3GJTA

Caspase-3 binds diverse p4 residues in peptides
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
141
Chain Sequence
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Caspase-3 subunit p17
publication title Caspase-3 binds diverse P4 residues in peptides as revealed by crystallography and structural modeling.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 141
sequence length 141
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2009-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gjtA00
1GQFA 3R6GA 4JJ7A 2J31A 4JR1A 2H51A 3RJMA 2H65A 4M9RA 4QU0A 2CNLA 1RWMA 2HBZA 2C2OA 2H4YA 4NBNA 1RHQA 4DCOA 3R7SA 3S8EA 4JB8A 4PS1A 2XZDA 4HVAA 4D3YA 1QTNA 1CVRA 1IBCA 2J32A 3D6HA 3GJTA 5LUBA 3GJSA 1RHKA 2CJYA 1JXQA 1PYOA 4N6GA 4NOLA 2H4WA 3OD5A 5LUAA 3NKFA 1RWKA 3NR2A 4QTXA 2C2MA 2XYPA 3EDQA 4N7MA 5IAGA 3H11A 4ZVQA 5IBPA 5IANA 2Y0BA 5JFTA 5IAKA 4EHDA 2P2CA 4NBKA 4LSZA 5K20A 2HBQA 3H13A 4QUBA 2HBYA 3BIJA 3QNWA 3IBCA 3V4LA 3E4CA 2QLJA 4EHKA 1SC1A 2J33A 1M72A 5IC6A 4NOMA 1RWXA 1F9EA 3H11B 1RWVA 3DEHA 4HQRA 2Y1LA 5I9BA 1RHMA 2H48A 3PD0A 2C1EA 1RWPA 1SHLA 4JJ8A 2H5IA 1BMQA 4DCJA 2WDPA 3R5KA 1F1JA 4FGUA 5IABA 3DEKA 4QUEA 4QU8A 1ICEA 1I51A 1SC4A 1RE1A 1K86A 1I3OA 1RHUA 3R6LA 4D3ZA 1PAUA 5LU8A 3D6FA 1K88A 3DEJA 4ZVSA 1NMQA 2XYHA 4ZVTA 3R7BA 3V3KA 4JQZA 4PS0A 4NOKA 3UO8B 3V6MA 2DKOA 4EHAA 5IBCA 1SC3A 3PD1A 4QULA 3SIPA 4N6OA 3DEIA 4EHHA 4AW9A 1RHRA 4QU9A 1RWOA 3H1PA 4ZVUA 5IARA 2QL9A 3EDRA 2J30A 4ZVOA 4ZVPA 5IBRA 4I1PA 3UOAB 4JQYA 2XYGA 5IC4A 3NS7A 3V55A 4PRZA 4DCPA 5IASA 4IEFB 3V6LA 4QUGA 3H0EA 2CDRA 3D6MA 5IAEA 4NOJA 4NBLA 3R5JA 1KMCA 4EHFA 4PRYA 4JR0A 3V4OA 4EHNA 1NMEA 4JR2A 4EJFA 1QDUA 3K7EA 3GJQA 4QU5A 2QLFA 4D3XA 3PCXA 3KJNA 3R7NA 1I4OA 4FXOA 4QUDA 2XZTA 2C2ZA 2NN3C 4IYRA 2CNOA 2C2KA 2QLBA 2FQQA 1NW9B 1GFWA 1I4EB 1NMSA 2AR9A 2CJXA 3KJQA 4I1RA 4QUJA 1RWWA 5I9TA 3IBFA 2K7ZA 4EHLA 5LU9A 4QUIA 2H5JA 2HBRA 3P4UA 2FUNB 2QL5A 4FEAA 4QUAA 4AWBA 2CNNA 1RHJA 4HQ0A 3ITNA 4QUHA 3P45A 4JJEA 4AWAA 4N5DA 4N7JA 3S70A 1CP3A 5IAJA 4FDLA 2FP3A 1SHJA 2CNKA 3SIRA 1RWNA 4ZVRA 3GJRA 3KJFA 4N6NA 4QTYA 1QX3A 5H0IA 2QL7A 2H54A
chains in the Genus database with same CATH superfamily
3I52A 3PE3A 3ZHOA 4OY3A 3V4ZA 5IJ0B 3L8GA 3JARA 1T3GA 3FIJA 4FMDB 1M5TA 3GFFA 4UXHA 5HCUA 1IATA 1SHUX 4PCLA 1GZHB 3A26A 1CG6A 2P0EA 4N0PA 4P4SA 4UEWA 4EKDA 1COWA 3CF6R 4HTFB 2G9QA 1E1RA 3FZNA 3GJTA 3RSCA 1E92A 3RRYA 1P5ZB 3EW7A 4E14A 3B9BA 1XPUA 3ZV3A 5F98A 1I1OA 3KOYA 4V3CA 2IEDA 1M6VA 4KX5A 1X77A 4YACA 2Z2YA 4J07A 3LF1A 4HBZA 3AR8A 3B2NA 4PYKA 5DMHA 1I94B 3I1YA 3RVJA 1PDVA 4MSUA 1R9GA 2P6OA 3KQOA 4EO9A 4MIYA 4OEHA 1EK2A 2WUFA 1U5AA 4GXTA 4K28A 1MIOB 1BQ3A 1VKHA 3VZSA 1XRRA 3S2GA 5CH5A 3TBHA 4MVJG 2RC5A 2PT9A 2XTJA 1Z73A 3USES 3RSFA 3AEQA 5MN4A 2F8TA 2JIMA 3OZDA 2AA3A 3LKBA 3FGNA 2W98A 2WUDA 4LVOA 1BGVA 1SC9A 3IMFA 4FDAA 4CTMA 3KLOA 4AD8A 2PKRA 4PYMA 4MEAA 4WINA 2BFBB 2R6R1 1RIIA 5LDGA 5K99A 2ZYTX 2EV9A 4ABYA 3VYSB 1ORRA 4NFLA 1SBIA 2ZYWX 1KAMA 2ILVA 3HM9A 1PJZA 4IKOA 1FTWA 4HMQA 3GXOA 3DE2X 3BIXA 3JD4A 3QLVC 4HB3A 4IQ8A 1DCFA 2A9FA 4OFZA 4YCAA 2A67A 1G4UR 1OFUX 4RTSA 3B5EA 8LDHA 1EB9A 2C5AA 4OPMA 1KDZA 2FWRA 1NFRA 3K70C 3WJAA 3T0IA 3EODA 5KQLA 2XYHA 4R7ZA 1E4EA 3AL0C 2XEDA 2DJ5A 3PXCX 4EQ6A 3K2EA 5C51B 3ORHA 1QH1A 3CNBA 3QBDA 1Q0TA 1WB6A 3I42A 4HHEA 2W6ID 3H3JA 1AA9A 1ID1A 1VLJA 1RACA 4ZT6A 3CJTA 2GGSA 1SU6A 3BH0A 1XTZA 2DVMA 4Z9AA 1FVOA 4FVTA 3DEAA 3DF7A 1V3TA 2EWWA 2IZ6A 4ASUD 5BSKA 2QTCA 4CM4B 4WCFB 4EZEA 1WXHA 3QE2A 3FB1A 4U7DA 3AUTA 3DAFA 2EATA 3NBFA 5FPTA 1M34A 2VN8A 4H9GA 3WC4A 3D8RA 1JLLB 4Z7OB 4N0EA 4YCDA 5KI6A 2YRXA 1H3EA 1PEYA 3D0KA 2HRDA 2IPAB 4UTZA 4F3TA 4XDYA 4MV3A 2WD7A 4TVSA 2G77B 4NARA 5EXEA 1J97A 4JXXA 10MHA 1NUPA 3VR2A 2WWXA 3MOSA 3QTBA 3WVNA 2Y1FA 4LHEA 3I53A 4C7XA 1PWEA 5G41A 3R7DA 5JZMA 1I4EB 5DYNA 4QDXA 1X15A 4A0HA 1ZHOA 4CKBA 4QUIA 4WOBA 1L6IA 3SOZA 3W6UA 1WRBA 2Q46A 4KAXA 4EKGA 2WUWE 4CR7A 5HJEA 4LJ7A 2EBHX 5HA5A 5JR3A 4K9PA 4BBPA 4IX9A 2MCFA 2Y4OA 5L7TA 3MTAA 1KAGA 4FYJA 2VAVA 1S2GA 2MSWA 3KVVA 5IZ4A 2HR1A 3MNFA 4I5FA 4S05A 2GWRA 3ELUA 5E7JA 1SCIA 3C7KA 2V0NA 1OWLA 4M38A 3FLEA 3SVZA 4ENRA 5AUPB 3G1UA 1XMOB 1U7WA 1Z0IA 3EJWA 3ED1A 1ECGA 1P1FA 4R68A 1V11B 2BEWA 1U28A 3HCOA 5EHQA 5EPUA 1UC4B 3VC2A 1QTQA 3HA3A 4LQLA 4II2A 1CQXA 5DO9A 1B2RA 3G2KA 2G9ZA 4MS3A 3ZE6A 4CQNA 2O19A 2J32A 3T5BA 4YJFA 2X0FA 5JVDA 2FPWA 2Z2XA 1J0XO 1BKDR 1WO8A 1K3TA 4CIAA 1FSFA 2QXTA 3MT8A 5BW4A 1E8MA 3KRTA 3NWOA 3AF0A 4JXJA 1ESZA 3L7BA 1HE8B 4Q6BA 3BIOA 5G4KB 5KWEA 4TSFA 4GAEA 3AT1A 1G8KA 2YZNA 3H8SA 1SH7A 4FFMA 2YIDA 1NNLA 1ZQ1A 3VU8A 1U02A 1LF0A 1P6QA 1J9EA 2AZDA 2ZE8A 2ZYAA 3W90A 3O4IA 5DX8A 2M98A 2H4JA 1ZRMA 1DTWB 4GC9A 4UFNA 2XEXA 5TF0A 2FW8A 3W1VA 1IC6A 1PLKA 2P9HA 4JI0B 1AZSC 1OILA 2QTVB 1IOWA 1PGOA 4LBVA 1WTCA 1MDBA 1T2FA 3L0DA 3LLCA 4LXUA 3VO2A 4EFDA 3LBFA 5C80A 3FHCB 2BFPA 3C3EA 1ESEA 5K0NA 3M9XA 2NIPA 2AN3A 1YZFA 2A5YB 3CCBA 4Z0TA 1V8FA 2QVYX 4AJPA 4E88A 2XB4A 3Q6MA 2D59A 1RCTE 3AUAA 2CLCX 3B3QA 3RS4A 2B2XA 4E46A 1TE2A 1UOEA 1I3OA 5DI3A 3EZ6A 3KEGA 2PNFA 2HV9A 