1P62B

Structure of human dck complexed with gemcitabine and adp-mg
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
241
structure length
229
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structure of human dCK suggests strategies to improve anticancer and antiviral therapy
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 90
structure length 229
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p62B00
3A1UA 4TT3D 3K70B 1IHUA 2VTKA 2CVHA 4NBSA 3THXA 4YMUA 5KSPA 1CJUC 721PA 1VG0B 4M8NE 2GXUA 4JLVA 4C0QC 2ERXA 2D7DA 2W2TA 2OFWA 5J4YA 2HXSA 1J99A 5B58C 4WW0A 2VO1A 2H1LA 4JLKA 3O47A 1KGDA 1Z6YA 4WZ6A 5CB8A 1YZLA 3ZVLA 5CYOA 4GZMA 2A5DA 2V6JA 4HAZA 3B1ZA 5ELXA 4GI7A 5EP2A 1XJ0A 1HH4A 2AFIE 4V0OA 1US8A 4A92A 4AG5A 4NYIQ 2ZR9A 2DPXA 1M7BA 1M74A 1U0LA 2JJ1D 3QJYA 2ONJA 1Z83A 3HPQA 2DB3A 3SI7A 1E32A 2FGKA 2PEZA 5CITA 3BERA 4K46A 3RDPA 1NVVQ 3F8TA 3T1VA 1CRQA 3LX5A 4Q1FA 1CR0A 5LB2A 2ZE7A 1DAEA 1XFAA 1VYTA 4AKGA 4TTQA 2KBFA 3BB4A 2J41A 1RVDA 4ZI3A 3B78A 2RGEA 1YZKA 3QY0A 2FPMA 2DY1A 4C0AC 3F0TA 3C14C 2Q6TA 3CR8A 3GJ5A 3U44A 2E87A 2ZI5A 2CK3A 5ANRB 4D80A 4Z1MD 2OFXA 1S9DA 3EARA 4LC0A 5G41A 1D2NA 4M9SA 3UMSA 3K8YA 1X86B 1E6CA 4IDPA 3VX3A 3MUFA 3UATA 1ZM7A 4I81A 5BYJA 4HB3A 2BDTA 1Z3IX 4TT3A 3FHOA 2J87A 4GP7A 1W4RA 3RC8A 4BLOA 3B1VA 1G17A 1Y3AA 2A5JA 3IILA 3KQHA 2ZTSA 3SBEA 3GEHA 1GSIA 1R6BX 2OCPA 3KJIA 1AS2A 2ORWA 3I61A 2GVDC 3IEUA 5FI0B 2WJVA 1LVGA 2VHQA 2P67A 1N6IA 3W8RA 1NL3A 1R2QA 1AQYA 1Z0AA 1A82A 1Q1QA 3IBYA 3KQKA 4MA4A 4Q1BA 3OIVA 2W2VA 4Q00A 1GNQA 1JAIA 4LDJA 4LYJA 1U2RA 4ZIRA 1EFRA 4LBZA 1NJFA 4EFNA 2VIIA 4GMDA 1OXTA 2WOJA 1XD2A 3X1YA 2GCOB 4DSOA 5CK5A 5JEEA 3GLHB 3IBGA 4XTCS 2JJ2D 1Z6TA 3R7WA 1UM8A 4JVNA 2CL6X 1XXHE 4QHSA 2GWHA 2O5VA 1RC8A 1II9A 2WMOB 2O8BB 1QHNA 3EC1A 3UG6A 2X2FA 4DEXA 2D62A 2HYIC 1XCPA 2JASA 2QE7D 3IQXA 1YRBA 3OIYA 1T91A 2ZR7A 1BYIA 4RVCA 3V9PA 1XTSA 3ZH9B 4CVNA 3CRVA 4DCSA 5JI3E 5EE1A 5BW8A 2C99A 3SHWA 3THYA 1Q3HA 1JPNA 4LZZA 1KDPA 4JBYA 3H2YA 4DDVA 1XTIA 2RGXA 2C96A 5G3YA 2NO9A 2YWEA 3CBQA 3ZVNA 1IY1A 3AVOA 4C4PA 4IEEA 3HU1A 1DE0A 3R9WA 1MABB 2NQ2C 4CZ2A 4MRPA 1G8YA 1E2FA 1XMIA 1CF4A 4BEBA 2PJRA 4OQNA 3EG5A 4MGYR 4A0FA 5E7MA 3IUYA 4G01B 3LV8A 2AXNA 1ZP6A 4AYWA 1KMQA 2QEQA 3TSZA 3IHWA 4ACBA 1P7CA 2N1BA 4IW3B 3ADBA 3RNLA 1FOEB 3Q7QA 4DC9A 1OT3A 3B8HA 1QRAA 3QG5A 2ATVA 4KV9A 4PPQA 4D4KA 4FD2A 5EXPA 2ZE5A 1E9BA 4YDSA 4DLYA 4L15A 1YU9A 4Q7LA 1PLLA 5A4JA 3LXXA 4DB4A 1KZGB 1M6NA 4OQLA 3EPLA 2F1IA 1U8AA 4G5SA 5H68A 4AK9A 1LNZA 4IJMA 2VPPA 4DCNA 1AA9A 1DVRA 3PENA 5KSZA 3RRZA 4F7WA 1L4YA 3EWSA 3KQUA 4JYCA 3DO6A 4HAWA 2OXRA 5EE0A 2J9RA 4F91B 3I3SR 4PZYA 1ZW6A 2VH5R 4QGAA 3KZ1E 4KYUA 4ASUD 3ZD6A 1SZPA 1OYYA 2ZREA 1TPZA 2V9PA 3B82A 4M1YA 3WHLA 2GBLC 1T3HA 2GAAA 2GDJA 2QE7A 1GDDA 2WWXA 3MWKA 4KFTA 4PAOA 1MRSA 2OAP1 3C5HA 4FN5A 3I8XA 1LF0A 2IT1A 1GZSA 3P4YA 3SHFA 5F98A 2I4IA 2ANCA 3F3YA 1PLJA 1HE1C 3CF2A 5J5CA 3ZQJA 4PXAA 1VCIA 4F92B 4MGZR 1RW4A 2IHBA 2FF7A 2KB0A 3GJXC 1K5DA 2B8WA 4RFSA 5KSYA 4B2IA 2IYYA 1CJTC 1N3BA 2FFAA 1GKIA 2V54A 5C4GB 1GILA 4GMXA 4EJSC 1OXVA 1K5GA 4BRUA 2G0NA 3GLGB 1Z0IA 4KJZA 4Q4JB 2P5SA 2QT1A 4C2UA 2YNMA 3AF4A 1D2MA 1U0JA 3WYGA 4NU0A 3TJZA 1GNRA 4OK3A 1S3SA 5AR1A 2J7PD 3U3MA 4Q4AA 4B44A 1P9WA 1CR1A 2C9OA 3QPWA 2QRZA 4P4UA 3FE2A 5B2ZA 3AVWA 1S8FA 2G88A 4QRHA 3FGNA 3OEED 1FL9A 2DWQA 1ZU5A 2EWVA 3NTUA 4QJ5A 4DT1B 5KPDA 2JLVA 4OK6A 1Z63A 3EC2A 3V4RA 3Q72A 3EZ2A 1XD8A 1LS6A 4NMMA 4HLUC 1KI1A 1X8LA 5SZKB 4US1R 1QG2A 3CONA 2REBA 1OJLA 2JLWA 5CK4A 3VKWA 1HEIA 3LXRA 3AP1A 5L3QB 2CLSA 4FWIB 4OKSA 3FOZA 3THXB 2QAGA 4LK2A 3VTKA 2I3BA 3ZZTA 4TQAA 1N6HA 4HZIA 3Q5EA 4TMTA 2BBWA 3LQRA 4G5OA 5DE3A 1DS6A 2B21A 4AKEA 1ZD9A 1AK2A 4PC6A 2BMFA 3BRWD 5H1YA 1G16A 4BGDA 4YC7A 2ZANA 1JBKA 3KTAA 5FOSA 2QM7A 1DBSA 2VRWA 1MO3A 3GQBA 1EWQA 1KO7A 2H18A 3CB4A 3WP1B 2OT3B 3QKUA 1G5PA 1US8B 2PX0A 1AN0A 1E9CA 1FX0B 1ZU4A 2C98A 2PZEA 3QG1A 5EJEA 3AGQA 5JS7A 4KITB 4GNKA 1KK1A 1P75A 4MUAA 3MG9A 4V0NA 3CZPA 2DFTA 3PJRA 1KMHA 1Q1EA 2WSSD 3FFAA 2J7PA 1E2KA 4OQFA 2F1JA 4NYJR 4QJ4A 4A6XA 2Q3FA 4F4CA 1NI3A 2ODBA 1XTRA 1SXJD 3G82C 3P26A 5FUWA 5FI1B 4CW7A 2VF7A 3EASA 3JZAA 5FPHA 3C15C 1ZD1A 1BKDR 3ND8A 2EFHB 4BLTA 3ZDQA 1A5TA 4UNPA 5D3MA 4E03A 1JPJA 1Z0JA 4LHZA 1F2TA 2OEPA 4B2LA 4HB0A 1KO1A 4V03A 5K8UA 4PSAA 2W6ID 3BFVA 1FQKA 1OLOA 1KK2A 4EQ6B 4BFWA 2A2ZA 4S2EA 2PL3A 5EZ6B 2R44A 1Q21A 5AUPB 1FNNA 2AR7A 1IY0A 4R7ZA 3TIFA 1E2QA 2WM9B 4DVGA 1OH5A 4UNQA 3CX8A 1M1YE 5D3QA 4B33A 4LJ8A 2W6JA 3BB1A 2PJZA 3MFYA 1ZUIA 1ZAKA 3VU9B 1DADA 1ZIPA 3MAAC 3ADDA 2G1KA 1U0HC 4P4TA 3ZVRA 4CEJA 5TDHA 4XSGA 4AD8A 5H8WA 2VP5A 3PIRA 1AZTA 4RD4A 2QT0A 1KDRA 3OAAA 2C04A 1IBRA 4B3DA 3GLFA 1HT1E 1G9XA 1XTQA 2IK8A 4LWZA 1I4DD 3OEHA 4ZIRB 2O0HA 3AF2A 4KVAA 1AGRA 1XEXB 3KDSE 3PG5A 4FCVA 5DISB 4TMZA 1XD2B 1I4TD 4EFMA 3O8CA 3CKLA 4Q7JB 3N5CA 1Z0DA 1W48A 2CLDX 1YZGA 3CNLA 1DAFA 3M1IA 4II7A 5FPSA 3E70C 1R10A 1W2GA 2H16A 1DAKA 2UVQA 5FTMA 3X1ZA 1CU1A 2X77A 2JLUA 3QF4A 4HUQA 1XBTA 3K09C 1D2EA 1CIPA 3LW7A 2NZJA 4QBIA 3RSLA 1EFUA 1WBDA 3QE0A 4V0KA 2QAJA 