QGAA 2DHDA 2VPXA 3EVCA 4OQZA 5CLQA 5FA6A 3UWSA 1JQKA 4C5BA 4F38A 2GN1A 2GETA 4NTZA 4RDCA 1JALA 3EIFA 5KAPA 2ZIEA 3ZCQA 3C5HA 1NXWA 1Z82A 1EWVA 2HF2A 2PX0A 3HCBA 1MJNA 1V9CA 4ITRC 2FZ5A 4N40A 1RRCA 2DM6A 4C14A 2I7TA 4JUAA 3GOQA 3GFTA 3NIGB 3WWDA 4CF4A 2JLYA 3KOMA 4G37A 3CTMA 1W0CA 3PVCA 3LS2A 3ZCPA 3H3XA 2VP6A 2B3DA 4NP6A 4OB7A 3OEHD 1YACA 1BHQ1 1JA1A 4KQ1A 5KSOA 5JNLA 4MV1A 2DWCA 1M7HA 3NX4A 1KKMA 4P5EA 5JCJA 1LUAA 3E3MA 3B1ZA 1QRUA 1PRYA 3IBYA 5GWXA 3QLEA 1QWSA 3GPBA 1E6UA 1QWOA 2B36A 2PLWA 1XTZA 2VJDA 1S9HA 4NFHA 4X6YA 5ELLA 3NGMA 5IYZA 4DCVA 3MUOA 4YJHB 1Q1GA 4TMFA 4EG6A 1EBBA 1XRNA 3OZ7A 2P9JA 4W7IA 3CCBA 3LW7A 2HRCA 1A88A 2O5VA 1S4MA 5JBIA 3JX9A 4H7IA 5IM5A 4UE3S 3HXPA 1Y7LA 2EL9A 1R12A 5LVAA 3HLKA 3GZ4A 3ONVA 3PE3A 3HV0A 5HKAA 3TLKA 3AXSA 1XJWA 2FOXA 1ZK2A 4FBGA 1SZCA 2G71A 2HQ1A 3AERA 3LYHA 4TZ0A 3HO8A 1N5IA 3ECAA 3PHHA 5A6SB 3RIHA 5LMZA 5FUVA 5FNVA 3VH2A 2ZKIA 3MF4A 3GEBA 1N2SA 1E20A 5I9BA 3UB4A 1YHZA 3D54D 2C5EA 2NPIA 4LDZA 1XZJA 5B2FA 1WHTB 3PUIA 3TXAA 4QVKA 1JG2A 2OXRA 2YCLA 3OWOA 1W0JA 3HEAA 3IDZA 3OOHA 1XZ8A 1YK0A 3STHA 1RQLA 1ZGGA 4D8YA 2E4XA 3AY3A 1B1CA 1D1QA 1E66A 1I6WA 4P0TA 3R9XA 1BMFA 1CVLA 2P2DA 4DL9A 1NBIA 3SBDA 2FUNB 1D4AA 4Y1FA 1PL6A 1T6YA 1OOEA 1XDZA 2IGBA 3EWIA 4EY4A 2PQ0A 1C29B 4CMHA 1B4DA 3HJFA 3DOOA 3CR7A 2IYSA 1RBMA 3GJ5A 4P38A 2B61A 4EDHA 1GILA 1XFAA 1TT5A 2VP9A 2X3FA 1QP0A 1BA3A 2F1RA 2PUBA 5K8JB 5C8XA 2ZCJA 1U5CA 4KI0A 1KAEA 4TQUS 1PS9A 2ZEJA 1AN9A 1GA4A 2WF8A 1Z6AA 5K0CA 1GRCA 3A4VA 3D1JA 4L6AA 3P45A 4UU8A 1H2HA 2CCGA 3THRA 4R1QA 2HIAA 1T2FA 3QPCA 1HEUA 1DT3A 4LSMA 3GJ0A 4HZUB 1C9KA 2BL4A 3GYBA 1T91A 3GAAA 4LZZA 4UD6A 5DBHX 3P96A 3TLGB 3ZXSA 1XVUA 1TM7E 5JI2E 3QX7A 5T7BA 2ZAMA 1FPQA 2C8JA 1XMQB 4HNSA 1J7KA 3BSYA 1UWCA 4FC7A 1IB0A 3HUFA 3DTVA 5K0TA 3X1JA 1RWMA 4JX8A 2Z4TA 1ADFA 2PR2A 5DNWA 5ERYA 3AQIA 1WV0A 4YXWA 2IXEA 1L4UA 3SEZA 4ARZB 2VHCA 3UUFA 4BZZA 3RSQA 1JWBB 2CLIB 4MIOA 1ICIA 2IHVA 4OYYA 2X8JB 1S8NA 2QG4A 1O77A 2PD3A 3NH6A 2HMWA 4F86A 4L6IA 2FN4A 2NU7B 2G9ZA 3DE5X 5CA1A 3QVOA 3I6IA 1MRNA 3MB5A 4NBNA 4DGQA 2VA8A 1ENOA 1XEXA 1NLYA 3T5DA 2D4AA 4HJRA 1T6BY 3K9HA 4UDOA 5FULA 1LX6A 2X1HA 2PZFA 4MVWA 3FI9A 3C41J 3UUGA 4LHWA 2IEAA 1CS4C 2XD4A 5JYBA 1N3LA 2CLKB 2J4FA 3LECA 1E3SA 2OCBA 3QVVA 2Q45A 3GBPA 3GROA 2VYCA 4GHWA 4B71A 4QG3A 2HMUA 4W8HA 3WLFA 4RFSA 4HPWA 1VKNA 4RA6B 3NBMA 1O54A 4LSZA 1UBTS 4RJTA 5JH7B 4M89A 5IMSA 2ODTX 5LQNA 3NALA 3M9LA 4YECA 2ZBRA 4Z7QB 5JNVA 1ODJA 2OSBA 1ENYA 2XRYA 3HN6A 4MKXA 1F2UB 5M3BA 2YQZA 4FGZA 1W9HA 3FMIA 4P3OA 4XIFA 4IH9A 1H3EA 2O2GA 4L16A 2OQIA 4BS9A 1JKMA 1HYQA 1VJ0A 4D4HA 2FRXA 2RAVA 3PR2B 5EZYB 3RM3A 4OTZA 2IEZA 4MV7A 2Y1EA 1R0LA 2RB5A 4MYCA 2Y4OA 4G5SA 3LLVA 3QE0A 3LT4A 4ARAA 1EI9A 4CQMB 3MTIA 3LG2A 1COWA 2D2FA 3RG2A 1SC6A 4O0LA 5GIOE 2Y93A 2J45A 3DR5A 4LC0A 3F5SA 3KLBA 4I9HA 4NVRA 2N9UA 4HC4A 1U28A 1KAHA 3LZ6A 4JGBA 5E0OA 3WWCA 2RONA 2BI8A 1A8PA 3CISA 3HDHA 3ZCXA 4MVJE 1XZBA 1MZVA 1NI4A 1XDGA 1H0RA 2BLNA 1O6ZA 2DX7A 2HGZA 2Z04A 3DEIA 4MR8A 4MHSA 3X44A 4N41A 3DXZA 1RC8A 1Q15A 3RC1A 1EZ1A 1LLCA 2JAQA 2QQFA 1TYAE 4MKHA 3ZHYA 5JAOA 3P97A 4F7WA 4U4AA 1RCTE 4XWTA 4INOA 5A5GA 5B7NA 4F1JA 1XCLA 2YMPA 3ORFA 3Q9NA 3MFQA 2WHYA 4N18A 2GN6A 2H8GA 4Q1FA 3I5XA 1U90A 2R6FA 2XSZD 4AUNA 4IIYA 1GSOA 1BXKA 3TNFA 4LVCA 4HQNA 2IV7A 5IU6A 1BE8A 4HNQA 4KXWA 2WKPA 4XE5A 1U3DA 3HY3A 1T9DA 4JI5B 1GNLA 5SY4A 3KPYA 4N7MA 3TNDA 1FDWA 3QWIA 3QEOA 2PMEA 5KYWA 1U7OA 3OOSA 1RMQA 4S2UA 3ZUPA 1CFJA 1PSWA 1BW9A 3UG6A 3IAUA 1VRCA 3JTMA 5J9FA 2J85A 1U11A 1TL7C 3GPLA 4JI1B 4KL8S 2D3WA 4BNXA 4ZJYA 4DCOA 5A3QA 1Q0RA 1P0CA 1S2DA 2CBXA 2D54A 2H48A 2C7OA 1CLUA 2H52A 4F56A 1L7RA 4MCIA 5EUMA 1TAGA 2YC2C 3FSRA 4YJ2A 4PRLA 5IUJC 5ALOA 1Y8RA 3T1VA 5BUSA 3GIDA 2X7XA 3PKJA 1NE7A 2FSFA 5FORA 1JEOA 1HC7A 4FYWA 2GXAA 4BNVA 3VJMA 2BV3A 3PNSA 2EFYA 4WOCA 1W8IA 3FLMA 4ALIA 4Y1RA 4G8BA 3ICOA 1Z2DA 1GNSA 4NY1A 4YMTA 4YAEA 3TNLA 5E6RB 4CEHB 3WLMA 4GYKA 4CKYA 2QTZA 2PXCA 1CE8B 2FMXA 3BSWA 4M76B 3V3KA 2H5LA 1KMCA 4XDZA 4CF5A 3QEBZ 3D6NB 4MRNA 3F96A 2I2AA 1T4MA 2NSJA 3OMWA 2PL5A 3U3DA 3ZNOA 3DT8A 3SSNA 3D4NA 3QMPA 1JAZA 1WMAA 1O95D 2ZBDA 1RBZA 4N49A 1X74A 5G53C 3IA2A 1QHYA 2FLWA 2PGIA 1IYZA 2YINC 3QHAA 1W5EA 4NBLA 4RJLA 3RAGA 3AWIA 5IJ0B 4U2CA 2MSCB 4K8RB 4UTRA 4O2RA 3U4HA 5JXHA 