3OOJA 3EBPA 2HJ9A 1V8BA 2PQ2A 3M0EA 4UTVA 1C81A 1XQVA 1UF9A 1P2UA 2GXQA 1E2HA 1Z35A 2OC9A 2YRFA 4N9WA 1IK4A 3SM9A 3ZCTA 3TIXB 5DTJA 4EHHA 2JIOA 4TMXA 2AN5A 1TVCA 2VJMA 4V0MA 2VF5X 2C5SA 2DWUA 5TPWB 3ZLVA 4L8GA 2XUOA 3AVPA 3CFYA 4DLAA 1CJCA 5AUQA 3USCS 1CY2A 1VMKA 3KDAA 2BR4A 3C6XA 4D57A 1IBSA 2IUUA 3U13A 3VZDA 5EQJB 4HDKA 3AY7A 1SBTA 4J6EA 4ZU1X 1QF7A 2FP4B 1R18A 2PA3A 4G0ZA 4GNKA 4Q7KA 5BWLA 2UXBB 2VKTA 1SKYE 5BWBA 9ABPA 1EESA 3CNLA 1SQ6A 3COPA 1VE6A 1J7JA 3E3LA 2PJZA 5CLQA 1E1CB 4YUWA 1GEGA 4H4EA 1P3JA 2QAGC 5ITZB 1RFGE 1XRPA 3SS7X 7ADHA 4KUHA 4F8EA 5EJ4A 4IYJA 2A33A 2E3JA 4ZEVA 1X80A 3UXMA 1ZD3A 2BEKA 4KR3A 3N5CA 5JY1A 3FW1A 1O0CA 3OE5A 2VJYA 3H4TA 2FUNB 4HGNA 2HL6A 5LP6B 1JIQA 3UOGA 3TD6A 5B3LA 2IDMA 4R6WA 3KT6A 2CNKA 2G17A 2K2QB 1E0KA 3A1SA 5ALLA 4ZCLA 1JHZA 1W5BA 5AOAA 2H1FA 5E7MA 2ZAGA 1KJIA 2J41A 2Z9BA 1NBIA 3MLBA 2DLDA 2Q27A 2VHQA 5FPKA 1HT1E 5CVJA 3LWBA 4QOIA 5DBFA 2ORVA 3PKZA 1Q44A 2QMYA 3HGMA 3C8MA 3KZKA 2QQ5A 4Q1VA 13PKA 3JQ7B 4DMGA 5EMKA 4JI4B 1BZYA 2QPLA 4PYRA 1H1LB 1U3FA 1CE8B 4DR2B 4G6ZA 4KOEC 2NU7A 4L72A 1AXGA 4D45A 2RH5A 1UKVY 3OCVA 1T0JB 2LZ0A 5KJCA 3CKYA 5EMLA 1WKBA 3GLIA 1B1CA 3IFSA 1T0BA 4JI5B 4WPGA 2XHZA 1SXIA 4BIMA 2O06A 3TRDA 4JEUA 3AEUA 1RRKA 2B2CA 4Z99A 1YZUA 3X1YA 5BR8B 3RD5A 3OZFA 3ADDA 2YNMD 3ACDA 2FE1A 2PWZA 3TZEA 5CYGA 1YOVA 3D3QA 2A0FA 4O4LB 4Q05A 1BA2A 4OB7A 1RLJA 1FXUA 3EXAA 1RMQA 3HDJA 5J5CA 3TAXA 2HDOA 2P2GA 2ARKA 1B42A 2O2HA 2PTGA 3VTZA 1ZWLA 2B3DA 2HK6A 1NBAA 4JL6A 1I2ZA 1V45E 2JZOA 3T1TA 5LXTF 1GAJA 2ODEA 2Q1YA 1ESMA 2P6PA 3QQ5A 4D6PA 5AYVA 3UAGA 3FDXA 5CM2Z 2R65A 2W6ZA 4XDHA 4CM9A 5DISB 4ZJYA 3RC2A 3VOSA 5AI6A 1TYZA 4RF3A 5G1PA 3JQ8A 4WCVA 1X7DA 3KKKA 1QFMA 3OE7A 3ZC3A 1IAVA 1SXJB 3DF9A 3EAQA 4BVKA 4NJMB 2A5JA 3WZLA 1DFIA 2PQMA 3L8FA 1T5BA 3KT3A 1UEIA 4FEEA 4GP9A 2QRZA 1OLXB 3C4VA 4QD3A 4E5PA 1OH5A 3EGXA 5CLHA 2MR5A 1WXFA 4BNUA 3UNXA 4FCTA 1V4BA 5LVAA 1R0YA 3OY7A 2Y1DA 5K0LA 4ZGWA 2R8YA 4N6OA 2EHDA 2REQB 2R5WA 2Q0XA 2H18A 2JGAA 4YIKA 5JS1A 4FYHA 4QUKA 4QQKA 5TRTA 3UGJA 3CPHA 1WSDA 1UXGA 4NVRA 3VC3A 1WF3A 3MN1A 5C46F 3PJRA 3R3WA 1YZYA 3VX4A 2YV4A 4PN7A 2VP3A 4ER7A 1IEXA 1NJ8A 3AY0A 3P97A 5AOVA 5JZ9A 1QIIA 4AS1A 1U2DA 1RJFA 1YE5A 3L1KA 3OH8A 1SAYA 3ZH2A 4X66B 3LVFO 3UHPA 3CZPA 1HKUA 3L4BA 4D43A 1ZCBA 4HDAA 1SFRA 1M2OB 3HLTA 4HDRB 4PZ0A 3JVEA 1P1IA 1H8HD 4YNBA 1REQB 3T5GA 3DDCA 4RA6A 5LBIA 4RPIA 4GP6A 4PAWA 2RHTA 5HCIA 3GDGA 3IAM6 4MP3A 3GLVA 2ID7A 3N05A 4L8WB 4HUTA 3EXHB 5B1YA 2W6JA 4QOSA 1BROA 3TIIA 4EABA 4J0CA 4NJEB 1LY1A 2AOXA 5K6AC 3OICA 2XT0A 1Z6AA 3HFJA 5J4LA 3ICVA 4XYEA 3KD3A 4I1OA 4W6ZA 4KH1A 3VZRA 2P3QA 5ALQA 1N6KA 2RB4A 4GXQA 3UXYA 1W0JD 3DL4A 1LJUA 5NLLA 2H54A 4KR2A 1MDFA 2J9GA 4NV3A 2HD4A 2XUJA 1O95D 2C03A 1MOSA 2ZJ8A 3WIDA 3WRVA 1U0HC 3NP9A 5T8KC 4PXAA 3RBAA 4EUFA 2SBTA 2FUCA 1XC7A 1QM5A 3LSTA 5JS7A 4I6EA 1DWPA 4D4GA 2GWHA 4HWSA 5K0ZA 2HF8A 3O8RA 2QTRA 1A77A 2QJFA 3H6KA 1C3OB 5F52A 2BMDA 4L51A 5COAA 3F5QA 3T7TA 1BDBA 1QCZA 1W49A 3FI0A 2R6AA 3IEKA 2J07A 5CURA 1H2AS 2QSJA 3MB8A 3CLHA 3REQB 5K0TA 3UJ7A 1QVVA 5TARA 4BN0A 1P2SA 1K6JA 1GR1A 1QIFA 3A1FA 3O2SB 3EZNA 4QYIB 4YRJA 1NX6A 1FBTA 1P7WA 2MOKA 5DGCA 3WP1B 2XXAB 4FDVA 4M0EA 3U2QA 1CY1A 4B3HA 3WZ2A 1R4ZA 1T5DX 1U9IC 3CLTC 4RVOA 2Y0PA 4KAFA 1P7VA 2VO1A 3L0IB 3QP9A 3U44B 2QORA 3CISA 4B7XA 2XUAA 4B3FX 3HJBA 5G53C 5HR5A 3E84A 2ZROA 2JGIA 3EA4A 1OLSB 1C80A 1ANKA 3HFRA 3IVGA 1WBBA 3VO8A 2ZQ5A 5JRZA 1X7XB 2NX2A 4S1WA 3IO5A 3TX6A 2AZTA 4BQQA 2PMEA 2JAPA 4G0VA 4RA9B 3NTVA 3F1LA 3OCWA 4IOKA 3MHPA 4PFSA 4UDNA 1HMYA 3IMKA 1L7VC 1JKIA 4IOMA 5T41A 2VK8A 1R6BX 3R7BA 2FRXA 3DDNA 4Q4AA 2AQIA 3KDPA 1F2TB 4KQKA 3VH4A 1X1BA 5JWOA 5IBCA 1BRTA 5JMTA 1NPDA 5IU6A 4DG8A 3M2TA 5ES4B 1CFJA 4TSRA 4Y0NA 1Z88A 4X6YA 5IK2A 3EAGA 1JMVA 4CV1A 5KREA 1E4YA 1P4GA 4ZT7A 5LA6A 3LQRA 1FP6A 3N7TA 2VPYA 4FEGA 3NPMA 5F7ZA 5FWYB 4ZEWA 3SF8B 3ZUPA 4YRKA 5LJLA 9LDTA 2AK2A 4BNVA 3IDZA 5KTYA 1PNRA 1ECJA 1PX2A 1Z0KA 4AG3A 5H5JA 1G59A 2Y9PB 1K0FA 3ZWKA 1VSBA 3F9CA 4CEJB 1BH2A 4N65A 4AICA 1NMEA 2OCDA 1OYVA 3E1GA 2G9UA 2XNKA 4L08A 5AVTA 1PTJC 3N75A 1DOZA 1TZJA 2WHEA 2FUEA 4QUDA 5INTA 2F8MA 1VI2A 1Z6QA 4C29A 1VHDA 1EVJA 1FPMA 4I8DA 1CLUA 5KVVA 4V02A 1HE2A 2AR9A 2VZ8A 1MX9A 4XRGA 2CB0A 4C4ZA 2ZTUA 1K6XA 3GUHA 4OFWA 4AROA 4DM4A 4FQ5A 4NS4A 5IXJA 3OA0A 2GBGA 4PZ9A 5P8WA 1EIWA 2QBYA 4FDLA 2XMPA 2QZJA 1NXSA 4UUAA 1PGPA 3TSAA 1E1MA 3HQ4O 4YRFA 1T36B 3KFXA 3L0SA 4B46A 5A4KA 5A5DA 1PQYA 2EL9A 1AT1A 3K1TA 521PA 1GQFA 1XXHA 3BMNB 3RGWS 4XYLA 4BJ5A 5BR7A 1TFRA 1A9TA 2VNSA 1CY4A 3M1AA 3FWHA 4TRJA 3NTQA 1MIHA 1QGDA 2DULA 2C3OA 4GICA 2BP7B 4GBJA 3AETA 4MMYB 4D9KA 3S8EA 1SIWA 3K70D 5FEMA 3BHNA 2OLJA 1ZD5A 1Y9AA 2OZLA 3AOEC 3CNQS 3EZFA 4RK4A 4WOCA 3AKEA 1KMQA 1NONA 2ZYHA 1TD1A 4RK0A 3WYNA 1ONOA 3EIXA 1HF3A 1P9NA 3DVQX 4Q0MA 4YCBA 2A1TS 5EHNA 1LTHR 3ZYZA 3I9MA 1OBCA 4OUKX 1NX9A 1WMDA 2W58A 3T9BA 4UOEA 2X0IA 1YCDA 1TI7A 2L0XA 3VR1A 5KNDD 1RJWA 3AO0B 1UDWA 1OV6A 3QNWA 1X7YB 2C5EA 2JB9A 4EH1A 5AM2A 3W0LB 2VWQA 2EBUA 3DZGA 2VXCA 2YYAA 3FDIA 4CHGA 1PZHA 3H1TA 3NRJA 3NC4A 4G89A 4HUJA 4QA9A 4YASA 3TPCA 