1P62B

Structure of human dck complexed with gemcitabine and adp-mg
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
241
structure length
229
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human dCK suggests strategies to improve anticancer and antiviral therapy
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 90
structure length 229
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p62B00
2OSBA 1VYTA 5E4FA 5JZVA 3U5ZB 1AA9A 2ZITA 3VR3A 1W0KD 2CCGA 3BRWD 2B6HA 1QVAA 3BIFA 1J90A 2V7QD 3P4XA 4GNKA 2ZTSA 2FNAA 1UADA 4MKFA 1C4OA 1EGAA 1KDPA 1XJ0A 4CDGA 4B3XA 2BV3A 3C8UA 1Z83A 3KFXA 3AKCA 1KIMA 1N0UA 2VP5A 2XTZA 5HTKA 2AN9A 3CF6R 4QJ3A 1PUIA 4KLZA 3ZH9B 3I3SR 2IXGA 1AGRA 5DH9A 1DAMA 3EPLA 1ZIOA 3QBTA 1CTQA 5DI9A 5AJVB 2J87A 3OIYA 4IDNA 1TL7C 2OG2A 2A5FA 3R9XA 1TQ2A 4AKIA 4DHEA 2WWFA 4HLQB 1Z06A 4DLZA 2VP9A 4L4UA 5HKKA 1N6KA 8OHMA 4C0SA 1T0HB 2NPFA 4NYIR 1KAOA 3QSYA 4UXJA 2HF9A 4OYHA 2JA1A 3IHWA 4HB2A 3VR6A 1UPTA 1E2NA 4I99A 1DE0A 4A2WA 5EJEA 4JBYA 1RW4A 1FW6A 2XNSA 4DDVA 2B7BA 1YVDA 1E9SA 3OE7A 4E07A 2Z0MA 3CZQA 1EWRA 1KO4A 2RMKA 3EIQA 3AB3A 3NBFA 3QKSB 4Q1DA 2BBTA 4EJSC 2ZJ5A 2GTPA 3R8CA 2ZYTX 2P65A 2ZI4A 1FX0A 1HYQA 2YVUA 4TTPA 2BKEA 5FBVB 4KLNA 2CNWA 2ZAMA 4G01B 3DHWC 2R2AA 1VECA 1Z2CA 5C46F 3ADBA 5AUNB 4B73A 5BN5A 4DSTA 1SVKA 1ZNXA 3E70C 1ESMA 1R0XA 5HZKA 1D2MA 3KXKA 2C99A 3MD0A 4Q1CA 2RAPA 2ZI9A 2VF8A 4DT1B 5AJXA 1K6MA 3LW7A 1UBEA 1K8RA 5KSPA 1E1QD 3GP8A 5EXPA 4TYPA 1Q57A 4KAXA 3VHXA 5KSYA 3ETLA 2H8KA 1SKYE 2QMUA 2GXAA 2B8TA 3JVUA 5G53C 3K0CC 4M2LA 4OQFA 2FFHA 1A4RA 4Q9JA 3AP3A 1KHTA 5JFGA 1AN0A 3NDPA 3GFTA 3OEHA 1NSTA 2JDIA 3PITA 2W6IA 1T3LA 1P5ZB 1W36C 1VG8A 1FMLA 3GEEA 4LJAA 4DLSA 4WZBE 5KOYA 1XD9A 4O0MA 4ESHA 2QROA 2ZE8A 1Z6YA 4JKIA 5ANRB 4HZUB 3KDSE 5C1BA 5KPDA 3JZAA 3OIWA 4LDJA 3DPUA 4XJXA 4OK5A 2F1JA 3SHFA 1KY2A 3V9PA 5E95A 4EPXA 1OXXK 2ANBA 2JLYA 3THWA 1E99A 1EG7A 2QUZA 3GFPA 3M0EA 4K46A 4LUCA 5SZKB 1XEWY 4JMPA 1JR3A 4LV8B 3GPLA 2AXNA 1JNYA 1A7JA 3SJZA 3VQTA 3VR5A 1G8GA 1NVVQ 2QMHA 1XFAA 1M7HA 3F5FA 2PZFA 1PV4A 3U3OA 5DHAA 5KPJA 5HPYB 1CR0A 4GL2A 3NVAA 1Q12A 4C0HA 4BLPA 1II8B 2Q6TA 4AYWA 4QGHA 2CLCX 4DB4A 2NO9A 2O8FB 4AYXA 1XPUA 1U0LA 2V8OA 1FNNA 1G6HA 1Z28A 2EFHB 4A0HA 2WKPA 2P6UA 4GP7A 4IHQA 4A1FA 3BGWA 1IN6A 1IJEA 4P31A 2P3SA 4Q02A 2VF7A 2VTKA 1QZXA 3ZZTA 2YINC 2CVFA 1HTWA 1NY5A 1NLYA 2XJ9A 1X1RA 2ZYUX 4K81B 4FXPA 3NC1C 1U8YA 2XEXA 1DOAA 1QG2A 2KBFA 4FCWA 1HH4A 2JATA 1XWIA 4P32A 1XDBA 2JJ2D 1VPLA 5KTYA 2ODNA 4UNQA 5BN4A 2BC9A 3P27A 4NKRA 1I2DA 4DIDA 4KJZA 4DDWA 4S2EA 4BEJA 4YMUA 2IUSA 4F7WA 4B74A 2VP6A 2WWGA 2ZI5A 3HR7A 1TPZA 4IDHA 2F1HA 1ZCAA 5J4LA 4QG7A 3AF1A 1EFHA 1P72A 4TYYA 1E0AA 1QHYA 3VX4A 2HCJB 3QY0A 3A6PC 2H16A 4PPNA 4QBIA 1X3SA 3TW4A 1B23P 2V54A 4A8JC 2R9VA 2I1VB 5L3VA 2QRZA 3FE2A 1Q22A 3Q9LA 1T6NA 4Q00A 2AFIE 3U3KA 4Q7MB 1NG1A 1NKTA 4MYUA 5A0FA 1J8YF 3ZS9A 4OQLA 2O8CB 3B82A 3OEHD 4B33A 4Q4JA 4P3YA 4RD3A 1VCIA 1XU4A 3M6AA 1KJWA 4MGIR 2BBSA 2BKUA 4NYIQ 3E2IA 1GDDA 1KGDA 1NG9A 2JJ2A 4I4LA 2BDTA 2WSSA 5G40A 3ZQJA 5C4GB 1DS6A 2OUKA 4LJ7A 1COWA 3X2SA 2OCYC 2FFAA 3TIFA 2UKDA 3O47A 3REFA 1E4VA 2QENA 3IHLA 4RJLA 4P4TA 2VP2A 2REXB 2OXRA 4A0RA 2WAXA 2FPKA 1AS0A 4E5UA 2Q9BA 2Y8EA 2A5JA 1MO6A 2O8BB 1CLUA 4OK3A 5FTNA 4D4MA 2WJGA 1G5TA 1KK3A 2RCNA 3L0IB 4ON9A 3DEFA 1Q1QA 1R2QA 1VMAA 1MRNA 1JAIA 4RCZA 4QHTA 2AHOA 4ZI2A 3QQ5A 4MQBA 2BM1A 4RVCA 2RGNC 4IXMA 4LGMA 2OXCA 5TB5A 1E2DA 4LJYA 1G6OA 5KO2A 1I4DD 3V4RA 1NSFA 4GZMA 4TTQA 3FFAA 4D0LB 1FZQA 4QBFA 1OKKD 3REGA 3CONA 4TMXA 1KI7A 4BGDA 4CZ2A 1W4AA 2ZAOA 3LVRE 2J7PD 2KI5A 3RLFA 3TH5A 4OI1A 3IPYA 1T3SA 1QHSA 3N2EA 4AIIA 4B47A 2C98A 1Z0AA 4M1WA 3HYTA 4TZ6A 1ETUA 3CPJB 4W5HA 2XSZA 2O0KA 5D3MB 2YOFA 5EE3A 3ICQB 3TRFA 1CF4A 2ONJA 1IY2A 2CJWB 1XZQA 1G16A 3CNLA 4Z1MD 3ND9A 3QF4A 4PZYA 1IBRA 3AH8A 4BEBA 4MKHA 4PO9A 1U90A 4AG6A 1TQ4A 4ZIRB 1AQUA 1GNQA 3QJYA 3C5CA 1JPNA 1VDZA 1KSJA 4JLPA 4LHYA 5FOUA 1TEXA 4DC9A 4PSVA 4HDCA 1A82A 2FGKA 2GDJA 1JR6A 2GJKA 1KI6B 1J70A 4HB0A 2VH5R 4M22A 1LF0A 2RGCA 4R9UC 1SVSA 5BN3A 3GD7A 3GQBA 4BWYA 5IHPA 4YXWD 2OM2A 3HJNA 3ZYCA 3RS4A 2VRWA 4EFMA 3RANA 2WWHA 1DADA 1BOFA 3SJAA 1RJ9A 4D2IA 2WTUA 2GJ9A 1KO7A 1Z0KA 4X8HA 2BEJA 4L5BA 4PFSA 2OFOA 1YR7A 4M1YA 2BWJA 2XB4A 2IWRA 1YZLA 1SKQA 3R7WA 4OQMA 2BM0A 2YC2C 4U7DA 2WOOA 5DGXA 4CW7A 1WBBA 4D26A 3K70B 2YJTD 3PUWA 1D9XA 4Q9KA 1JQLB 4LJ9A 5TV2A 4DWJA 3U6BA 1YRAA 1G64A 4KO8A 4V0KA 2Q3MA 3U44B 3CUEF 4MA4A 2GWHA 2PX3A 5A4JA 4FN5A 1ZM3A 4HAVA 4KV9A 4QM7A 1LVGA 1XBTA 1ELOA 3GJ8A 1MKYA 3F0TA 3LBIA 1RRFA 1KI4A 1KJZA 3SEAA 1RE0A 4M0LA 4WOPA 5FBQB 5JS7A 2JCSA 3ZD7A 3LLUA 3M4YA 3CRW1 4NZYA 3GLIB 1Z8FA 5CIWA 4Z8YA 4CEIA 5E7MA 3ADDA 1ZINA 1E96A 4I1SA 4MGKR 2WVJA 3IQXA 4XTCS 4ZKEA 3DMNA 4DCSA 3D6TB 2EQBA 3LLMA 5KU1A 2DBYA 2H1LA 2A5DA 3Q5DA 4OBEA 3A1VA 2E9SA 3K9GA 2WWWA 4HYYA 2F3RA 1JI0A 3KXLA 1SVIA 1UKVY 1WDTA 2D4HA 1UJ2A 2DPXA 4EQ6B 3WBJA 5JWRA 2ZRFA 1VHTA 3AVVA 2HUPA 3NHBA 4EFNA 2F7SA 1T4GA 1FOEB 4JVMA 3ZVNA 3AUYA 4RD0A 4XTRA 2ONKA 1A5TA 1N5KA 3GLHA 1K5DA 2CE7A 4QGGA 1VG1A 3AVXA 2PZEA 1FUUA 