4B6FA 4TX1A 1F8GA 4TLLB 2KBEA 4JC4A 2F48A 1QHIA 2DLDA 1VMEA 1ESEA 1F14A 4GDFA 2VFAA 4FDLA 4PZCA 4MUBA 3U48A 2Q46A 1QP8A 1QS0A 3WB1A 3C6MA 5KZMB 5AW7A 2LKCA 1H69A 2XUQA 3WLIA 2OY0A 3H16A 2E4AA 3T9FA 3OEYA 3NDBB 2BHNA 1ADGA 3Q8MA 3KJZA 2WF6A 4BTLA 5F21A 3C3XA 3E0QA 3FR8A 2PL1A 3NHYA 4EJ6A 5IZCC 1FUUA 1AO0A 2XHZA 4QNMA 5G40A 3DL4A 3FCYA 3QOFA 1PP4A 3V34A 4B34A 3AHEA 3PUJA 1QRSA 2V4MA 2XB2A 3AVUA 5ALFA 1YQWA 4EYQA 3K20A 5BYKA 2Q5FA 2XDQA 3BWEA 4INJA 4RH3A 1JVSA 1KAOA 2AFHB 3OIGA 2B4RO 5IKPA 1W48A 5CD9A 5TARA 1DUIA 3O95A 1T1GA 4M88A 5DGXA 1V5FA 1DADA 2J5RA 4FFNA 4FINA 4LZLA 3JAWB 4KOEC 1T9CA 1RXEA 3IJPA 3M6UA 3BCHA 4F3YA 3A9RA 1EFAA 1N2HA 3NHRA 4NC9A 1L5ZA 2CZGA 2C98A 4KQFA 4WZBA 4IKEA 3QMWA 2WI8A 3WO0A 1O8BA 4X94A 1V3VA 3S68A 1XRJA 2D5LA 5I7EA 4QTXA 5JV5A 2DUWA 3HXKA 5G4KB 3F1KA 2DTXA 1ZYUA 3KDPA 5SY6A 1SPBS 4J4TA 4OSOA 2HMVA 1LDMA 3EEOA 2XMQA 3REQA 1DB3A 5IC6A 2FSUA 3NU1A 1E9AA 4ZQGA 4XI9A 3I0MA 4K9SA 2JRCA 3EPLA 5DB4A 3UENA 4A2QA 3GEPA 4U6QA 1H0KA 4WNCA 4BASA 4AQYB 5CAEB 4NV0A 3OPYA 3HA5A 4MW0A 3GRZA 3RVKA 4S04A 1P61B 4IW3B 5FD8A 4JCCA 1J49A 1K63A 4QFMA 5LOVA 2YW9A 4K9LA 1DWOA 4XUGB 3NATA 3UOWA 4C0LA 4MLCA 2HWWA 3N07A 4TQGA 5ENZA 3TRHA 4EJSB 2I6SA 2CK3D 1R9GA 2Z0MA 2BBTA 3O2NA 3W6OA 1NG1A 5A9TA 4FUTA 1HQDA 4OG2A 3FGPA 2FR0A 3R8CA 3SFTA 1A69A 2CHVA 2A86A 2GK3A 5IEBA 4YUYA 2QTFA 1PJBA 4TKUB 3U61B 4ALMA 4LOHA 2AR9A 4GRIA 1T6XA 2RGUA 2Z3VA 5K8IA 3H9QA 1DKOA 2HK6A 2V8BA 4MWDA 4L4UA 4O2AF 1W9MA 1G8SA 1JKXA 1TX4B 3E22B 4D9IA 1JYFA 4RTLA 1WF3A 1E59A 2OXEA 3GQBA 3NDPA 4LXXA 4K6OA 4P3KA 4WJLA 2P2GA 5BW4A 1UIRA 1OKKD 5I7WA 3SLKA 2GGSA 3TUIC 4KLCA 3K31A 1RM0A 4CODB 4J0GA 1XAIA 4FPXA 4KR3A 3L7NA 4KREA 4ZOQI 1C0KA 1R4ZA 3MT7A 3H13A 1XEWY 4PCVA 1SBIA 1IAQA 1ZOOA 2B7BA 1X94A 2ZYHA 4Q3NA 5E0KB 2R00C 2ZB2A 3P2JA 4HGPA 5JUWA 2EX4A 3O8OA 2WEKA 1YL6A 1QM5A 2XW6A 3KS9A 3VO1A 5FP0A 4BMDA 1M6VA 1Z75A 1AV7A 4D41A 3B48A 9LDTA 4LX8A 1CQZA 4MIYA 3S3TA 3UMVA 3IMKA 1JPUA 2XUZA 3MGKA 1QP4A 5DULA 4CEJB 2DKFA 2AOXA 1IHXA 1R5OA 5KWSA 5JQWA 1QJCA 3ABSB 3FYUB 1U0TA 4B2LA 5HZMA 4B3TB 4KPYA 3V8MA 3L8GA 4HNAB 1QANA 1OB2A 1O6FA 1VYUA 3KJIA 3SVZA 5JFTA 2AMVA 2E48A 2R85A 2W2KB 3E61A 1O58A 3I5MA 4WXYB 5LZ5A 3SG0A 3HNRA 3QE2A 3SS8A 3VYUB 2P35A 3P2MA 3QVXA 1YJCA 3OPQA 1GKYA 4X1OA 1GZHB 1W36C 4FFBB 4BO0A 3M82A 4A3SA 3JWPA 4AYWA 2FE1A 2QUBA 1Y3FE 4OXYA 1B0UA 3S99A 5JRJA 2XCSB 1KMQA 1T8SA 5CVUA 2KB0A 4TWZA 4I1IA 1TA9A 1MN6A 3UJ3X 1D03A 1R7RA 5KOHA 4LNHA 1OTHA 1Q17A 2E6UX 3PFHA 3QVGA 1Y6GA 3DR3A 2BFDB 1WHSA 1TVMA 1GTJ1 2H3EA 3QG1A 4ZRNA 3F6CA 1K0UA 5H68A 5K0BA 2R6AA 3EEFA 4JAVC 3LDHA 3OFSA 1MIOB 2Y92A 4R1NA 2GT1A 4RKYA 4G5OA 2ADMA 2W8BB 2I8AA 4KPFC 4EY5A 1M0TA 3PDUA 2ZU6A 1XFDA 4GX0A 4A8PA 4DBLE 3FW1A 5IHXA 3FOFC 2AD5A 1J33A 2G1PA 5E8JA 3D6UA 3EJ6A 5D5HA 1PL7A 2UKDA 3VZCA 1WXEA 3AI1A 1NVFA 1M9NA 1NV9A 1RPNA 4D3FA 4MEAA 1E2DA 3N58A 3WL5A 1RPJA 2P0EA 3LY5A 2WINI 2GB4A 1Z7WA 4IOLA 1R88A 4MLZA 4B85A 4DA8A 2V74B 2QQ0A 2R6DA 3EXHA 3EZFA 3GJZA 3I64A 3ABRB 1L5FA 3CZCA 3H9JA 3L46A 1Q3HA 5AJUA 1I94B 3PC3A 1O0CA 5AK0A 5HE8A 2AHOA 2WU1A 3PICA 3DOHA 4JI2B 1JDSA 1UCFA 1TYBE 2HTFA 4NLLA 3UWMA 1FF9A 5HG0A 4CMIA 1UBFA 2ZTMA 2GUWA 3KEMA 3PUWA 4INPA 3RS2A 4BNIA 2F8SA 2OXIA 2NYAA 2XXBA 4AYTA 5L3QA 1IN8A 2NT4A 3BZUA 2XZPA 4J3FA 4BCBA 1OY1A 5BWBA 1LBQA 4DQDA 4CFZA 2QS9A 3IPYA 4ID3A 5GP1A 4BLOA 1DJMA 2ZJBA 1ZSYA 2CXUA 3DOJA 3ILYA 3MQ4A 4XQGA 4NABA 1L3CA 2P3OA 3QKSB 5CVEA 5HIMA 1U8UA 3LVFO 2PEYA 2WAXA 5CU7A 1E69A 4ROSA 2PJUA 1E6KA 2EGGA 1FP4B 2OAGA 1N7JA 3H4TA 1VTKA 4KOAA 5DTRA 4KKXB 3W3AH 4AJIA 5E1BA 4OREX 1X7HA 3F6YA 1I7NA 4UE2A 4HR7A 4IZ6A 4WD3A 3WRYC 1ZOIA 3VYRB 1QDUA 5J23A 1T3ZA 3RQSA 1CRZA 2D2XA 5D5QA 5EJ6A 1T34A 4IFIA 4ILEA 2V7QA 3K0HA 1OTXA 3A6ZA 4K9QA 2B3TA 5A02A 1SEPA 1GR0A 5JAPA 1PQPA 3F5QA 2A1UA 2EDCA 2H4YA 4BNNA 1W96A 1YS4A 4J2OA 4BKPA 5FDFA 3VKGA 5H82A 3OOEA 1KFBB 1ZICA 1C7QA 3NT4A 2HSWA 5CH5A 3HCRA 3RV3A 2QMZA 5BQ3A 2P11A 4GICA 3H4IA 3AVVA 3TK1A 3UFXB 3EEBA 3KZKA 3OQJA 1WMBA 4BRWA 4YPOA 3KKMA 2IZ6A 3PKZA 1JU9A 4EECA 3TXYA 1Y1TA 2AJDA 2DT8A 4A27A 4QJIA 4RSMA 1VJDA 5AJZA 3LT2A 4BVKA 2PSSA 1DAFA 1PGJA 1VLLA 5A4FS 4KFSA 2GPTA 4E1AA 4DRXB 4ZA2A 4BMOB 3MSXA 3OFND 3GGOA 2QEQA 3JASB 4BX2A 1U6JA 3PEYA 5IJ9B 1GQYA 4N12A 3SF8B 3NRCA 4FR5A 1YMQA 1NIPA 2UVPB 