1YULA 2C9DA 2UAGA 3VR3D 1ISPA 5DM1A 3LUFA 4MDYA 3E3NA 4DIKA 3NHWA 2E4WA 3FPFA 4Y6SA 1NXPA 2JHPA 1XZDA 5AKLA 3PC8C 1TRHA 3GFBA 3FDZA 4BAUA 1V35A 4TPKA 3DMPA 5THXA 2LVBA 2YOFA 1IMOA 1LLCA 2Y0EA 3STHA 1TYCA 4IO1A 3VZCA 4XPIA 1YZNA 3U7HB 8ADHA 1KI7A 3TRJA 4BCDA 1OCEA 3G49A 2PSJA 4IF6A 4JOSA 2D13A 4MVJI 5DFAA 1BAPA 4CUKA 4BKMA 1GGNA 4KNWA 5JTUA 3KCQA 1MVNA 1QFJA 2BGIA 1KTVA 2LDBA 2VIIA 3BJZA 4WV3A 4BX3A 4LF6B 4MVJA 2RGDA 3T7EA 4DE5A 1FMLA 3SJZA 2ZXUA 3DEIA 3QPUA 3I4CA 3VPHA 3C0KA 4U2KA 5ER6A 4LBZA 4YAOA 3C6ZA 4IVPA 5ALOA 2G67A 3M4JA 4CKWB 3ZDAA 2O8BB 4ER3A 2XDQB 3WICA 3HUEA 3PUVA 3O1JC 3V8NA 2HDWA 4YQZA 5AW7A 5J2TB 5TC4A 1JHAA 1BO6A 3TLZA 2BHRA 4HXYA 3QXJA 2BKAA 1HGXA 3KKQA 4NKRA 3AF2A 4NG5A 5WRFA 3AVOA 1R15A 4MV0A 2NUTA 3RF6A 3VSCA 2W9XA 3DV0A 3L77A 1UJ2A 4XM0A 5AI4A 3LPLA 4B80A 1DLJA 4N0QA 4DG9A 1OBOA 1N1MA 2VNKA 1YQ9A 3FWZA 5HW0A 1QU3A 3O93A 3OQPA 5DGHA 1IOVA 3P5BA 1PFYA 1KSGA 3NUQA 4NE2A 1WCYA 4W4TA 1OZ0A 1Q1GA 4PG5A 5CNIA 3SHQA 3BMOB 1YHNA 2K87A 5FBWB 3P1JA 1QWSA 5DGTA 4MDFA 3MMPA 1E3JA 1XDSA 4FEYA 3DJYA 5A5FA 3WX0A 4MMZB 5ALJA 4NZMA 4LYDA 4RZIA 3U0BA 4MZXA 3UT6A 2ZEJA 5DHFA 1ZISA 1GV0A 4FBGA 4M1ZA 1LTQA 3NVAA 3RTEA 2M6KA 3AESB 3SKVA 1CUFA 3PKJA 5EGNA 4GLJA 4B6EA 4O1HA 1SHJA 3J81A 1W6RA 3TX2A 1BVUA 4ZVRA 5C8YB 5LD2C 3UMRA 2Z04A 1Q7TA 2PMFA 4TWJA 2AW5A 1FFAA 5GONF 4Z4HA 4WK2B 4K26A 2P78A 3SE7A 5HRAA 5D8DA 3AKZA 1QLWA 4B73A 3G5TA 5CXXA 5JZSA 2PEZA 4IHJF 2VPZA 3H65A 5AW3A 2Q1WA 2X8AA 3HI4A 1ISHA 1GVNB 4YA6A 2PTHA 3QPBA 4AYXA 3M4NA 2PZGA 1QHGA 1OBVA 3ADKA 2Z83A 4PLGA 4F46A 2IOQA 3JARB 3F3KA 1K7CA 3N28A 1SULA 4GOKA 2O2DA 1QYXA 3AMVA 4NHOA 5DLQC 2Q6TA 4XWKA 5BY2A 1TYEB 1KSHA 4PGFA 4P4SB 1G5TA 3VDQA 1FDIA 3LBIA 5JD3A 1KS2A 4DC9A 4PR0A 1R8YA 4C6TA 1NQUA 3EIUA 3V1NA 1ZP6A 1JPUA 3QLUC 5IP5A 4D3FA 3AILA 3OD1A 4Q47A 4ARAA 5FOQA 5K01A 2EYQA 1NN5A 2XF8A 2XITA 2XQIA 2GASA 1NFQA 3IPAA 5CVTA 2O8EA 1XVVA 4RH1A 3ZTWA 2CXHA 5B4UA 1F20A 1YAJA 2W48A 1FB5A 4G37A 4LBYA 4XGKA 2DMRA 5REQA 3LT4A 1XLTC 2C3MA 4Q4HB 3FOZA 3N1UA 5KHAA 2NZYA 2HMVA 3VR6D 1R0XA 3AEQB 2ZRDA 5I8PA 1DKNA 3F98A 4G1MB 2XB6A 1KY2A 4YVFA 2AC4A 4DLZA 3UV3A 1H0RA 5IDQA 3U4CA 3KJHA 1E9FA 5DGIA 1CRLA 3FSGD 5KJEA 2C5BA 2CZGA 3K5PA 5KX5F 4XFJA 5CYOA 1CRZA 2ID8A 1R4NB 4BB6A 3G9TA 3Q7QA 1R9JA 3MC1A 4BQNA 4F2WA 5I7RA 2GMWA 1Z4IA 2J46A 3TO5A 5ALRA 3C43A 3URMA 3EEQA 3LZ6A 3SXUA 3CTPA 4MJ7A 3VPAA 2VKQA 4QO7A 3WLQA 1ZGGA 3RIYA 3DHNA 3ILYA 1O6FA 1XLVA 5CLLA 3ZJVA 1K7YA 4JVOA 3RRFA 4PY2A 1E4EB 1VJCA 1AZWA 2NO7A 4S1TA 5F5XA 4A82A 3ZW7A 4EQ6B 5ALMA 5F3WB 4E5VA 1QH1B 4HFMA 2V5UA 4OJYA 1WCV1 3CIFA 3CXUA 4E03A 2Z6AA 1UPFA 1UBSB 4IDEA 4J0HA 2YN2A 4OHUA 4MA5A 1N2XA 3IT1A 4Z0PA 3SYRA 3HABA 1EDDA 1G8FA 2ZIVB 5LNK6 2A94A 1ADYA 1EVYA 1YVDA 1VLHA 2DUMA 3CZCA 2B8TA 4QU5A 3E0QA 4AX8A 5BQPA 3CRZA 3QXCA 2O2SA 3F0TA 4QFCA 4U2GA 4BNNA 1WV0A 5IKMA 2D0DA 5TQVA 3RK0A 3P9IA 4DR7B 1N2OA 3NBUA 4N47A 4CKXA 2DBRA 2AEJA 2YRWA 1WU8A 4Y8VA 4US2R 1OT5A 1S3FA 2K7ZA 3BT7A 5HSGA 4KE8A 3KUCA 2PR2A 1CWUA 4RJJA 5HF6A 1O96A 1EINA 4KKXB 1I0ZA 2CXNA 1WCXA 2F1HA 2ZYGA 4NYIQ 4E70A 5IT4A 2V4ZA 4RKQA 3RTBA 1Z0AA 4DNXA 4BZQA 2X0NA 1E1NA 2XD4A 1FOEB 4BE9A 4EPTA 2YZMA 4RY9A 3FNIA 1JHRA 4CKBB 1YQTA 4G2NA 4MV7A 5H3CA 3LO8A 1SN7A 2EKLA 3KAPA 5LR6A 4M1QA 1ORIA 3ZU3A 2AX4A 4YRRA 1CR4A 4XASA 3LQFA 1N7IA 3HA5A 4XIJA 3PXUA 3O82A 3U81A 3ZGYA 2RSLA 4C3OB 1R0BA 2VXYA 1TUIA 2WA1A 3RG8A 4PWZA 4XYMA 4XRRA 2P9QA 3SFZA 3O74A 1EGQA 1PYOA 4RVGA 3KVNA 5G0WA 4MIOA 2C20A 3J80A 2ZIZA 3GLSA 3QFRA 4EL5A 3CW2A 4L7VA 2W6IA 3OJCA 2WWHA 1X19A 5GJVC 2CNDA 1JJAA 2BZ1A 3D3KA 3V9PA 3EJ6A 2R9VA 1B8OA 1DBWA 1KVRA 2WJ6A 3QMMA 4GMXA 4MS3B 4YJFB 1SCDA 5DLEA 1WBDA 5JVDB 4PVDA 1JQ5A 1I3NA 4ZQGA 4Q3KA 5A4DA 4ASUA 5L4LA 1N32B 1SPXA 1VRVA 1XAJA 3DCNA 4YAJA 4L4SA 2JGLA 5EUMA 3W9YA 2UXDB 8GPBA 4K9OA 2VJKA 2C82A 2I8LA 4BO0A 1R88A 2ZVQX 5I47A 2RARA 4J0GA 4XD7A 4U9HS 4ARZA 4U8GA 1T6BY 1DXHA 3VGPA 3M5CA 5AVYA 3VSEA 2GO7A 4OHCA 4MWZA 1H4TA 3S29A 2OZEA 3Q2KA 4OJNA 3W3AH 2J4CA 1O08A 4C5AA 2V1XA 1X7ZB 1SJ9A 1SCUB 4DV4B 1Y1SA 1DDOA 5EJ5A 2C5FA 2R86A 2XNDD 1P31A 3W2FA 5TQ2A 4CMIA 1Y7IA 3BMCA 2DFLA 3V6MA 4Z51A 2WU8A 1JDUA 1M1YA 5LSAA 2V97A 5HPYB 5JXIA 3J7TA 2Y66A 2D1RA 5DI3B 2ENUA 4G5XA 1VG1A 2JAHA 4P4LA 2HJHA 1AS3A 1DJLA 1HMPA 1W5FA 2ZPTX 4PO1A 3AJRA 3LPAA 3DMTC 3CG4A 4LK3A 4MCAA 5KTSA 3HTXA 5FYQA 2G0TA 3WGNA 1F8FA 3ZXXA 4WK4B 4UVEA 3EVEA 4Q3AA 4GMDA 2ZTLA 3HU1A 5HIKA 2D1QA 2ZBQA 1BJKA 3A3YA 3FN4A 1LTKA 1RZUA 2PKWA 3CH4B 3I2FA 2X23A 3NYWA 4KLZA 4UPDA 3R7LA 5MDHA 2HWUA 2OMKA 1ONBA 3WMRA 1H4SA 1CR0A 1YASA 4C08A 1WZNA 1CS4C 3OLVA 1U4OA 4JELA 1HV8A 4IG4A 4MWOA 4OQNA 4X0EA 3HLYA 4REQA 2VJAA 1XAIA 4LJAA 4POOA 1BXGA 2M2IA 3QFSA 4BXOA 1WW3A 2P62A 4IYRA 2IELA 4LZOA 2V7EA 1VECA 1R6VA 3O9MA 4P83A 4ZOCA 5LOVA 3GO4A 3EGEA 4OOEA 1LK5A 1UMDA 2XT9A 4M98A 5JU6A 1VL6A 1OXUA 2J09A 4KGDA 3UM9A 2FSVC 4U2BA 5JCJA 3ZUGA 4QDTA 2ZOSA 3RRJA 3I2HA 4W8GA 4JJEA 3NORA 4YBZA 1XMSA 4H1VA 2I2FA 4C0HA 1DJQA 1NIJA 1QIJA 3LX6A 4U0KA 4Z6KA 3BHJA 1X80B 1SRQA 2YWRA 4BYGA 1V1JA 4O2AF 4R1PA 2ET6A 1HO3A 1P2BA 4RXUA 3S7TA 3KKZA 2B37A 4U7PB 