1XU7A

Crystal structure of the interface open conformation of tetrameric 11b-hsd1
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
263
structure length
263
Chain Sequence
QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase, isozyme 1
publication title Conformational Flexibility in Crystal Structures of Human 11beta-hydroxysteroid dehydrogenase type I provide insights into glucocorticoid interconversion and enzyme regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xu7A00
2GZ1A 3IAHA 3WICA 3OIGA 3VVBA 3PHHA 3DB2A 1FDWA 2PGDA 4BMNA 3N58A 4BO1A 1KEUA 2GGSA 4ZQHA 3PWSA 4W9NA 4ALJA 2Q2VA 1DIAA 1E1NA 1WPQA 5KJEA 3RSHA 4NFHA 2ZB4A 2W90A 5IXYA 1UZLA 4N7RA 2JFHA 3ITDA 3UN1A 3FWZA 1VC2A 2WD7A 4ZQGA 5EIOA 4NH4A 1XEAA 1H2BA 2G76A 4GVXA 3HDYA 4GGOA 4DQXA 4GMGA 1XU7A 5A04A 4IDCA 2PNFA 1YOVB 2HSDA 3QLJA 3JQ7A 1NQ5A 3KEQA 4WOKA 4TRRA 4K28A 3TZKA 3PTZA 4E5YA 3LT2A 2Y67A 1I3MA 1T1RA 1HRDA 1FXSA 1F12A 3Q9UA 2J3KA 2RIRA 3EVNA 4B3JA 4YEDA 5ER6A 4NPCA 4HBGA 2EW8A 2QRJA 5BR7A 2FPGA 3GUCA 5DOVA 3WQSB 4FN4A 3ONDA 1JVSA 4NBVA 4XB2A 4HFMA 4PGFA 5JS6A 3G1UA 2Y1OA 5ITWA 1R6DA 2VTDA 3OMLA 3ZDFA 3WTCA 3ULKA 1ADGA 5L95A 4YR9A 1NR1A 2VYND 2E4AA 5JBIA 3GFBA 1N2SA 5TT1A 1LNQA 4RVSA 1ZUD1 3F47A 3UICA 1EDOA 2XOXA 3PWKA 3AI1A 1DC5A 1ZO8A 2CDCA 3E6AA 4D3DA 4MKRA 2LDBA 1ZSNA 1Z82A 3M6IA 4OHUA 8ADHA 1XWFA 1B16A 3A4VA 4RDHA 2NTVA 3TOXA 2X0JA 3DZHA 1HE3A 1DHRA 2CMDA 5LCXA 4OQYA 1MXHA 4FSHA 1YJ8A 4FQ8A 3VZPA 1X7GA 3ZW8A 4E31A 1EQ2A 3F5QA 4U6SA 2FN7A 3HG7A 1E3IA 4OO3A 5L40A 2X9NA 4J90A 1TT5B 4J1SA 2HJSA 2GR9A 1H6BA 2D3TA 4BL5A 4EGFA 3ANLA 2JCYA 3EY4A 2W4QA 4PLTA 3RJ5A 4DMMA 3O8QB 2HRBA 2ZIZA 3LLVA 3B70A 1P31A 