1P62B

Structure of human dck complexed with gemcitabine and adp-mg
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
241
structure length
229
Chain Sequence
b'RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structure of human dCK suggests strategies to improve anticancer and antiviral therapy
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 90
structure length 229
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p62B00
3ZYCA 2P6UA 3HYTA 2OG2A 2VRWA 3P20A 2DB3A 2WKPA 2VHQA 1FMJA 4GP7A 3OEED 1N0VC 4JLAA 2J7PD 1OXVA 1FP7A 3EIHA 4Q18A 1OH5A 1Z08A 5LPNA 4UKDA 2AKYA 3QEOA 3VX3A 3RLFA 1XP8A 3EZFA 4P4SA 3GEEA 2BKUA 2VHTA 2RHMA 3QPUA 1Z2AA 4MKGA 5EE1A 5LB2A 2ZSEA 3DDCA 4LBWA 3ZVMA 3LD9A 4Q7JB 2DCUA 4RCYA 4TLEA 1AJEA 4PC6A 4AYTA 5KDDA 1PLKA 1S3SA 2FE4A 2H18A 2OILA 3MWYW 4QXAA 5FTJA 4G1UC 3SBDA 1WA5A 3VX4A 3K9GA 1IBRA 1GKIA 5L3QB 2JLZA 1GKYA 1BIFA 4OK6A 3NC1C 5AJXA 1W4CA 4NP6A 2Z83A 1OH8A 5F98A 3U7EB 5EZ5A 4V0MA 4B44A 1H8ED 5JEEA 3FWYA 5FOVA 1U81A 2P5TB 1AK2A 2D3WA 3MWLA 2EYQA 2A3RA 4J0QA 1NLFA 2XITA 3K9LA 1Z06A 2OCPA 2WJVA 5JSZB 1YZGA 4ESVA 3U4QA 4MDEA 2FH5B 4PPFA 4BLSA 2PZEA 5BN4A 2BIFA 3VU9A 2GRJA 1DBSA 2Q9AA 3BB4A 1R10A 3KXIA 4YMSA 1EWQA 1NNEA 2QSZA 3OHMA 1SVIA 3NHAA 2IUUA 2C99A 3W5IA 2GESA 2J0VA 2PEYA 4BLTA 4DEXA 1IXSB 1DARA 5HCNA 3RS0A 1NP6A 2BKEA 2ZI7A 5KDOA 2RCNA 2G0NA 2JIZD 3ZLJA 2C8VA 1GVNB 1RZ3A 4LHWA 2UZIR 3OE7A 2IEZA 4W9MC 2VF7A 1VCMA 1CR4A 3AVXA 3DOEA 3T34A 3FFAA 1MO4A 2BEKA 1ZM4A 2C9CA 1LS1A 3PG5A 4HB3A 2VP4A 4TSFD 4POAA 2ZPTX 2ZS8A 4Q4HA 2WAYA 2GWHA 1Q3HA 2RH5A 4FMCF 2BDTA 2FGKA 2R6CA 2ZRFA 5HR5A 2XXAB 4D0LB 1E79A 4Q5IA 2ODBA 1E98A 2CK3D 1J2JA 3GEHA 4M53A 2ZRJA 2DFLA 3I8SA 3WHLA 5J4KA 2O8FA 4ARZA 4UXHA 4A4DA 2F1IA 1J8MF 4PHHA 1FQKA 2ZXUA 3GPLA 1R0WA 1OF1A 2NG1A 4NL4H 3TSOA 3UMFA 2CLSA 2ZS7A 5BN5A 1XX6A 3VR5A 5KSYA 3PFIA 2QAGC 1W4BA 1O87A 4QFMA 1U8ZA 1Z29A 4TQAA 3ZVRA 4Z1MD 2XZPA 2JDID 2ZU0C 2NIPA 3X1YA 2PT7A 4KSBA 4PO8A 2P2LA 5DIFA 4C4PA 2RKOA 3N5CA 4LC0A 1TEXA 5K8TA 4Q7LA 1IY1A 3ND9A 3WNCA 2N1BA 1LF0A 5EUMA 4G5RA 4LSGA 1VG0B 4IVRA 2GCOB 2BMDA 3GJ5A 3NBZC 1FNMA 2VHJA 4LJ9A 3SJCA 1TUEA 1RJ9A 2PMDA 3KFXA 1KI7A 3D6TB 4A8JC 4W7SA 4ZDKA 4M8NE 4CVNA 2O8EB 3GLFB 3DKPA 1OT3A 3BH0A 4B43A 4HB0A 3L0SA 4O0MA 1OB5A 3GJ4A 1HUQA 3TR5A 1W0JD 1SVMA 3HU2A 4BWYA 3EPHA 2AFIE 2GILA 1L7VC 1WCV1 1X3SA 2OV2A 5AJVB 1M74A 1YE8A 3B60A 3PUWA 3R7WB 4NCJA 4CRWB 3U5ZB 1TPZA 4F4IA 3SZRA 2BJWA 2BVNA 2PX3A 4G5OA 4JSTA 4TT3A 1LY1A 5JS7A 3A1SA 4TTRA 2GJ9A 3U3RA 4JJZA 3CLVA 3GLGB 3I92A 2ZI3A 4L9WA 4KSCA 4D0NA 1T8UA 3LVQE 3GLHE 3TMKA 1OFTA 2EVWX 2I1QA 4ASUD 4B75A 3K1JA 5FUXA 4DLSA 1BS1A 3VR2A 1DADA 2IYZA 3WRYC 4HAXA 2HYDA 1PV4A 3EZ7A 2ZJYA 4B3FX 2QT1A 1ZU5A 5JEDA 4O3MA 1UBGA 2G1KA 1DEKA 2ZJ8A 1UKYA 3AUXA 4DB4A 1V5WA 1CJVC 1N6KA 3NIBA 4B6FA 2EWWA 4JLVA 2VP9A 4GT1A 2ZVQX 3ZD7A 1LV7A 4D25A 3AF3A 2VBCA 1HE1C 3WY9A 1OIVA 1LNZA 2W00A 2ZYTX 3AKEA 4V0NA 3V00A 2WMOB 2NZ8A 3BIFA 2ATXA 3UATA 5K8UA 1DVRA 3CF6R 2XSZD 2O0JA 4PHFA 4RD4A 3WYFA 2GK6A 2OBMA 2QZ4A 2V7QA 4UXJA 3AVWA 1GP2A 4US0R 4B74A 4A15A 1P75A 3KKQA 4JLBA 3KJEA 2Z0MA 5CK5A 2KJQA 4MKFA 3THYA 4TYNA 2UVQA 2ZSAA 2CBZA 4QOSA 4TZ6A 2JJ1D 2RGCA 1G8YA 5BN3A 4C0AC 3LW7A 2LKCA 1BMFD 1WDTA 2CXXA 3OAAA 3VTKA 1UKZA 1SHZA 4S2EA 1UEIA 3CX6A 2CCGA 2HT1A 1Q12A 4Z8XA 3IPYA 4URWR 2QE7A 4URXR 3I5XA 2IHYA 3EZ6A 1EK0A 2ZE6A 4TMVA 1GWNA 4RKFA 1QHHA 5EUQB 3K0FA 3NBYC 2WSSD 4A0GA 2Q6TA 3IPXA 4JYCA 4D0GA 1JAIA 2V6JA 4IOMA 2QMOA 4D4KA 5J4VA 1OSNA 1NN1A 3B9QA 3LNCA 3WBJA 4HAZA 1NN3A 3FB4A 5E7MA 1E0JA 1M34E 4PSKA 2BBWA 2VHCA 3L0OA 4QM6A 2R65A 4M1TA 3SEAA 421PA 3K0CA 1Z83A 3QXHA 1XTKA 1Q3TA 3KQUA 4C0KA 4BFUA 4V02A 5KSPA 4MGZR 4DCSA 1QF9A 2DY1A 1HV8A 2IL1A 2WPDD 1E2PA 2ZAMA 5JJKA 3DO6A 4OKSA 2ZUBA 2W2XA 5CIQA 1RIFA 5J5CA 4OQNA 1ELOA 3CR8A 3PQCA 1OKKD 2VEDA 4EPRA 1Z6XA 1GSIA 2FSGA 2VSOA 3FMFA 3GQBA 5LD2B 2C78A 4TYQA 2QY9A 3E70C 5GJWC 4DRZA 3BFVA 4Q01A 4KYUA 3E1SA 4LJ4A 2WJGA 3GJ6A 2VPPA 1CJUC 4TLBA 3BE4A 3SHFA 2CHGA 1OIWA 4D4LA 3QJYA 2GNOA 2X2EA 1COWA 5JRZA 3RABA 4RY2A 4IDOA 1FP6A 2D7DA 4BRWA 3N2IA 2ONJA 2ZITA 1BKDR 1ZNYA 2VLIA 4XH9B 4WBSA 2P6RA 1SKQA 2FFAA 3SYNA 1D2NA 3ZVNA 1KI1A 3LBIA 4JLJA 1G18A 4LV6A 1Y3AA 5SZHB 4M1YA 2QTHA 1ZAKA 5CLLA 3UANA 2B8WA 2GCOA 4X8OA 1KZ7B 1P61B 3KTAB 4X8MA 5GVRA 3B1VA 1E1QA 1KMQA 2IYWA 3RAPR 1PZNA 2H5EA 4P0TA 4E03A 3CX7A 3SJZA 4DZZA 3AB3A 1YZTA 2FFBA 3CPEA 4DUGA 4N0DA 4YLGA 1E2LA 1NRJB 3RS2A 1M8PA 1VCNA 2GJ8A 4PXAA 4C3ZA 1C1YA 4O2RA 5FR1A 4GMXA 2A5YB 1J99A 2AR7A 3F3YA 3LXRA 2VTKA 1VDZA 3E5HA 1NKTA 1P2UA 3K09C 4EFNA 1RW4A 2YINC 4FCVA 1ANKA 3ZGXA 1YKSA 3ZZTA 1LFDB 1W0KA 1E2NA 3A4NA 4MYHA 4OHXA 2ZR7A 2YOHA 1A7JA 5IRCD 3L0PA 4OQFA 3GLGA 1AM4D 4IXMA 1N6PA 3OIWA 4P3YA 4ACAA 1E9CA 5E7JA 2QORA 2KBEA 3K0AB 1W36D 2FDCA 2IYRA 4RKEA 4Q00A 2G0TA 4FMBB 4EQ6A 1S96A 1E9AA 2ZU6A 4LY6A 3WYGA 1EWRA 3IHLA 2FNAA 5JS8A 1N6LA 2BCGY 5LDDC 1WRBA 2BJVA 5CM8B 2KB0A 4JLOA 4C0QC 2QM7A 1KJYA 1E0AA 3PVSA 1ZM9A 1XEXA 3NEYA 5FOTA 2IWHA 4LK2A 1PVOA 2ZRHA 1CKEA 3UPUA 3QPWA 3EASA 1UJ2A 4JBYA 4LHVA 2QRNA 2WHXA 3U61B 