4QOSA 1CXZA 3THYB 2W6IA 1QDEA 1M7GA 2GJKA 1YQTA 1KSGA 4AY2A 2D2EA 1YZTA 4M1TA 3AVYA 3D31A 1RYFA 5JRJA 3B5JA 3HYRA 3MJRA 4M2LA 4U7DA 1MT0A 2CL0X 3LRPA 1P72A 4EFLA 1KJZA 5EZ5A 1XRJA 4D0GA 5CLLA 4DB2A 4RJLA 1OXSC 3QSYA 2IC5A 1GL6A 1YR6A 3PEYA 1IXSB 2CXXA 3GLIA 1NN3A 5JJKA 3AUXA 4QNMA 3NXSA 4UJ5A 4RZUA 2BBSA 4CEHA 4OK5A 4X8HA 5JS8A 1XJCA 5HTKA 1XEWX 3BE4A 4MYUA 2JCSA 1JR3A 3B1WA 1GITA 5SZJA 2WWWA 4A8JC 2ZXUA 4PPFA 2RGNC 5CJPA 3M6AA 4JJKA 4GOKA 1H8EA 2ZS9A 1XPRA 1Q3TA 4OL0A 2VP0A 4DCTA 2RH5A 5IF9A 1OIWA 3WNBA 3T5DA 2AKYA 1R8SA 3CR7A 5P21A 5EE5B 1J7KA 1GG2A 5JWOA 4TL9A 5F9HA 3I72A 2PLRA 4HZUB 1SVWA 2FPKA 3IHLA 3AGPA 3O8DA 3U3RA 1AJEA 2PZFA 1NY6A 2OXCA 4DBLC 5CDFE 2GA8A 3H0KA 4FMDB 1FTSA 1OFTA 1YR7A 2CMKA 3CLVA 4ZI2A 4W5HA 3K0EA 1F6BA 1J8MF 2XNSA 3NBXX 1Z2CA 1W46A 3I32A 3QIAA 2CHGA 2IXFA 2F1HA 1QHIA 4M1WA 2NO1A 1MO6A 4Q4LA 3T15A 3K1JA 4X8MA 2OCYC 3QPUA 1ZINA 4QJ3A 4KFUA 4PZLA 5HR5A 3IIMA 3BC1A 3E2IA 2IUUA 3GJ6A 1X1RA 4RFSB 3JVUA 4JLJA 3NBYC 1E2HA 3B9QA 4U5XA 2QRNA 3WBKA 2GBLA 3N2IA 2CLCX 2OCBA 4FMCB 1MV5A 3ADKA 5IT5A 4KVGA 1OIXA 3B85A 4HLQB 2GK7A 2QMUA 5DI9A 1SKYB 2R6CA 3I5XA 2REOA 4KSBA 4X8OA 1V43A 1G6HA 1CBUA 3BD9A 4LJ9A 2O8EB 2WJGA 3AP3A 2PH1A 2PLFA 3ZIAD 5LD2B 4Q4AB 1K6MA 2C77A 4HAYA 2IYRA 3B7GA 1G4UR 3IIJA 4HATA 4JKYA 4NCJA 1WA5A 2QP9X 2REXB 1EWRA 4TTPA 5GJWC 3RSOA 1E1QA 2ZUCA 1T0HB 4D6PA 1DG1G 3RYTC 4W9MC 1NRJB 1T4GA 5JWRA 4IVRA 1GP2A 4Q02A 4BRWA 4TLCA 4NHOA 4PTLA 1D8TA 4LV8B 4B48A 4JLOA 3FTQA 1U94A 4TMXA 4EJSA 3QPVA 3VR3A 4DSNA 2KBEA 1LF5A 1KYIA 3EAQA 5IHPA 3GLFE 1W0JD 3QKRA 4YONB 2IYUA 4PC7A 1XB2A 4LYHA 1N5JA 2QL6A 4M9ZA 4U00A 5L8VA 4IFEA 3W6NA 5KTYA 4LRWA 2ZSEA 3W6PA 2R6AA 4O3MA 2J5XA 2ZRDA 3RC3A 1OH6A 5E7JA 4MRVA 4OHZA 2QM8A 3FHTA 5AUQA 1CTQA 2HF9A 3MCAA 4A0GA 1QHGA 4BUJA 3KJHA 4Q1AA 1BS1A 4UJ3A 1XPUA 1E0KA 1XCGB 4ILEA 2J59A 5JMTA 2QROA 3UANA 3D3QA 1XMVA 3TR5A 4YXWD 4F93B 5J4KA 1WB9A 2Z4RA 2ZRLA 3UMRA 1RFLA 2DBYA 1T9HA 1Z28A 1EXMA 2RMKA 1PZNA 2V7QD 2R62A 4N3NA 1VPLA 3B1XA 1OW3B 3FFBA 1R5NA 4PZZA 4G5RA 3A58B 1SHZA 1E79D 5FOWA 4LJ5A 3REFA 2JDIA 4DLUA 4BFVA 3GJ0A 2V6IA 3C4JA 4JZKA 4Q18A 3CRQA 5KU1A 1UDWA 1QVAA 2ZRKA 4LJAA 1Z47A 2WWHA 1G6OA 3QI2A 4JT2A 3CZQA 3QEJA 4CT5A 2CJWA 3GLIE 3FPAA 1WQ1R 2ZJBA 2DFNA 2GILA 1OB2A 4M1MA 3AF3A 3ZJYA 3SN6A 3A4MA 3NBZC 4PHTA 2VF8A 3IIKA 1WCV1 4BFYA 5D3MB 4EPVA 2FGJA 3K0FA 2ANBA 3U60B 2HUPA 1FQJA 3LWNA 4PAMA 3MRSA 5FOTA 3X2SA 4OI1A 4BZPA 3WNDA 1G8GA 1T8TA 3P1JA 2G1JA 4YMVA 1JR3E 1BH2A 5L3VA 1N6NA 2BBOA 1JB1A 4IVPA 4JVLA 2OLJA 4URWR 1ZC3A 3RAPR 3VAAA 2XZOA 1ZYUA 1Z06A 3CW2A 5KDDA 3SYLA 1RPZA 3BBPA 1L7VC 1KAGA 1VCOA 5JJLA 5K8LA 1EGAA 3X1DA 3W9YA 3CO5A 3RS2A 2BMJA 1YVDA 1GRQA 4B35A 5CB6A 5JSZA 2H17A 3RWMB 2O0JA 2WAYA 1KNQA 1CULC 3VHLB 1BIFA 1DAMA 2CNWA 3HWSA 2C2HA 5F3WB 1CLUA 2GZDA 2CK3D 3LX8A 4YXWA 4L9SA 1SKQA 1YZUA 2C5LA 2OBNA 3OF5A 1KDOA 3AKCA 3VKHA 1GFIA 2V7QA 4QBFA 3HR7A 4B73A 5GVRA 1OF1A 1KKLA 2G3YA 1E79A 2X19A 3AV0B 2Z6VA 5EXXA 1M2OB 3W3ZB 5IDVA 4LSGA 3NWJA 1E9EA 1IN7A 3BXZA 4UNRA 1SXJB 2BCJQ 4LOAA 3ZS9A 1L4UA 4MYHA 2A3RA 4JLMA 5FBQB 3QF4B 1UDXA 1Q44A 4B2PA 4HUQB 4B76A 3SQXA 1ESMA 4WBSA 3PUWA 1RIFA 1WF3A 3C5CA 5TVKA 4M0LA 3LW8A 1ZUNB 4LV6A 3TK1A 1CRPA 1U8ZA 1J90A 1Q1BA 5AUNB 2XJ9A 1XDBA 2BM1A 621PA 2GJAA 2OSBA 1TEVA 2PT7A 1A1VA 1MKYA 3KJEA 4WVFA 4JVMA 1G3IA 2SHKA 4JBWA 3U3KA 4B3BA 3KKMA 1BOFA 5KYKA 1EFRD 2QORA 4B3XA 4C0KA 5E7IA 3QENA 4G3XA 2NGRA 1JJVA 2N46A 2VP2A 1ZRHA 3F5FA 3NH9A 2X2EA 4LJYA 1NLFA 5B64A 1UBFA 2W0MA 3IPXA 5AJZA 4OI0A 3ASYA 3ZGXA 3A1WA 4GFDA 4JS0A 2WHXA 1EX6A 4QHYA 5JRZA 3Q7PA 3GPLA 2MSCB 2Z4SA 4ZPXA 2BEKA 4PSVA 4LBVA 3RS0A 3K0SA 1YJ5A 4LHYA 2D7CA 4LX0A 2JAQA 3K09A 3LBNA 4FW9A 2ZE8A 2BWJA 5SZHB 4CEHB 1GKYA 1CJVC 1K8RA 4D4MA 4PX9A 2QNRA 2F55A 2E1RA 4KO8A 1KO8A 3TBKA 5CIWA 3AM1A 4QHTA 2UZ3A 3LQQA 2OO7A 4B3GA 5H70A 5EXTA 3EIQA 2L0XA 3QVUA 1VYUA 1COWA 1R0YA 5DYGA 4ZO4A 2XSZA 5BQ5A 4US2R 1TU3A 3BORA 4M1SA 2ZM5A 3NVAA 4ZCMA 4G0NA 4LGMA 2WKQA 4OHVA 4B75A 1P2SA 3BH7A 4HDCA 2WIAA 4B3CA 2WWYA 2GKSA 2ONKA 2ZS8A 4TN1A 2FSFA 1PUIA 1E94E 2DHRA 3EXAA 4GPTA 5J4HA 4N1AA 4C9BA 4A15A 2F7SA 2WMNB 1P62B 2FFBA 2J0UB 4AYXA 3FKSD 3GFTA 4JLNA 2RAPA 4W5WA 3BH6A 1UBEA 2VP4A 4FXPA 3AUYA 1G21E 2D74A 2ODWA 1WRBA 3TRFA 4JJZA 1E9AA 4TSFA 4A8JA 4C0HA 5BWMA 2RGNA 2IF0A 1VG9B 1ONBA 4BPBA 1VTKA 4Q1CA 2FV8A 2NO6A 3VNUA 2WJYA 5J47A 3KXLA 5DGXA 1N5KA 4L8GA 2JLYA 3LLUA 4WXRA 4PQRA 1P6XA 4XOIA 3EIHA 1FUUA 1G18A 3CPHA 5JJIA 4LPSA 3PUYA 3ZD7A 2ZSAA 3EW9A 3QKTA 5FFMA 4NH0A 3UWOA 4TL8A 2R6GA 4G1UC 3I5YA 2ZVQX 4BWYA 3MGCA 1UADA 4Q9LA 3SDZA 4DUGA 1G7SA 1S1MA 1ZNYA 1UBGA 4RKFA 1U9IC 2OBLA 1EFHA 4TMVA 4OBEA 2RHDA 3QQ5A 1HY3A 5KNBA 4NCKA 3NG1A 4Q03A 3SZRA 2HYDA 5GVSA 2VSFA 3K0CA 2Q3MA 3PUZA 1Q0UA 1F2UB 4LI0A 4YMTA 4GP6A 3LAWA 4IEIA 4A1FA 1G7RA 2BIFA 4BZQA 3B13B 4D4LA 2CCKA 4P3YA 1F5NA 3QF7A 3B60A 3SYNA 2FPLA 4TMWA 4GT1A 4NYJQ 5LB4A 4UXIA 4EJSB 2H7VA 5DSZA 4D26A 1KNXA 4HAXA 2BM0A 4JIMA 2F43B 5FL3A 1AGPA 1OHHD 2ZVPX 4G5QA 3S1AA 3TSOA 6Q21A 2XOKA 3FKSA 1KKMA 1KK0A 2XNDD 2A5YB 5EUQB 1DOAA 2HLDA 3UXMA 4EPRA 4DRZA 