3BAZA 4KQXA 1J5PA 1SPXA 4DA9A 3NUGA 4GVLA 1HZZA 1LDGA 3O03A 3BMQA 3ZWAA 2W2LA 4ZQBA 2BH9A 1HEUA 4FIZA 4CV1A 3EVTA 3E9QA 1DC4A 2BELA 2GLXA 2VUTA 3ANNA 1T1SA 1BW9B 3AK4A 1GPDG 3Q2KA 3QVTA 4QUKA 4CR7A 3P2YA 3ST7A 1T24A 3MOIA 3VZRA 3PXXA 4XYMA 2E48A 2X5KO 1N7HA 3TF5A 5COAA 3NV9A 2G0TA 3PEFA 3F1LA 1EVJA 2YV3A 3KLPX 4IJUA 2D0IA 5L9AA 4N5MA 2NQ8A 4O59O 5CDUA 4M1QA 1U1IA 2PZMA 4R54A 4OOFA 3KYDB 4E13A 4F6LA 1VE9A 1O95A 1X7HA 3PJEA 3I9JA 3ZI0A 2PWZA 1MC4A 1R16A 5A5FA 3HHPA 3GH3A 3RUEA 4BNXA 3Q6IA 1LQTA 5EQDA 4BO5A 2EG9A 3ROQA 4XA8A 2Y0EA 3JQ6A 4IZIA 1Q7BA 4EI2A 1YRLA 1H9AA 1ZW1A 4RPKA 1J6UA 5AYVA 5TGDA 4D42A 2HJRA 1LSUA 3A1NA 3ADPA 3UVEA 3KXDA 1QR6A 2EP5A 3PJGA 2GN8A 3B20A 4RVFA 1RKXA 2HMTA 2JD0A 4WLFA 2IDZA 1M76A 4RF5A 5AXDA 4QT0A 4R1UA 2ZCUA 4XRRA 1HDRA 1EE9A 1FMCA 4K26A 3PFFA 1ISFA 4E2YA 1D4FA 4PLWA 4A7PA 4YT5A 3JYPA 1PZGA 3OJOA 3WIEA 5TJHA 2PD6A 4XYEA 1Y5RA 4GX5A 4D43A 1GZ4A 2O48X 1NBOA 3WGZA 4IXWA 4Q3NA 1HDXA 1JKFA 2OMEA 4IXTA 4MKXA 3Q9NA 4D0SA 1H6CA 3IKVA 5T5QA 3TZCA 2Q3EA 3VZQA 2FRDA 3WJ7A 1IB6A 3GN1A 1PIWA 4CM6A 4JP2A 1A71A 2YHIB 4PG5A 4AJOA 4FFLA 1JAXA 1B26A 4ALNA 3JQ9A 4LW8A 4IDDA 1NVMB 4UVHA 1NPDA 2HKIA 4PVDA 4IPTA 1PZEA 1DRUA 1I8TA 2GASA 3FF4A 1TEHA 3P5SA 4FOOA 4A03A 2F00A 4C4OA 1SC6A 1GU7A 3W8DA 1ENZA 3DBRB 4DMLA 1GAEO 4W4TA 3PDUA 1SNYA 1C0IA 3PHIA 5F1KA 3NAQA 5L4NA 2Y93A 1VLLA 1I2CA 4IMRA 1GQYA 4LSWA 2AG5A 4Z0HO 3ZWNA 1ZJYA 2OXIA 4B3IA 1ZFNA 2R2GA 1L7EA 3FR8A 1BXKA 4NJMA 2RHCA 2D1YA 1YE3A 4I5GA 1PQWA 8LDHA 1YL7A 3H5RA 1PU2A 1GZ6A 2A4KA 5HWSA 4NBTA 1EVIA 3HB5X 3UUWA 4C7KA 5F1OA 3DTYA 2PLAA 2IODA 2Q4EA 4PG7A 2CDBA 1IZ9A 4XQEA 1B3BA 4OKNA 4IDGA 4D0RA 4DL9A 1H5QA 4E33A 2A92A 4AJPA 1UP7A 