1P62B

Structure of human dck complexed with gemcitabine and adp-mg
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
241
structure length
229
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human dCK suggests strategies to improve anticancer and antiviral therapy
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 90
structure length 229
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p62B00
3K0FA 1NRJB 2WSMA 4OJKA 2BWJA 1K6MA 2ZPTX 2C9YA 4CEJA 1IM2A 3B8HA 3WRYC 2ZS8A 3U4QA 2QROA 2ZSBA 3B78A 4IVRA 4WXPA 3BFVA 1HQYE 1QBKC 5HR5A 2YWHA 1QVAA 4RD1A 2J7KA 2KSQA 1JAIA 1V5WA 2A30A 2QTVB 4EPRA 5EJEA 2CMKA 1QG4A 2A5JA 3EX7C 3AVWA 1E2MA 2C2HA 2BEKA 3GLIE 4JLAA 2QBYA 1NMZA 3QEOA 1E99A 3ZQJA 2WAXA 2PZEA 4B2LA 2FA9A 4MDFA 4EPVA 1KGDA 3TUJC 4KLNA 4LX0A 4TYYA 5IF9A 4KJZA 2PX0A 4F92B 3X1YA 3ECCA 3ZD7A 2X19A 3MAAC 3IIKA 1ELOA 1HT1E 1YZGA 2Z83A 4HAYA 1DARA 3VHLB 3PXGA 4DLUA 2GKSA 2PBRA 4JLDA 1E2PA 1KK3A 4U00A 3T61A 4Q4JA 5FPKA 1MABA 4PHGA 4Q48A 3R9IA 2D3WA 5FBVB 2AKAB 4P4SB 2ATVA 4TLDA 5AJZA 2Q9CA 4URUR 1SKYE 1OKKD 3DM9B 3P26A 121PA 4QHSA 1XPOA 2V4ZA 3LBIA 1FOEB 4OQXA 1G4AE 4YDHB 3TQFA 3OEHD 3GJXC 1QVRA 2VH5R 2XJ9A 3Q5DA 4D4MA 4ZDWA 3IBGA 1SXJB 2Z4SA 2R62A 2XSZA 2IYLD 2YC2C 3QG5A 1KDRA 2IYUA 3NIBA 2IEZA 1BH2A 4ARZA 5KNBA 1IN4A 4NBSA 3AGQA 1IOZA 5JHHB 5CK4A 4C30A 3A8TA 3AF0A 4Q02A 3AP3A 4RZUA 2QT1A 2FF7A 4LHXA 2DWPA 2ZSDA 1WBDA 1G8PA 4AIIA 1S3SA 3L0SA 3FYHA 2CJWB 4M9XA 3GEHA 2BBTA 4Z8XA 3X2SA 2FSIA 1CR1A 3THXA 4FW9A 5JJIA 4M0LA 2KBFA 4Z8YA 2EFHB 5CB8A 2GXSA 1IJEA 3LNCA 3TUIC 1MH1A 2MMGA 4RKEA 1N0WA 2YZ2A 2Z0MA 1RYFA 1E1QA 2NGRA 2O8BA 1IQPA 2FFQA 1P73A 3ZGXA 2OAQ1 2EFCB 4A1FA 3RNLA 3LBHA 3SQXA 2OAP1 1XD2B 1XEWY 4PHTA 3V4FA 3FDIA 3ADCA 1YZLA 3TSOA 1GWNA 2XX3A 2FDCA 1QG2A 4TYQA 4DC9A 2KE5A 2FFBA 1ZUNB 3D3QA 1FP7A 4LY6A 5DHAA 2VP9A 5TDHA 3PEWA 2VSFA 1H8HA 1YR6A 5DSZA 2X2EA 2Q0HA 2R6AA 3GJ4A 4A2QA 2ERYA 3K70D 4IEEA 2DHRA 4B35A 2WPDD 5H8WA 3GJ0A 1ZNXA 3B82A 1W5SA 1LF5A 1VIAA 3KQUA 2QG6A 521PA 5C2JB 2NO9A 3IGFA 3VFDA 2GBLC 4AYTA 3K09A 2TMKA 2BVNA 4RZXA 2X1VA 3UXMA 4QHYA 5KSPA 2H17A 2BIFA 2F9LA 3LX8A 2PMDA 3M0EA 1UBGA 2EQBA 4PQFA 2CCJA 1KSGA 2I3BA 3QXCA 3J81k 2ODEA 3IIMA 4NYMR 1EK0A 1HE8B 5G40A 2HDNB 3U7FB 2C96A 4RD3A 4OBEA 1NF3A 2XAUA 3RRYA 4BFTA 4MDEA 1E79D 1VHTA 1M2OB 3EAQA 2ZRCA 4JJKA 3MWKA 1OB2A 1ZCAA 1US8A 5D3MB 3C5CA 3RS7A 3C15C 5LDDC 4PO8A 1W0KD 3FKSD 5JLJA 2ASEA 4M22A 3I8XA 2QORA 1DBSA 4ERNA 2ZRMA 3A4LA 4AYXA 3U7GA 2IYYA 5JRJA 1G5TA 1I4LD 2ZRKA 1DEKA 3KDSE 1E9FA 1JPJA 3OAAD 4G1UC 3SNHA 4C7OA 1MOZA 1AKEA 1XCMA 1OFUX 1YRBA 3OE7A 1T9HA 1U0HC 1XD8A 3B1XA 4KCGA 1G21E 2Q3FA 4MRNA 1NG9A 1ZNYA 3H2YA 1K5DA 2Z4RA 4OQMA 4DDUA 1YJ5A 2R8RA 2C04A 1W4BA 4OYHA 1NBMA 1B23P 2J7PD 3RS4A 2PH1A 1VCMA 4TL6A 2CL6X 1BMFA 1E9SA 2L0XA 4NP6A 3K0AB 4PSAA 1W1WA 2GAAA 4KI0A 1P3JA 1TU4A 1UDXA 4LBZA 4C0AC 5FTLA 3HPQA 5KSZA 5DYGA 2DPXA 5DN6A 2FZ4A 3T5DA 5BXQC 1E0JA 4OQNA 1E3MA 1YZTA 1X8JA 4WZ6A 5DIFA 2F1IA 3I1FA 3VU9A 3VMFA 3C8UA 3K9LA 1NKTA 1E2HA 3K9GA 2ZXUA 3AVVA 1CJTC 1I4DD 3BBPA 3DEFA 5ELXA 4RZ2A 3JVVA 4S2EA 1M7BA 4IRUB 3OEHA 4UXHA 5EE0A 1H8HD 3PUYA 2QA5A 3QPWA 2J9RA 2IYVA 2WSSD 1S9HA 4NYJQ 4TL9A 3VR2A 3GLHA 2H18A 3OHMA 2JLWA 3ADDA 4W5WA 1HUQA 1ZINA 1T3LA 2J0UB 4GOXA 4B44A 4QXAA 1JBKA 4UNNA 4E07A 2DWQA 5IT5A 3EZ9A 1TL7C 3RC3A 2YYZA 3ADKA 1E1QD 1Z28A 4HAUA 5FH9A 1U9IC 4IDOA 3W9YA 3LV8A 1CRQA 4LWZA 2C77A 4G3XA 2CDNA 2GWHA 1KI9A 3CX6A 1ZNWA 4KLZA 1JR3E 2BJVA 4EKDA 3C41J 4W9MC 4XWAA 4BZPA 2QMHA 1CJKC 4ITRC 2VLIA 3Q72A 1Z63A 3FVQA 1X1RA 4Q4HA 1F2TB 2IS2A 1GAJA 4DDWA 5JFGA 1CS4C 1RRGA 2RGCA 4XTCS 2OEPA 3U3RA 4XWOA 1KI4A 4DT1A 1JJ7A 3D6TB 3GLGA 5JSZB 4TMWA 2A5DA 4B71A 2ZJ5A 2W83A 2H8KA 4BPBA 4D6PA 2G77B 5G53C 2C95A 4GMXA 2RHMA 1G1MA 4LPSA 4P4UA 4XWKA 1HY3A 1W44A 2WJJA 3I61A 4Q1DA 1P72A 1G3RA 5J4YA 4BLOA 2IYZA 4JIMA 4NU0A 4NCJA 1N5IA 2ORIA 2XOKD 4BLTA 3MMPA 3W6OA 3EA0A 3K0FB 4QOSA 1W0JA 3OIVA 2GILA 3HYRA 3T35A 4M1KA 1Z6GA 4ZCIA 1NG1A 2ODWA 1GOTA 4HDQB 2MSCB 2XEXA 4HATA 4W7SA 1E4YA 2C8VA 3DMDA 4JLNA 5K8IA 1KNXA 2JEOA 4V0KA 3W3AA 4D25A 5KTYA 2ZRDA 4TTQA 3CZQA 5KUTA 1DAGA 2IL1A 4KYUA 3CRVA 3EIEA 2O0HA 1SQ5A 2W00A 2IC5A 3ZVMA 3ZDQA 1NIJA 1XTSA 1DELA 4DCTA 3HJNA 5DISB 4B3XA 5EE9A 1GRNA 4DLZA 3CWQA 821PA 4A6PA 2W6JD 4HLCA 4UJ3A 2NPIA 4O25A 1XMSA 5DI3B 1OJLA 1N6NA 1D2NA 2MSDB 1VMAA 1N6HA 2JLVA 1TQ2A 4EPTA 4JSTA 5CLLA 4NYMQ 3A6PC 1IBRA 3SJZA 4DLTA 2FSHA 4MKGA 3M4YA 2WJHA 4AG6A 4TLBA 4GZMA 1MABB 4F4CA 1JQJC 5GJCA 3PJRA 2ZRIA 2YVUA 4ASUA 2DFKB 2GHIA 5J5CA 2CCKA 2WWFA 1TTTA 5JS7A 1XX6A 1VG9B 5FPSA 4CDGA 3GLFE 2D7DA 4UNQA 4TMKA 3EPJA 1SXJA 4XVUA 2ZU0C 4EFNA 1N6OA 1SHKA 2AFHE 3QE0A 5IK2D 1HYQA 4PC3A 4ARZB 1RFLA 4IOLA 2OUKA 1S0UA 3HWSA 3DOFA 3CF0A 4NE2A 3P4XA 5CLQA 3TAUA 3DM5A 1VCIA 3V00A 2NG1A 4IOJA 4QL3A 2ZE8A 2QE7D 4B2PA 1UM8A 2X2FA 3NBXX 4GL2A 2YC4C 2WJGA 5FL3A 3U61B 3WBKA 1NKSA 5C1BA 2DB3A 1ZC4A 3K1JA 4BRWA 3THXB 2ZAOA 3GLIB 1CR4A 4ZI2A 4TMZA 3NH9A 1AGRA 2ZE7A 4BFXA 2YJTD 3ZD6A 3WP0A 3P27A 2ZRAA 1P4SA 2DBYA 2OO7A 2XZOA 3CX8A 3U7EB 5JCPA 1YZKA 2CNWA 4PO1A 5JEDA 