2BFOA 3B1KA 4DLXA 1MX5A 3F7MA 1XZAA 4FKZA 3SHWA 2C57A 3G82C 2X6TA 1J6UA 2XPCA 4I81A 1MO4A 4DWWA 4OQPA 3UKOA 4DSNA 2D8AA 2KW5A 5AQ1A 5JNSA 1TVKB 4P6VF 5EJMA 3HKEB 1TA4A 1KMNA 1N92A 4Q7JB 3GRAA 1DT5A 1JH8A 2WWRA 4B6GA 2NXEA 3T41A 4OHYA 3HFGA 2AX3A 3ZW7A 3BIFA 3RVQA 1PNQA 4BAGA 4XCQA 1MOQA 4AJKA 4EMSA 1TUEA 5F1YA 4XYLA 2W42A 1RJDA 1Y7TA 4S1VA 2W6ID 3TPZA 2VTEA 3H97A 2BFBA 3V32A 2NSDA 3KUXA 2G8LA 2GEVA 3LCCA 3ZIDA 1MB9A 1E1YA 2H18A 1UMBB 2Z8YM 4X8LA 4DIOA 1E3DA 2JCSA 4U9IS 1WIWA 3DAOA 4KE8A 4DARA 1TJPB 4DSTA 3F9IA 3BZBA 1HOTA 3ZPXA 3KR1A 4JLDA 1J8VA 2RIRA 1TLFA 4JI0B 2J1LA 1PR4A 5DYYA 3ZWDA 1DG9A 1JEAA 3FH0A 5FLXA 4ZODA 1XXHE 4QOFA 5FOSA 3AUFA 1GV1A 2WD7A 2J30A 1CJUC 5FOXA 3MTDA 4J1TC 4GWGA 2X40A 5FJIA 4YDHB 5H9WA 4G1FA 1H2BA 2EX0A 4R81A 4MUAA 3W8DA 4TVSA 4F46A 5IF9A 3TIIA 1XXHA 3T4UA 5I9TA 2F3TA 2WIFA 2L17A 4RW0A 1J09A 1OZFA 2IPMA 1O7JA 3CVOA 1A5AB 1SXJC 1PS0A 2HV8A 2ZVPX 2GD2A 4PZDA 2YWRA 2ZIWB 2GMWA 4R7GA 5JBQA 1Z25A 3RADC 1FDTA 1TADA 2GI4A 2J0UA 2C7RA 2YNMC 3HCWA 5AKZA 2HRBA 2ZRAA 1DSSG 1YQXA 3L07A 3NKVA 3DMTC 4B45A 4CKXA 5A3SA 3JZDA 1OIWA 1PFQA 4X1KB 4D44A 4B8ZA 3GZTB 1GYRA 2PHZA 2W0SA 3ZGXA 1KYZA 1WW3A 1BHO1 1ZS9A 2YN2A 3G6WA 3PR1A 5P8WA 2D7DA 2DSTA 2J6HA 3NVAA 1OREA 1XVLA 4N3BA 4US2R 1NN3A 3RU2A 1GXSA 2AIRA 1RPAA 3VXKA 2Z8XA 4OQFA 5DM4A 2ZLBA 1PDWA 5B4TA 3JQ6A 1ZCJA 2WWWA 3N7AA 3P2EA 3AU9A 2ZGVA 2ZP1A 1JHQA 4ZI7A 3AEQB 1IIRA 1DRUA 3WWPA 4A2WA 3PXGA 3QFTA 2VKQA 1W4BA 1XKLA 2O20A 4IJWA 4U0KA 4KYUA 4HN2A 1RXCA 4MPJA 1RJGA 2AW3A 4BZXA 3D43A 4IINA 4HMOA 4AJOA 3AIOA 4U2KA 4WPGA 5IZ4A 2UV8A 2XLBA 4BDSA 2KBFA 2OBLA 4DYVA 1QHSA 1UBSB 1G21A 4L07A 5LJIA 1N8NA 4QYIB 2XIQA 3W3ZB 1KETA 1T5SA 5T3YA 4JA2A 1EGMB 3TD9A 1OFVA 3WKCA 3ZXIA 2ZT7A 3TQTA 4R8RA 1KH3A 3ELYA 2C0PA 2JIQA 3OTQA 4UHJA 4YUVA 4CMCA 1IDOA 1YNOA 4DUZB 3OI7A 1HL7A 1MOPA 4NXNB 1BCSB 4YAJA 1EK0A 3NBZC 5DI3B 1W7AA 2Q9UA 4F04A 4YMVA 2IXAA 4G3XA 3VRHA 5G0TA 4CM7A 3NKLA 3EXEB 4DMMA 3FJ1A 3COZA 4XASA 2VYFA 2CF6A 3MS7A 4K1LA 1OLSB 1ICEA 1QRDA 2JD1A 2Z9DA 4L2IA 1XVVA 3B53X 3FIUA 3QUBA 4WQMA 1PSZA 2H1IA 3L82B 5A4MS 1DBQA 3LUBA 2VCYA 4QU0A 4B7CA 1EH5A 1KDOA 3RIXA 3AV3A 3H9UA 3E9CA 5F33A 1DU4A 4OMUA 1RKQA 4DQXA 1KVSA 1XD2A 4CM1A 3U4DA 2BGIA 1OYWA 2GZ3A 4PG6A 5DKFA 3RH0A 1HNNA 3TAHA 4B0PA 1MDFA 5LQDA 2IH2A 4O2AB 4HWPA 4CM3A 3LY9A 4GVLA 2XMBA 1MPTA 2JIZD 2IEYA 5M04A 3UGJA 2O8FA 1H6BA 4UARA 5D1HA 1D5WA 1TA0A 3D4OA 3NC1C 1P4SA 3KTAB 1MA0A 2TYSB 2CY0A 3RWMB 3VHRA 4Z5XA 1KEEA 5TS3A 3K1YA 4WZAB 5F2NA 2WM3A 2VJMA 3F3MA 2AK3A 4FEEA 1VDZA 3E18A 4BVJA 4XX0B 2PJRA 5DM60 4FIZA 4ZJUA 1CIVA 1RAEA 1P0PA 2NZ2A 2X3UA 3HM2A 3WGJA 4HDMA 2FMFA 3BEDA 3FETA 1MEEA 2I62A 3EMBA 4KPUA 2XE7A 2XNJA 5EPUA 2B92A 4ND1A 4M1MA 5B7GA 2VRNA 5CLJA 2J3QA 3KAJA 4U2EA 3B6MA 5KJ6A 1T35A 2OB1A 3NEPX 1IC6A 4Z0HO 3UMSA 4KMSA 3DXXA 3RF6A 3PUXA 3TCXB 5G02A 2Q3EA 4WXRA 3K6SB 1EUZA 1PJSA 3RRFA 4AS2A 1G9SA 4LXUA 4Q9AA 1DX4A 1X13A 2B6NA 2I1WA 3ZU2A 5EJ4A 2PFKA 1OI4A 1YDMA 2R6ZA 2SKCA 2WWIA 4D8UA 4DLYA 5BOSB 4AC9A 4FE7A 1C8LA 2OQ2A 3H1PA 4DV2B 2BVNA 2C1XA 5F52A 1ZA2A 2ZRJA 3RVOA 2J3MA 2OEPA 3OJEA 4FGWA 4GI1A 3SLRA 3GLIB 2GBGA 2P7HA 2DHQA 3LT0A 1PFGA 4EO9A 1DRVA 1PZEA 1IQRA 3LBHA 2QRHA 5CIWA 3VHLB 3FKQA 2OHXA 3IP9A 4UCFA 3IKMB 4CF7A 4N47A 1XQXA 3ND5A 1DAOA 4MQBA 2WTNA 5K0JA 1A8IA 1P77A 2PBRA 3WGHA 5IT5A 3UANA 2BFAA 3J81A 1KZYC 1WP9A 2WJYA 3V7NA 1YVEI 5ALZA 3GV0A 4GPEA 2E18A 2D5BA 4X6XA 5GZ3A 2RE8A 2QRVA 1VYTA 1TK2A 1HF3A 2HREA 1D2AA 3N8KA 5BSRA 3RVDA 3IPAA 1F0PA 3NUQA 3K2EA 4QOGA 4AW9A 2WUEA 4HEA1 3O8CA 3RUAA 2BZ1A 2VDJA 1NJ6A 2HT6A 1OBCA 4RNCA 1JKJA 2P75A 4GGPA 3D5TA 2JRLA 3GJTA 4II2A 1LV8A 4N7BA 1IG0A 2YZGA 1Q50A 1UM8A 3NH9A 3VNRA 5L7WA 2VWHA 3JATA 3GMDA 3LP6A 5ERXA 4HDRA 4DCSA 4E33A 1KQPA 4LY9A 3V42A 1PEDA 3WC4A 1L1RA 5AQEA 1K27A 1ACMA 4O33A 1XALA 4IHJF 4Z2AA 3IKVA 2UYYA 4LHZA 4LRWA 1BVYF 4J2TA 3U62A 4Y2YA 3MWEB 4HH3C 4F3KA 4GWLA 1ECFA 4D79A 1DQYA 3BBLA 1SWVA 3EG5A 2J9YB 2YXLA 3KVOA 1VHLA 2ACKA 4L9SA 3TZQA 5K3EA 1U04A 3ZDAA 1IPEA 3NM4A 4M8NE 1X8LA 3AF3A 4OHOA 4GI2A 2ZK7A 5DWQA 3I6BA 2G36A 2ZM6B 1NVDA 1BRTA 1ZM3A 1XP5A 2XYHA 3JQPA 1RVV1 5C4IA 2QENA 1UL1X 3HCAA 1SU7A 3SLGA 4JLMA 1K6EA 4DT1A 2IDKA 5HIKA 2P3SA 1BE6A 1SKYE 3PHBE 1T9BA 4DYDA 4C4PA 4BXOA 2FLKA 5ESRA 3UQYS 3OEED 3T0FA 3PA8A 3IO3A 7MDHA 