4B4VA 3GGGA 2YHUA 2W98A 4IDAA 4GX2A 4ZN6A 1E7WA 4UUMA 3V1UA 4J4TA 1C1DB 3RI3A 3QVSA 1EK5A 3WGYA 3S2EA 3AUTA 2E49A 2O3QA 1QYVA 4YJGA 2NU9A 1C1XA 1E77A 5I9NA 3FWNA 4Y8VA 4A26A 4UUPA 3ZWBA 3AU9A 3I9OA 5CEEA 1LSJA 4HNHA 4GX1A 5L4SA 2VT3A 1NTOA 1BTOA 5TNXA 1T26A 1CEQA 2J3HA 2JAHA 4WASA 4ALMA 2WE8A 4CUZA 5H83A 4AJ2A 1VKNA 2AQKA 1QYDA 1V3UA 2AE1A 2VHXA 4JJGA 2QZ9A 1IZ0A 1UP4A 1Z7BA 2WYVA 1WVGA 3KV3O 3ADOA 1R0KA 4Q3DA 1ADBA 4XIYA 1EDZA 2ET6A 3RC9A 5A4DA 4WECA 3WYCA 5AXCA 4UULA 3DAPA 2DUWA 1WDLA 5K6AC 1EVZA 2RHRA 5IDQA 2YFQA 4MDHA 1GYRA 2V6BA 1ZK2A 1RPNA 2HK9A 5T64A 2BGKA 2GF2A 1E92A 3HFGA 1WMBA 3KYCB 3PLNA 1BVUA 1KY5A 3BTOA 3LC2O 4I9HA 1CQJA 5HM8A 3MWEB 4XGNA 4AVYA 1D3AA 5JDIC 4AFNA 1GEGA 3I23A 1U2DA 1P1KA 3W4KA 3NDIA 2DTXA 4K9DA 4L4RA 2EEZA 2CFCA 3SBOA 1ULUA 3ITKA 1OI7A 1M66A 1JLLA 3O4RA 2FR8A 1MLDA 2ZTMA 1OC2A 2C82A 3C8MA 1RM0A 1SAYA 3CXRA 3KO8A 3F9IA 1LC0A 2HMSA 3UFXA 3JYOA 4FC7A 4BKQA 1BGVA 1UZNA 5KWEA 3D3WB 4QSMA 4WCFA 2H63A 1N1EA 3GFGA 3ZZNA 5AXAA 1NASA 1ZVMA 2X0IA 2VUSA 2X58A 1DC6A 5GZ1A 3QHAA 3GUYA 5IZCA 4FFNA 3QW2A 2C20A 4IJWA 5B4VA 1NHGA 1G6KA 3JQDA 2X0NA 1NFFA 4EITA 1MXFA 4NBRA 4YT8A 3RUHA 1K6IA 3ICPA 4NIMA 1YBMA 1ZKMA 3PZRA 5U1PA 4XQGA 3IP1A 4O6VA 3UKOA 3PVZA 4CMIB 1H0KA 5T57A 4K1LA 1PSDA 3JQFC 1I01A 2WE7A 3WXBA 3MWDB 4L8VA 2EW2A 2HK7A 2I66A 4MVJM 4OL9A 5EERA 5JO9A 3W6UA 3CE6A 3WTBA 2I3GA 4KWIA 4Q3CA 2AQ8A 2NADA 3I9LA 1DEHA 3GG9A 3V2HA 4BO8A 2DTEA 4NK4A 5CP8A 4BB5A 2OORA 1YDEA 3MJCA 4PZDA 3RUIA 5KJ1A 1NVGA 4J43A 1PQUA 3TSCA 4HUJA 4NMHA 1PJCA 4S3MA 3KRTA 3H9QA 4XCVA 1YOVA 5L4LA 1FK8A 1VKOA 3HN2A 4D7AA 1VRWA 3WMXA 1AHIA 2IZ1A 5C7OO 2JJYA 3LVFO 3K30A 4YXFA 4RLHA 5DULA 2Y1CA 4XDYA 