1P62B

Structure of human dck complexed with gemcitabine and adp-mg
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
241
structure length
229
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Deoxycytidine kinase
publication title Structure of human dCK suggests strategies to improve anticancer and antiviral therapy
pubmed doi rcsb
source organism Mus musculus
total genus 90
structure length 229
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p62B00
1X6VA 1EX7A 3RLFA 3KFVA 2WWXA 1UKEA 4LYJA 1H8HD 1GNRA 2IYZA 2JJ8A 3IQXA 4E22A 5KUTA 1N3BA 5FUVA 3RWOA 2PT7A 4HB0A 1EFTA 3S1AB 2ODEA 4URZR 4XD7A 3RRNA 2IHBA 2WWIA 5GJWC 2NPFA 2QNRA 2W58A 5F2EA 2ZI4A 2ZR7A 3EZ7A 3FE2A 5LB4A 1CRPA 1RPZA 4HYYA 2GXUA 2JIZA 3LH5A 1N5IA 1E2NA 4NYJQ 1GL9B 5TDHA 2IXFA 2YC4C 4NBSA 4NYIQ 1JEDA 1QHXA 4IFBA 3K0SA 3T1TA 3PVSA 1IM2A 2IXEA 3CBQA 3CX6A 3EA0A 4IEIA 5KSZA 3R7WB 4GOXA 1E96A 3FMPB 2JLYA 1MR3F 4UJ5A 1SHZA 1LNZA 4KU4A 2BOVA 4B74A 1KI9A 4BASA 4Z51A 4ESHA 3U3MA 2N1BA 4JJZA 1NBME 2BMDA 1D6JA 1XJQA 1QVRA 2ZREA 5KNBA 2IBMA 1XFAA 5EJEA 4I1SA 3WBJA 5FBVB 2IYRA 3KQKA 1SHKA 1G64A 3K0FA 221PA 3LA6A 3PEUA 1UF9A 4RD6A 1JQLB 3TVTA 2EW1A 1HT2E 1KI4A 2LCFA 3H84A 4POAA 3FTQA 3ICQB 4BFZA 4DB4A 3OIVA 4YDSA 4Q7LA 4BUJA 3FPAA 4MKGA 1KK2A 2PZGA 5GVRA 4Q19A 4RY2A 4XH9B 5FL7D 3VFDA 4G5SA 2W2XA 1ZC3A 2R6GA 1HTWA 1DVRA 1A4RA 3RS2A 1R8SA 1G41A 3KUDA 5CLLA 4BZPA 4PC6A 3L8ZA 3IPYA 4YMWA 2IXGA 4Q1DA 3B5JA 3K0AB 4HB2A 3JZMA 3C7KA 2I1VB 4ERNA 3E70C 2F43A 2A3RA 3PUYA 4Q9HA 1KY3A 4GPTA 2FJUA 1ZU5A 3TUIC 3CNLA 1FNNA 1N5JA 4QBHA 2FFBA 4P4SB 1LS6A 1NG1A 2VP6A 2IUUA 1J8MF 2A5FA 2OZEA 1IXZA 4BFTA 5HR5A 2KJQA 3RWMB 1IY2A 1G4UR 4L16A 3HYRA 1US8A 2QBYA 1PLJA 1KKMA 1QHHB 4PAQA 4JSYA 2UVQA 2PMKA 3SBDA 4F7WA 5DYIA 4R7ZA 5CIWA 2PJZA 3U3KA 3W3AA 1NVWQ 4X8OA 1H8EA 4TLDA 2WJVA 1GAJA 2A5JA 3LX5A 1W0KD 2QMUA 4WZBE 3ZIAA 4WXRA 1T8UA 1T3SA 1HV8A 1X8JA 5TV2A 1I2MA 3LWNA 5F98A 5KO2A 4U02A 1CRQA 3WNDA 2FSHA 4ILEA 3GLIA 1S9DA 4K46A 4M22A 4EDHA 2ZS8A 2XXAB 1KZ7B 3IBYA 1BO6A 2OBNA 3B60A 1GSIA 4I1OA 1CP2A 1F2TB 2GJSA 1AGPA 5C1BA 4DT1A 4URVR 1IAQA 1CJVC 4JYBA 2FSGA 3PITA 4PZLA 4QGFA 5B58C 2C96A 4HZUB 5EXTA 1K6MA 2FEOA 3PUWA 4AYTA 5C46F 3ZS9A 2GCNA 2F9MA 5DISB 1UDWA 2VH5R 2GTPA 4DEXA 1RRPA 2Z4RA 1DAFA 1KK3A 2WOJA 3GJ8A 4M1OA 1G5TA 3R8FA 2IUTA 1IN5A 3GLFB 4JIMA 2ERYA 5L3RA 3QF4A 3N5CA 2IWRA 2V3CC 4LJ5A 2BBWA 2D2EA 4OHZA 1KIMA 1GIAA 2MMCA 3PXGA 4QM7A 3NBXX 1E2HA 2J41A 4YMVA 2WICA 1JXOA 4G5GA 4KHZA 5GADl 2ANCA 1EXMA 3OEED 1YR6A 5DLQC 3V9PA 4D0GA 1M7BA 1Z0IA 4TYNA 5GJBA 3VKHA 2ZVPX 1EK0A 2XX3A 1KDTA 4MKIA 3VHLB 121PA 1P9NA 2WPDA 3ASZA 4NMMA 3WMEA 2EYQA 2YINC 3EA5A 1GL7A 1OIXA 5HE8A 1LF5A 2ZRFA 3I8SA 1DO2A 4LK2A 4DLSA 1SXJB 5JSZA 3SHFA 3J81k 3EXAA 3JVVA 3B9QA 3CNNA 4XD7D 3KQHA 4MUBA 3UIEA 2IK8A 1ZUIA 1TX4B 2HLDA 4B76A 1AA9A 1Q1EA 4BEBA 3B9PA 1N6RA 2NMVA 1E2IA 2JIZD 2WHXA 4LJ8A 3RS4A 1P72A 1W4RA 1VTKA 3BORA 4QBIA 3ZGXA 1E2KA 4IDHA 2H17A 1T0JB 3CWZA 4QC2A 4QNMA 3IQWA 3E1SA 1Z0JA 2OEPA 2NZJA 5J5CA 1F48A 4DLRA 2Q3HA 1XCGB 3NKVA 3X1YA 4M1SA 2B7CA 3CPEA 3RS7A 1GG2A 2E9SA 1Z63A 3NC1C 4KYUA 4TMVA 4GP7A 4XVRA 4EFLA 4ZKDA 1D2MA 3O8CA 1D5CA 2FG5A 2B8TA 4TYQA 1JPNA 3QVVA 2Z5FA 1T4GA 2VIIA 1XMVA 4Q66C 5JLJA 1UKYA 4Q1AA 4TMWA 4H1VA 3THYB 4OKSA 4LGMA 2OG2A 3K8YA 2ZR0A 2H5EA 1W1WA 2H18A 2KWIA 4OHXA 3KKPA 3SQWA 1ZM9A 3SJBA 3BB3A 2ZS9A 3AVXA 2WIAA 2WVJA 2GRJA 4PC2A 1K5DA 5JWHA 1W4BA 2X77A 2ZUBA 5TMPA 4PQYA 1E94E 3SFVA 4O3MA 3GJ0A 4D26A 4HLDA 2VP0A 1TTTA 3LBIA 1S3SA 4EJSA 4F4IA 1L7VC 3TQFA 2CNWA 1T9HA 4OHYA 1E9CA 4TQUS 3AP2A 4WA7A 5FTJA 1XEXA 4ZDKA 1ZUNB 3M0EA 3HU3A 3LBNA 2J7PA 2NO6A 3LAWA 4RSGA 1VCMA 1IXSB 5JI3E 3R8CA 2W00A 3QQ5A 4URXR 1JQJC 3MWKA 1E2DA 1EWQA 2AWOA 1UBEA 2VHTA 3KFXA 1NN5A 4Q21A 2ZSEA 3OIYA 1CIPA 1CR0A 2IYXA 4P3YA 1N6IA 1P60A 3EAQA 3TJZA 4BLPA 2A7QA 5J4LA 1H8ED 2CMKA 5AJVB 2W6IA 4KBGA 3ZIAD 3PR1A 3FHCB 3GCGA 4OJQA 4B6EA 2QPAA 4CEHB 5D3MA 5BWMA 4V0NA 4Q1BA 4Q7MB 4L4UA 2TMKA 1AGRA 4JLKA 2CXXA 2GZHA 1Q22A 3GLHE 2JJ1A 4LOAA 4EIWA 1SVMA 2YOGA 1TQ2A 2VYFA 4LHYA 4V0ME 1EESA 4RZXA 2XNSA 5DI9A 4A6XA 4M1MA 2H7VA 4M0LA 4GMDA 5KHOC 5JMTA 2BM0A 4PZZA 1KSGA 2ZYWX 1COWA 2AX4A 1P9RA 2RGXA 3L8YA 3UANA 1KHTA 2GK6A 4Q03A 2JDIA 4DSUA 5LDDC 3EPHA 2MMGA 1R0ZA 3ECCA 4FCVA 5J4VA 4A9AA 5L3SB 1EFUA 3VKGA 5G53C 4ZCIA 1ONBA 1Q44A 4M1KA 3LY5A 3KJEA 4B3FX 4G1UC 3GJ6A 3FOZA 1E1QA 1SGWA 2LKCA 5FOSA 4DIEA 1Q1ZA 2IEZA 3LNCA 4MGKR 4RD0A 4Q9KA 4R71A 4PO9A 3KXKA 3K09A 2IW3A 1W44A 1Q20A 2J0VA 1FTSA 1FUUA 1KGDA 3PUXA 2WPDD 4MGZR 1NG9A 3GEHA 4BECA 1DAHA 4UNQA 4ARZB 2YC2C 4P0TA 5L3QB 3V4RA 5GVSA 4N0DA 3TAHA 1U8ZA 4MYUA 2O8BA 1UBFA 3DOEA 1N0WA 2X19A 2GXAA 1N6NA 2OXCA 2ZYTX 3KJIA 3K70D 1E9RA 2HLDD 2JATA 3ND9A 2QAGB 1FFHA 4LHWA 2DR3A 3QXHA 3RS3A 4RKFA 4PANA 1SKYE 1FX0B 1E1RA 1II8A 4RVCA 1QDEA 3VTKA 3KTAA 5AJWA 1GUAA 2GXSA 3C5HA 2XNDA 1N25A 2ZETA 1FP7A 1E99A 2ZANA 3FB4A 4MITA 4BFVA 1RRCA 2QM7A 3EZFA 3RRZA 1NNEA 5JRJA 1OF1A 2CL6X 1P75A 4D4MA 1G7SA 1YR7A 4KO8A 1G9XA 3M1IA 2ASEA 2O8CB 3T1QA 5JEEA 3WYAA 3H1TA 5KNDA 5FR1A 1E2JA 2BCGY 3QG1A 1CTQA 3LDAA 