1D5CA 4M53A 5GJBA 1F60A 4BLQA 3KB1A 2P0EA 2ZRGA 4ZCIA 2IUTA 2IWHA 4GOXA 5LDDC 3P20A 2QENA 2QU8A 4ZV4A 4NYMR 3R20A 4P4SB 4OHYA 3IDQA 2QN6A 4YLGA 4ARZA 1YE8A 5AJYA 5TV2A 3DM9B 1FMJA 1XTKA 2A7QA 1T3SA 1Z29A 2X8AA 4JLPA 1QZXA 1U81A 2YINC 4AIIA 5FOXA 1OKKD 2EW1A 2O8FA 4RD1A 2A5GA 1H8HA 3C41J 5CLQA 2QPAA 3DKVA 1KAOA 2PMDA 4JSTA 4DZZA 4EAQA 5CM8B 2DFLA 3L0IB 3KX2A 3KJGA 4V0MA 1Q1ZA 1NMXA 3NEJA 1FP6A 4NONA 1T5LA 4Y0AA 2I1VB 4PANA 3TUZC 5GADl 1TEXA 5G53C 2GJSA 2EVWX 1KY2A 1LV7A 3NC1C 3THWA 2QMEA 1H65A 2Z43A 2QPTA 1XNJA 4W7SA 5LPNA 1VMAA 1XXHB 4R98A 2CCJA 1VHTA 2EQBA 3IKJA 4D25A 4NCNA 3K0FB 5HCNA 5JEDA 2MMGA 5EP1A 4M9XA 5B57C 2JATA 1MH1A 4HSEA 4EPWA 1XMJA 1OFUX 2YZ2A 1OHHA 1IQPA 3O8BA 2CDNA 1E0JA 4WZBE 2V4ZA 2W0SA 2XNDA 3FDIA 5C46F 4M22A 1T6NA 1E4VA 4ABYA 3CX7A 3L2OB 2WWFA 3A37A 1PV4A 1NP6A 3TAHA 4RD0A 4BQSA 2YC2C 5EE3A 5JSZB 1JQJC 2FG5A 2H8KA 1L2TA 2XB4A 4F4JA 1RE0A 3NIBA 5BYKA 2ERYA 1NN1A 1UFQA 2V3CC 1B23P 2RGBA 4AG6A 4MGIR 3K9HA 4D0NA 2ODNA 4O0MA 1N0UA 1KIMA 5FOVA 1Z5ZA 2O8DA 1SVMA 2GXSA 5AUOB 2IEYA 3U5ZB 1C1YA 2A5FA 1KI4A 3CNNA 4IFBA 1KI8A 2AD5A 1OKKA 3RS3A 1BMFA 3FVQA 2JLZA 1X3SA 1DO2A 3TAUA 4YQFA 3KKPA 3CUEF 3DVLA 2BEJA 1VKJA 1W4CA 4GOJA 2GNOA 4B34A 1RRGA 2W6JD 2ZJ8A 4DIDA 2OLKA 2RGDA 4PO9A 1NMYA 2CBZA 3ZVMA 2ZJYA 1KSJA 1ZC4A 5BN5A 1P61B 2IS6A 4K81B 3A4LA 1A2BA 4TL6A 1E2GA 2GESA 5TXGA 1AZSC 2O0KA 1WE2A 2G9NA 2FSHA 2BJVA 4DLVA 1DARA 1E96A 3KFXA 1ANKA 1IM2A 3QXHA 1CR2A 1W49A 3BOSA 3NHAA 3B1YA 2ZROA 3OAAD 5HE9A 2GK6A 2WKRA 5C4MA 4IKEA 3DMNA 1ESNA 3EZFA 3GEEA 3EIEA 1RRPA 3HDTA 3QUSA 5LBIA 1OH8A 3OEHD 4NE2A 2VSXA 2AWNA 5CDFA 3PV0A 2C95A 3CH4B 1U8YA 4TQUS 3RHFA 4NP6A 4GBMA 1DAHA 2KJQA 4MITA 3CNOA 1GRNA 2ZYTX 4XH9B 4CRWB 5DN6D 2BBTA 3O8RA 1I2MA 1S96A 1KHTA 3WRYC 1VYVA 1XF9A 2WWGA 3SYKA 4LHVA 3U6KA 5AWFC 3DZDA 3HPRA 2B6HA 4Q1EA 4URYR 4L4UA 3KL4A 4AKIA 1SULA 1UBCA 2DYKA 3ZYCA 3U44B 4XWAA 4YDHB 3I92A 2ZSFA 5IRCD 2IA5A 3Q9LA 5G40A 2Y8EA 3SEAA 2XTMA 1SQ5A 4JYBA 3TGPA 3K0AA 5FPKA 1Z6AA 2IHYA 4TWZA 1IOZA 2AL7A 4ZDKA 1XPOA 2JJ8A 3GEIA 1LY1A 4LV5B 2J7KA 2OESA 2EFEB 4GDFA 3WMFA 1R0WA 5FBWB 1QBKC 2JIZD 2CE2X 1G3RA 1JR6A 4NTZA 1ELOA 1UKVY 3TUIC 3AKDA 2PCLA 3AVPA 5F2EA 4Z8XA 5TY0A 1BO6A 3WHKA 3LBHA 3DHWC 4TYYA 3QXCA 5AJVB 4L16A 1G20E 4BFXA 1FTNA 1VIAA 4X8LA 5KNCA 5UKDA 4Q01A 3EPHA 4RCYA 3G0HA 4HAUA 1R7RA 5C18A 4TYWA 1JR3D 1N6OA 4V0ME 2ZRCA 4PC2A 1E2LA 2BOVA 1E2MA 3LFUA 3AEZA 3LNCA 4B32A 1H8ED 2ZJ2A 2FNAA 3AKEA 2PMKA 3FMIA 3K9NA 1TUIA 5KDOA 1W7AA 2DCUA 1UEJA 3R7WB 2IS4A 4JL6A 5DN6A 5DLQC 3NHBA 5CYPA 1GAJA 4RFVA 3BFXA 4PFSA 4KCGA 4MKHA 2XITA 4HLCA 3SJAA 421PA 1KI6A 5JZVA 1IN5A 4FCTA 4J0QA 4IOKA 4RZ3A 2AKAB 4P31A 1EFCA 4M9QA 2IYLD 3CPJB 2JA1A 4BFTA 3VHXA 4BFZA 1OXXK 1XD9A 5HE8A 1P2TA 2C78A 3L8ZA 2AK2A 5J40A 2HEIA 3AB3A 3D7MA 4KXFB 1E9RA 2YOGA 1E1RD 2OBMA 4KBFA 5DYIA 3RRNA 3D8BA 2JLQA 2JGNA 2NTYC 4KHZA 2ZJOA 3L0PA 2ZEJA 1SGWA 4NL4H 1C9KA 4RD6A 5JWHA 5BN3A 2JIZA 2XTZA 2GJ8A 3OZXA 1VCMA 2P6UA 4QM6A 3FMFA 3ZZUA 4Q9JA 2CL7X 5JLJA 2GCPA 1Z8FA 1M8PA 1TF5A 1U9IA 2NPIA 4D0LB 4HDOB 2HCJB 1IXRC 3CIOA 3AKYA 1IN4A 4JKIA 4MKIA 4P33A 3UIEA 4KODA 5HKKA 2RGAA 1GL9B 1E1QD 3TNFA 4C0BA 3MLEA 3W34A 5B30A 2FSGA 2YYZA 5K8TA 2JLXA 1S1CA 4AKHA 2G77B 1SVKA 4OJKA 1T5IA 2IX3A 1ZM4A 1W36C 3IEVA 3IQWA 2DWOA 2X1VA 4JL5A 3ZZ0A 3CX6A 2FEOA 4D4JA 3WXMA 3VNVA 3TW4A 3QXXA 4XVRA 1KO5A 3W5IA 2OCAA 2WV9A 2HJVA 3OHMA 3QVVA 2IYQA 3RRYA 2Z83A 1NMZA 5EP4A 5DH9A 4CDGA 1LTQA 2J3EA 2FFQA 3RANA 1N6PA 1II0A 4A82A 3AF1A 1AQUA 1E69A 2ZAOA 1E1RA 1SVLA 1WDTA 3CPEA 4OYHA 3VR5A 3SJZA 2O8CA 4PPNA 1GUAA 1YRAA 4Q19A 1YHNA 2J1LA 2PX3A 3K0CC 2RGGA 5FTLA 2Z0MA 3THWB 5FTNA 2QPOA 4O2RA 2CVFA 2YC4C 3W6OA 1HV8A 2RGCA 2ODEA 3V00A 4BEJA 2FX3A 5DO9A 1PUJA 3GD7A 4ERNA 1EESA 4WA7A 3QEOA 1KSFX 4LJ7A 1G1MA 2IYTA 1TQDA 2XTNA 5JBQA 3CM0A 3QBTA 3R8FA 3RRMA 4QGGA 4KFSA 1TU4A 1UKZA 2QGZA 2ZSDA 4V0LA 3Q8XB 3U4QA 2GXAA 2JDID 4MUBA 5K8IA 1IJEA 1A2KC 2GCOA 2IBMA 2QMOA 3ETLA 3GLHA 4C30A 1AS0A 1KI2A 2JLSA 5TMPA 4MH0R 3FMPB 3FWYA 4ON9A 2RKOA 1SHKA 1HUQA 2N42A 1WBBA 4FMBB 1HYQA 4UXHA 3WYAA 1Q12A 3E5HA 1X1SA 2IYXA 4WAUA 1CKEA 2O8BA 2QSYA 1FPMA 3U61B 1I4LD 2QGNA 1R4AA 2P5TB 1FP7A 1Z22A 4AURA 1N0VC 3D6TB 3AVVA 3NKVA 2AK3A 4CF7A 3TVDA 3ICQB 3JVVA 2R2AA 2VLIA 1TUEA 3I1FA 3U7FB 3GFOA 1NKTA 2BHRA 3WRXC 2UZIR 2WIBA 3L0OA 2BKUA 2ZE6A 2OILA 1UKEA 1MABA 2QAGB 4PHFA 1S3GA 1GM5A 1J8YF 2W00A 3PITA 4JT4A 4G5GA 1EFTA 4M21A 2ZI9A 4R2IA 4CYMA 3FKQA 2ZJ5A 4DLSA 2EFDB 2LKCA 1G19A 1XX6A 2EYUA 3GCGA 4FI3C 2CNWD 1G3QA 2W83A 2FDCA 2PBRA 3KTAB 3J81k 4E07A 2YWFA 1FUKA 4QG7A 4E5UA 2YJTD 3I8SA 4U02A 4F38A 5FBLB 1WMSA 2FOLA 1KSHA 5TB5A 5BN4A 3G5UA 4XSHA 2ZIAA 1Z0FA 3A4NA 2FWRA 1RJ9A 4H9GA 3BIFA 3GJ8A 1E99A 2QY9A 2XAUA 3QBVA 4RZXA 1KMHB 3MSXA 2JEOA 1G8FA 2QBYA 2NPFA 3QOFA 5F9FA 4GRAA 2VEDA 3DMDA 1FW6A 4A2PA 2FEMA 3WMEA 3BB3A 2Q21A 4RSGA 2VBCA 4A6PA 1HQCA 3LH5A 3AQ4A 3EPJA 2ZRPA 3W3AA 3DL0A 2WJIA 3DOEA 4FCWA 1ZVQA 2GRJA 2HXYA 1XU4A 4WZAE 4DIEA 2YHSA 1F2TB 1P73A 4TLDA 3BH0A 4US0R 4TZ6A 1S9HA 1XZQA 1D9XA 1HTWA 1OIVA 2FU5C 2CCGA 5HZKA 4B74A 4XTRA 1NVXQ 2ZU0C 