3UG7A 1VIAA 3RSOA 1GITA 4XH9B 1X1SA 2VA8A 5FI1B 3WNBA 4A2QA 1GZSA 4G1UC 4WZ6A 1E2HA 2EU8A 5EE5B 4C0LA 1II8A 2KB0A 1T3HA 1W47A 3H4MA 4U02A 1YZTA 3T5DA 2QGNA 1J99A 2XSZD 1KO1A 2ZROA 2QM7A 4C0KA 2IEZA 2QSYA 1ZU5A 3VR2A 5FTLA 4RD1A 4BE7B 3AF0A 2HLDD 3MJRA 3PEYA 3JZMA 1JR3E 3IIKA 4V0LA 1T0JB 2GHIA 4UKDA 4AD8A 1OXVA 4UJ3A 1DG3A 3BAFA 4LBYA 2GEUA 3ZIAA 2G1JA 4GT1A 4RZ3A 4FMDF 1NLZA 2DFTA 3IO5A 3KKQA 3B2EA 2PLRA 1MO5A 4Q47A 3TW8B 4CT5A 2F55A 2BMJA 4KFTA 4X8LA 4TQUS 1KKMA 1W5TA 2IHBA 4UQOA 1KDOA 1Z0FA 2ZE5A 3PUZA 1UF9A 1OKKA 2EYUA 3BORA 3RVBA 3GEHA 4JBWA 1N0WA 3G0HA 5GJVC 1S3SA 3DOFA 1N5LA 2GBLC 3BWDD 2MMGA 1G7CA 3NH9A 3SZRA 3UG6A 4AKHA 1CR1A 2PMDA 1J8MF 3OIVA 5JRZA 3I5YA 2CJWA 2ZSEA 3B13B 1OPXA 3D7MA 4KYIB 2JAQA 1E2LA 1PLKA 5J4HA 4E22A 1CJTC 3T1OA 2P5TB 4GBMA 3QEOA 1YU9A 2PH1A 2VEDA 5G3YA 2MSDB 2NZJA 3ZVLA 2BJVA 5FUWA 1E2EA 1JEDA 1NI3A 2XGJA 3VFDA 3QE0A 2IUTA 5KHOC 1G4AE 3AP1A 2CL7X 4Y0VA 3FHCB 4NHOA 5B57C 3VNUA 3GLHB 2YV5A 1WBDA 2FMXA 3A58B 5J4KA 2ZUBA 4ZCMA 2N42A 3CX8A 1NN1A 4A6XA 3EX7C 4JSYA 4Q4AB 2RGXA 1M8PA 3BD9A 4B2LA 1P3JA 2ZRHA 1Z0IA 3ZS8A 1OB2A 2O8DB 2OBMA 4QNRA 5P21A 3OF5A 2ZYWX 3DKPA 2ZE7A 3I62A 1VKJA 2ANCA 1R0WA 2NO1A 2QT1A 4D0NA 3N2IA 3U4QB 4URUR 5SZIA 2ZJZA 2GILA 2F3TA 2JJ1D 3EPHA 1IY1A 1E9EA 3WY9A 2OE2A 3BBPA 4BFVA 4A36A 4ZIRA 2GK6A 1QHNA 4MUAA 2PT5A 1XX6A 3CBQA 3K70C 4G5QA 2OFWA 2FDCA 3P32A 5ELXA 3KJIA 1XZPA 3AP2A 5LBIA 1DELA 1ZVQA 3RRMA 1DAFA 2BHRA 1Z29A 2IYSA 4A82A 1NMZA 4OHXA 2GF9A 4TMWA 2XNDA 4AK9A 1GIAA 4IDPA 2F1IA 4M1OA 3ZZUA 3OAAD 4JLJA 4Q18A 3LW8A 2JDID 4WBSA 2RGNA 2GZAA 3QKTA 2WIAA 3QXJA 4IKEA 5JWOA 5JHGB 2ZI3A 2E87A 4C0BA 4P0TA 3K0CA 2J5XA 2O5VA 2Q0HA 4QC2A 4Q48A 1JAHA 4LRWA 3PENA 3BB1A 3RAPR 1MABA 3KTAA 3EZ7A 3HR8A 3UIEA 5TVKA 4M9XA 1HT2E 1WP9A 4W5JA 5H70A 3VX3A 1YZNA 3RNLA 4V0MA 3HU2A 2IS2A 4JKYA 2NO6A 1Y3AA 3Q8XB 4D4LA 1SHKA 4Z8XA 3QNUA 1TX4B 2EWVA 1QF9A 1Q21A 4Q1EA 3FMFA 1GL6A 5FBRB 3SU8A 3TNFA 4JVNA 1KKLA 3GJ0A 3ONWA 2YHSA 2GVZC 2VL7A 1Q44A 3WYGA 2VP0A 1OXSC 3DZ8A 1X86B 3NC0C 4RD4A 2C2HA 2DFLA 4C30A 4C0QC 1K5GA 2G88A 1HT1E 1CJUC 521PA 1UBGA 3D3QA 3N70A 2VPPA 2VSXA 3L0SA 3CF2A 1SHZA 2YWGA 2DCUA 2ZS7A 2CE2X 1FTNA 3OEEA 2ZSDA 4P4UA 1RVDA 4L15A 1AM4D 1OLOA 3CIOA 4KHZA 2VYFA 4QRHA 3UMSA 5JRJA 4BFXA 1XD2A 2W0MA 1UAAA 3GLIE 4M9ZA 4IOMA 4A6PA 3AUXA 2F43B 3IQWA 2UZ3A 1FMJA 2YWFA 1WXQA 3QF4B 2N1BA 2X1VA 5AJZA 2J0SA 5EP4A 3WRXC 2C9OA 2G9NA 2F9LA 1F5NA 2ZANA 4NMMA 3IBYA 2ZRMA 3WYFA 3GJ4A 1HE8B 4WXRA 1C1YA 4CF7A 3I5XA 1Z6XA 1KI1A 2CXXA 4NL4H 1YR6A 5GJBA 3N5CA 2IS1A 2IF2A 3P26A 3NBZC 2CL0X 3IIMA 3EWAA 4OHZA 3CM0A 3U60B 1RRPA 2WKQA 3W6PA 2CMKA 3WHKA 3LRPA 2BMFA 2OCPA 4B34A 4R7ZA 2WV9A 2UVQA 2V1UA 4IRUB 4AC9A 1OFHA 5C4MA 3GLIA 1FQJA 1D8TA 2PJZA 3X1WA 1S1CA 3NEJA 3VKGA 3HWSA 2BBOA 3UATA 2FEOA 4HLUC 1SZPA 2PEZA 4G0NA 3HU1A 2ZS8A 3TUZC 4DLRA 2J0QA 1HV8A 4TL6A 3W34A 2OHFA 2WJYA 3ASZA 3SN6A 1W44A 4C0AC 1JB1A 2JJ1A 4D6PA 2IYRA 4FCVA 1R5BA 4Z1MA 2HCBA 1SGWA 1G41A 2OAQ1 3PVSA 4F91B 1OV4A 3WMFA 5IK2D 3FVQA 2O8EA 3UWKA 5JCPA 1E9RA 1RRCA 1GL9B 4EJSA 3O8RA 3QOFA 1UEJA 3OE7D 5LB4A 3K0FB 3IGFA 2YKGA 1UBFA 2IC5A 1P9WA 3D8BA 3WP1B 5K8TA 2G0TA 4MRVA 3TBKA 3LV8A 1BYUA 1XEFA 3EG5A 1IXRC 2ZJ8A 1TU3A 3TMKA 4LSGA 2Z5FA 4TLEA 5FPYA 2FZ4A 4M1SA 5FPTA 1T91A 1ZM2A 1GRQA 1S3GA 4RSGA 1LW7A 2VBCA 1NKSA 5LD2B 3NHAA 5EXXA 3GLFE 1GL7A 1HQYE 3QKSA 4ARZB 4B3CA 3AVQA 3BB4A 1PUJA 5E7IA 2A5YB 3DL0A 621PA 1E1RD 4EPRA 1W46A 4FMCB 2CHGA 5EP2A 5IK2A 1WB9A 3I1FA 1KZGB 1HQCA 4FIDA 1U81A 3H2YA 2Q9CA 3R20A 2WWYA 3X1ZA 3A1UA 5FTMA 3BK7A 1OYYA 4IFBA 3CPHA 4IJMA 1FL9A 4NONA 1KYIA 1JJVA 1E0JA 2JLSA 1R5NA 1NVWQ 3H1TA 1SXJC 4RD2A 1PLJA 4RFSB 1ZC3A 3GLHE 2NZ8A 3PR1A 3SYLA 2JLRA 4L8GA 2IF0A 3SDZA 2A3RA 2ZSFA 2YOHA 3BOSA 4LYHA 1CJKC 3OESA 2WJJA 2J7PA 2ZJOA 2Z43A 3KJHA 3L2OB 4BFYA 4ZKDA 3FKSD 4B6EA 5HKKD 5JJIA 4MRNA 4Z51A 3LX8A 3W9YA 1E79A 3QVUA 1S9DA 3PUVA 1W36B 5FOSA 3KKMA 3THXA 2R6AA 4PSKA 1NRJB 4IVRA 4LJ4A 2Z6VA 1PJRA 1KSGA 4H9GA 2R6CA 2QORA 1N6OA 4WW0A 5DYGA 3ZGXA 2AKAB 4Q4LA 1E9FA 1U0JA 2Z4SA 4M53A 3U44A 3DOEA 1RZ3A 2ZU0C 2A30A 3B1ZA 3U3JA 2CL6X 5H8WA 1FQKA 2QSZA 3KB2A 3K0EA 1NP6A 4UXHA 3NBXX 1RIFA 2JEOA 3JVVA 3UXMA 4C7OA 1P2VA 2ZRPA 2AD5A 5B30A 3O8CA 4IOKA 5HE9A 4A0FA 3B1XA 3EARA 1CIPA 1LS6A 2H5EA 2HT6A 1GFIA 4LOAA 4QFMA 4WZAE 2EW1A 4OQXA 1E9AA 5C2JB 1ZM9A 4GFDA 2HYIC 5DYIA 3CR8A 5CIQA 4NYMR 1DVRA 1TF7A 2QTHA 4M1MA 2O8DA 2OCAA 4PAOA 2O52A 1OHHD 1Z6AA 3LDAA 1T8TA 4XSHA 1KDRA 1MT0A 1YJ5A 4OI2A 2WMOB 3IKJA 1RYHA 2QT0A 3EXAA 3BB3A 1KI3A 2LKDA 2J0VA 5C18A 4KBFA 5FOXA 2HF8A 1RYFA 4IVPA 4TT3D 2QMOA 3O8DA 1XTSA 4FWIB 1GOTA 3SYNA 1UDXA 1VCMA 5DNYB 2C03A 5JI3E 5KSOA 3TUJC 3A1TA 2W0SA 1IM2A 4O2LA 4TMZA 4H1VA 4ASUA 1E2FA 4AYTA 3NBYC 2Q3FA 3EWSA 1OIWA 1OH6A 2BVNA 4B2IA 3CZPA 2O8BA 1SXJB 3FWYA 5B2ZA 3GEIA 3A8TA 3WNDA 1BKDR 3FOZA 1BO6A 3QXSA 4QHYA 2P2LA 2FF7A 2WSSD 1Z6TA 3V00A 5E3HA 2BEKA 2ZU6A 1Q20A 2PMKA 4HAZA 4V0ME 1P9RA 2ZR0A 3CH4B 5DISB 5L3RA 4A0GA 2PT7A 5CK5A 4I81A 4DLYA 2J1LA 1OFTA 4BZQA 2KWIA 4C2UA 1U9IC 4IDQA 2FA9A 3D31A 2ZETA 4WVFA 2D06A 4MYHA 1E9CA 3GJ3A 