4WIAA 5E9AA 4A8JA 1FXSA 5CEEA 3DJFA 5BRNA 3DOJA 3ELWA 4BP3A 1BXZA 3D2AA 1B76A 1W36C 4FYPA 5BNFA 1DKQA 1ADFA 3GT4A 4LWOA 3I1JA 3LIPA 5EEHA 2V03A 3A9VA 1N2ZA 4LE1A 3GA7A 3T3MB 2OYRA 3WP0A 3EEOA 1IG0A 1PLJA 2W43A 5CDYA 5KOIA 1O6ZA 3TIGA 4NOLA 4BC1A 4Q15A 1GTJ1 2KQUA 4X92A 2GBLA 3LXMA 5ESRA 4YPFA 4E2WA 3CMMA 1PQPA 3ESRA 4TV8F 5AHKA 4RTPA 3QG1A 4YUVA 6PFKA 3O4RA 3W5DA 3LS2A 1WLSA 1RRCA 4J4HA 1V2GA 1QB7A 2XUQA 4MWCA 1JIJA 2IEBA 2JFQA 3MCTA 4O2RA 3I5YA 2I67A 4ZOLF 4B4UA 2IK8A 4EEZA 2QAIA 3GLIB 3ZVMA 1Y6ZA 2K6GA 1DZIA 2V7XA 3HMKA 4FGLA 3AEUB 2NSHA 2ZIXA 5LLSA 3TD2A 4P92A 1YVUA 4FLMA 4UNIA 2Z43A 2GEVA 2OHGA 3DFMA 1XUOA 1RJDA 2VUSA 3DTVD 3R8XA 3RBVA 4B7ZA 4F0JA 1YRWA 1YOVB 3F3SA 1AUOA 3O6VA 1GAQA 1HLPA 3O9ZA 4FD3A 3S99A 4TYQA 3AQIA 2OHOA 4LY6A 4NHEA 1NVWQ 2IVFA 3CT6A 3VTAA 3VYRB 2VDOB 1XE3A 4R1LA 4FQ7A 4RFVA 3K0CC 1KO7A 1GSAA 5PGMA 4EECA 1LX6A 1QMPA 2H2DA 2ICAA 3ISVA 1P18A 4IQ4A 1EDBA 4CTKA 1GAWA 3GLQA 1C9EA 2X9LA 1ZW6A 4OXRA 4PVCA 3L8YA 4ZC8A 3JQ8B 2XBMA 5FHRA 3ZEAA 4ZHSA 3QF4B 5U9CA 1YKFA 1U04A 3GMIA 4LJSA 2NTJA 4DSNA 3U3ZA 1YRBA 2BUBA 4HUQA 4H1HA 1RJEA 1XF1A 4HDNA 2QSYA 4R0NA 1M5UA 1T5SA 1SOUA 4KE6A 4MPPA 4OJMX 3A0RB 4X00A 3EGXB 5ALUA 5LJIA 2WI8A 4GM4A 3WGMA 4C2AA 2Q3LA 4Q7QA 1GPUA 1YB2A 3MPUA 1QQ7A 3BS4A 3BCHA 3DD1A 2I3ZA 4L02A 2ZWVA 3QM1A 4D9CA 1B14A 5TV2A 1ISSA 2BFFA 2Z9CA 3V1TC 4BO9A 4II3A 1KEEA 2XUGA 3F6SA 3O2JA 3B53X 3O26A 4ALMA 2WTBA 1D7OA 4OX9B 4PRYA 3PR1A 4EHNA 1U1GA 3AUJB 4ENSA 2CSUA 3GMDA 1MABA 1NXXA 1Z0SA 2YC4C 2JFNA 2V4UA 3AHDA 3QVWA 4UAUA 4CIVA 3ISTA 4H3SA 1VJ5A 3KOMA 3DBOB 1XA4A 4FXOA 1E9SA 1C1DA 1NRIA 4JEMA 4YGXB 5JAUA 2VT6A 1J1ZA 4MLPA 4NCJA 4N82A 2QUZA 4RTKA 4EAAA 4PQRA 5JSZA 2YNMA 2ZB4A 2VBIA 1Q0HA 4MAMA 3W34A 4FUTA 5E4FA 2WZBA 1JLHA 1YJBA 4LRWA 3GQBA 4ZI2A 1O6GA 2VDUE 3OPXA 4B2YA 2I7DA 3DSRA 3KSZO 4KMRA 3T6KA 2DYKA 2X8LA 2NYVA 3G9XA 4RA6B 3TLGB 4M36A 2FEKA 4ZYYA 3NQ41 2ECKA 1HT0A 3NIWA 1QRTA 1SO8A 4MVCA 4XQ9A 1CUXA 1H2BA 4F11A 1ML3A 2LP4Y 2IT1A 4DLPA 2H07A 3R1IA 2J3IA 3NUZA 1MC8A 1E69A 3OLCX 3TRFA 2D3TA 4MYTA 2W2XA 4MUGA 4N3NA 4TKZA 1G8MA 1EEXB 1X9HA 4XJVA 3KQQA 4Q6WA 4U2FA 1PJTA 3TSCA 4JYBA 1G3MA 5A3SA 2C29D 3B6ZA 4UEOA 3IEXA 2P91A 1ZH6A 1YS2X 5FO1A 3JTMA 4UU7A 3NEAA 8ATCA 3EFBA 3OX2A 2VCEA 1ILWA 3RC1A 1B15A 4DJAA 1ZJ6A 4HAVA 4Q16A 5SYNA 3BFVA 1A95A 1TIKA 4CUJA 1IU9A 4DWJA 3MEQA 4L5YA 2JBAA 1UQUA 4OHMA 5B1DA 3LWZA 3SQXA 2B25A 1CR6A 3N8DA 2VPQA 2Q3DA 1LUAA 3PFNA 1UKYA 3VU3A 1WSAA 1N0VC 4GLOA 5JG7A 4QEDA 1VDZA 4YLGA 3TTVA 5BUSA 3INYA 3TKYA 3ZHUA 3NIGB 5I4IA 1B41A 1YGYA 2PX3A 3A05A 3L02A 3OLYA 1XRNA 4RHEA 4YRCA 2R84A 2WJPA 3EQ2A 3TNYA 3B36A 2PJUA 3C4JA 4MWDA 4BMXA 1XP8A 1DCTA 2WHRA 4NU5A 1GPMA 2IXEA 3WYFA 1H8HA 3BORA 2DQSA 3ZW8A 2XZOA 1MJGA 4MWTA 3BXXA 4OLBA 5IKEA 3K09A 4LAFA 4UOQA 5FQNA 2YMMA 3ZVNA 1RE1A 3RC3A 2VC2B 4B3GA 3ZE9A 1ODIA 4NBWA 1KIFA 4PYLA 5EJ2A 2Z2KA 3WGTA 2FZEA 2A9JA 4TVKA 3RFTA 5CFLA 1VKJA 2X3UA 2FZKA 3QPCA 4QTUB 4R8MA 4TXHA 2CJFA 4FKBA 3NWBA 2ZJ5A 3A1TA 3M34A 3AKCA 4PSCA 2WKWA 2PMBA 5J5AA 4BO4A 1EXDA 5F9FA 4K6GA 1P1JA 4X1OA 3KEQA 2GLTA 1W581 4E1AA 6ABPA 4ZOAA 1W0JA 3AEZA 2ZCJA 1EUCA 1DBRA 1ADGA 1I6WA 4F7DA 1TCAA 2ORWA 3SD7A 2HRBA 1O95A 2QYHA 5ARCA 4JVMA 5TXGA 3RUHA 1DAOA 3JWIA 4JI3B 1GGVA 3BFXA 1FMFA 1KRXA 2AB0A 2X5NA 2JFHA 2Q0HA 2W2OA 1AIPA 4J29A 3H2BA 4L5CA 1U0FA 1XYGA 1PR4A 1TGYA 4I4TF 4M21A 4UPVA 4XWYA 5BVGB 2VTEA 4U7FA 2P41A 5LA6B 4HC4A 3HJFA 2C9ZA 5EIAA 1JW9B 2FSPA 4FZRA 1GUZA 5FYDA 4A23A 2FQXA 1EHYA 4WKGA 2RJNA 3CB4A 2R79A 3GXBA 4XLZA 2QQ0A 4M8KA 1A8IA 3S55A 3GRZA 4UZSA 4QWMA 2ZIWB 1K5HA 1F2VA 1PD0A 3E05A 3L6DA 4JFRA 4UNPA 3WBFA 4D9NA 3VKGA 3FD8A 5AKHA 2XRMA 5TE9A 3ZK8A 1VQ1A 2VH5R 2ZUWA 3F6CA 1MC1A 1KDOA 3MCVA 3OCJA 4QUAA 5TIIA 3OQ1A 2F9MA 4ESOA 3DEZA 4PZEA 2B82A 1PQWA 1HFEL 4FW8A 4MYRA 4GPD1 1AY0A 3KPJA 2W8ZA 3VI4B 1DAEA 1I32A 3D0QA 3EGVA 3FMOB 4S12A 1XRJA 1A9YA 3FLAA 5CIWA 1GA4A 3PIRA 4WLEA 4G9BA 4IQFA 1RXCA 3ST7A 3LQKA 4EVQA 4DDUA 2QBYB 3PDWA 1Z4JA 3VX3A 4CF4A 3EPHA 1LPSA 1E9DA 2AUMA 1JDTA 1LA2A 1EJ2A 1I2MA 1P9RA 1V41E 2I2BA 2P2DA 2ZYDA 3DUWA 3JR7A 4JNCA 1DTEA 2JFPA 4UUMA 4PYIA 1HK7A 3I0MA 4HSEA 1OTHA 5AW9A 3WL5A 5IXYA 4CKYA 5A5VA 3KM0A 1U3VA 2OT3B 2VYQA 3AETB 1QFSA 3FPJA 3MFYA 3OO0A 4YJ3A 1Z39A 4DIFA 4ZI5A 4NK4A 4OO3A 2NWQA 1GPYA 3PTAA 3I73A 1S1MA 2IUYA 2GOYA 3CXRA 1SC1A 1QCDA 4UBLA 1PTKA 3WGKA 2BFEA 3NTLA 4OQMA 3ZH9B 9GPBA 3GZ4A 3V8VA 3VNVA 1G9TA 2WPNA 3KB2A 2IEZA 2H48A 2VXBA 2IHYA 2XTMA 1DQZA 4UHCA 1GNLA 4W9NA 4LZNA 3E9QA 5C8ZA 2P68A 1OGJA 1V5FA 2E6KA 5IEJA 1I4WA 4D26A 3I8OA 4E4TA 4QUEA 4GI3A 3VSAA 4URWR 2QJRA 3LK7A 1JA9A 1UT5A 1PUIA 4F12A 5FWDA 1NUUA 4C3ZA 1X92A 1YQGA 1KJ8A 2H9IA 4K5QA 4OUDB 4B3XA 3WGOA 1K88A 2JJ1D 1NNUA 3EH1A 1C30A 1OPXA 1WEKA 1C7IA 1ZJYA 2AZ4A 5FUWA 3VYWA 3GN1A 1YL5A 5FBVB 1X13A 1GLNA 3OIUA 4A2CA 1E3TA 3OPVA 4IIFA 3PD1A 1RC1A 5DT9A 4ZYUA 4GKVA 5FNVF 4W5RA 4HH3C 1YB4A 2C57A 1ZEMA 2RH8A 4BS9A 3D4OA 4ZDKA 1X8KA 3I6YA 4PG6A 2J9RA 4M7RA 3PEWA 4Y1GA 4MQLA 3VV2A 1Q19A 3N2KB 1QG2A 1XVLA 1ZGCA 4MCIA 1P4RA 1JFSA 1U98A 1H3NA 1WR8A 2VYNA 3FTDA 3QIVA 5CYFA 2NXWA 2XI4A 4LVCA 1NGSA 