1XU7A

Crystal structure of the interface open conformation of tetrameric 11b-hsd1
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
263
structure length
263
Chain Sequence
QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase, isozyme 1
publication title Conformational Flexibility in Crystal Structures of Human 11beta-hydroxysteroid dehydrogenase type I provide insights into glucocorticoid interconversion and enzyme regulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xu7A00
3CMMA 3X2EA 3PEFA 4CLXA 5IFLA 4EDFA 3AI2A 4YT5A 4CLOA 4CUJA 2EXXA 2QHXA 4CODB 5U9CA 2FP4A 3Q6IA 3JQ9C 3RFTA 3TFQA 1UXHA 4XA8A 4IIVA 4BHTA 3LT4A 3PVZA 5TJHA 1AE1A 3AUAA 1HL3A 4Q3CA 3HHPA 3W8FA 1PU2A 2FSSA 2NU9A 2C2XA 2FPGA 3QE3A 1XKQA 1Y8RB 3PFWO 1KC3A 1FF9A 1D8AA 1FDWA 1XIVA 3L0DA 2NQTA 1D4FA 4CLOB 5KJCA 4CM7A 1LC0A 1Z7EA 2CUKA 4NBVA 4JIGA 3LT0A 3GNQA 3QY9A 2W2LD 4CM9D 2W4QA 2P4HX 4NJMA 3WBBA 1NWCA 4LW8A 4D41A 4J43A 4NFSA 4WLOA 3DBLA 3DMTC 3WFIA 4OOFA 4J16A 1XDWA 2PGJA 1NQTA 2OUIA 2EV9A 4W7HA 4E6PA 4PLFA 1A9ZA 5H83A 1S6YA 3JTMA 4Z0PA 1I30A 4BKQA 2BGKA 4J90A 4EUFA 1R12A 3H65A 1ZNQO 3I9LA 4OAQA 3RSHA 2J3HA 3A4VA 4KQXA 2BFOA 1Y8RA 3PQFA 1B0AA 1VJTA 4GWGA 2PFGA 4ZU3A 3WWYA 1EZ4A 4BNLA 3GHHA 2AE1A 4Z0TA 2CFCA 4B3HA 1UJMA 1WLYA 1N92A 4I5DA 1YJQA 4RVGA 1DHTA 1E6EA 1SO8A 3ASUA 3GN2A 3HB5X 1Q1NA 4JN6B 4QX6A 5EPOA 2X9GA 3ZHXA 1GZ6A 1BRMA 3SBOA 5IXYA 1FDVA 2CVQA 4NJMB 1YBAA 3JCZA 1Z73A 1MXHA 5K6AA 1E3EA 2B4QA 2Q2QA 1NPDA 3FWNA 5DCUA 2Q99A 4XYMA 5JE8A 2IZ0A 1DHRA 3E48A 3UN1A 1Y5RA 5A9TA 1J0XO 1DSSG 4CV1A 5IDWA 3FNHA 2WD7A 3A14A 3JYNA 3E03A 3NTRA 3WSWA 2FPIA 4N18A 2CSUA 1KVRA 2A92A 5I9LA 3T4XA 5L9AA 3EVTA 5DOVA 2RBEA 4J7XA 4WUVA 5I9MA 3PYLA 1EFLA 3HJAA 4ZN6A 2G5CA 3PJGA 3RUAA 4AJ4A 3H6KA 5DT9A 3KLMX 2DTXA 1LEHA 2D1YA 1VL6A 3JQ9A 5KVVA 4P4GA 1U3TA 3DMYA 3WYBA 1AN9A 5H82A 1WDLA 1F06A 5L7WA 3KUXA 1P0CA 2NVUA 2FZWA 2XXJA 3RJ9A 3TDKA 5L95A 4RPJA 3FR7A 1YQGA 3PHGA 2YDYA 1WXDA 2WD7B 3LYLA 4JBHA 5HS4A 4YAEA 2OORA 2EW8A 1ZBQA 3WMXA 4HWKA 4OMUA 3OP4A 1PGNA 1O6ZA 1LNQA 3HDJA 1NXQA 2C0CA 2CVOA 1L7EA 4RVSA 3S2GA 1E7RA 3CSDA 5BQFA 2B69A 4Y67A 4XJSA 4K26A 4BL5A 5GZ1A 3P7MA 2DBVO 4Q9NA 2UYYA 4IS3A 4A5OA 1YL7A 3DMTA 3MTGA 1SAYA 4FFLA 3WQQA 2NVUB 1GEEA 1HZJA 3HQ4O 1I8TA 4E33A 1KEVA 2HMUA 4GBJA 4ROSA 4MVJI 5G4LA 2ZTUA 2BHLA 3AOEC 3HG7A 3MWDB 5JLAA 1BXZA 2J3JA 4JX8A 2OOSA 2PLAA 4KQWA 5JY6A 4J4TA 5LDHA 4PG7A 3K92A 1X0XA 3IOYA 1EDZA 1IE3A 1KYQA 1LJ8A 3G1TA 4RVFA 3OQ1A 2Q2WA 1XWFA 2SCUA 2RHRA 2YHIA 3E9NA 4UVHA 5TC4A 1ZEMA 3P2YA 4WLNA 3X2FA 2WYWA 2BRUA 1ADGA 1PL7A 1ZJYA 3DQPA 1GUZA 3H5NA 2QZZA 5BR7A 3ETGA 4CV0A 4LRTB 1CIVA 1X15A 1EDOA 2HMTA 4X54A 4C7KA 1PGOA 4RQUA 3RVDA 4S3MA 2E37A 5KVQA 5A5EA 4BNGA 2EHDA 4WCDA 1OI7A 1X7GA 4GX2A 2PKRA 2WE7A 2IDZA 3TZ6A 2P2SA 2NVBA 3GR6A 1NPTO 2W2KA 3V2UA 2YHIB 1HLDA 1B7GO 4JQCA 4ZQBA 4J7CA 5HWSA 3IP3A 4XEHA 4ESOA 5B4VA 4FBGA 2PH3A 1GV0A 1I0ZA 1LRLA 3DBHB 4HP8A 3D1LA 1EBUA 1KS9A 4C7JA 4IUYA 1JDJA 3OQBA 3W6UA 1V3TA 4UUNA 3BHMA 4NU6A 4PLHA 2H6EA 4U5QA 3WX0A 3I3OA 4JJGA 3I6QA 2Y1FA 2ZJ0A 3EZYA 4R9SA 3AY7A 1DO8A 2FY8A 3LU1A 4J2OA 4DMMA 4CV2A 3K2BA 3W4JA 5JO9A 4JLWA 4YR9A 1DOHA 5ENVA 4L74A 2W2KB 1E7MA 2QQ5A 1OZAA 3HNPA 4DPMA 3ROMA 1O0SA 4XR4A 2FPPA 3NDJA 1Z82A 1NBOA 3RROA 4PG4A 3ITDA 2H1SA 2OMEA 3DZHA 4QECA 4HUJA 4I5FA 1QR6A 4MJLA 1I36A 3DZFA 4F3YA 5KVCA 1C0LA 1BVRA 1LSOA 3AOEA 2VNAA 4F45A 1GZ3A 4B4OA 1HF3A 3HWRA 4KUHA 1ENYA 1ZEJA 3ABIA 4OYRA 1P45A 3GRPA 4FFOA 4BO6A 1FDSA 3CZMA 3G17A 3ORFA 1M66A 4L4RA 5ADHA 3I9OA 3ZWCA 1VJ1A 1IZ0A 2WSBA 3VTZA 3OEWA 4O0LA 3GK3A 4H16A 5COQA 1X7HA 5FI5A 2O2SA 3O26A 3KRTA 4GH5A 1LI4A 3ZU3A 1ZSVA 1AHHA 1XELA 3UW3A 1U7TA 3JQFC 4WCFC 5AXBA 3K8ZA 3RASA 3WGTA 3Q1LA 1Z74A 3ZU4A 2DLDA 4EEZA 3GN1A 3GNSA 3RUFA 3V1TC 3WSVA 2X5OA 5TX7A 4R54A 4EEXA 1EVZA 2CF6A 4U7WA 5T5QA 5AXCA 5B37A 3KETA 2VWHA 2IYOA 1E3IA 3PGXA 4NIMA 1XA0A 4DC0A 3PDJA 2O2YA 1RM3A 3ENKA 3HFSA 4K28A 2DFDA 4YCAA 4BQPA 5C3MA 4FPXA 3KEOA 4J6FA 5A03A 2X0RA 4UVEA 3RKRA 4E3ZA 1T1RA 4DC1A 1GDHA 3E5MA 4G65A 5FI3A 4MVJP 4NBRA 2VTEA 1ZK2A 1E1MA 1H9BA 2VHZA 2TMDA 5CDTA 1A7KA 3SEFA 1XGKA 1SCUA 3GUYA 1VL0A 3OFSA 1HT0A 1VKOA 4A2CA 4XDZA 3F9IA 3WNQA 2CDBA 3GC6A 1G1AA 3WICA 2IYPA 1Z7BA 3AK4A 4YTEA 3I1JA 4BNNA 3Q3CA 4L76A 4B3JA 1TT5A 4R4JA 1X1TA 5L7YA 4AFNA 2NTNA 5DP2A 3SJUA 4RV9A 2Q1WA 2VRCD 1LSSA 1GQYA 4O5OA 3UVEA 1ZO8A 4RPLA 1H6DA 1B3BA 5CPFA 4CMBA 4IQ8A 3D5QA 3GZNB 5JYEA 1A4IA 4YAIA 3CIFA 2W90A 4OQYA 1H9AA 2X7HA 5THKA 4J49A 4LRSB 3GEDA 4XCVA 5JAMA 2Q3EA 4BO9A 4ND1A 2J3IA 3I83A 3VC7A 1L7DA 3K6JA 4I9NA 2GD1O 3BMOA 3RC7A 4RORA 3B70A 2NSDA 3QJ5A 4CM4A 1GL3A 3WBFA 3I9NA 1TT5B 2PH5A 4CQMB 3FD8A 3F3SA 1PTJA 4ND2A 3UHAA 1E92A 1SPXA 1KVSA 4HFRA 1TA4A 3JQFA 4WCFA 1HE4A 2ZYGA 4MVJH 4XJTA 4DA9A 3DC2A 2X8LA 4XR9A 5F3RA 3PJFA 1BG6A 3ZHBA 5JNLA 1JWBB 1LQTA 2VCYA 1FXSA 4UVGA 5THQA 4IXTA 4I1IA 4I9UA 5JDIC 3FBGA 4GX5A 2V6MA 4D0SA 1O95A 3BMOB 3HSKA 1C1DA 3WGIA 4DL9A 4CM4B 2O7SA 5G0UA 1M6WA 1Z6ZA 4FGWA 1I3KA 1ZK4A 3H2ZA 3LLSA 1QV6A 4E5KA 4WCFB 2AQ8A 1GYRA 1OBFO 1TXGA 4FOOA 2ILTA 3V5NA 1ISJA 