4PC3A 1MABA 2XZPA 3VAAA 1QF9A 2RGGA 4JVNA 4PFSA 2GJ8A 2EWWA 5CJPA 3AVVA 3FKSA 3ZVMA 3FHOA 4NP6A 4LYAA 4CEIB 3EZ9A 1P73A 2OCPA 1Y63A 1PLLA 2WAXA 1YRAA 3Q8XB 2AXPA 1GKUB 3TR0A 2GAOA 4OQLA 2VRWA 5EE3A 4EPTA 3ZVNA 4QM6A 3VQTA 3GJ5A 5ANRB 1IJFA 4B33A 4RD2A 3KJGA 3D6TB 1E2LA 1Z0DA 2ZS7A 3IIMA 1VG0B 4W5HA 5BXQC 1ZW6A 3BH7A 1VCOA 4RJLA 4FMCB 3CZPA 3NBYC 4B3DA 3SJAA 2CNWD 2BCJQ 2BC9A 4J0QA 1RFLA 1P2VA 1YE8A 1AK2A 2IYVA 1UPTA 2J7PD 2ZSAA 3JZAA 4L15A 5DI3B 4AI6A 4WW0A 4D0LB 3W8NA 2DB3A 3ICEA 3I92A 4DRZA 4GP6A 1XXHA 3HU1A 2OFOA 4A1FA 4LHVA 2RGBA 3O47A 2R6FA 4GSYA 1R0WA 4OJKA 1GVNB 3UWKA 5E95A 2OESA 3ADCA 4RZ2A 2A2ZA 3OE7A 3Q72A 5AJYA 4XVUA 1SVIA 1Z29A 5B64A 4NCHA 4WXPA 1W46A 2CEAA 4G01B 4C0KA 4Q7JB 4EPWA 1WBDA 3RABA 2BKEA 1PJRA 2Q21A 3P32A 2ERXA 5FPYA 4D2IA 3AM1A 3CRQA 1A2BA 1II0A 2GHIA 3KKMA 5GJVC 3THWA 1OHHA 4DHEA 3K53A 2AFHE 2JJ1D 3I3SR 2V6IA 1VG8A 4GBMA 2JCSA 4IDQA 2F7SA 1XEWX 4IDOA 1NLYA 4Q4HA 4Q9JA 4YQFA 3IO5A 3MJHA 3A1TA 2EWVA 3QOFA 5C4MA 2HT6A 3AKCA 2DCUA 2HCJB 2QL6A 3ZD7A 1AS3A 3KUCA 2FU5C 2GVDC 3EWSA 3R7WA 3K09C 3EPKA 3UPUA 1OYWA 2RHDA 1COWD 2A30A 1W36C 4C0JA 4H9GA 1N6HA 2OM2A 1NVUQ 1I2DA 1CR2A 2GETA 2GF9A 1E9BA 2JDID 2Q9BA 2QMEA 2NGRA 2WJGA 2Y8EA 3OAAA 5EP1A 3TW4A 5K8IA 5LD2C 4I99A 5DH9A 4PO8A 2OBLA 4A4DA 4KFTA 1O87A 4A92A 1DS6A 3TSZA 1FQKA 1G18A 3F0TA 3NTUA 4C3ZA 2F3RA 3SYNA 1CJMA 3H0KA 2P6UA 1E1QD 3BOSA 1P3JA 1SQ5A 3AGQA 3LBHA 3LO5A 4MYCA 1MKYA 4EFNA 2AXNA 1WF3A 4Z8XA 2ZTSA 4F93B 2GAAA 3MCAA 3T1VA 4LV8B 1WA5A 3GJ4A 5DYGA 1W36D 2IS4A 4JT2A 3Q3JB 4IW3B 2A5DA 1IQPA 3BS4A 4JSTA 1ZNZA 3C4JA 4QL3A 2MSDB 2O8FB 1Z83A 4A2QA 1P5ZB 1QHSA 2BDTA 5F9FA 1R7RA 2V9PA 1GRNA 5JJKA 1G8PA 2OXRA 3WYFA 2J87A 1QG4A 2EFHB 2FN4A 4DCUA 3GLIE 4PPQA 1KO1A 4YLGA 2IYLD 4M9ZA 3UKDA 4KITB 1KJZA 3FYHA 3L0SA 2GILA 1E1RD 2ZM5A 2OHFA 3MMPA 4JVMA 5FPSA 3RDPA 3A6PC 4Q1FA 3FMFA 2V55B 2FE4A 2XNDD 4DEYA 2QPOA 3EPJA 4V0KA 1KNXA 3NHBA 4HB4A 4XOIA 3U61B 1RE0A 5AK0A 3B1XA 1Z0FA 3FVQA 1G7TA 1GZSA 1XD8A 3QG5A 4FD2A 1TMKA 4HAXA 1ZM3A 3V4FA 4XWOA 4EPRA 3U3JA 1NN0A 2W2VA 2J1LA 3DM5A 1IJEA 3KDSE 1A82A 1XD2A 3R20A 3X1ZA 1GWNA 4A0GA 3WBKA 3IHWA 3K0CA 5JRZA 1JAHA 4M9XA 1MRNA 4DLUA 4A2PA 3ADKA 1CF4A 1NN1A 4B2PA 3FKSD 5CYOA 2BMEA 1UKZA 2O8EB 2VSFA 1XEFA 2AR7A 3K1JA 4FMDF 4TL8A 2D7DA 2WWWA 3KL4A 1XTSA 3THXB 2B6HA 1OW3B 4A8JB 4LZZA 1NVXQ 3Q7PA 5FPHA 5FPKA 1LFDB 1FTNA 2ZUCA 3ZQ6A 4CDGA 4QKQA 1VHLA 2DWOA 2NO0A 4NPHA 3QKTA 3W5JA 1DOAA 4V0OA 3EW9A 4Q4AB 4DCSA 1LB1B 3W9YA 4BZQA 2QM8A 1W7AA 4HLCA 2C9CA 4BLRA 1G5RA 3C16C 4F92B 4HB3A 5EUMA 2R44A 3AVTA 4QGAA 2BBOA 4IKEA 1GFIA 2FX3A 3DO6A 3REFA 1KI3A 4B47A 4G0NA 4HATA 3A4NA 4JLMA 2GCOB 1M8PA 4R98A 3AF2A 3PEWA 3AF3A 2C9OA 2GDJA 3FDIA 1HYQA 4WZAE 2WTUA 1N6OA 4PSKA 621PA 2YKGA 1F2UB 4JYCA 4EPXA 2AK3A 4JMPA 2WMOB 3U6KA 4JKYA 4Q9LA 1HQYE 4Q4JB 2GEUA 1BMFA 4HUQA 4I4LA 3RRMA 4PSAA 4V0LA 3R9IA 4M2LA 3AKEA 4TQ9A 3QNUA 5CK5A 5FOXA 1A7JA 2G77B 1R2QA 4WZ6A 1Z3IX 5FTNA 3B78A 4ZKEA 1OHHD 1S0UA 3SZRA 4QG7A 3WHKA 2WKPA 2P5SA 5CB8A 3IKJA 1HUQA 2QP4A 2HUPA 3T5GA 4ZI3A 5B2ZA 3TK1A 2BEKA 1VDZA 3B1YA 2IHYA 3SE0A 3LLMA 2FH5B 2PEYA 4RCZA 3PUVA 1IY1A 4M4SA 2IYTA 1PLKA 1TL7C 4TTRA 5E4FA 1RJ9A 4AD8A 1GP2A 1T3HA 3OESA 4FCTA 3NDPA 2BJWA 4M9QA 3OAAD 4PPGA 2RAPA 2CHGA 1SVWA 1E32A 2JA1A 2OUKA 1KYIA 1XEWY 5HZKA 4C2UA 2CCKA 1ZP6A 2XITA 4GL2A 1IBRA 3NWJA 3CRMA 4NYJR 1G3UA 1XMJA 4LHZA 4X8HA 3GFOA 4NYIR 4B35A 4BE7B 2WJJA 1Z28A 4OQXA 2QAJA 4Q47A 3RRYA 1XTRA 1P9WA 3A1WA 2R6CA 2FZ4A 1MO6A 4OI4A 3KX2A 4DCNA 3DPUA 3NEJA 1NMYA 2J59A 1XNJA 4B71A 1U98A 3SFZA 4AYXA 4ZDJA 1AN0A 4M1WA 3HU2A 2ZQ5A 4O2LA 3LX8A 4PXAA 4PAOA 1MO5A 3VR6A 1OB2A 3IHLA 3W6PA 4WBSA 3VR2A 3ZVLA 2FGKA 3AF0A 3DZ8A 1C1YA 4IOKA 2J0UB 2YWFA 2WSMA 3K0CC 2EFDB 4XSHA 4TYPA 1E69A 5CM8B 3VNVA 3TIFA 2YYZA 1VHTA 3QKRB 4HDOB 4Q4LA 2FPLA 2H92A 1WRBA 1R0XA 3KXIA 2AD5A 3QIAA 3QI2A 2NO7A 3GPLA 5H70A 5JHGB 4XWAA 1UADA 1TF2A 4MRSA 3G82C 1DG3A 1ZCBA 2XTNA 4EQ6A 3DM9B 2CHQA 3MLEA 3OEHA 4MGIR 3WP0A 2ZI9A 2FNAA 4ABYA 2F1IA 4QGGA 2C2HA 4WIAA 2RGDA 2ZI3A 2ZIAA 1OXSC 2WAYA 5M04A 1AKYA 4R2HA 1NVVQ 4GDFA 3GLHB 1Z47A 2BHRA 2G6BA 3DOFA 4LBVA 3NDBB 2VQSA 2WWFA 3VNUA 421PA 2HT1A 2IYUA 5K8UA 3U44A 1CJTC 3TSOA 2GA8A 4JLDA 2FPKA 4B3XA 4C7OB 4Q1CA 2OCYC 4O25A 3R9WA 2IL1A 1KJWA 2XB4A 1TU3A 3F8TA 2ZR9A 1NMXA 1P7CA 3EZ2A 2IYQA 2GVZC 1XJCA 4D4JA 1ESMA 1LW7A 4CW7A 3KKOA 2IA5A 4Q7KA 4EKDA 1KI8A 1SXJC 1RW4A 2GXQA 1BKDR 1FL9A 2CCJA 4MYHA 3B1WA 4R9UC 1CBUA 1XCMA 1VKJA 4NZYA 2VTKA 1L2TA 3P1JA 2ZRLA 1ZAKA 3AKYA 1U0JA 1E0SA 4K8OA 5BYKA 5JEDA 3CPHA 3LV8A 3M4YA 1KOFA 1HURA 2F1RA 4D82A 4Q48A 1XMSA 2Q3MA 3UWOA 2L0XA 4LWZA 4D4LA 1VECA 2R8RA 2GBLA 4HI0E 2WWHA 4JT4A 1MO4A 1BMFD 4HLQB 4JLVA 4OQNA 2A5GA 2P6RA 1KMQA 1Z2CA 2PH1A 3PQCA 5FOUA 2GCPA 4RD1A 4MKFA 4UKDA 2FGJA 3BXZA 3ZZUA 4LRWA 4W5JA 4BFSA 2AKYA 2QMOA 4UXIA 3G5UA 4D81A 1SKYB 1OIWA 1G1MA 2ZYVX 3BBPA 3QENA 1E9AA 2KSQA 3HPQA 3MD0A 4JL5A 4M53A 1Q1BA 2IS1A 4CEJA 4D80A 4ZCMA 1WDTA 3QXXA 4LC0A 4B48A 5BN5A 4KYIB 5P21A 1XU4A 4WVFA 4B75A 4UNRA 5AUOB 3U60B 2E1RA 4GZMA 3K9GA 1P61B 4OK5A 4PO1A 3VX3A 3BC1A 3W3ZB 4US0R 