1D4OA 3JAKA 10MHA 4NE7A 4EUSA 1I4TD 3UWKA 4B6RA 2JFPA 1FFYA 1E3IA 4R1TA 4EPXA 3Q4GA 1V7ZA 2G08A 3GJYA 1H2ZA 3HB1A 4PZAA 2Q50A 2JGMA 4BMNA 1EGQA 4HXFB 2H7YA 4Q7MB 3IODA 4FCWA 1EFDN 2QE7D 2H1HA 5HDQA 2YWHA 5HDBB 2C2YA 4FWBA 2VQFB 4MS1A 4G4GA 5BW8A 1X1EA 1YA8A 1Z4LA 4YK7A 2V6BA 3AP3A 4WLNA 1QGUA 1KVUA 2Q2OA 4EPRA 1U99A 4YGXB 3FWKA 5HIAA 1DEOA 4H7KA 5JY1A 5J1SB 1DO8A 5IM4A 3ZDXB 4GMXA 3ZWMA 3VJRA 1GR1A 3HCOA 5JVDF 1GNPA 3I5AA 3DM9B 4RA9B 5MGBA 4DLPA 1AOXA 5J1TB 4DR5B 3MWDA 1C3VA 4TSFD 1MW8X 2ZITA 5SZIA 4MYDA 4WCFC 4H4CA 2ES4A 1X19A 1Z5GA 2F62A 2HRDA 3VPHA 1H94A 3WGGA 1U2SA 2JL1A 3PL1A 3AJDA 2WHEA 5FL3A 4QM6A 1UJMA 2ZBVA 3DEZA 2IC5A 4NFYA 3FDFA 4I50B 3T5MA 1MX3A 5MN4A 5C8YA 4PXSA 3TTWA 3VDNB 1F6DA 1KMHA 4GLLA 1NI5A 1S2IA 2NXJA 3DT6A 2E5LB 3O90A 2OLEA 5WRFA 2HPVA 2BGNA 4GXTA 2CNLA 1KFKB 3B1FA 4GUAA 2GZ2A 5DLYA 4MA5A 4GOOD 3W8FA 1Z3IX 1X2BA 1UBNA 3OJFA 1JEQB 1P2VA 3CSDA 1MT0A 3GNSA 1FUEA 3OC6A 3ICCA 4J8PA 1NVKA 1XN4A 3I9JA 3UHOA 2REBA 5AHXA 3D6JA 5FWNA 1WB9A 1ZR4A 3RI3A 1Z4JA 5AW4A 2NAPA 3PVZA 3TKLA 1MOSA 1QF6A 3RYFB 1DUSA 5IVKA 1SCQA 1ZUNB 4YJHA 3VO2A 3ZU3A 1WKCA 3DHNA 2JIBA 1EE1A 3QF4B 4KGDA 4ZAWA 1PV1A 3K4HA 1WE2A 1ZW6A 4UU7A 3V4SA 5K7SA 2AI3A 1N7HA 1W0KA 4DB4A 2G9RA 4NU6A 1PZGA 4QUJA 1A76A 2DUMA 2H08A 2MMCA 3KQYA 3H9BA 1KDTA 4PINA 4Z9YA 2CJWB 2OKGA 3DCNA 5C7YA 2PH5A 3MWFA 4QAQA 4G5XA 3JSXA 4FKMA 4GI3A 2D1SA 4FUQA 4P3PA 1L5VA 2XI4A 3KU4A 1GZSA 3K9CA 3OIYA 4JNKA 4OB8A 4TMYA 5JZ9A 1E2KA 2IYTA 3SJAA 3H1AA 3H6GA 2AG8A 3T3PB 1FLVA 1FRNA 3KXKA 4RSHA 1N5OX 3M6FA 1HY3A 2D1YA 2H2GA 4BJ1A 5LB2A 1WW2A 4L73A 4DUGD 2JJ8A 3N86A 1DS6A 3ENZA 1FOEB 3W5VA 5A6VA 2FMUA 4XGKA 2QU7A 4MQ5A 1NJ5A 2AEFA 2GBLA 1NNUA 3ZBUA 5K6AC 3CZPA 2ZWOA 3KJQA 5J40A 2GD0A 4QOHA 2B9VA 4PG8A 5D3MB 3GPDG 3I6YA 2Q3HA 2YV5A 1OH7A 1L5YA 2RCYA 4IXMA 5FRDA 5T8KA 3N5CA 4C76A 4DV6B 2ADFA 8GPBA 5BR8B 3QH4A 4J7CA 3W2HA 1XRPA 5JEDA 3HUUA 2P77A 1Z07A 1K5PA 3GD7A 4JGIA 1MUUA 3F74A 5FLYA 4WCDA 2COKA 2AKYA 3C7TA 2A8YA 1J70A 1Z5NA 2PX2A 4DA7A 1HSOA 2FDCA 1M6WA 4V0QA 4YBZA 1PG0A 3ZDDA 1P5RA 2XCUA 1UPCA 1GLGA 3X2SA 1N25A 2GYVA 3KP1A 1QK4A 5A5VA 4CHGA 4LDNA 1CU1A 3DBLA 2YVAA 4I1YA 1U1DA 2Q4BA 4OSPA 3NHJA 4CETA 1GPNA 1WTAA 4Z4GA 1MQSA 2DFLA 3CMCO 3CX7A 4G9EA 4I99A 2QD2A 4BLPA 1HOXA 2DWUA 1L4GA 2L0XA 3HP4A 5CT5A 2DBVO 5B7PA 3I72A 5EIEA 2NT3A 2R8YA 1PYDA 2AUMA 4ARZA 1YE3A 3UPUA 1TYZA 4I1UA 3OP4A 1NBME 1ODIA 2P2NA 4PY2A 2XE6A 4AWAA 2X8JA 4TRMA 3ITDA 2WSLA 2XZLA 1NNEA 1YDEA 5AJYA 1EG7A 1DEKA 1ISMA 2NU7A 3RSZA 4HP8A 3E9NA 4NE9A 1NBMA 5I8PA 3CZQA 4UEJA 1KIMA 1VMKA 3PQ3A 1UJ5A 5BV0A 1N77A 2WHQA 3K0EA 3COJA 2VSQA 2OZPA 3JD1A 4ZU6X 5AKEA 3W5DA 1VJ5A 4F4UA 1QUFA 1ZNZA 3LPMA 3B7WA 4AURA 2IP2A 4C0HA 1JQ3A 4UEQA 4WXPA 5KWVA 1WKVA 4EYKA 4EFNA 5FBQB 4MNTA 4MV8A 4EKYA 2IDZA 4GMGA 1EZZA 5T4EA 3WBFA 3WMFA 3PRJA 4MQ4A 2NV0A 3T1TA 3RSCA 1IJKA 1DJQA 2ZIGA 4LIPD 5CB4F 1O89A 3QPVA 1OXXK 4RL4A 5LP6F 1F2UA 1H4SA 4ISCA 1QLWA 5AIBA 1XPRA 5JDIC 2ZFUA 3VDQA 3LDAA 3MLEA 4DAEA 2Y2VA 3FZEA 1G59A 5EZYA 3GLGB 1Q84A 1ZSNA 4XAQA 1U5BB 4AMVA 4II7A 3MJEA 3VTKA 3PJGA 2Y1CA 1TCAA 2OCPA 2YWXA 1O9GA 2C04A 1CJVC 2HJVA 3R7FA 5B3LA 4EX7A 4XTRA 3KETA 2EWMA 3ZWNA 3D8RA 1OH8A 1S4QA 3LWNA 1YCDA 5HS6A 1F3LA 1BWQA 3JVDA 2TMKA 1AF7A 4LGVA 5KNLA 2QTWB 1IVSA 2J0VA 3V8QA 5F9MA 2OT3B 3ZW8A 4ZT2A 1LJLA 2WKSA 3AFMA 2CL0X 2JKVA 2XB8A 3EXFA 4HEJA 4KV7A 3KOUA 3LWZA 4B3RB 2POCA 2R8XA 3HA3A 5DGIA 5TMPA 4XARA 3D3QA 2GPYA 1JS1X 4NJOA 4QGHA 3WLSA 1EX7A 5A6SA 3EQ6A 3KRTA 2OYSA 1N7GA 1NLMA 3KSMA 4TV8F 3E7WA 5GADl 4EGSA 5BUCA 5PNTA 2ONJA 4B5KA 3OSUA 5AD1A 4R1SA 3WHKA 3O9ZA 3A3OA 5K4GA 3EUAA 4JQYA 5TQJA 5IXYA 4EHNA 1RYNA 4EKNB 3ZWQA 5A1TA 3P71T 1R74A 5LCXA 2E1RA 3VU9B 4JH0A 1JEJA 2I65A 3S2EA 4R71A 3EZ6A 1XDUA 4Y3UA 3NOQA 3AI3A 3C5VA 5LDGA 5B6IA 1YKSA 4UEWA 2I3AA 3HKCA 3M4ZA 1TXGA 1SULA 2HQRA 3THXB 3EXIB 2YXBA 1SKQA 2VHXA 4IVNA 4N5HX 5BVGB 4RYLA 4WK6A 5TX7A 3AEKB 1CPYA 2ZUTA 2ZUBA 4MV9A 2BGWA 1O94C 1DAHA 4LJ5A 3GO4A 3M5WA 4P82A 4RE5A 4WUTA 1JJIA 5CEFA 1L5HB 3CT4A 4BQOA 4JR0A 1KDRA 2ANBA 1BU8A 1OVGA 3KYJB 3T0IA 4BVEA 2JI8A 4M86A 3M34A 3OZCA 1KS2A 2WV7A 3MERA 3RU3A 4CFSA 2W2LA 1CY4A 2QK4A 2NAFA 4G0MA 4WH0A 2WU0A 4B4KA 1T3HA 1P7CA 1YJXA 4B4VA 1LD3A 1P6XA 5B6PA 1JR4A 5BMVA 3H5LA 4L4SA 1SCUB 5LA6F 2WYUA 1JDJA 2O3QA 4I7EA 4EM6A 