2YFHA 1R16A 3HE3A 2P91A 2Z5LA 1RM5A 4DIBA 1T1SA 3BTVA 3MOIA 3U09A 1HYGA 1P0FA 2VUUA 2F1KA 1LTHR 1N9GA 1VL8A 4E2YA 2IXBA 5A04A 1U3VA 1LA2A 1A71A 1C1DB 2Q1TA 4YBZA 4DTIA 5IJZA 3KSUA 3EVNA 5GZ3A 3PLNA 4Q3NA 3H9QA 4L4XA 4GSKA 3C7DB 4EITA 2CVZA 4DLLA 3NGLA 4A26A 4XYBA 1W6UA 3TZHA 4IDBA 4ILKA 4TRNA 1QXSA 1AUPA 3H9EO 4TQGA 3WGOA 2V65A 2VT2A 2DBQA 1ENPA 2XXBA 3JD2A 4R1NA 4YT2A 1CF2O 3ZWVA 1E3WB 3B6ZA 3SLKA 4AJOA 2HRBA 4OKIA 1N9GB 1YQDA 4TZKA 4XZ3A 1A5ZA 2VN8A 1NYTA 1XU7A 3PJDA 4CR8A 4E4YA 4CL3A 5KJEA 4KUGA 1BXKA 4W9NC 5FEUA 4Z9XA 1XU9A 1DDOA 4RGBA 5L4LA 3ADPA 4JK3A 3TJRA 4AJ1A 4E32A 1CWUA 3ZI0A 3H9JA 3CH6A 5A02A 2AEMA 3IJPA 4CMJA 3AJRA 3D4OA 4IGEA 3RUEA 1IULA 2WMDA 4MOWA 1I2CA 1K6IA 1MG5A 3PWKA 1PJSA 4DIOA 4RQTA 1NHWA 5COAA 1KVTA 1DAOA 4R3NA 4MKZA 2C2YA 3EDMA 3DR3A 3ICCA 2ZCUA 1H2BA 3DAFA 2CD9A 5IN5A 3ZV5A 4D79A 2GYYA 1ZKMA 4A27A 3R6DA 4INAA 5DOZA 4RCVA 1ZXLA 1OC2A 3MZ0A 2PD3A 2JD2A 3D0OA 3K73O 4Y6SA 3MJCA 1B2LA 2WYUA 3OJLA 2QG4A 3NX4A 5CFZA 2AEFA 3D3WB 1ISIA 2UUPA 2W2LA 2XF8A 4L0QA 2B37A 3LC1O 1R0SA 1WZEA 2NU7A 3MJTA 2IE0A 3NDRA 2DVMA 2P5UA 1HDGO 4GVXA 1HDXA 2ZB4A 2FRDA 3BTOA 4I5EA 2Y67A 3C7AA 3DZIA 5MGBA 5HTOA 1HZZA 1KBZA 2PY6A 2EGHA 2QYTA 1SOWA 1GPDG 1GUFA 4Z0HO 3EUWA 4FJ1A 4EJ0A 5K9ZA 1UXIA 3RAJA 3VKVA 3PK0A 2D0IA 5ER6A 2JL1A 4B79A 2FWMX 2PK3A 3PIIA 2FHSA 3NJ8A 2BLLA 5EL0A 1K6JA 3BHJA 4HXYA 4LMRA 3HDHA 5TLSA 5KTKA 2X22A 3RBXA 4AICA 4NBUA 2EJVA 3GRKA 1ZH8A 1DC6A 2AXQA 1BWSA 4AJPA 3WDSA 3I9JA 3ETEA 2P4QA 4GWKA 4DYDA 1YRLA 3NT5A 4W9NA 3JQBC 3BZUA 3TQHA 2J5RA 3U4DA 2X58A 3PWZA 2YHUA 2VRBA 1GZ4A 1XQ6A 4R16A 5F21A 4WE3A 5IDXA 4LISA 3F47A 3DB2A 2FN7A 2P5YA 3PGJA 3ST7A 5L7TA 5JPIA 5DP1A 2PA3A 1JTVA 4M87A 1Q0QA 2C29D 4WK6A 1IPEA 1P9LA 5IN4A 4PZCA 3KHUA 3RCBA 2YUTA 4XWYA 1JLLA 2G76A 3QVTA 1HE2A 2UV8A 3TSCA 4H7PA 1GADO 3EMKA 1DFIA 2I3AA 3FNFA 4UREA 3DOJA 3OJEA 3JQAA 4CM3A 1K89A 1B8UA 2PD4A 3ZW9A 3AUSA 3IDSA 3WGGA 1CERA 3VH1A 2O23A 1Z75A 4EBFA 4XX0A 2Y93A 4BO5A 4FFRA 5IXSA 2DPGA 1UP7A 1R6DA 2HJRA 4JNKA 4BNVA 8LDHA 9LDTA 1YDWA 1D3AA 4HNGA 1PJBA 2VWQA 4YVFA 4DQUA 3OF2A 5U1PA 4GSLA 4R5MA 3LF2A 1U3WA 2J3KA 3INGA 3JYPA 3NRCA 4L73A 1DC3A 3V1UA 3U49A 3OSUA 4J9UE 4EGFA 3DZBA 1A7AA 1I3LA 5L40A 1DRWA 1ISGA 3VPFA 4YACA 3IKVA 3RBVA 4J91A 3D7LA 1PX0A 2JJYA 3LZ6A 2O50A 1J6UA 1O89A 2Y1GA 3WLFA 1U2DA 5IZCC 1E7QA 1WAMA 4HV4A 4N54A 3RI3A 3TPCA 3B1JA 2CZCA 1UDAA 4XRRA 4CMCA 3K31A 4PG6A 1N1GA 2J8ZA 1JU9A 5DBFA 5B4TA 3RJ5A 5I7SA 3TOXA 1Y9AA 1NFQA 1E77A 2ZTVA 4KWHA 4E21A 1C0KA 1M6HA 1W73A 3JQBA 2O3JA 3ONDA 2DM6A 2ZB7A 1UP6A 1WP4A 2NWQA 3L77A 3RUDA 5TT0A 3P19A 4NK4A 1YONA 4MO2A 3CZRA 4ALIA 3GY0A 1KERA 5AQ1A 3B1KA 5JCXA 2HRZA 1ADFA 1DIGA 4FGSA 1QORA 2UUOA 2O48X 4BNMA 4DRYA 4NJOA 4UVIA 4M55A 2H9IA 1YKFA 4WNCA 1UAGA 4LGVA 4B4VA 3WTCA 3HADA 2QYSA 3F46A 4MVJE 2X9NA 3ADOA 1P33A 4IINA 2V6GA 1PWXA 2RAFA 3GNTA 4CUKA 3QWFA 5KJ6A 1PSDA 4UUMA 1ULSA 4YAJA 4XYGA 1N7HA 5CDUA 1J49A 1HDOA 2F00A 3QQPA 4MVJA 1T25A 4AJIA 4XGIA 3B20A 4Y98A 5JSFA 1P1RA 4YT8A 2EP5A 3AU8A 3BIOA 3NKLA 4EJMA 1M75A 3LK7A 5TT1A 1MGOA 5TGDA 4R9RA 4MDHA 1DFHA 3AWDA 3BHIA 3KOUA 4ITUA 2NLOA 4OIMA 3LVFO 5FF9A 3KM0A 4XIJA 5IZCA 2DUUA 1V8BA 1Y1PA 3DBLB 3GAFA 3CKYA 4MVJF 1Y6JA 3UXYA 1VM6A 2R2GA 5I7VA 4I9HA 4GKVA 1BHSA 2X23A 3G3EA 1U2GA 3ROKA 1SEVA 3I9MA 3AW9A 3CINA 3JD1A 2IEDA 3O38A 4B8WA 3IUSA 1PGQA 1R0KA 4BKPA 1WWKA 1LLDA 3VZRA 1BW9A 3TF5A 2DU8A 3VOSA 2GF2A 1NR1A 4PLGA 1GAEO 3U4IA 3ZWNA 1ZK3A 3ZU5A 5KKAA 4G5HA 2D4AA 4DGSA 3QWHA 4TRJA 3F5QA 4PCVA 4IMPA 4CMIA 1QP8A 2VZ9A 2A9FA 4II3A 5CDGA 3ZGYA 3ZNNA 2D5AA 4J1TA 4XIYA 3A06A 2C5EA 4BNWA 1D7OA 2WE8A 3ZWOA 1XSEA 2HU2A 2JD0A 4IJVA 3JQAD 2Y0EA 4NBWA 1P1KA 3QVSA 3P2OA 3I4CA 1MG0A 1BW9B 1DLJA 4BMSA 2FMUA 4RJTA 2B5WA 4QQRA 2B0JA 4TWRA 3CPSA 4YWJA 4BGIA 2POQX 3HN2A 2GZ1A 2I3GA 1V3VA 4U6QA 3G0OA 5KJFA 1VKNA 3D3EA 5KKCA 3QVXA 5BSEA 4CMIB 3VAZA 1E6WA 2VWGA 3CE6A 4ZQFA 3ZCXA 3ASVA 4YPOA 1DLIA 3WQSB 3ZDFA 2GZ2A 1WDMA 2Z1MA 2FOIA 1LBEA 2GDZA 1GEGA 1D1TA 3OHSX 4KDEA 1QMGA 3ZV3A 3MEQA 3TRIA 2JCYA 1EVYA 3WGYA 2BFAA 1OC4A 5HM8A 5DBGA 5JAZA 3R3JA 2OL4A 4CR6A 1RYEA 3HZZA 4JBIA 3M1AA 4BMNA 4BNKA 1I3NA 4HNHA 1LC3A 1HE5A 1ZSYA 2VRCA 2YZ7A 2C54A 1YGYA 3JQDA 3QV1A 3GVPA 1ENOA 1KY4A 3DZGA 2Q45A 1EMDA 4HKTA 1LX6A 3T7EA 1HDRA 1H6CA 1I2ZA 4KOAA 5GY7A 3VTFA 4GL4A 1IUKA 4P22A 1PZEA 4RPKA 1GCOA 3E1KA 4WECA 4YJFA 3K5PA 2CF5A 4KDFA 4ALMA 2Z95A 5GMOA 1EK5A 3CEAA 3WGHA 1TT7A 2JHFA 3EHEA 5JYDA 1J5PA 3EK2A 3L07A 4R5HA 4QFDA 5CEFA 4NFHA 2ZTLA 5EQFA 2Y0DA 1YQXA 3S2FA 1W0CA 5L3ZA 4M89A 3N74A 3PZRA 1H6AA 3U4CA 2O4UX 2P9EA 4D3FA 1AXEA 2IZ1A 4WLFA 1P31A 1PJLA 4YJFB 2D2IA 4CMEC 4K9DA 1CYDA 4L4SA 3GDFA 3STHA 1NWHA 4BO3A 1TEHA 1YJ8A 4BNFA 2DKNA 4D3SA 4YAGA 2Y1EA 4NMHA 4R1UA 2X0IA 1ARZA 4R01A 3H9UA 4MVJD 3ZH2A 5G2OA 2FSVA 4K6FA 4Y9DA 1DRUA 1NTOA 3D64A 5F1KA 5L51A 2IXAA 4PN3A 1XYGA 1A27A 1JAXA 2HJSA 2WD8A 3P5SA 4FR5A 1O94A 3OJ0A 1MC4A 4ND4A 2X86A 1MC5A 4W6ZA 4A73A 3TNLA 5A3JA 4J0FA 3ZWAA 2YV2A 5KJ1A 3ZZNA 1E1NA 2JAPA 2JD1A 5DDIP 4XGKA 3NEPX 3PHLA 4BNYA 2VNSA 3AY6A 4E5MA 1QV7A 3HUDA 1UUFA 5COBA 2PZKA 1Y9EA 3DOOA 