2WWWA 3GJ3A 5KDLA 1E2JA 2GZDA 5D3MB 4KBFA 1YZNA 2B21A 1G4AE 1ZIPA 4LI0A 4F38A 2JCSA 1IONA 4MH0R 2Z4RA 3EZ9A 3VNVA 1WF3A 4OQLA 4TT3D 1G64A 4EJSB 4A82A 4L4UA 1R5OA 3IUYA 4G5GA 2P3SA 2IUTA 1VIAA 5EZ6B 4NCKA 2F43A 4M1OA 4AG5A 5BW8A 5IDVA 1GL9B 2AFHE 1G3RA 2W2VA 4DIEA 2OESA 3F0TA 3RC8A 2OBNA 3NKVA 5E4FA 1LF5A 2VSXA 4P31A 1QHXA 1CJMA 4BFSA 3ND8A 4GRAA 1W1WA 3NG1A 3TUZC 5KNBA 4RZUA 5EP3A 2C9YA 4IOLA 3IILA 4NCIA 5TXGA 2OFOA 3BWDD 1T0HB 4KI0A 3ONWA 4B73A 4BGDA 4ZDIA 821PA 3ZIAD 1TQ6A 4LJAA 5FUWA 1WQ1R 4TMTA 1W36C 2V8OA 4LBYA 4Q4AB 3CIOA 2EFEB 5KSZA 5K8LA 4C30A 1KSFX 3P26A 3UWOA 2PEZA 4DWJA 5DE3A 3ASZA 1DAIA 5TV2A 3AP1A 1T6NA 3X1DA 3TVTA 4UJ5A 4BRUA 2GHIA 1KK1A 3KKNA 1KI3A 3OZXA 2PCJA 1KZGB 4G5QA 4FWTA 3IGFA 3SQXA 4B3DA 1CTQA 1Z07A 1GRQA 2QP3A 4ZO4A 2D06A 4V0LA 4IDQA 1JECA 4LPKA 2QNRA 2O5VA 4TL9A 3AGPA 1NLZA 3QXXA 1Z6TA 1KGDA 3A1UA 5AWFC 1Q1BA 2IWRA 5E3HA 2ZRBA 2IYXA 1E69A 1KDPA 5J4HA 2NOAA 1VHTA 5JWHA 2F55A 2QROA 4NCHA 4ILEA 1G5PA 2NO7A 4QNRA 4DT1A 3I3SR 4P4SB 3UWKA 5DYIA 1UBEA 4HLUC 4LV5B 2V3CC 3FPAA 3SQWA 2ZRCA 4XSHA 3SOPA 1RRGA 2ZROA 4DSOA 5JI2E 1PUJA 2DWOA 1X8LA 1MT0A 5FH9A 5FTLA 2TMKA 4RD1A 5KU1A 2AN9A 5FI1B 4FCTA 3IDQA 5B64A 3CRMA 4DLVA 2QMHA 3B1WA 3KB2A 2IF2A 4GOXA 3CZPA 1JR3D 3V9PA 3T1VA 5H8WA 2Q3MA 3TW4A 4KXFB 3W90A 3VQTA 4BFYA 3OEHD 3KX2A 3P4XA 4BFVA 5CJPA 1JJ7A 3U4QB 4OI4A 1NI3A 4G3XA 4PANA 1F3OA 3RSOA 1RYHA 5JWRA 4LJYA 3D7MA 1SZPA 5TVKA 4BLQA 2CVFA 2WIBA 1KJZA 4O25A 1COWD 1JI0A 1P73A 2GXQA 4XTRA 5FPHA 1ZC4A 4QJ3A 3LDAA 1XTJA 3U7FB 4OQXA 4XVUA 4TTPA 3MCAA 2N42A 1A2KC 4OHVA 2CL0X 1SULA 1YR6A 2PX0A 1XD8A 1I2DA 3ZJYA 2ZM5A 1OHHA 1YU9A 1BH2A 4R9UC 3EPLA 3AM1A 1JR3E 4LUCA 4QBIA 1H65A 1FFHA 4Q4HB 1R5NA 1J8YF 3I1FA 4B3CA 3JZMA 1E1QD 5JFGA 1HT1E 4TMWA 4MQBA 1E2DA 2QBYA 3K70B 2OUKA 4Q47A 1OXSC 4ZI2A 1FUKA 5KNCA 2RGBA 4C2TA 4TQUS 2O8FB 4ARZB 5DNYB 2GDJA 3MJRA 3PR1A 5JECA 1IN6A 5D3MA 4HB4A 2WWYA 3AVQA 1F2UB 2IYVA 1NLYA 4QJ4A 4TWZA 2AKAB 5FBWB 3P4YA 2C04A 1T3LA 1IY0A 2Z43A 4G5SA 4BZXA 4OBEA 1U9IA 4PZZA 3LO5A 2ODEA 4UQOA 4B6EA 4EJSA 3W3ZB 2BMFA 3QY0A 3Q85A 1WBDA 4ITRC 6Q21A 5FUYA 2IHBA 1ODFA 3ZQJA 4NPHA 1FTNA 1M7HA 1RE0A 5CB8A 3T61A 5JJLA 3DHWC 3FKSD 3SHWA 4GMDA 3OIUA 1A82A 4Q4JA 1DELA 1N6RA 3TVDA 4ABYA 5C46F 1MRNA 1T5IA 4JL5A 2R2AA 4NYJR 1G3MA 4A1FA 1RRCA 1UM8A 4BQSA 3CRQA 1G7CA 2XZLA 1XZQA 1G3IA 1E9BA 2G83A 3GLFE 3BK7A 4TN1A 3U3KA 1JR6A 4AIIA 2DFNA 4EFLA 1ZIOA 4PSVA 3GLIA 2YC4C 3AF2A 2J59A 2Q9BA 4HLCA 1JAHA 4ZI3A 2ZRDA 3LAWA 1GUAA 2ZRAA 2EYUA 1YZUA 2PH1A 3MG9A 3NDPA 5G40A 2WOJA 3RS5A 2VL7A 4BLOA 2RGXA 2Q3FA 2ZS9A 2PLRA 4LJ6A 2ZI4A 2P6NA 2GAAA 3QNUA 1G19A 3C15C 1TMKA 2OFWA 3EAQA 4Q4AA 1AN0A 5JJIA 2JAQA 2FG5A 3TH5A 3T5DA 2UZ3A 2ZJ2A 2GJSA 4YMVA 2DWPA 1Q21A 4JLKA 3GLGE 3Q7PA 3FVQA 3I73A 3H1TA 1Q0UA 4WAUA 1U0JA 2FJUA 3RS7A 3OFND 3P1JA 1Q1EA 4JT2A 1KJWA 1ZBDA 2H16A 2R62A 2UKDA 1LS6A 4WXPA 2FSFA 2ERXA 2PL3A 1R0XA 1ZM2A 4BPBA 3T12A 1ZP6A 5DI3B 5HTKA 4Q9JA 5FL3A 3BB3A 5IT5A 3G0HA 1TAGA 2ZAOA 3MRSA 1KI9A 3QSYA 2ZI6A 2W6JD 3NTUA 2OCAA 2G77B 2O8CA 4QBFA 2QM8A 4U7DA 2CNWD 3PITA 5EE0A 1KK0A 5DN6A 3IEVA 1SVWA 2ZRNA 121PA 3WNBA 2W58A 2YJTD 3R8FA 1XJQA 2HUPA 1XXHA 2J41A 2ZVPX 2ATVA 1E9EA 2WWHA 3TAHA 3CUEF 3KJGA 4K81B 5BQ5A 1UF9A 2WBLC 4QL3A 3O8RA 1AKYA 3BS4A 3BRWD 4F7WA 4JZKA 1CLUA 1SKYB 1VCIA 2EFCB 1KI8A 3BGWA 2F1JA 3HPRA 1FX0B 3THYB 1ZD1A 5AUPB 1XNJA 2BV3A 2P67A 3W6NA 2FPLA 2VA8A 3W6OA 3JZAA 2EFHB 2WICA 1JPNA 4WXRA 2R6DA 1G291 2ZSBA 2D74A 2OCBA 4B32A 1G4UR 1G6HA 2CMKA 3SJAA 3SS8A 1NVUQ 1FPMA 4BZQA 4DSTA 3QKTA 3DVLA 2QPAA 4QHSA 3U7HB 3AVYA 4IVQA 5FR2A 3RC3A 1QHHB 2R6AA 3K0FB 1N6HA 4XD7A 4Q1CA 4FN5A 2NPFA 5JLJA 2VO1A 3GFPA 5FL7A 1OYWA 5DYGA 2GXUA 4OL0A 1T91A 2GKSA 3MWKA 2D7CA 1P72A 3MAAC 3PUZA 3RWMB 3I62A 4XWKA 1LW7A 1FMLA 5AUNB 1N6NA 2YC2C 2XX3A 3DZ8A 1CULC 1KY3A 1U98A 2A2ZA 1KHTA 2OZEA 2XOKD 3EA0A 4IXNA 1DG1G 4PPNA 4U02A 1W4RA 5FOXA 2NQ2C 2ZJBA 3NHBA 4JLMA 4CT5A 1R5BA 3LVRE 5UKDA 3SE0A 4C2UA 3SI7A 1E94E 4F92B 1OB2A 3EC1A 3GJXC 4I1OA 2CCJA 1KSGA 3ZVLA 1HH4A 2DFTA 4BLRA 1ZC3A 1DAKA 3HR7A 3MGCA 4NYIQ 5FTMA 4A2PA 1AZTA 1ZUNB 4GOKA 1NVWQ 3MLEA 2WV9A 3W6PA 2HT6A 1U90A 4BFZA 2JEOA 1Z6YA 5EJEA 2VP5A 4HAUA 4F4CA 3ADCA 5F2EA 1FW6A 4D26A 1NIPA 2BHRA 2C95A 1E1RD 5FPKA 4LJ7A 1F2UA 2X8AA 2FPKA 1NSFA 5P21A 1XJCA 4WW0A 3TSZA 5SZIA 2HCBA 1TADA 4Q19A 3ADBA 5HKKD 1ZD9A 2Y8EA 1S4QA 2X77A 3CPJB 3R9IA 4U00A 1K5DA 2IS6A 1GG2A 4H9GA 5HZHA 2HEIA 1X8KA 2AK3A 2QEQA 3AF0A 3CBQA 4LRWA 3SFVA 2A9KA 1TQ2A 5SZJA 1CRPA 1NKSA 1ZU4A 3KDSE 4HDQB 2YVUA 4CGZA 5BXQC 4FWIB 3AVUA 4B3XA 1GL7A 3ZS8A 2XGJA 3C5CA 1G21E 3TNFA 3KL4A 4KLZA 1CIPA 1E2FA 4S35A 4HAYA 4A92A 1MO6A 4MITA 3BH7A 3J81k 2GVZC 4JVMA 3KKMA 4YXWA 1E4YA 3H86A 3MMPA 1NVVR 1GITA 1KO1A 1UPTA 3U6KA 5B2ZA 5ANRB 4LBZA 3NEJA 1XMVA 2QSYA 1D2MA 2FSHA 3M1IA 2XTMA 4D6PA 1W2GA 3VHLB 4KV9A 2MMCA 4TQ9A 1TU4A 2CL6X 2IYYA 2RGAA 1E9RA 3GEIA 1S9HA 3B82A 3H2YA 5A0FA 4NBSA 1EFUA 3LFUA 1U0HC 3FTQA 4DHEA 4HZUB 1S1CA 4TLAA 3AP3A 4IHQA 3ZD6A 3NWJA 1H8HA 2BCJQ 2XNDA 5EXSA 3K0EA 1R8QA 4XSGA 2QQEA 1P6XA 1ZRHA 1K6MA 2H7VA 4EQ6B 4MA4A 5DI3A 2ZJZA 