2CLSA 4Q1BA 2GXSA 2LWIA 2QNRA 4ARZA 2NOAA 2FH5B 5BXQC 5FBLB 3C5HA 5FI0B 3THWB 1NVVR 2MMCA 4F93B 2HT1A 5M04A 1AJEA 4HUQA 4TZ0A 4LHWA 3C16C 2B7CA 1XPRA 2OCBA 1E0SA 3A1SA 3BFVA 3EC2A 3IDQA 4EFLA 3MWLA 1Z3IX 2VHUA 2ODBA 2ZM5A 5LD2C 4EAQA 4Q19A 3TVDA 4URYR 3RRYA 4R2IA 1KK0A 1A1VA 1NL3A 2GK7A 4KSBA 1M74A 3TAUA 1M7GA 3NWJA 4YC7A 2ZRDA 2HLDA 2J46A 2JLQA 3AV0B 1KY3A 1D2NA 4XD7A 5IF9A 3IILA 2V3CC 3MUFA 2DR3A 4B75A 1OH5A 5LPNA 4D82A 1ZM4A 4FMDB 1LS1A 5DI3B 4CYMA 1TQ6A 2BBWA 4BLTA 4DSOA 5KSZA 3NIBA 3U6KA 1H8ED 4HAXA 1G8PA 3CO5A 1II9A 5AUOB 5GADl 3PEWA 2WPDA 1N2CE 1PVOA 4BZXA 1E2QA 4F38A 1RFLA 4OI4A 2OO7A 5HCIA 4BFSA 3SNHA 4U00A 3TSZA 2ODWA 5J4YA 2QPTA 1NNEA 4DZZA 1IN7A 4BRUA 2Q3HA 4GI7A 3UPUA 3DVLA 2D7DA 2IBMA 3WYAA 3B85A 2RH5A 3S1AB 2P6NA 4DLUA 1L7VC 1HY3A 2ZRGA 3MCAA 4DRZA 4A8JA 4H1UA 5AJWA 1E94E 2R6GA 3RRNA 3I32A 2VSOA 2X19A 3THYA 4WIAA 4Q7KA 1KMHA 3RS3A 4GSYA 3QXCA 4YLGA 4F4JA 4IOLA 3P1JA 1E4YA 2YWHA 3WRYC 1NVUQ 1KI9A 1U2RA 4JLAA 4UJ5A 4FMCF 4BRWA 2FN4A 4II7A 4DUGA 4ZV4A 4XVQA 2C77A 4HUTA 2AFHE 3U7GA 2RGAA 1QRAA 2P67A 1OFIA 2XTMA 3O8BA 4A92A 2DFNA 5FFMA 5FUVA 4B3DA 5AUPB 1U99A 2P5SA 3U7FB 3T15A 4UNRA 2JLZA 5F9HA 2ZJBA 4PPFA 5BWMA 1R8SA 1W49A 4LPKA 3AKDA 4BLRA 1AQYA 2FFQA 1RJ9B 4TLCA 1Z07A 1P61B 1XCGB 2ZR9A 1L4YA 4LV5B 2W2XA 1ZJ6A 1UEIA 3CX7A 5CYOA 1MO3A 2OAP1 1M34E 1BMFA 1X8JA 3IUYA 4KYUA 2J0UB 5GVRA 5HE8A 3UMFA 2PEYA 1YZQA 2CHQA 3FFBA 3VAAA 3LNCA 1UM8A 2H7VA 2OEPA 3U61B 2GAOA 3TUIC 3SJCA 1ZD9A 1CU1A 1AIPA 1F2TB 3U3RA 4DUGD 1W48A 1F48A 4B3GA 4Q21A 2K5UA 3A4NA 4CT4B 2V1XA 3T1TA 5EE0A 3LO5A 4GP6A 2AX4A 1G8YA 4ITRC 1E0KA 2J3EA 4JVLA 3VMFA 4OJKA 3KKOA 3RABA 4BFUA 2IYQA 2FSFA 3K8YA 3TE6A 5EXTA 3UMRA 1N6HA 2QI9C 1NIPA 3MWJA 1Z22A 3OEED 2FPLA 5SZHB 3DMDA 1JBKA 4MKGA 5JS8A 4DSNA 1MR3F 1ZD1A 3QPVA 5HZHA 5TMPA 1NJGA 4PQYA 3FGNA 5JHHB 4LYAA 1QDEA 2D62A 1NJFA 2BCJQ 3KKPA 4RFSA 2XITA 4YMTA 3ZLJA 4EIWA 4IOJA 2Z4RA 2J41A 4DDUA 2IYVA 2ASEA 1DARA 4QBHA 2V7QA 2ZE6A 2JLVA 2RHDA 2GF0A 4PAMA 3W6NA 1ZRHA 4PSAA 2RGDA 1GKYA 3K0SA 4J0QA 3LXXA 3THYB 3B9PA 1ZBDA 2C8VA 3ZD6A 3K0AA 4PC3A 4CEHA 4C3ZA 1FFHA 1T5IA 2GZDA 1FTSA 1WF3A 3A4MA 1Z08A 4B48A 5LB2A 3QBVA 4HAYA 1S2MA 1NBME 2TMKA 3GFOA 5JECA 2GCOB 4P4SB 1R0ZA 3WMGA 1VIYA 1XJQA 2ZRIA 5EQTA 1S1MA 2HDNB 4NYMQ 4QGAA 2JASA 1JECA 3QVVA 1I2MA 1OYWA 1Z63A 3EZ2A 4I1VA 3V4FA 3P20A 4DCUA 5CJPA 5FL7D 1TU4A 5KDLA 1Z0JA 2GESA 1JQJC 1QVRA 4FINA 2WZQA 4LBZA 1G4UR 3KQHA 2QTVB 3GJXC 4ZCLA 1QHHA 2QQEA 2WOJA 3OHMA 3I8XA 4R98A 5L3SA 3M1IA 1W4BA 1N6LA 4B32A 2H57A 2IL1A 1I4TD 1TEVA 2GEVA 3EZFA 1NMYA 2VP4A 2G3YA 1ZNWA 2QPOA 1UFQA 2ZRCA 3RS2A 1S9HA 3DM9B 2DYKA 3RDPA 2CDNA 4AKEA 4HDQB 3GLFB 4JSTA 5G41A 4M4SA 1SVWA 1TQDA 2O0HA 2V6IA 4KITB 4PX9A 1DAEA 5L3QB 4GOXA 3EAQA 1CS4C 2FU5C 3MAAC 3X1YA 4BLQA 5AR1A 4AG5A 2C96A 2A7QA 2GBLA 4RCYA 3KFVA 4KXFB 4MDFA 1X6VA 4LV6A 1E2PA 2ZI6A 3OIUA 4JLMA 1F2TA 3DZDA 2PCLA 2AD1A 1CR2A 5DN6D 2QBYB 2AXPA 1US8A 4DLXA 2QTFA 3FMIA 3SOPA 4TL7A 3BXZA 2ZI7A 3ADCA 3T12A 4HI0E 5FL7A 3CX6A 4TTRA 2P0EA 4KBGA 1AS2A 4E03A 2IS6A 1AK2A 1XMJA 2Q21A 3PCRB 4PHFA 3NTUA 4RD6A 1P60A 4TMKA 4WAUA 1KMHB 4G3XA 3CPEA 4KCGA 4LBWA 1EXMA 1N6RA 5H1YA 1BMFD 5FR2A 4V02A 4RKEA 821PA 1SQ5A 2XZLA 2DWPA 4LHVA 4PQRA 4Q7JB 3IIJA 2ODEA 2QAJA 5FTKA 5EXSA 5GJWC 3G5UA 3PUYA 2XJ4A 1WQ1R 2IYYA 4NDZA 4QJ5A 1JALA 1V43A 4GOJA 4JYBA 4XWAA 1RPZA 4CEIB 1M6NA 2ATVA 5E7JA 3VNVA 3BFKA 2OBLA 1E2MA 1W2HA 1IJFA 1XXHA 3RS5A 3FTQA 4E09A 3RS7A 3Q7QA 4URXR 1O87A 1VCOA 1O3YA 1JJ7A 1E2JA 3AKEA 4PC6A 2NO7A 1TUEA 4O25A 2BOVA 3AGQA 1R8QA 2PLFA 2ZRJA 4I1UA 3RWOA 4GMDA 5FPSA 2F9MA 1GKIA 1FP6A 2X8AA 2XZPA 1OIVA 1W0JD 1N5IA 3GJ7A 4HUQB 4RZXA 4OHWA 4BLSA 5J47A 1OHHA 1W36D 5KNBA 4BFWA 3H0KA 4QOSA 1OB5A 4TSFD 2NO0A 2J45A 4NYJR 2XX3A 2V4ZA 4EUNA 1TUIA 2SHKA 2PZGA 2ZUDA 5DE3A 3TR5A 4LI0A 1VG9B 4PO1A 1EESA 1J7KA 4PPQA 3GLGA 5F3WB 2VHJA 3FKQA 4YONB 2W2TA 1YZGA 4D81A 5EE1A 4TLBA 3K09C 2R44A 4QBGB 3A1WA 4TL9A 4JL5A 4N3NA 1QG4A 1BH2A 4HEJA 1L4UA 2CLDX 5J40A 3SBEA 2J9RA 4ZDKA 5IRCD 3PQCA 3WBKA 1R10A 4ZDJA 3NH6A 2Z83A 1MOZA 2WIBA 5D3QA 1U0HC 2FFBA 3AGPA 4BPBA 1XTQA 5TDHA 3GLGE 2WJIA 4FD2A 2L0XA 3K09A 2YOGA 3A36A 4TYNA 3VTKA 1GILA 4DT1A 2A5GA 2MSCB 3T1QA 4CRWB 4EJSB 1U8AA 2YC4C 1P2TA 5G3ZA 3W8NA 1VYUA 3LQRA 2QAGC 1ZU4A 2W00A 1CJMA 1ODFA 2KE5A 4D0GA 2P6RA 1XD2B 5EP1A 3CLVA 3C14C 3I72A 3MWYW 3SS8A 3K9HA 4KODA 2HXSA 3EZ6A 4AKGA 4LWZA 4IEIA 3KKNA 4LX0A 2ZYVX 3MFYA 1B0UA 3TR0A 3HPQA 1ZUNB 3T1VA 1XXHE 1ANKA 4XWOA 3L8ZA 1MH1A 1TF2A 3AQ4A 1CRPA 2VHCA 1N5JA 4UNNA 4Q01A 2WWIA 3P4YA 2WWXA 3CB4A 3KQNA 2YNMA 1VTKA 2ZJYA 3FB4A 2QEQA 3QKRB 2QQ0A 1GTVA 2ZEJA 4TQ9A 3HU3A 1OH8A 3BC1A 2QE7A 1XEXB 2IYZA 3SE0A 1E6CA 2XOKD 2PX0A 2OFXA 3T5GA 1MABB 3KTAB 221PA 1AGPA 1VCNA 1FP7A 4M1KA 1MRSA 2GCNA 4R71A 5KNCA 3QXXA 2D74A 5JI2E 2IUUA 3AF2A 1KO8A 3I92A 3ZZ0A 3W5JA 2ZUCA 3ZJYA 3OFNA 1G21E 1XJCA 4D4JA 1IXSB 5FR1A 4OQNA 4FCTA 5BYJA 4UNSA 1P73A 4XVRA 2OZEA 3PFIA 2GJAA 5KNDA 1YR8A 3K9NA 4A9AA 3SFZA 2Q9AA 5JSZA 5EZ5A 4YXWA 1Q1BA 4ERNA 2FEMA 4NYJQ 4OI0A 1BS1A 2JLWA 3KL4A 3PXGA 1ZD8A 2XAUA 1DAGA 2YWEA 1IXZA 