2ZB3A 3C1OA 1NFRA 4FSHA 1E5QA 5ENDA 5BNFA 3IAHA 1SBYA 3G1UA 1HDZA 2C20A 2ZK7A 3JYOA 1LQUA 3PHIA 4BV8A 1QKIA 3JD0A 5TNXA 2OFPA 4GLOA 2V6FA 5LDGA 4WLEA 4NI5A 1R37A 3W4KA 4CPDA 4DBVO 2G17A 2NM0A 2I9PA 4IQGA 3CTMA 3TFOA 3GH3A 4YDRA 5JXWA 3COSA 1BGVA 1O9BA 1MV8A 3GPIA 4WEQA 2CMDA 1U1IA 2IZZA 3L4SO 3T7CA 4OH1A 1GY8A 4A7PA 3RC1A 5ER9A 2I66A 4WPGA 3ZWYA 4JBGA 2NACA 3MJ4A 2FR8A 3GT0A 2VUTA 2EIHA 3A1NA 1P1JA 3ZWWA 1YXMA 3S2IA 1YBMA 3V8BA 3FNEA 2DPHA 1BDMA 2GSDA 3ZNPA 4M86A 1K0UA 3IC5A 5L4NA 3GG2A 1P77A 5EINA 4ZA2A 1IY8A 1UXGA 3KVOA 3N58A 4GX1A 3QWAA 3H3FA 4NU5A 1KVQA 2EP7A 4PLYA 1DJQA 1OFGA 4IGFA 1N5DA 4PLZA 4OJNA 4R1SA 5KWEA 2A4KA 4YJGA 4B7XA 4IDEA 4RZHA 4YRBA 3WG9A 4LCJA 2O7QA 1M76A 3SX2A 1BMDA 2FR1A 3FWZA 4BNUA 4D0RA 4EZBA 3UF0A 1HE3A 2VQ3A 3AUTA 4F6CA 1R4MA 4XQ9A 2I5PO 3JQGA 1KEWA 4QO7A 4IXWA 4LCEA 4RLSA 4MINA 2A35A 2BELA 3OM9A 5L45A 4CL8A 5T64A 1NAIA 2WTBA 4XRGA 3M2PA 4KUEA 3NDIA 3GPDG 3GQVA 1LDGA 4U0JA 3DAGA 1KIFA 4YJGB 2ZTMA 4FFPA 4XQEA 1HLPA 3Q0EA 3OQ6A 4ALLA 5IG2A 3WIEA 5JDCA 4PLCA 4PZEA 3RFXA 4Q39A 1XLTA 2PKQP 1Y7TA 1PIWA 4HX5A 4GMFA 4JCOA 3TOZA 3DOCA 3ZWMA 2EKLA 1R4MB 3C24A 5DF1A 3JQGB 4FN4A 4MKXA 1VSVA 3FI9A 5U4QA 1N2SA 4CQLA 2GN8A 2ZYDA 3EYWA 2IEBA 3UCXA 1DXYA 3MWEB 1CETA 4R3WA 1TB4A 1WMBA 1IYZA 1I3MA 3O9ZA 4NG5A 2X6TA 3TWOA 5TJ9A 2OP1A 1RYDA 4N5NA 1UZLA 4ZQGA 1VLLA 5G0SA 2YV1A 2NTJA 4UVDA 1G0OA 4AL4A 1YDEA 3JQ8A 4RF4A 1DIHA 4TROA 2AG8A 1GQ2A 3RC9A 3RKUA 3EC7A 3I4FA 1IHYA 4IM7A 2OBYA 5F1OA 3DXFA 3I23A 4Q3BA 4M54A 1F17A 2FZEA 4BNZA 1U8FO 1KEUA 4UEKA 3AFMA 1B26A 2YW9A 1K3TA 5ITVA 3MTJA 1DC5A 2EF1A 5FFFA 3A28A 3L6OO 3LDHA 4II2A 4R1TA 4XQCA 3ZV6A 1ID1A 4GAEA 4J4HA 4ALJA 1C0PA 2GN9A 3C3XA 2B4RO 1ONOA 3EGOA 1GQQA 3JQ8B 4D7AA 4YRAA 5IZ4A 1NASA 4BNTA 4PVCA 4BS9A 1FDTA 1QYVA 5B12A 1DB3A 5B4UA 5AOVA 3CXRA 5EIOA 1B8VA 1BXGA 1LRKA 1SMKA 2DBZA 1X7DA 1ZMOA 2D59A 4CM5A 2X5JO 1LLCA 1U7HA 1CDOA 2NU6A 3RUCA 1FDUA 5CDSA 2Q2VA 3GLQA 4CLHA 5T8KC 4CM1A 3ZN2A 5KCZA 5IDQA 5BSFA 4PG5A 1K5HA 1V6AA 5DCWA 1PJ2A 4BNHA 2YV3A 2G1UA 5JCJA 4GGPA 2NQ8A 2B83A 2C7GA 3H7AA 1PR9A 2AW5A 1X0VA 1X1EA 1E7WA 3F6YA 3FF4A 3DAPA 1B3RA 1UH5A 5CHEA 4NHEA 1BXGB 3FPCA 5ICMA 2DTDA 3BYZA 4EW6A 2Q49A 5EJ2A 1Y81A 2IODA 4DQVA 2AQKA 2XPCA 4WKGA 4KTVE 1EUDA 3ROPA 2YQ4A 3WGQA 3HN7A 4K6CA 3WMWA 3KO8A 4MVJG 3BXXA 3IP1A 2AA3A 3ANLA 4MP3A 1HETA 1XCBA 4RZIA 5LCXA 4HFJA 3VPSA 4JXKA 2HMVA 1NR7A 4UULA 4E30A 5JFOA 3T4EA 2PTGA 2JCXA 1F0YA 4BNXA 4IPTA 2CY0A 4G2NA 2W98A 5HA5A 4QTZA 5A9SA 2BH9A 3GOHA 3ZWXA 3BTSA 4AG3A 4IMRA 1BTOA 1T2FA 5CEEA 3U0BA 3UOGA 1NNUA 1C14A 1SEPA 2UDPA 1WDKA 2ZQZA 1YL6A 2GGSA 1EVIA 4EI2A 3ON5A 4Q3EA 4BKUA 7MDHA 1T26A 5C7LO 5AXAA 1NQOA 1LU9A 1PJQA 2TMGA 3E6AA 1XEAA 2AQIA 4QFCA 2PGDA 3ONEA 1QRRA 4UUOA 5FWNA 3OICA 2BFPA 5IF3A 4URFA 2RIRA 1DIBA 3BMNA 5A9SB 3B1FA 2O3SA 4BO4A 3LQFA 4J0EA 3OIDA 4IZHA 4OXNA 4GMGA 1NQAO 2P68A 1EUZA 3IMFA 2BGLA 3IS3A 4IJUA 5C7IO 3GVXA 5T8KA 3VH4A 2OZPA 1C3VA 3RUIA 3VDRA 4D45A 1T2EA 2AHRA 5EQDA 2VT3A 3DEYX 2FR0A 4J9VA 1Q7GA 4PLPA 1RKXA 1TLTA 4PLWA 5I8ZA 3VKUA 3KLPX 3AY3A 4IBOA 5CDYA 2HO5A 1XG5A 3HB4X 2YY7A 3DHYA 3K9QO 5T57A 3ZHYA 1G6KA 2D5CA 1H2HA 3BMNB 3PWSA 4IDDA 3E82A 9LDBA 1ADCA 4RF5A 3ZW8A 1CEQA 1VC2A 3Q2IA 4YAKA 5G0WA 4ZICA 2E49A 3RBZA 5BNTA 5I9NA 4UUPA 3NV9A 2BF7A 4WASA 3L6DA 2WEKA 3NUGA 3WGZA 1BDBA 1PZGA 1N1EA 1UXJA 3K96A 4FD3A 3OMLA 1T4BA 4NK5A 5DBIA 2ZQYA 1E3JA 3K2EA 3R1IA 4HBGA 4E31A 5KOIA 1UZNA 2GPTA 4QSMA 4CMKA 2PNFA 2YJZA 2J5KA 1AXGA 4WNIA 3PIDA 2VYVA 1KOLA 1B14A 4FC6A 3M2TA 4BKOA 1SB8A 3GGOA 4ALKA 1GCUA 3FTPA 1ULUA 1ISFA 4ND3A 3SLGA 2B5VA 4PZDA 3PRJA 2P9GA 2BI8A 2I6TA 3OETA 1CQIA 5JBIA 1PS8A 3FN4A 3DWFA 3SJ7A 2GCGA 3GDOA 2LDXA 3AI1A 3RC2A 2GNAA 5TQVA 1U4OA 4TVBA 2HK7A 4IDGA 4CV3A 5BNIA 5DN9A 1VJ0A 4BKRA 1PJTA 3DHEA 2Y66A 4RF2A 1MFZA 4JJIA 1U28A 1R15A 1PR3A 2C59A 3JQAB 4DVJA 4F6LA 5CAEA 4TKLA 5ITWA 1HRDA 3KBOA 1ZW1A 1NFFA 4MKRA 4JROA 4L8VA 4OOEA 1F14A 4FCCA 1ZZEA 4O59O 5HS6A 1VRWA 1B8PA 5JCJD 3ENNA 4PGFA 4XD2A 5A9RA 5KNLA 1YOVA 4MP6A 1U9JA 3KSDO 4RDHA 3E18A 3JQ6A 1PZFA 4NNJA 2E6UX 4QEDA 5A05A 3GVHA 1I10A 1QSGA 1YWGO 3D4PA 4ZVVA 4FIZA 4ZGWA 1MB4A 3OJFA 2OBNA 4CLRA 1PQUA 3H5AA 3O8QA 4DYVA 1XR3A 1X13A 3FBTA 1ADBA 1IZ9A 4ZD6A 4DPKA 4NR0A 2A94A 2HMSA 2ZJ1A 3W8DA 5K0ZA 4WLUA 1PJ3A 2VZ0A 3ETDA 4E12A 2GERA 2RH8A 3PYXA 4RPHA 1A4UA 3IUPA 2XAAA 3WFJA 1EVJA 2J5QA 1YOVB 2DUWA 3QW2A 4D44A 4B7CA 2XOXA 4ID9A 5CG2A 1EEHA 4CLRB 5CEJA 2RHCA 3O03A 3O8QB 2EGGA 3WB9A 4B8ZA 1U3UA 5A4DA 3QWBA 2JFFA 3S1LA 4LSWA 2R00C 1DBVO 3GDGA 5HBRA 3JYLA 2YDXA 3PXXA 6ADHA 3MJVA 2Y1CA 4MIEA 2HK9A 3DZJA 2E82A 1EBFA 4DQXA 4DWVA 3UFXA 3GGGA 2AEJA 2BGMA 4HY3A 5JS6A 1H5QA 1ZK1A 4XYEA 4J2HA 3DHNA 3QVWA 5JW6A 4TVOA 1ONPA 1PQPA 3FSRA 1WNTA 4DIFA 5TF4A 2AQHA 1ORRA 3VVCA 3DFUA 2PV7A 3FPLA 3I52A 3E8XA 3ZU2A 3CUKA 4K1LA 4RPGA 1G0NA 2DBRA 5HRUA 1TVEA 1GPJA 1MLDA 4WGGA 3F4BA 1QLHA 3OA0A 1PZHA 4J4BA 2HDHA 4BO8A 5A3VA 3GF4A 3OA2A 3I5MA 3VPHA 4E0BA 4I08A 5ILGA 4WEOA 3VZQA 1NQ5A 1EE2A 1JW9B 2VHWA 1IL0A 2OXIA 1R0LA 2H63A 1I24A 2UAGA 5EESA 6LDHA 1AHIA 3I9KA 2NVWA 4YQYA 4E5YA 3FTNA 