3A58B 3VHXA 4JL6A 1OJLA 1NJGA 3N2EA 3UXMA 1UKEA 4H1UA 4IFBA 1XEXB 3FHTA 4BASA 2FEMA 4TLCA 3P32A 1GIAA 1CF4A 1XWIA 4KODA 1EX7A 1TUIA 5AJYA 3QF4B 1NIJA 3AVOA 3KUCA 3V4FA 3CZQA 4DB2A 1XTQA 1O3YA 4WVFA 4Q9LA 4IW3B 3HYRA 3LQRA 4URYR 2AX4A 4LDJA 3L82B 3ETLA 1AS3A 2OBLA 3QKSB 3ZDQA 1E32A 1ESMA 4IDPA 1R4AA 4LHXA 4EPWA 4QGAA 3BJIC 4YMWA 1FX0A 4NZYA 2F43B 4JS0A 2NGRA 2NO9A 2AXNA 3Q5EA 1KIMA 4UNQA 2ZR0A 2CHQA 4BUJA 2ZYVX 4PAMA 1WBBA 3U7GA 1G8HA 1U9IC 1AA9A 1YR9A 1JALA 2ZIAA 4PC1A 2VF8A 5FBRB 1D9XA 4JT4A 4KJZA 3Q3JB 4HDCA 4JBXA 2KI5A 4NYMQ 3WRXC 4JBWA 1ZMXA 1IM2A 2KWIA 1JEEA 1RVDA 4LJ5A 4M0LA 3L43A 4DLXA 5GJVC 4QKQA 4QGHA 1GRRA 1Q1ZA 3RRNA 2HF8A 2RB4A 4WZ6A 3C16C 1ZNXA 4RD0A 2GBLC 2OT3B 1FOEB 3QF7A 5KUTA 1SXJA 1JBKA 1IHUA 3VKHA 4B76A 3QKUA 2YWFA 3GJ7A 4FD2A 3B1YA 4PAQA 4LHYA 3EWAA 3B7GA 1TTTA 1P9RA 1HQCA 4LYAA 2X2FA 4PHGA 4D4MA 5GVSA 3HWSA 1ETUA 4PQYA 4UNRA 2NPIA 1JEDA 4OYHA 1YJ5A 5SZKB 1V43A 1G6OA 3LWNA 2HJGA 1XPOA 2QGNA 1NG9A 4A0FA 1JQJC 3W8RA 1N5LA 1QHYA 2IYQA 2RGGA 1E2EA 2A5DA 2OXCA 3KJHA 3WMGA 1DE0A 1ZW6A 3IBYA 1MO5A 3G82C 3TQCA 5EE5B 2A78A 2GCNA 4LZZA 2GJAA 4DT1B 1E9FA 2DHRA 3HJNA 4ZDWA 1TX4B 5IK2A 3EX7C 2AWNA 5EP1A 3WMFA 1KYIA 2FZLA 4BFXA 4W5HA 3CX8A 2FN4A 3SYKA 5B30A 1TF5A 3OE7D 1G1MA 2EU8A 1NG1A 2J0SA 3EC2A 4Y0VA 5KPDA 2GEDA 4DDVA 3BD9A 5J4YA 3ADKA 1JQLB 3WNDA 4KYIB 2JJ8A 4BEJA 4CF7A 4D4JA 2RGNA 1Z0AA 2NZJA 3HP1A 4V0ME 1ZUIA 2YNMA 5L3SA 3B1ZA 4A6PA 2J0UA 2JLXA 2IS2A 2ZANA 2C03A 2D2FA 4N0EA 3FKQA 2GAOA 3BORA 1E79D 2VP6A 2ZQ5A 1GNQA 2NO0A 4EUNA 3K70D 5BYJA 4V03A 2ZI5A 4NU0A 4B35A 4N3NA 4DLRA 3IHWA 3E2IA 5FBLB 1VYUA 4A8JB 2W6IA 3NBXX 1KI2A 1WE2A 2PJRA 1XPUA 2QP4A 1FL9A 1T3HA 2IUSA 5CLQA 3LX5A 4FXPA 4KITB 4OK5A 2FMXA 2ZJ5A 2JLYA 4CYMA 1Z63A 1P4SA 1EG7A 4R7ZA 4YC7A 3O8DA 2ORWA 1M7GA 5E95A 2H57A 2GF0A 3C41J 1P9NA 4MGIR 3FHCB 2FFHA 3NDBB 3RDPA 2ZE8A 1R0YA 3I61A 1II9A 1QG2A 4JVSB 4A9AA 3IEUA 2RGDA 3QENA 3LX8A 4HZUA 5KNDA 3A37A 4CZ2A 4M2LA 3KQKA 3MSXA 2OO7A 4MRPA 2BBSA 3OF5A 1ZD8A 1PUIA 3F8TA 1G41A 4FI3C 4MKIA 3D3QA 1ZCBA 4OI0A 1G8PA 1OE0A 2QQ0A 3R8CA 1OW3B 1FNNA 4C0JA 1N25A 5H70A 2FA9A 4JVLA 5C4MA 1G20E 3C7KA 2WZQA 1AQYA 2YHSA 1TNDA 2V6IA 4C0BA 3KXKA 4LYFA 1F6BA 1IQPA 2QBYB 3CRVA 3KZ1E 3KQHA 2CCKA 1TQDA 1KSJA 4XJXA 4RD6A 3QPVA 1I4TD 2V1XA 3TUIC 4BLPA 2B6HA 4US1R 3CPHA 2QL6A 3QF4A 4QM7A 4GSYA 1HYQA 3SJBA 4BE7B 1WB9A 1W46A 1CRQA 4DCVA 3L8YA 3H84A 4P33A 4TL7A 4M1WA 1K8RA 2JASA 1G9XA 2QRZA 1KI4A 1VIYA 3QKSA 4Q4LA 4IFEA 3K70C 5K8IA 2CHVA 1IN7A 1KO7A 4EAQA 3T35A 4LX0A 2RHDA 1ZJ6A 3UG7A 3U60B 1SHKA 2I3BA 2XEXA 4JSYA 4Q4JB 4KBGA 2RAPA 3VR1A 1P2TA 3DEFA 3DMNA 4I4LA 1N0WA 5H68A 1CJTC 1HEIA 2Q0HA 4O2LA 2GEUA 3WP1B 2A5FA 4DLYA 4JVNA 5JI3E 2FSIA 2D62A 3NBFA 2BWJA 4LV8B 4PZLA 4OHYA 5CB6A 1GILA 2ZEJA 4M9SA 3GLIB 1P9WA 2HXYA 2Q9CA 3THXA 5TARA 3VFDA 4W5JA 2BM1A 4UNPA 4V0OA 4QBGB 3REFA 4RCZA 1KKMA 3EIQA 1EFCA 2V7QD 2ZRMA 4DSNA 4ZKDA 5DO9A 1Z3IX 4JYBA 1JJVA 3VR6A 2J7PA 2F1HA 3SN6A 4B2PA 4B3BA 1CEEA 1Z0JA 1E9SA 2Z6VA 5AJWA 4PFSA 1R6BX 1FQJA 4EPXA 4Y0AA 3OAAD 3KXLA 1NMZA 1IN5A 2VH5R 4LYJA 2CLCX 2C77A 3EPKA 2J7KA 3OIYA 2OEPA 1AIPA 4LWZA 3IBGA 1LVGA 2QE7D 3TUJC 2ZTSA 3DM9B 4MGKR 4PZYA 1Z0KA 4ZCLA 1XEFA 1NN5A 1HY3A 3Q7QA 1XCPA 4B48A 3BFXA 3FMIA 4EPVA 2O8CB 3EARA 3MFYA 2QPOA 3QIAA 1F2TA 5L8VA 4B2LA 3VAAA 2EWVA 3T1TA 5DISB 2VP2A 4ZIRA 2PBRA 2QT0A 2QAGA 3KKPA 5FFMA 1XXHB 1H8EA 2J87A 3L2OB 3WHKA 4D82A 3GJ0A 4NHOA 2DPXA 4HYYA 1E2KA 5C18A 4OQMA 2IK8A 3GMTA 1FTSA 1SKYE 2G6BA 3NH9A 3A1TA 1G16A 3HPQA 3CNLA 3MWJA 4Q7MB 2CLDX 5JRJA 3RHFA 1UBCA 5J47A 2W0SA 1G5RA 3AF1A 3HDTA 1W4AA 4OI2A 3U44A 1RC8A 2B92A 4RZ3A 1NY5A 5FOUA 1M6NA 4PX9A 4QG7A 1XTRA 2PT5A 2NMVA 4HDOB 3SDZA 1E2HA 2JJ2A 1W48A 5HCIA 3ZS9A 2F7SA 2JIZA 4NYMR 4A8JA 4TYYA 1Z0FA 3ICEA 1Z47A 1YVDA 4IDNA 1R2QA 3N70A 2B8TA 2RGEA 4JIMA 3RRMA 2IT1A 4QHYA 2WKQA 4B47A 4H1VA 5FPYA 1MO3A 4F4JA 5H1YA 2EQBA 3TQFA 3B5JA 1SXJE 1HURA 4Q7KA 2ZRGA 1CP2A 5KYKA 4PR0A 1I2MA 2CL7X 4XOIA 2HDNB 1NVXQ 1XZPA 2QP9X 2ZSDA 5KOYA 2X19A 3TSWA 1NL3A 1OXTA 4L16A 1HA3A 4GL2A 4DEYA 2XTZA 4AYXA 1VKJA 3AH8A 4RSGA 1MV5A 2GTPA 3U3MA 4F93B 2YV5A 1EFRA 1XDBA 3BXZA 4DCNA 4C9BA 4CEHA 4Z51A 4DBLC 2QG6A 2XZOA 1MABB 1L8QA 2I1VB 4RZXA 4OJQA 2J1LA 3WXMA 3DL0A 3K8YA 1T9HA 1OFIA 3L8ZA 2PZGA 3RANA 3D8BA 3UMRA 2WMNB 3K9HA 1P2SA 1YRAA 4DDUA 1OV4A 4Z1MA 4DUGD 2GVDC 3K0CC 4WZBE 1E99A 2JDIA 1D9ZA 4AWXA 3O8CA 3LV8A 5B58C 1NF3A 4JJKA 4QHTA 2WM9B 4CEIA 4KVAA 4MYCA 4EDHA 1E6CA 1NMYA 3HU1A 4YONB 2IXEA 5FPSA 3M6AA 2N46A 1W0KD 1D6JA 1DO0A 1KK2A 2OE2A 2GF9A 5F9HA 2J3EA 3ZQ6A 4EFMA 4ZPXA 2FEOA 3LBHA 3RSLA 3DZDA 3FMPB 4MRVA 1L4UA 5A5GA 5JHGB 221PA 1MH1A 2CE2X 4K46A 1NY6A 4AKHA 2XNSA 1QDEA 4MRSA 2OSBA 4TMXA 1GRNA 3TW8B 1W0JA 4LYHA 4IKEA 4HLDA 3VR3A 1HQYE 1W2HA 1DAEA 3PENA 2OCYC 4FCWA 3RYTC 3GJ8A 1S3GA 1XMIA 2O0KA 2O8DB 4JLNA 1X8JA 2PZFA 1PLJA 2RGNC 1DS6A 4RFSA 2LWIA 1E0SA 1ZINA 1XBTA 3CF0A 1BYUA 2F6RA 4TL8A 2JLSA 1RRPA 1KK3A 2A7QA 3RRZA 2ASEA 2QA5A 1GM5A 1Y63A 4ASUA 1A4RA 5EE9A 3Q5DA 5BWMA 1CBUA 1Z8FA 2D2EA 2QI9C 3AKDA 3SFZA 4LCBA 2NO1A 3D31A 2CDNA 2D4HA 3T1QA 4L8GA 1W44A 