4X8LA 3VX4A 5EE0A 5FPTA 1XTJA 3P26A 1CR4A 1NY5A 1L4UA 5AUPB 3W34A 1MH1A 3T5DA 1E9DA 4P31A 2DBYA 2A9KA 3E5HA 2EVWX 5SZKB 4H1UA 2VF7A 4NH0A 5KTYA 4PC7A 4GOKA 4RZ3A 1XXHE 2FPMA 5B57C 1DAIA 4LC1A 1J70A 2JEOA 2XOKA 3REGA 3RANA 4GOJA 5LPNA 5JFGA 5EP2A 3FMOB 3SN6A 5FUXA 2ZRPA 4JVLA 4BFUA 2VF8A 3PUZA 4BPBA 3I62A 1XBTA 4RFSB 1VCIA 4LBWA 1AKEA 2VLIA 4BQSA 2JLXA 1E2MA 5SZIA 2ZUDA 3NXSA 2R65A 2VEDA 3PG5A 3GJ3A 4LPKA 1Z6TA 5BQ5A 3U4QA 1TF5A 4AG5A 1UM8A 4C0LA 4KSBA 1EFRA 1E9FA 3ZD6A 2D62A 1DAGA 1OH5A 2FF7A 4Q02A 3QXCA 3MAAC 1NIJA 2PX0A 3EIQA 1W47A 2IT1A 4BRUA 2NIPA 3CX8A 5CLQA 1JR6A 2ZI6A 4FINA 5DSZA 3T12A 3HWSA 4P33A 1TEVA 4IFEA 2LWIA 1TADA 3Q5DA 1G17A 1II9A 1R6BX 2O8DA 3NC0C 3KB1A 4NL4H 2IWHA 2HF9A 4NU0A 4KVAA 1KDRA 1U94A 2XJ4A 5IK2A 2ZJOA 3QEOA 3RC8A 4DC9A 1XB2A 1XCPA 2BIFA 4MRNA 4A36A 4Z8YA 1E9EA 1KI7A 1TEXA 1W2HA 2V8OA 4NONA 4DSOA 2WJIA 1P4SA 3TUJC 6Q21A 1BIFA 2ATXA 4JLBA 2HEIA 3BH6A 3VR3A 2FFAA 5BN4A 1YR8A 2QENA 1UBCA 3K0FB 4TMTA 4XJXA 1OSNA 2PZFA 2JGNA 3GEIA 3NBFA 3DVLA 4CGZA 1MO3A 1NRJB 2GK7A 3QPVA 4PHGA 4YXWA 2IS6A 2P65A 2VHJA 1B0UA 2VP2A 5J47A 3CF0A 4JL8A 3LLUA 1OXUA 1GNPA 1XTIA 2CHVA 5JBQA 3EZ6A 2WKRA 3UK6A 1WQ1R 5CYPA 2CJWA 2C99A 2IX3A 3FFAA 3AVOA 4NKRA 4B44A 1ZD8A 1T3LA 4PQFA 1EGAA 2BKUA 2C77A 3H86A 4KVGA 4PQRA 1E9SA 2O52A 5LBIA 4OQFA 3W8RA 4U00A 2KE5A 3CUEF 4CF7A 2F43B 3KQNA 4NCJA 1S8FA 3U5ZB 2GBLC 2ZROA 1PZNA 1G3MA 1U81A 4DBLC 1B23P 1AQUA 4US2R 2PT5A 1DG1G 1G3IA 3KXLA 2P3SA 1TQDA 1JJ7A 2BEJA 4PAMA 4QBFA 3X1DA 4B73A 4ZIRB 1RIFA 5ELXA 2O0JA 1L4YA 3RS5A 1DPFA 5CITA 1US8B 5A0FA 2QBYB 1NIPA 4OYHA 2HF8A 4W5WA 2RB4A 3QBVA 5EE9A 2QE7A 1KAGA 3SR0A 2WZQA 3WMGA 5HKKA 3QY0A 5E3HA 1G7RA 1WP9A 2HCBA 2P0EA 1NKTA 2R6DA 1UEJA 2FEMA 1RZ3A 4URYR 2CVHA 1XDBA 4EUNA 3SBEA 5A4JA 2N42A 3VHXA 3GLIB 5JI2E 1Q21A 4AC9A 1GITA 3TQCA 1OFUX 4F38A 1KI2A 1I4DD 1DARA 3P4XA 4N3NA 1VIAA 4G5QA 3GLGE 1S1CA 5JCZA 4YONB 4MRVA 3BD9A 4DT1B 1P6XA 5HZHA 4LBYA 1DE0A 1KI6A 4JVSB 2QMHA 3QUSA 5G3YA 2VSXA 1M74A 2OBMA 4JLJA 2WM9B 2ODWA 5DN6A 1KY2A 1N5KA 1PUJA 1T8TA 2J45A 2R9VA 2ZU0C 5CDFA 2UZIR 1KK0A 2IEYA 2QQEA 3H2YA 5H68A 4DSTA 1S96A 1T0HB 2IS2A 4Q9IA 5EP3A 4P32A 3QKSA 5KSOA 2FOLA 4JBXA 3I61A 3QF4B 2DWQA 3W5IA 3LRPA 1W0JA 5FFMA 2JLSA 3RHFA 3DMDA 1J99A 2H16A 3EX7C 2WIBA 3GMTA 2J5XA 2XOKD 2UZ3A 4TZ0A 1P2SA 3A37A 3CRRA 1JB1A 4Z1MA 3ZS8A 2ZRAA 4OI2A 4QJ4A 2GEVA 1JNYA 3IEUA 1F3OA 4KSCA 2C03A 4RKEA 1ZNYA 1G6OA 2H1LA 2NO1A 3QF7A 1GOTA 1KMHB 3SEAA 4TTQA 3L2OB 5JSZB 2FDCA 1C9KA 4G5OA 1UBGA 2F3TA 3CLVA 8OHMA 3K70B 1EFRD 2DFKB 1Q57A 5A5GA 1HA3A 2ANBA 4MRRA 3WY9A 2WOOA 1M1YE 3MWJA 4HAWA 3WRXC 3I4LA 1M34E 3GFPA 1YZLA 3BE4A 5J4HA 4AKGA 5IRCD 2X1VA 4KFRA 4MUAA 1E2GA 4US1R 2JLVA 2ZRDA 3VR1A 2P2LA 5IK2D 1AZTA 2PMDA 1FOEB 4E03A 2X2EA 1R4AA 1CS4C 4FWIB 3TRFA 1Z07A 1HEIA 3RS0A 3KQLA 4S2EA 2YWHA 1C4OA 4DVGA 1J8YF 1N2CE 2EQBA 2OCAA 3A36A 3AGPA 4QXAA 3U2QA 4TYYA 1CJUC 1AM4D 2DWPA 2DPXA 3CF2A 2O0KA 4LHXA 3ADDA 2ONKA 4TN1A 4L9SA 1CULC 4YXWD 1IXRC 5JWRA 5FBRB 4C30A 4XVQA 3SC3A 1OH6A 3SQXA 4K81B 1KKLA 2WV9A 1R10A 5FTMA 3AF4A 1WBBA 2W0SA 2W6ID 3AH8A 3DEFA 3B1VA 3S1AA 3ZZTA 4DDWA 4C2TA 3C8UA 2UKDA 4IDNA 4MKHA 1EFHA 3VR4A 2RH5A 4L9WA 4QFMA 4JS0A 5HCIA 1G8FA 4MYTA 2JLRA 1T5LA 4BZXA 3CW2A 4AK9A 4EJSB 3CPJB 3LVRE 2QTFA 4DDVA 1XEXB 4HAVA 2NOAA 3H4MA 4KLZA 3EIEA 3NEYA 4TL9A 3QJYA 1W4CA 4FMBB 3UMFA 2HV8A 1KO4A 2C98A 2Z43A 3I5XA 1P2TA 2P5TB 5C2JB 2PBRA 1KSFX 4QHSA 4B3CA 1NSFA 5BN3A 3QXSA 3BFVA 4IEEA 3N2EA 4Y0AA 1OKKA 5CJ2A 4C0BA 5UKDA 3JVUA 2QE7D 1TQ6A 4LYFA 1G16A 1LY1A 4O2RA 3A4MA 2J0QA 4U7DA 3DHWC 3QEJA 5HKKD 3IEVA 3QKUA 1SVKA 4KLNA 1CKEA 4IOMA 5KPJA 2AL7A 5SZHB 4DXAA 1BYUA 5D3MB 2BMFA 3ONWA 3GFTA 3EC1A 4JJKA 4TZ6A 4UNPA 5FUYA 2ZE7A 3AUXA 4KFUA 1ZVQA 5DIFA 1E4YA 3LD9A 3CX7A 4JLPA 2IYYA 5EE1A 4Q5IA 5FTLA 5EZ5A 2ZAOA 3X1XA 2FV8A 4HSEA 3A58B 3NHAA 1RVDA 4C4PA 2ZXUA 1Z8FA 4DJTA 4ZI2A 2HJVA 3K0AA 2KB0A 1Z0KA 1QBKC 1IHUA 4C9BA 5KDOA 3X2SA 3A1SA 3K9HA 1EWRA 3T06B 2NZ8A 5FOVA 1KK1A 1ZC4A 2WWGA 2HYDA 4IVPA 2YWGA 3HPRA 3ZDQA 2ZAMA 2G1KA 3L0PA 4CIDA 2QA5A 5DN6D 3FHTA 2DY1A 3RVBA 1K5GA 4P4SA 1ETUA 4DLYA 5KSPA 1JI0A 2G1JA 5EXSA 2FA9A 4OI1A 5AR1A 1NJFA 2GEDA 2I1QA 3GP8A 1SVLA 2IUSA 4FWTA 1W0JD 4NE2A 4PR0A 2ZRNA 3GJXC 1QHHA 721PA 1J90A 3GLHA 821PA 1U8AA 1ZM7A 3AUYA 1S1MA 2OE2A 3WHLA 2WMNB 4TLCA 4B34A 1XPRA 1LS1A 4LJ7A 1HT1E 1R8QA 4RD4A 1FW6A 3MWLA 5J40A 1ZBDA 1BOFA 1W36B 4C7OA 4URWR 4PHHA 2QEQA 4Z1MD 1U0LA 4LJ4A 4C0SA 3UMRA 3I5YA 2XTZA 5LD2B 2GJAA 1Z6GA 1RC8A 1Z6AA 1J7KA 1DADA 1NI3A 4NCIA 2ZJAA 2HXSA 2XXAA 2RMKA 2O8BB 4NYMQ 1XRJA 1VG9B 2VHCA 4UNSA 4OK6A 1MT0A 2QTVB 1F2TA 5FUWA 2V6JA 4DLTA 5H8WA 4HDQB 5C4GB 3WP1B 3MUFA 1OLOA 1II8B 5K8LA 1Z08A 3LW7A 1E0AA 3KKQA 3IILA 4HZUA 1N6KA 3BWDD 3KTAB 4TLEA 4AG6A 3B2EA 1Q0UA 3BFKA 3BERA 4DCVA 5E7JA 5LB2A 2OT3B 3RYTC 2C95A 1KAOA 3B8HA 4QGHA 1VG1A 2C04A 4OQMA 4PHFA 5FTKA 1YHNA 4DDUA 2Q3FA 1N0UA 1YQTA 1LV7A 5J4YA 3D7MA 2AFIE 3GLFA 2IYWA 1KSJA 4MGYR 1ZD9A 4PX9A 1UJ2A 2QTHA 2QQ0A 2MSEB 4IVQA 4KJZA 2R6AA 4GMXA 2CLDX 1ESNA 3ETLA 1SZPA 3QSYA 1CLUA 5L8VA 1MABB 1UEIA 1XZQA 4IOJA 4JLNA 4YMTA 