1R4NA 4CUZA 3BTUA 3KYCA 3RQSA 4AJJA 1BSVA 1DEHA 2O3TA 5BSGA 7ADHA 1MUUA 3L9XA 5DZSA 5F5NA 3TL3A 1VE9A 3GVIA 4U0KA 2RCYA 4NFYA 2B35A 4KMSA 3RD5A 1ZMTA 4OKNA 4B4WA 3NTOA 1LRJA 1NVMB 3ZNOA 2I65A 1DJNA 3OH8A 4LVUA 3OEYA 1WVGA 2E4AA 3GAZA 2NTVA 4I5GA 1FK8A 4BVAA 4RVUA 4FB5A 4GQAA 3PYMA 1PJCA 5EMHA 2UVDA 3VPGA 3IL2A 3PP8A 3U62A 2Y05A 1IB6A 1LDNA 4RVHA 4YRDA 3VVBA 4JP2A 4NQZA 4TMFA 1XHLA 3M1LA 1A9YA 1R4NB 4D46A 4FS3A 3ZWBA 1UDBA 3KYCB 1H6BA 2VYVD 2P9CA 1OOEA 1C0IA 5I7FA 1R66A 1YVEI 3QA9A 3GVCA 4KWIA 2WWRA 4FW8A 4BQRA 3WWZA 4AVYA 3PFFA 4PIVA 2R00A 1HTBA 1J4AA 2ZYAA 2Q1UA 4LSMA 8ADHA 3PI7A 4P8RA 1HEUA 3TL2A 4BGVA 1X14A 3F1LA 3NAQA 2ZKLA 2HSDA 3UH1A 1JA9A 1GD1O 4DBZA 2Y1OA 3LSYA 4I8XA 3JD4A 4CM6A 1NVGA 1PGPA 2PD6A 4YJDA 3TZCA 4CM8A 1O5IA 2VHYA 4IS2A 3GMSA 1E7YA 2W8ZA 4Z9FA 1HWYA 1WPQA 1JKJA 5CPBA 2HCTA 4FOSA 3AFNA 3H2SA 4XKJA 1ISMA 2GASA 3VH2A 2X0JA 4CMHA 3WYCA 1EK6A 1Q0HA 3U5TA 1OMOA 2QIOA 3JQ7A 2NU8A 3SXPA 2HUNA 3EY4A 5BT9A 3PTZA 3WNVA 2GO1A 1HYEA 4CM8B 1KY5A 3AUUA 4KZPA 2EKQA 4HADA 1ZFNA 1NP3A 5JMWA 4O1MA 4TZTA 4YA6A 4C4OA 3EAGA 1ENZA 4OXYA 4ALNA 3S55A 1PGJA 4YQZA 3Q9UA 5H81A 4BGUA 4RLHA 2Q50A 1XQ1A 1WZIA 5AYVA 3GG9A 4OSOA 3IQDB 1JVSA 2V7PA 4J3FA 4BO1A 4D43A 4CMEA 1KEPA 3N7UA 1YL5A 1PS9A 1DFGA 2WYVA 3D5TA 3WJAA 3LF1A 4IJWA 3Q2KA 4BMVA 3H5RA 2VHXA 3JQ7B 3H9GA 2BMAA 4BO7A 3DBHA 4QT0A 2EERA 1HDYA 1SZJG 2BFMA 3W4IA 1FJHA 1K2WA 2CNBA 5KIAA 5IAAA 1GUYA 3WIDA 4AJHA 4BNJA 3WR5A 2X5KO 1P44A 4O6VA 1YB5A 4PG8A 1DC4A 1PQWA 2Q46A 1LDBA 1UXKA 3DBRA 3M6IA 3PPIA 4N5LA 1M67A 5LC1A 2GN6A 3SC4A 3DZKA 3OECA 3R0IA 4TKMA 1E6UA 2QRLA 4OQZA 4BGEA 3OBBA 4Q3DA 3E9QA 4CMAA 2JHGA 1MA0A 3SVTA 4CMGA 3F1KA 1ONNA 2QRKA 3RIHA 3KB6A 2Y0CA 4CJXA 1DIRA 4UEJA 2ZATA 3JYQA 1Q7CA 1I2BA 4IIUA 1GFSA 1IOLA 3JQCA 4D42A 3IIEA 3DBRB 1NX6A 4M1QA 3ZV4A 4R51A 1M2WA 2DTEA 4Y8VA 3V2HA 2GN4A 3KTDA 4QXMA 4ZQHA 5A1TA 1GTMA 4DLBA 3UAGA 1C1XA 4GX0A 4IQ0A 2WM3A 2JCVA 3RU9A 3DO5A 1JWAB 4YEDA 1NM5A 1KETA 4LK3A 2R6JA 4FDAA 4JP3A 1F8GA 4Y6PA 1EQUA 1LSJA 1LDMA 3GFGA 4UEOA 4BIIA 1MX3A 2QX7A 1CRWG 2WDZA 1H93A 2JFHA 3AM5A 1MXFA 4IZIA 5IDYA 1QYCA 5JDCC 4BV9A 1KC1A 1WW8A 1JKIA 2OO5A 1YH3A 4TRRA 5DCYA 4NBTA 3TN7A 1QYDA 2Y1DA 4HFMA 4RO0A 1UR5A 4RF3A 5TIIA 4GVLA 3BMCA 4WOKA 1UDCA 1D1SA 4F46A 3QIVA 4W99A 4XDYA 5JC8A 1KVUA 4Q3AA 1C1XB 5T67A 5TRTA 3L6EA 1E3LA 2ZB8A 3WJ7A 1ZSNA 2H5LA 2JFGA 1Y8QA 4TSKA 5BSHA 1QYWA 2NNLD 4DUPA 3HFGA 1EE9A 1AGNA 3VZPA 3GUCA 4U6SA 1E5LA 2ZCVA 2X1HA 3GHYA 5I7EA 2EKPA 4WOJA 1NVTA 4FFMA 1PL8A 1E3SA 4RVDA 3BMCB 3FHLA 1LDEA 2OP0A 3LC2O 4DXHA 1QYXA 4M49A 1CJCA 2JAHA 2ZIZA 4DLAA 4BO2A 4FC7A 3ITKA 3UCFA 2HMWA 1MFPA 4E5PA 4GKBA 5B1YA 5G4KA 3ONFA 3H8VA 1E1LA 3JD3A 1NHGA 3C8MA 3DFZA 2YFQA 1T24A 1Y8QB 3PHJA 5ILOA 1GU7A 1HKUA 1JVBA 4BB6A 4L75A 1S7CA 4MVJM 1GYPA 2I76A 2EEZA 4UAGA 2PWZA 3QSGA 2AE2A 3C7CB 4P38A 3C1TA 4B7UA 3AM4A 1O8CA 3HDYA 2DT5A 4KP7A 3UGKA 3TZQA 3WS7A 3INTA 2QW8A 3W1VA 3NTQA 3GZNA 2VHVA 3E9MA 1ZJZA 3BAZA 4D3DA 3FNGA 4NDNE 3WYEA 5T6BA 4FJ0A 4BB5A 2Y99A 1I5RA 1SB9A 5G4KB 1YE3A 1W4ZA 4XB1A 1T2DA 3U9LA 2B4TO 1E0DA 4YJHA 2AMFA 5TSDA 1Y5MA 4RL6A 3D4NA 4CQMA 1RPNA 2RH4A 5J23A 2DQ4A 1ZCJA 4L9RA 1F8FA 2NADA 3TZKA 4Z3KA 3NT4A 4PLTA 3KZVA 3C1AA 4EYEA 4DREA 4OO3A 3RFVA 4IJKA 2VOEA 4GGOA 2C07A 1HXHA 2JKVA 5EN4A 1U8XX 1VPDA 4E2ZA 2VZ8A 2Y68A 3E5RA 3PQDA 4AJ2A 1GYQA 1HSZA 4J1SA 1T2CA 2NV6A 1TI7A 4YJHB 3AI3A 2Q1SA 3KV3O 5I8WA 3JQEA 2Z1NA 3KSZO 1GR0A 4WJZA 3GFBA 2EG9A 5FYDA 4IDFA 5AXDA 2X4GA 2V6BA 4OSPA 2HAEA 3IKTA 1UAYA 2HKIA 4FQ8A 1N7GA 4LN1A 1ZK0A 4PFJA 1PWZA 1HYHA 4AJEA 2G0TA 3LC7O 4YB8A 2NUAA 1HSOA 1YO6A 3PQEA 4CLDA 1T4DA 5DNAA 2D8AA 2GUGA 5JC1A 2DAPA 3ZHZA 4CQLB 1FMCA 3MOGA 3INRA 3WTBA 1SNYA 3WXBA 1PS0A 3GEMA 1UP4A 4MIOA 4QUKA 2C5AA 5L4SA 3OJOA 4PRKA 2BD0A 1SOVA 3UUWA 2VOJA 3R3SA 4AJNA 4R68A 4U8GA 4E5NA 2CDAA 1RM4A 2EWMA 2PZMA 3K30A 4MP8A 3F4LA 3HDQA 4Y6RA 5C7OO 1DRVA 3GGPA 4LVCA 1H0KA 4KTTE 1E3WA 1VI2A 4A10A 1ISHA 5L53A 4E2XA 1U4SA 2YYYA 3DTTA 1PEDA 5F1PA 4CLEA 3MJEA 4YYZA 5JAQA 1U5AA 4G81A 3JV7A 1I01A 4WLVA 2VUSA 1LDYA 4A0SA 1E7SA 3GEGA 5A06A 4MPDA 1QLJA 5F5LA 2OHXA 1LXCA 1YBVA 2PZJA 4P4NA 3FCOA 5G0TA 4O63O 3W8EA 5AVOA 3PJEA 1LLQA 3O4RA 4HFNA 3SC6A 4J1NA 1DPGA 3DTYA 3F5SA 2GLXA 2VYNA 1W8DA 2GR9A 4PRLA 5ICSA 1A72A 4H3VA 3RUHA 3QWIA 2BKAA 5CP8A 3GA0A 3UICA 3U3XA 3VZSA 4ZRMA 4NZ9A 4NH4A 2B36A 1RJWA 2O4CA 4AJLA 3ULKA 3LT2A 1I32A 4Z3DA 2YQ5A 1P3DA 3D3WA 2J6IA 3H4VA 3S8MA 2PR2A 1QG6A 1P1FA 4ZJUA 1DIAA 3U4HA 3AU9A 3VPXA 2HK8A 3CMCO 1V35A 1K6XA 2QZ9A 5JDIA 4W82A 5ES3A 1LUAA 4J7UA 1ZVMA 4NPCA 5JAIA 1DAPA 2X0NA 1WMAA 3QLJA 2DFVA 4P4LA 3V1YA 1CQJA 3NT2A 3QRWA 1P74A 4TRMA 3GMDA 2O3QA 1OAAA 3QP9A 1ZIDA 5A5FA 3S2EA 3PZBA 5EERA 4CM9A 2D3TA 3H3JA 4Z6KA 1VSUA 3KYDA 3EZLA 3OIFA 4E13A 2GRAA 4YXFA 4XGNA 1T2AA 5G0VA 3G49A 4DMLA 4ND5A 4BO0A 3GZ4A 4CQMD 4IY1A 2PGLA 2PZLA 3DL2A 3BMQA 4IDCA 1NAHA 4PLVA 3NYWA 4XYLA 4EUHA 5KVSA 1JKFA 3L4BC 5C37A 1E1KA 1YB4A 3G79A 1Z45A 1UZMA 2LDBA 2I67A 4EUEA 4CR7A 1JN0A 1HDCA 2VWPA 2X9VA 2BI7A 2C82A 4S1VA 3VHRA 3KYDB 1I33A 3WLEA 4EJ6A 4J1QA 4PVDA 3UKOA 3WOHA 4AJKA 2EW2A 