3ONWA 3GPLA 5TV2A 4N3NA 1QHNA 4IHQA 3BB1A 3D7MA 4A15A 4LJ6A 2GEVA 1E96A 2WOJA 1C9KA 3BB3A 3MG9A 1T5LA 1ZM2A 1S3GA 2IBMA 2JJ2A 3CZPA 4DRZA 4ZDJA 1W36D 1AKYA 1E98A 2EFDB 1N2CE 2H1LA 2OG2A 2C03A 2N46A 3L8YA 4UNRA 4D81A 2BKUA 4URZR 1JJVA 4P32A 2XZPA 2XB2A 2BBWA 2HCBA 4RD6A 2I4IA 4QM6A 4OL0A 2XZLA 4BLQA 1T6NA 4MRRA 6Q21A 1ONBA 1PZNA 3OZXA 2EW1A 4A92A 4HB0A 3RS3A 3AVPA 2P67A 2VHQA 3H86A 1ETUA 4FXPA 4CVNA 3WHKA 4KO8A 3LH5A 5LPNA 2EYUA 2RB4A 1E1RD 3AF3A 3RHFA 3UWKA 3A1SA 3DHWC 4CRWB 2O8CB 3QNUA 3T34A 2FGKA 1N0VC 1SXJC 3IHLA 4OI4A 1US8B 1A7JA 1G5RA 2AN9A 2J7PA 5D3MA 5K8TA 3UMRA 3HU2A 1QF9A 1DS6A 5GJBA 2REBA 2ZVQX 4QBGB 1OYWA 4II7A 5KU1A 4JLPA 4YXWA 5JJKA 1IN6A 4DB4A 5K8LA 1VTKA 2AK2A 3M1IA 3SYLA 2DYKA 1XTIA 3U60B 5A5GA 3LD9A 5F2EA 1R7RA 2ONKA 2CK3D 4MGZR 4C7OB 5EXPA 3AKEA 4A82A 4Q7JB 4G0NA 3I32A 4YDSA 2IF2A 2KB0A 3FKSA 3DPUA 5JMTA 4KSCA 4LC0A 4QG7A 4AI6A 4E5UA 3LWNA 3W5JA 4A6XA 2PJZA 1TX4B 5E3HA 2RGNC 3GMTA 1U8YA 2YWEA 4TWZA 1NBME 4OHXA 1NNEA 1BO6A 4H1UA 3WNDA 3EZFA 1XMJA 3A37A 4Q18A 5KSYA 1R5OA 2XTZA 3K0AA 1PUIA 1TQDA 2G6BA 3A4MA 5FTMA 4EJSC 4YXWD 1RYHA 3QBVA 2ZEJA 4P0TA 3OESA 4GP6A 5L3SA 1Z6AA 4JT4A 1DTSA 3A58B 1EWRA 3AP1A 1D9XA 4LI0A 2A7QA 3SR0A 5C18A 1UKVY 5FTKA 3VU9B 1XJQA 1KJYA 4M53A 2GVZC 3GJ6A 5IK2A 2XB4A 3NXSA 4TN1A 2FPMA 4MYUA 4Q9LA 5FPHA 2OLJA 3TH5A 4DCNA 2PJRA 2Q21A 2BKEA 2W58A 4JLMA 4QGAA 1SXJD 2CL0X 1Q57A 3RS5A 621PA 3ZLJA 5SZIA 1SHZA 4G5OA 2NTYC 3QVVA 1J2JA 1OLOA 3CONA 4DSUA 1E0KA 3GLHB 4QGGA 4ZPXA 1UFQA 2GK7A 4CEHA 2IYWA 1NBMD 1OE0A 1Q1QA 2J0UA 1R10A 2OCYC 4Q00A 4NZYA 5SZHB 2QM7A 2YWFA 3LXXA 5JHGB 1II8A 3VHXA 4AKIA 2ODBA 4WAUA 5AWFC 4B32A 3HR7A 3GJ3A 3KL4A 1N25A 2O8DB 1G17A 3MLEA 2A2ZA 2P0EA 4KV9A 1WBBA 3TW4A 1N6PA 1XXHE 3L0PA 3LVRE 3BXZA 3BB4A 3TBKA 4LHVA 4N0DA 1JXMA 1NVWQ 1NVXQ 1W36C 4YMWA 2JDID 2QPOA 1HURA 2C9CA 1SVIA 3VTKA 1RE0A 1P2SA 1ZC3A 1D8TA 1OXTA 1W0KA 2DR3A 2J1LA 2V6IA 3FMPB 3MWJA 3PUWA 1TEXA 5L3QA 5IRCD 1F2TA 4QBHA 5DNYB 3T12A 1DAMA 4V03A 1E79A 5J40A 2ZETA 5JSZA 2GCOA 5DO9A 2NQ2C 2ODNA 3ZS8A 3VKWA 4U5XA 2OM2A 3PUVA 4IJMA 2VHJA 3MJRA 3N5CA 1VCOA 1E2EA 1GKIA 1LF0A 1M6NA 1WQ1R 4LJ4A 4DXAA 3LO5A 3OIUA 4QBIA 5AJWA 1W0JD 2IHYA 5GADl 1E2KA 2W2TA 3TW8B 3EIHA 1KMHB 5BN3A 1CKEA 5LD2C 4Q7KA 3PEVA 1UKEA 4W5JA 4ILEA 5DE3A 2FOLA 1UBEA 4H9GA 3FMIA 1R5NA 5DHFA 2JJ8A 2OHFA 1G41A 4B3BA 4TSFA 2VP0A 3N2IA 1FNNA 3NH6A 1FX0A 2B8TA 4JZKA 2UKDA 3I5YA 3X1DA 4B73A 2F1RA 1BIFA 5ANRB 3FE2A 2CE7A 4ZCMA 2RHDA 4Q7MB 1EG7A 1UDWA 1PJRA 2XTMA 1OXSC 1D2EA 5AJXA 4YQFA 2FSFA 3K09C 1F48A 3MSXA 5DI3A 2CE2X 2Y8EA 1E2LA 1OIXA 1SVOA 2R6FA 1D5CA 1KK1A 4PO9A 4HZUA 2ZQ5A 3WP1B 4KHZA 1H8EA 5B2ZA 2ZI9A 1OT3A 1COWD 1LB1B 1D2MA 2LKCA 2ZS9A 4GMDA 4PTLA 2VHCA 3SZRA 1U98A 3QF4B 1M8PA 4TMXA 4V0NA 4A0HA 4LV8B 2X77A 4XD7D 4L5BA 4URVR 4JBWA 4K81B 4QM7A 4B48A 2QNRA 4TSFD 3A36A 3LQQA 4F91B 2XSZD 2WVJA 3PV0A 1G19A 4IVPA 4D0GA 2DCUA 3P32A 4L16A 2WWYA 2F9MA 4GI7A 1P7CA 3DMNA 4PPGA 3JVUA 3RSOA 2AX4A 4WIAA 4NDZA 1EFTA 5J4KA 3RS2A 4M1WA 4PAQA 3NVAA 3WNBA 3BGWA 2HF8A 3UPUA 1HE1C 1GNPA 2O8EB 3KXIA 3KUDA 3SE0A 3VR5A 3ND8A 2PL3A 3FMOB 1M7GA 2J46A 1JNYA 1GKYA 2D74A 4LBYA 1Z8FA 1A5TA 1Q21A 2DFTA 4UNSA 5TY0A 1AZTA 1YZNA 1BKDR 3RS0A 1E9EA 2J87A 4M1TA 4URXR 3GLIA 3OFNA 5BYJA 5BN5A 1DAIA 3TRFA 3AKYA 4TMVA 4DSNA 4L15A 2QTFA 5LD2B 4B47A 4Z51A 2VQSA 4I1SA 3G0HA 4XSHA 5EUQB 2ZYWX 4Q4LA 1CEEA 2G88A 2F3RA 4J0QA 5HCIA 4FMCB 1Z0AA 3LA6A 2IWHA 2I1VB 2JDIA 4MRPA 5B30A 4C0JA 4DCSA 4QHTA 4RD4A 5E7IA 1KAGA 2RMKA 2HUPA 4WVFA 3IBYA 4N1AA 1W47A 3AV0B 2IW3A 4CT5A 2ZR9A 1NJGA 1SGWA 3PENA 3E1SA 2ZI5A 2XXAB 1B0UA 4AURA 1J8YF 1XU4A 2IA5A 4DIDA 4CT4B 4ZDIA 3UIEA 4X8HA 3CKLA 4LHYA 1KZ7B 1NVVQ 2PEYA 1ZUIA 2XJ4A 5G41A 1ZD1A 3TLXA 5L8VA 3VR3A 2Z43A 2D4HA 721PA 4YC7A 1GNRA 1KI6B 1N5LA 1VIYA 2JIZD 3EW9A 1N6KA 4WZAE 3AM1A 3LQRA 5FPTA 5J4HA 2O8CA 2C78A 1TMKA 3B9QA 3PEYA 3R8FA 2FPKA 1Z08A 2PT5A 1T91A 3MWYW 4XH9B 1FP6A 4RJLA 2JASA 3ICQB 2ZJ2A 3EASA 1Z22A 4M9ZA 5DN6D 1EFRA 3VX3A 1IN5A 2H57A 1NMXA 3IQXA 3ZS9A 3CM0A 2NZ8A 2ZYVX 4EJSB 2P6NA 4B3GA 4M1OA 4IKEA 1GL7A 3SHWA 2OBMA 1E9BA 2QRNA 1TUEA 1BMFD 3AKDA 3MCAA 1U8ZA 1K8RA 4K8OA 3B85A 3CRMA 5JS8A 3GJ8A 4PHFA 2CVHA 2IWRA 1ANKA 4PQRA 1N6IA 5KDDA 4OQFA 2QN6A 3VR6A 2CCGA 1KNQA 1KZGB 2EFEB 3I62A 4FCTA 1UEIA 3KZ1E 2QMUA 3QXSA 5KDOA 3AVXA 1Q3TA 1XMVA 2HXYA 2QQ0A 2ZIAA 3OE7D 3SFVA 4WA7A 2ZSFA 3THYA 4US2R 1QDEA 1G6HA 4IDHA 4KFUA 3TJZA 5J4VA 3FHOA 1AS0A 1RRCA 2ZUBA 1MRSA 2LCFA 3U6BA 1JXOA 3RSLA 2O0KA 3EARA 3ZIAD 1C4OA 2GDJA 4LV6A 5L3SB 1G3IA 4JLOA 1OH5A 3DVLA 1N0UA 2BMEA 4WBSA 3AP2A 2CVFA 1FTSA 1KKLA 2V7QD 4XVQA 4AK9A 3BH0A 3LLUA 2ZI3A 3QVUA 4FMDB 5KNCA 2WKRA 2GJKA 5FBRB 4PPQA 3ZZ0A 1A82A 1KMQA 3BC1A 1E9RA 4GDFA 4YMVA 1E2IA 4JMPA 3THWA 5B64A 1Z0DA 3SI7A 1KI8A 1NY6A 3TGPA 1KKMA 2AXPA 1JAHA 1YR9A 4JLJA 4JT2A 1XWIA 4UKDA 3AVQA 1UBFA 4Y0VA 2R44A 3GCGA 4CEHB 3TQCA 2FNAA 5E4FA 4NPHA 1RKBA 3MFYA 4ZCLA 4A8JC 1II8B 3CIOA 3I8SA 5KDLA 1ZM9A 1QHSA 5JCZA 3BK7A 2O8DA 1KI1A 2JJ2D 3B13B 3G82C 2GXQA 3OAAA 2OILA 2B21A 4BFSA 4EPXA 2QGNA 4DIEA 3PR1A 4DLVA 2ZM5A 1NLYA 3HU3A 5FUWA 