2AX4A 1HT2E 2PT5A 4TL7A 1HE8B 1VDZA 2AN9A 2GEDA 5A5GA 3AH8A 3GFPA 3NEYA 1QHSA 4KBGA 1E9SA 4XIGS 3I73A 2BVNA 3CWZA 5EXSA 5FUXA 1NN0A 2WSMA 2IS2A 4TLBA 2CHVA 3THOA 4IVQA 3EWAA 3HJNA 3WP0A 4TLEA 3R9IA 4CEJB 3BGWA 2GVZC 4I1UA 5FL7A 4FMDF 1JECA 4HYYA 1E3MA 3H1TA 4LHXA 2RCNA 2HF8A 2A30A 2ZRMA 4QBHA 4B6EA 4XVUA 1NNEA 1W4BA 4MKGA 5JHHB 2WBLC 1UKYA 4W5JA 2BMEA 4RKEA 1OSNA 3GLFB 4O2LA 3SFZA 1NVWQ 4MKFA 4QGHA 3TMKA 4DDWA 1COWD 4I1OA 2BC9A 2NOAA 1R5BA 1X6VA 2ZJAA 2V55B 2XSZD 4TQ9A 2IXEA 3CRW1 4FMCF 4B3FX 4EKDA 2EU8A 2G6BA 2ZITA 2GAOA 1LS1A 4Q7KA 1M34E 1KJYA 4LBWA 1A7JA 1KI6B 821PA 3L43A 2HDNB 1KI3A 2ZJZA 4OQXA 2R8RA 4M1OA 2ZU6A 2YOFA 2J46A 3EA0A 2Q9CA 1CJKC 2P2LA 4NYMQ 5GJVC 5IK2D 4LUCA 3U6BA 3TQFA 1TAGA 5L3QA 1IN6A 2AWOA 1CP2A 1KTVA 1N5LA 4TSFD 1X8KA 2R6FA 3TH5A 3GLHE 1AIPA 3Q5DA 3WMGA 4EIWA 3AVUA 3DOFA 1W5TA 4JLAA 1CEEA 3X1WA 4ZKEA 4RZ2A 4OHWA 2QQEA 3LO5A 3VKGA 1ZCAA 4V02A 3W8NA 2QTFA 4Q48A 4CIDA 2OG2A 1W36D 3LY5A 4OHXA 3TLXA 2ASEA 3PFIA 3GJ7A 4BASA 4LJ4A 5DI3A 3GLIB 4TMKA 4L5BA 5M04A 1HA3A 4QGFA 1F3OA 3A36A 3TUJC 2XB2A 1FX0A 1YZNA 1G64A 4DUGD 4BFUA 5J4VA 2YVUA 2V8OA 1GOTA 2ZRJA 1HURA 1E2NA 4HB2A 2F9MA 3T1OA 2GF9A 3ECCA 3OE7D 1TF7A 4CEIA 4A0RA 2IF2A 5KO2A 1OH7A 4XJXA 3TQCA 4AWXA 3AVXA 1KOFA 2WTUA 2G83A 5KHOC 121PA 5TARA 2V1XA 3SE0A 1QHYA 2XEXA 4Z8YA 5JCZA 1FNMA 5GJCA 1QG4A 4IXMA 4EQ6A 3GP8A 4B47A 1JAHA 4C2TA 1EG7A 1PLKA 2FA9A 3U7EB 1I2DA 3Q3JB 2XOKD 3R8CA 5IK2A 3T61A 1VHLA 2ORIA 2AD1A 3K70C 2HLDD 4F4IA 3R9XA 4C7OA 1ZMXA 3PUXA 4JL8A 4FIDA 1KZ7B 3REGA 3UKDA 5FBRB 2O8CB 1XEFA 4I99A 2VL7A 3DZ8A 3VU9A 3C8UA 1GWNA 3EZ9A 3U3OA 1SXJC 3KB2A 4MRRA 1LFDB 1P9NA 3OIWA 5JHGB 3U7HB 2GTPA 4RD2A 1UJ2A 1JEEA 3Q85A 1S2MA 5L3SA 1DTSA 2D06A 2OUKA 1MOZA 4PQYA 4PR0A 3AP2A 2IW3A 4I1SA 4IDHA 4PHHA 1ZM9A 3TKLA 4TYNA 3EX7C 3SQWA 2Q9AA 4JLBA 1XEWY 1R5OA 2P6RA 2JJ1A 4Q9KA 1H8HD 1SVSA 2OFOA 2ZPTX 3U4QB 1JQLB 1XEXA 4ACAA 3KKNA 3UPUA 4LYFA 2WZQA 2GZAA 5HZHA 4HLDA 1IY2A 4D82A 1VIYA 2ECKA 2I1QA 1Y63A 2ZRNA 4PHGA 2QTVB 2BMDA 2YKGA 2HT1A 3OE7A 2XXAA 5FUYA 2NMVA 1JXMA 1VECA 3QNUA 5HPYB 4PSKA 3U3JA 2AHOA 1NY5A 4ZCLA 4PO1A 1EK0A 3GLGE 2ZI6A 3BAFA 3SJBA 2H92A 3P32A 4Z1MA 1YR8A 2J0QA 1JALA 4I4LA 5L3RA 3QKRB 4AYTA 3AVTA 3AVQA 3ICEA 1XWIA 2ZI3A 4DEYA 2ZI4A 3K53A 2ZUBA 3FB4A 1GNPA 1U99A 2VP6A 4QC2A 4AI6A 1N6LA 1YKSA 1PJRA 4YMWA 3UWKA 4MQBA 4HDQB 4XD7D 3SS8A 4TLAA 4EPTA 1J70A 5HCIA 3HP1A 1QHHA 1ZNXA 4RCZA 4URXR 3PR1A 4NDZA 1N6RA 1KJWA 1N0WA 2LKDA 1WXQA 3RABA 1W1WA 2IS1A 1DELA 2FJUA 4M1KA 1GIAA 1JXOA 2FFHA 4DWJA 1Z0KA 1QHXA 3FMOB 5FTJA 4UNSA 4URZR 1RJ9B 2WPDD 1BMFD 1NIJA 4PPGA 2J0SA 3V4FA 2B92A 521PA 1S0UA 4JSYA 4BE7B 1OE0A 1PVOA 4RY2A 2JJ2A 3T5GA 2XX3A 4H1UA 2G0TA 2QZ4A 3A8TA 1FFHA 2QI9C 4NYIR 1NF3A 3TSWA 4LJ6A 3VX4A 4ZDJA 3KQNA 2CJWB 2OHFA 4KI0A 3WYFA 4WXPA 2IWRA 1W5SA 4HZUA 3MWJA 2RHMA 5EP3A 1NVVR 3QXSA 3SNHA 5KUTA 2QBYB 1Q20A 4DDUA 1P2VA 3H84A 3CRRA 3GJ4A 2ZRIA 3SBDA 3LBIA 3MWYW 3GJ3A 4DCUA 1E9FA 4Y0VA 2C9YA 4FINA 3LLMA 1XJQA 1T8UA 1E0AA 1UPTA 4PQFA 3TR0A 3KKQA 1DAGA 4DCVA 2WAXA 4PAQA 4S35A 4A9AA 4XD7A 4KSCA 1II8A 3K9GA 4UXJA 4A4DA 1R8QA 2GZHA 2Q0HA 4Q21A 2ZETA 1Z6XA 1EX7A 1N6KA 3RS4A 4Q9IA 1OPXA 1Z08A 3ASZA 5DNYB 1RYHA 1ZNZA 5A0FA 2O8EA 4BECA 2AXPA 4QKQA 3T35A 3KKOA 2WPDA 1LB1B 4JVSB 1TNDA 1G4AE 4KLNA 1TL7C 5FPTA 4MDEA 1AKYA 2Z5FA 1LW7A 3X1XA 1CR4A 1NBMD 1KDTA 1KI7A 2VSOA 5JECA 4ASUA 2VP9A 3T34A 4C0SA 4EPYA 2FZ4A 1RRFA 1GRRA 5CJ2A 2F1RA 2R6DA 3OESA 2NG1A 4E22A 2ZS7A 1TQ4A 4WOPA 4C3ZA 3MJHA 4QXAA 2KSQA 5BXQC 4RD3A 2PZGA 3H86A 1D6JA 3EZ6A 3MMPA 4LBYA 1JJ7A 4IOLA 4DLTA 4Z51A 2GJ9A 2QP4A 4HB4A 4QNRA 4Z54A 2Q3HA 3L8YA 1E9DA 3SOPA 1NSTA 1G7TA 5FBVB 3RS5A 1CS4C 3SC3A 2JLRA 1AM4D 5FUVA 3VR2A 2B7BA 2VHCA 1S4QA 4QL3A 2WJHA 4Q47A 5DI3B 3VR6A 1V5WA 1P60A 4DLZA 2XZLA 4OQMA 3P27A 3T06B 3LDAA 3AF0A 1N5IA 2HV8A 1E2DA 1JNYA 2BCGY 3NDBB 4ZDIA 4IDOA 2IEZA 2NIPA 3IPYA 2ZYWX 3K70D 1NVUQ 1J2JA 1O87A 2C9CA 4XVQA 3RVBA 3LVRE 4R2HA 2HT6A 3IO3A 4TYQA 3PVSA 3RS7A 3HU3A 4ITRC 1KK3A 3SJCA 1DAIA 4CEIB 1ZD8A 1KY3A 2CE7A 4KU4A 1W47A 2ZUDA 3DPUA 3NH6A 4TTRA 3RLFA 1XP8A 3KQLA 3OEEA 1E2JA 4LCBA 2GETA 4HUTA 3EPKA 3PEWA 3QKSA 4BLPA 1AKEA 3JZMA 1OXUA 1NBMA 2ZRAA 3U7GA 1TTTA 4IXNA 2YOHA 1AS3A 1RRCA 1UF9A 1NG1A 1DPFA 2VHJA 4KLZA 2IL1A 4K8OA 2BV3A 4MRSA 4KFRA 1MR3F 2VA8A 3ZS8A 5EUMA 3OFND 2VQSA 2WICA 3EA5A 4C7OB 4Q9HA 4KAXA 4NZYA 2KWIA 1P5ZB 4EDHA 4A8JB 5HKKD 3KXIA 4PC1A 2EYQA 1P9RA 1XZPA 3W90A 3BK7A 2ZQ5A 1MRNA 1GKUB 4DKXA 2C8VA 5FOUA 1KO4A 1W36B 5L3SB 1E4YA 4L9WA 2J45A 3ZLJA 4IHQA 4Q1DA 1TX4B 4DLXA 3BWDD 4BFSA 3KFVA 4Q4HA 3U2QA 4D2IA 4AC9A 1MO5A 2QMHA 5JFGA 2IUSA 2YWHA 3M4YA 4IOJA 2OAQ1 1FMLA 1G41A 3CRMA 2WSSA 3L0SA 4URVR 4C0LA 3N2EA 1YZQA 4JLDA 1HQYE 4IOMA 2ATXA 3CH5A 2QUZA 4BLSA 3ONWA 1UAAA 2P65A 2XXAB 2Q9BA 5DHAA 1L8QA 1SXJA 5KPJA 2B8TA 1Q22A 2FE4A 2ZYUX 5FPYA 4DLWA 4A0HA 1W0KD 3VR4A 1OFHA 1SKYE 4JMPA 5FR2A 3ZQ6A 2J0VA 3CF6R 5EQTA 2F3TA 1U90A 3OIUA 1G8PA 3PEUA 3SR0A 3UG7A 3SU8A 2ZR0A 1JI0A 2PCJA 3S1AB 2WJJA 4LYAA 1DEKA 5DHFA 4HEJA 4B43A 3OFNA 1T3LA 4UNNA 3FHCB 2KI5A 2F6RA 3PQCA 4EUNA 2GXQA 2LCFA 3DM5A 