1NPYA 1V9LA 3LLVA 1JQBA 3KYBA 3BMQB 1IHXA 4GI2A 3I6IA 4R69A 3ZNQA 3FRJA 3AM3A 1B16A 3QHAA 4E2WA 4OGWA 5JY1A 4FJ2A 1EFKA 1Q2XA 1SC6A 3DDNA 4LMPA 3KXDA 1MP0A 1RM0A 2C7VA 5GZ6A 1N8KA 3IJRA 4JJFA 2ET6A 3PHHA 4W4TA 3ANMA 3ZWPA 4MIYA 1P1HA 4ZQEA 4XB2A 5DULA 2PKQO 5JO0A 4B3IA 4BOYA 3ROQA 4IDAA 3QVOA 5MDHA 3EW7A 5CG1A 1IPFA 3MCVA 2DC1A 4OM8A 1U5CA 2Q4BA 3JSAA 1RWBA 3Q9NA 2G82A 3KEQA 3DONA 4OHUA 4ZRNA 1BVUA 4GLLA 3ANNA 1EQ2A 4BUCA 1GV1A 2AG5A 1PJ4A 3L9WA 3MJSA 2O3RA 1LSUA 4OL9A 2EJWA 4Z9YA 5JMPA 2E48A 2WJPA 2OGUA 4ZHSA 3ICPA 4DPLA 3RU7A 1V3UA 2HLPA 3PLRA 4OXKA 3NGXA 1ZXBA 3W6ZA 3LT1A 2O3UA 4A03A 3FR8A 3PDUA 1ZUD1 2IRWA 3RWBA 4JGBA 3VDQA 2GZ3A 1Q7BA 3L4BA 5TS3A 4FFNA 4QO8A 3WQRA 4RDIA 5C5IA 1H94A 4XQGA 5K6AC 1LLUA 2HQ1A 2VYND 1F12A 4M8SA 4YT4A 1JAYA 3VH3A 2I99A 4ONEA 1L1FA 3Q11A 4BNIA 3BA1A 3A9WA 1ML3A 3DBVO 1EUCA 2Q4EA 3AOGA 3OIGA 4GPD1 3NJ4A 4W7IA 1PL6A 4R41A 4H15A 3V2GA 1YB1A 3UCEA 4N5MA 4B4UA 1P1IA 3C85A 4N7RA 1V0JA 1Q0LA 1B15A 1YS4A 2CDCA 2QRJA 2VTDA
chains in the Genus database with same CATH superfamily
1QGUB 3EA5A 2XUKA 3X2EA 4BX9A 4CLXA 2H1WA 4D9HA 2O1XA 3AI2A 1OWMA 3CT6A 2VDNB 3GLIB 1OT5A 1ILWA 3D31A 2QHXA 2GWHA 4CUJA 2RHGB 4KEAA 3K3PA 5AOBA 5WRFA 2PRYA 3U1VA 4LI3X 1EE1A 3UH0A 2O5RA 1TYBE 3C3WA 5GV8A 3JQ9C 3RFTA 4YUVA 5BQ3A 4P84A 3Q7IA 1STOA 1SQ5A 1KP3A 5FUVA 5A5DA 4IIVA 1VGVA 1T8TA 4BHTA 4J0IA 1X8XA 3CQ9A 1XLVA 3W7AA 3H3XA 1OIWA 3LT4A 2R25B 4R0MA 2W2NA 4I3GA 3PDWA 2PEYA 2AOVA 2ZWIA 1KZ9A 3HHPA 1D04A 1UK9A 4Q3CA 5EC8A 4KK4A 1B74A 2C2XA 2WIAA 2XGMA 2DFKB 3QTBA 3FUXA 2FQWA 1LV7A 3QVKA 4OFXA 1IXSB 1I3CA 1XKQA 3PFWO 1KC3A 3CW9A 1P5HA 1D8AA 3CB4A 1I7SB 1XVTA 3A7EA 1P4SA 2ALJA 2NQTA 1D4FA 4JUIA 4M0FA 3WGLA 3ZK7A 5KSOA 1MORA 4K9LA 4CM7A 4NBVA 1Z7EA 2V3VA 1MB0A 1NDHA 2FFBA 2Y27A 3PL1A 1T29A 2CVFA 4NJMA 3WBBA 4CM9D 5AW1A 3W2IA 4A4DA 4DG8A 2DEUA 4M9UA 4NZYA 3QELA 3AVOA 1GNQA 3LKDA 4OOFA 4J16A 3S44A 1OWNA 1BH2A 2HQSA 2OUIA 4E6PA 4PLFA 4KDCA 5H83A 1S6YA 2PLNA 5J59A 2GEKA 2BGKA 4EUFA 4AY6A 1L7BA 3PEUA 1MRSA 2ABWA 4GG1A 3RSHA 3A4VA 4KQXA 3UJ9A 3PQFA 1B0AA 1CUJA 4TMYA 3KJEA 4ZXPA 4ZU3A 3TM5A 3WWYA 2PU7A 1CS4C 3HN6A 5LZ5A 1PO7A 4BNLA 3KSBC 3T0IA 4Z0TA 2CFCA 1C1YA 3KJQA 1UBOS 4RZQA 1E1QA 2IHNA 2CLMB 1L5QA 1DHTA 3JZIA 1JHVA 3GN2A 4JN6B 3EQZA 4W6QA 1M5UA 4X8OA 4UUQA 2X9GA 5CYOA 3ZHXA 5A2GA 2JLYA 1BRMA 2CL6X 4FT4A 3SBOA 5IXYA 2CVQA 4NJMB 3MD0A 2O1EA 1Z73A 3JCZA 4I4TA 4TS3A 1C0EA 3QELB 5CGZA 4JXXA 2FX5A 3GFFA 3FWNA 3N2NA 1FY2A 1WPGA 3R3XA 4LOKA 1QHYA 4XYMA 5TPWA 4I66A 1PFUA 3E48A 4DA4A 3ICOA 2BRUC 1OGYA 2EYUA 3STYA 4MGEA 2XA1A 5FPHA 3UN1A 3ESAA 2VUHB 1F6DA 1Q84A 2Z4SA 2UZ0A 4TTPA 1X9GA 3A14A 4KVAA 3E03A 4N0DA 3N6RA 2QQFA 3NH9A 1FUIA 1TRHA 2FWRA 2I0FA 3UXMA 4P3OA 3T61A 3P9YA 5DGCA 4DZRA 1Y7IA 2QP9X 3MRSA 4YCSA 3CWZA 1UM8A 3TLEA 2R65A 4A0RA 4UQPA 4WUVA 2FFHA 2HWKA 1P2SA 3A9RA 1SU8A 1EFLA 1KK1A 1TU4A 1FQKA 2YHBA 3MT7A 3NNNA 4FN5A 4ZN6A 4QZVA 4MUJA 2ACWA 3TZEA 2YN2A 4I4TB 5DT9A 2WF9A 1F48A 2D1YA 2DPYA 2COEA 5KVVA 2A57A 3HSYA 1Z4MA 2Q9BA 4YIKA 5TPWB 4FMCF 4PC6A 3EDRA 3DF7A 4RFSA 5KYXB 1O96A 3U4MA 1YZFA 3BWYA 5K3BA 3TDKA 2WFLA 3ZTTA 2YC4C 5DWDA 4ZZ3A 4ZK6A 4CCSA 2YDYA 4U9IS 1WETA 4MUHA 5HS4A 4XUCA 1NY6A 1UZAA 2OORA 2PRSA 4IQ4A 2JEZA 2O6LA 2J4CA 2NZ2A 3LFUA 1QO9A 4FMPA 1YQEA 1NN1A 4HWKA 3TXXA 3OP4A 3MWDA 3TCKA 1NXQA 1DUSA 1YHNA 4RVSA 3ZHTA 2Q0SA 1S8OA 2OHJA 3CSDA 3F5DA 4G0OA 3FZEA 4G5SA 2AW3A 2JLBA 3GJZA 5JNUA 2PQ6A 2UYYA 4IS3A 1P81A 2QRNA 1TZKA 1YL7A 3SJAA 1KI7A 3GQBA 3KEFA 4FFLA 3T0FA 4OQEA 4RFSB 2H00A 3KELA 5HUQA 3ZTYA 2WJJA 5HOQA 2OENG 4B4DA 1HZJA 1F6WA 3HQ4O 4IOMA 1HK7A 1VE7A 3P32A 3TIFA 5BWNA 2HMUA 3DFIA 4MDFA 2R6DA 1RKQA 2FW0A 4MVJI 3N2GA 4LXGA 3WKEA 4YCNA 2O8VA 3AJ9A 4RFLA 5IAJA 3MWDB 3PITA 5JLAA 2WKPA 4JX8A 5LDHA 4YAUA 2VPTA 3OQNA 4HQLA 5K0LA 2R1TA 4MW4A 1ZD1A 4ZDWA 2HBQA 1L5KA 3UKJA 3HZRA 5HNKA 3SQDA 4FHCA 4HXEB 4Y2YA 1EB8A 2YJNA 3SXUA 4A9AA 3A31A 1P7ZA 3FPEA 4IEIA 2ZR9A 3GQBB 3CGGA 5TC4A 2B94A 1FBTA 3E3MA 1RYYA 3P2YA 4WLNA 1CHDA 3B3AA 1QYIA 2I2FA 2O8NA 5IBCA 5CYPA 5TQ0A 2BFCA 5CR9A 4DV3B 1QOQB 3NNSA 1OFVA 2OZVA 2VYCA 4BXOA 1CQZA 3HJCA 4KG7A 1M6VB 2HADA 1X2BA 3N2GB 1PGOA 1W36B 2E37A 5LXTA 1F2UA 1V5WA 2O57A 4HDNA 4TTQA 3EPPA 2AR0A 2R1TB 2WE7A 4WFKA 1RYBA 1LK5A 3TZ6A 1CVIA 1M6EX 5KYTA 3SXUB 1GN8A 3QE0A 4TVSA 3A2MA 5HKBA 3SVLA 4JQCA 3COYA 5HWSA 2G9VA 2Z8ZA 3AYZB 3IP3A 4GR4A 4DKJA 2ACKA 4FBGA 4GRDA 2JKYA 2SKEA 1E4OA 2CNDA 3N05A 3GD5A 5TQ0B 2BFCB 1BD3A 1X7WA 2ZXFA 1GQRA 4G0XA 4ZAFA 2QGFA 1JDJA 4NAVA 4TN5A 1J2JA 2P9BA 5J5CA 1WBDA 4BXOB 4AS2A 3BHMA 1JG3A 3C70A 4L1KA 4RPIA 4U5QA 3GFPA 3BE5A 4X7MA 3PE3A 1I4LD 2CBZA 5D5PA 3EZYA 4KQEA 2X4IA 1L2TA 2DT8A 2FDRA 4G0YA 1ZGBA 1I2MA 5LXTB 1F2UB 4RA9A 2FCRA 1Q20A 2AI2A 4I0WB 1DTWA 3VBCA 1AQLA 2QI9F 2QX6A 1YDMA 2ZW9A 3F8SA 1XCLA 4XCXA 4ZEMA 2Y8EA 5JO9A 1GTJ1 1J99A 5ENVA 1NIPA 3F3KA 1DQSA 1O0SA 3DVQX 4E46A 4XR4A 2FPPA 2OHIA 3NDJA 1Z82A 3OURA 3FHCB 4LDAA 4MI6A 3VO9A 1YK1A 3ITDA 2BDUA 4FQ7A 1X7WB 4I5FA 5B1DA 1UKYA 4MJLA 3LWDA 1RW4A 3CSUA 3QXCA 1I36A 1E1QD 3CG4A 4YRJA 2C9YA 1YFJA 1TLLA 1T0UA 5JADA 1K8YB 5DYGA 