4JKIA 3T1OA 4BFWA 3L0IB 2XGJA 2WJYA 4N0EA 3K9LA 3P4YA 1AZSC 3OE7D 2D4HA 1XJ0A 2W0MA 1OFTA 2R62A 3BB4A 2NTYC 1X1RA 2G0NA 2BJVA 3CH5A 2RHMA 3LXXA 2F9LA 3U3RA 5TARA 4A6PA 1SXJA 4C0HA 5JZVA 1U9IA 2Q9AA 4PPFA 5E7MA 2KI5A 3TR5A 3E2IA 4ACBA 1MV5A 2D3WA 4NDZA 1XTQA 5KDLA 5JS7A 1G8HA 2CL0X 1T91A 4KODA 2AK2A 4ON9A 4TSFA 3UXMA 1DO0A 4LJ9A 3OIUA 3FGNA 1P2UA 5CK4A 4E5UA 5BYJA 2QUZA 3MGCA 2ORWA 4HAZA 1EFCA 1OT3A 5FBWB 4DCTA 1XXHB 3NG1A 2X2FA 2JLZA 2C5LA 3SYLA 2PZEA 2YZ2A 4AIIA 1M6NA 1KI1A 4IXMA 1OKKD 1K8RA 3CNOA 4BWYA 2YV5A 2VA8A 4LCBA 1I4LD 2RGEA 4RFSA 4LYHA 3IBGA 4NCKA 3AVYA 1FMLA 1TUEA 3NH9A 2FFQA 2QI9C 3THYA 4M8NE 1P62B 4MA4A 3BIFA 3SYKA 1PVOA 2QGNA 2KBEA 3CIOA 4P4UA 2VPPA 4X8MA 2QP3A 2B92A 2NQ2C 3AVWA 3K0EA 2WSSA 5TVKA 5CM9C 4N1AA 1ANKA 1DAKA 3THWB 1KZGB 1A5TA 2YOFA 3KKNA 4DLXA 4B6FA 4Q4HB 4G5RA 5FOTA 2ZJ8A 2JLQA 3ZZ0A 4LJAA 4JLOA 1Z06A 2V7QA 3PIRA 2PL3A 4EFMA 4A82A 4E07A 3AP1A 3U6BA 3CO5A 4PC1A 2ATVA 2Q9CA 3D3QA 1ZNXA 1KJYA 1D2NA 1OYYA 3AKDA 1IN6A 1HE1C 4LJ6A 2B7BA 3BAFA 1SVOA 1X3SA 3EG5A 4LUCA 3TH5A 2OSBA 2K5UA 3CM0A 1TPZA 4M1YA 3PCRB 4CVNA 2Z0MA 5DGXA 2W6JA 5G40A 4ACAA 1Z2AA 4LBZA 1KO5A 4BFYA 4C0AC 2ZJZA 1GRRA 3O8RA 4QBGB 4B43A 3T61A 2CE2X 2QU8A 1U0HC 3SJCA 4JZKA 4D25A 2O0HA 4YMSA 2ONJA 2PCLA 1XPOA 2REOA 3G0HA 1YZUA 3N70A 3BGWA 1D2EA 3OFNA 4F4JA 5KU1A 2Q0HA 3IO3A 4CEHA 2BBTA 2ZE6A 3IUYA 5FR2A 1R5OA 3QVUA 2EFEB 4NCNA 3B13B 4CT4B 3AQ4A 3SOPA 1GILA 3MFYA 4AKEA 4QJ3A 2ZE5A 3C15C 4OI0A 3I32A 4HDCA 3DL0A 3SS8A 5G41A 1NLZA 3VR5A 1OH7A 2V1UA 3I8XA 3LW8A 2ZU6A 2AKAB 1NVVR 1W4AA 2B21A 4TMKA 3VU9B 1W2GA 5KSYA 4AY2A 2ORVA 4BRWA 5JJIA 1VMAA 2WWYA 2ZYUX 3NIBA 1R5NA 1Q12A 4FMCF 4II7A 2ZRIA 4ZIRA 3B7GA 2GWHA 4S35A 3EIHA 3UG6A 4A0RA 1JJVA 2DFLA 4F4CA 1GKYA 3QPWA 5L3SA 1Q3TA 5HE9A 4FN5A 2GESA 4UXHA 4YMUA 1KDOA 4B2LA 1U9IC 5CDFE 4MDFA 3AVQA 1DAEA 4QHTA 2QT1A 4BGDA 4LJYA 4IOLA 5L3VA 3NH6A 4XTCS 1N0VC 1X86B 1XD2B 1YU9A 2QORA 4IJMA 1QHNA 2PLRA 3MG9A 1G20E 4NTZA 3AVPA 2VL7A 1IOZA 3NBZC 4CZ2A 4LSGA 5G3ZA 3THOA 3VMFA 1M7GA 4QNRA 5GJCA 4I1UA 3GLGB 2YVUA 3SHWA 3TGPA 1X1SA 2VP5A 2A78A 3CRW1 1XWIA 4TTPA 4ARZA 1YKSA 5L3QA 4FXPA 2PCJA 3IGFA 2QSZA 1SXJD 5JS8A 4TWZA 3UATA 4TQAA 1YZKA 1FMJA 1XMIA 2ZEJA 1GDDA 5EQTA 3MRSA 5FBLB 1KO8A 1ZD1A 3AVUA 3IIKA 1KNQA 2H57A 4DLZA 1JAIA 3MSXA 2ZI7A 1T5IA 2QAGA 3F3YA 3PEVA 1ZU4A 1E79A 2SHKA 1FX0A 4TSFD 3CR8A 3HR8A 1E2QA 1QG2A 2OFXA 2JLUA 1SKQA 5D3QA 2EU8A 1IY0A 2RGNA 1IN7A 2QRNA 1E3MA 3CRVA 2DFNA 5TB5A 2YOHA 3GJ7A 4WOPA 1D9ZA 5KDDA 2GKSA 3O8BA 3HDTA 3CF6R 4KFSA 4ZO4A 2RGAA 3W6NA 2P6NA 4Q00A 3BH0A 1Z6YA 4HEJA 4W9MC 4KCGA 1JR3A 2ZJBA 2XZOA 3B1ZA 2O8CA 1U8YA 1BS1A 1CJKC 1NKSA 4PPNA 1O3YA 3DMNA 2VHQA 1VPLA 2AHOA 1ZM4A 4BLSA 4HUQB 2V1XA 4ZV4A 1A1VA 1KMHA 2CE7A 2W2TA 1MRSA 4GFDA 2ZRGA 1NY6A 1DBSA 4CEIA 2ZSFA 2WSSD 2ZRHA 2ZRKA 1NLFA 1SULA 4XWKA 2J7KA 2VP4A 3C41J 4TL6A 2AD1A 1AS2A 3TAUA 3IIJA 1E2PA 4A0FA 4DZZA 1TUIA 1Z22A 2V7QD 4DUGA 1NF3A 4L5BA 2FSIA 3A1UA 3CR7A 4I81A 5SZJA 1RJ9B 4IXNA 4KV9A 3M6AA 1S9HA 5KNCA 5DI3A 3FKQA 3RAPR 3AEZA 2CK3A 3KB2A 1XX6A 2W6JD 2CLSA 3D8BA 3GQBA 3SI7A 4OHWA 4PTLA 1G4AE 1PUIA 5DO9A 3FFBA 2XSZA 1G6HA 3D31A 3BRWD 3QPUA 1ZM2A 4GZLA 5KOYA 4RD3A 2D06A 1ZJ6A 3OEHD 3WXMA 1IN4A 1FPMA 1H65A 1KDPA 3WNCA 5KPDA 4JL6A 1ZIOA 3GD7A 4QJ5A 3RC3A 3UG7A 5FOWA 3ADBA 1XPUA 1XP8A 3OFND 2OAQ1 1Z6XA 3AV0B 4LV5B 4FMDB 1N6LA 2YWEA 2AN9A 3MJRA 1FQJA 1AIPA 4OL0A 4URUR 5EE5B 3PENA 4I1VA 3QXJA 3LXRA 2GF0A 4YC7A 1WXQA 3TVDA 1JXMA 1E2EA 3RSLA 1XF9A 4Q1EA 5HCNA 2CDNA 4CYMA 2D74A 4OBEA 2RKOA 4PHTA 2D7CA 3ZJYA 5JHHB 2B8WA 2Z83A 3U7EB 1TNDA 1X8LA 1R0YA 2VSOA 1D9XA 4IRUB 2PJRA 1M7HA 1NBMA 4TYWA 3PFIA 1FNMA 1PV4A 1YZTA 5IHPA 2I3BA 3FMIA 4B3GA 4O0MA 4EQ6B 1KTVA 2BV3A 2DFTA 1TF7A 3HR7A 3TNFA 1NP6A 1J2JA 1FUKA 3OHMA 4KXFB 2J9RA 2QAGC 1E0KA 4FIDA 4XTRA 5AJZA 2ZRCA 4HUTA 1BYIA 2JJ2A 1CR1A 2WKQA 4QRHA 2NG1A 4HZIA 2RGNC 3HYTA 4MQBA 2VBCA 2G9NA 1OV4A 4AYWA 5JECA 3X1WA 3U44B 1HQCA 2YJTD 2OCBA 3KJHA 2NPIA 3OF5A 4M9SA 3WYGA 2O8FA 5IT5A 4ZPXA 1ZNWA 2OFWA 4Q18A 4D6PA 3BFXA 1F5NA 5BW8A 3FWYA 1FZQA 3DKVA 1DTSA 2H8KA 2OILA 1MOZA 1VIYA 4C0QC 2PEZA 3QBTA 1G291 3K9NA 1ZCAA 1YVDA 1E79D 5EZ6B 2QROA 1M2OB 2QY9A 1ZIPA 1S2MA 2G88A 4LPSA 3N2IA 2ZRJA 3U7FB 4QOSA 1E2FA 4XSGA 4BLTA 1QRAA 5K8TA 3LFUA 1G8YA 5EXXA 1SVSA 2J0SA 3KQUA 2IYSA 3K70C 1RYHA 2ODBA 1CU1A 2XZLA 4JBWA 3TUZC 1A2KC 2BVNA 1JR3D 1ELOA 1UDXA 1UKVY 2FZLA 1G8GA 3NVAA 521PA 3B82A 4AKHA 2BBSA 3B85A 2GNOA 1IN8A 4B2IA 1N6PA 1X8KA 2EFGA 2WJHA 3OZXA 4RFVA 3GLFE 3BK7A 3AB3A 2DYKA 3ZYCA 1Z5ZA 1ZRHA 1GKIA 1W5SA 2CVFA 4TMZA 3AP3A 1EG7A 2HYIC 2OLKA 1QZXA 1AJEA 4IHQA 1DEKA 2RCNA 1ZMXA 4P4TA 1D8TA 4ASUA 1QHIA 2WBLC 2O8EA 5JWOA 2F55A 2ZJ5A 2GZDA 2N46A 4XIGS 1RYFA 4PZYA 2VO1A 3THXA 1E98A 3B6EA 3LVQE 3V00A 4A8JA 2XAUA 2GJKA 4CEJB 3EARA 2JLWA 1G5PA 2QPTA 1E4VA 4ZDIA 4DLWA 3ZVRA 1VCNA 1SXJE 4DUGD 2J3EA 2REXB 2C8VA 3C5CA 4Q4AA 1F60A 1NJGA 5JJLA 3T35A 3Q85A 1I4TD 1ZINA 4JLAA 2Q6TA 2FMXA 1W49A 2QN6A 4Y0VA 1R5BA 2IC5A 3OIWA 1DELA 2CK3D 4EPVA 2GCOA 4NHOA 2IF0A 5H1YA 4DWJA 3TBKA 4EJSC 4HLUA 2EFCB 2QT0A 1TU4A 1AQYA 1YRBA 2XSZD 