4NPHA 4DKXA 2VSFA 1KMQA 2CCJA 1GUAA 4JLNA 4Q4HB 1M7BA 1NLFA 1D2EA 1YKSA 1D5CA 2QM8A 5FBWB 3TLXA 1KI2A 5JEDA 2EFEB 2C9YA 3QPWA 3U4QA 1XCPA 2WJVA 1LV7A 2MSEB 3QPUA 1IAQA 3I73A 4Q7LA 3W6OA 3R8FA 4MGYR 5CDFE 1IN8A 3LBHA 4N0EA 4PANA 3TGPA 1PLLA 1S8FA 2ZSBA 3MG9A 2V55B 2KJQA 2R8RA 1DAKA 3VR4A 3LAWA 5K8IA 4BFTA 3LH5A 2VLIA 1U9IA 4XSGA 1D9ZA 3LXRA 4OK6A 4C9BA 3NXSA 4ZPXA 5DO9A 1W5SA 2OLJA 1F6BA 4YMWA 2XXAA 4B43A 3C15C 1M2OB 1DEKA 1ZYUA 4A2PA 1QHIA 4PQFA 4IFEA 1PZNA 3CKLA 3B9QA 4L16A 2OBNA 3HYRA 4W5WA 3QF7A 1LF5A 3RSLA 4TQAA 1HA3A 1T8UA 4LJ5A 3TQCA 2NIPA 2KBEA 1W2GA 1G7SA 3KB1A 4OHYA 4RZUA 3SHWA 4JJKA 1HURA 2A2ZA 2GA8A 4DEXA 4G5SA 4US1R 5F98A 5FPHA 2ZXUA 1RC8A 2IWHA 3QKUA 4AWXA 5DSZA 5CYPA 421PA 4B3FX 4DB2A 4G5OA 2XOKA 4DBLC 3IEVA 3B5JA 1VG0B 3BERA 2F1RA 4EQ6A 4DLVA 1DO0A 4BLOA 2ERXA 2FGJA 4KFUA 1QBKC 2V6JA 4YMVA 2GAAA 2VO1A 3B60A 3IPXA 4ACAA 3U7HB 2FSHA 2RKOA 4TLDA 5HR5A 2G6BA 3SR0A 2AL7A 3DDCA 2DHRA 1DO2A 3I61A 2CHVA 4QKQA 3T61A 3FKSA 2C78A 2CNWD 1EX7A 4B6FA 2NGRA 4QXAA 2CCKA 1P4SA 1E98A 3EZ9A 4XIGS 3HPRA 5JBQA 4YQFA 3BH0A 2GETA 2ZS9A 4HSEA 4B44A 3ADKA 4M9QA 1NN0A 2QL6A 2WSMA 1T5LA 3G82C 1XNJA 3R9IA 5L3QA 1BIFA 4LJ6A 2OV2A 3KXIA 2G0NA 1G8FA 2JIZA 1P6XA 3E1SA 3PUXA 2DY1A 5JJLA 1ESNA 4QNMA 3BH6A 3FMPB 3QG1A 4JS0A 5JMTA 1N3BA 4D80A 4EPTA 3KJGA 4MH0R 1HE1C 2GXUA 3OFND 4W9MC 1XMIA 1TNDA 4W7SA 3LY5A 4CVNA 3HDTA 4G5GA 1D6JA 3UWOA 4AY2A 4XOIA 5K8LA 5FUXA 1OT3A 1IN5A 4RFVA 3Q3JB 2REBA 5CM8B 4EDHA 1GRNA 5JSZB 4LY6A 3OZXA 4CGZA 1GG2A 3QEJA 3AF4A 3K70D 1J2JA 3BE4A 4TLAA 1AS3A 5UKDA 2LCFA 3AM1A 2ORWA 2GVDC 5CK4A 2ZRBA 5BQ5A 2C04A 2D2EA 4Y0AA 2C95A 2WAYA 4MRSA 1XF9A 4CEJB 1QHXA 2AR7A 2G83A 1IN4A 2QPAA 1G3RA 1TF5A 2ZVQX 1YE8A 4XWKA 3ZDQA 1KI6A 2JIZD 4DVGA 1E9BA 4HLUA 3VU9B 1GAJA 1FNMA 1ZMXA 2BIFA 4GOKA 1EFRA 3ZVMA 721PA 2EYQA 4I1OA 4JIMA 1XXHB 3AVYA 1DBSA 1X8LA 4PC1A 3R7WB 2CK3A 5DHFA 2WJHA 1OH7A 3W8RA 3LFUA 2IHYA 4HB4A 3LX5A 4JBXA 3TK1A 3RC8A 4QM6A 4JJZA 1OW3B 3IO3A 4OL0A 4CIDA 4DLWA 2ZPTX 5CB8A 3SBDA 4C2TA 1OFUX 4TL8A 1XTJA 2ZIAA 4RKFA 2XB2A 1NBMA 1SXJE 4IVQA 5JEEA 4NTZA 4LCBA 4P33A 2IYWA 4Q4AA 4JT4A 4M9SA 3KX2A 2IW3A 1CKEA 1GRRA 3SFVA 4GPTA 1NY6A 1CP2A 5EE9A 3ZVRA 1DPFA 2N46A 3I4LA 3MJHA 1UKZA 5FOWA 1YR9A 2FE4A 4HAUA 1YRBA 3RS0A 3NDBB 3CRVA 1CRQA 4Q5IA 1KTVA 1JXMA 3ZQ6A 4GMXA 5CLLA 1XCMA 4X8MA 4TYQA 1DAIA 4XD7D 2FSIA 4URWR 3AVPA 3MMPA 2HJVA 5LDDC 4JYCA 4JLVA 3OAAA 1X8KA 3B7GA 3VU9A 4PTLA 2FPMA 2IT1A 4HZIA 3RRZA 4ZI3A 3EA5A 3EIEA 4F4IA 2RGEA 5CITA 1SVOA 2EFDB 2REOA 1SXJD 1RKBA 2IYLD 4FI3C 4PPGA 1GWNA 4LJ8A 2G77B 4LHZA 2CBZA 1TAGA 3BS4A 3AVUA 1SULA 4PC2A 4TT3A 2PJRA 1S0UA 2ZRNA 4PO8A 2FJUA 5J4VA 1E9DA 5CM9C 1N6IA 3VHLB 1UKYA 4LYFA 3UKDA 1RRGA 3A4LA 2DWQA 4Q66C 1XRJA 3AKYA 2O0JA 3NEYA 2IK8A 3Q72A 1OSNA 3B6EA 1JEEA 3T35A 2YYZA 2H18A 2DWOA 5AK0A 2R6DA 4US0R 4DSUA 2ZRKA 1P2SA 1G3MA 1N6NA 2QP3A 2CK3D 1G20E 4JLDA 4LHXA 4URVR 3QKRA 5AWFC 2W2VA 1W4RA 5B64A 3L43A 4IEEA 4MYTA 1Q1ZA 3B78A 4LC0A 1G19A 2X77A 2XTNA 3EIHA 4HATA 4L9WA 1LFDB 4BZPA 1SVMA 1GKUB 3EASA 4US2R 3MSXA 2FSGA 1GM5A 3I8SA 4ZO4A 3S1AA 3PJRA 2WHXA 2RGBA 1FPMA 2JJ8A 3BFXA 5FUYA 5EP3A 3SQXA 2DFKB 1DG1G 1G5PA 1XTIA 1GSIA 1L8QA 1NN3A 2J0UA 4MKIA 4C4PA 1R7RA 4NCNA 5JJKA 1XEWX 1OXUA 1V5WA 3DKVA 4Q9HA 1E2KA 4FWTA 4EPYA 1U94A 1HEIA 3DO6A 3MLEA 3QENA 1II0A 2D7CA 3C41J 5GVSA 1NMXA 1KK1A 1N25A 3HP1A 2LKCA 2BJWA 4LYJA 2ZVPX 2W58A 4A15A 1QHGA 1TADA 3WNCA 3LA6A 4LBVA 1TMKA 3EA0A 2OILA 3AVTA 4LK2A 3GLGB 4Q1AA 4HB3A 1XEXA 3KQLA 1GNPA 2QN6A 2IXFA 2OLKA 2CVHA 1YQTA 3L82B 4D25A 4MRPA 2J7KA 3K53A 3LBNA 4RZ2A 2O8FA 4FMBB 2IYUA 1U98A 3B1VA 3CF0A 1KNQA 4NP6A 2GZHA 5F2EA 2OT3B 4F92B 4ASUD 5GJCA 4KI0A 5J5CA 1EK0A 3RC3A 4UNPA 1Q3HA 2QU8A 1U8ZA 4A8JB 3L0OA 1OXTA 1ZCBA 4WA7A 1T9HA 3F8TA 1A2KC 1HUQA 2RGGA 2FG5A 2GCPA 2A9KA 2X2FA 2FWRA 1WE2A 2QA5A 3UK6A 3WHLA 2O8CA 4TSFA 2KSQA 1OE0A 2XXAB 2C5LA 1KZ7B 4KU4A 3TAHA 3U2QA 4N1AA 1VYVA 1G291 3J81k 4XVUA 1UBCA 4B3BA 4DCTA 1EX6A 1EFRD 2AWNA 3NKVA 1XTRA 4NU0A 1IY0A 4DIEA 1NVXQ 2FZLA 4JT2A 3KUCA 2GKSA 3C7KA 4PR0A 5F9FA 2ORIA 1WCV1 1KK2A 3AF3A 5FH9A 2E1RA 1ZW6A 3FHOA 1CBUA 3MWKA 3CRMA 5AUQA 4MITA 1H8EA 4QL3A 3WMEA 3AEZA 1NIJA 4RY2A 4O2RA 2A78A 2VHQA 2GCOA 4P4SA 4B76A 4DEYA 1Z6GA 1F3OA 3PIRA 3Q7PA 4PAQA 2QAGA 1GNRA 1WA5A 4JVSB 1FUKA 3K9LA 2QMEA 4Q03A 4ZDIA 4Z54A 3QI2A 3CW2A 3GJ5A 1COWD 2QY9A 3C4JA 2WM9B 1XPOA 3KQKA 1MO4A 2B8WA 4MDEA 2IXEA 3CNOA 1CEEA 1KNXA 3X1XA 1ZP6A 1EFUA 3H84A 3T06B 1Y63A 1LTQA 1G5RA 3GLFA 4MGZR 1IOZA 4PZLA 4CEHB 3LD9A 2ZJAA 5A5GA 5D3MA 2WPDD 5JLJA 4O3MA 3L0PA 1SVLA 4JZKA 4NCHA 1YZUA 1KDTA 1NF3A 1IHUA 1G3IA 1KSFX 2IYXA 4ZCIA 2IX3A 1Z47A 2GXQA 1L2TA 4LC1A 2W6ID 1BYIA 5B58C 1P7CA 2XNDD 4PXAA 4FW9A 1E79D 6Q21A 3CRQA 3KQUA 4Q4HA 4B2PA 1P75A 4HDOB 1WRBA 2ZRAA 1P62B 4MYCA 1MV5A 1AKYA 2I4IA 1JPJA 3W3AA 1AZTA 3SC3A 1XMVA 4TWZA 4ACBA 1H65A 3W5IA 3CNNA 4IXNA 3K1JA 4MUBA 5CDFA 1XMSA 4M1TA 4YMSA 2HYDA 1XTKA 2NPIA 1E3MA 5CLQA 5FTJA 4NE2A 1P9NA 1ZNYA 4KSCA 2CEAA 2GRJA 3BJIC 2FV8A 2IS4A 5KYKA 1M1YE 1KI8A 2WKRA 4QHSA 1C9KA 2R62A 4JLKA 3THOA 2D3WA 3EC1A 3NG1A 1GP2A 3GCGA 