1WP9A 2YV5A 3PUVA 4LPKA 3BJIC 1N25A 3P4XA 1OYWA 1ZIOA 1DO0A 3E1SA 2H57A 1W44A 8OHMA 1QHHB 2EFGA 3DDCA 3DEFA 3HR8A 2VHTA 1OFIA 1T0JB 1CJMA 2P6NA 1RKBA 5C1BA 5J4LA 4ARZB 1C4OA 4URUR 5AJXA 3WY9A 2EWWA 4DDTA 1UEIA 5EE9A 1E2EA 2MSDB 3ND9A 4DSTA 4LHWA 4PO8A 3UMFA 4DHEA 2QTHA 1MO4A 3N70A 2O8FB 1NLYA 1ZM2A 3VR1A 1GTVA 1NSFA 1Z2AA 4D81A 4CT4B 2QQ0A 3CWQA 5SZIA 2UKDA 3CF0A 4UKDA 4XWOA 1A4RA 3VQTA 1ZNWA 1B0UA 4TYPA 4R9UC 3LVQE 4M4SA 5CM9C 5DIFA 1VG1A 4PC3A 3M0EA 5JCPA 2DFKB 2AFHE 2ZRBA 1Z6GA 1SVIA 4BLRA 4DSUA 4GZLA 2OM2A 1W0KA 4H1VA 4Q7MB 1G8HA 2J0UA 3PCRB 4A36A 1VG8A 4Q66C 5KNDA 3I62A 1E2PA 5KOYA 3FYHA 2MSEB 2QA5A 1OB5A 5CIQA 3IGFA 2FN4A 3WNCA 1G5RA 1YR9A 1ZBDA 2OE2A 1R0ZA 2GF0A 5JI2E 4P32A 1F48A 2OV2A 2DR3A 5E95A 2D3WA 1XTJA 1IAQA 4WIAA 1RZ3A 3WBJA 2NZ8A 2ZYVX 4TZ0A 2PEYA 1II8B 1NBME 5E4FA 4LY6A 3VFDA 3K9LA 4O25A 3VMFA 2FH5B 4NCIA 2W58A 3T1TA 3TVTA 4DJTA 4YMSA 4QBGB 2XZPA 2ZI7A 3A1SA 2O8DB 2IYWA 2WVJA 3QXJA 2YWGA 4C0JA 1G5TA 3BFKA 1O3YA 3EZ7A 1G291 1XMSA 2ZRHA 2LWIA 3MD0A 2KE5A 2NO7A 3H4MA 1F2UA 4I1VA 4OI4A 3KUDA 3T1QA 2XGJA 2K5UA 1G3MA 1QF9A 3C16C 2A9KA 2GEVA 2W2XA 4POAA 1IN8A 1U98A 1SVOA 2D4HA 3ADCA 3BS4A 2IYZA 4Q5IA 1GVNB 2MMCA 2WWIA 2HJGA 4A2QA 3A1VA 5FL7D 1NN5A 5AJWA 2F43A 4NPHA 3HYTA 4B71A 4N0DA 2GHIA 4HI0E 5FR1A 4HAVA 3I4LA 3NDPA 4B6FA 1ODFA 4MRNA 4DLRA 1NLZA 4IDNA 5KDLA 3HU2A 1G7CA 3T12A 2NO0A 2WKPA 3DKPA 2H5EA 1GL7A 2R9VA 4ZDWA 1SXJE 3KUCA 4MGKR 3W5JA 2GEUA 1W4AA 2IYSA 3GMTA 2ORVA 2O52A 4P4SA 2IYVA 1NIPA 2RB4A 4EPXA 1IJFA 4MYCA 1OV4A 1VCNA 4N0EA 1TADA 4MDFA 2QSZA 1P4SA 2VHUA 2DWPA 4HLUA 2OZEA 5C2JB 2TMKA 3NBFA 1ZJ6A 4IRUB 1TQ6A 5FTKA 2D2FA 2WOOA 2ZSBA 4JBXA 4GL2A 4UQOA 3TW8B 2XJ4A 4CGZA 1IXZA 3K0AB 3ZIAA 4OI2A 5LD2C 3NC0C 2IXGA 4GSYA 2FMXA 3C7KA 1NG9A 1Z07A 1E2IA 2HCBA 1TQ2A 2E9SA 2GCNA 2BJWA 1D9ZA 3B2EA 3B6EA 3IO5A 4BZXA 2VYFA 4DXAA 2F9LA 2QG6A 2V1UA 2C03A 2A78A 4NCHA 1NKSA 3QKSB 1XXHA 1BYUA 3PXGA 2ZAMA 4QFMA 5FH9A 4LC1A 3LA6A 3RWOA 1XCMA 3KXKA 1ETUA 4MYTA 1R0XA 1X8JA 221PA 3MWLA 4NKRA 2R65A 3GLGA 1W0JA 4Q4JA 1IONA 1JEDA 2B7CA 2QP3A 3PEVA 4P0TA 4ESVA 2CEAA 1G3UA 4IDQA 2QAGC 4A2WA 1Q57A 2CHQA 4XWKA 1KI9A 3A1TA 1E0SA 3A6PC 1ZM3A 4KYIB 1E98A 3L82B 1ZUHA 2FSIA 1P2UA 4FWTA 2BKEA 3B9PA 4ESHA 1ZCBA 1QVRA 1DG3A 4R71A 1NJGA 1P3JA 1TF2A 4QM7A 1FZQA 2FZLA 5G3ZA 1TMKA 4DT1A 5KSOA 3SFVA 2EFCB 5AK0A 5E3HA 4E09A 1N2CE 4ZKDA 4Q4HB 1W2HA 3UK6A 3TE6A 4OJQA 2P3SA 1M7HA 3LD9A 2ZRFA 2F3RA
chains in the Genus database with same CATH superfamily
4F04A 4TT3D 1PJTA 3K70B 1WDMA 2CVHA 4NBSA 5KSPA 3DZGA 721PA 1M6VA 4DXDA 2IE8A 2IH4A 3RFXA 4GQAA 1XTTA 3C5WP 5D87A 2W2TA 1UK8A 2OFWA 5K99A 2JFZA 5BSVA 2HXSA 3ZWCA 4P0QB 2VO1A 4HDRA 4LXYA 3SZLA 5BNZA 5U4XA 2YRFA 3DHVA 1P7PA 1TD9A 1X15A 5TF0A 4F7DA 2OQ2A 3KPUA 3OMWA 4ZVVA 1W1IA 5CB8A 1MW9X 4GZMA 2A5DA 4BRSA 4FUTA 1UBLS 2VQEB 2VPXA 4FHFA 3E7DA 4HAZA 4I8IA 4J3FA 4ANFA 1FCJA 4WXMA 5FD8A 5JCOC 1XNHA 1MZPA 3BRQA 2JRLA 1KE1A 5BMVA 4MV4A 2DPXA 1M7BA 2JJ1D 3G2LA 3QJYA 4LTMA 2MYNA 3TRDA 2ONJA 4RY9A 8GPBA 1JDUA 1Z83A 2OZLA 5EMJA 5FTWA 5K4HA 2DB3A 1E32A 5ES4B 5GOZA 3BERA 4K46A 1Z5WA 1CRQA 3UK1A 3T3EA 4MUMA 3R3VA 1H0SA 3F5SA 1CR0A 3Q7RA 3ONVA 1IQUA 5LB2A 4N0PA 2O2DA 3D6HA 4CF6A 4DMLA 1VPDA 3RJ9A 3ZOZA 1Y81A 3TQIA 1K08A 2OCGA 3RH0A 2WYHA 2J41A 1RVDA 1B42A 1MB2A 2J9FA 3EQ6A 3GZTB 4EARA 3B78A 4RVOA 2GBFA 1O6ZA 1GNSA 1IH8A 2ISSD 2JGLA 3EG9A 3NYRA 4JBGA 2FPMA 4LE2A 2R8EA 4N6OA 4BNDB 4EZEA 4NWIA 3F0TA 4RYDA 5AD1A 3VZDA 3CR8A 1OOEA 3T3OA 2E87A 1U2DC 1RMTA 2ZI5A 5ANRB 4CMBA 4D80A 2V7UA 3DQPA 2OFXA 3DONA 3SZUA 1T1GA 1YV9A 5EHZA 1ZI8A 3EARA 5G41A 3C0KA 5DBOA 5BWOA 1X86B 1E6CA 1UWCA 4MV5A 4D9EA 5BYJA 4K5QA 2ZB7A 4EYSA 3JVEA 2R2GA 1RCTE 2QX4A 1B3BA 4GP7A 3H5NA 2E4AA 3GY0A 1JLKA 1G17A 1Y3AA 3KOUA 3SKVA 3IILA 4YAKA 1C0IA 3HWRA 1DC5A 2QLNA 1GSIA 1R6BX 4GVPA 2VJKA 5CCEA 1QGED 2FLKA 1VKNA 2ORWA 2GERA 2Q3DA 3N2YA 4WCVA 2LE0A 3RSHA 4L28A 1EB9A 1B0ZA 5JATA 2RHBA 2WJVA 4WZZA 2BJHA 1LVGA 2FLVA 3BL8A 2JAXA 4C7VA 1F0KA 1Z0AA 2GLTA 3IBYA 3NOOA 5EWMA 1C9NA 3TRIA 2VDPB 1T6YA 3PFGA 1C9YA 4OKNA 4Y7DA 4OJTA 4CM5A 2XWSA 1U2RA 3DMRA 2JCBA 1TT5A 4IO0A 2FSVC 2XE6A 4GGMX 1JIUA 1JTFA 3RKRA 1OXTA 1WMEA 3ZY4A 2GCOB 5CK5A 2GYWA 2YJ3A 3IBGA 4XTCS 2IOYA 4K6KA 1Z6TA 2HU5A 1DUIA 4TZKA 1LPSA 2VTBA 1J23A 3SLGA 2I6GA 1UBNA 2HN9A 2XY4A 5I01A 1W0CA 5ICEA 1RWOA 3UG6A 4U2CA 4DEXA 2D62A 3GP5A 3IQXA 2XE4A 1T91A 5K0TA 4CVNA 3L8DA 5E4JA 1U3FA 2CFCA 1KXJA 3CRVA 3GBSA 4BO8A 5EE1A 4DCSA 1ZZGA 2BKXA 4RDXA 3THYA 4U8GA 1KDPA 3DOUA 3U4IA 4DHWA 4F4UA 2JAWA 3H2YA 1XTIA 1LX7A 4DV2B 2RGXA 2D0OB 1O54A 5G3YA 3GDOA 2YWEA 3OIFA 4ZICA 1MZVA 3CBQA 3MYYA 4ZT4A 4IEEA 3HU1A 1DE0A 2EKQA 4MUKA 2HZBA 5FUBA 4FR0A 1QCCA 4FFWA 4EY5A 1NBEA 2DLDA 4K9DA 5K3SA 4MB0A 1ULBA 1E2FA 3SSNA 1Q0ZA 2OCXA 4MW0A 7REQA 4HX2A 4ZK2A 1I2BA 2AQKA 3P9SA 1GCOA 1DV1A 3EVTA 4AYWA 1BE1A 1QC5B 4YBZA 4EMSA 1AE1A 1PU2A 2PAAA 2VDJA 4YFVA 4DXAA 5JD4A 1TZKA 2G6TA 4MP6A 3IHWA 1WQ4A 3ADBA 5CIYA 2JHPA 3ITDA 1FOEB 1A9ZA 4ZOBA 4GVLA 3S8EA 1OT3A 2ATIA 1QRAA 4A7PA 2QL7A 2A14A 1R64A 3P4UA 3BBLA 4GM0A 4IZHA 4L15A 4Q7LA 1Q6YA 