3SU8A 3TW8B 1V43A 4E09A 2LKDA 1F2UA 4F91B 4B32A 4HAYA 4D0NA 2NO9A 2MSCB 3AF1A 2FFHA 2X8AA 5TXGA 3DDCA 3TMKA 4Q4JA 4BFXA 5DNYB 4EAQA 3CWQA 4MRPA 4IDPA 1NL3A 1OE0A 2ZJYA 2HDNB 4UQOA 4FI3C 3HJNA 2QZ4A 3MWYW 4A15A 2J46A 5IDVA 3L82B 2XB2A 2QRZA 4TT3A 4DB2A 3HP1A 4RZUA 2OLJA 1JEEA 1S4QA 5AUNB 1G3RA 4DKXA 4Q01A 3U4QB 2G3YA 3TSWA 4GNKA 2PLFA 2ZSDA 3SDZA 5AWFC 3TLXA 1Q3HA 1OXTA 2F1HA 3A8TA 3Q9LA 4TMXA 1JPJA 2KBFA 3A4LA 2CLCX 2JASA 1TQ4A 1E6CA 2F1JA 3LQRA 5HTKA 2O8DB 2RGCA 1NBMD 3WNBA 2CL7X 2P67A 2PX3A 4M21A 4QHYA 3I72A 2IF2A 4CRWB 1KO7A 3RSOA 1OFHA 5TY0A 4WAUA 4KAXA 1NMZA 4BEJA 3DKPA 4KI0A 3EASA 1HE8B 1W5TA 4B3BA 3I1FA 2JJ2D 1CEEA 3PV0A 1G21E 1H8HA 2C9YA 3CB4A 2GZAA 3C14C 2DHRA 3P20A 1YZGA 3TKLA 3ZLJA 1Y3AA 2CJWB 3Q5EA 2R2AA 4M1TA 2CBZA 4LI0A 4DIDA 2A5YB 4EPYA 3CONA 4KBFA 2FSFA 4U5XA 3W90A 2D2FA 1QHGA 1RKBA 1T6NA 4DSNA 2J0UA 1ODFA 3CH4B 2ORIA 5B30A 5EUQB 2VP9A 3QKRA 4AKIA 2O5VA 4TLAA 2QSYA 2YHSA 3QE0A 2ZE8A 1XD9A 1OIVA 4UJ3A 1U2RA 3ZQJA 1OB5A 4GRAA 5FI1B 1LVGA 2AWNA 2XTMA 1WE2A 4UNNA 3TE6A 4MDEA 2F6RA 2GJ9A 1HY3A 1G7CA 5EP4A 1UFQA 3O8DA 4A8JC 1JECA 4W7SA 1NN3A 5FL3A 5F3WB 5CB6A 3VKWA 1G3QA 2C78A 3ZH9B 4D4KA 4LDJA 1VYUA 2ZJ2A 5E7IA 4LX0A 3EPLA 1ZYUA 2ZSBA 1GL6A 2V4ZA 4AWXA 3W6OA 1BH2A 2XJ9A 1KSHA 2VHUA 4HAUA 2G83A 4LV6A 1UAAA 4V0MA 5FL7A 1F6BA 4A2WA 3KZ1E 1U90A 3UMSA 1OXXK 1GTVA 4ASUD 1JALA 1YJ5A 5FH9A 5AJXA 1EX6A 4R2IA 1L8QA 4UXJA 1S3GA 2XEXA 3VU9A 1VYTA 2ECKA 4HLUC 5HPYB 5FI0B 2REBA 1WMSA 4ZCLA 4A0HA 1VYVA 2OAP1 3F5FA 3IPXA 1KI6B 5AUQA 1XZPA 3SJZA 1IONA 2ZRBA 1OFIA 1YR9A 1RRFA 2FWRA 3DZDA 1OH8A 4FCWA 2CCGA 3WMFA 4Z54A 4PSVA 1NSTA 1YZQA 2ZRMA 3GEEA 1QVAA 4DDTA 1V5WA 4TLBA 4MH0R 2OV2A 3ND8A 4CT5A 1LTQA 1OXVA 2ZPTX 4NYMR 3QKSB 4FW9A 4G3XA 3SNHA 4AURA 1Q1QA 2QGZA 3I73A 1G19A 2BWJA 4ESVA 1GRQA 4BLQA 3PEYA 3GLGA 1YZNA 3PJRA 1Z0AA 3EC2A 3P27A 2QG6A 2Z6VA 5DE3A 4L8GA 1AS0A 2BMJA 1CXZA 3ASYA 3T15A 1W48A 3L43A 2ZITA 1JR3E 2HJGA 3CKLA 1W0KA 1TAGA 2BM1A 5C18A 2HXYA 5JCPA 3A1VA 2JAQA 1DAMA 2ODNA 5IF9A 1WCV1 5J4KA 1HH4A 4OK3A 3U7GA 4TT3D 1N5LA 4LY6A 5KYKA 1OJLA 1LF0A 4JBYA 2W83A 3WRYC 1E0JA 5CIQA 1OPXA 3BJIC 4RCYA 3T34A 2ZI5A 4V03A 1WB9A 2OO7A 1GNQA 5EXPA 3LQQA 4ITRC 1RRGA 2QP9X 4DLVA 4IVRA 3CZQA 4OHVA 5DHFA 3RNLA 4BLOA 2I4IA 1QHYA 2V54A 5DHAA 5FBQB 1JBKA 5F9HA 1GM5A 2YNMA 3U3OA 3U7HB 3R9XA 3IDQA 2Z4SA 4V02A 4TL7A 4GI7A 3EWAA 1ZUHA 2EYUA 3BB1A 4YDHB 4GT1A 1XTKA 2G0TA 3Q7QA 1U99A 3L0OA 2E87A 4ZDWA 1FP6A 2ZVQX 3OEEA
chains in the Genus database with same CATH superfamily
2G5TA 2G9RA 4OP3A 1GUYA 2VQDA 4PQEA 2WWXA 1H8HD 2AGVA 3QJGA 3GROA 1E3JA 1KIAA 2ID4A 3M8KA 4PNEA 1OAOA 4BVKA 3KSAC 3U4AA 2HMWA 3GLVA 1N3BA 2E5WA 3PRHA 4FDMA 4ZT3A 1JHUA 1EAMA 1K0FA 3VNBA 3WLSA 2PT7A 3ZV5A 4EY8A 3S1AB 4OOEA 1T5BA 3AW9A 3PFNA 4XD7A 4RPKA 2AOUB 4FXOA 4DAOA 2VEOA 4ERXA 4QLBA 5CFZA 1UKCA 2JZNA 2ZI4A 3H5IA 3L0ZA 1MOSA 1HYBA 4WASA 4QD3A 3CLRC 5I9NA 3N6XA 4BUZA 2QRMA 5IJ0B 3E8XA 3T5PA 3CZ9A 3GFRA 3GT0A 4RAOA 5JBNA 4B3SB 1Q0LA 4FONA 2HU5A 4ZICA 4NYJQ 1E2NA 4QQRA 2Y27A 4ZEWA 1MJNA 1OMOA 3CCCA 4NBSA 3ZNOA 1JEDA 4M9RA 4XCVA 3K0SA 1Y81A 1RI2A 2IFTA 1PS0A 1IM2A 5KYXA 3EA0A 3JQ7A 5FTWA 2Z6AA 4IBOA 5KSZA 2BFMA 2XXJA 3FDJA 2R7MA 4F5ZA 1XC7A 2JLYA 4QBKA 1E1LA 4UJ5A 3DBHB 1E3TA 3FTDA 3S0JA 4H77A 5FWXA 3PC7A 5ALDA 4BASA 3ZVKA 1OFGA 2ZREA 2DKNA 1FRQA 3PE4A 1XFAA 3KQKA 1IEWA 2I67A 4UVGA 1G64A 3L5KA 4RD6A 4WDQA 5EUCA 2EW1A 4F5WA 3I5AA 4POAA 1EINA 5AHOA 4A2CA 4DCMA 1GCUA 4LOKA 2AFHA 4A10A 5JNVA 2ZUVA 4YDSA 4Q7LA 3DH0A 1E7WA 1WXIA 2BUBA 1KK2A 3AFGA 3BSSA 1WVGA 3L6RA 1A95A 4FJ0A 2IUYA 4OEHA 4Q19A 4RVUA 5FL7D 3ROEA 3CJTA 4CU2A 5JAHA 1QIKA 2B34A 2EATA 2R7LA 2W2XA 3I52A 1ZC3A 1X70A 2J3MA 1FVHA 4I6EA 5F2OA 1DVRA 4CUZA 5C5EA 4BO1A 4W5QA 1SUCA 4PZDA 3QP9A 3U48A 4PC6A 3L8EA 4H6XA 4E2ZA 2W37A 2IXGA 3OSZA 2Q5QA 3VO9A 4HB2A 3JZMA 4Y2SA 4E5DA 4ERNA 4EBBA 3E70C 2A3RA 3PUYA 1RBZA 3Q3EA 4Q9HA 1M5RA 1WZUA 2FJUA 1ZU5A 2EJVA 2XZDA 3CNLA 1YQDA 2VH1A 4KQHA 5HVNA 4KC0A 2HCTA 1V8PA 4JJ7A 1TT5A 2EZ8A 2JBAA 3EFOA 4XJTA 2NAPA 1VPWA 1PFGA 2IUUA 2VP6A 1F3LA 1EFKA 1UXJA 3OTHA 4FKBA 1IXZA 5CBKA 4MHTA 2Q5HA 2VJLA 2MT9A 2QOEA 2COEA 3NWBA 4GLFA 4WOKA 1IY2A 1G4UR 1C7FA 1QUEA 1W88B 2Y1EA 3HYRA 4L16A 3VDRA 2JIMA 3AQIA 3OPMA 5TJHA 4PAQA 2OCXA 1T2DA 1QH1A 3AEKB 4G56A 4ETWA 2NUPA 1GV0A 2QW1A 2VBIA 1Z0SA 2ZTMA 3VU3A 4CIVA 2Q8PA 4QJIA 4D3FA 5DNEA 3U3KA 3S8YA 1USUA 1A50B 1ZISA 1IZ0A 1H8EA 4TLDA 3KPYA 1ORVA 5NULA 3U9SA 3VZDA 3PFFA 4P2BA 4WESA 1TJNA 4O2AB 2D1SA 5LC1A 1JAXA 2ZYGA 5H0IA 1KEKA 1USIA 3LFTA 4QDTA 3WNDA 1A77A 4EJ2A 2J5QA 2RI0A 4EW2A 1I3NA 3GLIA 3CISA 1S9DA 3PDWA 2HIHA 1EXWA 4M22A 4TS3A 3HNOA 2K87A 2QG4A 3L7MA 1LLDA 2FR8C 3WQQA 5IAEA 2GPAA 5M5BA 1F2TB 1HSZA 2B35A 3UY4A 2VKTA 4TVSA 1R0RE 1PVVA 2IV2X 3HLYA 4EF5A 3DXYA 1QRUA 2FSGA 3NORA 3L06A 3P9YA 4L72A 2PD3A 1Q77A 1K8YB 1LK7A 4WKNA 1LI4A 4MVJF 3WB9A 4J0IA 1UXOA 5I45A 2ETVA 4UDNA 1BVUA 3OWOA 4DSZA 4GPZA 3DMPA 1TM5E 1XN4A 1RRPA 1Y1RA 3ZD9A 4B0PA 1MVOA 2WOJA 5K2OA 4MUFA 4QOIA 1XKXA 4BB9A 2ERYA 1HEYA 4MULA 2YY7A 3TD6A 4MQFB 3QFRA 3N2KA 3LDUA 1AQIA 1V16B 3PXGA 3NBXX 2NVUB 