4LGMA 5F9HA 4R9UC 3AKCA 2ZYUX 1M34E 3TNFA 4P4TA 3SJAA 3RAPR 1E4VA 2QI9C 1WCV1 4LCBA 5CM9C 2IS1A 2ZJOA 1EFRD 4KFRA 4YONB 3ZYCA 3T06B 1XJ0A 1G3QA 2QU8A 4KODA 3BH7A 4MKHA 2NPFA 5B57C 5L3QB 1MR3F 2OCPA 3ASZA 5CIQA 2FV8A 1MT0A 2WM9B 3QKSA 3IO5A 4BECA 1P5ZB 1FTNA 1Z2AA 1IY2A 3BFXA 4JL8A 4DCUA 2GCOB 3PIRA 2WWXA 1LVGA 2QMEA 1D9ZA 1QHIA 2HJGA 3AEZA 2JLZA 1UAAA 1AA9A 4LUCA 4UNPA 4ACAA 2BEJA 3KXKA 3ZVNA 4PPFA 4DUGD 5EE1A 3CUEF 3I5XA 2ZI7A 1M74A 4E03A 3CPEA 2D06A 2GESA 3PVSA 5HZKA 2A9KA 5EP3A 1GNQA 5EP2A 4BLSA 1T4GA 1E69A 1TEVA 4LBWA 3X1XA 3ZIAA 1OHHD 1KMHA 1BS1A 1KDPA 1Z3IX 3K0CA 4LHZA 1YE8A 4IXMA 2NOAA 3RYTC 3H1TA 1XTKA 2J59A 3JZAA 1Q44A 4LSGA 3T1TA 3EPHA 4LHWA 3KKOA 2WWWA 1XBTA 4TLAA 2YNMA 4TL7A 4BRUA 2J0VA 1UJ2A 5UKDA 4DEXA 1GIAA 1P6XA 1U81A 3QKTA 2R6DA 4URWR 5C46F 1FX0B 1IXSB 1IXZA 3B6EA 3EPLA 2WIBA 2JLSA 1KYIA 4NTZA 4TMTA 2YHSA 1JEEA 4C0LA 4YLGA 2KJQA 4HZIA 1SULA 4WW0A 1XZPA 1OH6A 2QTHA 4EUNA 3WRXC 1VYTA 4OI1A 1KAOA 1PLLA 3CH4B 3VQTA 1LS6A 3SYKA 1F3OA 4RD2A 1NN5A 4LV5B 4U02A 5FI1B 4HZUB 5JRZA 3IHWA 4R71A 4MKFA 1T5IA 1R0WA 1W2GA 4JL5A 2ZANA 3CH5A 1WP9A 2RH5A 1P61B 3WXMA 3T1OA 1W49A 1U94A 3QF4A 3SBEA 2J0SA 4GFDA 1Z6XA 5FR2A 4G5QA 1R0ZA 3BORA 1Y3AA 3B60A 2B6HA 1Z0JA 2IK8A 3B1YA 3T15A 2G83A 1HH4A 2EWWA 1P9NA 2RGNA 4LJ7A 2WMNB 5JECA 3EXAA 4D4KA 2AL7A 1T8UA 1IJFA 2GTPA 5IHPA 1G7RA 3RRMA 3RWOA 1ZUHA 2CHVA 4TT3D 1J7KA 1NJFA 1OKKA 1Y63A 3QPVA 3CF6R 3GJ5A 1W48A 3AUYA 2BMDA 2GNOA 2HCJB 5DI9A 4CYMA 4BFUA 2O8EA 3CB4A 4TQUS 4Q9IA 3CLVA 3C7KA 4C9BA 4JKYA 1XDBA 4DCVA 1W46A 3NKVA 4HAWA 3H0KA 5TXGA 4DKXA 4TZ0A 1T3SA 2HYDA 3CBQA 5BYKA 4B3FX 4EQ6A 1RW4A 1NLFA 2G1JA 3TSZA 3U6KA 4M9QA 1EFHA 4ZI3A 2F7SA 4DSOA 2BM1A 2GJ8A 1N5KA 2N1BA 3PITA 3Q9LA 1DG3A 3LLMA 1IXRC 5DGXA 4L9SA 1WDTA 4LJ9A 1TF5A 1FUKA 3FFBA 2RGBA 1W4AA 2WICA 1E32A 1TQ6A 2J5XA 2GJSA 3QKUA 2QAGC 1TU3A 3CR7A 3AF1A 1CJMA 2OCAA 2C9OA 1U90A 2AKYA 4IDQA 4BFVA 1AZSC 1NSTA 1P2UA 2KWIA 1J99A 1CLUA 4ZKEA 4TLEA 1AM4D 4NCNA 3RABA 3PCRB 2ZJ8A 4HB2A 2P6RA 2ERXA 4HI0E 1LFDB 1OV4A 3FWYA 4HB4A 3U44A 2BCJQ 4KAXA 2ZE6A 2XXAA 1KJZA 1Q22A 1NI3A 4BZXA 4D4LA 1KJWA 3O8CA 1SVKA 2AWOA 2Q3MA 3DKPA 1OXUA 3RDPA 2D7CA 2QSYA 2B7BA 4HEJA 4MGIR 3IO3A 1KI6A 5SZKB 1DO2A 1G8FA 1VKJA 4JVNA 4JVSB 4XD7A 3A1VA 2KI5A 2QMOA 4TL8A 2ZSEA 2OFWA 3U3OA 3W3ZB 1P62B 4C4PA 3RVBA 1CJUC 2PZGA 2W2XA 4EIWA 4DEYA 5HKKA 2OFXA 1COWA 4DSTA 5FUYA 4B76A 3BAFA 1OIVA 3AF4A 4Y0AA 2A78A 5LBIA 4EJSA 2QEQA 1UBCA 3BS4A 5TARA 1SXJE 1SVLA 4I1VA 2FFAA 1XTQA 5KSOA 2WTUA 1Z0IA 3R9XA 4PC2A 1OXXK 5AUQA 2IHBA 4NCHA 1Z0KA 5HTKA 3S1AB 2LKDA 3PUZA 4D0LB 2QUZA 5JI3E 1OPXA 3R7WB 1F60A 2R65A 4FWIB 4Q9JA 3B7GA 1FPMA 3NG1A 2A5FA 2HJVA 1DG1G 1RRFA 4GOKA 2V1UA 2VL7A 3THYB 5CYPA 3U2QA 3U5ZB 2C5LA 4M8NE 4NH0A 2GA8A 3EZ7A 1FQJA 2JA1A 2WWIA 1U8AA 1DADA 4QJ5A 2YV5A 1OHHA 1TPZA 3AQ4A 3B1ZA 1P2VA 1S4QA 2VA8A 4GSYA 3SJBA 4AC9A 5FOWA 3LDAA 4Q03A 2REXB 1GG2A 1BYUA 3EWSA 3TVDA 1TQ4A 2FX3A 2G3YA 3F5FA 4IOKA 5FOVA 3R9WA 2MSEB 3K0EA 1SVWA 2ZI6A 2K5UA 1PLJA 4BFWA 1L2TA 2WKQA 2A5YB 3OIYA 2IT1A 4MGKR 4QGFA 1E2JA 2NO1A 3THWB 3K70C 1KDOA 3BERA 3U3JA 3IDQA 1FMJA 4KBGA 4QRHA 1P9WA 5FL7D 1GP2A 4ZKDA 2AFIE 1ZYUA 5FI0B 1VECA 3O8BA 4B43A 1I4TD 1LNZA 1FFHA 1FMLA 1NLZA 1DE0A 4AKHA 3KJIA 3LFUA 4UJ5A 4M2LA 1EXMA 3DL0A 3KJEA 1N6LA 5AJVB 1G5PA 3WBJA 2E1RA 4Q7LA 1OIWA 4I81A 1R0YA 3W34A 1J8MF 3WMEA 2PCLA 2WJVA 4QNMA 4O0MA 4PZZA 4Q1FA 3KB2A 4QC2A 3WMFA 3SEAA 3QIAA 2YWGA 2FSGA 1G3MA 4MA4A 2ZROA 4NHOA 3BE4A 4OJQA 2BMFA 4Q9HA 4ACBA 2CL7X 3N2EA 3QF7A 3SJCA 3T1QA 2F43B 2GZAA 1X1SA 3LBNA 1ZIPA 1NL3A 4MUBA 1L7VC 3QKSB 4NCIA 3SHFA 1LW7A 1P75A 1EX7A 2C98A 1T8TA 2BC9A 4RVCA 3K9HA 2GCPA 4MQBA 1Z0FA 1G7TA 4I1OA 2QZ4A 4OI2A 1UPTA 3ICEA 3IKJA 1G8YA 4L4UA 1G9XA 4PANA 4DLXA 2FEMA 4BEJA 4NYJR 1L8QA 1DO0A 3K0CC 1VCNA 1PLKA 2GF9A 2OV2A 1G4UR 1NN0A 2YOFA 4MYHA 2ZI4A 1EWQA 2AWNA 3DZ8A 4P3YA 3VX4A 4A2PA 5DYIA 1G7SA 2WPDA 2AXNA 2BJWA 4QBFA 2OXCA 4YMTA 1S2MA 2NZJA 4HLUC 3KFVA 3BOSA 4PHHA 3CF2A 1ZM7A 4BGDA 5KYKA 4ABYA 2Q9BA 1II0A 3KTAB 3PFIA 2UVQA 4GPTA 4JJZA 1OFTA 1LY1A 3KX2A 3KQNA 4OK5A 3K9NA 1GKUB 1ZU4A 3Q85A 4H1VA 4ZO4A 1XTRA 3MD0A 2HF9A 3TKLA 4K46A 4CW7A 2HLDA 1FQKA 1D6JA 1E2DA 1H8ED 4V0MA 2CBZA 4M1SA 2ZU6A 3OEED 4O2LA 2YOHA 1QHHA 3U3MA 5FFMA 4HDCA 5JBQA 1CP2A 1XEFA 5BW8A 2WV9A 5EXTA 4YMUA 4V0LA 4W5HA 5CDFE 2ORWA 3L0OA 3RRNA 5J4LA 4AD8A 5E95A 1VG1A 1DAHA 4M21A 1N6RA 3UATA 3NEJA 4LK2A 4PAOA 3TVTA 1E2GA 3SN6A 2WWGA 3TR0A 2QRZA 3L8ZA 4Q9KA 3RC8A 1S9DA 1U99A 1MV5A 2ZRGA 3CRRA 4EAQA 1LTQA 2GCNA 2Q9AA 1YRAA 1AK2A 4M9SA 3A4NA 1UEJA 2I1QA 2IXFA 2WWHA 5BWMA 1XZQA 4ESHA 1E2NA 1CTQA 1Z47A 4NCKA 4X8MA 1WB9A 1G7CA 3E5HA 3P4YA 1SVSA 2HT6A 4PZLA 4US1R 2QENA 5EE5B 3L2OB 2AK3A 2GZDA 2J41A 1R0XA 1KO7A 1HV8A 1AQYA 2IXGA 2ANBA 3FKQA 1DPFA 5P21A 4B3CA 1KTVA 1F5NA 2FE4A 4QJ4A 3CWZA 3PG5A 4IVQA 3DO6A 2FFHA 2D2EA 5AR1A 4LJ8A 4IOMA 4MYTA 2W0MA 2EVWX 2B92A 4US0R 1CIPA 3GEIA 1S1MA 3QQ5A 4WXRA 2XNSA 1JPNA 3C16C 4JS0A 3KKNA 4EQ6B 4LC1A 4BE7B 2VTKA 4M1YA 3REGA 1IN8A 3AF2A 1WRBA 1YR7A 1RJ9B 1X86B 3V9PA 4G5SA 4Z1MD 2SHKA 1JALA 2IXEA 3Q3JB 4KU4A 