4TMKA 2ZGVA 4FFPA 4I1UA 1OZHA 4BFCA 3KVYA 4U9IS 3PD7A 4U6SA 5FF9A 5JH7A 2WTUA 1ODCA 4FGSA 1RKUA 3HCNA 3H5AA 4LF4B 2I03A 5K51A 1E96A 1NY5A 4GR4A 2PMKA 4JSRA 2W0MA 3GVIA 1ZMOA 3OCYA 4MI6A 4Q5IA 3W7AA 3L0BA 4Q1DA 1YDHA 2BJVA 1IBMB 1TFUA 4OHPA 1PQUA 1MCZA 3OOYA 3DV0B 3I0ZA 4DEYA 5KNDA 3Q11A 5KEIA 4PNEA 3QFHA 3QG5A 4YV1A 3JQPA 4UUOA 1R6XA 2WP0A 4DREA 2OQIA 1YACA 3I5AA 1QYDA 3S70A 2IP1A 3CLVA 1VC2A 4ZT4A 2ZYSA 4JX8A 5BV1A 3VR3A 2R2AA 1DG3A 4MXDA 3CZ9A 3KEFA 2ATVA 4EG5A 4M9XA 1P5FA 4HK4A 3VFDA 1ACLA 3E22A 3NOQA 2R1ZA 3PC6A 4I4NA 4DV0B 1CUZA 4ZIRA 1C3LA 4RVHA 2HMWA 4UXIA 4UAGA 4ZI7A 2GUWA 4HS9A 4BBAA 3UMSA 3MGBA 4FB5A 1GA6A 4BX0A 3CLRC 4BMYA 1KEUA 1SG9A 4GS5A 1EFDN 2BI4A 3GRVA 4IY1A 3PNSA 1RYZA 5BSVA 3EQ7A 3DNFA 2YS6A 2UU9B 4IIJF 4BX9A 2A88A 4KR7A 1F0NA 3BX1A 4TYYA 4N6GA 3A1DA 1T1GA 3JQBA 2FN3A 3HXTA 4OQLA 5F5LA 3UKOA 3AI3A 1E63A 4Z1OA 2WF5A 2I7VA 5JAOA 1UK7A 2HA2A 3QUBA 3OJFA 1PVVA 1J25A 4N3AA 4HPWA 1Q0UA 2I54A 4TV9A 2P79A 1WG8A 3FSRA 3PRYA 4GOMD 4QOEA 2AMVA 5LQJA 2J08A 5GINE 2QN8A 4CLEA 3E4CA 3LBHA 1OJ7A 4FE4A 2H0QA 1M72A 3OC0A 2QQGA 2DXIA 5KQGA 4EO4A 2BEUA 5EKTA 4D2IA 1Z12A 2C7QA 3ID6C 5E6UA 4CR8A 1X9IA 3QYJA 4WJZA 4C6TB 4PN3A 2YN4A 1TL7C 1S2LA 3PUKA 5KB3A 1X1AA 4LS3A 3TR5A 2AJDA 4IUCS 5ABPA 2YWCA 1QR6A 2O8EB 3ZHRA 1AQUA 4LCJA 1W59A 5EHXA 2XMSA 4HH0A 1QHHA 2GDJA 2ZBFA 2FW9A 4HG2A 3N0XA 5FOSA 1NW4A 2RHHA 1NW7A 5CBPB 1CUYA 4BP8A 1U9CA 3A11A 5ALIA 1E7QA 2EP7A 1PUXA 4H3VA 1B8PA 1LGYA 1USUA 3DOIA 5FI5A 3W4JA 4MYHA 3FCYA 3UT5B 3DDOA 3LNCA 4UFPA 2R6GA 2RAUA 4OP1A 2Q4OA 3GP8A 3ES9A 3GF4A 3RVMA 3E9ZA 5L6MB 5BMVF 4UUNA 3EMKA 2AX3A 2HEGA 4X54A 3QFCA 5TVKA 1CRQA 3SXUB 1W36D 3EIQA 3TMKA 4MO2A 1MV8A 4TYWA 2X8JA 3LI2A 2FSHA 2XIJA 3Q8LA 1NJ5A 3IT2A 3PDIA 4KGXA 1JN0A 2PX5A 2QENA 3D4IA 1Y3FE 1DG9A 3AHIA 1Y6GA 3K1JA 1YFKA 1DP4A 4FGKA 1N6IA 4RZHA 3VQTA 1DRJA 1RVDA 2SNIE 3ZY6A 3U61B 1YZGA 2WIKA 5K6TA 4Q34A 3COZA 4X9XA 3PA6A 2XLBA 4ZMRA 3KZNA 1HBJA 1HL7A 1O89A 1UL1X 4G1UC 1RI2A 4Y6LA 5EA2A 3DE1X 1KHTA 1AG9A 1YZHA 4EJ0A 5K7SA 2CFRA 1IHXA 5L3RA 4ZOQI 3A6DA 2ZTHA 5F77A 4DA7A 3NFRA 2IYQA 3MCWA 3LYHA 2ODQA 2KLHA 2RI1A 1FDOA 1E8DA 3H9UA 3GCXA 2IU3A 2VA8A 2F7SA 4O63O 4QQFA 4B09A 3I1FA 1TU3A 2P9YA 1MAWA 1W2WB 5HCNA 3VR6A 3FYUA 2X41A 3A1WA 2X7XA 1MORA 3W06A 1DOAA 1QS0A 1UWLA 1ZM7A 2JPDA 1O96B 5LDDC 2QLLA 2YUTA 4PC3A 1GKKA 1V6CA 2QAGA 2X58A 1NJGA 2ZR0A 3W3ZB 2JLSA 5AR1A 5CBKA 5DP2A 2Z58A 3FSGA 3RDPA 1AHNA 5IH7A 2CXTA 5LUBA 3GA0A 1VLMA 1RAEA 2KI5A 5L6LB 1PZGA 1VM6A 4ND4A 2XODA 3A9RA 2GZ3A 4IDHA 1GT91 4O59O 4Z0NA 4CBVA 1K3UB 1KZ7B 4UVHA 3RVKA 4RXTA 1KF0A 3KKMA 1MB0A 3QWHA 4EHIA 1G6Q1 2EW2A 3ONNA 1D8TA 2PWBA 5CRIA 3K32A 1NV8A 5A7HA 2IS2A 4LWPA 3C7TA 5J43A 1VCHA 3KPVA 4PC7A 1AGXA 2I3BA 2X77A 4GC5A 1D0SA 3GT0A 3DLIA 2LD4A 4KFRA 4Z7NB 3IV7A 1T9GR 3NHZA 2VG8A 4NBUA 4RK1A 4DY4A 2B5VA 4NATA 3LD9A 2D1FA 3T7CA 1JPVA 2BV3A 2D54A 3TJZA 5HKLA 1P0MA 3H4IA 4XARA 4J0JA 2CE7A 2QRJA 1H9CA 1CY0A 5IUJC 1KZ9A 4LRSB 5A1JA 3IVAA 1EXWA 1GZ4A 5T7BA 3PYMA 3ORSA 2ZTSA 2E2WA 3F7TA 1Y6JA 3NX4A 4WFJA 2G9NA 2ZCVA 1FP4A 4AY6A 1PVDA 1VGRA 3KLBA 3SE0A 1FFCA 3DHVA 5AW8A 1AXRA 4F3YA 3FDFA 2Q0SA 1UIRA 5F2KA 1T4GA 4ARZB 2GAOA 3WB9A 1F4VA 5LPNA 2QLMA 2CFOA 3MRVA 4FN5A 2R60A 2WFZA 3U16A 1R4MA 4OVKA 3BB3A 2DPMA 3FVVA 2YQZA 1OBHA 2WABA 2V7GA 2R6ZA 3Q8MA 2QF7A 3JQ9C 4P36A 5D86A 4CG1A 2IXDA 1OFHA 1E5LA 1OSNA 1XRLA 3MJTA 5KVQA 2VJNA 2HXGA 3MUNA 5CCBA 2HRRA 4BKRA 2UUOA 4OMCA 3FE2A 1Y7TA 5TQ2B 3BMCB 2HN9A 4KC0A 3WIVA 3KQLA 1JYEA 1EUYA 1Z5WA 2XQGA 2GESA 1KEKA 1Y6QA 1I5RA 3BQNB 4V2UA 3P2EA 4DIEA 1HSOA 3TLMA 4NBLA 4JB2A 4TQGA 5EKSA 1RFLA 4RK6A 1UMCA 2RDMA 2I9PA 2PGOA 4H15A 4RMNA 1KMHB 4U9UA 2EGHA 4ZXPA 4GQIA 4O4HF 5KYKA 2ISQA 3MLAA 4G81A 3T5AA 1EWKA 2XZTA 1F0PA 5SZHB 2FPMA 2A7QA 3PQ7A 1A5BB 4ZCIA 3WAJA 1TM7E 4ZYLA 1ORTA 1SR8A 3BL5A 2VP9A 2OMEA 4F6CA 1V47A 1QANA 1GDTA 4IIDA 1GYQA 2ZJAA 3WNDA 1WDWB 3K96A 4U7JA 2LV8A 4Z3KA 5HK9A 2QGZA 1MQAA 1Z2AA 1JLKA 2H5JA 5KYUB 2XLCA 1NUHA 2UDPA 1VJ0A 1BXGB 4LDRA 4FFNA 4A2QA 1T8YA 2Q4BA 4BXOB 1IIBA 4Y2TA 5C18A 1BX0A 5LOVB 3TMYA 4X7RA 5TEVA 2EU8A 5KSOA 1Q50A 2B8EA 2QD3A 1L5HB 3GN2A 4MW5A 3HXKA 4NYMQ 3ZBQA 1M6NA 5FA8A 5U1PA 4EMTA 2X6TA 1SEPA 3O21A 1Z33A 4LPKA 3HWX1 1LC0A 1WWKA 3IP7A 4BEBA 2A57A 4JLKA 4PTYA 3QVOA 3FX2A 3L8CA 1WZ2A 3HWWA 3FTFA 1S8OA 1E2UA 3VDRA 3NGXA 2NV2B 4ZALA 2Z95A 1WB9A 2Y1CA 3Q88A 5U4XA 1NC3A 5HJ2A 3TUZC 4IBOA 4A8JB 3KLNA 3T5TA 3LZDA 3JYOA 3IEPA 2H11A 3LP8A 5ILGA 4EA8A 5B55A 2DZDA 5K6AA 2ECPA 2YIMA 4U6NA 4MPRA 2VZ0A 5F51A 3H9CA 3KUUA 5IBPA 4D82A 3DV2A 3FJYA 4FD2A 3HBAA 4X24A 5FBZA 3K2BA 2Z8ZA 2PKCA 2OBXA 3GJ3A 1H85A 3HU3A 4NMMA 2HIGA 5GMOA 4EAQA 4F6RA 4ZEMA 1RBQA 4DBVO 4R7GA 1A0OA 1D5WA 1NF8A 1B0AA 4M22A 3WA6A 2ONCA 3RABA 4NNPA 4DA9A 4BQFA 1OA1A 2F55A 1WCIA 3RSHA 2FWNA 3EF1A 5FP0A 4DDKA 5I9BA 3M1LA 3HUTA 1F4PA 2WD9A 3A4YA 1A7KA 3MD9A 2FXIA 3IH5A 2PH3A 5A2QA 5J2UA 4CL8A 2FG7C 1J49A 2PR7A 2B6HA 1WUTA 1HDOA 2VNAA 1E6WA 2PIAA 4FYIA 5DNEA 2B21A 2ZIXB 3BCSA 1FE8A 1P91A 1VRWA 2QP4A 3I2IA 4R54A 5DGXA 3WL6A 4P7JA 2KPOA 4WOJA 2F3QA 3HR8A 3GEDA 5FEUA 2GCGA 1YH3A 1K06A 1R37A 