5A4JA 2WUWE 1M6NA 3I37X 4DQKA 5B3JC 3SVLA 4TRMA 4G5SA 4CKBB 1ZR2A 5H68A 1XK6A 3TOSA 1VA4A 3WLAA 4G86A 3IBTA 4B87A 4B5LA 3LL4A 4ZT3A 2Q6OA 1L4YA 3EWSA 1Y7LA 4P83A 4ZAZA 4YUYA 5EE0A 3KQUA 3OT4A 2VQ6A 4J7XA 5DOZA 3I3SR 3BGIA 3HJBA 5J2TA 2ZUFA 4Q24A 3VO9A 5BV2P 3BIWA 4KQEA 1M76A 4KYUA 4NBKA 4M6WA 4QGAA 3N0VA 1OYYA 3QKIA 4AUNA 3EWNA 5BVHB 5SYMA 5C1IA 4PN7A 1TO1E 2XOEA 4MEAA 3G02A 2HX1A 3RR2A 4J0EA 4YVFA 4ZOLA 2QE7A 1VIVA 1RI1A 4YP9A 4FDMA 1IMOA 2IP4A 1MQAA 1SXIA 4BNHA 4KFTA 5IC4A 1YS7A 3O4VA 4YJ2B 4WACA 2AW3A 2FW0A 2G7ZA 4HXGA 5BORA 3H5IA 3O82A 4QQFA 4ZAWA 5IVIA 3RJ5A 4DANA 2RC5A 3E3OA 2IT1A 1GZSA 2AZMA 3PTZA 3Q41A 1H4VB 1C7ZA 2IXBA 4UAJA 1PLJA 2WM8A 4ONEA 3UGKA 3OP1A 1E0DA 5LDHA 1Y9DA 2AMLA 5HRUA 4A73A 4MGZR 1WSWA 1RHRA 2P5YA 5D8DA 2CNNA 2KB0A 5K0LA 3PUIA 1K5DA 3T4PA 5JMPA 3MN1A 3QX7A 2Z1MA 1QYXA 1N3BA 2GN0A 1GKIA 2V54A 3K9CA 1Z2OX 2LR0A 4G0QA 1OXVA 4R2LA 1K5GA 3ZE1B 4DPKA 1IUNA 3K1YA 4YI3A 1JHVA 2QVXX 1U0JA 3BT7A 1D07A 3FVRA 2O2HA 4F0JA 3ZD8A 3OPQA 3I2GA 3TJZA 4OK3A 1PZEA 1FTQA 2C83A 1C1XB 5AR1A 3U3MA 3SX2A 2V8BA 4XM1A 1MF7A 2PD6A 1CR1A 2C9OA 1ORWA 2P75A 3QPWA 1EVEA 3L6EA 2QN1A 4QRHA 3OEED 4G0MA 4BNLA 3FRJA 4IJ5A 5BW5A 1FL9A 3I28A 2QD5A 1KEEA 2XB6A 3AIKA 1ZU5A 1OX6A 2VYND 4QJ5A 4TMYA 1NATA 4IX1A 2JLVA 4OK6A 5DDIP 1Z63A 3A4YA 4LOKA 3EC2A 3TRJA 3V4RA 2GNAA 3EZ2A 5HVNA 3ONNA 2XZDA 1OZ0A 3KVVA 1U3UA 2Q6KA 3NETA 3VYTB 1SQSA 2XXBA 4H6XA 1UJ6A 3OLXA 3KSDO 1ZKMA 4JCOA 2WM2A 4QRIA 3LXRA 4PGGA 5FA5A 2PUHA 3I1IA 4FWIB 4Y1GA 2WVGA 2O8NA 2G8NA 1CDEA 5AQ1A 3VTKA 3PBKA 3RAGA 3ZZTA 4TQAA 2VQFB 3BJEA 3R44A 4DBZA 2DMRA 2XPCA 4FDVA 4ML3A 4G5OA 3FTEA 2CSXA 4IH1A 1RFGE 4I4TA 5H1YA 4BGDA 5DBFA 1NVKA 5AT1A 1LBQA 5LUBA 4CR8A 3KTAA 5FOSA 2GAJA 4KXXA 2NXEA 2F8MA 1H2EA 1PK9A 2VRWA 1MO3A 3GIDA 1HDIA 2ILTA 4Y0NA 5IUJC 1IZ7A 2Q5CA 1D0VA 4DGSA 2B8NA 5FYDA 1QP8A 4UHCA 1FX0B 1E9CA 1ZU4A 3ABSB 2BKLA 3EUAA 1QGDA 3D4PA 4YUAA 5JS7A 2ZWMA 1Z2DA 4ROTA 4PCAA 3ZXIA 4KITB 4ZT2A 5ALDA 1P75A 1U2PA 2DKOA 3MG9A 1M5TA 4QDTA 3PF9A 2Y3IA 2DFTA 3CZPA 5L4LA 4LQCA 2OGSA 1KMHA 1JKIA 4TRNA 4KE7A 4NNOA 3NMUF 4UTVA 1RE1A 2YV3A 2F1JA 4QJ4A 2Q3FA 1J2UA 1NI3A 4M49A 3MF4A 1SXJD 2I78A 1SG0A 1A9QA 4NY1A 1ZJJA 1T1SA 2VF7A 3EASA 2O50A 3N07A 3R4CA 4I55B 2AYXA 2WILA 3AKZA 3C15C 1ZD1A 1E5DA 3ND8A 2EFHB 3K2BA 4AJKA 4MRMB 1ZK3A 2FW7A 3ZDQA 3D7LA 3OEYA 4UNPA 4DXHA 5LOVF 1JFFB 3AHJA 4X61A 2B20A 3KJXA 5E9AA 2Q4BA 5K8UA 1O57A 1KO1A 3D0OA 2HU2A 5CUQA 3WK5A 4PSAA 2W6ID 3BFVA 1DIRA 4NFHA 3HCBA 4ID3A 3SF8A 4BFWA 2A2ZA 4S2EA 2PL3A 5EZ6B 5JQGB 3K35A 2CXUA 4OGWA 2Q1XA 3ESYA 4TKUB 1FNNA 2BR4A 4C05A 3NANA 3TIFA 2IH2A 3OC6A 5BVHA 1ADFA 1OH5A 1IVSA 4MWZA 2YYSA 2H2AA 2I7VA 3H8WA 4WADA 4B45A 1KAEA 2Z3ZA 4LJ8A 2W6JA 4B33A 4JI0B 1DI0A 3HKBA 4JEMA 3TYXA 3LQFA 1O0BA 2Z5GA 1EFLA 2XWPA 2HDHA 2JGRA 1VM6A 1F51E 4G1MB 4PSUA 1H2ZA 2VWPA 3ZVRA 3HVHA 4HR7A 1BFKA 4IMJB 4KN6A 5GGYA 5TDHA 3SC2A 3BHIA 3BRWA 3KOWA 4AD8A 1U28A 2I9PA 1VA5A 3IUPA 4LCJA 2VP5A 2G9RA 4CIXA 3JWIA 3IQGX 5EPUA 1T4DA 1IEVA 4LKRA 5EKDA 2FPXA 1FUYB 2QJRA 2JHGA 4CUZA 3PQ7A 1HNXB 5JXHA 2QT0A 1JB9A 1DCTA 1KDRA 2BHLA 3PHLA 2C04A 4IMPA 1IBRA 4J0FA 4LX8A 4O4LB 4B3DA 1XTQA 3GPCA 4BEVA 2II6A 4ZODA 2IIVA 9ATCA 4V0QA 3BMOB 1KOGA 1ZKDA 4EGSA 5HUHA 5CVTA 2XUPA 4KQCA 2P9FA 1VC2A 5JDIA 2N0SA 3DQZA 2AX3A 3K0HA 1AGRA 3KDSE 4KVAA 3V8NA 3QXGA 4FCVA 4EFMA 1XD2B 1GCGA 3ITEA 2XUZA 5TNXA 3ZV4A 3CKLA 4BO1A 1NW5A 1QK5A 1Z0DA 3B5IA 1AH2A 1W48A 3QSGA 3LBYA 1U31A 1EUCB 2ACEA 2KLBA 5EJFA 3VDNB 3CJRA 3M1IA 4II7A 4R3NA 3SXUA 4F3NA 4EATA 2YTZA 4WEOA 5CXQA 1W2GA 2UVQA 4UEQA 5FTMA 4YMGA 1CU1A 4LF5B 3ZCUA 4N3AA 4PLFA 1U7XA 1G66A 1GTRA 3OM8A 2NZJA 1EFUA 4WLVA 2BGWA 3K92A 4MIYA 1X87A 1QGUB 2BP7A 5ENVA 1T15A 4DW8A 4YEDA 4QOSA 1CXZA 2YVAA 1WCIB 4YP0A 1QDEA 4ILKA 4W9NC 3ZV7A 1YQTA 4E12A 1TEZA 4D9IA 2PE5A 4MJXA 3IQHX 1TK9A 3ACBA 4HGNA 4OXKA 2C5GA 1RYFA 2GUWA 1PFUA 3GUYA 3MXTA 4EQZA 4ZYZA 3MJRA 4M2LA 3ZK8A 2CL0X 4U7DA 5EHXA 1MV8A 1KJZA 1TGVA 3B2QA 1NKVA 1V8PA 1XRJA 4YT8A 5I7UA 1IOLA 1KU6A 4PHCA 3HACA 4JQCA 1ECCA 1VPTA 1FXUA 2WE7A 2BLNA 3MWDB 2X0DA 4W8GA 4OV6B 4K03A 4DUYB 4MQUA 5AVJA 1NN3A 5JJKA 3IP8A 5HGXA 4GWGA 3K71B 5JZ9A 4F97A 2ZR8A 5AJWA 5CTJA 4LNUB 4FE7A 5ALSA 2HK9A 1DINA 4GKAA 1DWUA 1EFVA 4INPA 5JS8A 5HTKA 5A5FA 2VRCA 3E3LA 3JPWA 3I34X 1KAQA 4WK6A 3DWIA 1W25A 4JFRA 1LSUA 2YIVX 4WSOA 1GITA 1GRVA 1WU8A 4NZ9A 4CLHA 1KARA 2WWWA 3M2TA 2I55A 4N8EA 5DASA 5L3ZA 1TUGA 5FKJA 4EVSA 1HZZA 2RGNC 4PPFA 4V0SA 4YRAA 1T4MA 3I30X 3H5VA 5K8VA 1TK2A 2D1YA 4JAVC 1B16A 3A4TA 1JDTA 2D4AA 3QVMA 1A98A 1KYYA 1Q3TA 3A3PA 4LHEA 1H3EA 4DCTA 4PTYA 2WUGA 3ILHA 4EAAA 3LX4A 1QQ7A 5IF9A 4LECA 4MVJD 3CR7A 5IN4A 1R9MA 4GR4A 3ICCA 4Z3DA 4B6GA 4DIOA 5BQXA 2INGX 5BWNA 3GFSA 4FLFA 4HZUB 3WYNA 1RLIA 1SVWA 2OORC 3IHLA 3QFRA 2PZFA 2ATEA 1NY6A 5EJ6A 5LR6A 3BDIA 2BFMA 3G8AA 4J9UE 4P81A 1EVJA 2OXCA 2YX1A 4ZT5A 3RVLA 2ROQA 1PZGA 1YAHA 1YHZA 4F11A 1XTBA 3LA8A 3CLVA 3OTGA 2CMKA 3QTTA 5DP2A 4HEHA 5FPQA 2B4AA 3RT7A 4EKNB 2PO5A 5EKXA 2AQHA 3HDVA 3G5MA 2I5PO 3DC2A 1Z2CA 2HTFA 3I32A 2ET6A 4UD2A 3V33A 4GE3A 2OLEA 3WFZA 2JVKA 1DMSA 4Q4LA 