1TKAA 1E3SA 2Q5CA 4MUNA 3T4XA 1P1KA 2VOJA 1F4PA 3NQ41 1QPGA 1PR0A 3BX1A 1YQXA 3FNIA 2ANCA 4NHEA 4RSMA 4X45A 5AOAA 4DM3A 1YR6A 4NQZA 1N57A 3UMMA 3QYJA 1ADCA 4BRSA 3A7EA 4MIYA 3VKHA 4GL4A 4MKIA 1KDTA 3KELA 1HTTA 2H8GA 3BWCA 1Z82A 3ASZA 3WMEA 4EWLA 2BLLA 5HE8A 5TGDA 1ODKA 3PQ2A 4RSHA 3I8SA 3LXMA 5DCWA 4ZT2A 1SZCA 3L8MA 4RA9B 3V1YA 4DLSA 4JN6B 1TO6A 3EXEB 3QMMA 3JVVA 4DPLA 3BD7A 3SMVA 3CVUA 2DUJA 4MUBA 1MG0A 2B9EA 4M1ZA 3D4PA 3UIEA 5EJ5A 4JP2A 3DYVA 1ZUIA 3FCEA 1TX4B 2ONZA 3NJ4A 4OTZA 5E1DA 4E31A 1A9RA 5HRAA 2VRBA 1VFNA 3PX2A 2R11A 4MVJP 3TXYA 3IIEA 1JFTA 3F6EX 3BORA 1HG1A 1DU4A 4I4TF 4C6SA 2H17A 1T0JB 3MYYA 3RAFC 1C80A 2O7VA 3RK4A 1SG9A 2SBTA 2XYPA 3ZTWA 2PR2A 4FFRA 2P9EA 4J9VA 3MCTA 1L7RA 4WINA 1N2XA 3NALA 4WKGA 4ZOLB 2LCIA 2J8ZA 3PIIA 1Z26A 1E7YA 2BYTA 1XCGB 4Y2JA 4ML3A 4M1SA 1SVUA 1ONOA 3CPEA 3RS7A 1XMOB 3THRA 4L75A 3NV7A 5FEMA 2GF2A 3NC1C 1V5GA 4GP7A 4MQEB 2VYNA 3RR2A 2VZ0A 4EFLA 2O0LA 5JO0A 5KNBD 1D5CA 2B69A 2EJWA 3G2QA 1CUYA 2B8TA 3IT3A 4PZ9A 5TF4A 2Y93A 2AMJA 3TPCA 1W85B 1XMVA 3N74A 4Q66C 3EQ6A 3GDWA 1UKYA 4H1VA 4B7ZA 3THYB 4OKSA 2PKRA 3D43A 3VDQA 3K8YA 2DETA 2CSXA 3M1LA 3AL0C 4U9UA 3KKPA 1C8VB 4NZMA 3VI4B 4JP8A 3THSA 1QOZA 2NVOA 1JFVA 2Q4OA 3PJGA 1FA9A 3Q5GA 4NOJA 4QYWA 4JVOA 5CNKA 5DGHA 3BILA 1BXRA 3AVXA 2GRJA 5ALJA 3TQTA 1G8MA 1K5DA 1OI3A 4X1IB 1QC5B 5LLSA 3U09A 3U81A 5HX7A 2X77A 1YDMA 2ZUBA 4PQYA 5EWMB 1E94E 4CI0B 1E1CB 2Q45A 3BMCB 3S81A 4I9FA 4R0VA 4U2DA 1MX1A 2FR1A 1ZZEA 4O3MA 4DV4B 2B83A 4LDNA 4BNFA 4GKVA 3LBIA 3I2KA 3RTDA 1L7VC 3UWDA 4YCMA 1LZLA 1IOLA 4BE9A 2IVFA 1I3KA 4TQUS 2O59A 5FTJA 1C3OA 1VBNA 3B3GA 1DSSG 4L8YA 4AUMA 2XPCA 5K3FA 2Q5EA 2DU8A 3PGJA 4R1NA 3JAWA 5HOEA 2X76A 1V8BA 4GBGA 4CIBA 2XBUA 3R74A 2AEJA 2ZJ6A 3L0YA 1JQJC 4NBKA 3LOPA 4P22A 4ROTA 2VHTA 1EFVA 1QLHA 4ZJZA 1M8JA 1HMYA 2O7NA 2G1PA 1JH8A 2C7VA 2EZTA 1QG6A 3LUHA 1P60A 1UOEA 4OHRA 3DDWA 1Q6ZA 1PQYA 2YX1A 3C1AA 4OAOA 2A7QA 5A4AA 1UMDA 1D0IA 3EFBA 4M7PA 2FRDC 1HL7A 1NUSA 4HQ0A 4H18A 1DRKA 1TA0A 2GR9A 4B3JA 4CKWB 1GRVA 1U7TA 4K1LA 4KBGA 3UICA 1LV8A 2WFZA 1X7XA 3GZNB 3IMGA 4CEHB 1MC8A 1XVUA 4X54A 4HEQA 4EMTA 1LPPA 1L8XA 4OH1A 1JT9A 1LPNA 4DYHA 4OYLA 3GIDA 4L2IB 3QE2A 2C42A 4DY4A 2YOGA 5GZ6A 4M0FA 1WSBA 3TNLA 4LHYA 1QIMA 2H1FA 2P4SA 2I2DA 4LFAB 1F38A 1SH7A 3ZWMA 1T24A 3VKVA 4OLHA 1NUUA 3OIGA 3AFIA 3IP1A 4FNMA 4IX9A 4M1MA 4A6XA 4ZHQA 2J9YB 4O63O 1J22A 3LECA 4KUHA 5ICGA 2DHEA 4PO3X 4KIFA 3JCZA 2PXHA 2H31A 2X6RA 2C9DA 2L17A 4HYEA 4R7GA 5ICFA 2G7MC 2RGXA 1KHTA 2NWQA 1H69A 2ZAYA 4Y1EA 1M33A 1C50A 3U1VA 4XR9A 4GH5A 2YYSA 5IC5A 2JPDA 1R0ZA 3U3DA 3PFKA 3ZLUA 3EVAA 3GFVA 4CTJA 4FCVA 4WKBA 1N7JA 1A5AB 3AJAA 2NZ2A 5CFMA 3QU7A 4ZCIA 1EP3B 4YJ3B 5AVJA 3ZHZA 1KR5A 3QWFA 3LY5A 4B3FX 4S05A 3QOWA 1FFYA 2B1JA 2LKCA 1IZYA 4KLAA 3LNCA 3E81A 4NECA 3BD8A 3KXKA 4PO9A 4FFBB 5AO9A 1JG3A 1Y5MA 3K09A 4I4NA 1W44A 4EI8A 1JU4A 3VPCA 2RIRA 3I2GA 4RTRA 2RGWA 1QE5A 2VP3A 1T9BA 4FOTA 4G1VA 4MGZR 5KAPA 1DAHA 1NG9A 1L7BA 4CLRB 4ARZB 1NTOA 1IBMB 4Z0HO 4P0TA 5GVSA 2X14A 4N0DA 3AUJB 4UHHA 2YFKA 1UANA 3M33A 4P3NA 5E1OA 5K4GA 2LXNA 4LGYA 5AH0A 1T34A 4QWMA 1N0WA 1RAFA 2WLTA 2X19A 3ZY2A 2GXAA 1N6NA 2ZYTX 1MV8A 3KJIA 4J2HA 1BS2A 4L6CA 4OXYA 3V8NA 4R6XA 1DDIA 3BUSA 4NNOA 2QAGB 3WX0A 4J0GA 1HQDA 3OTWA 2I4RA 4PANA 1SKYE 1II8A 1E1RA 1XT6A 2P4QA 4HWRA 4JUDX 4PAGA 3WKAA 1JT2A 3KTAA 5AJWA 4YRNA 5K4AA 4GPEA 5J63A 3ZW7A 1CX9B 2AC4A 2I8CA 4K3VA 3EZFA 5I7VA 4QWWA 5AOCA 5KYVA 3RRZA 2HPZA 1XRMA 4MR7A 1BFKA 4R6WA 1AQNA 3E27A 2EDCA 3EEFA 2TECE 4AN1A 1EVZA 4D8TA 4HEA1 5AKHA 3FLBA 1XTZA 3WYAA 1BEUB 1U5CA 2QRGA 3F2IA 4FYWA 5FR1A 4ESEA 3VZSA 1Y3FE 1G2QA 1CTQA 1DP4A 4IIJA 5H9VA 3H13A 1BC5A 4PC3A 2BMWA 4HRXA 4ZD6A 2Q49A 3ZQUA 4CLXA 3LUAA 3MJDA 4DBZA 5A4IS 1QF9A 3FGZA 2H51A 2RGGA 5IJ9B 5LIPA 5IZCC 4MV1A 4KR2A 4X1YA 2EWWA 4ZYXA 1YS2X 2D1QA 3KLBA 3X43A 4LYAA 1SPBS 3VZQA 4W5OA 2PUGA 3ZDDA 2I66A 1AUPA 2HMUA 3GA7A 4XDYA 4P6VF 1R50A 2WAXA 3TR0A 3GLUA 5EE3A 2CHEA 3TSCA 4AMBA 1NOIA 3VQTA 3GJ5A 1JQDA 5CA0F 2NP6A 3NW9A 2ZBPA 1QFSA 1G5FA 2ZXEA 3D6TB 3CY6A 1Z0DA 1X80B 2CXSA 3BMOB 4W5HA 5BXQC 1XDWA 1VCOA 2QS9A 4IGFA 3JYQA 1W5FA 3ZXIA 3SJAA 4JX8A 1T9GS 4C2AA 4J0QA 1RFLA 1P2VA 4LTMA 2I76A 1VA4A 3DTTA 5DI3B 5M29A 1NUHA 2Q46A 2PRZA 1CD5A 5LQUA 1XR3A 2YV1A 3W4IA 4RTNA 1XXHA 5TEWA 4CQLB 2OR3A 5HBGA 5ALFA 5KTKA 4BKPA 1T9CA 4QQKA 1WMEA 2XGSA 1SBCA 3G1TA 3G89A 2X8WA 4C4ZA 5BVGB 1DJOA 2OHHA 3GGJA 4IFIA 3Q9UA 4RZ2A 3ADCA 1WB5A 1ZHHA 2RJOA 3OE7A 5AJYA 3ROFA 1DAPA 4WXPA 3U80A 2AOWA 4OHKA 4P38A 4I9NA 5EL0A 5KYGA 4JKOA 3G85A 4X44A 3ZV4A 4ZGWA 1AG9A 3P52A 13PKA 1SK9A 4JDUA 4OPMA 5DEIA 4ZV9A 4BO2A 4KTTE 4WLOA 2VUTA 1F12A 1VGVA 5AVYA 2E4XA 2HA0A 3BBLA 2BEVA 2Q21A 1UUFA 4X6YA 1F8XA 5ALXA 1AN9A 2I7DA 2PVCA 3FPHA 5ENDA 2B61A 5FPYA 4JC8A 4D2IA 3UGTA 2FRXA 4UDXX 5AXDA 2CV0A 5JROA 2C4NA 5IN4A 2VK2A 1L3BA 3GNLA 5C3MA 3THWA 5B58T 3K53A 3OP4A 3UK0A 3EGDA 3D3NA 3PXAA 1VG8A 5DCLA 2YH2A 2PMCA 4IDQA 1KETA 1KH2A 1RPNA 3OZWA 3P2EA 1VP3A 2JZOA 4QDUA 2C8JA 2OYSA 1Y7HA 2EWVA 4E4RA 2I2XB 5C4MA 3L7YA 3AKCA 4O33A 2QL6A 3OMLA 1ZNQO 4DWVA 2DHCA 1AS3A 2R8EA 1QK3A 2GVDC 