3B8HA 4PQFA 1GDDA 4NTZA 2A5GA 2RMKA 4M1SA 4BZPA 1E2MA 1IXRC 2Q21A 3I5YA 4URZR 4I99A 3NXSA 3VMFA 2YWGA 1Z5ZA 2IYUA 3AVPA 1A2BA 1KO5A 1EESA 4B34A 1KO8A 1ZVQA 1Q57A 4DIDA 5FBVB 1NSTA 1P7CA 4L15A 4U5XA 5DGXA 2XSZA 4EPYA 2GCPA 4KHZA 3QBVA 1XEWY 2ZYUX 1AKEA 2ZE7A 1US8A 3KB1A 4C0HA 4PPQA 3SYLA 4AI6A 1ONBA 5EQTA 4E5UA 1DTSA 5AUQA 3CH5A 2JLUA 4FIDA 1KNQA 2JJ1A 4ZV4A 2F1RA 1E96A 3THWA 3T5GA 1T4GA 1XB2A 1BMFA 3M4YA 1AGPA 2O8BA 3FHOA 1G7RA 5DHAA 1DAMA 4IOKA 4RVCA 3EW9A 4YMUA 4OJKA 2YOFA 3RS4A 2W2TA 1P5ZB 2QGZA 5FUVA 3B13B 3LQQA 1E2GA 1QHGA 3LA6A 3SR0A 5M04A 1QVAA 4M4SA 5HZKA 1W7AA 4OK3A 2WSSA 1GL6A 3TBKA 1T3SA 1KAOA 4R2IA 4YDSA 5FI0B 2WWGA 3O47A 3Q9LA 3TR0A 2GZAA 3CKLA 1P62B 3QBTA 3CNOA 1EX6A 3CF2A 5G3ZA 2GK7A 5A4JA 2R9VA 2WTUA 2BBTA 1XRJA 3K53A 1KMHA 3DMDA 4HLQB 3MD0A 1S8FA 5CYPA 4HZIA 1GNPA 1UAAA 1UFQA 2O0HA 3QQ5A 4LOAA 4KVGA 1M1YE 1R0ZA 3R9XA 2WPDA 2PJZA 1DG3A 3C4JA 1YR8A 1MRSA 5JBQA 2IS1A 4Q1DA 4D81A 3QXSA 3K09A 4NDZA 1XFAA 4TTQA 1SXJB 2P0EA 1E3MA 2FF7A 1OKKA 4M9ZA 3SU8A 721PA 2QUZA 4GDFA 3UMSA 4KFTA 4M9QA 4XWAA 2ZRKA 4QNMA 4DLZA 1GKUB 4CDGA 2ZJOA 4QBHA 2HLDA 4Z8YA 5JZVA 3EIEA 2A30A 3CNNA 4Q1BA 4Q03A 4RD2A 1MABA 3S1AA 3W8NA 2JJ2D 2XJ4A 3PCRB 1EGAA 4RJLA 1T5LA 3FDIA 2E9SA 2H8KA 4DDTA 4PO9A 5DLQC 3GFTA 1EFTA 2Z5FA 2ZJAA 4L9SA 4CW7A 1XCGB 1G7SA 2REOA 3EZ2A 3L0IB 2R44A 3I8XA 4QJ5A 5DI9A 5G41A 1NBMA 1S1MA 3TAUA 2YZ2A 1R8SA 2C2HA 1DAGA 1IN4A 4E07A 4IVPA 2W0MA 1XMSA 2AWOA 3GCGA 4PO1A 4DDWA 1SVSA 1UBFA 1L4YA 4M9XA 5FPTA 5CYOA 5LD2C 5CJ2A 4OHZA 3CRRA 1C4OA 4UNSA 5JMTA 4JLDA 4JMPA 4URUR 1ZCAA 1OHHD 3BFKA 1GOTA 1IOZA 4D2IA 1KY2A 1XD2A 2WSMA 3X1XA 1EFRD 1U94A 4B3GA 4AC9A 5L3SB 4LGMA 2IX3A 3QOFA 2J0UB 3W5JA 1TL7C 3KQLA 4PC7A 1II8A 2BMJA 3LLMA 3H0KA 3X2SA 1PLLA 1JXMA 2H92A 2I4IA 2R6GA 3LRPA 5GJBA 2FGJA 1DPFA 4B71A 1YRBA 4ZKEA 3UK6A 3PXGA 2LKDA 3TE6A 4AKEA 4B33A 4IOJA 3EPJA 2GXAA 2O8DA 2WJHA 2F9LA 4ACBA 5L3RA 3FMOB 3QKRB 4DCUA 2ZUDA 4DVGA 3UKDA 4KFSA 3DOFA 1BO6A 3ADDA 3OESA 3KUDA 1Z28A 2ORVA 3ECCA 2VIIA 2HJVA 4LC1A 4PSAA 2CJWB 5GADl 3RVBA 1ZM3A 3CM0A 4K8OA 5FTNA 2R6FA 4HATA 2BM0A 3EG5A 3AP2A 2VYFA 4IEIA 1JPJA 1SVOA 2WWIA 4JLPA 1VG8A 4ERNA 4GBMA 2FZ4A 2BBOA 5CDFA 4KFUA 4HI0E 4LPSA 1CXZA 1QHNA 2QMEA 5EXPA 1OFUX 1CR0A 3P27A 2IBMA 2JLVA 1KO4A 2BOVA 1VHLA 4PQRA 2JLQA 4QRHA 2WJIA 2VQSA 4JL8A 1T0JB 2HF9A 3LY5A 2MMGA 2QU8A 3BOSA 2J0QA 2MSCB 4KO8A 3EA5A 2IF0A 1OIXA 1W5SA 3TK1A 1B0UA 1NN0A 2H17A 3IO5A 1CR2A 2V1UA 4HLUA 4QGGA 5KHOC 4US2R 2C96A 4WIAA 3M0EA 2ZR9A 1ESNA 1HE8B 2K5UA 3K0SA 3AUYA 4GFDA 3RS3A 2FX3A 2A5JA 2OAP1 4M21A 3ICQB 1F48A 3PEYA 1XJ0A 4WA7A 3CO5A 1QVRA 3I72A 3A1WA 2ZRLA 1U0LA 4XTCS 1YZQA 3C8UA 4NE2A 1B23P 3LBNA 3A1VA 1N2CE 2HV8A 4OHWA 3I32A 3ZIAA 1YZLA 3FFBA 2JGNA 1XPRA 4ESHA 4EIWA 1N6IA 3I4LA 4KAXA 1OPXA 4BECA 2YWEA 4ZCIA 4EJSC 4AKGA 3CR7A 1VTKA 1XMJA 3GFOA 3UG6A 1KSHA 1DOAA 2B7BA 3RNLA 3ZZUA 2IYSA 3G5UA 3GLIE 3W9YA 1G3QA 5L3QA 4NCNA 2QTVB 3QG1A 4AKIA 2MSEB 5EE3A 5DN6D 5EXXA 1GNRA 1S9DA 1KI6B 3THXB 4CEJB 1IN8A 1AQUA 5EXTA 4FW9A 4W5WA 3KFVA 3GD7A 5IF9A 3B85A 2IXGA 2OHFA 3QUSA 1IY2A 1C9KA 4YMTA 1M2OB 2MSDB 2ODWA 3C5HA 3LLUA 3MJHA 3DM5A 4WZAE 4HSEA 4FMDB 3WMEA 1ZM7A 1X86B 2DR3A 2J45A 5JSZA 3GP8A 2YYZA 1E4VA 3U3JA 4IDHA 4L5BA 1Z0DA 4MUBA 4C7OB 2EW1A 3R9WA 3A36A 3VKGA 2ERYA 1D5CA 4OI1A 1Q20A 2JLWA 3X1ZA 4R71A 3B78A 1XCMA 3V4RA 1XU4A 1WMSA 3U3OA 4QC2A 1F5NA 1JNYA 4Q21A 2FFQA 1VCOA 2SHKA 2QPTA 1VPLA 1ZUHA 2CEAA 5BYKA 2P65A 4M1KA 1QHSA 1AZSC 2F3RA 1W5TA 4XD7D 1GTVA 1BYIA 4DC9A 5FL7D 2PMKA 2CE7A 3FE2A 5KPJA 1LB1B 2CVHA 3QEJA 1YQTA 1ZNZA 2XAUA 4A2WA 1XXHE 1F2TB 1TF2A 4P4TA 2LCFA 4A0HA 2ZREA 1BOFA 3WBKA 2NTYC 4ZIRB 3FGNA 1JR3A 5DSZA 2QAGB 2ZUCA 4P32A 5TB5A 2XXAA 1MR3F 1IJFA 3OEHA 4I81A 2Z4SA 4N1AA 1YZKA 4CT4B 4V0KA 2KSQA 2HLDD 4E09A 4P4UA 3TJZA 1OYYA 1YR7A 2V4ZA 2BC9A 3JVUA 3TGPA 3IIMA 3U44B 3PIRA 3QXCA 3T15A 5JCZA 2XJ9A 4JKIA 1FUUA 2JLRA 4MYTA 1DAFA 4D80A 3CRW1 5TMPA 2H1LA 3IIJA 1EFHA 2AXPA 2QTFA 3U6BA 2WIAA 3QVVA 4MDFA 1II0A 1RKBA 2WVJA 3AVTA 2IYLD 4DJTA 4URVR 1VYVA 4GZMA 1I4LD 2OLJA 3QKRA 1HT2E 2WAXA 3KJIA 1NBMD 2ODNA 4LHZA 4I1VA 3U2QA 2GXSA 3HR8A 3NH6A 4HUQB 1G7TA 2ANCA 3A4LA 2REBA 2OM2A 1RPZA 4AG6A 2CJWA 1KNXA 2AHOA 2G88A 3VR4A 4A36A 1Q1QA 4A6XA 4NYJQ 4TZ0A 1Q22A 2WKRA 2W83A 3DKVA 5JWOA 4RZ2A 4E22A 2F3TA 2YWHA 2O8EA 3WYAA 3GLFA 1FZQA 2GETA 1AS0A 2ZRPA 3B2EA 1G8GA 4NONA 1X1SA 4ON9A 1XTIA 4TMZA 4WOPA 5JCPA 5CK4A 2IC5A 5L3VA 2DWQA 3ZZ0A 4CEHB 4FINA 1IJEA 2OAQ1 1NJFA 1U99A 4Q1EA 3CWZA 4NKRA 4NYIR 1K5GA 1KKLA 3FYHA 3R7WA 1E0KA 4Q02A 2R8RA 3JVVA 3T06B 1ZYUA 3R20A 4YXWD 4XWOA 2AD1A 5C2JB 1SGWA 1ZNWA 2FV8A 3LH5A 1NBME 2GZHA 2NO6A 3REGA 3AKCA 4CEIB 3ASYA 5AK0A 3QI2A 4GPTA 3QG5A 3FKSA 4DLTA 5EP2A 4PPGA 1W49A 5C1BA 1Z22A 3PEWA 3OIVA 2C9OA 2ZSFA 3K9NA 2FWRA 3GLHB 521PA 3PEUA 1UDXA 2J5XA 2OLKA 1KTVA 1H8HD 5C4GB 2XNDD 3X1WA 1KDOA 2WOOA 4IEEA 1G17A 1QG4A 2EFDB 3B6EA 2VP0A 4PC3A 1OXXK 1GAJA 4FMDF 1N0UA 1Z2CA 2HXSA 5FOSA 4IRUB 5LBIA 2BEJA 4MUAA 5HE9A 4HAVA 1XD9A 1D2EA 4EKDA 4CEJA 1OFHA 1KI6A 4RFSB 2L0XA 2P5SA 4X8LA 1VECA 3OFNA 5B57C 4II7A 2J9RA 4XVQA 1W47A 