3W4JA 1U3VA 3QRWA 1PTJA 4IMPA 2EV9A 2E6UX 1U3UA 3OSUA 4WNCA 2R00A 4P22A 5T6BA 5KVCA 5G4KA 3PJDA 1V3VA 4RF3A 3LF2A 4R69A 3AU8A 4J7CA 1VSUA 2EERA 4ZVVA 2Y1EA 4QX6A 4WGGA 5CPFA 1E7YA 4LMPA 2P9EA 1NVTA 2OL4A 2Y1FA 3OBBA 4PLZA 3B1FA 5DF1A 5FF9A 5JE8A 5LDHA 4U8GA 1MC5A 1VSVA 2DBRA 3KOUA 3W8EA 2NNLD 2RAFA 3K8ZA 4HX5A 4PCVA 3AUSA 3RUCA 4CM4B 1MG5A 3OJLA 1J0XO 4BVAA 3BXXA 5DN9A 4XWYA 2HLPA 2DPGA 2P5UA 3N7UA 3ZN2A 1OBFO 1M6HA 1NNUA 2PZLA 2O23A 1YBVA 2Q50A 3PLRA 2QRLA 2W2LD 1AE1A 4RJTA 4FGSA 4FPXA 1VI2A 2HK8A 5JO0A 5DBFA 1E7MA 1A7KA 1SBYA 4R16A 5LC1A 4CLHA 2X6TA 2QRKA 5J23A 1Y9AA 4IIUA 1YDWA 1JVBA 3H8VA 4ZA2A 4DBZA 4XDZA 4U0JA 1P1JA 4NU6A 2H6EA 2POQX 2ZYGA 5JAMA 2HMUA 3NT4A 3RFVA 5BSFA 2PFGA 3GDFA 4B8WA 1HDOA 1I32A 3V1YA 3HADA 3MJVA 3O38A 2I99A 3QWHA 4CV3A 1H9BA 1DRVA 3BMNB 5CG1A 1JN0A 3D4PA 5EJ2A 3JYQA 3ANMA 1GFSA 1X0VA 3ASVA 3D3EA 4W7IA 1LRJA 3IDSA 2YV2A 3DAGA 4DGSA 3DTTA 2CVQA 3D7LA 2DBZA 2DFVA 4M89A 1RWBA 4Q3AA 3TRIA 4WCDA 4OSOA 2WDZA 4KDFA 4JIGA 3QSGA 1KY4A 2BLLA 1R15A 4BS9A 4ZJUA 2DKNA 1F06A 4L4SA 5C7LO 1F8FA 5CHEA 5FI5A 3GDOA 4NQZA 1YKFA 3MEQA 4FFRA 5CDSA 5MDHA 1NAIA 3KSUA 3SVTA 1U7HA 2C59A 5EMHA 4XRGA 4AJEA 3QWAA 3RBVA 4L75A 4AJJA 5JCXA 3DHYA 4A27A 5F1PA 1QYCA 4S1VA 2ZTVA 3KYDA 4PZCA 5IDWA 3F4LA 4HY3A 1QV6A 1E1KA 3T4XA 3NTRA 4J2HA 2VNAA 5DDIP 4BB6A 2ZYDA 3UCEA 3ZV6A 2JCXA 3K2BA 4QTZA 3COSA 2DQ4A 2TMDA 1A72A 4J1QA 4G65A 5FWNA 4QFDA 3JD4A 4E32A 3CPSA 1PS8A 3JYNA 3FR7A 4DPMA 5JAIA 5JMWA 3F46A 3ROKA 3R1IA 3WGIA 2G1UA 3OHSX 2D5AA 2IYOA 3N74A 2D4AA 4AJLA 1PJ2A 4BNUA 1E1MA 3WFJA 2Y1GA 5THQA 3KSDO 3R0IA 2ZYAA 4EUEA 4BKPA 5AXBA 2EXXA 2VUUA 1Y81A 3L4BC 4BGEA 1SOVA 1LDNA 3D0OA 3RASA 1EUDA 5CDYA 