3MPOA 3EWSA 4D99A 1CUEA 3G0IA 1OYWA 3AX6A 3M83A 2RKWA 3DBHA 4RK6A 1N6HA 2OM2A 1NVUQ 2GKOA 2GF9A 3E2MA 3GFFA 1E9BA 2Q9BA 4ND8B 4N18A 4TMYA 3RYFA 3TNJA 1QFJA 3TW4A 5AIAA 2V45A 4HX2A 5LD2C 1C2YA 4I99A 4PO8A 4C29A 2I4NA 3TSZA 3JVDA 1JYFA 1FQKA 3GRUA 3NTUA 4UBKA 1MW9X 5KHAA 3SYNA 2ATIA 5F7JA 4PCVA 5CRIA 2WA1A 5CU7A 2OGZA 4IDAA 2PU5A 5C37A 2XB9A 3BOSA 3B12A 3NRBA 4P7KA 3NXKA 3AGQA 4QUIA 3WAKA 3VBEA 3VR6H 2GO1A 5BSHA 4CMCA 2ZBGA 2QVLA 4JWTA 4F11A 3EG9A 2WHEA 3NOOA 4LV8B 4F97A 4NZZA 1G9SA 1X13A 1U04A 2QRUA 1X7YA 3MTBA 3UZUA 2IS4A 2M6SA 4JT2A 1XA3A 4JUIA 1UP6A 4YRDA 2GNPA 3C3BA 1G8JA 1SU8A 1PQ4A 2V3VA 4L95C 4JSTA 1D2AA 4FQ8A 4ZVPA 3RUHA 2EP7A 4YJHB 5GP1A 2O8FB 4J3FA 3DAPA 1QHSA 3PDCA 4D5EA 1OREA 1E7MA 2A7XA 4NWIA 2V9PA 3CGGA 2VOEA 2DY0A 4N5MA 1G8PA 1H2AS 2HAEA 4RHXA 3WYFA 3A6HA 5ALTA 4E08A 2C1XA 2J87A 1UQUA 4EF6A 2XCTB 1GU0A 1KAHA 3K4PA 4BMDA 2FN4A 2WF6A 2AI3A 4AJ4A 1IEQA 1O77A 1J2TA 2IYLD 2HA5A 3GZJA 3DC2A 3FYHA 1C7ZA 2VNHA 4X90A 2C5GA 4G85A 4JVMA 3A6PC 4TVBA 3JYNA 5TGTA 1FJ2A 4E51A 2O06A 2V55B 3V2UA 2XNDD 4DEYA 2QPOA 3EPJA 4V0KA 1EE2A 3NHBA 2EKQA 1U7PA 5DGTA 3UMYA 5FUMA 5EQJB 2QMZA 1PYDA 3EGOA 1XZMA 4J2OA 1XLUA 4MICA 3FBWA 1Z0FA 3DFIA 1LZKA 1G7TA 5LWHA 1GZSA 3B6ZA 3QG5A 4FD2A 5ERGB 3V2HA 3A06A 3IDSA 3V4FA 1JFFA 1N2BA 3RUPA 4JYPA 1S2NA 2IXTA 4BB5A 3IE1A 3LA8A 4MI9A 3ROKA 1IJEA 3LSYA 2EIXA 1A82A 4HNAA 2IH4A 4NJEA 1FP2A 4UD2A 1YBAA 3IHWA 1O4WA 5JRZA 1CS0B 2AFVA 1I1NA 4KAAA 2H7XA 3VHQA 4B7UA 4L0CA 2CXNA 4A2PA 4LZOA 4G1MB 4N7BA 1CF4A 1GXSA 5AQ1A 5CDHA 3WRWA 4A26A 3W2EA 1L8LA 4HFNA 2F17A 1ZCZA 2O8EB 2F8SA 2W11A 1K5PA 1R6TA 3K1JA 4FMDF 2QM0A 4H31A 1USKA 2W9XA 1SKAA 1DRVA 1DKQA 1OW3B 3HB5X 4A8JB 5ILOA 1CZUA 3E7DA 5FPHA 4E5VA 4EJFA 3F98A 1QP4A 4NPHA 3W5JA 4YCCA 1A04A 1SKUA 1LPMA 4PYIA 1JQBA 3EW9A 1A9OA 4Q4AB 2JB9A 4CM8B 4BZQA 4DCSA 3VPHA 4Q6BA 4HLCA 1SIUA 2C9CA 4UQPA 1E7SA 1L5FA 1KJQA 3NX4A 1QO0A 4HB3A 4N41A 1TAUA 1SOVA 2VZ9A 2WWRA 1THZA 3SF8A 4QGAA 4YB8A 1N1EA 1ODIA 3PC6A 3I04M 3REOA 2O14A 3HL4A 4UMVA 3MQ2A 4Z99A 4CG1A 1FRZA 4B47A 3N0WA 4G0NA 3V1NA 3UUGA 4ER5A 1ECGA 1ZQ1A 1RHQA 1UBTS 1ZMOA 3MF4A 4R98A 3USCS 4BO4A 2JZCA 3DTNA 1H94A 4WZAE 4KQXA 2WTUA 3ODPA 3CPSA 2P2ZA 4PSKA 2ODAA 3L6UA 3OFKA 4Z3DA 4JYCA 1GZ5A 3RSQA 3AZPA 4JHXA 4XM2A 3INGA 3V1LA 4JMPA 4DOMA 3TPZA 3K5IA 1JU9A 4PX3A 4HH1A 3FW1A 4YROA 3GA0A 1IK4A 3RRMA 3RB8A 3G88A 2X4IA 1SCAA 4RA9A 1W96A 3EXEA 5JSYA 4FIZA 4HQOA 5ESRA 3AKEA 2DT8A 3UAXA 2Y1OA 4PXYA 5BR8B 2G77B 5D87A 2XUZA 1TCVA 4MLCA 2VNSA 1DXOA 3B78A 3C1TA 4FOLA 4ZKEA 1PR5A 1S0UA 3EVCA 5F64A 2AG1A 4QG7A 2JGLA 1M34A 4CMAA 5BR1A 4GLLA 4KX5A 1X9GA 3T3MB 1OLSB 2VDNB 2ZIUB 3IKJA 2HUPA 5IMBA 5H3HA 3T5GA 3WDLA 4KPEC 4EKYA 1S2GA 1WZEA 1DBPA 4IIGA 3BQ9A 3LS2A 4D8XA 4V2IA 1WVIA 4JELA 4ZYVA 1QTQA 1O54A 2OGSA 3M6VA 4TTRA 4AD8A 2VF5X 1KA9H 3ZIUA 2V3CC 3MAGA 1SQFA 1YJAA 2BJWA 2FPIB 3GLQA 3HJHA 1IM5A 2RARA 3IBSA 3OAAD 3NATA 1R1DA 1J4AA 4Z49A 4JXKA 2QYSA 2OUKA 1E32A 3A2KA 4EI2A 2PZMA 1KYIA 3JPYA 2P79A 2GASA 3WGVA 3W79A 3JASB 3ISJA 1W59A 3RS8A 4CI9A 5T8KA 3DR5A 2CCKA 4B8ZA 2EX4A 4AAYA 3MINA 1ISSA 3NWJA 4J76A 2XRFA 4CDGA 4LHZA 1NQUA 1QRDA 4PRLA 3IQEA 3OEYA 1Y5IA 2ZAIA 4PG7A 1B74A 5BQPA 4OQXA 2VWPA 3MMNA 4JP3A 1XCLA 3K9BA 4XWWA 4CM6A 4R8KA 3RBVA 2X15A 2WIKA 1P9WA 3LPCA 3UK1A 5HHTA 1PFQA 1MO6A 4OI4A 4BNHA 4X66B 3DPUA 2I3GA 2NUTA 5IAOA 3UPTA 1NMYA 2J59A 3BMCA 2CV2A 1U98A 2GBIA 1PJBA 4EYGA 3ZU2A 3H8VA 2MU1A 3CUSA 1MFZA 1PE0A 2ZR8A 3HU2A 2YHAA 4RLHA 1WX1A 4K7JA 3HL0A 1WSWA 1LPAB 4PXAA 4V38A 4M1QA 3VR2A 2H1HA 1ZEMA 1C0KA 2QTLA 4F9TA 3AWDA 2IXAA 5JAQA 2H5IA 2YWFA 5A71A 2WSMA 3KWJA 5BSKA 2HR1A 3K0CC 2EFDB 2JGEA 2YWRA 3K2IA 5CW2A 4UFNA 4B80A 1SU4A 4OU5A 3KHSA 1X1AA 4R40A 2BTQB 2LUOA 2AD5A 3KXIA 1RKUA 1EVKA 2NO7A 1ADFA 4OKNA 3GPLA 1Q0QA 3PFBA 4HWSA 1R4NB 2OKGA 3JQAA 3N75A 4ZVLA 4Q3CA 1JSCA 2NSDA 2V74B 2QUIA 3G82C 4G8JA 2C5SA 3PXBA 4EQ6A 1C9MA 1UM9B 3DM9B 4LRSB 1EK6A 4YV0A 4MGIR 2R84A 1MRZA 2PDAA 4GC9A 3A0RB 4BWVA 2X9GA 1IHXA 1NQWA 1PEYA 4RTSA 2C2HA 5DPMA 3ZJ5A 2ZIAA 1QV7A 1MIHA 3IEXA 4GLBA 5TPWA 4TTTS 1NVVQ 2M1XA 3O8QB 2AN5A 4U7HA 1H05A 4ER0A 5TIIA 3DOFA 3LQFA 2VQSA 1K1EA 4XD2A 1GZVA 1P1JA 1H1DA 1T2UA 2Z5GA 4JC5A 1IBLB 1V9SA 1ESCA 4EEXA 2GA8A 3A0UA 4JLDA 2CW5A 2FPKA 5ALUA 3S2YA 1PL0A 4OAPA 1OFVA 2GRUA 2F3QA 4P54A 5HJ2A 5T4FA 3F8TA 3DZKA 3D4OA 3CE6A 1NMXA 3KPJA 2R6ZA 3W5AA 2CNBA 4FR2A 4IZIA 1U5BB 5E9AA 3PQEA 2HI0A 3A14A 5TX7A 3I76A 1TJYA 3DYIA 4YQEA 1ZK4A 2HHLA 1PAUA 3FWPA 2YW9A 4OU4A 4RXUA 5CG2A 5ITVA 2IA5A 4P35A 1M2WA 4XX0A 1KI8A 3SC6A 1SXJC 3C7AA 2GXQA 4FE4A 1M72A 2B3DA 3MBKA 2I6GA 5EXEA 1E3DA 3H11A 1CBUA 1HOXA 3DGFC 2H54A 4NZYA 4JV5B 2DHQA 1L2TA 2VUIB 2PS1A 3QSGA 1EBBA 1ZAKA 1KVSA 4W7HA 5JEDA 2AUTA 1HE2A 1HURA 4G23A 4JEHA 4D82A 1XMSA 3EDRA 5CX1A 1YDGA 3UWOA 2UAGA 1OA1A 1EMDA 3ABRB 4CUKA 4D4LA 1VECA 2R8RA 3JSXA 4JT4A 2WWHA 1PQPA 4CLRA 4LF6B 2ZZKA 1Z6ZA 4MPDA 1L9XA 1GGMA 1YL6A 1HF3A 2HCFA 2PX8A 3DHNA 4J4HA 4CMBA 2PH1A 3PQCA 1KC1A 4YP5A 2JI4A 2ZT5A 3HCFA 3WGJA 5JZOA 1LLCA 2FGJA 1PFUA 3V4SA 4D42A 1RXVA 4DIKA 3UJ6A 3KTOA 1MEEA 3PRJA 1HDYA 3H0EA 1FW8A 