4KVGA 4TMVA 5KUTA 4M21A 4DDTA 2AK3A 2QBYA 1ZUIA 4ABYA 2ZSAA 1ONBA 1F60A 1N0VC 1S4QA 2B21A 5EUMA 4D4KA 5KDDA 3WP0A 3FHTA 2X2EA 3W90A 2HXYA 4TN1A 3BH7A 1H8HD 4KVAA 4HLDA 4R2HA 4F4CA 2G1KA 5L8VA 2GJ8A 3B1WA 3MRSA 2DB3A 4BASA 2HEIA 5SZJA 4NCJA 3KJEA 2ZREA 2AWOA 2QE7D 4JL6A 1IONA 2D2FA 1DTSA 1UKEA 2W83A 3AVOA 4ZDWA 3EW9A 4V0OA 5IT5A 4AI6A 1OIXA 1QHHB 2J59A 5TXGA 1LNZA 1A2BA 1N6PA 4NCIA 1YHNA 4LPSA 3RWMB 3CWZA 5JWHA 2HV8A 4DJTA 3K0AB 4BECA 1KJYA 2R6FA 1VHLA 2BMEA 3QUSA 1P2UA 3ECCA 1CULC 3H86A 1XD8A 2EFCB 3RHFA 1OF1A 4QGFA 4EPVA 2AK2A 1ZC4A 1SKYB 4QJ4A 3SJBA 1EFCA 3E5HA 2ATXA 4BQSA 1AZSC 3THXB 4URZR 4G5RA 1ZAKA 2NG1A 1FX0B 4YDHB 3F3YA 1W1WA 1JXOA 5FPKA 3RYTC 2C9CA 1Q3TA 3FPAA 3QXHA 1ZM7A 1AKEA 3B1YA 4JL8A 3GMTA 2IA5A 4OJQA 3SI7A 2FOLA 4LZZA 2R65A 1E2GA 2ZJ2A 1G17A 1S96A 4PC7A 3TJZA 4TYWA 3TKLA 3VKHA 4CEJA 1G3QA 4AURA 2VIIA 3B8HA 2JLXA 4JLOA 4A4DA 3UANA 1KO5A 2W6JA 4UXIA 3ND8A 4OKSA 1Q0UA 4L9SA 2JLUA 1EFTA 4GRAA 1XB2A 3MGCA 3ICEA 1W7AA 2AKYA 3LWNA 3LVQE 4MRRA 1F2UB 4PHHA 3GJ6A 2FX3A 2YZ2A 4Q1FA 4Q4JB 4GDFA 2HJGA 1E69A 1G3UA 3CWQA 2BMDA 4TMTA 2BCGY 2EWWA 4JLBA 2QAGB 3DM5A 121PA 2QP4A 2ZR7A 1CJVC 5DN6A 1LB1B 2IEYA 3U7EB 5BYKA 1R5OA 2RHMA 5EUQB 4N0DA 5K8UA 3W3ZB 1US8B 3SYKA 3FMOB 2OESA 3L8YA 4M8NE 2XZOA 4C0JA 4GZLA 4NH0A 3Q5EA 3PEUA 2GEDA 3WXMA 1LY1A 2WBLC 1Z2AA 1R6BX 4X8OA 1G7TA 2PBRA 3PV0A 2O8EB 2W6JD 2QG6A 2NQ2C 4C7OB 1KOFA 4K8OA 4BFZA 3FYHA 5FL3A 5BW8A 2JGNA 4DLTA 4WXPA 2GNOA 2QZ4A 4DCVA 4EPWA 3EPJA 3VKWA 2UZIR 1SXJA 1OJLA 3K0FA 3TVTA 1G8HA 2ECKA 4B35A 1G7RA 2VHTA 1UDWA 1ZNZA 4EKDA 2F6RA 5DLQC 5DI3A 1R4AA 5FOTA 2IYTA 1YZKA 4IDOA 1KSHA 4ILEA 1WMSA 2ZQ5A 4S35A 2PL3A 2I1QA 5CB6A 3R9WA 1GVNB 1G18A 2NMVA 2I3BA 4PZZA 4KFSA 3KUDA 2QRNA 4KFRA 1TTTA 2WMNB 3T34A 4PHTA 2B92A 2ERYA 4HZUA 1I4LD 4OHVA 4Q9LA 3TSOA 3CRRA 5FOVA 1IQPA 5TY0A 2GJSA 2EVWX 1W0JA 1ZIPA 4V0NA 4U5XA 4B71A 3PG5A 1W0KA 2EFGA 1R0YA 4HAWA 5IDVA 3U3MA 2H17A 3CH5A 4NBSA 3EPKA 1CR4A 2RB4A 3IEUA 4PHGA 2QP9X 5H68A 1W4CA 1G9XA 1Q1EA 2ZRLA 5JCZA 2H92A 2QGZA 2ORVA 3KZ1E 3A37A 3VR1A 3SQWA 5EZ6B 3ZIAD 3X1DA 4ESVA 3ASYA 2NTYC 4BUJA 1F2UA 5HCNA 3QIAA 4V03A 5CJ2A 1NBMD 5L3SB 1KAGA 3TQFA 3AVWA 5TARA 5DIFA 4HLCA 3TSWA 1CXZA 1Z0DA 1Z5ZA 2PCJA 5AJYA 4Q9IA 1H8HA 1E2IA 3PEVA 3CR7A 1EWQA 4POAA 5KDOA 3LQQA 4DCNA 1ZUHA 4YDSA 1E1QA 2F43A 2VQSA 1XP8A 4NCKA 3FDIA 4DXAA 1DAHA 3Q85A 1E1RA 1NN5A 2V9PA 3IBGA 1G1MA 1E32A 2WICA 4IW3B 3QG5A 1JR3D
chains in the Genus database with same CATH superfamily
4P8RA 1ZI9A 5JZVA 4S1WA 4H4EA 1W0KD 2CCGA 2Y1CA 4O5AA 6CHYA 3L6EA 2I8AA 5KCZA 4GGPA 4HG2A 4KQ9A 3AUTA 2Q2QA 3S2YA 4CHTA 1EYZA 3DZBA 3EA4A 1SRQA 4L57A 4B7CA 5B58T 5ALXA 1Q84A 2C2OA 3WFJA 2XT6A 4J1TC 1RRMA 2XTZA 4RZSA 1JQKA 4UBLA 1Y7HA 2AN9A 2FMIA 4YAKA 2L42A 1JYSA 2CLMB 3K7EA 4KLZA 4JEHA 2E55A 5DH9A 3DT6A 1ZAYA 1JEJA 1CTQA 4GRIA 1Y9EA 4KO3S 4LOLA 2G71A 3M6IA 2I54A 2OG2A 5T5QA 3URMA 5JNVA 4WRRA 4C43A 1KJ8A 2C59A 4DHEA 4UM8B 2JFYA 4DLZA 1Z06A 2VP9A 3TIXB 5HKKA 4TVKA 4DIBA 1TE2A 1T0HB 4LZWA 1FFDA 4NYIR 1IEXA 1EX1A 2V3VA 3QSYA 1CQZA 1H93A 3KVRA 3VR6H 5CFLA 1RQRA 3HH8A 1MEOA 1LU9A 3VR6A 1ULTA 3AJAA 4I99A 4RGBA 4EGFA 4A2WA 4IIUA 1X8XA 1ESZA 1UL1X 3EY4A 2R79A 3OWHA 1FFCA 4H4CA 4YRIA 1FW6A 1TD1A 2BT4A 2XNSA 1F0KA 4WLVA 2B7BA 3ZY3A 2YWDA 3RFUA 3GARA 3S0JA 1Q16A 3EIQA 1P0IA 3AB3A 2BBTA 1W87A 2ZJ5A 3Q7TA 2Q5CA 1W96A 2W2PA 2BYTA 1FEZA 2Y0EA 1XHEA 4YPOA 3R8CA 3ENNA 4A6EA 3K6KA 3AR6A 3MB8A 1P1BA 2ZI4A 2GFHA 3BIJA 2GAIA 2B25A 4KLNA 4G01B 1IYZA 3DHWC 2R4UA 4HJRA 2XB6A 2GI4A 5HA5A 1W35A 3PNOA 1V0JA 2IVFA 2ZWAA 3LYUA 1RWMA 4HAOA 1Z2CA 3ZHQA 2H4HA 5I7EA 3ADBA 4ND8B 2APJA 1FJHA 1PQWA 1AB5A 1H05A 1U6KA 4Y2GA 5AW5A 5CEJA 1D1PA 4DSTA 3KSBC 3DB2A 2TECE 1TKBA 2WF7A 3L05A 3NPAA 4MA0A 3CGWA 1GUFA 1TVKB 3UMYA 1K97A 5ARDA 1I32A 1SBTA 1U1CA 2C99A 2OCGA 1EHIA 2RAPA 3KJQA 2ST1A 4C08A 3ODPA 1A8QA 4YDRA 5AJXA 1K6MA 1ZH4A 5I8PA 1UBEA 1C1HA 2M6SA 3ZGOA 4XFJA 3IQZA 3QEKA 5EXPA 1ST2A 1W76A 1YB4A 2J3DA 3P97A 4KAXA 3VHXA 4DLBA 3DMTC 3DV0B 2X9NA 2QMUA 2ZUSA 4HRXA 3GGSA 3IRUA 3HRIA 3GWGA 2PVCA 4FB5A 3OTOB 2PUAA 1POXA 2XUGA 1BC5A 4RKYA 4A8PA 4R54A 2FFRA 4FFOA 1L5ZA 5CGQB 4DJFC 3H97A 3IAXA 2OQIA 5G4KB 3W5SA 3GFTA 3OEHA 2JDIA 1FDTA 3QRWA 2W6IA 2QN3A 2P69A 2XE8A 1P5ZB 3DEIA 3RC9A 4MV7A 3GEEA 4LJAA 4BL5A 3KZNA 4ALNA 1T1SA 3G1TA 1XD9A 3RARA 3UOWA 4ZZ2A 1Z33A 4MB2A 5CB4A 4KQ2A 1JU4A 3KDSE 4K9KA 1K6IA 1I1NA 4DMFA 5KPDA 2B9EA 3TNYA 3DLCA 4LDJA 4O1MA 4G26A 1BXRA 3DPUA 5K3SA 1R6AA 4N40A 4OK5A 2F1JA 3A05A 3SHFA 1OBVA 2C07A 3R0QA 3V9PA 4X6YA 1XVLA 2ANBA 2HBZA 3A9SA 4BO2A 4F1JA 1CUUA 4M46A 3VM6A 3VZDA 1EG7A 3ESRA 2UXBB 1JR3A 1VRCA 3O1IC 3K5IA 1JNYA 2QJTA 2UZ1A 5CCXA 2IZ5A 3GRRA 2WG1A 5LP6C 1NVVQ 1WU7A 2X7JA 5DM70 2D1SA 3U3OA 1DUSA 3A14A 4AM8A 5HPYB 3IPLA 5I9SA 1O6CA 1VPEA 4GL2A 4LDAA 3DO5A 1II8B 2CUNA 2PQ0A 4AMUA 4NENA 2O8FB 2HK6A 4LXIA 4UAJA 4MS1A 1XVVA 3HA3A 4B31A 3E4DA 3VYUB 1VE3A 1XZLA 1Z28A 2V8OA 1JAYA 4RESA 5A1JA 3KVYA 2Z2IA 4GW3A 5B3AA 4CV3A 2I2FA 4BCCA 1EA5A 4ZANA 1L7AA 3VOAA 4ZVNA 1I4WA 4TZTA 4ARVA 4UOZA 2VF7A 3AO0B 2VTKA 4Q82A 1QZXA 2PL5A 3PHLA 