5FTKA 4GZLA 4CIDA 1YHNA 4UXIA 4M22A 2C5LA 3DPUA 5IHPA 4MGYR 1VG9B 4F91B 4XVRA 5TY0A 3OEEA 4DKXA 1Z0IA 4LJ8A 1XTSA 2HCJB 3AF4A 5AR1A 4C7OA 2V55B 3IKJA 1E9DA 5FOWA 3AV0B 1T8TA 2VHUA 5CDFE 2G9NA 3TKLA 4R2HA 3ZH9B 1E2QA 2W6JA 2WWXA 2IW3A 3B1XA 1KOFA 4EPTA 3B9PA 3PJRA 3NVAA 2CNWA 1CU1A 4UJ3A 8OHMA 4KU4A 3AEZA 4MRNA 1X1RA 4Q1AA 5J40A 1NMXA 2G1JA 1DO2A 2WJYA 4M1MA 2DFKB 1DAHA 3SNHA 1KDRA 1LTQA 5GJCA 3PUXA 4NMMA 5LB4A 1US8B 2PLFA 1AGRA 1G3UA 1EXMA 2AK2A 3H4MA 4TLDA 1A5TA 2WWFA 4TMKA 5D3QA 1N6OA 4PAOA 4C0LA 1SXJD 1U8AA 3AGQA 3THWB 5ELXA 2O8BB 1UDWA 5KO2A 2FPMA 4Z54A 1G5TA 3IQWA 2Q3HA 4TYPA 2DBYA 3BBPA 1J90A 1X6VA 3T1OA 1XF9A 1D8TA 1F60A 2GJKA 2PCLA 5HE8A 1J7KA 2IS4A 1CJKC 3QVUA 2IA5A 3THOA 3PUYA 1RYFA 1CS4C 1E2IA 1VMAA 2ZRIA 3AKYA 2QAJA 3RWOA 3WP0A 3C14C 1UKVY 3NC0C 5CM9C 1PJRA 4DLWA 3LXXA 2E87A 3HU3A 2XB2A 1KDTA 1KMHB 1QHIA 4UNNA 1Q44A 2XB4A 2XOKA 1JB1A 5IK2D 1M7BA 1MKYA 2ORIA 5CIWA 2ZETA 2KE5A 5AJZA 1TF7A 5J4LA 4XIGS 1J70A 1IAQA 5G3YA 3BH6A 1S0UA 2REXB 4HUQA 4TSFA 2V54A 2ZE5A 4KLNA 3KTAA 4AY2A 2ANBA 3MUFA 4Q48A 1JXOA 1N5KA 3EWSA 3Q72A 3A8TA 4GP6A 4Q66C 4QGFA 5DH9A 4B2IA 2CK3A 3O8BA 4X8HA 1AS2A 1U2RA 4PC2A 4Q9HA 3AVVA 5G53C 2FOLA 3A4MA 4KCGA 1IXZA 3VU9B 3AQ4A 4HB2A 3TLXA 1NVVQ 1KAGA 2JA1A 3S1AB 1E1RA 1QZXA 2QN6A 4HAWA 4RD3A 4AYWA 3A6PC 2KBFA 3PEVA 4DXAA 3PV0A 1VG1A 3VNUA 1SVLA 1SXJC 2O52A 5HKKA 2W6ID 2C98A 2DYKA 5CITA 3CB4A 3BERA 1OH7A 3BC1A 4A0RA 2F9MA 4A2QA 3W3AA 2HYIC 1G8FA 2ZI9A 4AK9A 4AURA 1S2MA 3TIFA 3FOZA 1WXQA 1Z6AA 1P2VA 3K0AA 1U8YA 5EP4A 1QRAA 3CONA 3TRFA 1GZSA 3PUVA 3GLHA 1HTWA 5JHHB 1P60A 1A1VA 4GOJA 4MYUA 4BFTA 4DLUA 1L2TA 1UEJA 5AUOB 4ZCMA 621PA 1XD2B 2X1VA 3SC3A 5KTYA 1TEVA 4JKYA 4TL6A 1XEWX 5F9FA 2B7CA 2BMEA 4YDHB 4AD8A 1RRFA 1OH6A 4DSUA 4HEJA 3BB1A 1CR1A 1OLOA 1II8B 2IYTA 4RFVA 1WP9A 4Q1FA 3EXAA 2ONKA 3BAFA 1P3JA 4BFWA 2YOGA 2GA8A 4Q9IA 4FMCB 4LBVA 3IO3A 1GFIA 2J46A 4PTLA 5HPYB 1QBKC 1SVKA 2EFGA 4KFRA 2ZYWX 2QMUA 5F3WB 1MOZA 3QE0A 1N5IA 2ECKA 1OXUA 2OXRA 1R7RA 3CH4B 2G3YA 2WJJA 1N3BA 4BEBA 5E7IA 3CWQA 2JATA 1RFLA 4I1UA 4MRRA 1W36B 2GBLA 3RRYA 3KQNA 1RJ9B 4R98A 4I1SA 4MKHA 3W34A 2IEYA 3IIKA 2E1RA 2V9PA 4TYWA 1N5JA 3QXJA 4Q9KA 2IXFA 3SBEA 5KSOA 2VSFA 3CW2A 2FU5C 5FBQB 3F5FA 4IJMA 4YQFA 1SQ5A 4G01B 1TU3A 2OFXA 2QENA 4GNKA 2YKGA 1TQ4A 3UIEA 5TDHA 2AD5A 3LW8A 4PHTA 4DCTA 2GEVA 1I4DD 3Q8XB 1VYTA 4HUTA 4ZDJA 5DHFA 4NH0A 1UADA 3IQXA 4GI7A 3VKWA 4C0SA 4G0NA 3KKOA 2XTNA 2AL7A 1Z6GA
chains in the Genus database with same CATH superfamily
3R5HA 4B7AA 5IJZA 2WNHA 2OXTA 4BLVA 4F2DA 3EH2A 4RV4A 2IU6A 2ZVDA 1Q77A 3ZU4A 1I5RA 1I6KA 1XRLA 4WE3A 1JG6A 2Z09A 5DCLA 4O4HB 3FIJA 4P4GA 1N0VC 4O2AA 5EKDA 4R40A 1QRRA 1U4NA 2BEUA 2Q0QA 3HKDA 4DR1B 4RS4A 1WWKA 1WCYA 3VR6D 1QKKA 3G8AA 3ZWXA 4YIHA 3JS5A 1FRFS 3C4QA 3UMMA 1WD5A 2I65A 4YRTA 2I29A 1Z08A 2BZGA 1VPTA 2YDXA 4UKDA 7REQA 1OH5A 2BHSA 3QEOA 5T8KC 4D7AA 1GTL1 3W79A 4Z0TA 2BFWA 2NTJA 1JEYB 1UMBB 4INPA 2RHMA 3PR2B 4GVLA 3H8VA 4XKJA 5EE1A 5FP0A 1FJGB 5LB2A 1BKYA 3F6SA 5CT9A 2BT4A 4Q7JB 4YAOA 2Q8QA 1LX7A 1WZ2A 4AYTA 1MN6A 4EMUA 1F8XA 3BL8A 3PWSA 4NCXA 4QXAA 1ADJA 1NYQA 5GONF 4YRJA 3JD1A 4G1UC 4MVJA 3SBDA 3UJ6A 3VX4A 3C24A 1KRXA 2I4TA 1IBRA 1L0BA 1JRLA 5DHSA 5L3QB 1X42A 2JLZA 3U31A 4OK6A 1CE8A 3ZHSA 1MG5A 3R7SA 3BGVA 3O2QB 2OM6A 4DV0B 3ESDA 2IVFA 3M9XA 1S89A 3KR9A 3LDGA 4E7PA 1ADCA 1SOWA 1QTNA 2Z83A 1ID1A 2E4AA 1AGNA 2XT6A 4R1NA 2J09A 3UWMA 1V7CA 4IHJF 5JEEA 1U9JA 5BN3B 1U81A 3MA0A 5JO9A 2P5TB 4FHGA 3SHOA 4DR3B 4JJ7A 2D3WA 2ICAA 5TGDA 3VH4A 2NM0A 5CIYA 1SH7A 1NNLA 1XDDA 4MNTA 3TI9A 1Z06A 5EQFA 1TAQA 4NRDA 1XHEA 1XU9A 1JHPA 2HI0A 2VK4A 5JSZB 5LKAA 4ESVA 1FFWA 2I6TA 2CJXA 2A1UB 2WR8A 3SSOA 4BP9A 5BN4A 2BIFA 3KZOA 3UOWA 3VU9A 4D3ZA 5IXSA 2GRJA 1AUVA 1DBSA 5BV8A 2Q9AA 3DMYA 1BKSB 1A2QA 5DT2A 1R10A 3KXIA 1F7VA 5H9WA 1NNEA 3OHMA 2IUUA 4DR2B 5AICA 3W5IA 4XX1A 4MW0A 2FLVA 3F4KA 4WQMA 2X3UA 2ORED 4J0CA 2H11A 1RM4A 5EHQA 5CYFA 2YQ4A 2XVYA 4IEFB 2VRBA 5K6AC 1O94C 1R0RE 3P71T 2UZIR 3OE7A 4UFNA 4AT1A 1PEDA 2IELA 3K3PA 4I9GA 3AL2A 5G0SA 4W9MC 2WAAA 4DYDA 1CR4A 4J7UA 4MULA 1IHYA 2C9CA 3G2JA 4YT4A 3TOZA 1YL6A 4DN6A 3SZOA 2ZS8A 2WAYA 1Q7GA 5J1SB 2Z2YA 3GWGA 4BNIA 2FGKA 2ZRFA 1X2BA 3JY6A 3RHZA 1XZMA 2O06A 1IQUA 1E98A 1U3DA 3AG5A 4M53A 1VHWA 2ZUTA 1DOZA 1F1JA 3CJQA 1REQA 3I8SA 4XW2A 2NU9B 3LGSA 4KX3A 5LOVB 1JDSA 1QGUA 4FMPA 4QAQA 3ZU3A 3TD6A 1VGQA 3GPLA 4AY5A 5IM4F 2FOIA 5AI8A 1NAIA 4O33A 3TSOA 2CLSA 4E88A 1G59A 1PS9A 4GYYA 3K9CA 2OFPA 3DPSA 4PNZA 4WY2A 3VR5A 1EQAA 2PUHA 3PPXA 4ODIA 3TKAA 2QAGC 3RSQA 5KSYA 3HXLA 2AN3A 4N03A 1O87A 4QFMA 1Z29A 4QXPA 5CNMA 2QYOA 1OWPA 2XZPA 2JDID 5DPMA 3EQ6A 3JQFA 6PFKA 4HZGA 5DIFA 1Z18A 5HIAA 3IUBA 4RA9B 4ZMBA 2VJMA 2EKPA 1N92A 2Y05A 4RL4A 5D00A 1GNTA 2QZSA 5EXDA 3RT9A 1JXAA 2IHVA 4LX8A 3BTVA 4NHEA 2N1BA 1BD4A 1ULSA 2B9EA 2E55A 4G5RA 3ZY3A 2VTBB 1M10A 1EP1B 3B3QA 3QE9Y 4HNSA 1VG0B 1VP9A 1NVFA 1W34A 2BMDA 3CRZA 3N2KB 2JF0A 1RHQA 1NHWA 3A1CA 3KB8A 3F1LA 2I33A 4HAOA 3DFMA 1BA3A 1H2BA 5A0VA 1CY7A 2I6GA 3OJFA 4A8JC 4F5WA 3PZRA 4ZDKA 1WX1A 4G37A 4DLSA 1M8JA 4JEMA 2BFAA 3JWGA 4B43A 