5DT2A 3QVWA 1CE8A 3KAPA 3OLVA 2XDWA 1Y33E 3KSZO 1HURA 4B33A 1Y8QB 3NVKI 1I24A 1UXHA 3K1AA 3OF5A 1EUDB 4QWMA 5DTMA 2CB0A 4P92A 3CXRA 5LP6C 1MIHA 3WGVA 4HV4A 4DV5B 4HTFA 4YV7A 3FTEA 1K3UB 1VLJA 4GI5A 1I6MA 4AUMA 4PC2A 1LLFA 4M1OA 5EQTA 1SC9A 5JADA 1QHHA 2Y68A 1IBMB 3EWAA 3KG2A 4DTCA 4A5SA 1NASA 3L0IB 4OJKA 2B6HA 2VTBA 1NY6A 2PXAA 4ASUD 4FS3A 5JNUA 4I2NA 4RDIA 2W7TA 3CNNA 3JPYA 5K0NA 3FZYA 2DUUA 5IKMA 4XVUA 4GYWA 3INRA 3CEPB 4BAZA 2JFQA 4ZRMA 3IVCA 3MT8A 4FXPA 1NXVA 1Q1ZA 2PXXA 4HD8A 4C4RA 4MUHA 1E3LA 4BBAA 2A0UA 2GQ0A 1ZAKA 4NQZA 2IYRA 2ZI5A 4EGJA 5FPSA 4XQ9A 4B43A 2ILTA 2ECFA 1SOMA 4XIYA 2H17A 5TS2A 3AHGA 1BJRE 3VVBA 3FVRA 1IUPA 1SU8A 5EHXA 1VP3A 1JFFB 2FFAA 2GEUA 4FLMA 3VR2A 3ISJA 4ZCLA 1MB0A 5IAKA 3GRVA 4MI6A 3PC6A 1QQ6A 2OOKA 3T7JA 3LKVA 4Q7KA 3PNMA 4KKVA 5IJZA 3JAWA 5AI5A 3ROEA 2NU9B 1LPMA 2C2ZA 1FDUA 4F4CA 2HXGA 3BRQA 4I5IA 3ZGOA 4ZEOA 2D5CA 1C7FA 5G4KA 3VTZA 2W6PA 2H1VA 2VRCA 3U3MA 1LSSA 3KJNA 5DJ5A 3AHHA 2GZHA 3LUGA 5CT9A 4YT5A 2QPOA 1KDVA 2JLVA 3PFFA 5D6OA 4X3CA 2WYIA 5CFOA 2XQKA 2ZE7A 5CK4A 1ID1A 4LOKA 4NZYA 1SO8A 2AN1A 3ABOB 1ODFA 1R00A 4LNUA 2BMFA 4X64B 4CKCB 4E51A 2DRIA 5FBHA 5CAEA 4ZAYA 1U1EA 2FWNA 5DVZA 2RJOA 4BNFA 2C1ZA 5NULA 4Z7JA 2BE9A 4F3TA 3PNYA 1TK3A 4F9TA 3HU3A 1H5NA 3T7KA 5J4YA 4RY9A 2A1IA 4QT4A 3OUZA 4C7OA 3GH3A 1Q7GA 3RFXA 3W1EA 1GM5A 1JVBA 1A1VA 2IF0A 2C8VA 4EJSA 5C4GB 2JCGA 3S1SA 4IBOA 3FUUA 1F6BA 3MTEA 1VYVA 2XMPA 5FTNA 3F1LA 3ZKWB 1OJ7A 3RF7A 3I45A 1N32B 1E61A 1JLRA 1GGEA 1PZNA 2IUTA 2ZWPA 4BQNA 1FJXA 4LRYA 3AM3A 1IM8A 1P2FA 3G5TA 4KYIB 3KKKA 4R83A 1SKAA 5EMLA 5T4FA 2H0AA 4NOLA 1X80B 1UM9A 2VCEA 1QVRA 1O5TA 4KXXA 4UNRA 1VG0B 1VCMA 5EXXA 4ZDJA 3C7DB 1US8B 2V9CA 3F46A 3OTWA 7MHTA 1XJCA 1FJHA 3RHFA 3OMLA 4TRNA 1E1MA 1C8KA 2UZIR 2D74A 4KWIA 4UUOA 1JQLB 1XRSB 1T8TA 2P40A 4MWSA 4AROA 3Q9UA 3S2UA 4LDAA 4I4LA 4RF3A 1JF8A 2BIFA 1SZPA 2ZE5A 3TEMA 5AOAA 3VC7A 1Y4UA 1JW9B 1Z4PX 2AN9A 2HPAA 1ODKA 4X1IA 1T1EA 3EBPA 1OBOA 1PW5A 5EKTA 4DANA 1UEIA 2GHQA 4R8LA 4HLNA 2P27A 3JQAD 2BY4A 1AUVA 2DHCA 1UADA 4I4CA 3IEKA 4CL0A 2JLAA 4JYBA 3ANXA 1GCAA 3P0HA 3AR4A 3ZTYA 1C9NA 3E23A 5AUQA 5JZSA 1M6NA 1SG6A 2J46A 1SXIA 1SHLA 2C5SA 1P5FA 2VG8A 4HNAA 4A26A 1SHKA 1ZNWA 2A57A 1WXXA 3H2SA 2Q7OE 3LT1A 4W7HA 4U3JB 3P5BA 2ZXUA 4HDNA 1CHDA 3KV3O 3T3IA 3QTLA 7GPBA 1HH4A 1Z5UA 1H23A 1AF4A 1EM8B 1ZH0A 1U4SA 2QIPA 3OVMA 3R41A 2FUG1 4JLSA 1SB9A 4RF5A 2I6GA 3BM5A 2GZAA 1A82A 4LXQA 6REQB 5ERGB 4IIJB 2GZMA 1KKUA 1U8AA 1SY7A 1R8QA 1T10A 1GTVA 1NOIA 4BLTA 1ZX1A 4P98A 4UUNA 5JSYA 4BMVA 5BT9A 1GG9A 3GNQA 5KBYA 3DEHA 3GLHB 1J25A 1FNNA 4K9PA 7YASA 1WBBA 1F0YA 2FRVA 4IGKA 4YLGA 4QBTA 3V9PA 4S12A 3PU6A 4EP1A 1SQ5A 2V7EA 4UXJA 1MIOA 3FTDA 3H0EA 4FE4A 3S27A 1ONPA 4DJEC 3STYA 1Q57A 3D6MA 2BZGA 3IOEA 1CERA 4X45A 5FV4A 4KN6A 2YHAA 4C6TB 4TSRA 4YLYA 1UKZA 4UM5A 4WZ6A 4UBMA 4D4MA 3KU1A 3ME5A 4L75A 3QKWA 5J63A 3VA7A 4XDGA 4N0PA 2XWPA 4MYUA 2WAAA 5ENVA 1SBHA 1J0AA 2JB9A 3GDHA 2ZJ3A 4TTIA 3FCCA 1BSVA 5GIPE 3LH5A 5KX5B 2QM8A 3TL3A 5L95A 2JLCA 3VSBA 4MGEA 3I2IA 2RGEA 1DRKA 4Y2RA 5D3KA 1YFLA 2WFZA 1MKYA 2XUDA 2FJPA 2WMYA 2PUGA 2R4TA 4HT3B 5CCBA 2QVGA 1ZCZA 4NKRA 1IXYA 4HFJA 2QVLA 3T34A 2G1UA 2J6IA 2SBTA 4PBTA 3UK2A 4DLSA 2AOTA 1SC1A 4O4IB 4Z9FA 4HYEA 1YQEA 1NVTA 4YHBA 5EWLB 4JYZA 2CKDA 4E0BA 4CG0A 1FMLA 1GY8A 2OBFA 2PS9A 3R0VA 1NUAA 2JIPA 1M75A 4OXNA 5ILOA 5LD2B 1FFAA 1SWWA 3LQ4A 1OFIA 3IV7A 3ZKAA 4N3AA 1T6NA 2J5XA 2OWDA 3W3AD 1A9RA 3EZLA 3LXRA 4NZMA 1EJBA 3BE8A 3IBGA 3LC1O 4ZK6A 2XB9A 4IQFA 4B7ZA 1BN7A 3GRCA 2J4DA 1XCGB 4HFNA 2CL5A 3A1NA 3FRHA 2XTNA 4D57A 4GMDA 3G2KA 3EIQA 4DLZA 3HVUA 4GBED 4QULA 1GU0A 1FTWA 2F9MA 2QZPA 2X76A 3SD7A 5LP6B 4D25A 3RB8A 4PPNA 2FWMX 1NXSA 4MRAA 2WP8J 5ALKA 3T5CA 5IT0A 2CDCA 3QFSA 1U0OC 4N03A 4X3PA 5AVKA 4MV6A 3KQOA 1ZM9A 2W2VA 3PD7A 3W2TA 2WWFA 2J3IA 1EG2A 4DIKA 4Q3CA 1ONOA 5E1DA 4E5VA 3HCCA 2CLLB 3H1BA 1W47A 4JBIA 5HM6A 4NCBA 3EDOA 5BSWA 1OFHA 2C7VA 2H9AA 2HQSA 2KLBA 4Y9RA 2P9EA 5CYFA 2WF5A 4GNKA 3U31A 4B3CA 5IF3A 4XH9B 4DREA 3L05A 3PP8A 4EZIA 3B3AA 3M6VA 4DHWA 4F11A 1ABEA 1X6VA 2ZROA 2A0YA 2ERXA 3KYDB 3OLWA 4DQVA 3CWZA 3AEZA 3G1UA 2O8CA 3W9YA 3FKSA 4EGCB 1II8A 2R8BA 1FQWA 2HL6A 4ZQCB 5T4HA 3UMFA 3HSSA 3UTDA 4UKDA 4JIGA 3ZCRA 2FP3A 3G9TA 3ZQJA 3K96A 4HRVA 3UJDA 2DETA 4KXYA 3I9FA 3UWDA 1ISFA 2JK1A 1LF5A 