3PXEA 4X1KB 2VTEA 3ZZTA 2YINC 2CVFA 5DCWA 1CYDA 2XJ9A 4PE5B 2GAFA 2IITA 4YAFA 5COQA 3FI9A 3LCMA 4PSDA 1Y82A 1CQXA 5K8JB 1TZBA 4EL0A 3R3YA 4MRMA 2W98A 5IKPA 4UTZA 1OZ0A 4FCWA 1A72A 1XWIA 2XRMA 2H08A 2XDQB 2JJ2D 5KTYA 1K92A 3F2VA 3BICA 4LRTB 3GT3A 2BC9A 4KMRA 1I2DA 3KR2A 1H1LA 4IJWA 4JR0A 4WNAA 4TOIA 4EGJA 1WXDA 2RJOA 5TRTA 2Z6QA 4YMUA 1REQB 5ALFA 5D8DA 2VP6A 2ZI5A 2QTNA 3R7SA 3BILA 3NORA 3PE3A 4IDHA 2LV8A 3I6BA 5H82A 3JWEA 2X14A 3RD5A 1DJMA 2D1FA 2Z4TA 3LG2A 1QHYA 2WD9A 3A28A 3V6LA 4BUCA 4CDRA 2IPMA 1XA3A 4PPNA 1SC9A 3TKAA 1GKKA 3AFHA 2J4DA 1X3SA 3FDFA 3ACBA 5HF6A 4OOEA 3RC2A 5EY5B 2OPBA 2R9VA 3K20A 1JSXA 5BSKA 5HBRA 4IS2A 3R0JA 3FE2A 1GPBA 5CYGA 2HA6A 1T6NA 1W19A 4JC4A 2AFIE 3AHGA 2OVBA 1NG1A 4MYUA 4P9NA 4K0KB 3ER9A 2MSNA 4JT9A 3JARB 1SJ9A 4N3GA 5CLHA 5SYAA 3SICE 4B8YA 4FB4A 5CCEA 1U0GA 2HADA 2OG1A 1EUCA 1ZY2A 1JHPA 1KU6A 1VCIA 2N75A 4IFIA 2DRIA 5T8KA 1YQDA 1KJWA 2ZBPA 2O2DA 1GDDA 1KGDA 4DR6B 4CMCA 1WB5A 4I4LA 4OBBA 1XNGA 1LPSA 2H52A 4LJ7A 2LIVA 1COWA 2CXPA 2OCYC 2V5UA 4QPJC 3SC2A 1ZZGA 3X2SA 5KTPA 5L8VA 3REFA 4L3VA 4XDZA 2XA2A 3P9ZA 2BELA 3F9RA 2YL2A 4RJLA 4P4TA 4O2AA 2PV0A 4YAEA 2NV6A 2QHXA 2WUGA 4P54A 3I0ZA 4FR5A 4UQPA 5G1OA 3THSA 1UMKA 1NAIA 4WESB 5E8RA 4JUIA 3KQMA 4ZN6A 2FPIA 2WJGA 3ZK7A 1G5TA 1KK3A 2PGXA 4TZKA 4RTQA 5ES4B 3DONA 2QN2A 2VT2A 2WAMA 3GGOA 4P84A 1LPMA 5D1NA 1RZRD 3QHQA 2V96A 1LWOA 1JAIA 1YDHA 4QHTA 1EM6A 4GMFA 4DCOA 3QQ5A 4NRDA 4ZI2A 2BM1A 4OHPA 1MX9A 2CSUA 4N0MA 1K27A 4RFLA 5TB5A 3OPYI 1PSDA 4CBVA 1WV0A 2V4UA 1G6OA 4MW2A 5BUSA 5EQFA 2H2WA 5IS2A 3C3MA 1L5YA 3MINB 2WTBA 4IIJA 2VRNA 4IQGA 3CTMA 4D0LB 3T3EA 3HJCA 1RDFA 4GBGA 3KFLA 4QTTB 3L4KA 3WK5A 4RM3A 4XJTA 4ZVOA 4MA5A 4KR3A 2VF2A 1L7PA 3LVRE 5K0SA 1M5RA 1JI3A 3ZGNA 5BYAA 1GTL1 3IPYA 4N47A 3N2EA 4AIIA 5F77A 3D3EA 1P7PA 3DDNA 4FSHA 3IP6A 3BD8A 1BXKA 1WUIS 2IOHA 1U7XA 2O0KA 1F4PA 3AHFA 3DFFA 4MQLA 1ODTC 4U2BA 5BQPA 1MIHA 3B53X 2ONJA 2B5VA 1IY2A 3E9MA 3NYQA 3GVPA 1XZQA 3TLZA 4D8UA 5FLEX 5B7GA 3CNLA 1ZJWA 3PLAE 4PZYA 1SXQA 2Q27A 1Y89A 4PXYA 4AG6A 1TQ4A 3CLKA 2ZTHA 3F9IA 1A4UA 3QJYA 5AHOA 1EFLA 2X8LA 5JS2A 4LHYA 2EP5A 5IBQA 4AVYA 3NCTA 4R01A 1TEXA 4Y2JA 1Y8RB 3LUBA 1TLLA 4N3CA 5H0IA 3T9EA 1JA0A 1A82A 2J9XB 3EEQA 1J70A 1GR0A 3QBEA 4M0CA 2VH5R 3NV7A 4M22A 3NTRA 4WK0B 5DP1A 5FDFA 1BTOA 3AEYA 5E2IA 1NV9A 1KZYC 1SVSA 4GOLD 3WV5A 1S7CA 5BN3A 3TF5A 4BWYA 3R9XB 3RV3A 4YRGA 3MSCA 1DIGA 2BRUC 2OM2A 2WJWA 2Q2NA 3H7AA 3NXKA 4XEUA 3RS4A 2IOQA 3VR4D 1J6UA 3M70A 3M6MD 1KO7A 2WTUA 1C7RA 1JIQA 1R8XA 2OFOA 1EE9A 1BCRA 3GPCA 3IX7A 4TS3A 1N9KA 2IDZA 4MV6A 1SKQA 1JLRA 4RHXA 1QTQA 4Q05A 3O73A 4UCXA 4X64B 2L18A 4JJ8A 3NDJA 5KVSA 1WBBA 3CW9A 1AF7A 3D1JA 4LMRA 4TWAA 3HTXA 2YJTD 4R3NA 4X97A 3V1YA 3OPYB 2GYWA 1EH5A 2I4MA 4J1SA 1C9YA 5CA0B 4L4RA 1PT8A 1G64A 1HETA 2AQHA 1SCJA 2VDRB 3CZ4A 3HEAA 4KO8A 2A0KA 2EKBA 4V0KA 2FN3A 5U4QA 4D41A 4JUCA 3TXAA 1C1DA 4FN5A 4IV5A 4G0WA 1V8ZA 4FEYA 1LVGA 4E12A 4GYJA 3MF4A 1ELOA 3D8NA 1CY0A 2C0QA 1HEUA 3DT9A 2DPGA 1P2GA 2AG0A 3A6FA 3PWKA 4EMBA 2EZ9A 1Z8HA 1KI4A 3DQPA 3OKCA 4HH1A 3SEAA 4WOPA 4M0KA 1LPNA 5FBQB 3BHJA 3T7EA 3TRJA 4DRXA 2GEKA 4UUQA 1SA0A 4Y9TA 4ES6A 4HWOA 5JS7A 3CRW1 2C88A 3VV3A 4UZSA 3KCNA 1PNRA 2EIHA 1R8JA 3W5BA 3ADDA 3FLMA 1XL1A 3RK4A 1V37A 1H6BA 5GOZA 3IQXA 3PLNA 2WDZA 2R6JA 3ANMA 2OL4A 3WL6A 2EQBA 1PYDA 3G59A 5JQWA 2VOEA 3A1VA 1Y1QA 4JGIA 4BUZA 2GBIA 4CMIB 2WWWA 4EGQA 3ROXA 2F3RA 2ALJA 4GKVA 1GCIA 1FRZA 4ZO6A 4E2YA 2CFCA 1A2QA 4KXLA 2MCFA 5DXJA 3WICA 3CVVA 4XR4A 3P52A 4RMJA 2AV6A 4EQ6B 4FDMA 1NFRA 3EUEA 1SU4A 4EFNA 4QYMA 2I4NA 1TCUA 1T4GA 3LP5A 1R6VA 2XDAA 1E89A 1Z3CA 3CV3A 3GFRA 1X1AA 4B17A 1RS0A 3I2FA 3N76A 3P5SA 3T5TA 4ZMSA 1TAQA 4U2GA 3UXHA 3GLHA 1C4WA 2PGIA 2CE7A 3FTCA 4HDMB 2FZVA 2VSNA 3ANYB 4Y2TA 1SWWA 2IU4A 5IVIA 3TNDA 6REQA 5BQ3A 2WFMA 4K9QA 4IIBA 2NUBA 4RS4A 4I1PA 4NV3A 4NULA 3KYIB 4WZ6A 4P2GA 2EU8A 3L1KA 1NUPA 5EE5B 2WYWA 1Y80A 1T3HA 2KB0A 4ZYZA 2JLCA 4D46A 2K4MA 5AK6A 3C3EA 1SB9A 2Q3LA 5C37A 1XF1A 4PLFA 5IAOA 1RI5A 1R0RE 3C6KA 5JMWA 1EJ2A 4ZRNA 4JQOA 3VR2A 5FTLA 2MSKA 4Z99A 4RD1A 3OECA 3AF0A 4KRGA 3PE6A 3MJRA 4KX5A 4I1IA 5T8KC 6PFKA 5JD4A 3PEYA 4ID9A 1G8KA 3G2KA 3IIKA 1T2NA 1LDMA 3GJZA 3OTIA 5M7EA 3W6UA 1OXVA 4KPGA 4DV1B 3M5DA 5JDIC 3N2GB 4R3WA 3AUSA 3BAFA 1XZNA 2J08A 4LBYA 4PSUA 3W4KA 2OKGA 4OKNA 4FMPA 3IHTA 4GT1A 3WGGA 1ZWLA 1NLZA 2DFTA 3H8VA 1UFVA 3F6EX 2X0DA 4JYZA 1EGHA 3D2BA 1AKNA 3TW8B 1MO5A 4WKGA 2HQOA 1QFSA 2TYSB 4JELA 4LE2A 2I2BA 4IJKA 9LDBA 3PUKA 1QP7A 4MUGA 2QTRA 2O1EA 2QTBA 1WF6A 3ESXA 4ND5A 4G4SP 2NU8A 1UANA 3O4FA 4GMHA 2HMAA 5MFPA 4HHEA 2DERA 3DOFA 2YIVX 1N5LA 3E15A 2QVYX 2CMDA 1VA4A 2CUTA 3UG6A 2EX0A 4QOFA 4IZIA 2PMDA 1J8MF 4B6JA 1B8VA 1OPXA 2JAQA 4QOJA 4PV7A 5KX5A 4E22A 1CJTC 2X8JA 3D1VA 2BFMA 2P5TB 3QEOA 3J7TA 4GBMA 2PH1A 4RHCA 4JDUA 5EJGA 4HGPA 3VNAA 1NDUA 4LCJA 5CX4A 3ZVLA 2WP8J 4V0SA 3NAGA 1Y4AE 4GBJA 5ECWA 1TYAE 1SXGA 2J3MA 3WGYA 1YULA 4D45A 1M0TA 3DLTA 5KHOC 3L7YA 1G4AE 1JFLA 4X6LA 1JIJA 1GA1A 1KR2A 1B93A 1Y6FA 3FXAA 4XJVA 3V2GA 5E9AA 3I2KA 4FDUA 1PS9A 3VZRA 2NX2A 3K73O 1FVOA 3DTYA 4MKZA 2AR9A 