5BO5A 5HYVA 2OCYC 3QPUA 4OXIA 1ZINA 1CY4A 4EGFA 1HO3A 4EHFA 1VJ0A 2AN1A 1WZEA 3ENNA 3IIMA 3HY3A 3W4IA 2IUUA 3GJ6A 5FEUA 1WU7A 4EHNA 5KQMA 3FOZA 1E2HA 3B9QA 4YDRA 1X1CA 5F1YA 1V5EA 4UHEA 4I1IA 1MV5A 3ADKA 5IT5A 1I7SB 4KVGA 5LZ7A 1WY7A 4HLQB 5CXXA 1SKYB 1DBPA 2EDAA 1ENOA 3LT0A 2Q4DA 2B5WA 3HU5A 1LZLA 1V71A 4KSBA 3NXKA 1WIWA 4B6RA 4B4KA 2HRBA 2Q2OA 4ETMA 2WUEA 5A1TA 4TWRA 2FMHA 1R6VA 1C3LA 1E89A 5LD2B 4CKWA 4Q4AB 3RS9A 2C77A 4ZI5A 4HAYA 3FM9A 3ZNPA 1RJDA 5JI3E 1ZXBA 2DQYA 2GPWA 5JE8A 2Q1YA 3OSUA 1W6UA 3BHNA 4AN0A 3T7SA 2ZBGA 2ZUCA 5B4VA 2VOJA 1SU6A 4D6PA 1DG1G 1Z8NA 3RYTC 3VR0A 1L4NA 1MQSA 3FPSA 3QLVA 4UVDA 5KYXA 2Z5LA 3UJ7A 2I2XB 3FLAA 3S0JA 4BRWA 1MAAA 3NI2A 1EEXB 2GBIA 5E6SB 1D8TA 1U04A 2VJMA 4LYGA 5G4LA 4JLOA 2IPOA 2V6FA 3FTQA 5KQRA 2YV4A 1U94A 3VR3A 4DSNA 4UUBA 1FFBA 1LF5A 3UICA 2H1RA 3GLFE 4B4OA 1W0JD 1NHGA 3QKRA 1EUQA 4YONB 3AHCA 4DG9A 1KRXA 2FPRA 3K05A 4L7QA 3RROA 1LLFA 3FLMA 3RVRA 2QL6A 3CH6A 2BGUA 1D5WA 2RH4A 4REMA 4ZCSA 5KTYA 1L8LA 4YJ3F 2MWMA 2AOTA 1PKXA 2BGNA 4LXIA 4O3MA 2V98A 3IUBA 4MRVA 1T2VA 3TZBA 3I64A 1OX4A 1CEXA 2WV7A 1T2AA 2YWDA 4EUKA 1CTQA 4UMVA 2E55A 4L72A 4NV0A 1VL1A 4CI9A 3VM6A 5AHKA 3RIMA 4REOA 1SRRA 1AA6A 4I5DA 1XPUA 5TQ2B 3ND6A 4PW0A 2J59A 5FNVA 5JMTA 1YCDA 1E1KA 4LY3A 3NRJA 4LRYA 4KGZA 1XMVA 3CJTA 4QWMA 4JLWA 1WB9A 5IVPA 5J4KA 5ARCA 5JYBA 3R6GA 2AF3C 2Y1DA 3GQBB 2DBYA 2AFHB 4BFCA 4EHBA 2WYIA 4FN4A 3OM0A 4J4BA 1U7TA 4RVHA 3PE3A 1CFZA 2P4SA 1PZNA 3NBQA 2R62A 4KPUA 3VISA 1OW3B 1RYZA 3AFNA 1XNQB 2X42A 3A58B 3JR3A 4XYBA 5GM2A 4RZQA 4BFVA 3OFSA 4RL6A 2VUHB 4Q18A 4QOHA 5GM1A 3EEOA 3SWWA 4N54A 4G5HA 5AW4A 1G5IA 2PJDA 2PG3A 2IEIA 5IPFA 2ZSHA 1ND6A 3QEJA 3FNGA 2M9MA 1YBVA 1X7YB 3GLIE 5U9CA 2J9YB 3FPAA 4ROSA 4LOJA 2ZJBA 1AKRA 4M1MA 3UB4A 2VF8A 3DDNA 1WCV1 3IIKA 4KG7A 1PZXA 3R6WA 1MJNA 4RVDA 2PBFA 3HBLA 2X1LA 4L78A 5D3MB 4BGVA 4D7AA 3CVYA 4BZPA 4PAMA 2NLOA 1Q0TA 3ZDBA 2A9PA 2Q2NA 3HCCA 2Z8XA 1G8GA 3WNDA 2OGUA 5CA0B 3EF0A 5EQFA 4HMQA 4JJ7A 4RY8A 2H1CA 1SOVA 2N9UA 2OLJA 3RAPR 1ZC3A 3NGMA 5IWAB 3U4CA 1G0NA 3FSGA 3HCEA 2J3DA 3DO8A 3WB0A 3FYUB 4L50A 1RPZA 1SPXA 1L7VC 1KAGA 1BEUB 1VCOA 5FOQA 4B3RB 5JJLA 1EGAA 3O9VA 3OQIA 4FYJA 2CKMA 2O6HA 4FI3F 4JJ4A 4WLFA 3ZZ1A 4CM4B 1GGEA 3RS2A 5BRAA 1EBFA 4RMIA 2K6GA 1T4BA 4H7IA 5DV9A 3AUFA 4IDAA 4X93A 3OOWA 5JSZA 1ZJZA 3RWMB 4R7GA 4TKZA 5ICGA 3KETA 1KOJA 1KNQA 2QF7A 3DXXA 4YO8A 1GAXA 5MF6A 2HBQA 1QRDA 2HQSA 1P2DA 3PSAA 4FE3A 1CLUA 1KJNA 2CK3D 3GAAA 3LX8A 4J91A 2VTDA 1GR1A 1SKQA 4XB2A 5EZSA 2C5LA 2I66A 3TD6A 4YFYA 4FW8A 4Z4CA 3QZUA 1WUIS 5KINB 2V7QA 3KL2A 1T8YA 5HF5A 1G8SA 2H29A 3IRVA 4QBFA 1NUPA 2A4KA 3GL9A 3HR7A 4YWJA 4EB8A 5GVRA 4C6TA 1T3ZA 5IC6A 1E79A 1HEYA 2P8SA 3AV0B 4M86A 5GIPE 1M6HA 1AV6A 3N5KA 4EVRA 3CKKA 5IDVA 1U2QA 4PN3A 4LF4B 2ZTLA 3LVFO 1I6LA 1PD1A 4LSGA 3AU8A 3BXZA 4UNRA 1TVKA 5HA5A 2BCJQ 4GRDA 4LOAA 4UQPA 3WQSB 3ZWKA 4BJHB 3KSZO 4ER5A 4F4HA 2A3RA 3R7LA 5FBQB 3E7FA 1Q44A 2H52A 4B2PA 3OQJA 1ESMA 4WBSA 4KXWA 4I9NA 2OXIA 1JBEA 1NJ1A 4D3DA 1WF3A 1QH1B 3P8ZA 2FW1A 4M0LA 1RQPA 5FF9A 1Q1BA 2NVWA 5AUNB 3F9RA 3LCUA 621PA 2PT7A 1WZIA 5E9QA 1BVRA 2D1QA 3ES9A 3OZUA 4WVFA 2GI4A 3ZHXA 4B3BA 5LJIA 3VC1A 1G0OA 3SSOA 4A3SA 4RW0A 3KKMA 2X0RA 3ZBUA 4C0KA 4G07A 5E7IA 4ZVPA 1JJVA 2N46A 3HJFA 3TL3A 1ZRHA 3F5FA 4JGIA 5DTRA 1U5CA 1YDMA 2NZXA 4MR9B 4N01A 1F8XA 1A9TA 3FCOA 1L5WA 3PFCA 3SXPA 3T0GA 1QRSA 3HA3A 3A1WA 4JS0A 3GPLA 1EX6A 2EZTA 3FOBA 5JRZA 2MSCB 2G5TA 2Q1UA 4PSVA 4UVHA 4LBVA 3VPSA 4HPXB 1YJ5A 1JBQA 2IFTA 2YJ4A 3PXXA 4IICA 2QK4A 4D57A 2P1RA 2XR1A 5DM4A 3A3OA 4CEHB 1K8RA 1CJVC 1Q2UA 1QOPB 1HQKA 1X1EA 1PR4A 2H4YA 1XRSB 3FSJX 4I0WB 4OKIA 3IXLA 2Z5VA 3HXPA 1J56A 1P7VA 1FVXA 1ZD4A 3COVA 2XBMA 4C4XA 1IPFA 2UYQA 1MPXA 1I3KA 2OO7A 5AVZA 3CSUA 5H70A 1QFXA 3M4JA 3QVUA 1VYUA 3HB5X 5CPBA 4ER3A 1EX9A 2B1GA 2NTJA 3GZNA 2F1OA 2XYVA 4DSZA 1R6AA 1QWOA 4MULA 3K6RA 4ZO4A 1R27A 2WMYA 4B40A 4DJJA 2JI7A 3OFVA 2ZKIA 1AQJA 4MUNA 3BORA 3R3XA 3EEBA 1FSZA 5B5SA 1FYEA 4OHVA 4EG3A 3IQEA 2BM9A 4OLHA 2PU7A 2I54A 2A0UA 3FUVA 2C2OA 3X44A 2IZ7A 1NXXA 4ND2A 3N3AC 1PUIA 4FJ1A 1FU4A 2DHRA 1V41E 5L7WA 2WMNB 1ZRNA 1HOTA 2DU8A 3JQEA 2ZXFA 2RAPA 5EJMA 3IE2A 4F96A 2DERA 1WWKA 1Q1NA 2RB5A 1G21E 2D74A 2ODWA 1N2GA 4XEHA 2FOIA 2W8ZA 4XPIA 1CIJA 4YUVA 1VG9B 1ONBA 2R87A 2WF5A 2XDQB 3PICA 5BSWA 2W2KB 1YR2A 3VNUA 3CUSA 5J47A 3UHOA 1DXYA 3A2LA 3RU2A 1BJKA 1WMFA 3NALA 1FUEA 3LT4A 4EF6A 1WJGA 4TTIA 1P6XA 3G8YA 2AC4A 1FUUA 1VDMA 4XYGA 2XNKA 4CBVA 3UWOA 4TL8A 4KB5A 1YZVA 1MB0A 3ZDEA 2DAPA 3V4ZA 2ESRA 4G1UC 4TV9B 4ZC8A 4BWYA 2W22A 3AIMA 2GPYA 2OCDA 8ADHA 3M33A 1KYXA 4ZRMA 5BSUA 2FX2A 5ELLA 2AFIB 3V7YA 3VPXA 5BR7A 1CUHA 4RKFA 4YCMA 1N5OX 2E37A 1XZKA 1SKMA 3AR5A 4OBEA 2D5CA 4CIAA 1HY3A 4AUEA 2ZZKA 2FUG6 3FGZA 1YIOA 2O57A 4H7EA 3OLCX 5IJWA 4J0DA 1A96A 2JHAA 3C1UA 3LCVB 1TO2E 1V9LA 4GP6A 4LI0A 3I2JA 4YMTA 1WM1A 2FP4B 2IP1A 1D8AA 2R4QA 3B13B 4WY2A 1BROA 4EHKA 1P5FA 2CCKA 3KLNA 1ZXXA 3JRXA 1ILWA 4BKUA 2ZZMA 3QWBA 2FPLA 4ZVRA 1U8XX 3VYVA 3OO0A 5LB4A 2BFEB 4P5PA 3RC9A 3LCRA 2IHZA 4EJSB 3EQ9A 2H7VA 2XCOA 4D26A 3BIOA 4V39A 2ZW9A 2YNMD 