1UEXC 5FIUA 4BFSA 1NVBA 3G5UA 4RLFA 1ENZA 1SKYB 2ZYVX 3OQ6A 4LNUB 3A1EA 4PY2A 4QDJA 2C3UA 3C3DA 3RVLA 1J20A 3INTA 2QRKA 1EJ6A 4AKTA 4E5YA 1WDTA 3QXXA 4ZCMA 1KTIA 3G8BA 5BN5A 2CV1A 2EBHX 3D3JA 7REQB 2PLWA 3OT1A 1L1RA 4BJHB 3HUUA 4GZMA 2WW8A 2B82A 3Q8KA 3O91A 5EJ9A 3DLBA 1WXGA 3HHEA 3VC1A 4UU8A 5EE0A 2VDPB 2PKCA 3P2IA 2XVAA 5IWCA 2P1ZA 4U2KA 3OJEA 2W42A 1NY5A 4DDMA 3SPXA 2WG0A 3NBQA 3FMVA 4DRYA 1IOVA 1MH1A 3H8JA 3LDFA 3D64A 1A9TA 2AQHA 5EIBC 1B76A 4ZU6X 1NX6A 1MNQA 2QDKA 1P0FA 1JLRA 3O84A 4U9HS 4ZYZA 4NH0A 5BURA 1ORIA 4HO1X 4PC7A 3Q9SA 2A1IA 1VDMA 2H07A 4GOKA 3V4ZA 1DAIA 1T6XA 1TYZA 3OURA 3P4UA 4LZNA 2JEOA 3NHWA 4M8IA 4GSKA 3REGA 4GICA 4BX2A 1H42A 2UYGA 4XARA 5IEBA 4GOJA 1EA7A 3OTGA 2C3PA 5JFGA 1OTYA 2NNLD 1M1YB 4WY8A 5FUXA 4JVLA 2UUCB 2FWBA 3DHEA 2NZWA 1HE3A 3I62A 3E23A 3AI7A 4DS3A 4IWYA 1WKCA 3N05A 4RIIA 3E9QA 2ZUDA 1JMVA 1RQPA 1W8DA 3BL5A 1WTAA 3E3AA 3FLAA 4LPKA 1H5QA 1UDBA 5BT9A 3VBCA 4YDQA 1NNSA 1O6GA 5I9BA 1TF5A 3VR6D 4ZO6A 4P3KA 1VJ0A 1YUMA 4C0LA 4YV2A 4YH1A 2B4TO 2D62A 1OH5A 5IAJA 2FF7A 4Q02A 3QXCA 1NIJA 1EDDA 1JKFA 1PSDA 2IT1A 2BEWA 1Q7BA 2NIPA 3H9QA 3LVFO 3OQIB 3V7NA 1JR6A 1N2CB 3MJEA 4FINA 1MAAA 1CDOA 2X41A 3T12A 1NXVA 5IT4A 4KPYA 2G7ZA 3GJZA 2D5AA 5CXXA 1H2WA 2IXBA 3Q5DA 2Y99A 1G17A 1II9A 1KQPA 2O8DA 1EUZA 2O8VA 3KB1A 3R77A 3E4DA 3CYFA 4PWZA 5JH7F 1RTTA 1U94A 3HXTA 2XJ4A 3JY6A 2UXBB 1I4OA 1U1IA 4X84A 2ZJOA 5PGMA 4B3TB 1XCPA 4MRNA 4A36A 1I9CA 1E9EA 1UCFA 4NONA 1ISRA 5D2CA 1GQRA 5ESWA 4DSOA 3NPMA 1ZR2A 1SG0A 2BW0A 4RWEA 2RCYA 1H2EA 3TUJC 3OJCA 1JEJA 3BH6A 3KPVA 3VR3A 2FFAA 4JOCA 3BWEA 1YR8A 1I6LA 1L7QA 1EUCB 1UT5A 4FOPA 1IC6A 2E1PA 4G5FA 3DV9A 4KXWA 2WLSA 2JGNA 1L5HB 1QGAA 1ZVMA 2I2AA 2CNDA 3NBFA 3DVLA 2YR0A 4C4RA 5JC8A 3T95A 4PHGA 5ALOA 3BIWA 2VHJA 2X4DA 1U3WA 1YMQA 1M75A 2X5KO 1YBHA 4FEEA 2C7RA 4JLSA 1JDNA 1M73E 4IIJF 2XUKA 3ZJVA 1E5LA 1VZ3A 1WQ1R 5CYPA 2CJWA 3S8MA 4MVJM 2IX3A 5REQA 1E0DA 1GSOA 1RDFA 1ZDMA 1C3XA 4MS3A 1NJ2A 3BQMB 2Q8NA 3KT8A 4N3AA 2W4QA 4PQRA 5LBIA 3KALA 3IUJA 1Y6ZA 3TQIA 2IU6A 3RYCA 1UXKA 2NUBA 5A5FA 2NACA 2Q1WA 1HFWA 4C01A 3KQNA 2JAPA 3R5HA 8MHTA 3ODGA 1GTSA 2BGJA 5E38A 4NLLA 4F4HA 3KLNA 1DHTA 1TZKA 3V33A 4C6TA 4NZ9A 4OQYA 2XMPA 1U81A 1C30A 1ZGCA 3TKAA 1RXUA 3U4DA 4BO9A 2ZB4A 3H8SA 1L3CA 5EPEA 2QBYB 4UZSA 5JCOA 5IN5A 1TQDA 4N7JA 3E0XA 2DF8A 1JJ7A 5COQA 4PAMA 4QBFA 3RKSA 1Y98A 3IBCA 3AETB 2V5UA 2ZKLA 4KXMA 4MO2A 4WD3A 1GPNA 1ND6A 4PZAA 5CITA 1KY4A 5IKEA 5A0FA 2RG7A 4O0LA 5BWNA 1R4ZA 1W5EA 1NYLA 2Q4RA 2A59A 2HF8A 2ZJ1A 4OYHA 4W5WA 3RAJA 4TVOA 3QBVA 4U63A 2IEAA 4QUBA 5JXHA 3RWBA 4HGYA 5LQSA 1ISIA 1SCDA 1ZO8A 3SR0A 1BE0A 5T4BA 3HXOA 5HZGA 4ZTZB 3WMGA 1YHYA 1KMNA 2I8AA 2WQ6A 5E3HA 4YV7A 1SVNA 3HCAA 1R6UA 3FOAA 4FCCA 4G0VA 2HCBA 5IASA 2WJ4A 2P0EA 4LMBA 2R6DA 1Z4JA 1ZL0A 3B1JA 3A7DA 1RZ3A 4EUNA 1XDBA 3R0ZA 2AA3A 3AIMA 1Q19A 3TRDA 1A4IA 1RXSA 2IY9A 3O95A 4ZVSA 4AZ3A 7GPBA 4RTMA 1IQRA 1LBSA 1OFUX 1KI2A 1SD5A 1VIAA 1AD2A 4G5QA 3GLGE 5THXA 3DHVA 3KOXA 4UPDA 2Z2KA 3IEIA 3C48A 1MJGA 3BD9A 3ZHBA 5KTNA 1PU2A 3V2GA 5BVHB 1B2LA 3N7AA 4F0JA 3G8AA 3IP5A 2DT5A 1P77A 4KQ1A 5AVVA 2AR0A 1EWYA 4JY7A 1LQTA 4NCXA 3L4JA 3CX4A 3DFZA 4NG4A 4UNIA 1S8NA 1M74A 2WU4A 3D7LA 1ECFA 2JGRA 4H1HA 5AQEA 3N8DA 2UZIR 1FK8A 2V0CA 4UTVA 3H2KA 1SUWA 2O9JA 3FOWA 3RHTA 4AJLA 1YQGA 3ZKAA 1DBQA 2HMSA 5KSOA 4ZXFA 3QU4A 1DC8A 3T0IA 1LQUA 4MKZA 4JEUA 5IYZA 1V35A 4UTXA 1JDJA 1MG5A 5FFMA 3FA2A 1DC3A 2WD8A 3VU1A 3EVFA 3DMDA 4XPIB 1KORA 3ISTA 4UTPA 3EX7C 4PBTA 4RL4A 4CTOA 2WIBA 4MRAA 2IPOA 1TPYA 2B8NA 1YQWA 2Q3DA 4DR4B 3L05A 1U28C 4IMRA 1L0BA 3CRRA 1ZESA 2H1WA 1JB1A 4UEJA 5B7PA 4UUQA 1RMYA 2G63A 2WD9A 2WSBA 5KJ6A 5EMKA 3NDJA 1PT8A 1J39A 4RKEA 3MWEB 4BIMA 5AESA 2NO1A 3QF7A 4GGOA 3VR0A 1W93A 4LF5B 4G9EA 3OQHA 1XG5A 2QTGA 2FW9A 1BA3A 3E5NA 3IA2A 4CM8A 3C3KA 4V1CB 1Y5RA 3KT0A 3AM5A 4OA5A 5FB3A 1Z2OX 1FBTA 1E62A 3JZFA 2Z56A 4QASA 4B6JA 5A5GA 4GAEA 1F0NA 3ABSB 2ANBA 4MRRA 1V5FA 5JDIA 5LMCA 3WRXC 5G0TA 5F1YA 3I4LA 4P4GA 4BV8A 4AZ3B 3ZDZB 5J4HA 2XZTA 1OBHA 4MR8B 1GKLA 3K05A 3M3PA 3OCXA 3T0GA 4WZAB 1KVTA 5ISMA 5TQJA 4KFRA 1E2GA 3SSAA 3GG2A 1C3JA 4L28A 5KQGA 3MUOA 1D1PA 2WJWA 5IK2D 1IWPB 3M6FA 4DJAA 4YT2A 2XNHA 5GGXA 3TRFA 2VRCD 2ESRA 3NB0A 1Z07A 3HLKA 4XW2A 1KE1A 4C7BA 2NADA 2YWHA 2C2YA 4EA9A 1C4OA 3WFIA 2OCAA 3PICA 3TLGB 3A36A 4PZUA 5MF6A 1CJUC 4P86A 5HNKA 1YU6A 2ERCA 1U2GA 3VKUA 2DWPA 2C3YA 5FWNA 5KSWB 4OLBA 1GGVA 2O0KA 1U4SA 2MHCA 3KLOA 3ADDA 1PWEA 2WE8A 3I9MA 2J3IA 3MTIA 4F6LA 4X5OA 3B1KA 4IFTA 1CF2O 4O2AF 3DDUA 3DMTA 4HLNA 5KCZA 3NHMA 1UP7A 5ARDA 1OLSA 3DL4A 4OYRA 4Y6GB 4BEWA 3SQXA 2JFXA 4K03A 4UEQA 3V5NA 5CFOA 1G0OA 5AW6A 2W6ID 4DDWA 3DEFA 5KTPA 4IS3A 5HG0A 2QUBA 4XLZA 1P4AA 1R3DA 4IDNA 1EFHA 1LBIA 2OCDA 3HVHA 4MKHA 5E4TA 5I7HA 4UU1A 3N76A 4N0PA 5FYQA 2FPIA 3SK0A 1NONA 2XDYA 5A06A 2WFAA 4PWYA 3FI9A 4IIBA 1JEQA 4MYTA 1A7UA 2VHWA 3AUSA 2BF7A 4HAOA 4RORA 3UT6A 1VRCA 1P18A 3H9EO 1J33A 1UMCA 3L1IA 3PFHA 4GI3A 2NOAA 3C3MA 3H4MA 1SQSA 5FFFA 3TLZA 4Z7QB 1RKVA 1O0SA 1UC8A 3NEYA 4TL9A 4OB8A 3FCAA 2DQYA 1KO4A 1YOBA 2FDRA 2C98A 5AHRA 4TYMA 1P2TA 4HQ6A 3PX7A 5DBGA