3CX8A 4NENB 4PXSA 4L9RA 5DK4A 3T4PA 2WIJA 1N5DA 3BD9A 3T3IA 1P3JA 1PT7A 2Z8YA 2PS1A 1KVRA 3N8HA 4H77A 4NMXB 4ZXFA 4CTJA 2O8DB 1V4BA 5P21A 4QNRA 3OF5A 3VI3B 4UBJA 1GTJ1 1CWUA 3WLKX 1B73A 1VKJA 2ANCA 3LP8A 1ZIXA 1R0WA 2QT1A 5LN1A 3HADA 2I6QA 1JEOA 5JV5A 1IDOA 4ZEMA 1RYEA 4URUR 2N9UA 2ZBVA 1YFZA 2VJKA 3GMDA 5IBRA 2GILA 2VJQA 4TRNA 4EATA 3EPHA 3ZQUA 1L5RA 3QUTA 4TRJA 3E7DA 3BBPA 3ROEA 1GXSA 1OBHA 2D6FA 2Y1XA 4ALMA 4BFVA 3SCZA 4CFZA 2GK6A 2NXCA 2Q5JA 3HBFA 4IQ0A 1ZK2A 2XPCA 3MERA 3A7DA 4G5QA 4K3VA 1HC7A 2FDCA 1T5HX 3KJIA 4OSEA 4CPDA 3AP2A 1RAIA 5LBIA 5LL6P 3WA7A 1SD2A 3K5WA 1LDNA 1KFEB 1WLYA 3I6ZA 1OTYA 3FFXA 1DAFA 5G4KA 2QVLA 4DV4B 5DX1A 1GIAA 1Q15A 3EE6A 3PWSA 4Z3KA 4Q39A 5BNTA 5ITSA 3OQMA 5ADVA 1QO0A 1UFOA 2NADA 3OZWA 4Q18A 3LW8A 1C1DB 3R1IA 4OM7A 5E6RA 3U13A 4CM9A 3QKTA 3JVEA 4P80A 2QKYA 3EODA 1BHO1 1GV0A 3FX2A 3KSRA 3V7WA 3SZ3A 4AJKA 2Q0HA 2EX4A 1PT9A 3ELUA 3Q3EA 4Q48A 4LK3A 2LIPA 3RU7A 1TW3A 2QJRA 4X92A 1E1KA 1HM5A 2BFEB 3KTAA 3OCUA 3EZ7A 3PGVA 3HR8A 1ORTA 4WV3A 5TVKA 1MB9A 1B1CA 5H70A 1Z7EA 1GDHA 4L08A 2H0AA 2XBLA 4ZOAA 4QTUB 1Q0RA 2O0MA 1SHKA 2RHOA 3U7QA 1AV7A 1JTEA 4CCAA 1ZG3A 2VHXA 4JLWA 3HVJA 3DLIA 4H0NA 3OWXA 3PCXA 4OMDA 5J2UA 2E49A 1U8TA 1PBNA 4JVNA 1JT9A 3FDZB 4FDLA 5HIKA 3GJ0A 3ONWA 3O91A 4ER7A 2J32A 2GVZC 2FB9A 1BMQA 1Q44A 1QIEA 2PDAA 3MAJA 1OXSC 3OO1A 4UHKA 3GJSA 4RD4A 1KE2A 3S99A 3T8YA 5FI5A 4C0QC 4AF8A 4EEKA 1EHCA 1HT1E 3LMKA 1UBGA 4XPIA 2A9RA 3D3QA 5EZYF 3VYRB 3JTMA 2VPPA 4XLLA 3L0SA 4X3PA 4FGZA 4C03A 2DCUA 4R9VA 4AP5A 2WVGA 1QP4A 1JDTA 4Q34A 1P0CA 4P4UA 1QMGA 3RKSA 2H07A 3T7IA 1PEYA 4JD5A 1OLOA 4RIIA 3K8ZA 4NLLA 1XD2A 3JRXA 3KAQA 4MICA 4BFXA 2NZWA 4M9ZA 4HT3B 5GM2A 2GPWA 3KHTA 4IOMA 1Z5OA 3AUXA 4KLCA 4YJDA 1JFSA 2F43B 4O4HB 2UZ3A 3GLRA 3P9QA 3QF4B 4O2BA 4YHBA 1HL3A 2X1VA 2XNJA 1PIWA 2X15A 3MPOA 1XOIA 2C9OA 3CE6A 3IXQA 3L0BA 2F9LA 3CH6A 1BE0A 3N5KA 2G9NA 2X86A 2ZRMA 2OYRA 4X7PA 4WXRA 4CF7A 5AIBA 2W2NA 1VE5A 4ETIA 2CXXA 4NL4H 4ER6A 3N5CA 3WKAA 2IF2A 2IODA 3MXTA 5KJEA 4Y2SA 1IHXA 3U60B 3V8BA 2PMBA 2BMFA 5CR9A 4RTOA 2QS9A 1PJQA 2UVQA 3BK1A 3MWDB 4JZYA 4JJ7A 9GPBA 1V6AA 4MWGA 1PQYA 4YGYA 1OFHA 5EIBC 2HU2A 5C4MA 1ZK4A 2Y0BA 4HLNA 1F8XA 4FE4A 1KIFA 1D8TA 3GX1A 4ND3A 3CA8A 3X1WA 1N3LA 4DMCA 2VJBA 1KVTA 2FG6C 1Z62A 1HQKA 2FRVA 3DUFB 5JDIA 1RM4A 4BMNA 1AKWA 5DLEA 3DF7A 4O02B 3UATA 3HCPA 4DAOA 2FEOA 3PCTA 3G02A 4HLUC 4D9HA 3TZBA 5CCBA 1JE1A 3WHPA 2RBKA 1MJGM 3TEMA 1MNQA 5KX5B 4DLRA 1XUOA 2HIHA 2XB8A 3IUPA 4YRLA 3SN6A 5T6BA 4D6PA 3HNRA 2JJ1A 4CTOA 1YBVA 1G20B 1HPLA 2Q5HA 3QW4B 3W6ZA 4A5OA 4F8EA 4Z1MA 1OC2A 1P77A 1VPWA 3SZGA 4H6WA 4TMYA 3DYBA 3IKTA 1OV4A 2O8EA 1L8OA 4FZ3A 3UWKA 4AO8A 1RRCA 2P4UA 1JA1A 1FRQA 4NK5A 3QOFA 3IKVA 3O8RA 3UH0A 5LB4A 3BULA 3IGFA 1UBFA 1WX1A 2ZWVA 3N0XA 1JZSA 5JAOA 5H9WA 4DN6A 4MRVA 5CVEA 5IC5A 3ROTA 3RSGA 3MW8A 4N5LA 1XP5A 1PFQA 1XEFA 1MIOB 1IXRC 3KWFA 4TLEA 5KB3A 4OGFA 2FZ4A 4DLLA 2ACWA 2OORA 3V8QA 5BUZA 2A9OA 1YL6A 3EZNA 4RSGA 1FFGA 3I45A 4ENSA 4G25A 2FMFA 3FSRA 5LD2B 4QAJA 3RE1A 3ETNA 1YJQA 3NASA 3MWFA 2Q2WA 4GR9A 3QKSA 4H3VA 1LNQA 3TR6A 1X7HA 4ARZB 2BTQB 5IDQA 4AXXA 5K7SA 2E18A 2EZUA 2XVAA 3L93A 5JYDA 2X58A 3AVQA 5IF3A 4Z7JA 2A5YB 3H9GA 2YV1A 2C3UA 5CA1B 1E1RD 1T1JA 4IKPA 4OQDA 1W46A 3PQEA 1LPPA 3GROA 4EL5A 3FOEC 1WB9A 5LLTA 4BBPA 5KOHA 2Z5LA 1YQGA 2DBQA 3RUPA 1T2CA 4N48A 4N6NA 1S2DA 2YMPA 3A6LA 3JYQA 3R20A 5EMMA 4CKBA 5JTTA 4C0XA 5EGNA 4RQTA 3X1ZA 3U48A 3G8CA 1R74A 3O1LA 3Q40A 1T1EA 3CPHA 1USUA 1A2OA 1ETHA 1G5IA 4IJMA 1RABA 2VK1A 3DPIA 4DR7B 4NONA 1KYIA 1JJVA 2QLJA 1A1SA 1R5NA 2OOSA 4KAJA 5EXDA 1KORA 1PDVA 1SXJC 4RD2A 5FLYA 5IZCC 1PLJA 4B9AA 2RI6A 2CUKA 1GRVA 3PR1A 5CFQA 2IF0A 3SDZA 1L7OA 2YOHA 3BOSA 3MJSA 3DE4X 2WJJA 2ZJOA 3KQTA 1RVV1 3P9NA 2EZ4A 2P9GA 4HDKA 5T6MA 4JI1B 3FKSD 4B84A 2ZT6A 4ZKDA 2G9ZA 3EAFA 4B6EA 5CBPA 5JJIA 1PNOA 4MRNA 4ZVUA 1Q14A 4RHEA 3LLVA 4ZT6A 3WLEA 4BNWA 2X13A 5TPWA 2X1HA 1O8BA 3KJXA 3LGSA 3PUVA 3VRHA 1VJCA 1DFGA 4XD2A 1Y7PA 3PYXA 3KKMA 3OBIA 4D57A 4E4YA 1T9BA 1JF8A 2VUHB 4PSKA 1G8AA 3WNZA 4JUAA 5DHTA 5JASA 4XPZA 4LXXA 4DM3A 1YDMA 3TI7A 1IWPB 1YNSA 5DTEA 3UB3A 2W2MA 2QL5A 3E7XA 1YS9A 3VKUA 4AX4A 4CTKA 3A3OA 1FP1D 1N6OA 2PAAA 4WKCA 5K8VA 1QC5A 2C9DA 4G67A 3TTUA 1SEVA 4BLVA 1I2AA 3DSRA 1RZ3A 2IZ0A 2A30A 2QL9A 4JWTA 3VJLA 1GZ4A 1SIBE 3DNMA 4MLZA 3PHHA 2QSZA 2HGZA 1VHJA 3EIUA 5AKLA 2G1PA 1CUBA 4J0JA 3ZK9A 5DTQA 1ID8A 4J7XA 1C1XA 2BFEA 1RIFA 2QU7A 2NWQA 2OOKA 1VKOA 3EBLA 1FE8A 5DHQA 1N9GA 1MAUA 4KZKA 3UXMA 3DCIA 4DRYA 1P2VA 1YA8A 1NYQA 1KEZA 1M0WA 3MCVA 4BTLA 4A0FA 1DCTA 3B1XA 1A5BB 1PZFA 4E5YA 1OPRA 1LSUA 1P1JA 1X7GA 5KYWA 2AYYA 4LOAA 4PYOA 3RWBA 4OQEA 4JJIA 3Q1LA 2JKVA 2XD9A 4G8JA 2B2CA 4OQXA 1FZTA 1E9VA 1NQOA 1ZM9A 2WA1A 2VK8A 4XRGA 4Q24A 3CR8A 3BT7A 2F62A 2H59A 3A1CA 3L8GA 4HNAB 4FFSA 4NYMR 4NJOA 3UT6A 3TB6A 4M1MA 4JLUA 3I30X 4HN4B 3ZCRA 3IP8A 1Q0PA 1EDOA 1T8TA 2YMMA 4JI7B 3IKJA 4NMWA 3AG6A 5GM1A 3BUSA 1Y6RA 1OROA 1KE1A 4BVHA 3EXAA 3IEKA 2AC4A 2J0VA 3GI1A 1MNAA 2Z3ZA 2V7EA 4KE8A 5E1OA 1YHYA 3QSGA 4KBFA 2B94A 3EMKA 2QTMA 2W2KB 1K2WA 3ZBQA 1JHRA 4L50A 4TWJA 