4IDDA 5MFZA 3L0SA 4J9UE 4L3VA 2BGRA 4OHCA 2WQ6A 2XB2A 4G0ZA 1L5GB 1CY6A 4FC7A 5EJ9A 1LBSA 3ECSA 1KU0A 2ACWA 2JL1A 3HU2A 3TR5A 4BWYA 3L4JA 1BE8A 1NM5A 1U11A 2GILA 2KX7A 2OV2A 1Q15A 2W48A 3R7WB 2VYND 4NCJA 2QYSA 1KH2A 1TPZA 3U5ZB 5CNKA 3ZWNA 1I2BA 1M6VB 2M1XA 2P2NA 4ZU6X 4FFBB 4P9NA 4BX9A 4RVFA 5GM2A 1LJ8A 3P9SA 1JFRA 2YRFA 4HNRA 1VKRA 4TTRA 5KQRA 1ZI8A 4LIPD 2DBZA 3CLVA 3U56A 4K9SA 4OPMA 1PZGA 2ZI3A 2JI8A 2JHPA 3LVQE 4YRDA 2RSLA 3NOVA 4CDRA 2EW2A 4DCJA 5A02A 3BE5A 3B6KA 3EXIA 3LLSA 4E46A 1EE9A 3FM9A 2PD3A 1BS1A 1D1QA 2FW8A 3TZBA 4LQ4A 3VR2A 4ZYLA 2OXEA 5BPFA 4MV4A 2IYZA 4ABTA 3HHPA 1W2WB 2A5LA 4HAXA 2RJ3A 4X97A 1PNRA 2ON6A 3I83A 3WLKX 3ZWMA 2X15A 2X5JO 4RF2A 1ZU5A 2Q3LA 4P2GA 1UBGA 2G1KA 1C0EA 3IXQA 1VE1A 2MOKA 3HBMA 3NBQA 3PNQA 1UKYA 4FSDA 1SXGA 3V8VA 4OL9A 1MRZA 4B6FA 1ISSA 4WKCA 4R68A 4JLVA 2VP9A 4MW4A 2ZVQX 3DE2X 1LV7A 1R3UA 2GQ0A 2QUBA 4PS0A 4ZGGA 1AC5A 4DANA 2OK7A 2W00A 3WLLA 4C7MA 2ZYTX 3K70B 1Z8DA 1RYZA 1E8NA 4V0NA 3V00A 5COAA 1LKZA 2JVKA 2NZ8A 3C8DA 2AG5A 2FAXA 2LPMA 2O0JA 3D3NA 4RD4A 3WYFA 1K8QA 3PUJA 1SD2A 2GK6A 2OBMA 2QZ4A 1V7QA 5IH3A 3AVWA 3HSKA 3ELYA 1T5SA 5K8JB 2PWYA 3DZFA 3W6ZA 1P75A 2WPNA 3ZVKA 3KKQA 4JLBA 3KJEA 4Q0MA 2KJQA 4MKFA 3T5CA 2DPGA 2H9YA 3PRYA 3TWOA 1L7PA 1HMYA 2UVQA 2Y9MB 3ETGA 3F7NA 2JJ1D 2QV7A 2VZ9A 5BSHA 5TLSA 3NNSA 4YALA 2WM2A 2RGCA 1THZA 1KQNA 5BN3A 3S1LA 1IUPA 4MQ5A 2PFKA 3FPLA 4RMNA 3P19A 3OAAA 3EDMA 3VTKA 1OI3A 1SHZA 3BF7A 3IOCA 5CHEA 1UEIA 1BQ4A 1NRXA 3T5MA 3VPAA 2YYAA 2R11A 1K6EA 4NBRA 2K2WA 2ZKLA 4URWR 1DHTA 1U5AA 3HP4A 2IHYA 3PNLA 3SC2B 3KOOA 1QAOA 2ZE6A 1A9XB 1XTPA 2X5KO 5EUQB 3L06A 3NBYC 5T4FA 2WSSD 3HV0A 2Q4TA 5IAJA 3H9BA 4R0NA 1M5UA 4D0GA 1JAIA 4IM7A 3IR7A 4IOMA 3OTIA 1KYQA 4TWBA 1WULS 2XH8A 3EEYA 5ALGA 1SUEA 1HZZC 1T15A 1UK8A 3EY4A 3LNCA 3ZV4A 2PE5A 3UGQA 4YUVA 1E0JA 3BEOA 3E5NA 2BM8A 3EMDA 4PSKA 4Q3CA 1KH1A 2BBWA 4TX1A 1HM5A 1ZWKA 3I53A 3L0OA 4UVEA 4M1TA 421PA 2ZSUA 3MJSA 4PPYA 2Z9BA 2V58A 3C3KA 3EG9B 4MGZR 4O4JA 5KSPA 4DCSA 3CCFA 3CS3A 2ZVJA 4XQCA 1E5DA 3L02A 4OXRA 5EMLA 3K71B 3VA7A 2YWBA 5J5CA 4CM8B 4YREA 4HH3C 4HADA 1LDYA 1LRKA 1Z6XA 3UM9A 2IXTA 1YVUA 5BNTA 3GQBA 3LK7A 3AM5A 1XZAA 4DRYA 3AFNA 3QE3A 4TYQA 3NNNA 5GJWC 4DLBA 4QUIA 4L08A 3UWDA 1HLPA 4ZAFA 3CH7A 3WFIA 5AW0A 4RSHA 1DLIA 1U5CA 4FVTA 4JELA 3BE4A 4TLBA 2O2HA 4ZVMA 1OIWA 3IX7A 3SHFA 1X77A 2LD4A 3RAEC 2NU8B 2CBGA 2CGEA 5HCUA 4J43A 4D4LA 2HSWA 2AI1A 5JRZA 5KYYB 4RY2A 3QU2A 4IDOA 1FP6A 4HMPA 4BRWA 2HU2A 2ZITA 3FDFA 3ZGZA 4UMFA 2V5AA 1BKDR 2VLIA 2E7ZA 4GZ5A 1GQYA 1H85A 2YIVX 3NUGA 4KDEA 2IH5A 1MB2A 2V9ZA 3ZHCA 1SKQA 2P6RA 4QDOA 1LPMA 1H0KA 3A3KA 3S2SA 1D2NA 3GBSA 3DAPA 3LBIA 4ZODA 1PYOA 3E82A 4I9NA 4LV6A 5B37A 4JASB 4KUEA 2VTBA 2QTHA 1FFAA 4E70A 3UANA 1U7ZA 1GGJA 3D81A 3O8QB 1LBHA 1KZ7B 1MAAA 1QFYA 1P61B 1JEAA 4YJFA 4YP9A 3B1VA 3OIFA 3H9JA 5JNUA 2H5EA 5AKZA 2XDWA 3R0QA 1G21B 3SJZA 1B14A 4IWYA 4MKXA 5L6MB 1TJ4A 4XIFA 2CN1A 1AU9A 1ZG3A 2P9QA 1KZ6A 3RS2A 1M8PA 4PXAA 2DSNA 3DKRA 5JALA 1UZMA 3NYIA 4YGXB 4YO8A 4GVXA 3BGSA 1I4WA 1GQSA 3PVCA 4XQ0A 1X92A 5KQLA 1G66A 1J99A 2A5YB 4UD2A 2I1LA 4GQBA 2IPNA 2FEAA 3M70A 3ZHXA 3LXRA 1F6DA 5T7BA 4EFNA 1L9KA 1CZKA 1ML4A 2WAOA 4FFBA 1YKSA 2XZTA 3J7AC 4DBVO 3Q0EA 4FZRA 4U5QA 1UP6A 1WVIA 3QX3A 3ZNPA 4MYHA 2JKVA 4OHXA 5IRCD 1KIAA 3T7IA 3M5DA 4H2DA 1H6CA 3E4CA 4P3YA 4OYLA 1RLJA 4RNDB 5E7QA 3U26A 3K5IA 1W88B 3L1JA 4YP7A 3ESQA 1QH1B 3GT7A 4HNHA 3TX2A 4XX0A 2V0GA 1EWRA 1O58A 4L78A 2FNAA 2XTJA 4RAQA 5JS1A 1N3YA 3DL7A 4DKJA 1E0AA 2QM7A 1H2WA 1KJYA 4UCFA 4YI3A 3NIGB 3PVSA 5FOTA 1WMBA 5AM5A 2IWHA 1XWWA 5K3SA 4ND5A 4Z2AA 3NU1A 1BDIA 5JAZA 4W5RA 1O4VA 1YNOA 1UJ2A 3MJEA 4QU5A 3GJ3A 4GBGA 1E2JA 2NUPA 5D3MB 4KQFA 2HIAA 2WRZA 3C1AA 4FGLA 5CBPA 1JWAB 2PUJA 3CZRA 3HL0A 2WY2D 1A5ZA 3ZCUA 4MH0R 4CKXA 3EZ9A 1JFSA 1SUWA 3D3JA 3KPVA 1WF3A 2GA9A 2CHUA 1F17A 3FDJA 5KNLA 2QQ5A 5TPZD 1W25A 1OZ0A 3V8MA 3IUYA 1ADBA 3NVKI 3SK0A 3BTSA 4UHKA 1CF4A 2OP1A 3FWNA 1EUCB 3VVLA 2FP4B 4Q05A 4EI7A 5IDVA 1M2HA 4RETA 1G3RA 2W2VA 4E6PA 1H69A 2RB5A 2X5XA 4MHSA 4XGKA 3O3MB 3JWPA 2W2NA 2VSXA 2SECE 3PQ4A 4ZVTA 3WRVA 2OECA 4H7IA 3OM9A 1SBZA 4GRAA 3W4IA 2XA2A 3NG1A 5KNBA 3TUZC 3MAJA 1L5YA 1CUYA 4IOLA 2WJZB 4NCIA 4WFJA 2OFOA 2QK4A 5B3JA 1RJDA 1H05A 4MVJP 4EP1A 5L4SA 4CLRA 3OF3A 3BJRA 1A9XA 4J1QA 4DMLA 2VJDA 2XTAA 4BN5A 4ZDIA 2G1AA 5K0LA 4ZT3A 5I3ZA 1SEPA 3AETB 5FUWA 4EQZA 3WTBA 2NNLD 1GYRA 4KFCA 2M6KA 2J48A 3JRWA 3R3SA 4BB0A 4LBYA 4Q4AB 1OCEA 3CKKA 4PRYA 5K8LA 5CB4F 4C30A 1GR0A 2XIQA 3OX1A 3H5AA 3IUQA 2EF1A 2ROQA 3OU6A 3GUZA 3C70A 2VWHA 4LMPA 2JA2A 3P0HA 5DE3A 4DWJA 1DAIA 3RVSA 3AP1A 1KC1A 2RI1A 2X8WA 2J3DA 3R7NA 3TVTA 2PQMA 3EG9A 5AXDA 2GARA 1KK1A 2VUHB 3KKNA 3DR3A 2PCJA 1KZGB 3OZXA 3L7OA 4YCBA 1MENA 1KEPA 1Z07A 1N2OA 2QP3A 3Q1LA 1BWRA 2O2JA 5AHWA 5IAEA 4YJGA 1JECA 4DA9A 2GPJA 2O5VA 4TL9A 4QU9A 4CM8A 4DMRA 2IFTA 2FWNA 1ZK1A 1KGDA 3NIWA 4JOSA 1JIKA 1QTRA 3ZDYB 1Q1BA 4NFSA 1D2RA 1QB8A 4IZHA 1E69A 1KDPA 2NOAA 1VHTA 3R0ZA 5JWHA 4UW9A 1CQJA 5EJ7A 1MB9A 4ZHQF 1NZJA 4G89A 5LR6A 3WMXA 4IKOA 3SOZA 2IGTA 3JXEA 3A2LA 4P4SB 1MIHA 1ZGHA 1UBEA 4IIJF 