2VIIA 3I4LA 3AB3A 1XEXA 5JZVA 2Z5FA 1QHYA 2RKOA 4XSGA 3FB4A 1G8HA 4TYWA 4L9WA 3FHCB 3ZH9B 2GAOA 5KHOC 3MJHA 4CEIA 1KOFA 1O3YA 2QP3A 4TLCA 1CR2A 3X1WA 1GDDA 4AY2A 4DLYA 1OXVA 4OHWA 4B33A 5JWOA 3C5HA 2FN4A 4OQLA 4MYCA 2VP4A 1FNMA 3KJHA 4HUQB 4TTRA 4A2WA 3F3YA 5JEEA 3PQCA 1ZM4A 1L4UA 4GP7A 3VNUA 2IUSA 2WJIA 4LYAA 5FOTA 3TMKA 4RZ3A 3LXRA 4AG5A 2PT7A 3BD9A 2FU5C 4LBVA 3EZ2A 3THOA 4IW3B 3U44B 3KKMA 3X1ZA 2B8WA 3BWDD 2EYQA 1Z83A 5GJWC 1P2TA 2VF7A 1TNDA 2AD5A 2WSSA 2X8AA 2AHOA 1U9IA 4LYFA 4Q1AA 5CK5A 2VEDA 2FG5A 2ZRFA 1JECA 1UF9A 4LOAA 2HYIC 3D8BA 3TSWA 4KVAA 3I72A 1ZM3A 2P3SA 1UKYA 4DDVA 3M6AA 4ASUD 1G6OA 1E2FA 2VYFA 4JL6A 2O0JA 3QUSA 4P31A 4Q1BA 1WA5A 4PPNA 4Q66C 1S96A 5AJYA 3SDZA 1GRQA 2J3EA 4HAXA 4NKRA 2OCBA 4PSVA 4RKFA 3KJGA 1XNJA 1X8LA 3HPRA 1Q1BA 5JJLA 4ZIRB 5JI2E 5CIWA 3GLFA 4NYIQ 2ZRNA 2ZTSA 4CZ2A 3IEVA 4KBFA 3VR1A 1Z6TA 4F4JA 2IS4A 4A8JA 4LZZA 1GL9B 4OKSA 1BOFA 5FPYA 1Z6YA 1MO5A 3S1AA 2H16A 3KQLA 4Z1MA 1DOAA 3RWMB 2ZREA 3IPXA 1Z5ZA 4NYIR 4D82A 3R7WA 4QKQA 2QL6A 3GLHE 5L3VA 2Q3HA 4JSYA 4PFSA 4PX9A 4YMSA 2O5VA 2H5EA 5EUMA 4LRWA 2H7VA 2PLFA 4DJTA 5HZHA 2O52A 4Q1EA 5FR1A 1NP6A 3RLFA 1YZUA 1W4RA 1QHXA 4E22A 3ZVRA 4QGHA 4DB2A 4C0KA 3FGNA 3UKDA 4BFZA 3P1JA 4C0QC 1GZSA 1YR8A 1ESMA 3WHLA 4FI3C 4MH0R 4C3ZA 2GXUA 2P2LA 3WYAA 2QAGB 3UMFA 1ZMXA 2VP6A 3E2IA 4V0OA 2GVDC 3CR8A 1ZBDA 3K8YA 4OI0A 2ZRJA 2IYSA 2CEAA 5FTJA 4D2IA 1P60A 1R2QA 3ZJYA 3IQWA 3QKRA 4QJ3A 1NN3A 2JLRA 3Q7PA 3W6NA 4F7WA 4BEBA 1H65A 1ODFA 3LY5A 1E0SA 2BBSA 4JYCA 4IEIA 5H1YA 3TIFA 2HEIA 2RAPA 3BH6A 2QPTA 2VHUA 3KFXA 1FUUA 4WZBE 2ZR0A 3T1VA 1NMYA 1FL9A 3KXLA 2R9VA 1Q3HA 4Z54A 3W8RA 4V0ME 3E70C 3EZ6A 1Q12A 2IUTA 5AUOB 4RSGA 1ZJ6A 3K70B 1A2KC 1OB5A 4LJYA 1Z29A 4LYJA 1AS3A 3OEEA 1FW6A 5A0FA 1E2QA 4AWXA 3UK6A 1PUJA 1W4CA 4JLKA 2HLDD 4Q4AA 1OF1A 2G9NA 4O2RA 2F1HA 1LV7A 5HE8A 3B1WA 3HYTA 5DLQC 3NBFA 4KITB 2F43A 4G5RA 4JBXA 2ZAMA 5BQ5A 3UG7A 4A9AA 1VHLA 1V43A 1KDTA 4NL4H 4OK6A 4C2UA 1X8KA 2OBLA 3EA5A 1XFAA 3UANA 1E9AA 4DDTA 3ZZTA 1X3SA 4DWJA 1Q20A 1AS2A 1XD9A 1X6VA 2VRWA 3WY9A 2IEYA 1G3UA 2V6JA 3TE6A 5TVKA 1HA3A 3QG1A 4MUAA 4KSBA 1N5JA 1W2HA 5KOYA 2QM8A 2ANCA 3NDPA 4TQ9A 3RRZA 4RFSB 4DZZA 2BHRA 3MGCA 4EPYA 4MRVA 2FMXA 1WE2A 1XJCA 4Q47A 2ECKA 1XB2A 4IXNA 4HUTA 1ZP6A 4LPKA 1GITA 3CRW1 5CITA 3W5IA 1S8FA 1ZU5A 4OHVA 2ZJAA 2JJ1D 4X8LA 4A0FA 4BASA 1JB1A 1MO6A 3GP8A 2PLRA 1S1CA 4B75A 2O8FA 4G01B 4G5GA 2REOA 1OW3B 2G0NA 3HR8A 1XP8A 4NMMA 1XTJA 2JATA 2GEUA 3KTAA 2RGEA 2OE2A 2ZRBA 3SS8A 4TYNA 1KIMA 2RGDA 3NTUA 1ZD8A 1MO3A 1DAEA 3PUXA 5TMPA 1KO1A 1U0JA 2HT1A 3QXHA 4BLPA 3QEJA 5FBLB 1ESNA 2JCSA 3TUZC 1E9CA 4XIGS 1QHHB 1K5GA 1YVDA 3Q8XB 4BFYA 1KI7A 5JWHA 1ZVQA 3L82B 3QI2A 4GOJA 1Z06A 2IYXA 4FWTA 1TADA 3BFKA 4OHYA 1LS1A 1ZD9A 2R6GA 4FMDF 2VHTA 5HKKD 1XCGB 1Z07A 1VYUA 5M04A 1A1VA 1ZAKA 2CLDX 5GVSA 1UKZA 1ZW6A 3CPHA 1KO4A 2RGGA 2YINC 3I3SR 1T0JB 1E1RA 1NY5A 1XXHA 3OFND 1AJEA 4UXJA 4RCYA 2FZLA 4PC6A 2G1KA 4Q21A 5D3QA 5G3YA 1R4AA 4HLQB 4KFSA 1AN0A 3NC0C 2CLSA 2HV8A 3H4MA 4GNKA 3FFAA 1KSFX 5H68A 5KPDA 2DFLA 2OESA 4ZDKA 2W2VA 1WF3A 4U7DA 1ZRHA 2P5TB 3ND9A 5E7JA 2ATXA 3CX7A 4A4DA 1KO8A 2F1JA 1W5TA 1JI0A 2GJAA 2GBLA 1TAGA 4MRSA 4BLRA 4QFMA 4EDHA 2BDTA 1W36B 5F3WB 1XCPA 4ZV4A 4B74A 4TTPA 3W8NA 4AYWA 5CB6A 2DY1A 2D62A 3LW7A 4PR0A 3LVQE 2AR7A 3TR5A 1TF7A 4PC1A 3HDTA 3AVTA 1GVNB 2R2AA 5BN4A 4JVLA 1FZQA 2GEDA 4D4JA 3K53A 1VPLA 2V3CC 1RJ9A 1Q0UA 3GFTA 5LB2A 4MITA 2VF8A 2IYQA 3SFZA 1IONA 1XEXB 4LJAA 4B6FA 4POAA 2B7CA 2WKPA 5L3RA 5C4MA 3ADBA 4E09A 4M1MA 4CEIB 3EG5A 3KB1A 1MO4A 4EFLA 3UMSA 1OH7A 1AQUA 4FIDA 3F0TA 3QJYA 4JYBA 1OFIA 1RRPA 1YU9A 3A1UA 3W90A 5EZ6B 4RY2A 5K8UA 4HUQA 1E94E 1G16A 2ORVA 2Q6TA 5G3ZA 3VKHA 3KKPA 3NEYA 5EQTA 1F2UB 4OK3A 4BUJA 4B3DA 1IAQA 2VP2A 4CF7A 2A5GA 3OF5A 3GFOA 1VDZA 3QY0A 4JLVA 4C0HA 2JLYA 1E0AA 4WOPA 1R5BA 2P5SA 5AK0A 1TF2A 2FJUA 1CRPA 1M7HA 4DLWA 3EIQA 4FINA 2UZ3A 3K0SA 3GEEA 2H92A 2BCGY 2PEZA 4GT1A 4XJXA 3ZZUA 2NMVA 1NVUQ 5F98A 2RGAA 1G291 1KO5A 1J70A 1GTVA 1KI3A 3L43A 1WMSA 3ETLA 3DKVA 3LAWA 5CJ2A 4IFBA 4FMCF 3BIFA 2V8OA 2NO0A 4MGYR 4URYR 5EP4A 3UWOA 1KHTA 2OLKA 2QAJA 2XNDD 2WZQA 3NBZC 2BOVA 2E9SA 3REFA 3CW2A 4CEJB 1GILA 5FOUA 4DUGA 1R6BX 3U4QB 2PX3A 3KKQA 4FN5A 2OSBA 1T3HA 4ZIRA 2IX3A 5FOSA 4C0BA 1KSHA 2FEOA 3GLFB 3B1VA 1QZXA 3QSYA 1GM5A 2ZRLA 2DFNA 2GZHA 1U2RA 2W6JA 5FUXA 4X8OA 2MMCA 2BBOA 1IY0A 2QP4A 4A8JB 2ZE5A 1KK0A 4I1UA 2IYTA 5GJVC 1G8GA 4IDNA 2QBYB 2W6ID 3B9PA 3OIWA 4XOIA 3AUXA 2G0TA 2PMKA 2UZIR 1JEDA 1G18A 4PC7A 4LJ5A 2D2FA 2ZVPX 2GJ9A 1QHGA 4P33A 3VR4A 2BM0A 4PAMA 2R6CA 1JQLB 1GL6A 1AIPA 2XITA 4D26A 2BMJA 1IHUA 3CRQA 3FOZA 2JGNA 1EGAA 1KSJA 4EPWA 4PQYA 1JR3D 5EZ5A 4IFEA 2QAGA 4NONA 4Q4JB 2FWRA 1YKSA 5E7MA 4A0RA 2JLXA 1P9RA 4P4SA 5AUPB 2XOKA 1Q1EA 4JBYA 2XGJA 1HTWA 1OYYA 4XVRA 2RGXA 2IS6A 3QBTA 3NWJA 4TT3A 3FHTA 1HEIA 3SOPA 3CO5A 5CM8B 1M1YE 5TB5A 5F9FA 4Q1CA 1O87A 3QKRB 5B58C 1VG0B 2E87A 3DOEA 1CF4A 3N70A 3MWLA 3I92A 1I2DA 3C4JA 2GXAA 3HP1A 2ZITA 4F38A 3ASYA 2JAQA 4V02A 4IDPA 2BV3A 2CLCX 2FH5B 1EFUA 1NSFA 2ZS7A 4R2HA 3F8TA 1G20E 2VSOA 4GBMA 3SYNA 1ZCBA 4F93B 