1OHHD 2HAEA 3C6XA 1RC0A 4RO0A 3S1AA 6Q21A 3KHKA 1KKMA 2XNDD 4P3PA 2GCIA 4G0PA 3MB5A 4LRSB 3ZWDA 5BSMA 1VLQA 1D4ZA 2FW6A 2NV6A 2RG7A 1OILA 3EIFA 1D5CA 4MS1A 1A7UA 3OJEA 3DKKA 2IUTA 3G68A 3JVIA 1RLMA 3EUFA 5CVEA 4EJ2A 3HA7A 4M38A 1P80A 1X42A 2QPLA 3P20A 4P38A 4XZ3A 1EVZA 5LDDC 4ZV4A 1GA1A 2WT9A 3NT5A 3R20A 4CF3A 3BAZA 4FQ8A 2G5GX 3IDQA 1ULSA 3E23A 3GVHA 1BVUA 4DJFC 5A5DA 3J80A 1TYCA 1UC8A 4ARZA 2ZBUA 1X0XA 3DM9B 4YP7A 2BN4A 2DHCA 3EEYA 5JT1A 3OA0A 2IUEA 1G20A 4B84A 2A7QA 1Z29A 2X8AA 3CF4G 1QZXA 1U81A 2YINC 5EZYF 5FOXA 3TXXA 2B4QA 1OKKD 4YPOA 2A92A 1PNVA 2A5GA 4LXGA 1ODLA 5CLQA 3RARA 3HMKA 3DKVA 3KT8A 3MWEA 3RUIA 3RNOA 4B17A 4D96A 4X65B 3JD4A 2DFLA 3Q8MA 3SJ7A 1AUXA 3E18A 3KJGA 5C8YB 1Z7EA 4LWOA 1L5MA 3TLEA 1OLUA 5FBHA 1NMXA 3LF2A 5B3KA 1YR1A 2XCIA 3WWDA 1HLGA 1LZKA 1Q92A 4PANA 5K3OA 2WTBA 1IG3A 1JWBB 3LLCA 3NC1C 2EVWX 1KY2A 1VL5A 2XYGA 1MORA 3K31A 2QMEA 3TZQA 3TOVA 1XCLA 3H9QA 2Z43A 3KV3O 4FBLA 3JS5A 1XNJA 1BWPA 2W5UA 2WM3A 5AJHA 3DAHA 4R98A 3RTGA 5C51B 2CCJA 5CT4A 4JI6B 3IKJA 4D25A 1Z37A 1CIVA 1D1QA 1L7RA 2IV2X 3REOA 5JEDA 3T8YA 5H5JA 4S05A 1BW9B 4L5IA 5EP1A 3CBGA 3UC5A 5A4KA 4LGCA 3I0NA 4HSEA 4EABA 3E0XA 1PGPA 4LC9A 4EKYA 5HKBA 5JIBA 2C5HA 3WL5A 5ALVA 3WYEA 5DT9A 2CDNA 1LSSA 2PR2A 4AZSA 1NXWA 2V4ZA 2W0SA 4ZEXA 1A4IA 2VJCA 3K6JA 3R5TA 4ABYA 3BGSA 3B3AA 3JARA 3S7ZA 3P45A 4BQPA 4H08A 4F2HA 3VVBA 1NP6A 3FN4A 3OM9A 3PXDA 2VJDA 1NYQA 4WCFC 5AKLA 1UZAA 3I12A 2F90A 4W6ZA 1K68A 4TTVA 4KK4A 3T94A 3ZCQA 4COKA 1LDYA 2XIJA 2VHEA 4D8XA 2WP8J 4Z1OA 3KYDA 1B23P 1BAPA 4FMPA 5DXAA 1IRXA 3OEWA 1NSYA 2ZSUA 4JV5B 1X1AA 3ESBA 4YRBA 1G5HA 3ZQ4A 2ALJA 1Z5ZA 2O8DA 2PMCA 4EA7A 3DYVA 1RI5A 2ZT8A 1C1YA 3OZBA 4H60A 1JHOA 3LUJA 2QIPA 3WL6A 3QITA 2RHGB 4WGGA 1RXSA 1KI8A 3IDOA 3K30A 1XVVA 4MYRA 5TT1A 3FLEA 1TJ3A 1VLJA 4AZTA 1X3SA 3AUTA 3H9EO 2NTVA 1WQ3A 3GC6A 2YQ4A 4MW2A 3HFRA 4GOJA 3WKBA 2HM7A 4PRKA 2OLKA 2RGDA 1W93A 4PPYA 4QO8A 4XRRA 4ND3A 3RHTA 1DB3A 2HO4A 1GGNA 4L3WA 3ILVA 4HDRB 2Z9CA 3DZHA 3H5RA 3H1FA 4JJGA 3FNFA 3RG8A 5BN5A 4RTSA 4QJBA 1UPFA 3GFGA 1RI3A 3H2IA 2XUAA 1OAOA 1XKTA 2V5VA 1WE2A 3BWYA 2FSHA 2ZIZA 3HN6A 5DGHA 2G9NA 3WDLA 4DLVA 4UTNA 4YRQA 1E96A 1KQGA 2ZATA 5L95A 1LI7A 1S89A 4EO4A 1L5ZA 3BOSA 3B1YA 3OAAD 3OQ6A 3P7MA 3PC4A 4OH1A 1NJSA 4BMSA 2D3TA 4F2DA 4JDUA 3GJSA 5BYBA 3P2JA 3EIEA 2C7RA 2P69A 3OEHD 5B53A 4EM6A 2QBYA 4CUJA 2OZLB 3S27A 4F12A 3PV0A 3QMVA 2Q2VA 3AIIA 4MVJF 1TCAA 2DEUA 4P7KA 3H5AA 3B7WA 2MU1A 3ILXA 4JC4A 5AVKA 6ADHA 1ZG3A 1T0UA 2BBTA 5LDGA 1ZL2A 1DC6A 1KHTA 2FEKA 4DNOA 1XF9A 1WCWA 3GUVA 3HUFA 4GW3A 3SYKA 4UFOA 3AR9A 1O5TA 1JG3A 3MZ0A 5K03A 3WB1A 3HDHA 1S01A 4J1NA 2B6HA 2R96A 2HH9A 3CS3A 4OY3A 3EG9B 5HQ3A 4AKIA 5KAMA 4RANA 1SULA 1WXGA 4DYHA 3VU1A 3U56A 3ZYCA 2P9EA 2BDEA 3GRYA 3DB1A 3P2MA 4KWTA 2DQZA 1TI7A 2VQ3A 4MWSA 4QOJA 2DPMA 4YDHB 1PTKA 5G40A 1MC8A 4PAGA 4ZVUA 3GT7A 1W9MA 2Q0XA 4UM9D 1SQ5A 4PRYA 3UJDA 4CU5A 4RENA 1HDRA 2XQJA 1I4EB 3HJTA 3VOTA 2Y6VA 3TTWA 5K3EA 1QXSA 3DAPA 3TGPA 2IW1A 2OOKA 3OZWA 1O8BA 1BKYA 2BMAA 3CNQS 3NTRA 4LV5B 5AKZA 3ZHYA 4XUDA 4BV2A 1CEYA 3H3XA 1SUAA 2ZVJA 4BKPA 2WPNA 1XN4A 1F38A 1T4CA 4TTAA 5T64A 2OVBA 3HSYA 1G2PA 4QUGA 4CG3A 5F78A 3ZIUA 2HPVA 3EUEA 2PH3A 3U3ZA 1ZGBA 4AMVA 3TUIC 1B8OA 1SEVA 5E8JA 5F2EA 3S81A 3NOXA 3QGMA 2M1ZA 4E2YA 3CMMA 2JZCA 1V8ZA 4TYYA 1ONNA 4IIJF 3QXCA 2I99A 3E15A 5CP8A 1EE2A 4HGOA 5KWEA 5IBPA 5J1TB 5KAPA 3H2HA 5D7BA 1A5BB 1CZKA 5UKDA 1E3JA 3EPHA 3G0HA 4HAUA 1R7RA 1A88A 3QK7A 4HLNA 1JXQA 2HV9A 4PLTA 5FULA 3VZSA 4BNIA 5KS2A 1Y1KE 1N6OA 2O1EA 1QZTA 3JYHA 4V0ME 2ZRCA 4PC2A 1HNNA 2FAXA 5F2OA 4ZT7A 1N3IA 1E2MA 4GMFA 2OYCA 3FTCA 4KQGA 4B32A 3LC0A 3GRUA 4O4IF 2FNAA 3FMIA 4KIJA 3K9NA 1TUIA 1W7AA 5L7YA 2VTBB 4F72A 1RVV1 3ESCA 3ADPA 3V97A 5TPZD 1B8UA 3BHJA 3I5MA 1GZ6A 5B1SA 1UKCA 4PFSA 1XEAA 4Y1RA 4MKHA 1DEAA 4HGRA 4EO7A 421PA 2QIOA 3HWWA 1KI6A 2AG6A 2G72A 1YQDA 2AKAB 4NAUA 5DEOA 1J0DA 1VSBA 1Y1SA 2IZ1A 1T5DX 2JA1A 5BSHA 3CQ9A 1OXXK 1XD9A 2PSEA 2AK2A 3D7MA 4CL3A 5B12A 2OBMA 4UVEA 1M54A 3EXIB 1WEKA 4M0CA 2DTEA 2R00C 3IOEA 3COSA 4YRCA 5ED4A 4IPTA 1W1UA 5EGSA 2FEXA 2R1ZA 4MI3A 3R3WA 1Y6FA 3TG8A 4KHZA 2EZ8A 1V5FA 2PSJA 2IU6A 2V4UA 6PFKA 1UKAA 4ZXPA 3K1TA 4EUEA 5JWHA 3O1IC 5KVSA 3WP1B 7REQB 5AM2A 3FH0A 3OZXA 2GJ8A 4YDQA 1VBNA 1VCMA 1XZGA 5BQ3A 3HN7A 2DFDA 4JJFA 3SZ3A 4BB0A 1OFGA 1H2AS 1NHWA 3EPRA 3P0FA 4IIGA 1J06A 4YV7A 1W76A 4WZAA 5C1DA 5JLJA 1FFSA 4M1QA 3ZK9A 2QLFA 1LJUA 1Z8FA 1TM4E 4C7BA 1EGHA 1LQ2A 4HGPA 1D1TA 4UMEA 1U9IA 4RH0A 2NPIA 1EXNA 1EA5A 3QUBA 3KSBC 2HCJB 1CW2B 1NNUA 4O5AA 4MKIA 1IB0A 1GGKA 2OXFA 1HE3A 5I7SA 5HBGA 1T43A 2G1PA 3ZW9A 1GL9B 3KWLA 4NBWA 4Q3CA 2EJTA 3BZBA 1NI5A 3KUXA 3TNFA 2G5PA 2Z1NA 3WLHA 1DXOA 3TD9A 3ZKWA 4CM8A 4AP6A 2P35A 1Y7PA 5SY6A 2JLXA 3O1HB 4DV3B 4NU8X 4LVCA 5J2TB 1ZM4A 1EBUA 2FR8A 2WINI 3IEVA 1U11A 1Z56C 3IQWA 2X1VA 5IDXA 5KVCA 1HTBA 1U4SA 2PQMA 4FFLA 4R9RA 2MR5A 4TV8B 3RVSA 2GPTA 3A2MA 3E3AA 4YRRA 3TW4A 3QFHA 1OX5A 2OCAA 4QYSA 2WV9A 4ZOLB 3OHMA 2HHCA 5DNVA 3QVVA 2IYQA 2IPMA 1LCIA 2DPGA 3CY6A 3LLVA 2Z83A 3N8DA 3RRYA 1MRZA 4JJEA 5DH9A 4J0CA 1WNTA 1NW8A 2EDCA