1NBOA 3N2GA 1T26A 1UFKA 1UZUA 4JENA 1T0PA 2EQ5A 4GGOA 4B32A 1Q15A 3BXEA 4JBWA 1A96A 2WIFA 3NM6B 2A3NA 3GL9A 2FX3A 3QVJA 5C8XA 2ZQYA 2GEKA 1L5YA 5EWJA 2FEMA 4E0BA 2H08A 3QHAA 3LUPA 1EUDB 3CONA 1NAHA 5TY0A 4RWEA 2JLWA 2VRCD 3SJUA 1J9ZA 3TLBA 4MGYR 2PRIA 4J1TC 5LL6P 4FFBB 1VZ2A 3OQHA 4GE3A 4HFNA 5H4HA 3TGLA 4KV9A 5LKRA 2WG1A 3CWQA 1NVVR 4L3VA 5JTTA 1SKQA 4HUQB 2ATIA 2YR0A 3ORRA 1YA4A 1CF2O 4HDNB 3RC7A 4F5ZA 1GITA 3CR8A 4LX0A 2QQFA 1MAUA 2ZIAA 5FI1B 1CETA 5CX1A 1WMEA 1IQ0A 2LIVA 4EATA 5D1HA 3F7OA 1N6LA 2CFIA 4NCNA 4TLLB 2FPGA 2G82A 5BT9A 3WTCA 1E18A 4LOKA 1YUNA 3I92A 2Z5VA 3AF4A 3PFIA 2CFCA 3GGCA 4K9SA 5CCEA 5HQ3A 1WXDA 1XLWA 3SKXA 3TZKA 3WIEA 1MABB 4OU4A 2QN9A 2I2AA 2EZ4A 1PGQA 1USIA 4EB8A 1KFEB 2R1TA 1C1DB 1DRKA 1IYZA 1CZKA 3OFJA 2JHGA 4IIEA 2JAQA 1U0EA 3A7DA 2I62A 4BNFA 2HNKA 2DFTA 5JSZB 4G1VA 4UDYX 5I4CA 3B9PA 2ACKA 1H94A 2DT8A 3E61A 4Q82A 3DTVA 1IN5A 4WD3A 2PBRA 3GQBB 4YPVA 4KQGA 2Z3VA 5CYPA 1PTJA 3DE4X 4YP5A 1V16B 2JFFA 2O9JA 2ZJFA 1Q3HA 1KDPA 1YVPA 1UKZA 4B3SB 1K6MA 2O7NA 4K0RA 2LIPA 3BQMB 1EVZA 1QTNA 1R4AA 3HN7A 5KVAA 2E4VA 3BDIA 4UNQA 4DDMA 5JSKA 3T4UA 1KKMA 4XYBA 1C1XA 2HYIC 3GOHA 1XK7A 4S1OA 1T2DA 3DLBA 5E2AA 3NB0A 3H2IA 3OD5A 5JALA 4LOAA 2X5OA 3TCXB 1L5RA 1M2JA 4Q01A 1C7EA 1DOHA 4O2LA 2WF9A 4OQQA 2J1LA 4LZLA 1SK8A 4QGAA 3A2NA 2H2IA 4BV9A 3U60B 3R9XA 3DOFA 5A0VA 2PO7A 1EK0A 1L5VA 4YS6A 5A7GA 3FMIA 3N8HA 1XVTA 1J2JA 1HETA 4JYCA 1IUNA 2Y6UA 3KOWA 4ZKDA 2AIRA 4TS3A 1S96A 1P0FA 2AOUB 3DAPA 3LW7A 3PXBA 2XKKA 3NRCA 4KJZA 3ZHSA 2JBAB 5EERA 1X7HA 3QVXA 3PXDA 5C9ZA 4YROA 1Y98A 5DEOA 1O6BA 5JO9A 2CLKB 3AOEA 4QOFA 3KEMA 3L1VA 4P3OA 2VQEB 3NDRA 4KTVE 5E6SA 1GAEO 1Y9JA 3ZS9A 1P9OA 1QG4A 3U4MA 2OYCA 1SCJA 4BMZA 4R2JA 1O5IA 1XU4A 4WN9A 2JLAA 4Z9BA 1KFBB 4R2KA 3HVJA 3VHXB 2VPPA 4JLOA 4RH0A 5ALEA 1B0ZA 3OJ0A 4C7MA 1X3SA 1L3BA 1YRYE 2D8MA 3IP9A 4C4TA 4MAAA 5T64A 3EC7A 1MMFB 3M6WA 4Q1CA 1PJ4A 5GV8A 4YUYA 1T2CA 1M2WA 1SOAA 3VMMA 5H8WA 1QFZA 3RYHA 2QTHA 1UC8A 2ZRKA 3HI6A 4Q7EA 3W3AD 2WWYA 3GR6A 1BGXT 2JLVA 2GR9A 4B81A 2PV7A 1STOA 2A9PA 2OPBA 2ZJ3A 3MERA 1Y9DA 1C29B 3KYBA 4RX1A 5KBYA 2CVHA 3EULA 2VJLA 1ND6A 1SA0A 3PE6A 3PJFA 3CLRD 4I08A 3WBBA 3KHKA 1JIXA 4IRUB 3B1WA 2BH2A 3W4KA 1XJQA 1AN9A 1C9DB 1MO5A 5JCXA 4HYYA 4XQGA 3SDSA 4DAEA 2C8VA 1BKYA 4H08A 4MGEA 3QJGA 1IM2A 4QDZA 1PHPA 2MSCB 2CHQA 2H7VA 2HHCA 1O77A 3Q2OA 1CB0A 2ATEA 4BTVA 5F7XA 1PFQA 5L3SA 2FMFA 3WGYA 5LM3A 3VKUA 4QYWA 3B7WA 3CF0A 4LVNA 1ECCA 2GI4A 3M4YA 3TL6A 2O2EA 1FQJA 4MW7A 3KFVA 4PHFA 4URHA 2I7XA 3E9NA 3SC2A 2C95A 4BMDA 1MB4A 3OPQA 2OORC 1EWRA 3K30A 3GLKA 3ED5A 3RNLA 2W2LD 1BVHA 1DT5A 3WLPA 1DUIA 3A6EA 3GJ7A 5I8ZA 1M7BA 3G7NA 1G38A 2Q3BA 2BVNA 2D2IA 2VK2A 4DYDA 1NRWA 2PFKA 3B6MA 4KWCA 1MN6A 3OT1B 2PZAA 3GEGA 1EJ6A 4AL4A 5JJBA 1AA6A 3U3DA 2HJWA 3MYRA 3KKOA 1VG0B 3DKVA 2OD2A 4YP9A 3NYQA 4RIGA 1ZUD1 3VV3A 3SXJA 2HA7A 3SZLA 1XZLA 1YFLA 1TOAA 2DFKB 1CR1A 2WWFA 3X1WA 1D2EA 1JTVA 1DARA 2XY4A 2Y05A 2ZIUB 2PBZA 2XCSB 4HDOB 5HBRA 421PA 1GCUA 3ZI4A 2ZBVA 3WGZA 3ZN2A 4AG6A 1FDVA 1CVRA 2XT6A 5DWDA 3I9V1 4KE9A 2QSZA 1HOTA 1XZAA 3A6HA 4PO3X 1IBKB 3D2LA 5E4YA 5EIHA 1P7ZA 2PUCA 3R0QA 4RMJA 4N7MA 2JI4A 5IAGA 5G0UA 5TX7A 1VP3A 3GPLA 4DLTA 4PG8A 1TMGE 3BL8A 4DB2A 5CFPA 5KTNA 2XMRA 4BATA 5IHPA 4RVDA 5KZMB 2ZDHA 2ZJBA 4QLOA 1DBQA 1N92A 2X7HA 5AWFC 5IEBA 1H2YA 1ZK3A 3AP1A 1U3GA 5T3YA 3C98A 4YJ3B 3VUFA 2NTVA 1V71A 4Y9UA 1NXOA 3HA2A 4OMFG 2QRLA 3DS8A 1YVRA 4IJUA 4Z0HO 5TMPA 2BCJQ 4M2LA 3DBHA 5FOWA 2VATA 1KXJA 4IHJB 3IDSA 4BP1A 3WGUA 2YN0A 3OTQA 2JA2A 4FOLA 4ZAFA 1Y4ZA 1R27A 1C0PA 4BNMA 1YB5A 2EQAA 2BFEB 2C61A 3NASA 4BKUA 4AX4A 4GKKB 3DZKA 1ZGZA 4FLFA 4PCUA 3AXTA 1JE0A 1ZSYA 3A4IA 4C06A 3ZZMA 1RHUA 4C4SA 1NMXA 2Q9AA 3ITEA 3KQVA 1CYDA 4AB1A 2Z8XA 4AZ3A 4EBBA 1NYQA 4AKGA 3L41A 3AHGA 5E7QA 2CSXA 4DPKA 4LIPD 1AB5A 1CDEA 3ETCA 2P8SA 4U4AA 1S02A 4UBOA 1E3DA 1KEZA 2XJ9A 3PTLA 3RASA 2IIVA 1SG0A 4DSAA 4FPXA 2VSFA 1ZVMA 1ZWKA 1DAKA 3BHIA 4J7AA 3RLIA 3H5NA 5CHYA 1XI2A 3HFGA 1RPAA 2G7ZA 4B40A 5JRJA 2ZUUA 1C30B 3PEVA 4GBGA 3WLRA 4OAOA 3AONB 3RFFA 5FTLA 2FFBA 2YINC 1ULBA 2HA4A 2WV7A 3N7AA 1J0AA 1TCUA 3N3AC 4TMWA 1GQRA 5GQSA 3WXBA 4CF6A 1Q74A 2PUFA 3TVYA 1WOMA 2Z6VA 1GIAA 3HKDA 2IWRA 3BIWA 3KJXA 4AJ9A 3VPDA 4J1NA 4LK2A 4IXNA 3LF2A 1KR2A 3H6HA 3Q9NA 2RGWA 2XQJA 1BD3A 5TGDA 4CMCA 1XKQA 2ZVDA 5ANRB 2FX2A 4BCCA 4XLTA 2V3WA 2V6GA 4DV2B 1UXIA 4YB8A 4OQPA 4X1IA 2B83A 1NG9A 3UA3A 4ZCRA 2Q6KA 2CL5A 3S1AA 4D80A 2A35A 2NOAA 4QGFA 5LYJA 1EVEA 3AJAA 5EUBA 5JNTA 2RGYA 5JH7B 3K70B 5FV4A 3WGHA 5IKPA 1AO0A 3I12A 1Y42X 1LFDB 2C77A 3FWPA 3SIXA 3EQ8A 1N5IA 2C9MA 1EX9A 5JSUA 1ZONA 1NW8A 1DKMA 1E2PA 3CSUA 1XRMA 3OI7A 4OGLA 3ESQA 1C0KA 3BXOA 3EMDA 1VXOA 1QKKA 3LQYA 2JFVA 1JL3A 3ETLA 4GE0A 1SD5A 3RIGA 3PFFA 4WXRA 1EBFA 1ACMA 5AJVB 2PPVA 5LQDA 1YTLA 4QELA 2ZXEA 3EFOA 1EFAA 1AV6A 4P5DA 4ZOEA 3F6YA 3LRXA 2Z30A 1GGHA 4PCAA 4RORA 4BUJA 5KIAA 1QYVA 4YRBA 3HCDA 2AG0A 4BZXA 3ZVLA 4OKNA 2G4CA 3SYKA 4G26A 3S5JA 5KNCH 4WLUA 4KKVA 1T9HA 3LTEA 5HUHA 3LPDA 1FLVA 1JEYA 1WDMA 5GVSA 1XDWA 1JBKA 1VSUA 4LQCA 3QYFA 1XWIA 3AY6A 4PXSA 2VP2A 5B3JC 2G04A 3OHSX 5L3ZA 