4BP8A 4D4GA 5JJBA 3ROQA 4L95C 5KYYA 1Y1LA 3K1AB 3O90A 5CDYA 3CHYA 3SX4A 4B79A 3NDBB 4XSHA 1RRGA 2RHRA 3QFTA 4ERXA 1DTEA 1E3SA 1X8LA 1MT0A 2ZZKA 4EUFA 3FY4A 2TMKA 1NVKA 3DXFA 1TU0A 1ZMOA 3TCXB 4QOJA 4FCTA 1ETHA 3DOUA 2R8BA 1QE5A 2C9ZA 2QMHA 3KQUA 3WRWA 3SNKA 2GWRA 4GOXA 4PG7A 3PT5A 2YHIB 3VNAA 4R01A 3V9PA 4I46A 2ST1A 3M6WA 2JIRA 2I6QA 3TW4A 4ZICA 1IUNA 3ANYB 5HF5A 5JANA 5FPQA 3DL2A 2VTEA 4UFOA 4H6PA 3TIXB 4CM3A 1J39A 5JDIA 2BKVA 1QH8B 4TM7A 1R4ZA 3U4QB 4DJAA 4DRXB 3HWX1 4GVPA 5FWDA 4ALJA 5KYWB 1Y3HA 1B3RA 3PPIA 1RYHA 2J30A 3IBTA 4I2NA 4LJYA 4G36A 4D3YA 1EFPB 3GP5A 3NV7A 4GOLD 1QO0D 1MDFA 4JOQA 2C4HA 3FBGA 1J8DA 4BLQA 4O25A 4NR0A 1ZC4A 4IICA 2R8PA 4OFWA 2WFLA 3LDAA 3H2KA 3DFZA 4BQQA 5A9SB 1Z7WA 2WQ7A 5JJ5A 1B0AA 2CL0X 4JC5A 4JENA 4RWEA 1YGPA 3GLKA 2ZOSA 3DDSA 4RQTA 4WK0B 4Z7NB 3JZIA 3RAJA 2B4RO 4P7BA 4F5YA 1YU9A 3TOVA 3VSAA 1Z39A 2C7QA 1K2WA 3DTYA 4R9UC 3AM1A 3HA2A 4I5FA 2V4UA 2WFMA 3TX6A 2GN2A 1NW9B 4B3CA 3ZPXA 1QH1A 4YCAA 1OGJA 1SVUA 5CDGA 4TUYB 4A5OA 5JFGA 1HT1E 1P5RA 1YZFA 1KRWA 5JZSA 1YJAA 2VI5A 5JAQA 2HNBA 3S7TA 2PXCA 3JSAA 2HU8A 2GD6A 1JJBA 5JECA 1M6HA 3OLZA 5D3MA 4HB4A 2WWYA 1MB0A 3RIEA 3OECA 1F2UB 1RJFA 2P9TA 1S2OA 1TUBB 2C5BA 3FHLA 2ZTLA 3M4NA 3PNPA 4KGVA 2NYVA 3AB8A 3GHYA 3P4YA 1IY0A 2Z43A 1B74A 4BZXA 1CPYA 2R5NA 2WUVA 2Z04A 3LKDA 3WYDA 3L1HA 3LO5A 1GU1A 4QEKA 3W3ZB 2BMFA 3Q85A 2JIPA 3L8EA 4ITRC 4V2IA 1WBDA 5L6LB 2WLSA 3ZQJA 5JSQA 1T1JA 3MCVA 2HQOA 1FTNA 1K89A 1RE0A 4L0QA 2DHDA 5CB8A 3T61A 1EQUA 3V3KA 2FR0A 3DHWC 3FKSD 3EVDA 4X7RA 5ALTA 4DJEC 9ATCA 1DOHA 3DZBA 4JQYA 1DELA 1N6RA 5ALNA 5C46F 5KCZA 2BP7B 4FEAA 1I6MA 2IITA 3L7KA 4A1FA 1RRCA 4BQSA 4IIDA 1G7CA 1O5TA 1LPBB 1TYBE 3GCDA 1G3IA 3ZIDA 2YUTA 4AJOA 5G0UA 2NN3C 1Z36A 1RTKA 1U3UA 4BQIA 3T3PB 2DEUA 1TYCA 3AF2A 3EQ7A 3RG2A 1PD0A 3ZHTA 3WLNA 5CJJA 1GUAA 2C94A 4ITUA 1EHYA 2YY7A 3FLEA 5CW1A 3RS5A 4INOA 1PEYA 3CLSD 4U6SA 2DKOA 1QB7A 2PLRA 4LJ6A 1XU7A 2H1VA 2P9GA 2ZI4A 3NR2A 4FXOA 5HDBB 5KB3A 3DAOA 4Q4AA 1AN0A 1NC1A 2B8EA 3GLSA 2JW5A 2J3QA 3TH5A 1WOYA 5J63A 2B94A 1L9XA 3M4ZA 4XWYA 1XQ6A 3OX3A 2FQ1A 1F8GA 2GJSA 1DNPA 3KVRA 4EX6A 2C42A 1ILWA 1YZ3A 4IH4A 4JLKA 4WZAA 2XMQA 4KLCA 4F3RA 3CMCO 4Z4QA 5D01A 3OQIA 1Q0UA 2V7GA 3FN4A 1U0JA 5HS6A 4K6KA 3MTBA 3OFND 3QUTA 4TVOA 2ABWA 2F1KA 4AS2A 2JI6A 2H29A 1C7RA 1LS6A 1V16B 1KBQA 4R5HA 2Z98A 3VPCA 3NORA 2ERXA 2PL3A 3A9CA 3PFKA 4TWIA 3OTHA 2PUFA 1JBQA 2NVUB 4D8YA 3WSVA 4B46A 3VHXB 1O77A 5A04A 4Q7EA 3BB3A 3PHIA 3ZHZA 5GZ6A 3V6LA 1K6XA 1LRJA 1J0XO 4D8TA 1RZRA 4L4YA 3PD7A 1FFCA 4TS4A 2I3ZA 2O6LA 4BZWA 1E1CB 4WECA 2CNWD 2W6QA 1GR1A 1KFEB 5DN6A 4YP1A 1OREA 5C1IA 121PA 3WNBA 2G4CA 2FQWA 3R8FA 4W4TA 1XJQA 1DX9A 2HUPA 1NR1A 4U6NA 3NHLA 2ATVA 1GT91 4ESOA 3CUEF 3JQCA 4K81B 4YBZA 1CT9A 1UF9A 3DJYA 2Q5QA 1G2PA 3QBEA 2Q28A 4JBHA 4FT4A 3BRWD 3G6WA 1PHRA 3JQAB 3BE8A 3ZHBA 4Q37A 5TSDA 1V8OA 2YN2A 1P3Y1 2UXDB 5BSWA 2G06A 4G24A 3S2YA 4BGVA 5DBOA 1FX0B 4MLPA 1WMEA 2V6BA 3RQIA 1U80A 4OOEA 5C8YA 3ZHOA 4PRZA 3OCZA 1XNJA 4JDPA 3AY0A 1BU8A 4KGDA 5DSTA 2FPIA 3K96A 4EY3A 5U4XA 2Q45A 3B38A 1G291 1NQ5A 2ZSBA 3CLSC 3ZWQA 1TCUA 1FLAA 2A94A 2OCBA 2PMCA 2QM0A 3LBAA 3NTQA 4B32A 3KXDA 3SJAA 2I7CA 1NVUQ 1FPMA 4DSTA 4DRXA 4XR9A 2AE2A 2NT3A 1LPSA 1U2TA 5JPIA 3U7HB 5FFFA 4M1EA 2FUCA 4B31A 4XD7A 1N6HA 3ZBPA 2B3TA 4UTNA 4FN5A 3L1UA 2R4QA 3FB1A 5FL7A 1OYWA 1ABBA 2WZBA 5DYGA 1K7SN 3JD3A 4OL0A 1T91A 5BT9A 2D7CA 4YNBA 1HTBA 5E3JA 4OVKA 3ILSA 5WRFA 1UFVA 4XWKA 5H4GA 5A9SA 3GCWA 3FAZA 1E4EB 1CULC 3NDRA 4PPNA 1YFKA 2XOKD 4G1CA 1YL5A 4IXNA 5DLDA 1TIBA 2ZJBA 1RHMA 3NHBA 1I7PA 4JLMA 3H99A 1BWSA 2AOTB 2IDKA 4M0CA 4N3GA 4XM0A 4GP9A 4TS9A 4JB0A 4B17A 2DRIA 1G5FA 3IP7A 3VPSA 3CN7A 4HQLA 3F9IA 2E1PA 1VC2A 3QEMA 4L5CA 5HUQA 5FWNA 3G0GA 3HG7A 4TUYA 3CQ9A 5I45A 2ZBEA 1A1VA 1ZC3A 4V39A 1JSZA 4TZTA 2QUJA 2ZUVA 1AZTA 1GPH1 4HX9A 4YMGA 1PZMA 2WV9A 3R3VA 4RH3A 1Y7PA 3X44A 2WT8A 4JYAB 2QKYA 3MT9A 1MDBA 2JEOA 5EJEA 3ADPA 4HAUA 2G1UA 1HKHA 5AM4A 2IE8A 2C95A 2CNDA 5FPKA 1XJ5A 2Q4RA 1F2UA 2IXBA 2Q5JA 1UKBA 4IO0A 2QUAA 3EIOA 2XWSA 2JHFA 4JAVC 1XJCA 1YACA 2OGUA 4WW0A 4E1BA 4PAGA 3KB6A 4RV5A 1POWA 4UPEA 3Q8MA 2HCBA 3GGPA 4Q19A 1C30A 1ZD9A 2B2CA 1MMFB 3PTAA 1GLGA 1C8BA 1S4QA 2X77A 4YGYA 4JI3B 4M86A 2H2HA 1L1FA 2QRVB 1K5DA 3D43A 4U00A 5CA1B 3OEYA 3QVOA 4XRRA 4CHTA 4Y6OA 1X8KA 1I3OA 3FPEA 5BRJA 1LX6A 5KHLB 2QJWA 3A70A 5K0FA 1TQ2A 2PKEA 3FNRA 1ZU4A 3WR5A 2YVUA 1WEKA 3D4LA 4CGZA 1KAHA 1YB2A 3AVUA 1DEXA 2B1GA 2TMGA 3W4JA 2XGJA 3IC5A 1N2IA 3UFXA 5EGNA 3NRCA 2VF2A 3M3DA 4QG3A 2FQXA 1K68A 2FFJA 3PQEA 3QLTA 5IT4A 1E4YA 1QQ7A 2OL4A 1JG2A 1GY8A 1IQ0A 1Q7TA 2Y4OA 2VJOA 2ZIEA 4KQHA 5AMXA 1Y4ZA 5ANRB 4LBZA 4QPJC 1MFZA 4CQLB 1E6EA 2GNPA 1BVHA 1IY8A 1T4BA 3OH8A 4F97A 4R2LA 2XTMA 1KMIY 3EXFB 1W2GA 1QS0A 3CG0A 2H63A 4MLCA 4N76A 1JDJA 4KV9A 2I8AA 1CSEE 1N8TA 4N0QA 4WH0A 1L5FA 1D1SA 1E9RA 1WKCA 1YHZA 1NVDA 1TVCA 5A0FA 3B82A 3BKXA 3HKBB 1W5FA 1KF0A 4L75A 1RMQA 1BSVA 4BNXA 1U0HC 4E3ZA 1I2CA 4INZA 4PICA 3R44A 1BEUB 2AG6A 2VPIA 4M98A 4XFJA 4U4AA 3ZD6A 3R4VA 3FF1A 1V11A 3KOYA 4QLBA 3AZQA 4FBGA 4KQMA 3EJWA 2QVBA 1WR8A 3K0EA 