3RAJA 4TT3D 2QMOA 2M9MA 4I3FA 4FWIB 4ZU1X 2P77A 4X3CA 4BU1A 4OQPA 3L4JA 4KXVA 6GPBA 1P4HA 1PFKA 5KX5F 2WYVA 3AFNA 2IEIA 4LQCA 2DGDA 4H1VA 2Z9BA 2FSSA 1Z2NX 3L1VA 4D4HA 3EWSA 2MINB 3MEQA 4WUTA 3K6SB 1QXSA 5HIIA 4KGVA 1YI1A 2BVNA 5I4KA 3CZPA 1BAPA 1QPGA 3WNDA 2ZDHA 2ORYA 2HMWA 5I6DA 1KEPA 4OP1A 2P2LA 3PRKE 3U19A 1K7SN 3E1KA 1L8LA 4V39A 1FU8A 2VOJA 1DKPA 3P0FA 4Z9BA 2ZU6A 4HAZA 1P9RA 2ZR0A 3CH4B 3I2IA 2PUTA 4MIOA 3DMRA 4K6MA 5AKHA 2JCVA 3GEDA 4Q3LA 4A0GA 4BZQA 5HF5A 3VDNB 4C2UA 3P0RA 4BQOA 5AI6A 4F8JA 1ODCA 1CQPA 3BX1A 4PFQA 3IAM1 4MP3A 3T4XA 4BOYA 5HP4A 2CLSA 4Q1BA 3QTBA 2PN1A 1ZR4A 3FJOA 2GXSA 4I8XA 5ALZA 4X1IB 3NX4A 5EWJB 3B7WA 1CDZA 2EAUA 2C4HA 3HBAA 3L04A 5EXEA 1YCHA 4UHFA 4ZJZA 3R74A 5AOCA 5FI0B 1J09A 1FP2A 3H2BA 2MMCA 4PYLA 3K32A 4F93B 2C1EA 2PZMA 1XNRB 1YZ3A 2F00A 2IU0A 4LHWA 4FYVA 3R3UA 2OCBA 3A1SA 3IDQA 1EFPB 3E9RA 3R5TA 3D43A 5H4GA 2ZM5A 1OX5A 2FHPA 3TVDA 2YNMD 1KAHA 2NU8B 1AKRA 1M5TA 2Q4OA 3F46A 3RRYA 4HDRA 4S1VA 4QBKA 3D0KA 1QDLB 3CG4A 1MC1A 1XN4A 4PFKA 4ZAYA 3VGPA 1A1VA 4EW6A 4FYJA 2YYYA 2O2XA 5DEIA 5SYMA 1UXIA 2NNWB 3NIWA 4K28A 4INZA 4J91A 4ENWA 1N77A 5REQA 1Z5VA 3RK0A 2R7KA 2OHIA 1GZUA 3AR5A 2JLQA 2ZRQA 1KY3A 4H7IA 4BVKA 2FEAA 2I29A 3FIJA 3AR3A 1R64A 3EF0A 5KJFA 1UFRA 2YN0A 2C42A 4L4YA 1H6CA 1OH5A 1K7CA 4JNCA 4LZLA 4ZOEA 2B9VA 3ZX5A 1HGXA 2X3FA 1ZM4A 3TI9A 3BF8A 1TQHA 4XASA 1UKCA 3CZRA 1Y8AA 3M3HA 4N8EA 2A92A 5KVQA 4HAXA 2O19A 4U0JA 5LZ8A 1B8PA 3MVEA 1CG6A 2CN1A 5IFKA 2O7NA 3KAPA 2BKLA 4FT2A 4YBRA 4DWOA 1AXRA 4BZXA 1E2QA 3K1ZA 4B6GA 3B1FA 2FW0A 3E58A 2JIDA 1BD4A 4KGDA 4R2JA 1T1IA 2ZCVA 3ZE2B 4D44A 5FLKA 2WT9A 4U00A 3TSZA 5J4YA 2YXDA 4YJGB 1XALA 5DWDA 3VUEA 3P9SA 1D4FA 1YOVA 4BRUA 1C80A 4CI9A 3DVLA 2Q4TA 5BMOA 3PQ7A 2D7DA 1DWUA 2IBMA 3HY6A 4RVUA 5CRIA 3B85A 4LRQA 1CNEA 4FE3A 4H7JA 3C70A 2P6NA 4DLUA 1PYOA 4HK4A 1JV2B 7AT1A 2Z30A 4C7KA 4NAUA 5LZ2A 1XK6A 4EUEA 1G9TA 4WIAA 2XUFA 4Q7KA 4GSYA 4U9IS 2CB9A 2M1ZA 3CCCA 5HEKA 2ADOA 5DPMA 4FOSA 1XLUA 3AI3A 1E4YA 3GA7A 1FYFA 1XCLA 1RD4A 2B69A 1SM4A 3CN7A 1U2RA 3A4VA 3R0XA 3M6UA 1L4HA 3CZCA 3TPZA 1J1ZA 3PWTA 4GVXA 1IZ8A 4ZMRA 1OD6A 2H11A 4WX2B 1P5FA 3M49A 4CMHA 4LSZA 4XVQA 4HUTA 1CS0B 1E18A 2XYRA 2ZYDA 4BKQA 1OFIA 1QK4A 2XTMA 3AIOA 3EXHB 3KZOA 2DFNA 2R1TB 2YR0A 3NOVA 1O5TA 2W11A 3JD0A 4Y1RA 5LLDA 5FUVA 4L22A 1OBOA 1FYEA 3PC2A 4EF4A 5DEOA 2P5SA 3BSFA 3KZXA 4L02A 3T15A 4UNRA 4MGHA 3DG9A 2AG1A 3O4HA 5F9HA 2INGX 4F3RA 3H2HA 2R8EA 1R8SA 4GOND 2FWMX 3HXQA 1E5XA 3VH3A 1M6EX 1ZH8A 4BLRA 1DXYA 2FFQA 1FDWA 1RJ9B 4C4RA 2YH2A 1K4YA 4WLEA 1P61B 1XCGB 2G9RA 4LV5B 3DW1X 4XLTA 3A70A 2BP7B 1YBHA 4X00A 2OAP1 3E9QA 1X8JA 3G2LA 1PGNA 3PRJA 4AY6A 2J5RA 4X3OA 3GJYA 1XHFA 1J5XA 4JB8A 3LNCA 5FFFA 1SY7A 4WGFA 1RNLA 1T36B 4M0FA 3LA8A 4FFBB 1ZD9A 4DTCA 1RI2A 2B4AA 1DIBA 1F2TB 3U3RA 4X44A 4PZDA 4B3GA 3NDIA 1PJCA 4XDGA 4Q21A 1TM4E 3DTNA 2K5UA 1CZHA 3A4NA 4CT4B 3TFOA 2OMEA 5EE0A 3RT1A 1GEGA 3QLTA 4UTNA 1G8YA 4OUKX 3M6XA 5H83A 1BXGA 3ZCQA 3VMFA 4D5GA 3ZWDA 3HCBA 5K8CA 5BN1A 3NUGA 3PHCA 4XARA 5KYWB 5M34A 3TDKA 5EXTA 4RPHA 2I91A 1GCOA 2FK8A 3GB9A 3AFIA 3AHDA 4LQ4A 5F5NA 4OGKA 1D6NA 1HMPA 4ZHQB 4WZBA 3OEED 1JFVA 2PYIA 1PG2A 3F4LA 4ZU3A 5K1ZA 1RAEA 5F23A 3W9BA 4P38A 1NE2A 4H6VA 5JS8A 1ZGCA 2HA7A 4LWOA 2CMFA 1HFEL 3FGNA 3FDJA 3H75A 1OY1A 5JHHB 3M4ZA 1QDEA 3BDAA 5EESA 3JASA 3GDFA 4F5EA 3KKPA 1F12A 1TVKA 1PJZA 3NNSA 3RVDA 3AM4A 1LQ2A 4EIWA 5F5LA 4DDUA 1OFGA 1TCBA 2HHJA 2ZWOA 4LFAB 2ASEA 2GZ2A 1T2AA 4MWEA 2JCGA 4GLLA 1GKYA 3R5JA 4IJ5A 4P4NA 4AZWA 2JFQA 3B9PA 3THYB 1EIWA 2C8VA 2EJWA 3ZD6A 1IUPA 4JQSA 1T5IA 3C3AA 3REOA 3ERCA 1WF3A 4XX1A 3FJ1A 3A4TA 4LNAA 2ZUUA 3JD3A 5EIBD 1EVQA 2WHQA 3AIIA 3ETDA 4YJKA 5TVGA 4ZI7B 3AW9A 4BX9A 1VIYA 3I2HA 3LPNA 2ZRIA 5EQTA 5BO5A 2HDNB 4O8CA 3IE0A 2JASA 1E59A 5D86A 3TQSA 1Z68A 2H65A 5EIOA 2IGTA 3P20A 3V3KA 1AKMA 1H2XA 4K5QA 3VKFA 3WIUA 5E0KB 3OOHA 1Z0JA 3UAGA 2H1FA 4L07A 5K4GA 4DPMA 4LBZA 1G4UR 4X6XA 1U3CA 4BNJA 2WOJA 3OHMA 3M1IA 1O6ZA 5A3SA 5AM2A 4GPAA 2G5PA 4BQQA 2VP4A 1MJGA 2G3YA 1SH7A 5A05A 1ZNWA 3HCCA 4RPKA 2ZRCA 3RS2A 1UPXA 4AKEA 2Y2VA 3GLFB 1Y4SA 2YJ3A 4JSTA 5G41A 3OE4A 1SBIA 9ABPA 3BWCA 3UHFA 3KPUA 3K8QA 4GOXA 4OTZA 1VI6A 1XTUA 5FNVB 3VPAA 1GY8A 3WB2A 3X1YA 1SKAA 5FWXB 4Z9FA 1E1CB 2C96A 2GBLA 2B4QA 2IPOA 3KFVA 3OZBA 4RCYA 2JD2A 3ZCVA 5HS4A 1EJ0A 4MDFA 2ZI6A 3OIUA 1UC4B 2OK7A 2PCLA 2PKRA 2J48A 4CE6A 1SN7A 2AD1A 3PK0A 3KE9A 1ZEMA 5YASA 3GPIA 2OBBA 1FFBA 3AMVA 2JB9A 4IZOA 1IU9A 2QBYB 5AHWA 2ZI7A 7ABPA 3OC0A 4KPUA 4L9AA 4MMYB 4CKYA 2H00A 2H85A 5FL7A 3DTVB 1S8OA 2JLBA 2ZXFA 3PQ2A 4L0MA 1AS2A 1IY8A 4O1HA 5I7AA 2ZIEA 1AK2A 3AIMA 3MELA 3NRBA 5GPBA 1M75A 4GF5A 2NAPA 4Z4CA 1IVYA 1GGVA 1IB0A 1P60A 4TMKA 1KMHB 4FNGA 3M4XA 4XVCA 4I36A 1N6RA 3WWCA 4JP1A 2C3YA 2D13A 4E2XA 1OZHA 4HGRA 1W4ZA 1V48A 2NQTA 4GPBA 4PICA 4V02A 1X2BA 3WGJA 4K03A 821PA 3L7AA 4AJ4A 3IIJA 2FPGB 2MR6A 5KKNB 3VJRA 5AYVA 1YGPA 3JQRA 2QAJA 2ETXA 5EXSA 3WRWA 3L02A 5A6SB 3LQYA 4CM4A 1LDEA 1QTNA 2WF8A 5I7FA 3EBPA 2EV9A 2JHGA 3CUSA 4Q9AA 2QV7A 4HH0A 4XWAA 1M6NA 2ATVA 4RORA 4CEIB 2WZBA 3PR3A 4TKLA 4ZYXA 2HI0A 3MMZA 4LZJA