1HDYA 1NPYA 4EJMA 3ICCA 3GA0A 4TRJA 3RIHA 4MVJP 3GRKA 2XXJA 1HZJA 4UUNA 3ZV3A 3O26A 1ML3A 4GAEA 4NZ9A 4M55A 2PH3A 5COBA 1H6DA 3AI2A 1UAYA 1GPJA 4KTTE 3VTFA 4BO2A 5THKA 2YHIA 3K31A 3E8XA 4F6CA 2NTJA 4XGKA 3JQGA 5IDYA 2FSSA 3Q11A 4RL6A 3UAGA 5A03A 1BG6A 2DAPA 1YB4A 1D8AA 3L9WA 2NUAA 1EQUA 4Y9DA 3EZYA 1P9LA 1D1TA 1ZXLA 3D5QA 3PGJA 1E6UA 1ZK4A 1ZMOA 4UUOA 1UXJA 3HFSA 3DBRA 2C5AA 2UAGA 3AI3A 3UF0A 1JAYA 4GH5A 4JJIA 1YL6A 1XQ1A 3X2FA 5JFOA 2X5JO 4Y6RA 3IIEA 3TN7A 2XXBA 4WK6A 4LRSB 3S8MA 3TZHA 1NFQA 1JWAB 4YAEA 2PR2A 3VKVA 4UEJA 1AGNA 1GZ3A 3BZUA 1NWCA 5ENVA 5KVVA 2VCYA 3JQCA 3L4SO 3H9JA 4ZICA 4EEZA 1LLDA 3OJ0A 2FP4A 2GN4A 1HYHA 1X1EA 1EUCA 1BMDA 2PZKA 1C1DA 1Z73A 3ZHYA 4MKZA 4AG3A 1XG5A 5KJCA 2OOSA 4BNZA 2AQIA 1HF3A 1PGJA 1ZEMA 1E7SA 3IL2A 2GO1A 4KOAA 1I0ZA 3VKUA 3ZW9A 4QQRA 3DZJA 3GC6A 4MOWA 3INGA 1LLUA 4UREA 2B5WA 4KUGA 4WPGA 1WWKA 2A94A 1V9LA 4PLCA 1AXGA 4IM7A 3TZ6A 3D4OA 1GL3A 2ZCVA 3GGPA 1EFLA 1QRRA 4PLVA 3WGGA 1J4AA 1LDMA 4WUVA 3RJ9A 1P44A 3IKTA 5FI3A 4CM3A 3PDJA 4F46A 2C29D 4F3YA 4RPGA 2BRUA 1R0SA 4ROSA 4A2CA 5A9SB 4PLGA 4Z3KA 4Y6SA 1NQOA 1XU9A 7ADHA 3RUDA 3EUWA 3DMTA 4BMVA 2J6IA 1K0UA 6LDHA 3QWIA 2X9GA 1PR9A 5A9RA 3KB6A 1TLTA 1VL6A 4IJVA 4YVFA 1I24A 3JQBC 4OH1A 3WOHA 4J49A 1B14A 1CYDA 5ICSA 3QV1A 5JSFA 3TFQA 4B79A 1ENPA 1ZSYA 5A1TA 5JYDA 2G17A 2Y05A 3CEAA 4CM8B 2H5LA 5I8ZA 4MP6A 4ND5A 4OYRA 4E21A 1MP0A 3H2ZA 4RF4A 3A14A 4FFPA 1ZNQO 1N8KA 3VAZA 4MPDA 4Z0PA 1DIGA 5JC1A 2GSDA 2X8LA 3I4CA 3C85A 1I3NA 3ZNNA 5KIAA 1HSOA 5GZ6A 3ABIA 3FHLA 3OQ6A 3D3WA 3VTZA 2BFMA 3AM3A 2VZ8A 1UR5A 3G3EA 1UXIA 3RC7A 4IY1A 3QIVA 4YQYA 3V2GA 5KJ6A 1LSOA 5HA5A 1W4ZA 1H2HA 3VVCA 4QEDA 3Q3CA 2NQTA 1QYWA 1M2WA 3HDHA 