5DMHA 5BW5A 2BJWA 2WWTA 4L1KA 3T4EA 4O4JF 2VDVE 4DM7A 2GPSA 2QN7A 1GGKA 1EK1A 1PJ8A 1GRNA 3O8BA 1T1IA 1CJCA 1CRWG 3HUDA 4ZI5A 5IJ9A 5K20A 4E08A 4XD7A 2XWBF 5D00A 1O4VA 4BFVA 1DIRA 3AH8A 2BBSA 2QJTA 1NF8A 5AW9A 1O03A 1PHPA 4G0XA 4EYSA 3HP1A 4B74A 3TX2A 2DWQA 1YOBA 1KP2A 3SGLA 2ZCVA 1W4ZA 1SU4A 3A32A 3Q7SA 4NCHA 2VT7A 2W9XA 4Z99A 1EGAA 3BCUA 2SKDA 1ECBA 2WOJA 4ATNA 4RTJA 3QU5A 2GCGA 2VIIA 2FR8A 5CFNA 1KFEB 4MDHA 1WG8A 4KQGA 4ZV7A 3U16A 1QH1B 1UMCB 1JHYA 3CC8A 1EB9A 3P9SA 3USZA 3H9CA 3AF1A 3QYPA 3CPHA 3IQHX 2VL7A 1LDGA 1UMBA 3M83A 3TUJC 4EQ6A 2PU5A 2R47A 1O97D 5FBWB 1U7WA 3T3HA 3UF0A 5LA6B 4GPAA 3E05A 3AKEA 4HSEA 4WLOA 3RABA 2O06A 1F51E 4JD5A 1KJ9A 1KZ1A 4E22A 3HBFA 5BV7A 5JCJD 4PV7A 2Q4TA 1O5IA 2HF7A 2SNIE 2X77A 2OHOA 1PTJA 3DOIA 4F4IA 4ZKEA 1JJ7A 4CDNA 3A1TA 3ZV3A 4DC0A 1LB1B 3QSGA 5LU8A 1TO1E 1C3XA 1RWQA 4MKIA 3UGQA 1ZD1A 4E2ZA 4EWLA 2JLXA 1GITA 1WZIA 3KT8A 1XMOB 1G7RA 1JSXA 4JQCA 5AP9A 5ALXA 1CY0A 3L1HA 4R1UA 4NJEB 1PFKA 2J67A 1RYFA 3K8YA 5C7OO 3DDZX 4IUDS 4YA6A 1EWQA 1GT91 4IICA 1Q0SA 5AI9A 2RGXA 3LRXA 2HPZA 4CQLB 2DLNA 4P3NA 4WX2B 5I4BA 1LJ8A 1JEDA 3AC0A 4UFOA 3THOA 1XWWA 3RFCA 2C99A 1IJFA 3QUSA 3R7BA 3EYAA 1YVPA 3ZWOA 2RGBA 4YT8A 4FHZA 1Q21A 3B3GA 3M1AA 2GO1A 1XVAA 3E2MA 2W2PA 1U3UA 4PYQA 1FDOA 4NU0A 4BE7B 4QPDA 3OAAD 1BA2A 2ONZA 3UMRA 1W0JD 4A8JC 3KJFA 3PTAA 1AURA 1R0SA 3KHUA 4B6OA 5HP4A 2QN9A 2VP2A 1SXHA 4KW7A 1TZBA 3AEQA 4MKFA 3LBYA 2ZRKA 3ESCA 1PYGA 1XMPA 2HNKA 3QWFA 1WY7A 5L3ZA 3DS8A 3GJ4A 3A3NA 3CXUA 1ONBA 2CHGA 2WG1A 1UBHS 3U3RA 2YMLA 1GVNB 3FUVA 1TOAA 2G9QA 3L1IA 5E6UB 1TUIA 2IUFA 2OE2A 4UTPA 1QAQA 3CLRD 4ZPXA 3L02A 3NONA 4WFKA 1K5HA 4KWHA 3T52A 5AHKA 3MELA 4OATA 4CDMA 5HYVA 2KHZA 3HFSA 1NN0A 4J1QA 3WBBA 4D4IA 4YCBA 2CV0A 1AQ6A 5BN5A 2GHTA 3CUTA 3IT2A 4GPTA 4RHEA 1QCCA 2JC3A 1BCSA 2FWAA 2Y1XA 4RK4A 4ZOCA 3SHFA 1EFUA 2L2QA 2X0IA 2PZLA 3PI6A 4Z0TA 3VZBA 1LW6E 2ONYA 2ZETA 3N2ZB 2ZSAA 2Q5OA 4P0PB 3AW9A 2YN0A 3DC7A 4W5JA 1M34B 2VRBA 3EXEA 4DV7B 1KGSA 2AX4A 2FEOA 3W79A 1UJCA 3K9GA 3WK6A 2ECOA 3B5JA 4LY6A 4F2DA 4UMDA 4EO7A 2AB0A 2R4QA 3ANSA 5KINB 4R8MA 1DC3A 2I5PO 3A6PC 3C5CA 1L7MA 5HR5A 1GGNA 3L0SA 4ZZ0A 2Z09A 5EG5A 2DPLA 2RKOA 5CA0B 5JLAA 3L7CA 2FZKA 2RHDA 3JALB 1P1CA 2J7KA 3A70A 1FFWA 4OCZA 5EZQA 3DZ8A 4AM8A 4PYKA 2ODWA 4RKRA 4DWVA 2FJ0A 5CPFA 4CQJA 3RS9A 4CMGA 4B8WA 3MCWA 4G1VA 3ZZTA 3L4SO 5I8WA 4QTZA 1U9CA 1GPJA 2HCFA 2TS1A 4S35A 3QEMA 4OBWA 5FPHA 4Q1BA 4WZAE 4CKEA 3WADA 4AO6A 2A9VA 4QUBA 4IIBA 3MXTA 4CDRA 1I9CA 2JFWA 1TCUA 4M1TA 3TTSA 5AKJA 1KE1A 1A9OA 3KTAA 1DKUA 1J8QA 2B1GA 3Q85A 4GSYA 1ZONA 3L6RA 4UBLA 4WZAA 2BKUA 5GGYA 3KZMA 3I8OA 2JS7A 3D3NA 1RJEA 1D2HA 3G8YA 3CN7A 2GSDA 4M53A 4EG7A 1FTSA 2PNFA 4QYMA 3NM6B 3NWOA 4RLFA 5ECYA 4WLVA 4IXDA 3M3PA 5ULLA 5H3CA 1U8CB 4QXAA 1O9HA 2P1ZA 4W9NA 1NGSA 4Q9DA 2OXCA 1W85A 4WV3A 5KWJA 1E2JA 1DFGA 3QLUA 5KDDA 2LDBA 3GDWA 1PI3A 3IMGA 4A91A 1Y3HA 1D0IA 1JTVA 3IKLA 3BREA 3STTA 5BOSA 2D5AA 2XMCA 3GLUA 1COWD 4K05A 1FS5A 1XPUA 1E4EA 2QW1A 4MUIA 5DBIA 4D81A 2FW0A 3QMMA 3B8HA 3N05A 1UXKA 2NX2A 2V45A 2Z1MA 2XTAA 4TXLA 2WE7A 3ETGA 4HH1A 2EKZA 5BNZA 3E3LA 4M83A 2AXPA 1M0EA 1WA5A 1EFRA 3IQEA 2QVZX 3IRUA 4LJYA 1CB0A 3STVA 4B6SA 2ZRDA 3MBIA 5A9RA 3S7TA 4HF7A 1VA4A 4P81A 5CB6A 3DMPA 2FX3A 2Q49A 1ZIXA 3CHYA 3OKCA 1WCIB 4DY4A 2LIVA 2VZ0A 2HK8A 5FXMA 3WL6A 1ZD5A 2FFBA 2EHDA 4YQZA 3RTAA 1V1MA 2PGDA 5TT0A 4CT5A 5FOTA 3IP1A 3NASA 2AF3C 4PGMA 3RIYA 4TTAA 1OAOA 2CKMA 4XB6B 1DMSA 2NQ2C 3ZN2A 1ZH2A 4K1XA 1N2OA 3QEAZ 3VSCA 1QGZA 3V1KA 1GPYA 1PTKA 5DGCA 3OCZA 3MK31 3NHMA 2QB5A 6PFKA 2BGUA 1E58A 1VCIA 2VF2A 2Q6KA 3D59A 5E2BA 1U6KA 5KYKA 3MWEA 4B6EA 3NYWA 2VP4A 2QYHA 2H07A 1U2EA 4OHVA 1D3AA 4O08A 2LCFA 1EB8A 4RVHA 2GPNA 4HH0A 1ESNA 5B7QA 1HUQA 2F1OA 3OUTA 3RHZA 5IN5A 3WL3A 4CLEA 3AR2A 2C9DA 2QQGA 3EIXA 1YR9A 3QIVA 1P1JA 3DAHA 4N7JA 5GONF 3S28A 4UHHA 3WMXA 1Y1LA 2JBAB 3J7TA 1ZD9A 1ZU5A 2R66A 1H4VB 1G291 2DP4E 2MINB 4AK9A 5HJ2A 2MSLA 4E4RA 5KPJA 3CVJA 3RVSA 1U3VA 2QUIA 3MBKA 2Z6QA 3AETB 3TTUA 4MUGA 4ZOLF 3N6RA 3AIKA 3L4BA 4Y2QA 2C9YA 4ZD6A 1EWKA 2C5FA 2FJUA 2GO7A 2I22A 2NU6A 2IS4A 1SUPA 1S2LA 2EJUA 4BNUA 5SZHB 2Q0QA 3MUNA 2A9QA 3B70A 5EAIA 4K8OA 1U63A 1EWTA 1OBFO 3T7RA 2BHRA 1N1GA 1A9XB 2XB4A 2M1ZA 2WSBA 3GFBA 3LUPA 4DRZA 4NIMA 4TLCA 3EAQA 4JQZA 1QDLB 1TECE 3VC3A 4CG2A 