2COUA 3H2KA 3G0DA 2XGSA 4DJTA 1J0CA 4C43A 5BORA 3GT4A 4BFXA 2IQIA 4RA9B 2PL5A 3QVUA 2OVBA 4QU8A 2AG1A 1HF3A 4EFLA 1DWQA 1WMSA 5FFNA 3OF5A 1OW3B 2Q7DA 2NUBA 3KEMA 2NXNA 1P45A 3ZJ5A 1I1OA 3GRPA 4FMDB 3HCNA 3SZMA 2FPPB 1UIRA 1X6VA 4IRUB 3ORFA 2UZ3A 4WTOA 3WYNA 4LGCA 5EP1A 3IKJA 4HYEA 2GX6A 4GOKA 3B3FA 3DVSX 1Y9ZA 5K0BA 3ETHA 2RHOA 3L4EA 4QGGA 4D02A 6YASA 1TZJA 1JQEA 3GK3A 3V9AA 4Y7DA 3KRTA 4Q01A 1QANA 1QFMA 2H4YA 3I2IA 1DQNA 2SNIE 3A4MA 2BZ0A 3JQFC 2ONCA 3A1UA 3A6HA 3K8ZA 1CIPA 1L7OA 2WU0A 2ZSUA 3LC0A 4JXJA 4KAAA 5JNRA 3KB8A 1II8A 2DZDA 3QH4A 3RFFA 4NVRA 3I0ZA 5KQRA 2QZ4A 2YRXA 3DVLA 3GNSA 3HU2A 4L0DA 5J3JA 4OK3A 3U7JA 5K01A 4YDHB 2NO0A 2GETA 5A4MS 2D7JA 4LZAA 3FMGA 1XZAA 3HACA 3SM3A 4F97A 1VJDA 5L3QA 2VWHA 2JZCA 2IYOA 2ZWVA 2O19A 4DC0A 1AA9A 1QB8A 5FPPA 1A5TA 1VYUA 3HFSA 3P8ZA 3W1EA 4K28A 5I01A 1H3NA 3H1BA 4BQPA 5C3MA 1VIMA 2Z09A 3KEOA 3AVYA 3LAWA 3ODPA 1ZRHA 3ENZA 4N82A 1K7CA 3S99A 3KJGA 2WDPA 5EKTA 5DSTA 1II8B 2JLWA 2VTEA 2ZU0C 4XQ0A 3O4GA 2BMEA 1X1CA 2VHZA 3BGSA 3MBOA 2C4NA 3W2FA 1ZLXA 4C30A 3V4LA 4RAQA 3ELDA 2I2BA 1XGKA 5F9HA 1VL0A 1EAMA 1N2XA 1VKOA 4JS0A 5L3QB 3F9IA 3WNQA 2V6IA 5GJWC 4YLYA 2CDBA 3GC6A 3A6JA 13PKA 4ARUA 3ZGLA 4YTEA 1SK8A 2HA5A 3G8DA 3Q3CA 1VP3A 3KZXA 4B3JA 1TT5A 4AFNA 3M9WA 1IQ0A 2JLUA 4RV9A 2FEWB 5K4GA 4QOSA 1SHJA 1RABA 3JAWA 1I6LA 2IUUA 1MVNA 1FNDA 3D5QA 4CG0A 3LBHA 3KPWA 3L49A 3RIXA 4OJMX 5JRZA 2FGKA 3OOEA 4ZODA 4YHBA 5AI4A 4LRSB 3UGQA 4DWOA 1PYOA 3GEDA 1QOPB 3M9XA 2G40A 3I83A 1SHUX 2NZXA 1QZ3A 2HA4A 4I9NA 4LHYA 1D4AA 2XHEA 3B1VA 4H3HB 4MUBA 1NNEA 1EESA 2GEVA 4RZ3A 3RC7A 2OCKA 2FN9A 4R1MA 4QYIA 2GXAA 2P9ZA 4BLWA 2II6A 4CM4A 3I9NA 1TT5B 1ZGGA 2SBTA 4ND2A 4FXPA 1PTJA 3QLVC 4TTIA 4TT8A 4ZEOA 3UHAA 3WOVA 1E92A 1M7HA 3D3JA 1J0BA 2DF8A 2J9RA 2PGIA 1YCDA 3JAWB 4AMYA 3OTQA 4P5EA 4GKJB 2V96A 4XIFA 3WV5A 5F3RA 3PJFA 2IEYA 1G5PA 1H2YA 5M04A 2AVNA 5JNLA 2P9QA 3B53X 3BERA 3CRMA 4HGRA 4YAOA 2VCYA 1Y48E 3EB9A 5GGYA 3BVPA 4DDUA 4UVGA 1XRMA 3JWPA 2O07A 1KKUA 3B89A 3VPBA 4PYMA 3AR4A 3W5SA 1O95A 1IHUA 5CJ2A 1C1DA 4QYIB 4ZQIA 2PE5A 1U0LA 3VNUA 4CM4B 3DQZA 4N0MA 2K2QB 3RYCA 4AG6A 4KB5A 1U2TA 4N03A 1I3KA 2CCJA 5F4BA 2XWJI 3MIIA 4Z2AA 3LLSA 2CD7A 1JI0A 1GNLA 5CW2A 1QV6A 4E5KA 4E5VA 2QNRA 4HWGA 3E05A 1E5XA 2WUGA 3FFWA 1Q1QA 4FOOA 1G63A 1KYTA 5DBEX 4F4DA 2YFHA 4K3VA 1R16A 4TMWA 2CLEB 3GA7A 3LY5A 4HGPA 3MOIA 1YBFA 3FDJA 2HZBA 3S27A 3BXPA 5HKOA 2F1KA 1KMHB 3E7DA 5B6JA 4QWMA 2IXBA 4AKSA 1LA2A 4KO8A 4RC9A 2EWVA 1C1DB 2FRDC 1M1ZA 4YWHA 1YK0A 2GTPA 3MJFA 3RYCB 2O5CA 1HZZC 821PA 5ALZA 2QT1A 4EITA 1UOOA 5FTWA 5EEGA 2GVDC 3BA6A 2IKQA 4HATA 4JUDX 4FDUA 1PLLA 3TUJC 3QKRA 1GSHA 4XYBA 3I2FA 1W6UA 2B4YA 2ATEA 3V7WA 3LPMA 1QXSA 1AUPA 1E62A 2ZIGA 1Z39A 3NC0C 3WGOA 3MCTA 1ENPA 5AK6A 5LU8A 2VDVE 1TYAE 3ZWVA 4L28A 5CLLA 2BOVA 2WMOB 2ONKA 3I5UA 5G1NA 3T5BA 2N1MA 2XNJA 2JIBA 4GO1A 1KQGA 5GIOE 4IJ5A 8ABPA 4UEQA 2WABA 2VN8A 4AMBA 4EPYA 2F1OA 2V1XA 3EDYA 3WIVA 1DDOA 2DCMA 1ZOIA 3C3DA 3FJ1A 3FSJX 3GJRA 1XHFA 3W5CA 5K8TA 3ZDBA 4MW2A 5KX5F 3E15A 3VC1A 3IJPA 1FNSA 3RRJA 1TZCA 1Z7GA 3QKRB 2IY9A 1IULA 1NZFA 1P62B 2WMDA 3SY8A 5KYYA 3PWKA 3I4LA 3H1GA 1PJSA 2IPNA 4RQTA 1JH8A 3BZWA 1W19A 2UZ1B 4FLFA 3RGWS 1DAOA 2QT9A 3KFXA 3VA7A 4HB2A 4XD7A 5DNVA 3HWX1 2DR0A 1FYFA 2WZQA 2ZR7A 3DR3A 3SIRA 4ZKDA 2AMYA 2AFHA 3NU1A 5MN5A 2P3QA 3DAFA 2M6RA 5TEVA 1G3MA 2IH5A 1J42A 1LWOA 4U4AA 1SXJC 4BZQA 3OP1A 1AZSC 1A96A 1TL7C 2A9VA 5K8JB 3D0OA 1CUYA 3MSXA 4Y6SA 1U80A 3MJCA 3PPWA 4NBSA 4JJKA 1QCYA 5DRTA 2WYUA 3EVGA 3W04A 2B7LA 2QXTA 1YS1X 2J59A 1FTYA 4WVLA 1CUWA 2A5JA 3D2BA 4L78A 1WXXA 1R0YA 2PMKA 4YHHB 3HB9A 1QGZA 1L8XA 2HF7A 3PENA 5KSPA 2NU7A 4BRZA 3IVGA 2AFHB 2DVMA 3LHSA 3BB4A 1LLFA 3ROXA 1RHKA 3LL4A 1M8KA 3A9TA 4M9QA 1XHEA 3SR0A 4CGZA 2I6QA 5JSZA 3DZIA 1YS6A 3TBFA 4CL0A 2ZYHA 3RHSA 2HPZA 3TQQA 2ZI7A 2PN1A 3DVRX 4PAOA 3VQTA 4P4UA 1TZMA 5E2BA 3RF7A 5IM4A 4FJ1A 4AN1A 1BA2A 1MIHA 1UXIA 3QX9A 4QQFA 2RHWA 2V5UA 2OGWA 5ALLA 2F8MA 2JL1A 1CNEA 1DV2A 5FJIA 4N7BA 2PK3A 1JJVA 1CDEA 3EAFA 4H35A 4QOIA 4G1VA 5BSHA 2ECPA 5EL0A 5EWJA 2WIJA 4KO1S 2PJZA 2NU7B 3BHJA 1A9SA 3PIRA 4PX3A 4LMRA 2OQRA 4OLHA 3FTFA 1KFEB 5KTKA 3IP6A 2QD4A 4P08A 4CKEA 4EQZA 2X4DA 3L1UA 4RACA 4KMMA 1ZH8A 4WNYA 1BWSA 5ECWA 3UJ3X 2P4QA 1G41A 4GKKB 5JSZB 3IHLA 1Q12A 1KOFA 1F8XA 4QXPA 3E81A 3IYLW 3I6MA 3ZDXB 3U4DA 4AZ0A 5SYNA 4B80A 2X58A 3AILA 4NZMA 2YHUA 4QAJA 2JLSA 3JARA 2JFOA 1MENA 1XCOA 3F47A 1QZTA 1NTRA 3HI6A 3WGKA 5FD8A 4EG1A 3PGJA 1X70A 5JPIA 2CVPA 4KIFA 5DP1A 3DNPA 4JT8A 1TQ2A 1N5LA 1QE5A 2GDJA 3K9BA 4NKRA 5EWJB 3PC6A 4LPKA 1ZAYA 2CFOA 4U8HA 5AM1A 3IXMA 1O95D 5IN4A 4UM8B 4PZCA 3SP1A 2QN3A 1DKLA 2YUTA 2X14A 4XWYA 1M7BA 4CKEB 1JLLA 4I4NA 4D82A 3EZXA 2Q4RA 1I13A 4RHXA 1HE2A 5SZHB 3NBUA 4AX4A 4Q19A 5B58C 1D03A 5KWJA 4PFSA 1PW5A 3D1VA 3P20A 4JBNA 1DFIA 1NU8A 1OILA 2E85A 3GDWA 2QP3A 4UREA 4AZ0B 1RP7A 3DOJA 1ZIXA 1SQSA 5DWQA 1ZUIA 1K89A 1B8UA 3TNDA 4WBXC 5B1HA 2HW8A 4JJ4A 1OTYA 2R5NA 5EE9A 3WGGA 1CERA 4RD3A 5ALRA 1R50A 2VKQA 2ZKIA 2FMHA 2VCHA 3DEHA 4NMMA 2Y93A 4XX0A 4FFRA 1UP7A 5JXHA 4RANA 3IE1A 3MMNA 4BNVA 3BK2A 2HJ9A 4HNGA 