3RCBA 2OGUA 2BI7A 2FMUA 5KVSA 2JD2A 5MGBA 2GN9A 1YS4A 3LYLA 5L7TA 2O3JA 3T4EA 1OFGA 1P77A 4DLLA 5IFLA 4TSKA 4AJ1A 2C7GA 2D2IA 1G0OA 2VN8A 2D8AA 3KETA 4ONEA 2CSUA 1SOWA 3WJAA 2NSDA 4GPD1 3SEFA 4XYLA 1O89A 1QSGA 1UXHA 3LQFA 1PWXA 2QYSA 3ZNPA 2JFGA 4ILKA 4UAGA 2CZCA 4IBOA 4BNMA 1O9BA 4R1SA 1QMGA 2I76A 3EC7A 3QA9A 4R5HA 2DLDA 4J91A 5BT9A 3MCVA 3NDJA 3NRCA 4W6ZA 2GYYA 3WGOA 1HKUA 4DC0A 1M67A 1DJQA 2UV8A 4B4OA 4Z0TA 4DPKA 3FCOA 3GMSA 4L0QA 1BRMA 4BV9A 1DIHA 1LDEA 3LC1O 2IEBA 4FGWA 1JW9B 1GUZA 1BDMA 5CDGA 3V1TC 2OFPA 5DZSA 4E0BA 1ZMTA 3FBTA 4GLOA 3RFXA 3AY6A 1T2AA 4J9UE 1PGNA 2FY8A 4LCJA 1KVUA 1LQUA 5IJZA 4R9SA 4W99A 3TQHA 1YXMA 3BYZA 1A27A 3VH4A 5ILOA 3DWFA 4GGPA 2O3SA 4RVHA 3ZH2A 1KVSA 3RKRA 1EE2A 1GCUA 4IQ0A 5HS6A 2WEKA 3NTOA 3G49A 4Y6PA 4ALIA 1LJ8A 1DHTA 4CM4A 3PYMA 4O0LA 4CLOB 1Q0QA 3LT1A 2EHDA 3AM4A 3IOYA 4I9NA 5BNTA 5L51A 4A0SA 4JCOA 4YJFB 3GRPA 4IIVA 2RH4A 1MUUA 5A9TA 2Y0DA 4RPJA 2Q45A 4BIIA 3PPIA 3G17A 1HE2A 3DFZA 3O9ZA 4ALKA 1R0LA 2VWGA 1NXQA 4IDBA 1I33A 5TQVA 3PRJA 1V3TA 4TZTA 5COQA 3WSVA 2ZTLA 1C3VA 3K2EA 4IGFA 3OETA 3GNQA 4RGBA 4UVGA 4AJIA 5KKCA 4CM5A 4HXYA 1GTMA 2I9PA 3U4HA 4JXKA 2GUGA 3DZFA 4IDFA 4OQZA 3U09A 1P3DA 2IXBA 3ONFA 5T8KC 4PG8A 4RDIA 1NM5A 5FYDA 3EW7A 3CZRA 1B8VA 3BMNA 5IXSA 3GY0A 2Q1UA 3G79A 2GCGA 2BMAA 1HLPA 3RU7A 2C5EA 2EF1A 2H9IA 4JQCA 4TQGA 4ZHSA 2PK3A 5BNIA 1R4NB 1NX6A 3VPSA 2CUKA 3PI7A 4AJHA 4CM9A 3KHUA 3S2IA 3DDNA 5F21A 1GV0A 1HSZA 3I4FA 4YB8A 2O2SA 2UUOA 1VJ0A 4MP8A 4A73A 3NYWA 1IPFA 4N54A 4CQLB 2EIHA 4KMSA 1ENYA 1KVTA 3H5AA 2VYVA 2YUTA 3CKYA 4DRYA 4U6QA 3GVHA 3RKUA 3VZSA 2NLOA 3S2FA 2DPHA 3QVWA 5LDGA 2FPPA 2PY6A 3TL2A 4DLBA 1UXKA 1GUYA 2LDXA 4TRNA 2AXQA 