2YOGA 1OSNA 2V7QA 1E6CA 2Z6VA 1R8SA 3GQBA 4RD0A 5HPYB 5KPJA 1CR0A 3V4RA 2OBNA 3HU1A 1PV4A 1YHNA 5CYOA 5LB4A 2CJWA 1DAFA 4R7ZA 3WYGA 1JR6A 5FUVA 4ESVA 1RPZA 2EFGA 1T0HB 2OZEA 2ZSAA 3DZDA 1KI2A 3AGPA 5HCNA 1XF9A 1SVMA 3H84A 4Q4AB 2IYRA 4HLDA 4Q01A 2O8BB 1OFHA 2EWVA 4XTRA 2ZRPA 2IUUA 3VNVA 2PZFA 1XD2A 2FPLA 5FOXA 2OFOA 2WBLC 2J45A 4DBLC 1TUIA 2QP9X 4FMBB 4JKIA 4F4IA 2V1XA 3A1TA 4JLBA 2CHQA 3W6PA 1GUAA 4QNRA 2ZJYA 4HLUA 2J0QA 3QENA 2W0SA 4HAZA 4B2IA 3B5JA 2CXXA 3AH8A 3IUYA 3G5UA 5EP1A 2JJ1A 4N0EA 3ZQ6A 4TYPA 3JZMA 3LW8A 4HDOB 3ZVLA 4GZLA 2ZJZA 4RFSA 3IIJA 2GETA 4RFVA 3P20A 2VP5A 3FTQA 4LYHA 3DDCA 8OHMA 4CGZA 3U3KA 5JWRA 2VPPA 3WYFA 3VKGA 2V55B 3SC3A 3LX5A 1PVOA 2F3TA 1BYIA 3LRPA 3O8RA 1XEWX 4DVGA 1GRRA 2FGJA 2WOOA 3C14C 4I99A 2YKGA 2F6RA 4Q19A 1DVRA 2CHGA 3CNOA 1J90A 3R20A 5GVRA 3AVUA 2OXRA 1QRAA 2O8FB 1VYVA 5EXSA 2C99A 3MUFA 3WMGA 1NVVR 3EPKA 3VAAA 1ZNZA 4Q5IA 4DHEA 5DH9A 2WJYA 4TZ6A 5IDVA 1XPRA 4ON9A 5EXXA 3KQKA 1I2MA 1SZPA 2DWOA 3B2EA 4PSKA 4A0GA 5HE9A 2CK3A 3WNCA 2VSXA 1DAKA 1YQTA 2V9PA 221PA 3NHAA 1IY1A 2A3RA 1CULC 1GSIA 3SU8A 3SQWA 1C1YA 4KVGA 2WHXA 2N42A 4KXFB 4C2TA 4TQAA 3NBYC 1IN7A 2CNWD 4S35A 3T5GA 4HYYA 2HXSA 3SBDA 1Q1ZA 4FCWA 4AKEA 1AGPA 3GJ7A 3IEUA 2IF0A 2W6IA 1R8QA 1CU1A 2EU8A 4O3MA 2GK6A 4JVMA 3R8CA 1KK2A 5FL7A 3NDBB 3L0IB 1CXZA 1UADA 1XXHB 4R98A 4PZYA 4CIDA 2F55A 2JIZA 4BQSA 1HT2E 3U7HB 1RZ3A 3EC1A 3NC1C 2JLQA 3O47A 3GLGE 1Z2CA 2LWIA 2QE7A 1KY3A 2WMOB 2ZR7A 3I73A 1MRNA 2XNDA 3TK1A 1EX6A 3QPUA 4A36A 3QOFA 2ZRHA 4UXIA 3AVOA 4HSEA 5CDFA 5EE3A 1EESA 2ZYTX 2AD1A 1WXQA 1JR3A 3KQHA 1F6BA 3AVYA 2P6UA 1RIFA 2QGZA 4FD2A 1HQCA 3A1WA 3Q5EA 5C4GB 1YZQA 4DLRA 1EFCA 4KFTA 4EFMA 5H70A 2OT3B 2VO1A 1E9DA 1G64A 5SZJA 1L4YA 2QSZA 4BZQA 4BWYA 1A4RA 4B6EA 2XTNA 4MKIA 2JLUA 1VG8A 1U0LA 4R2IA 5KNDA 2NIPA 3TAHA 3KUCA 3QXJA 5FTNA 3BRWD 2ZUCA 3FMFA 4GRAA 4I4LA 1CJVC 3FPAA 1MKYA 5A4JA 1XRJA 2KBEA 3CPJB 5CJPA 1II9A 5FBWB 4DLSA 1GFIA 1KY2A 4HB3A 2VBCA 4KYIB 2NO7A 1XMIA 2QY9A 4HAVA 3NHBA 3MRSA 3GD7A 2ZJBA 3Q7QA 1W7AA 2QT0A 1NIPA 3BJIC 3IILA 4Q4HB 1F2UA 2ZUDA 1ZIOA 4UQOA 4D80A 1NN1A 3EWAA 3GFPA 3RANA 2NO6A 3IPYA 4D0NA 1RC8A 4OHZA 5AUNB 2RCNA 2V54A 3O8DA 4PXAA 3CNNA 1CBUA 2P65A 1OH8A 1SKYB 2QQEA 2GF0A 4DT1B 3UG6A 3GLGB 3QXXA 1A2BA 1XPUA 4AKGA 5KO2A 2WIAA 1N3BA 2WAYA 4RCZA 4B34A 3EC2A 3PEUA 3CNLA 2GRJA 5J47A 4FCVA 4C0SA 3D31A 2QPAA 4LDJA 421PA 5FBQB 2PCJA 1RVDA 1SKQA 4L8GA 2ONJA 4M4SA
chains in the Genus database with same CATH superfamily
5SY9A 3FPLA 2ZGVA 3R6TA 3V1YA 4OJKA 5FT9A 2IV7A 1J07A 4OIFA 5F21A 5K3AA 2ZPTX 1JTFA 4LXGA 4K0RA 4IJ5A 1IM2A 1PJTA 3B8HA 4ES6A 1IMJA 5GIPE 3U4QA 4PYQA 5JG7A 3N87A 2Y99A 3KR2A 4HDKA 4R2KA 1IZ9A 4PLYA 1W581 3OMLA 1HQYE 1QYWA 2YWHA 2GS9A 5K3FA 2J7KA 2O2EA 3OJCA 3OZBA 1DBQA 3Q1KA 3UO8B 5KTNA 1V5WA 1MTOA 2Y4OA 5EJEA 4D1YA 3AXTA 1EH5A 2CMKA 3EOZA 4XARA 3HLKA 1MVNA 3EX7C 3BXFA 1WP4A 2ZRQA 3UC5A 1WCWA 1M2VA 2HIGA 4JLAA 5BSVA 1NVGA 3N8DA 1D0IA 4NE7A 3E3AA 2QBYA 3R3WA 3PQFA 1E99A 3UC9A 3VKUA 2IZZA 3NKLA 4Q39A 3SIPA 3MJTA 3MYYA 3D54D 1RJEA 1VLLA 4B2LA 4H4EA 2KMLA 4HWOA 3TUJC 1LBSA 4KLNA 4LX0A 2C4KA 2OBBA 3EH2A 3QU7A 2FPPA 3RNOA 5JFOA 3AYZB 3QEKA 4KJZA 2OAGA 5FBZA 3K2IA 3RSZA 1FVOA 4N3CA 4U6NA 4F85A 1BE8A 1OV6A 1Q3KA 4FBGA 1YJBA 5CGZA 1C8LA 1MENA 3HA3A 4J1QA 1P1CA 2WT8A 3PIDA 3PXDA 3FLBA 3PRJA 1NNSA 1NI5A 3L0CA 3UH1A 4ZYLA 3WLOA 1KQFA 2HPHA 3LPNA 3W2EA 1ZA2A 2ODAA 4Q3DA 3B6KA 2B5WA 4ZOCA 4YJGA 1KP2A 2NADA 1OXMA 2ATVA 2XECA 4NZZA 4AX4A 2VUIB 1B2RA 1DQSA 2Q9CA 4KEAA 1OKKD 2IU6A 1LD3A 3B8EA 1LU9A 2JI6A 4QHSA 5B7QA 1AUQA 1A5SB 1WO8A 1EJBA 1FOEB 1RLMA 2ZWIA 3LBIA 4XUDA 5A0TA 4OQXA 2DT8A 3C74A 1G4AE 5AW2A 4JP5A 4YDHB 3OEHD 1AGNA 3GJXC 3Q5DA 3KYBA 4U8GA 2IHVA 1Q16A 1T1EA 2Z4SA 5CA0A 1RWXA 3V7FA 1MN6A 2ZR8A 3VDQA 1KDRA 1M33A 1CYDA 3QA3E 4TLLB 3NIBA 2IEZA 4UD6A 2GOYA 2XCTB 3JWPA 3ZE2B 2PDAA 2ENUA 4W9NC 1C2TA 3QKWA 1UKCA 2RG1A 4MJXA 5HEKA 3WFJA 1ZLYA 1MDBA 4DARA 1U2ZA 4RZUA 5EIWA 1GT91 1FTGA 4A8HA 4RNDB 2VT6A 3SX0A 2DWPA 2P9ZA 1RXUA 1WHTA 1S3SA 2BTOA 4JQYA 3GUVA 2VYVA 4Z8XA 3V8VA 2ZWAA 4FYJA 4BVAA 1Z75A 1X94A 2CFCA 4CDMA 4FW9A 1P0FA 1M0TA 1P4AA 1T2AA 2KBFA 3DS8A 1GFSA 3V4SA 1IJEA 3ESCA 3TUIC 1MH1A 2WJPA 3E9DA 2NU9A 2YZ2A 1MA3A 2GD6A 4KMRA 5E7QA 3ENZA 1IQPA 3IP1A 2ODTX 1MB2A 4TGLA 4DA0A 2ZUVA 5JSQA 1U7UA 1YI1A 4EW1A 1PUXA 2D5LA 4YT5A 2XNCA 1QJ4A 3C48A 2DQ4A 2X0JA 1I7QB 3SQXA 1XEWY 1B14A 1IVNA 2DBZA 1NMSA 4HNAA 4KB5A 4UOQA 2J3MA 2FQWA 2YHUA 2VHVA 4INZA 2FUCA 1EM6A 1XTUA 2RC5A 5DHAA 2EBWA 4IIVA 4LY6A 5I47A 4EKNB 2VP9A 1L5FA 1F6WA 3OWXA 4GS5A 1WY5A 4KO4S 4MO2A 5AW5A 5DSZA 2I71A 5EHZA 2X2EA 1QO9A 1ORWA 4A2QA 4WBNB 4YUAA 1OAAA 5H83A 2ERYA 2JHCA 4G5FA 4IEEA 4KWHA 3K70D 4F06A 4RIFA 1YGYA 3TDNA 2G1PA 2FCAA 1ZNXA 4PFKA 1W5SA 1X80B 1VIAA 3PDJA 1VGVA 5HJ7A 3U9LA 3T4XA 1JJBA 3OICA 3W04A 1OLSB 2GBLC 1FXWF 3K09A 3D5EA 1KE1A 2X1VA 3MTIA 3U49A 1VIVA 4DS3A 2BIFA 5JH7A 3GH1A 2F9LA 3RFTA 1MT3A 2EQBA 3QXCA 4AN1A 3S6JA 2LDBA 1X7YA 1LA2A 2HK8A 1EWKA 1EK0A 4NYMR 1I6WA 1IDOA 1LBEA 1PWZA 2JFBA 4G6ZA 5EA2A 5G40A 4ZXPA 4BFTA 1E79D 4FQ7A 4HDSB 1I5OA 