1ZJJA 2J45A 2XDYA 2JJ1A 3E22B 3K0AA 1BS9A 3O4FA 3KB6A 4ZIRB 3O91A 1YUBA 3EEFA 4YP1A 1M2HA 2PX6A 4ZI7B 5CFQA 3E9CA 3MMZA 4U2DA 1I6LA 1L4NA 5E1OA 3HP7A 3QX7A 3FUTA 3LCVB 1CCWA 2FVXA 1HTTA 2Z9DA 4X7PA 4JB3A 4ZOBA 2OCXA 1FFHA 2YHAA 3HK2A 2P2CA 2DFVA 2PUWA 3Q87B 4MPDA 4MOWA 1OC4A 5EMJA 5HE8A 1RWBA 5HILA 3LVRE 2GX6A 2GZ1A 4QPNA 3G6WA 3AIMA 4RSGA 1G19A 2BSQA 1T9BA 3FOWA 4XVQA 4DFDA 3OKAA 4PX5A 1R0KA 3BSSA 2XWBF 3I72A 4IV8A 2QV0A 1XELA 4QM7A 2OKCA 1OI4A 2WRZA 3L7DA 4TV9B 5F7JA 4K6HA 5K3OA 3WLTA 4C0KA 3LQ4A 2VF8A 2YDYA 4GMFA 2YQ4A 3RKUA 4QIHA 1ZXBA 3I04A 5JSQA 3G8BA 3HL4A 5B37A 4AC9A 1U8AA 2EFJA 1SZDA 1WPRA 5ECWA 4BN5A 4YY3B 2HQSA 3TQIA 1SUWA 2BEUB 4NAVA 4KO4S 1CIPA 1JFRA 1GCGA 1XHFA 4I4LA 4IZIA 4R2XA 2MINA 5E6UB 4X71A 1BDIA 4OF4A 3HDHA 5THQA 2QI9F 3ZV6A 3RS8A 4EPYA 5TS3A 4RF5A 2VHYA 1C0EA 1RJGA 2Z09A 3OQOA 3IBTA 1M6WA 2G1UA 1P2FA 2WVHA 4FFOA 1CJVC 1UJMA 3K53A 3Q12A 4B75A 1RBYA 5AK3A 2E0IA 3UPDA 2C8KA 2LNDA 4B4WA 3QGMA 4CODB 2AXEA 1QHHB 2FMUA 4RVUA 2NZUG 3M1IA 4HBGA 3M70A 4BCBA 4FIZA 2XMZA 3PJDA 4JY7A 2A2ZA 4B9EA 1EWQA 3VC1A 1CDZA 3I28A 2P9GA 3LO5A 5TGZA 5KTKA 4FFDA 4E7PA 1PKXA 1UWCA 2RHLA 1O9BA 1VLQA 3T7JA 3LPCA 4R98A 2VRBA 2HY7A 3CUWA 3A04A 5A3VA 1VPWA 4TKMA 3F2IA 2IBSA 3HKBA 1EK6A 4M1KA 2APJA 5EP4A 4EIWA 1VCNA 1YRAA 3V8BA 5K0EA 2A9QA 1QP4A 1YKGA 1U8ZA 4U6QA 3G2IA 3RAJA 4CL3A 2YTZA 2FX5A 4B5LA 1K7EB 5I7UA 3UCFA 2BLNA 4B4OA 2JZNA 2Q41A 2BHLA 3OHPA 3UWKA 2AG1A 3COVA 2D5IA 3I3OA 4EJMA 1I4OA 2YXPX 1KORA 5I7VA 4RAQA 1ZJZA 4M1EA 3H5OA 2X8JB 3B9QA 4PZYA 1WY7A 3HBMA 3PCTA 1HYHA 2AOWA 2LW7A 4G8JA 1S2NA 3H16A 4L8VA 4NDNE 1VPTA 4U5XA 3PE4A 4XM1A 3R7WB 1XL1A 2YWEA 2F17A 5IH3A 3G79A 4BECA 2MSLA 3EY4A 4QC2A 1ZJWA 1B1AA 1Z74A 1PP4A 1HQKA 2IS1A 1I0IA 5KYYB 1GPH1 4L75A 4U00A 5CG1A 2P35A 4L8FA 1E1KA 2GFIA 3IAM1 3H5WA 4ENPA 3C3AA 1PEKE 2NO5A 4FW9A 5AHXA 4L0QA 3SX0A 1W1IA 1P1KA 3GQVA 1J0CA 2P5YA 3MJSA 5CMLA 5BSGA 2YFKA 4QSMA 3JTEA 2ERXA 3B70A 4TKUA 1EUQA 1L8QA 1VRCA 5F1OA 5T57A 3P8ZA 3AIKA 2IXTA 2PSSA 4Y1RA 3FFXA 1CQIB 3MB5A 3OPNA 4LZJA 2JLXA 3UH0A 1YCHA 4ZXFA 2XIQA 4OHXA 2W2QA 3IVCA 1QORA 5HZGA 2XE8A 3WLKX 4H4DA 3SICE 3R9KA 2P1DA 1Z36A 2FWMX 5F3DA 2BTEA 2CJYA 1QS0B 1JTEA 1N4AA 1NJ6A 4X62B 2UZ1B 3EG9A 1BXRB 1DQYA 1FLDA 1L9KA 2OP0A 2QAGB 3FBWA 5KQPA 1LK0A 1K68A 3HCRA 1PFWA 3OF5A 4HB2A 2GBCA 5IAOA 4BAGA 3M5WA 1N3YA 1N2CE 3OKPA 2NSYA 5BOSA 3ZWNA 3W8FA 3LX4A 3L1HA 3OBBA 1G17A 2CMGA 1XPJA 1NIPA 1JDSA 3D3WA 2J33A 1ZC3A 4GVPA 1C2TA 2RBKA 2RKBA 3IPXA 5IZCC 1C50A 1T8UA 1GGEA 3AEYA 2EFDB 2KMLA 2X42A 3IE2A 4FE3A 5JOQA 4XA8A 3TZHA 5BW5A 4GI1A 4Z4IA 2X86A 3K2IA 4L4YA 4NIMA 4M9UA 3LK6A 4KIGA 2WINI 5FDFA 1ZU5A 1QZUA 4INOA 4K88A 5H70A 1PV2A 3AUKA 4UZFA 1EBBA 1XMXA 4IWNA 1NKSA 2PT5A 3PNPA 3TQQA 1OC2A 4A0RA 3C3DA 2GRAA 1OGYA 1NULA 4HPJB 3W2EA 4MW6A 1XDBA 1GNRA 3L0OA 3WNVA 1GRRA 1FP4B 1ZO8A 5BXYA 2RGEA 4G9EA 1WDTA 3FRIA 5A06A 2XDWA 2FOIA 4ETIA 5HGXA 1TUEA 4ZCMA 1N6RA 2WA2A 3BRCA 1R4MB 1LNQA 4LXGA 4UE3S 2ISCA 4DM3A 4EG8A 5CB4F 6ADHA 4DUZB 2VSQA 3KVOA 4IEEA 1NLUA 4PR3A 2Y4NA 3AUYA 3LGAA 1E79D 1GQSA 1F7UA 4YAUA 1F9AA 4YIHA 2I33A 2RCYA 2WWVD 1G3IA 3IHKA 2M32A 4PCVA 1FS5A 4WHMA 3ZE2B 2FF5A 3L43A 1Y0BA 4V1CI 3RUFA 2D2EA 3ICCA 1XR3A 4A8TA 1E2FA 3SFVA 2VSOA 3T1YB 4ARVA 2FFQA 1A88A 3DFIA 4IS3A 1U2SA 2QZPA 5TQ0B 4DSOA 5A1TA 3Q1LA 5AK6A 1JEJA 1IXZA 3B89A 5DBHX 3WK7A 2C2GA 1H3FA 4HEHA 4I55A 2PE5A 3TB4A 1UMCB 3PRKE 1M75A 4QPZA 2AE1A 3B3FA 4BFLA 4F93B 3ULKA 4EPVA 2AXNA 3FB4A 2Q07A 5LQMA 3SQNA 3FTEA 3SYTA 2ZUVA 1R2QA 1S7CA 2F9LA 2IEAA 2AJCA 4G56A 4GBED 4LJ9A 1HORA 4Q03A 5BSMA 4B17A 1HG1A 2IXGA 4I50F 5TEWA 2HCFA 1R5BA 5JNUA 3D6TB 1QF9A 1J7KA 2IGBA 1IIRA 1X86B 1ZDMA 2HAEA 2OCAA 4B6OA 4EF6A 2G6BA 1VJTA 1Y5NA 1V9LA 2I3AA 3DZFA 3H8WA 4PLYA 5DRTA 3U4AA 3KBBA 3UHOA 1HNZB 3WO0A 4NQZA 1JG4A 3I9KA 2PKYX 3RARA 5A5EA 2JANA 2SHKA 4KI0A 2X1MA 1Y37A 2SKDA 3H83A 3KL2A 3S68A 1OQAA 2F8SA 3AEKA 3ZOZA 2RGCA 1BN7A 3FOCA 4IIGA 3VR4A 3K9FC 5CAEA 2JKZA 3KL4A 1I6KA 3FXAA 4WKCA 3O1LA 2IPLA 3L0CA 4ARSA 3SY8A 4C76A 1QRUA 3P0EA 3AHHA 2O23A 3BXHA 3C6QA 3RUCA 3TM5A 2QX6A 3DLHA 1UKBA 3IDFA 5E6RA 3HYRA 1NASA 1S8NA 1PJCA 3M3HA 3HBFA 3U26A 5EZYA 1HQDA 2I78A 1CUVA 3SPXA 5G1NA 3BGIA 2DSNA 4JUBA 1EFUA 3NTXA 4D9IA 2Z5FA 3L49A 4WXEA 2WKPA 4I9FA 5DI9A 5DM70 2EKDA 2IHNA 2Q3EA 1DIOB 1DJNA 4OIMA 5T5QA 1KDVA 3VDXA 4ZHQA 4I9GA 3GGPA 1O94C 2H0AA 3OUUA 3DMYA 3KEOA 3GDWA 4JVLA 3ROEA 4C88A 3M6FA 4EFNA 2QN6A 3CS3A 2BKVA 4J0KA 4MA4A 4F6RB 2H5IA 3KWLA 3NBXX 3U5ZB 4FSDA 2BDTA 3AM5A 3VH3A 3KU1A 1WCIB 1HXHA 2J3MA 4G5YA 1Z4QA 3DTTA 2WF6A 1CEYA 2R7KA 5J2UB 3FBTA 5IMBA 1CF9A 1HEUA 2G8LA 2C7GA 3C3YA 2A59A 2LR0A 1J8MF 3AI1A 4DBLC 1G5IA 4OHVA 4BWVA 3EAFA 4R05A 2IYVA 2A8YA 4GDMA 3O8DA 4ENWA 1ZK4A 2YWJA 1XMPA 3HB7A 2K4MA 2PS0A 4IDFA 1FLNA 3BKWA 5DN9A 4PO8A 3N2GB 4CFZA 2J48A 3R5SA 2O8FA 3PHCA 1VMIA 4RDIA 2EWMA 4JASB 1NP3A 4RY2A 1YQDA 2XUIA 3EPPA 2WM2A 2J5RA 3BK1A 4FGWA 4RHTA 1QG0A 4XH9B 2G1KA 5EWJB 4N5MA 1CEQA 4MV4A 2V6JA 3URKA 3WQSB 4NABA 5DCUA 3R4VA 1LPNA 1J4AA 4FP9A 3FPBA 1Q14A 3MTEA 1BHQ1 3AR9A 4JH0A 3C5WP 5NULA 4BJ3A 4EB6B 1WZEA 4HJXA 2V1UA 3SR3A 