4RQAA 5F51A 4XSGA 1X7HA 3HGMA 2QQEA 1V16A 1VDMA 5LU9A 1A95A 3A3YA 2HB6A 5DMHA 2NAPA 2Q27A 3BK1A 1NBAA 4Q3AA 5CUQA 3WNVA 3ZE6A 1F7UA 4NATA 3VHXA 4OY3A 5CAEB 2FPWA 2ALJA 3OJCA 3N2EA 1P9OA 4H1UA 4V1CI 4DY6A 5CCBA 4YLYA 1XEXB 2YS7A 1MHTA 1HOXA 3M83A 5ITWA 3D8NA 1GIAA 5HIIA 4WBNB 1U2GC 4J75A 2YY6A 4UARA 1SQFA 5G1PA 3V7UA 4JUFA 5EJMA 3QF4B 4GNRA 5H3CA 3ZWDA 1NIJA 3OOYA 3KUCA 3G0CA 3QVGB 1Y4DE 4K28A 1XTQA 3A6DA 3CC8A 3OFSA 2QMYA 1HTTA 1BHO1 1HG0A 2AX4A 2OV4A 1ODSA 1IBLB 4FLMA 4J6EA 3ZDQA 1E32A 4JFAA 4IDPA 3LYUA 1R4AA 1QFMA 3STXA 3ER8A 3BJIC 4K9RA 1FX0A 1U2DA 4IG4A 4ALNA 1OXBB 1SC3A 3QZUA 4GGOA 4OQZA 4CMAA 1HI9A 2PUWA 2QDXA 2RAFA 3VVBA 4B7UA 4DNPA 5JQGF 3BIJA 1YC2A 4U9IS 4UNQA 1GRVA 4BUJA 2CHQA 4RESA 3FPBA 1WBBA 3KLBA 5JU6A 4OFZA 3U7GA 2EHDA 1U9IC 1AA9A 5FBRB 1ZVKA 1Y1RA 1XYGA 1E18A 4P84A 4QXQA 1SU8A 2IHZA 3FDZA 3ZHQA 1MFPA 1GDTA 1UAYA 3I01A 3LWZA 1TDJA 3N1UA 3DDNA 2CXSA 3HN6A 3P0JA 3OX2A 3WDSA 3WRXC 1AZLA 1FYDA 5COBA 1JEEA 1IEXA 1RVDA 3PRHA 4LJ5A 4JYPA 2OXFA 5F2NA 1CEQA 2FUG1 3AOEA 3LQYA 3WL8A 3L43A 4K2HA 4RA6A 4G0QA 3D3KA 3LCUA 5LP6B 1B8UA 1JEOA 3KPUA 3E2MA 4RF3A 2HF8A 3NFYA 1FNSA 4CLEA 3HVJA 1BMQA 3C16C 5I9TA 2BW0A 4H59A 2GBLC 1E4EA 1TCAA 2I3GA 4FQ8A 4MVJD 4BNTA 5D87A 2EFYA 3KHTA 1AGYA 1YF3A 3QKUA 2JFNA 5CXXA 1U2ZA 1XFDA 4FNMA 4PRLA 1JIQA 3ECAA 2HO5A 4JMLA 3SAJA 4EFDA 3A0UA 3S99A 4YJ2B 4P8RA 4LVOA 1EXWA 2X2FA 1CX9B 3GT3A 3IT0A 1VMIA 3HWSA 1TT7A 4UNRA 4TQGA 2H00A 3IJRA 4UU8A 4G63A 3KALA 3HWRA 2RAVA 2XE7A 2D1QA 4LZOA 4QTUB 1G6OA 3LWNA 3OCUA 4BO8A 4FNGA 4L8VA 4UM9D 5DP2A 1NG9A 3O4VA 3AL0C 3R3HA 3JYNA 1N5LA 1ISJA 1QHYA 1OILA 2OXCA 2VS1A 3DMTA 3AI2A 3TQCA 1MO5A 4DXHA 1W9HA 3JASB 5K0ZA 3IUMA 1E89A 1P6QA 1Z8HA 1VLMA 4YECA 2O19A 4UVGA 2WVHA 9MHTA 4WZBA 4N5NA 5I9BA 5BNZA 2VF4X 2FP3A 4ZDWA 4DADA 1V4BA 5EP1A 2P68A 1HQKA 3UO8B 1KYIA 1Y1KE 2FUNB 3CVJA 1AZWA 2C31A 3ZD8A 2QI9F 3R0XA 1E8MA 3OICA 4II2A 2OBBA 3D3WB 2FN4A 2ETVA 1NNUA 3OE7D 1G1MA 1PJBA 2JNWA 5KPDA 1K86A 3IQEA 1CVIA 5CA1A 1ZLXA 1QFSA 2F3QA 3ADKA 4DQVA 3KFLA 3DEHA 2JJ8A 3ORHA 3IUEA 4BEJA 5BSGA 4CF7A 4ZOLA 2QVZX 4V0ME 3UTCA 2IUYA 4FOSA 4Z9FA 5JNLA 1HL7A 3B1ZA 2GHQA 3A06A 3OKPA 2AMVA 2J0UA 2YBDA 3I9KA 4NF2A 3U80A 3U7IA 1EEXB 5C81A 5L40A 2QZJA 4DIOA 3PIIA 4CM9A 3FKQA 3MTDA 3MF4A 3OJXA 4A91A 4TRRA 5IAOA 3EGEA 4EHAA 3P5BA 1GNQA 4A27A 4TRNA 4V03A 1EDBA 5C5CA 4EG7A 5BW4A 3PGJA 5LM3A 4L74A 1VYUA 2UZ1B 4XE5A 3LUGA 3I39X 4I1IA 5JNVA 1WXGA 2PJRA 3X3HA 3VPHA 1FL9A 4M9RA 4ZK6A 1IYZA 1QGED 2IUSA 3ETHA 5K1ZA 3VR5D 5D86A 2ZJ5A 2WIKA 2JLYA 4OYYA 4R7ZA 2IQ5A 3O8DA 2ORWA 1GV1A 2XNKA 2EJCA 2KMLA 5E95A 5FDFA 2C8KA 2H57A 5JYDA 1B16A 1P9NA 3C3DA 3C41J 4MGIR 5ALUA 2VVTA 4D5EA 4XYLA 4U9UA 4N5IX 1P4HA 1LW6E 1QG2A 4JVSB 4FFLA 4ALIA 2RGDA 3LX8A 2JFVA 2QRGA 1Q95A 2QNIA 3A37A 3INGA 4M2LA 4CZ2A 4DBZA 4YV1A 4PYNA 1GT6A 1PUIA 4KJXA 5EYPA 4MOWA 3VU1A 5DOVA 3QUQA 4EF4A 3IOYA 1MUUA 5KOIA 2WWRA 1G41A 1XTUA 3EVTA 4FI3C 1Q92A 4BNVA 3WGUA 4BNJA 1G8PA 3EXG1 2XWBF 3L04A 4HOYA 3S2FA 3G85A 3ZE1B 3B53X 2H4ZA 1ISPA 2ZJ3A 1G20E 3C7KA 1DDGA 1UXJA 2WZQA 3BT7A 1XVAA 1AQYA 3AR5A 1TNDA 5FADA 3KXKA 3RGWS 3UXEA 1I2AA 1BVUA 3AMVA 4LXXA 4Y9TA 2Q6KA 2IGBA 3I0ZA 3TCNA 3W8DA 1TQDA 3ZCTA 4RFLA 1KSJA 2XWQA 4XJXA 4RD6A 5J9FA 1E6LA 2C29D 3N05A 4M9UA 4BKQA 2H0AA 3U81A 1SNYA 4BLPA 4US1R 2R1VB 3CPHA 3QF4A 4V0RA 3BWBA 3SJBA 1HYQA 3LT5A 5E9QA 5I5EA 5LMUB 4X1YA 4GZ6A 5AHRA 1GU7A 1CRQA 1YVEI 1IK6A 2VJKA 1IMJA 1BXKA 1VJCA 4JLUA 1MPXA 4MW9A 3DQZA 1YB4A 2W5UA 3HJAA 2Y4NA 4AXBA 3Q6IA 3FWPA 4M1WA 3QFFA 3HCNA 4BQRA 4PZPA 4Y2HA 3V42A 2NW6A 5ALMA 4MUIA 3T35A 1KWGA 3AR9A 2RHDA 2H2IA 2VAXA 3L8FA 1I80A 2OB2A 4FHFA 4X66B 3U60B 4D92A 5HM8A 4PBRA 3IAS1 3ZDEA 2KLBA 4TKUB 4MW2A 5EJ2A 1M72A 4NG4A 3VR2D 2PV0A 10MHA 1P2TA 5IN4A 2PRKA 3EDQA 3DGEC 2WD7B 4PWYA 2Q0HA 2B35A 2HSGA 2GEUA 5AM2A 5IT0A 4D42A 1U3VA 4B2YA 3AZOA 4Z4HA 1V4VA 3KCQA 3FUUA 3R6DA 4F3CA 4H15A 3JQFC 3NBFA 2BWJA 4EW3A 4DV1B 4HQ0A 2C4NA 3ZQKA 5BOSA 3G8DA 1FP1D 3WSTA 5CVTA 5TARA 1NZDA 1J7JA 5KHAA 4KKXB 1KQOA 1FEZA 2YWRA 5BVHA 4IQFA 2DQKA 4KIWA 3AR3A 3QUAA 3UJ8A 3ODPA 3HBLA 4RCZA 3U4DA 5AIBA 4HPXB 4CTMA 3B7PA 1EFCA 3EIQA 3F5SA 2ZRMA 4L28A 4TKMA 4PTYA 5I6DA 3N8IA 2C4TA 1LEHA 3EA4A 4RM3A 2ZIUB 4I14A 4EK9A 4R2KA 1O97D 5E4YA 4NAUA 5IC4A 4EVQA 4YJ2A 1H4SA 4AN4A 4PM4A 1C1DB 1ZJ5A 2QL9A 3UWSA 1CF2O 5AJWA 1WBJB 2V74B 4PFSA 2QAIA 1R6BX 2GPBA 4E32A 4RTLA 1IXYA 4EPXA 1C81A 2EJUA 1NM5C 3OAAD 1DUIA 2VH5R 1IN5A 3KXLA 4LYJA 3WWPA 3EPKA 3F78A 1DKQA 3LX4A 2ES4A 1HO3A 2OEPA 2PYZA 4R83A 4TM8A 3NETA 4TV8B 4C78A 3G2HA 3TUJC 2ZAYA 3MUOA 3O7WA 3RK4A 4QU8A 4MGKR 4K9OA 3W5SA 1TC2A 2QLTA 4S2UA 1E64A 1XEFA 1U1DA 4NS1A 2X0DA 2WEKA 4GMKA 1O4WA 4F4FA 2WUGA 2ENWA 3FMIA 3REQA 4EPVA 2B6NA 4I50F 4WCVA 4LRXA 5JAPA 1G5IA 2ONCA 5EHIA 2C2ZA 3CLKA 2FCRA 3C6KA 2IXAA 1JP7A 1M5TA 5IFLA 1A7AA 1RYEA 3VAAA 3RVQA 2QTLA 1PO7A 2IP2A 2VP2A 5DISB 4E2ZA 4ZIRA 4UOZA 1BDMA 1H3EA 5JMOA 5D8DA 1MJ5A 3KKPA 5C37A 3HTXA 1JIJA 5DZSA 3EAGA 4B4DA 4NHOA 3W06A 3W1VA 2VDKB 2D6FA 4O1MA 2IK8A 1EBBA 1FTSA 1SKYE 2G6BA 1LJLA 2JAPA 2WKWA 3ABIA 3UCXA 3A1TA 4S24A 4LRYA 3O2JA