1M2OB 1N3YA 1RJDA 1XKXA 3EAQA 4GGOA 5B3KA 1FTQA 5C4IA 3UBTA 3GEGA 4DEVA 5B6IA 1OB2A 3JAKA 4P7GA 4Y2UA 4E7OA 2WU4A 3RS7A 1NGSA 1RR6A 1C3XA 1W0KD 1YO6A 1YTLA 3COWA 3LZ6A 4PO8A 1KXZA 5BSEA 4II3A 2IYOA 3KYCA 4KYVA 4MP6A 2RGRA 1VLZA 1ZJJA 2QORA 3OZDA 4FHEA 5HSGA 1DBSA 4TS1A 2ZRMA 4ERNA 5C3MA 4MV7A 1U28A 2EERA 3U7GA 1IZ0A 1JIUA 3L01A 4H08A 1NW8A 5JRJA 1U3CA 1I4LD 2WD8A 5F4ZA 1DEKA 5FYDA 3DEKA 3QWHA 4B6GA 9LDTA 3NKFA 3OQIA 2PGIA 1EJ0A 4P7FA 4O4IA 4B31A 3ZGZA 2Q99A 1OFUX 1P19A 2VKTA 1U0HC 3B1XA 3CLHA 3IAS1 2Q3FA 3H2YA 4DDUA 1K5DA 2XOEA 4MDYA 4OQMA 5LMNB 1AB5A 1SHUX 4F86A 4OKNA 1SH7A 1B23P 1XZHA 4RABA 2FWIA 2I6QA 4UEOA 3WFIA 1UBMS 1HKHA 1J33A 1B3RA 4BKQA 3N3AC 3WL8A 2C2WA 3H83A 1IFXA 4QFDA 2VDQB 1FYXA 5CVTA 1UDRA 1LPMA 2A67A 2HLPA 3LI2A 4NP6A 4ZRDA 5IVIA 3C3KA 2Q5JA 1PBTA 3AETB 4Z9XA 5FTLA 4C0AC 3RAJA 5AVQA 5KSZA 3M89A 3W3AH 3T9DA 2BH9A 1L1QA 4NQRA 3Q40A 3DDOA 4DN6A 1USGA 3T5DA 5KQPA 1ZVMA 2P9FA 3EW7A 1Z7BA 4OQNA 1TTPB 4GYYA 4GSLA 4WNAB 2PX8A 5CM2Z 4YRTA 3BBLA 3VMFA 4F3KA 4NLLA 1E2HA 4YTEA 3CYFA 4HNVA 3SP1A 5IPFA 1CJTC 4Q3AA 4XQGA 2BONA 3O4GA 3JVVA 1PZMA 1KYYA 3OEHA 3GOHA 5EE0A 3WKAA 2QA5A 1RZRD 4E3WA 1S2DA 4V0SA 1P91A 3VR2A 5LR6A 3GLHA 1RYZA 4N76A 4X3PA 1YZHA 2NXJA 3W2FA 1ZINA 1U6KA 2J0UB 4F96A 2FUG6 4UNNA 3TRJA 2HGSA 4AB1A 3R7BA 5MGNA 3GGGA 3NM4A 3E5RA 1AK1A 3RC3A 2WWVD 1EBBA 3ADKA 1E1QD 1Z28A 1R4MA 2VHXA 3LKBA 4HX9A 1AMNA 4PGFA 4IDOA 3LV8A 3DH0A 3DQZA 2C77A 2AXQA 4G3XA 1RT9A 2CDNA 1W5BA 1BXRB 3M8KA 4GZ6A 2ACKA 3ITEA 5T67A 1E9VA 4F5ZA 4HJRA 4TWAA 3AOEC 3JPYA 4B85A 1PDOA 5EJMA 1CJKC 3WYCA 2VDNB 2HHCA 5DM70 5MN4A 1XDZA 1JDVA 1X1RA 3FOFC 1GTMA 4B8YA 1KEWA 2QD2A 4PYNA 4C4TA 2XUFA 5E2BA 3RVMA 5DYTA 2XWSA 5IULC 2FWAA 1GAJA 4WXHA 3NVDA 3VNAA 2UXBB 1RLUA 5JDIC 1DP4A 1R9JA 2OEPA 1A9SA 2MOKA 3RKUA 4Z2AA 1KFKB 2X40A 3WRXA 4DCMA 3DXYA 1N2SA 1UBLS 4I1IA 4EWLA 1RM3A 5I48A 2XZTA 4G9BA 3P9ZA 2R8BA 3HB4X 2XCLA 5CT9A 5G53C 1W9HA 4XWKA 4P4UA 4Y8VA 3TW0A 4FEEA 1HY3A 2WJJA 1Z37A 5HW0A 3IJPA 1NX6A 5JAZA 4O1HA 1MVLA 1XNHA 1RAEA 4WLEA 2A0FA 3NATA 4NOKA 3PX3A 2XOKD 4NU0A 3MTEA 1C7IA 1Q0QA 2WD7A 2ZBGA 3IBSA 2QQFA 3MMPA 3EA0A 3S2EA 3CLRC 4DPKA 2QM3A 3CUUA 1W0JA 1XRMA 2GILA 3HYRA 2F4NA 1KU0A 2OV4A 4LGYA 3T0FA 3ZHOA 1UQUA 5CFOA 2PUCA 4I2VA 4CKYA 2BSQA 3R0XA 2MSCB 2GEJA 3NBQA 4W7SA 5HA5A 2J5BA 2X0RA 2P9YA 3R5TA 1KNXA 2NP6A 5HXAA 2VEOA 4V0KA 3W3AA 5CLIA 3JVDA 5FBKA 3CZQA 5DHPA 4A8TA 1X9IA 3TECE 3ZCUA 4AJJA 2IL1A 4PPYA 3CRVA 2PNJA 2ZSKA 2HN9A 2O0HA 3EIEA 4O2BF 2QV0A 4FU0A 4LDPA 2OCDA 1BKYA 3ET4A 3ND8A 4EKIA 3ZVMA 4DRYA 1BE6A 1EAYA 3OF3A 3M49A 1WKCA 2WIKA 1DELA 3P9NA 4GP9A 4OF4A 1T9CA 2V7PA 3HJNA 4A5OA 4EVIA 5HNKA 1FZTA 2AHRA 821PA 1GNVA 4K9NA 2DPMA 5DKFA 3AY3A 4E5MA 5IAOA 4JYAB 4X6XA 2W6JD 4UJ3A 2EJUA 4A73A 5BXYA 1VHQA 4YO8A 2CKDA 4R7TA 4LKOA 4TXNA 4CKXA 5K4AA 1V37A 2QVCA 3SCZA 2NYVA 3O9MA 4HH4A 5IWCA 3IODA 2JLVA 1TQ2A 2H5JA 1S6YA 4F4HA 4I19A 1IBRA 3OZWA 2FSHA 4FT4A 4MKGA 2OGSA 2W5UA 3LECA 2EJCA 4TLBA 1MABB 1JQJC 2ZRIA 4FLMA 5CNIA 9ABPA 4QU5A 3P0JA 4D8XA 3E53A 2AR9A 4ASUA 4QQ8A 1Q83A 4YBZA 5F5XA 3ZXUB 4JI3B 2IUYA 3AEYA 1WM1A 5J5CA 3N5KA 3DLBA 1V95A 1N2CB 2CCKA 2EG9A 4TV9A 1HM5A 1BC5A 1YA6A 3ANTA 1TTTA 3MGBA 3OPXA 4GC9A 3LGXA 4E14A 1FEZA 2BZSA 3HCDA 4CDGA 2C84A 1WHSB 3DHVA 3JWGA 4O5AA 4Y0NA 4D8VA 2RG7A 5HUQA 4FFOA 4KQMA 4FDAA 1K3UB 5YASA 2J4DA 2SICE 3EF0A 2IYEA 1N6OA 4JU8A 1SHKA 5IK2D 3VJRA 1HYQA 4RMIA 4BIMA 3H9EO 4UOZA 5TT0A 2Q2WA 1FDUA 2XLCA 1SVNA 1DINA 1S0UA 1SWWA 2NO4A 3G9XA 3OPYA 1YA4A 4WJKB 3SC2B 3CF0A 4RYDA 3UY4A 5CLQA 4EAAA 3TAUA 1VI2A 4HGOA 5I7AA 1LV8A 1KF0A 1VCIA 2VFAA 4LAFA 4KXVA 3OZCA 3MEQA 3HSKA 2ZE8A 3KKKA 4AP9A 1P0CA 4BVJA 2OZLB 2X2FA 3DOUA 3NBXX 4J91A 2YC4C 3ZZMA 1QDLB 3ZU5A 3ITDA 2QGFA 2YH2A 5C1BA 2DB3A 1YQDA 5F33A 1DUSA 1G2QA 4WGFA 1YRWA 4ND4A 3EQ9A 1EGMB 1CR4A 1JIVA 1TLTA 4I6EA 3SNKA 4ZI2A 4CUJA 1AGRA 4BFXA 2DH6A 3N6XA 2YW2A 1C7ZA 4IWYA 1F8FA 1WMAA 3OE1A 2OO7A 1LDMA 2XZOA 1G42A 4LJLA 5HIAA 1GGKA 3PQ3A 5DP1A 3JTEA 3I34X 5IYZB 5JCPA 2CNWA 4ZVKA 2HCRA 5JEDA 2ZCUA 4F4UA 1IY9A 2QYSA 1M8JA 2H11A 1CF2O 1QHNA 4I4TB 5BPHA 1T9KA 4GVLA 4GOMD 1BJRE 4QD3A 5AVYA 2M1XA 3PGXA 4A15A 1HE3A 2GN9A 3I2FA 3ORFA 4OQPA 1P31A 1ZJ5A 1L9KA 2WOJA 3BB3A 3CE9A 3IBCA 1T5LA 3OQOA 1CNFA 1S3GA 1W4ZA 2JJ2A 2ST1A 4X71A 5EHQA 4DRZA 1I2ZA 1EINA 1W36D 1ORVA 2BEWA 2HSDA 3F5MA 1AKYA 3IMKA 2C82A 1BDIA 4L73A 1Y5LA 2C03A 2Q8QA 3D6NB 4X20B 1JJVA 5BMVA 3Q98A 2I3ZA 4IMIB 3VR6H 5TGDA 4Z4HA 1IQRA 5LMUB 3S8YA 4IRXA 1RCUA 5DCUA 1NUPA 4HQKA 4C04A 2BFWA 1SEVA 4ZVVA 2IITA 1JMKC 1T6NA 5J2TA 4A92A 2EW1A 3Q9SA 3CH7A 2P67A 3H86A 4CVNA 3QWFA 4KO8A 1P17A 3LH5A 5AKYA 1TXGA 3HCEA 4KR0A 3FZQA 5AHXA 4YRMA 3RHFA 4EYSA 5K3OA 3DHWC 2O8CB 1ZUD1 1MJGM 1WSWA 3TSAA 4ZFNA 2O3TA 1S89A 1N0VC 5GINE 2AC2A 2IVFA 1FLAA 4OI4A 1US8B 1FRQA 1MVOA 5E1MA 2J7PA 5F12A 4BQIA 2ZIXB 1OTHA 3D4PA 3CF4G 3HU2A 3JU3A 2PWZA 1J1IA 1DS6A 1YB4A 2QX9A 2REBA 4ZAXA 4LDZA 4BJ3A 4QBGB 3RBVA 1Y6JA 1PQWA 1DT3A 2IEDA 1EP3B 2CNLA 1POXA 4II7A 4JB3A 1Y4SA 4R9RA 1C1XB 2HBZA 5KYVA 4YXWA 4GXQA 1IN6A 4YNBA 1ENZA 3DVSX 5EPEA 3UV3A 3WMRA 3MSCA 