2ZSDA 2XVZA 3EA4A 4L8FA 3T0GA 2CJXA 3HVKA 2G5PA 3ROTA 3OT1B 4FE3A 5ALDA 2UZ4A 4C6RA 4IUBS 1WUJS 3W5HA 1U3CA 1XX6A 3HO6A 4BO3A 5AW3A 4LTMA 4NYJR 6ABPA 2VUUA 4GG1A 1HFKA 1QIDA 1FX0A 1H4QA 5KAMA 4Z0NA 4K40A 4Z4EA 1OC2A 1E5DA 5F35A 2GBPA 3GN2A 4RA9A 2IW3A 3WNDA 2WHXA 1APBA 4BRZA 4EY7A 3F73A 3WYGA 3N0VA 2PMKA 4XW2A 1LBTA 3JCZA 3VI3B 4Z1MA 4TXMA 2Q4EA 1IUOA 3QK7A 4GM1A 4N6NA 3HBAA 4MVJP 3RVNA 3CFYA 1QTRA 1N0UA 1SVWA 4O4LA 3LQRA 1JE1A 1TF2A 2P4EA 4MQEA 1ATZA 4NK4A 4OX9Y 2DPXA 3B9RA 1Q3TA 1SHZA 3PT5A 2JH8A 2PYIA 3U39A 5HPYB 2C29D 5G3ZA 1I8TA 4QZVA 4LYAA 3RU9A 5GV7A 3TMYA 3KE8A 1B6TA 5H16A 2XCTB 1E6CA 1VGVA 2IZ0A 1X7YB 1EFPB 3PG5A 5L4NA 2F00A 4I1PA 5KQRA 1OLXB 3CONA 4U8HA 3HSKA 1JEQA 4LXTA 1XDWA 1IZ0A 1YB2A 2H8KA 3RRZA 2FSSA 3FUTA 1TQDA 4E3ZA 4PZEA 3OLCX 4UBKA 4A0SA 2MHCA 5KJCA 5JG7A 3BCSA 4HY3A 3ZZMA 4DEXA 3N5KA 1E3WB 1J0CA 2EBWA 3CO5A 3KZNA 5FFMA 2WG0A 3GN1A 3WK4A 1ZGZA 2ZULA 2O0LA 3NETA 4MITA 5LYYA 4DLNA 1Z2AA 2EARA 1E89A 4AS1A 1IEVA 5HRAA 5K0EA 1K6IA 3K0KA 3Q2IA 5AT1A 3ORQA 5BV8A 4DKXA 1UBCA 4XPZA 2XNDA 2QDXA 5IJAA 3Q8KA 1I80A 2CJWA 1YZFA 3HKBB 5FA5A 3BRWA 2VXYA 2YRFA 1SVKA 3DH0A 4LC1A 4M0FA 3U4QB 3RS3A 1X7XB 1YR7A 4R9NA 1Z2PX 2GJ8A 3O84A 4M9QA 3ILHA 3RYIB 1PNRA 4H15A 2FSVC 1JZTA 3KL2A 4DR6B 1UPAA 4QIHA 1RJWA 5IX8A 1AJEA 2WWGA 1W35A 1WPGA 2O4CA 4HNHA 4NS1A 1ZLYA 4QJ4A 2NZYA 4PX5A 4XJVA 1KJJA 3FB4A 1L5NA 2WJVA 1KI6A 5IUKC 3PUHA 4YJFB 3GT7A 2AVDA 1N0VC 2IGTA 2I29A 2P6NA 3UJCA 1RJ9B 1E3EA 1UT6A 2C88A 4IL5A 4ZVOA 1M2GA 1VRWA 1KR5A 1Z8FA 2PSFA 4MAMA 3S6JA 1SKMA 2QX7A 4QKQA 4BATA 3LLSA 3MIIA 1DTWA 3PQCA 3RCBA 2IX3A 4CW7A 2FUCA 3RGGA 1X1QA 4QXMA 4OYRA 1P2UA 1UOPA 1DEXA 2FB9A 4H7FA 4LJ9A 4UBIA 3VO8A 2SCUB 4LYHA 2YX1A 2XJ9A 4YB8A 4CUJA 4GPD1 2PUJA 1R8XA 2Z2JA 3G6KA 3V9AA 4EELA 4M7PA 3WLEA 3AEUB 3Q3VA 2OCKA 2Q7XA 1Z4QA 3BHJA 2NUBA 2YL2A 3QW2A 4PRKA 5HGJA 2JZOA 1RRPA 3V4FA 4E13A 1BDIA 1NQAO 4AKIA 4U0JA 3UGTA 3SPXA 1DG3A 2CVPA 5KJEA 1VI6A 3ZU4A 4UQLA 3EEIA 4J49A 5JSZB 1I2AA 2BFWA 2ZVJA 4AN0A 2FWIA 2A6PA 4ZREA 1B73A 4P7FA 4MJ7A 5JS2A 4D02A 2P9QA 1NMZA 4FYJA 3THWB 1C4WA 2G72A 2O57A 4H08A 3Q72A 3ZDZB 3C85A 3NBAA 2W22A 4KSBA 4RVSA 1HSZA 3W8NA 4CLRB 1OCEA 3H2IA 4OAOA 4CLDA 1LSJA 2PXHA 1Q1EA 2BTQA 3SE7A 3T94A 1KPHA 4E07A 5KNBD 2FGKA 3RFTA 2QVCA 2XUHA 3BB3A 2O1XA 1ISJA 1HFEL 1SR8A 1H6CA 1LPPA 2CHQA 4S1TA 5KPDA 2QJRA 3NWPA 1QB7A 3FUXA 4FEAA 2XMDA 1SXPA 2MSNA 5I47A 4IWNA 2RGNA 1OWMA 2IDJA 3HADA 3OM8A 4IKOA 3ZQ4A 3ED5A 4F0JA 4BGDA 1T9AA 1W2GA 3QE4A 2VNKA 3FFWA 1HE4A 5AW6A 4LRSB 4PC1A 1DKPA 4XVHA 2Q07A 3F4LA 3FX2A 2FETA 2KPOA 3ADBA 3W6UA 5REQA 3HYCA 3O1JC 1FP6A 1A4UA 1SG0A 1LVGA 4HQOA 2E85A 2DBQA 1TEVA 2WAMA 1D6JA 1EAMA 1M8GA 4JC8A 2FEWB 2Q6OA 4C7JA 3K0FB 5MF6A 3TPFA 5EN4A 4BX3A 1E6MA 1L7QA 4AZ3B 4MEBA 3KWMA 3A1VA 4QVGA 4JGGA 5E4JA 2YIVX 1CUBA 2IDMA 2W8ZA 4ECEA 2D1FA 4CEIA 3GLGE 5H81A 4FW8A 3DBIA 3I0NA 4GOMD 1PUIA 4JJ7A 4L5BA 4CM5A 2BI4A 4ZYZA 2G7MC 4HWKA 2XV1A 2RAFA 1RWPA 3FZQA 4IDEA 4JY7A 4Y2XA 4A23A 1R1DA 4ZDIA 2C03A 4JLNA 4GFDA 1QKJA 2Q29A 4TV9B 5CLGA 1B8UA 2BOVA 4A0QA 1JAYA 1XA3A 2ACVA 3M2PA 1FRQA 3ST7A 3NQ41 3SM9A 4IHQA 3SYRA 4EBFA 5COBA 4L4ZA 2V0CA 1XTQA 3HHEA 3S70A 1S3GA 3WYBA 2VO1A 1P62B 4D8XA 5DV9A 1OZAA 1V9SA 1ODLA 2CSUA 3BXZA 4KN5A 4PN3A 5DBOA 1ZH4A 4GR9A 3LBFA 4IZOA 1I51A 2TSYB 2P1RA 2I03A 2NV2B 3G3EA 3IUSA 3O1IC 2B5OA 2Y1LA 4TS9A 2D06A 2P0AA 3GVPA 1ZI6A 2W83A 3R77A 2O5EA 3PF8A 5E1OA 1CZKA 4N3CA 5TXGA 3TFWA 3EGVA 1G8PA 4Y6QA 2IHJA 4F4DA 3G0CA 5ELMA 1E9RA 5K3FA 2A2ZA 3RJ9A 2QSZA 1SK9A 3I5YA 3K9QO 2MSEB 2R65A 4CNBA 2MYNA 2Q6VA 4AX4A 3IE1A 2Z58A 2QRMA 2GAJA 1RAFA 1NN1A 4C0QC 3LBAA 1CQPA 2PD4A 4H4DA 4MGYR 1L8AA 3F78A 4KXMA 2OORA 5ANRB 4TGLA 4NR0A 1TEXA 3ETHA 4KNYA 4RELA 4XQ0A 3GJSA 2NZVG 1WY5A 1EXDA 1F4LA 4D0LB 3KALA 4O1HA 3NC0C 2QXTA 4LISA 3OY2A 1LPOA 3THXA 2V7QD 3P4UA 3EXIA 1YB1A 3IUQA 5BVGA 2ATCA 5J2UF 1H2XA 3P52A 2QAGA 3PEVA 1I3MA 2IS6A 1JSZA 1RS0A 4HQLA 2M1XA 4LKOA 4NF2A 3I1JA 4F5WA 3WL8A 5JIBA 3FBGA 4ER6A 4QBHA 3DMDA 2I2CA 4HN4B 4IF4A 1BMTA 1F60A 1VHDA 4XR9A 3MOSA 4KO2S 4I14A 2RGWA 3DO6A 1VE3A 3L4KA 3REGA 5CLLA 4D97A 1TKBA 4KDEA 3L8MA 5ICGA 3TQCA 1KF0A 2ZBGA 3DAPA 3G89A 4QU9A 4R16A 5EIXA 5HF9A 3GUZA 5AUPB 5I9IA 3AIMA 3OQ6A 5I01A 1R6UA 3QI7A 2JGJA 2FMTA 4EGFA 1SCUA 4AP6A 1WOYA 2G6BA 4IHAA 4MVXA 4FXOA 