4DQUA 2I4NA 3OF2A 3CRW1 5BWOA 3CV3A 3U7EB 1NMYA 2A1UA 1ATZA 2W2QA 2WU3A 4PY2A 4L73A 1MJFA 5K8IA 4E08A 1DC3A 1J8QA 3U49A 4QTTB 1JLLB 3A2LA 4XX1A 2QPOA 4J9UE 4QNMA 1A7AA 2F6RA 3LRPA 4OF4A 3VPFA 4EI7A 4S1WA 4YRQA 1TNDA 5CT9A 3SZGA 2BL4A 4C0LA 1UJNA 1HTWA 4KYVA 1AK2A 2AF4C 3LZ6A 2RC6A 4KFSA 3WLFA 1U2DA 3C98A 2RBKA 3KTAA 4XX0B 2WWFA 1XZKA 4N54A 5F98A 4Z8XA 2QPAA 1PQYA 1XVUA 3GYGA 5HMMA 1KTIA 1CUUA 3IO5A 3FMVA 2JVJA 2K5UA 1D6MA 2A1UB 1DUVG 2J8ZA 3T1QA 5CXQA 4FKBA 3GLHE 1Y9AA 4HDKA 1DAMA 2AYXA 2LXNA 5NULA 1RLMA 4NWIA 1K3UB 3EQ2A 4OIFA 4P93A 4EUSA 4E21A 5BN3A 3PF8A 4BQSA 3KQNA 1LBIA 3JQBA 2O3JA 3D6HA 1H2XA 2AR7A 4M6WB 2WJAA 4DV1B 5IKEA 4Q1EA 2IXFA 3I9V1 1C4WA 5G02A 2GZDA 4XXHA 1GRVA 1RLTA 1YONA 1LVUA 2IIVA 3K0CC 1E0KA 4EKIA 3N2IA 2JVIA 4JB0A 2GKOA 5JCXA 2HRZA 1ADFA 4N39A 3FTQA 3SSAA 4ZKEA 1CP2A 4OEHA 1KJ9A 1YZUA 4Y30A 2H9IA 1DNPA 4FHGA 1N2CA 1Z36A 1ZNWA 2FE4A 4B4VA 2ZBUA 4HDKB 1IH8A 2BEJA 1QGAA 1XEXB 1A9PA 1DQPA 1Z5PA 5BN3B 3OOSA 4HS4A 2VJYA 5AK5A 4B6PA 2AKYA 4LC1A 3ADOA 4BIMA 4HAUA 1K7YA 1MHTA 4HLCA 2DY0A 1A88A 2GPNA 2RAFA 3FOWA 3QOFA 2R84A 4U2FA 2C4VA 2FP3A 3EGDA 4G1UC 1M5RA 1YIOA 1NW7A 3QPUA 3X1KA 1PSDA 1Q1BA 3E9DA 1H23A 4YAJA 4XYGA 2UXCB 3BICA 1N2OA 2QJTA 4KE8A 4YMIA 4CTJA 4LOIA 2DSNA 2F00A 1FJGB 1RXWA 1KMMA 4GZ3A 2DXIA 3F6SA 4G4JA 1CF4A 4AJIA 1DWOA 4XGIA 2G6BA 1N2CB 1XMXA 2RGCA 4V39A 2F3QA 1RQPA 5H5JA 4YT8A 5EZYA 1QHXA 3G5UA 3OQIA 2D5IA 3C6MA 1E1CA 3AU8A 3HKEB 2IS6A 3WK9A 3RKSA 4X93A 1RLOA 3O4HA 4Y9RA 3TKYA 5B3LA 1MGOA 4MJ3A 1HMPA 4G37A 4N9QA 4JJEA 1SKYE 4CVNA 2FSFA 2EBUA 3S2UA 3BHIA 3EGDB 1RQ2A 4ITUA 5C3UA 4DM3A 4HJXA 2LW7A 5EHZA 1R0RE 2GEBA 3LFTA 5FA5A 1N36B 4G5GA 3KM0A 3NOOA 2DUUA 3E3AA 3EH1A 3LGXA 2HN9A 3EZ6A 3MBIA 4GBGA 4XPIB 3DBLB 3SHQA 4TXNA 4FEYA 3GWGA 3IOBA 1TVMA 3O3MB 1RBZA 4MVJF 3LP8A 5DHUA 5AJXA 4D26A 2EATA 3F9RA 3C8DA 3KOWA 5EZYB 1AO0A 1U2GA 1KJZA 2GJ4A 1E1CB 1SEVA 1QIIA 3I9MA 3JWHA 3O38A 3UUEA 5KNBH 2QTVA 5G1PA 2TMYA 4FWBA 2OYSA 3CH4B 4BKPA 5LQNA 3NW9A 1GRRA 4L57A 3KUKA 2XIJA 2ZT5A 2W7TA 2ZSEA 4KE9A 3TNYA 5HHTA 4Q5IA 2DU8A 3PEEA 1MO2A 4QBFA 3VOSA 2BHRA 1E4EA 1P6XA 4XI9A 1J0AA 3GXOA 3NWBA 1GAEO 4PLGA 5IAEA 4PN7A 1NRWA 2XKBA 1ZK3A 3I04M 3KKKA 5KKAA 4G5HA 4UC0A 4Q4JA 3SJBA 3ZU5A 4S2EA 4FMCB 4L5IA 1Y6ZA 3DULA 1ZI9A 3QEAZ 2QLLA 3Q6MA 4C5AA 5F4ZA 1JEAA 1DAHA 2PMWB 1YS9A 2Z56A 3WMEA 4OI0A 4EI8A 1P7WA 1VB3A 2R8OA 4PCAA 2H9YA 3A06A 3A3PA 4OLFA 2WE8A 2QTVB 2XUJA 3IBFA 1SULA 1Q7EA 3OQJA 4IJVA 4MRPA 4ZV4A 2Y0EA 4DQDA 1P1KA 4CETA 3QVSA 1TF5A 3P2OA 3SI7A 1W4LA 3BJMA 2QSJA 3ODGA 4BMSA 1GNVA 5EIBD 4BUJA 3FSGA 4HXGA 2OUKA 3DB1A 3FZYA 1E4EB 1L4EA 3G0BA 3KJZA 5C35A 5LMUB 1QPGA 3KB2A 3NBZC 4IXDA 5EHXA 3DL0A 3PCXA 5KJFA 1TTTA 4Q4JB 1R4ZA 3QVXA 4OBWA 4BFZA 3N2ZB 4UOZA 1I6MA 4S12A 4EQ6A 1J9ZA 4DLZA 1NBWB 4YPOA 3QNUA 1ZM3A 3ER6A 5LKAA 2GZ2A 1T6ZA 1WDMA 1JHUA 2XIQA 2Z1MA 4X60A 5L3RA 4D8XA 4KNVA 5J1TB 3ZV3A 3OZAA 5GPBA 1PBNA 2PZBA 2XYRA 4IV8A 2XB2A 3RSLA 3WGYA 1P9NA 1OC4A 2FPSA 5BOVA 4F9GA 5DYWA 2OL4A 4BNKA 1DPFA 1VSBA 3V8RA 4G97A 4ZYTA 1V8OA 1IY1A 1ZSYA 1XMPA 3RIMA 2HJWA 2IUTA 2VRCA 5JD3A 5DM2A 3GLGE 2YS6A 2C54A 4R8LA 1BE0A 4WXRA 4L9AA 2W58A 1JFRA 4EQ6B 3WHLA 1KY4A 3DZGA 5GV7A 1KRHA 5T41A 4YO8A 4PAQA 4QLAA 1LX6A 2P2DA 4DV7B 1NOIA 4RKEA 2Q41A 4Y7CA 4X61A 1YNSA 4X71A 3M5WA 1IUKA 1XVAA 4GL4A 1PZEA 4P22A 4KFCA 2YS7A 2RGEA 1SOUA 2XMBA 4YJFA 3K5PA 2ODTX 2LR0A 5IJ9A 1T0HB 3F6BX 1QK5A 5EYPA 2HDNB 3PNQA 2I3BA 3NRJA 4UTPA 1G9XA 4MS1B 2X5XA 3D3NA 1EEXB 1J5PA 3R5SA 2FSIA 2XR1A 3UK2A 3PU6A 4R5HA 5K05A 2YVKA 1GSIA 2G1JA 3S4YA 1C7EA 1WUKS 2Y0DA 3EPRA 1YQXA 3NETA 4QOEA 1W0CA 3N0TA 3S2FA 5IT4A 1ULHA 4KWTA 1U63A 4M89A 3AB7A 1NX9A 1KP9A 5JARA 2GAIA 3R4CA 4C08A 3V4ZA 1QCCA 2JGDA 1P3JA 2QB5A 4MHTA 4WLFA 2FR8C 2X42A 1P31A 4ZHQA 3KPUA 2OGTA 3C6YA 3EUFA 4YJFB 5ESDA 2D2IA 3BH7A 1GPKA 5IJ9B 1TVCA 4IDQA 5H80A 3FPFA 5EYPB 3GDFA 3HV2A 4BQQA 1NWHA 1U4NA 1NA5A 3P0HA 5DHTA 1YASA 2XMGA 1KGSA 2PBRA 4D4JA 1G5TA 2IXGA 4KPEC 2V4MA 3QMWA 1SKMA 4FINA 4YREA 1V8FA 4ZZ2A 1U1FA 4UXJA 1J23A 4C89A 1DRUA 1NTOA 1HQYE 2CYAA 3HU1A 1Z6QA 4ZOCA 1N4AA 4PN3A 1XTQA 2JGDB 1OROA 2I2CA 4ZAVA 3S6JA 1VPEA 3LCJA 5FOUA 3KKNA 2QLNA 2WHEA 2WD8A 4DWJA 3H2GA 3LQRA 1Z56C 3DLIA 1Q0SA 1SCBA 4A0FA 2I78A 4Y2XA 3OKCA 4NYIR 1RXYA 4GOMD 4V0SA 1ESEA 4N40A 3SHTA 1G6HA 2H1OA 5KJ1A 1ZHHA 1KAEA 3ZZNA 5JXJA 3FVWA 2AN4A 2XZPA 5KTOA 5DDIP 1XQVA 4XGKA 3PHLA 5PGMA 3V6MA 4BNYA 4Q21A 1QV7A 3A2NA 3QQ5A 3HRHA 5COBA 1FRNA 3HMQA 4JLNA 2C7PA 1JS1X 3DOOA 5CD9A 4FSHA 1E5QA 1ECBA 1TIBA 3IAHA 2VSXA 4JV5B 1VRVA 3TTTA 2INGX 1L6RA 1LQUA 2OSBA 5FKJA 4NMXB 4ZAXA 1GXSA 4GLOA 4O33A 1FVXA 2ERCA 1RHJA 1OFTA 4WKCA 1I4WA 4X8MA 2XSZA 1GTL1 1Q14A 2NT3A 2FSHA 3AF2A 5ULLA 5BRAA 4L6CA 1TM1E 4NI5A 1HRKA 1R37A 1OFUA 4JWTA 3QI2A 1EJ6A 4X5OA 4DBVO 2OAEA 3KXPA 5H02A 4QDZA 4BFWA 1QIMA 3CTMA 5DH9A 4TXLA 3RHZA 3RR2A 2J41A 4NAHA 1A9TA 5TPZA 3COSA 3ZCPA 4WIAA 3H8JA 1AURA 5CIWA 4GI3A 2RDMA 3NM4A 2IZZA 1DP4A 1XJCA 4JYAB 5JROA 3T7CA 1KAHA 4MCAA 1K8QA 3RC1A 4MYRA 4JBGA 3VSBA 4L8FA 2BN4A 4K6MA 3EC1A 3GT0A 1QFJA 4CQJA 3TL6A 3I2JA 1P6UA 1MOPA 2EIHA 4H0NA 