1IQ0A 2DYKA 1RYMA 1T4CB 2P6OA 5F2EA 1GLGA 1IBSA 1YBAA 4HC4A 4N7BA 4MGZR 3UT6A 3WJAA 1LTKA 1Z4OA 2X5XA 3LSYA 3WLKX 1OXBB 3AKEA 3FDJA 3ZZ1A 1FNBA 4Q7JB 2CSXA 1H3NA 5TC4A 4YDSA 1O97D 1N36B 4J4TA 5FFFA 1K9SA 1NYLA 2KB0A 4CTJA 1TJPB 3AL2A 4Q0MA 1JWAB 1YK0A 4YMIA 4W9RA 2B2CA 2O5CA 1GSAA 3N86A 2V6BA 3T7RA 4DNXA 1GTL1 2RGNC 3GMTA 1M6YA 1U8YA 2YQZA 4F5WA 4OHXA 1NNEA 1UBHS 4EUKA 1XMJA 2ZLBA 3BCRA 2Z8YM 3FG9A 3L77A 1R5OA 2FR8A 1YI8A 1T15A 5CUQA 4MVXA 3DLPX 1TQDA 3A4MA 2QUKA 4L75A 4RK4A 5EJ2A 2DOKA 3QBVA 1U7XA 1P81A 1Z7WA 4I5GA 3KDPA 1WLYA 3CF4A 1PZFA 4GP6A 1XTTA 3U7QA 3WK6A 1QO0A 1P1HA 3DMRA 5EWLA 4XRGA 1DTSA 1J0BA 3A58B 3AP1A 3VPAA 2VJCA 1LC3A 1Z4PX 1Y1SA 5ALQA 1J24A 2W6OA 1P33A 3HNPA 1IK6A 1DKNA 3TIVA 2ILVA 1XJQA 4YS6A 1KJYA 4M53A 3PD7A 4XA8A 1DC8A 2BM8A 2RONA 1NURA 3B9BA 3PC8A 4FYIA 4IH4A 3CVJA 4GOOD 4KTVE 4TN1A 1JI3A 3QMMA 2Q21A 2BKEA 1NM5A 4JLMA 3KQPA 4DCNA 4B6QA 3FFWA 2CL0X 2I3GA 1L5OA 2MJLA 3FPCA 4HUJA 3G8AA 621PA 3K4QA 3EXIA 2VCEA 1QQTA 4GUAA 1HDYA 5SZIA 4X00A 5CFPA 1Y3FE 2FUG1 1B7GO 1QE0A 2IYAA 4ENWA 1VBKA 4IIJB 4OLJA 5LIRA 3STXA 2XUQA 4KKVA 7GPBA 3SK0A 2ZVJA 3KM0A 5GIOE 2IPOA 5GQSA 1UFQA 4Q1VA 2IYWA 5BSGA 1YR1A 3O4IA 4NZYA 4Z2YA 3DT9A 3UXEA 3EXHA 1L6IA 3KTDA 4N5DA 1MEOA 2ACEA 2G82A 1UIRA 2VNAA 3KL4A 1N25A 5HRAA 5KIAA 4LQ4A 2JEZA 4QPDA 3UOWA 4JB8A 2ZIUB 1N6PA 1XXHE 3D4LA 1JGTA 4AFNA 5JDIA 4MXDA 3Q6NA 5D5QA 2VWQA 3PPIA 4MR8B 4LHVA 3WQSB 1JXMA 1WZIA 1JIXA 1OQAA 1NVXQ 2VJBA 4TUYB 5K3BA 4EG4A 2JDID 1SU8A 1HURA 3C6KA 1WG8A 2CW5A 2QL7A 4IINA 2C9CA 1SVIA 1YK1A 3VTKA 5K4GA 1DO8A 1ZC3A 5H0IA 1C0LA 1EWYA 2VDMB 2JHFA 3NR2A 3P2YA 1OXTA 5H4HA 2V7GA 3CKKA 4MW1A 5L3QA 1XJ5A 4TN5A 2JF0A 5L8VA 3LTNC 1PBNA 1F2TA 7REQB 2Q6IA 1E5TA 4NESA 3N8NA 2ESRA 2XT9A 5HKLA 2I03A 5KTPA 3PWSA 4V03A 1XKQA 4XFDA 5GGYA 2PLAA 4MLDA 5JSZA 3ZHBA 5INTA 5FF9A 3BWMA 5LZ5A 2YY5A 3IUBA 4WKCA 1P5HA 3FDXA 2HIHA 1BA3A 4JASB 2AV6A 5CX4A 4YJFA 3EVFA 4IJMA 2VHJA 3TTYA 3N5CA 1RYYA 4HGYA 1M6NA 1XZBA 4LJ4A 2AG0A 3OIGA 3PGVA 3KJNA 5H82A 1JQBA 3OIUA 4RACA 2HBYA 3QSGA 5AJWA 3DR3A 2XQGA 5FQNA 5IH3A 4IYJA 5BURA 2WE7A 4G4SP 3U3XA 3M7IA 1JHRA 3DKIA 3TW8B 3EIHA 3W4IA 1RWKA 2FFJA 2Z8ZA 2D1FA 1XN4A 1PAUA 3EF1A 1NAHA 3T0IA 2PL5A 1UKBA 1RQLA 4JGGA 4ILEA 4WL0A 2FOLA 5TEWA 1UJBA 5KKCA 4H9GA 3VR4D 1TA4A 3PF8A 5DHFA 4CLOB 1G41A 1H2FA 3GLTA 4TSFA 1SBHA 1KYXA 4RA9B 2R1TA 5JQWA 4RULA 3L41A 4IYRA 2IFTA 3CUYA 4JZKA 5DGTA 3TGWA 1L5HB 4H0CA 4ICIA 4YDRA 4G1FA 2VXCA 5LA6A 4B73A 3I5YA 4LFAB 3FE2A 1V1RB 2RHDA 1SG9A 5TVGA 1UDWA 5JZSA 1PJRA 1OXSC 2D00A 5BNWA 1G5IA 1NMEA 2FSFA 4K3UA 5CB4A 5KKAA 3UWSA 1F48A 1T5BA 5DI3A 1V5IA 4IUYA 4JOQA 2Y8EA 1E2LA 1D5CA 3HLYA 4FWBA 3H1BA 4HN4B 4I5EA 1Z8NA 2Q62A 2ZQ5A 2JL1A 4DC0A 2ZI9A 4KXYA 3WE7A 4FFSA 3KG2A 4DLBA 5EFOA 2ZS9A 3BWEA 3FZNA 4GMDA 5DRTA 1U98A 2W2QA 1PEAA 1RWMA 1M8PA 4EFDA 4A0HA 1XPJA 4LV8B 1BU8A 2X77A 4XD7D 3F47A 4L5BA 4BDTA 4URVR 3E61A 5BV0A 1L7XA 3L7MA 2XAAA 4TSFD 2YL2A 2Z04A 2NV2B 1CUGA 1UFRA 2Q4OA 2FW6A 3H6GA 3FAZA 3HBMA 3NTVA 2DCUA 1C50A 3HB7A 1V5GA 2FMUA 1QVWA 4HMOA 3V80A 4KO1S 1P7CA 3SGLA 1BD3A 1H23A 3IAUA 4RVHA 1ULSA 5ALYA 1JWBB 1XVIA 3NHJA 3QRWA 4QDOA 4RK5A 1ULTA 1XP5A 1HDIA 1Y8QA 3RSOA 4F3CA 5ITWA 2V3VA 1EFTA 4M1WA 5DW0A 4E5DA 1R3DA 1ECFA 1GCAA 4PAQA 3ROEA 1IBMB 3UPUA 3V6LA 2O8EB 1JAZA 1RI5A 2ZTHA 2OYSA 3CLSC 3KPYA 5HX7A 5I4KA 3PNVA 2D74A 4OD0A 5CU7A 4X93A 5CDSA 3A4IA 4KI7A 1U4OA 2EP8A 4LZJA 1LWOA 3WKBA 1AZTA 4NI5A 3X2EA 4C21A 4FXOA 5A6VA 3HGQA 3MMNA 4A23A 1E9EA 3GLIA 1T8WA 2UZ1B 1C30B 5BYJA 4ZEWA 4LMBA 2IOHA 2CUZA 3AKYA 3EDRA 2V5VA 1N2GA 4EBFA 2WI8A 3OLZA 3K9QO 3G0IA 4WUVA 1A96A 1AE1A 1E3WA 1QQ5A 2D5AA 2W8BB 3AIMA 4F12A 4Z1OA 5KNDD 4MRMA 5ALUA 1MIOB 2FJ0A 5E0KB 2Z08A 1V11A 1I6LA 3LG2A 3O95A 3GFVA 3I6ZA 3K35A 3LA6A 4X92A 2OQVA 2JDIA 3JAMA 1OX5A 1PWXA 3L6UA 2FTKE 2WC1A 4MR9B 3IOCA 3SE7A 4RD4A 2EBUA 2BAGA 2HSZA 2VZ0A 3CZRA 3FYUA 4H6PA 1DQYA 3VZPA 3LCRA 2IYFA 3O84A 4EMTA 1WXEA 3G0BA 1YHYA 2VDJA 4KACA 1OI7A 2ZIFA 4BE4A 2IW3A 2C83A 3UXHA 4CT5A 1O03A 2FPGA 1KC1A 1O1YA 2ZR9A 4RF4A 1D0SA 1T10A 3E1SA 4Q16A 4A27A 3P0IA 3RS8A 3UEOA 2ZZNA 1QB8A 2QKYA 2RHCA 5A1JA 2XXAB 1C29B 4TKVB 4MWCA 1J8YF 5JS1A 3WBBA 3O5AA 2O4CA 1DLIA 2GPWA 4IIYA 4ZDIA 3UIEA 1EFVB 1XDUA 3CKLA 4LHYA 3A32A 4X8HA 4BMVA 5FWAA 1NVVQ 1X3LA 1O4VA 3ETJA 1ZUIA 1TGYA 3DZJA 3FKJA 3PNOA 3TLXA 1F4PA 4XYLA 2GPYA 4CBVA 2C20A 2Z43A 2D4HA 2I4LA 4Z4CA 1JG7A 2TS1A 1GNRA 1JEOA 2IZ7A 2ORED 3FLMA 4J1TC 3ISTA 2DUJA 1N6KA 1QFJA 3AM1A 3UJ6A 4RC9A 4UTNA 5J4HA 4K6HA 1COZA 3B9QA 3KBOA 3DYVA 4HV4A 1WU7A 1T91A 2ZYAA 4RJLA 5F2OA 2C5EA 2FPOA 4FSHA 3RRXA 5B4UA 1Z22A 2QW0X 3ZY5A 1QV7A 1AUXA 2Y1DA 4RVNA 3VX3A 1P18A 4PCAA 4AECA 1NMXA 1VSUA 1J8FA 2L17A 1QGUA 1ULZA 1WCIB 2NZ8A 3KLBA 3WMWA 3Q6IA 2GJ4A 2P6NA 4RKYA 2Y1GA 3RBZA 2IIQA 1R3UA 5E1OA 4IKEA 3SHWA 1WD7A 1YVEI 4Y7CA 3TSYA 4H77A 3HEAA 1GFWA 1YDGA 1N3LA 1L6RA 2ZBEA 1TUEA 3ELUA 3AKDA 4O4LF 2PH3A 1I7LA 1U8ZA 4UU0A 1ORTA 3BDAA 3FBWA 4EKYA 5CJJA 1ANKA 4WESA 3IVXA 1XOIA 1N6IA 1PWHA 4WLFA 4OQFA 2VPZA 3TMYA 3VPFA 4FCTA 5KCMA 4R8MA 2UYHA 2ZAGA 4DA4A 1XMVA 4RNCA 2ZIAA 2H4YA 