4RJKA 4R7TA 5B1HA 1OFTA 1KTVA 2H2AA 2I8CA 2QGZA 5JD5A 1HYGA 2A0FA 2FP4A 4M8KA 3ZX4A 4N0EA 1ZIYA 4BKRA 1LNQA 3A1CA 1EUDA 3IJEB 1Q7BA 2GAOA 2OGZA 4XX1A 1H2YA 3FHLA 4ZU3A 2FKAA 4GXRA 4RM2A 5BN3B 4QQNA 3I3SR 3PEWA 1VE1A 1BX0A 1T9ZA 2ZTHA 3F2VA 4OGLA 3SWWA 1WCXA 4JJ6A 4RH0A 4DR2B 2FVXA 3SICE 1FFXA 3PHGA 2BHSA 3FWHA 3CPSA 2PIDA 2BMJA 1FDSA 1P5HA 2OBXA 2VPZA 3R3UA 5TQ0A 1DPGA 4O1MA 5K45A 1NX6A 1RTTA 1J5EB 2BGGA 5BO5A 3VYTB 3PQ6A 3TLCA 1EXVA 1QIMA 4L85A 2PUAA 3SZLA 1C4OA 3DHWC 4XD2A 5GONB 1V6CA 4C7MA 4MV3A 4Q4AA 4ENWA 3GJRA 3LHKA 1N33B 1VSBA 1HK7A 2GJKA 4FBLA 1ZGJA 1IY9A 1S0UA 4JOQA 5CM8B 2ATEA 4BO8A 3PDIB 2VQDA 5J58A 3GWZA 2WFMA 4RDXA 4FSXA 3IKTA 1VQ1A 3WKAA 2YIMA 1CX9B 1D2CA 2C3MA 3U17A 4MO2A 1JFFA 1QIKA 3CLVA 3FTNA 5F3WB 3D2CA 3KSDO 3QOWA 4NMWA 3DXYA 5LDDC 3TOVA 2JGEA 1OXKB 3HWX1 4IDNA 5CHYA 2V1XA 4FB4A 1EK6A 5GM2A 1XLUA 2UYGA 1RADA 2DVMA 3GMTA 4H77A 4RIHA 4B1FA 3GFFA 2ZS9A 2YJ4A 3LDGA 4MR9B 1E1QD 4CMJA 4TKZA 1JDPA 2WDPA 2O8EB 2G25A 4FYPA 4D6PA 2PA0A 4EB6A 5B64A 2ZI6A 3W2GA 1A7AA 2DT5A 4NH4A 1H8EA 2GNPA 5CLFA 3C70A 1MPXA 5C37A 5TGTA 2DFNA 1PR3A 2PAFA 5JLJA 1AQYA 1K8ZB 2YJTD 3MCUA 3Q9SA 5KYUB 4AY6A 4U6SA 1PG5A 3SC3A 4NZZA 4JUFA 3ZS9A 1XU4A 1CUCA 2YJ6A 2CJFA 3CLHA 4A10A 3Q8LA 2O2YA 1GGJA 4Q1CA 1GQSA 1EESA 3RUHA 1KWGA 4I4TB 4RZSA 1PGQA 5F1KA 6Q21A 2PMBA 1T36B 1N9KA 4UNQA 3C3WA 5JW6A 4CGZA 3TD6A 3LRTA 1KAMA 2VDLB 4B09A 2IHYA 1VJRA 5IAEA 3AR5A 4MO9A 3FYCA 4YRBA 4EUEA 5BV1A 1PUJA 5EJ5A 4LCEA 2DSNA 3H2GA 3M4JA 4TWAA 4U7GA 3D3WA 5C5DA 1LXCA 2AFIB 1RZ3A 2CXHA 4H3VA 1H2EA 4L28A 4IH4A 4EVQA 5ITWA 3ED1A 1ZHHA 1SOUA 2P2CA 5JSQA 2ISCA 2XBUA 3EW7A 3ZKWA 2VF7A 4C7XA 5A4KA 1Q0ZA 3N76A 4UD2A 5JS7A 4H1UA 2B5VA 1BWPA 1U9IC 5E38A 1HKUA 2DQYA 1U2DA 3CUKA 3TLEA 1X80A 3UPTA 4DMUB 1EXWA 4ZT7A 3RUIA 4I08A 2ORED 1THTA 2CNKA 5EPOA 4FDUA 3O8LA 4X7BA 5SICE 3I3OA 3IUMA 1LI7A 2A4MA 3ICPA 3AVWA 1Z73A 3DEKA 4BV3A 3K9FC 1TQ8A 3TG8A 5U4QA 3TSAA 1WD7A 1E1KA 2HHJA 2I2DA 3C8DA 4QDJA 3RRJA 1JQEA 3RSHA 1RYZA 8MHTA 3I30X 3I53A 3QF7A 5JJCA 3ANYB 5MN6A 1M2FA 3K3PA 4G1MB 1P4AA 5KYVA 3WL4A 2JFVA 2OECA 1MQAA 4NU8X 3QU7A 1MFPA 1ZK0A 1JFRA 4NENA 1KSGA 5E3HA 4FB5A 3G8BA 1QH9A 1YB5A 3CUWA 3OE7D 4NEGA 1T4GA 3HJHA 2WAOA 2IY7A 4GSKA 1GTZA 5B4UA 1JB1A 4ZEMA 2CZQA 4Y2VA 3JWJA 3B1YA 4KLNA 2QKYA 1FEZA 3IXQA 1QK5A 3GDGA 3FPSA 3N7UA 4ZXFA 4W5TA 3NHKA 2KSQA 2ZCUA 1OXTA 1R0BA 2QUKA 4QASA 5C35A 1SCAA 3L84A 5AYVA 4CG3A 3ER8A 4E6EA 5DH9A 1PZXA 3R5HA 1XD8A 2IUSA 2BSXA 2JW5A 5DN9A 4N8SA 3UCFA 1YVDA 2H9YA 3FTPA 1NC1A 5EKXA 4GR5A 1H3FA 1RR6A 1UAYA 2ZIUB 3WLTA 2O8DA 2E5FA 1L2TA 1EM8A 1HE3A 2BRUA 3D8SA 4JLBA 5BNFA 3GLHE 4JJIA 1C0IA 3CRVA 5SYNA 4AJHA 6REQA 4IIJA 1UDAA 1Z5OA 3E5HA 3NLLA 1V8DA 4Z4CA 3J7AC 2X4LA 3CNBA 4FONA 1AGRA 3A1UA 1XEWX 3JWGA 4G67A 3K5HA 5IYZF 4KUHA 3VR6D 3WGKA 4I3GA 2I4RA 3GLHA 3QUTA 1SOWA 2QRZA 2CVHA 2Q8NA 2RBEA 5TJ9A 3ZZNA 2BEWA 9GPBA 1QQ5A 1TPYA 2Z98A 3T3EA 3M1LA 1TAQA 1CZNA 1Z47A 3IVAA 2UXDB 4ZYWA 2E2WA 1L1EA 1YT5A 1A2BA 2EWWA 2IBMA 1J1ZA 3BQNB 2J7PA 2Z95A 4TS3A 1CEQA 4URHA 1E1CB 4C6TA 1XQWA 2GK6A 2H2WA 4Q5IA 5FNVF 1KYVA 3FOAA 2R44A 3BL8A 1KJWA 5SZJA 3WGQA 1XTSA 2ZXEA 3IOBA 4DCJA 2P67A 2C2GA 4TSKA 1PEAA 1RM5A 3PHCA 3Q10A 5F3RA 1G7SA 5BN4B 3W4KA 2J59A 3T5AA 1LI5A 1E6LA 1Y4DE 1EZ4A 3W4JA 5KX5A 4W7SA 3AVQA 4HAYA 1LDNA 3TAUA 4YDQA 2IZOA 3GLTA 1RMYA 3GDOA 1P9WA 1Z2CA 2PO7A 4L4RA 5DXJA 2J5BA 4UHKA 5G1OA 5EEHA 4I4IA 2ZSJA 4F8JA 1L6RA 2DFKB 3GJ6A 3NBQA 4ZGBA 5JEEA 1KYYA 4O4IA 2W5UA 3H05A 3WX0A 4BLUA 1HE5A 5H02A 2B34A 1AUOA 1K7EB 1PJ4A 2FG5A 3GOHA 3PPXA 3SEAA 4EPWA 5JAHA 3BWMA 4LXIA 2QJFA 4REOA 2V7PA 1MB4A 4LFAB 2H7XA 1DKRA 2DH5A 5B2EA 4IIHA 5F98A 1MV8A 3H83A 4E31A 2PUCA 3ZHCA 3BC1A 2JFFA 3CF0A 3FSJX 3DOFA 4OHPA 2EX1A 3QPDA 3T9BA 4F4HA 2HA4A 5CDTA 1Y5LA 2Q3CA 4H6XA 2W6CX 5LYJB 1C5KA 2JASA 3T35A 5IULC 1I1HA 1G2QA 2HDOA 2HMSA 1E4VA 2FEPA 2ID8A 3P1JA 4GEKA 3W06A 3C1OA 2O2JA 4YMLA 2BDTA 3INYA 2VXBA 1M8FA 4KAFA 1OA1A 5B5SA 3WK5A 4ES6A 1VJTA 3AKDA 5ALTA 5FA8A 4BE4A 2ZYUX 4KV9A 4JN6B 3TLYA 4F1KA 5M2QA 3CM0A 5HZKA 2DFPA 2CLCX 2I6QA 1XLTA 4FQ7A 1N5DA 3CUSA 2OR3A 2GHIA 4ENUA 1GO2A 5HZGA 2IYUA 1YZUA 3C45A 1G7CA 4AI6A 2VOEA 1VSVA 1GNTA 1W2WB 4A0HA 3PGKA 2QD5A 2OCDA 5LBIA 3U7EB 1E3MA 1XZPA 3L7IA 2B4QA 4PZYA 4ZDKA 2KQUA 3F3YA 3M4NA 1ZJZA 2ECPA 1HE2A 1O2DA 1RQPA