4BQIA 2EQAA 4Z86A 2DWUA 1UBSB 1QVZA 2PKCA 3PXBA 3S2IA 1VXRA 2O2XA 3FNEA 3FSGD 3PUXA 1VFPA 2QW1A 4HUQA 2DPHA 2G4VA 3DL7A 1JMYA 2OBBA 4M88A 2P2GA 2GSDA 3ZNPA 4AP6A 1MRZA 4WZAA 5AKYA 1K0UA 2BGGA 2J6BA 5DM0A 3UY4A 1P77A 3G59A 3KVOA 1XZNA 3OZSA 2FN3A 1P9RA 4G8BA 5EIEA 2CCGA 4LJ9A 3C14C 1P1BA 4IGFA 1OYYA 2GKSA 4EO4A 4R1SA 4L3WA 4YJGA 4B7XA 3AIMA 4HPWA 2HCBA 2WK1A 4C1BA 2O7QA 1M76A 4D96A 1NG9A 3B6KA 1Z8NA 1PSZA 3FLAA 4BNUA 2ZYSA 4HH3C 2PSFA 4HUQB 4MR7A 3Q7PA 3ZTWA 4IVNA 1W25A 2GT1A 3ZIAA 1NE2A 4KWEA 1ZBDA 2I5PO 2VHEA 3AKDA 3JQGA 3L46A 4WZAB 5FOXA 3A26A 2BGWA 4IHQA 4MINA 4UXIA 3CZCA 1XZMA 1JTFA 2ISCA 2Q8PA 2NTYC 1CQWA 2Q8NA 3LQQA 3T5GA 4BEVA 4LF7B 1XWWA 1DAKA 4QQKA 2YBDA 2CLHB 4XRGA 2XCLA 5EIFA 5BR4A 1UBUS 4KUEA 4B73A 3NM6B 3NDIA 3O8CA 1WR8A 2A2ZA 2BFDA 1CC1S 3GPDG 4WXMA 2FDCA 3GQVA 1PT9A 3HA2A 4U0JA 2ZSBA 5C34B 1KIFA 2FWPA 2RGUA 2ZTMA 4YJGB 1VCIA 1HT3A 3LCVB 3OI7A 3DDUA 3H19A 5EUCA 4TLDA 5AICA 3GFRA 3W0LB 5JDCA 1KMQA 5CVDA 3VMFA 1Q91A 2RGNC 2DKFA 3KSMA 3RFXA 3TOZA 1PIWA 4JP8A 4GMFA 4MR7B 3DOCA 1JZQA 1NC3A 1Z4OA 2C61A 3OWHA 4IDPA 4LRQA 4OG2A 4PPNA 5DF1A 5E7JA 1JSLA 2WYHA 3JQGB 2Q4TA 2LP4Y 4MKXA 4JVNA 5GTDA 1DKUA 1HEYA 1N2SA 2JFZA 3QFTA 5F77A 2YWCA 3LPDA 3T34A 5HW0A 3THYA 1H8HA 3TNJA 2Q5HA 3UUGA 4C78A 1O2DA 3AL2A 3U48A 4D4KA 1WMBA 1IYZA 3NHSA 2X6TA 3WY9A 5TJ9A 3PCRB 3QX7A 1X74A 2BISA 3LUDA 2V7EA 3CO5A 4N5NA 5D2CA 1VLLA 5G0SA 2NTJA 5JAPA 2BHTA 5E6RA 1YDEA 2M2IA 2B34A 2W4IA 2WF7A 1DIHA 3JQ8A 4Q93A 2PX2A 3J81k 1A4XA 3QG5A 1YQUA 3PC7A 1J5XA 3RC9A 1B1AA 3O0DA 3AHHA 1XMQB 1E63A 3R6WA 3UWSA 2NQ2C 2E6KA 3IH5A 3OLVA 3ACCA 2PRIA 4IM7A 5F1OA 4Q3BA 3NTLA 3VR4A 4BJ6A 2IEZA 1EWKA 1F17A 2JJMA 1YQ9A 2WU8A 1TQHA 1XB2A 2RGBA 1E9FA 3MAAC 3MPUA 4JELA 3RYIB 2ESRA 3IEIA 1SN7A 1B26A 3MOSA 1R8XA 2EOAA 3OC6A 3P9CA 3FLEA 3THYB 4M8LA 5ITVA 2Q07A 3TX2A 3MTJA 1DC5A 3A28A 3BT7A 4O4LF 3KFVA 1R88A 4FKMA 1R8QA 4C4AA 1LW7A 1NXWA 3HEAA 4GAEA 3C3KA 4PXAA 4K9PA 4DRXA 3C3XA 1LKZA 1XX6A 2PUBA 2C3UA 3EGOA 3JQ8B 4C76A 4YRAA 1NASA 2QL9A 4N5DA 4PVCA 4BS9A 3R41A 4Y2PA 4F3KA 3O92A 5HRAA 4RD2A 2ENWA 4J76A 1BXGA 3I1FA 3P2MA 1YIAA 1X7DA 4QJ5A 3VV2A 4AT1A 4CM5A 2G9RA 4H31A 5TMEA 2Z2YA 1LLCA 1U7HA 2NU6A 3W2EA 4PNEA 3EXHA 1A8IA 2QTTA 4ENTA 3GLQA 3V4VB 4CM1A 1IOWA 5IDQA 1OX4A 3PTLA 5BSFA 2OMKA 5K99A 4RUKA 2HMAA 5IT9A 4LJRA 3EVDA 4HRAA 3PGLA 2GCNA 3EFOA 4QBHA 5SZJA 1PJ2A 4Y1FA 4FVTA 4U63A 1NRXA 4Y3UA 2H11A 3T5TA 1QGED 3QY0A 4DRXB 1V7QA 2Z2JA 3H7AA 3A6GA 4G1CA 2XSZD 4ZJZA 4XUEA 3DAPA 1Z5WA 3PDHA 4RHFA 4COOA 4KR7A 3JR7A 1RMQA 1T0PA 2YIMA 4NZZA 5M29A 1FXWF 2PXXA 1BXGB 2ZJ7A 4NHEA 1JXQA 1AU9A 3BYZA 1N8NA 4MSUA 4MULA 5EJ2A 2J87A 2JBWA 2NU6B 1T6XA 3NGMA 3OFND 3I42A 3OUZA 1X19A 2FW7A 3LQ1A 3NCTA 4I4IA 4U7PB 1OX4B 2LCFA 4BBPA 2QZJA 3WB2A 1EA5A 1EUDA 1FZQA 2ROQA 4MWBA 1CZRA 4P34A 3EFOB 2QGZA 4J8PA 4EARA 2CXTA 1BX1A 3KO8A 3M1YA 4JLAA 4HH1A 3ORSA 1XCBA 2FZCA 3K0KA 1I6WA 4HFJA 4TKZA 4BPRA 1R0ZA 1NJ6A 3BJEA 2BHSA 2ZUBA 2HMVA 5BR1A 1NR7A 4EGAA 2VNJA 3TMYA 1D6NA 3UAOA 4G2NA 3EH2A 4GKAA 5HA5A 1JKXA 2BH9A 3GOHA 4NZOA 3ZWXA 2C4MA 1T2FA 3U0BA 3EYAA 2HR1A 5EGSA 1SEPA 2UDPA 3P2JA 2ZQZA 3SQOA 1YL6A 3C7KA 2GGSA 3UW1A 4A82A 4YP6A 1EVIA 2XMZA 4EI2A 1QDEA 4BLTA 1GPWB 1EUDB 1EFTA 3SQWA 1ORIA 2FOLA 2R11A 3TG8A 1Z5OA 4EOGA 1ABBA 2WKSA 4M98A 5AXAA 1JYSA 1NQOA 2TMGA 1LVHA 2W5UA 3IPYA 1L4BA 2X40A 4V0ME 4EKDA 4ZXFA 1VG9B 2AGVA 2X2EA 3DF9A 4KFTA 1VMDA 1WXFA 3V6LA 3A4TA 5T4HA 2HV9A 1RRMA 3OICA 5LUBA 4F60A 1ZDMA 3MB8A 4UE2A 1JXMA 2C2BA 2GFQA 5TY0A 1DIBA 4HCJA 3EEBA 3K1JA 4BO4A 2MYTA 3LQFA 2X9QA 3K35A 2G7MC 1TO1E 2CGEA 3M6LA 3OIDA 4J0EA 1L5NA 3VYSB 5ALOA 5FBVB 2DJIA 2QM0A 1P80A 2XOKA 1EUZA 3HBNA 4B82A 4TWZA 5BW5A 4EF4A 4GUDA 2KBFA 5C7IO 4BP9A 1C9KA 4YPVA 3VH4A 2DR2A 3HJRA 5IVPA 3TUZC 1R8SA 2E5WA 1UJCA 2XAUA 3AERA 2CJPA 2QM3A 1KJ8A 4HGQA 1H4VB 4EA6A 1V8DA 1N5OX 5BXYA 2UUCB 1Q7GA 3B6IA 3JRNA 3RAGA 1QAOA 3TCNA 2AI1A 3HCOA 3KLPX 2DWOA 3AY3A 4IJMA 2XB9A 4ZI3A 1I0IA 3X43A 3OLZA 1G55A 2Q27A 5J40A 2YY7A 4WD3A 2I3ZA 3UOAB 5BN4A 2B1RA 3OHMA 4TXHA 5T57A 3WDLA 4A15A 4OQFA 1YUMA 4DCNA 3NHFA 3PWSA 2GPYA 5LM3A 1A8SA 2QZPA 1Z2NX 2FETA 2P3SA 4IDDA 3BULA 5DB4A 4RF5A 1U7PA 2Z6UA 1P2FA 3RBZA 2PJDA 4R2IA 4A1OA 5BNTA 1REQA 3AFGA 3H5WA 1AQ6A 3SOPA 5HVNA 2OC9A 3I01M 1CLEA 3NV9A 2CWWA 4JU9A 4WASA 5FI0B 3O84A 2ZJ4A 2FZ5A 2C8LA 3AERB 2X3FA 2YNMA 5A7GA 1BDBA 1PZGA 1JBEA 4U1RA 2XCTB 4HEA1 4NK5A 5JFTA 1TKRA 1AUQA 3KKZA 4GZLA 5DBIA 3TH5A 4F9EA 2ZQYA 5IM5A 1E3JA 1HO3A 2R6AA 2XTZA 2P6PA 5JUWA 5DYYA 2C9BA 3F96A 4E31A 5BN4B 4AX8A 3N39C 2VTDA 4RHTA 4MW5A 5BSRA 1OAOC 1QNLA 2P8SA 3IR7A 3NPMA 4HD8A 2ZJ8A 2J5KA 3W9UA 4R98A 4O3MA 2H2GA 1ZVQA 3R4VA 1Q22A 3BD6A 4GT1A 4HAYA 3FGPA 3M2TA 1B0ZA 3R9XA 2C42A 2BPOA 1SB8A 3GGOA 1E6LA 3NBMA 4XTRA 3X44A 3EMBA 3K1ZA 2KI5A 2QL7A 4L4UA 4UTZA 4UXHA 1NMQA 2OFXA 5C2JB 3HXOA 1FYWA 2VLBA 2PS1A 1IWOA 4LZJA 5JBIA 1CQIA 1PS8A 2BCGY 3DWFA 1GPUA 4RTRA 2CMKA 3SJ7A 4JA0A 2LDXA 3RC2A 1X3LA 2GNAA 4FE4A 3HJHA 1SHTX 2RHHA 4TVBA 3OQMA 3DT9A 4AN0A 4BKRA 5IUKC 1C50A 3FKQA 5KTTA 4Z4QA 1BN6A 2RJOA 4JL6A 1MFZA 4JJIA 4NYIQ 4GYKA 2XTMA 4PAMA 1R15A