2QUAA 3I0MA 4HNHA 3OMWA 3WA6A 4KFUA 1G6HA 5J4VA 1I3NA 1RPNA 4OXNA 3KHSA 1ULBA 3EDYA 1YZ3A 3ETHA 4PYMA 2LCFA 4PNPA 1JXOA 1GN9A 4TROA 1EQUA 3EARA 1W59A 3F9CA 1C4OA 2X7JA 4BO9A 2HW8A 3QE4A 5L3SB 2NU8B 3V4LA 1GQFA 3Q3VA 1EP9A 3EOBI 2BMEA 4WBSA 1WB6A 2P30A 1NJ1A 1GV0A 1N7GA 2V7QD 2BMAA 3PC7A 2AG8A 4XPZA 1K1EA 1BWSA 1T9AA 1QVZA 1YQWA 2ZI3A 1JW9B 2FW9A 4FMDB 4QTTB 3DMHA 4AJ4A 4DDHA 4EB6A 1GCOA 2GI4A 4W99A 4ZTZB 2AFRA 2Q07A 5K0JA 5BV8A 1FB5A 3KVVA 2AI1A 2IX9A 1TZ2A 4AW9A 1OTXA 4JMPA 3WJ1A 3THWA 4YWJA 5B64A 3MGGA 4F1JA 4YJ2A 1U3FA 2AXPA 4CKEA 4Z6KA 1LLCA 3G49A 4UKDA 3U3ZA 3BGDA 1IATA 1UBFA 2AF3C 4HNSA 4WN3A 4UTPA 2VTBA 3GCGA 3BHJA 5E4FA 1WNTA 4I3GA 3MFYA 3KK0A 1N8TA 3VHXB 4AF6A 4CM1A 4WK2B 4S2UA 4NCAA 3PEEA 4O0LA 2DUUA 1L8XA 2ZJ4A 1YRLA 1ZMRA 4CN9A 1WDWB 3G82C 3CURA 3OAAA 2H63A 5C0OE 3T3IA 1FFYA 2B83A 1SOMA 3EFEA 1VGQA 1YDWA 3H11B 3PR1A 3ROMA 3A0RB 3HU3A 4DIEA 3T5AA 3AKCA 2EKPA 1YQXA 2OBYA 4P4TA 4HF7A 5AI8A 5HOEA 1DCKA 2QI9C 3SVTA 5A9TA 2IS1A 4FNAA 3PPVA 2KQUA 2V45A 3HEMA 4I4NA 4KFRA 4L95C 4YONB 3UBMA 2EFJA 1VI5A 3AU9A 2QU8A 3K05A 5ALXA 3T06B 3LIIA 5JTUA 1C7FA 2NPFA 5EQDA 4G4SO 1MR3F 2FPIA 3PYLA 4DWWA 3E23A 3OFVA 2FV8A 2AEJA 3VMMA 2RGUA 1KRXA 3IO5A 4OHOA 4BECA 1SFRA 3FUCA 5CP8A 1CUBA 2G40A 1IY2A 1BU5A 1PWEA 2Y3IA 3EJ6A 3QKIA 4JL8A 4XD2A 1OVGA 4JWKA 2AS0A 2DHDA 3PIRA 3WLJA 3F9IA 4Q4CA 1EAMA 1LVGA 2VJKA 3HM9A 4ARCA 4OQQA 4LUCA 4UNPA 2AOTA 1XELA 3KXKA 2XVXA 1KOGA 4DUGD 3I5XA 2FX5A 1U2QA 2VPXA 1I1QB 3TXYA 3JYPA 2VPWA 1M74A 3SKYA 4WCFC 1IHPA 4FYHA 3TL6A 3CPEA 2ZIZA 3UFBA 4BZWA 4E03A 2O6HA 3AR2A 2BH2A 2OHJA 4R83A 1SELA 3GT7A 3HKBA 2Q4RA 2EZTA 3M6UA 4BLSA 1T4GA 1RIIA 4N47A 3KZOA 4LBWA 3KV3O 4C6TB 4ETMA 5ULLA 3UMMA 1HNZB 3X1XA 4ZP1A 4OJTA 1B6SA 1KMHA 7ABPA 1BS1A 1GG9A 1B8VA 1W6RA 3K0CA 3STWA 3A70A 1YE8A 2QZ9A 3H1TA 1IUKA 2I2CA 3GRVA 2MSLA 2WF9A 3M3DA 4P2GA 1GFZA 1T8YA 2WWRA 4RVSA 1FE8A 3V5NA 4TLAA 3EAGA 5KCZA 4BRUA 1HLGA 3L9WA 2A5LA 4MLCA 3DOIA 3KSDO 4OFZA 4DLNA 5B7NA 1P6XA 1GJRA 1U81A 3QKTA 1I51A 3H8SA 4K2HA 3BFJA 4URWR 4CU5A 4DXHA 4EELA 5C46F 3WAJA 4L8FA 3MJVA 5EZYA 4RPIA 1KYIA 2XNKA 3DAGA 5JQGF 2GNAA 3NIFB 3KKLA 3QBEA 4ISCA 4KDCA 5DTEA 5KWEA 4C0LA 4B79A 3QFTA 2FSVA 2Y1FA 4HZIA 3RC7A 5K6AC 1PNTA 5EI5A 1FFAA 4EUNA 3ID6C 4CMAA 1G6Q1 2B99A 1SBCA 2A57A 2APJA 4REQA 3CLSD 1PFGA 1EK1A 3CH4B 3I2HA 4MA0A 1LS6A 2B8JA 4TS4A 3RVLA 3VR0A 3VPDA 3DD5A 4LV5B 2A86A 1NBHA 5TPZD 2VNSA 4K6CA 4HZUB 5CVCA 5TIIA 3IHWA 4KQFA 1F7UA 2ZVDA 1QH1A 4M0UA 1JIQA 5ISMA 3PDIB 4XLLA 3JQAD 2ABWA 3L1JA 4F5YA 4M7WA 4HEA6 3CH5A 1WP9A 3U5TA 4KHPB 1KEEB 4B83A 1SU6A 3JVIA 3W06A 1U2TA 3COJA 2CWDA 1M8GA 5BOSA 3SBEA 3QF4A 4G0QA 4I1RA 3FUXA 5KNBD 3KKZA 1R0ZA 1SXHA 1D07A 1FLDA 2B6HA 3OOSA 5EKXA 4C88A 1ICIA 1ORRA 2IK8A 4YRQA 1HH4A 5CLGA 1P9NA 2RGNA 5JECA 2WMNB 3DTVD 3Q5GA 2ZUUA 3F3SA 1XNQB 1PVDA 2GN4A 2HHAA 4D4KA 1QWOA 5IHPA 2VSYA 3EF3A 1G7RA 2FRVA 1CQZA 3FR8A 4MJLA 4WI1A 3RRMA 4AMGA 3AW9A 2CHVA 1CZOA 1IG3A 3FHJA 4J16A 3U9SA 4NAUA 1NJFA 5JSHA 1D09A 3IT2A 3QTTA 2WMDA 4FMPA 5AI9A 1YJQA 2YUIA 3GJ5A 1W48A 4B7AA 3OLQA 5DNAA 3AUYA 5DZSA 3EZYA 1MZVA 1IUPA 1G8JA 3F6CA 3KVOA 4JENA 3N2GB 4CYMA 3RVSA 2HD4A 1JKMA 1NBOA 1U0FA 4BVLA 5HUHA 1M54A 1RHKA 4I8XA 5EMMA 1N9GA 3H2IA 3AERB 4BX0A 5BUSA 4DCVA 1XDBA 2HU5A 1W46A 2B1JA 3NKVA 5TXGA 4YUYA 3A9TA 1EM8B 2W2LA 1T3SA 4NFYA 4TZ0A 3CBQA 1BCSA 2O8NA 4OO3A 4H6XA 5JS6A 4EQ6A 4BY9E 4LZOA 4DDMA 1EZZA 4RY0A 2DRIA 3BZWA 3ABSB 3GPIA 3V48A 5KTTA 5BN5B 1N5KA 1DG3A 2YFYA 4LFBB 2NZ2A 3JARA 4QQFA 3M9XA 1CIJA 4ZOAA 5CB0A 4X3CA 4I5FA 3RHSA 2HMWA 2XE4A 2FEAA 4K6FA 3WWOA 4R9VA 3WWPA 3IP9A 1P29A 4U63A 2L82A 5CRIA 4P3PA 2J5XA 1TQ6A 3K2EA 2GJSA 3SHQA 4AWBA 1PIWA 1T5OA 2IP1A 3E7DA 1F17A 3ZWKA 2OCAA 1SCQA 2C9OA 3TQHA 4FDLA 5G4KA 4BFVA 2KWIA 1UWVA 4CDNA 4HBZA 3RABA 2JCXA 5L95A 4HB2A 2ERXA 4HI0E 1RAAA 4EG8A 5B7PA 1HE5A 2N9UA 2BFBB 3GVCA 1B93A 4HB4A 4GYWA 3U44A 1J5EB 4R69A 4B8WA 4OLAA 4EY7A 4D4LA 1JRLA 1K89A 1DWQA 2ZYDA 2CXPA 3G85A 1W0CA 3VYSB 4J90A 2P40A 1PK7A 1OXUA 3H13A 4BU0A 3LNTA 3ZDCA 4ZMBA 2CDRA 5CG2A 3PFCA 4BV8A 2D7CA 2GSWA 3KJZA 4BL5A 3E03A 1WZNA 2QSYA 2VSQA 3M6XA 4MPTA 3RTCA 3IO3A 2PV7A 5SZKB 1GTG1 3SBOA 3DMGA 4G25A 3SD7A 1CDEA 3CLRD 5HF5A 1XU9A 4JVSB 4XD7A 4G09A 3CSSA 1TT5A 4L9RA 4JYPA 3W3ZB 2ZSEA 2OFWA 2QXTA 3KHUA 4ETIA 5IDXA 2PM8A 4C4PA 1CY7A 1H4VB 1QX3A 4BO1A 5AM2A 5F9MA 2OFXA 4GVXA 2R7AA 3RKSA 1COWA 4D96A 5AI5A 4XWTA 1UBKS 2VNIA 2FP4B 4U8HA 3D6HA 3D6UA 3IR6A 4O4JF 1VP9A 2YXLA 1O9HA 1LEHA 2QUBA 1GNTA 1D6MA 1I30A 2G72A 3CMCO 1AHIA 4LY9A 4RVGA 4EJSA 2H3HA 1SVLA 3GBVA 1YIOA 1M1NB 2FFAA 2IELA 4I1VA 3NTLA 4NEGA 1DUIA 4NMWA 2PPLA 1JX6A 3O0DA 3V7UA 1YJ8A 2BGJA 3QPBA 3VOSA 2Z98A 1DXYA 1T6BY 3GG2A 5ER6A 5AUQA 2V7WA 4KRYA 1ZD2P 2IHBA 4NCHA 3ZQUA 4C3VA 3ETGA 2YRXA 5DYWA 1Z16A 4DQVA 4J3JA 2QUZA 1GD1O 1JVNA 2J08A 3DVAB 3R7WB 4AZSA 4QZVA 2UUCB 1T2CA 4FWIB 5JNRA 3ENWA 2IEBA 3B7GA 2FQXA 5IZ4A 2XBLA 1DG1G 2XWJI 3SZ3A 2V1UA 3ZXYA 4YRAA 2AF4C 3KSBC 1J8VA 3K94A 3U2QA 4CDRA 2C5LA 3T5TA 3BQNB 3I5UA 3R3VA 2V7TA 3EGWA 4TZTA 1Z88A 4WINA 2J9GA 4O33A 5BR4A 2DU8A 3LOQA 5HRCA 4QJ5A 3FA2A