1JIIA 5KAPA 4EX7A 4BPRA 4EYKA 4AQ7A 2R8RA 1II9A 3VHLB 3D54D 3E7PA 3I6QA 4DZRA 5DX1A 2ID9A 2OM6A 2VEOA 4KX3A 3U4DA 3AI2A 4JJZA 4JUAA 3DCYA 4MK4A 4OSEA 4TUYA 4ZCTA 4WKBA 5KYXB 5CX1B 2VUTA 4HNHA 4MCJA 4A26A 4QGSA 4G25A 1ZAKA 5I9TA 1ISMA 3SVTA 2C54A 4OKIA 4FYYA 2G06A 2XBLA 2YHBA 2E4XA 4F5DA 2FPGB 1JGTA 4Z9XA 2HQBA 6REQA 2V9ZA 4CEIB 2WICA 2ZRJA 4ZQIA 3PQDA 2ZRCA 4EVSA 2UYOA 1OJLA 2VDPB 4YEDA 4AMZA 4HADA 1NLYA 1XA0A 2IHKA 2ZWPA 3CURA 2HZ7A 1HTBA 1LDBA 4Y0VA 4ZQBA 5IXSA 2GTHA 1SUSA 2R1TB 5JCOA 5EHIA 2JJMA 3D4PA 2PU7A 1JSZA 4YWHA 3UWMA 4J7UA 1Z0UA 3HB0A 1ZR2A 1IVSA 3BEDA 4F04A 2GJ8A 3BWDD 2IY7A 3DTVB 3MSCA 4PIVA 4HNVA 4JLMA 4OI4A 3SJCA 5JPDA 2C04A 3HYTA 5FIUA 1ZNZA 3T5MA 3VBCA 4D9BA 1FQKA 5HDBB 3GLFA 4C0SA 1G291 4P53A 4AUNA 5B1SA 4UOZA 2AJ8A 3TQHA 3GJ6A 4EA9A 1L7PA 1E3MA 1QYCA 2RHWA 1JHPA 4AYTA 1HR0B 2VRCA 1XN1A 3HP4A 1C1XB 3R3ZA 3MG9A 5AJYA 1N2IA 3V4RA 4GPAA 3V32A 3QVTA 4L0CA 3GY0A 1SZPA 2XCQA 5L7YA 2EDCA 3OF3A 1J00A 2EWVA 4WADA 2P27A 3JZMA 4I5EA 3R9XB 6LDHA 3A25A 3VU1A 4OSPA 2JLCA 1C3EA 3DEHA 1BVRA 4DIMA 1OHHD 1YCGA 1GTSA 1AGYA 4CQLA 1WP4A 3WA7A 5DHAA 2PRZA 3TIVA 3GH3A 4M89A 4B3TB 3EVZA 2W2KA 4IAOA 1WW2A 4FGUA 5B2EA 1L5QA 3WGGA 4GNRA 1QHNA 1T2NA 1PJBA 3I6ZA 1ICEA 1IMJA 4R9UC 3WKAA 2A4MA 4QLAA 4LXXA 3WQHA 1SVUA 5ALTA 4XWGA 1QPGA 3T3HA 2H2AA 4Z4QA 1PK8A 4IJWA 5E6SB 3R74A 4ZQCB 2IW3A 3FKQA 4G0YA 3GGGA 2I76A 3GT3A 5LMUB 1VLLA 4GZ6A 4QOJA 1OXKB 4WN9B 1NN3A 1R9NA 1W93A 4MNTA 3M4ZA 1ZI6A 4D92A 5B7PA 1XDZA 4XD2A 1AKUA 3W2TA 1LLDA 3LQ1A 4E7OA 4QL3A 4QXMA 1FEZA 2ZRPA 1E2IA 1K6IA 1TMOA 1WXQA 2QDXA 5DXFA 4AO7A 3RB8A 1U2TA 3KOXA 1IEQA 4IL5A 4YCMA 3U3XA 3LOQA 4Q3DA 5C1OA 3CINA 3RYHB 2MYTA 4K0KB 1HYGA 1X8JA 1HYQA 3VSDA 3HBLA 2E82A 4IH9A 4KBYA 4R16A 4RKRA 5C5IA 3CLUC 4OB6A 3IP5A 5HNKA 4X8HA 4CNQA 2WYIA 5EIBC 2EVWX 4V0RA 5AICA 1T1EA 1YXMA 4DKJA 1AKYA 1SA0B 1X70A 2SKCA 3DQPA 3B6EA 1N7HA 4DABA 4MI9A 2X9VA 3H75A 3GNLA 3LCUA 2D4HA 4EA6A 1X1RA 5A4IS 5KDLA 3KZ1E 3LU1A 3KB8A 3S8YA 1VPLA 4E32A 3DTNA 2QPAA 4FBLA 4AJJA 1KYWA 1WDLA 3EF3A 1S4MA 2VUUA 4ZCPA 3C3WA 4OQEA 1F0KA 1K4MA 1RWWA 1ZD4A 5L3SB 1XZEA 2MSEB 2ZKIA 3AJDA 4H6XA 5FL3A 1V1MA 3ZLBA 3MWLA 3U4GA 2GXUA 4IIUA 4FZ3A 3ZCRA 4BLPA 4BQSA 3NHJA 2BEVA 4JZKA 4N54A 3VAAA 2ALJA 1YI0A 1MRNA 4QOGA 3SC2B 2CD9A 2P4SA 1YC5A 1UPXA 3F4BA 5EOVA 1BHO1 2B3TA 3CO0S 2R6DA 5FO0A 1UFVA 1UK8A 2QN2A 2VSNA 3IKMB 2PWPA 4LYJA 8AT1A 4YAFA 5ALVA 4CETA 1YDEA 2DHQA 1JEAA 2O2XA 3ELDA 4WUVA 4ZRMA 3ZW9A 1T9ZA 3C4QA 4L57A 3C48A 4OLJA 1CEXA 2CNLA 2F9FA 1TTPB 3KTDA 1OUMA 1Z3IX 3DB1A 3C7AA 4M53A 5JY6A 1IB6A 1H0HA 2FSFA 3KC2A 2HZBA 4B87A 2B92A 2H2WA 3FYSA 2QUHA 3VR5H 2WKSA 5LP1A 2B1RA 2ERYA 4KDFA 4JCCA 4PE5B 3EXG2 4ZP1A 3R5XA 4MW0A 4EMUA 4I5IA 1PWXA 2AKYA 1TJPB 3FNGA 5IYZF 1H2HA 3NPAA 3OT5A 2NG1A 2X0KA 2W11A 3W3AA 1FXWA 4JJFA 2MR6A 3D0OA 1F5NA 4P2GA 4BMSA 4DA8A 2JI7A 1WZIA 3HBJA 1DSSG 1GTZA 2OAP1 1L5GB 4UHHA 2I80A 5C1BA 2YVUA 3AVVA 1GL6A 1TEXA 4D8XA 2ECOA 4HZUA 4I2NA 3RVRA 1VIMA 4QXPA 4ZREA 4QVGA 3IQGX 4K6KA 4ZZIA 1NRXA 1MJHA 4RPLA 1G41A 3UHFA 1FY2A 2I5PO 4ZVKA 4B9AA 1NXVA 1WPGA 5LD2B 4ZRNA 1BS2A 1FJXA 1T0IA 4TMZA 3MTGA 3RWBA 1CUEA 1M8KA 1LC3A 4XUDA 3S81A 2GN1A 1RAIA 1RLUA 4IIJB 3K5WA 1N8TA 1D6MA 1TF7A 3AL3A 2DG2A 3HO8A 4H0CA 2BWJA 1BHSA 1UXJA 4JNKA 1P45A 1DO2A 1XCMA 4E5SA 1OI7A 3L46A 1WUJS 2WF7A 3G9ZA 3LLMA 3ZDXB 4D0GA 3C3CA 4NCAA 1W4AA 1LK7A 5JYCA 1NDUA 3CUVA 3HB9A 2W2LA 3AVXA 3I37X 3K9CA 2PKQP 3NV9A 2OO3A 3SC6A 2WWRA 3RRMA 4HLCA 1ELOA 2WT4A 3IV6A 2AUTA 2HLHA 4CT4B 5A02A 4Y0AA 1DS6A 2WIDA 4AZ3B 4BV8A 3WL8A 2BFDA 2WVGA 1U90A 2B69A 4IFTA 4XVHA 2OECA 4YJHA 2GB4A 1WETA 3QK7A 2II6A 4WBXC 1FNSA 2DPXA 4GRIA 4PGAA 4HATA 3ZHCA 1LCIA 2YHUA 1MW9X 3MWDA 3QXXA 2LCQA 5CGZA 4F4FA 1Y5RA 4Q1EA 5G40A 3OJEA 1IWOA 4BMNA 2W42A 4LJ6A 1JVSA 2QUKA 4FMPA 4TTQA 3N2NA 3OM0A 5JZVA 2JARA 1BWSA 1E7WA 4IOJA 1EAYA 3O2QB 1Z7EA 4Y2JA 4N3BA 1E6UA 1IB0A 2BN4A 1G3RA 2Q6VA 3HKDB 2X13A 4WMLA 1G20A 1N9ZA 3LDAA 3PRJA 1KFCB 1SWVA 4CIBA 3WLJA 4CT5A 4TXNA 3IB6A 2P4HX 1P29A 1XXHE 2EKZA 4NENA 4X1IB 3K9WA 5CLGA 3R8FA 3SQWA 2AJTA 4IVRA 5I9NA 4RHYA 1VKZA 3S1AB 3VAZA 3ITNA 5LYJB 3L7LA 2E48A 2E85A 1E3LA 2Z6UA 2RG1A 1QG6A 1JQKA 4POAA 3P9SA 5LC1A 1M2FA 2OG1A 1E66A 1JQ3A 3OT4A 1KJQA 3KDSE 1CF4A 1XDDA 1YJCA 1DX4A 2NU9A 2Y1XA 3KTAA 1BTOA 3R6GA 4UHDA 1D1SA 1M6HA 5JHGB 4LY9A 2EF0A 1IUKA 3UAXA 3L4JA 1ML4A 3EFOB 4FJ1A 1Z47A 5DLPA 4C04A 2A30A 3E6AA 5DX0A 4WLOA 5C31A 3MMXA 5D3ZA 5BWNA 4JKYA 3TLYA 1C0LA 1OF1A 4GX0A 3TSYA 2GUGA 5B3KA 1VB3A 4KGVA 1H5UA 3BJIC 2CLEB 2H5LA 3WY9A 4G4SO 5J59A 3RUDA 1BRMA 1MX3A 4RTOA 2ZUTA 4DPMA 1JEYB 2HJSA 2QNBA 5FTKA 5IVPA 4A16A 4EGFA 4H3KB 3W6PA 3PNLA 1OXTA 4A92A 1TK2A 2PL3A 2AF4C 2ZR8A 2IV3A 4GZMA 1XD2B 3K0AB 3DE3X 4M0DA 5CNMA 3E3MA 3QJYA 4QBHA 5J4YA 4HSGA 4TN5A 3CVYA 2JK0A 1FL9A 1SBNE 4YR7A 3MQFA 3E53A 3PX3A 4YO8A 3EZ2A 2JLRA 3TEMA 4CCYA 2HUPA 1ZG3A 2P3OA 4KPGA 5B57C 2ATXA 2BZGA 2BGUA 4FYMA 2YUIA 3HVIA 2R62A 2NQ2C 2Y1OA 2P4UA 4UVGA 3MAGA 3ETJA 4ZO8A 4ODIA 2GYWA 2BKEA 1DXOA 2DBQA 4KQ9A 4R40A 3E8SA 3WYBA 4C0QC 2HH9A 3ZD9A 3CR3C 1NVXQ 4L5JA 5A4AA 4MPJA 4RV5A 5LDHA 1SHZA 2G88A