2EKLA 3D64A 3ZV5A 5JC8A 4QECA 2EJVA 2WD8A 2C2XA 4YJDA 3FPCA 1LDBA 1JKIA 5JMPA 4BO9A 1DFHA 1ISHA 1CF2O 2VRBA 3KUXA 1L7DA 3GF4A 3SX2A 4WNIA 2P9CA 4JNKA 4M87A 4YAKA 5KNLA 1BXGB 1CERA 3AUUA 3JQAA 4E3ZA 3C1OA 3ZNOA 3G1TA 2Q46A 4WEQA 4MVJE 3VPXA 3EAGA 5B37A 4PRLA 4E2ZA 3LK7A 3HB4X 4IS2A 5BSEA 2W2KB 3PQFA 1LI4A 2UYYA 1B8UA 2Y1DA 4XEHA 2IZZA 1K6JA 3OEYA 1QLJA 1K3TA 1E6WA 2X23A 4AL4A 4YAGA 2IZ0A 2E82A 4R9RA 1PGQA 1Z7EA 1QKIA 4FR5A 1G1AA 2Y66A 2P9GA 1EEHA 5K6AA 3RVDA 5DOZA 3FD8A 1LX6A 4JP3A 5AQ1A 1I2BA 3KM0A 2VNSA 3HN7A 2NU6A 3DR3A 4G81A 2B5VA 4K6CA 3WGHA 3FNHA 5G2OA 1ULSA 2ZTUA 4DREA 1JWBB 4Z6KA 2OO5A 4GWGA 5JDIA 1Q0HA 1U3WA 4K6FA 4UVEA 3RBZA 2AEFA 5IN4A 3DEYX 1Y8RB 3IUSA 3OIDA 4IUYA 3JD1A 1E3SA 2P4QA 1TT7A 5GZ3A 1O8CA 2NV6A 5IF3A 2Z95A 1B15A 1DAOA 3OF2A 4PLFA 2WD7B 3JQ8A 3L0DA 1PGOA 2OBYA 2WTBA 3ZWWA 5I7SA 4ID9A 3BHJA 5F5LA 5HRUA 6ADHA 1PJ4A 3LT4A 3NDRA 4CMEC 4JK3A 4MIYA 3E5MA 2P4HX 1YO6A 2GRAA 3FNGA 1YVEI 4E4YA 1Z45A 4LCEA 4IDEA 5TC4A 3BMCB 3GAFA 1ONPA 3CIFA 5KTKA 1GYQA 4QO8A 4E5NA 4GI2A 4OXKA 2B0JA 3OFSA 1IHYA 1LU9A 3I83A 3H5NA 4PLPA 3DMYA 1FDUA 1E0DA 1UJMA 4J1NA 1CIVA 3MJ4A 4R5MA 3GOHA 4D3FA 1LRLA 5IZ4A 3HZZA 5ADHA 3DC2A 4CQMA 1A4UA 1MFPA 3H2SA 3SXPA 5TLSA 1Y1PA 3F6YA 1FDTA 3JQFA 4AJNA 3TZQA 4GMFA 3PHGA 5F3RA 1X13A 4U0KA 1G0NA 2NTNA 3BIOA 1D7OA 5JDCC 3WNQA 3PK0A 4FFOA 4QXMA 2EJWA 4DIOA 1T2CA 1WXDA 2FR1A 4X54A 1WW8A 4J16A 4JROA 4KQWA 3PHLA 1GYPA 4ND1A 2D5CA 4WLNA 1V0JA 4MVJG 1ZK1A 1V8BA 3BA1A 5DCUA 9LDBA 3OJEA 5L3ZA 2GZ3A 1KEPA 2B4TO 4XYGA 4D3SA 3GAZA 1KIFA 4UEOA 3MZ0A 2EWMA 3UW3A 2ZJ0A 2XF8A 3UCFA 1PL7A 5TJ9A 2NVUB 4EJ6A 3LU1A 3V8BA 4D46A 4GL4A 3L6EA 4XX0A 2C0CA 2I65A 3DBHB 4JBGA 4PLYA 5GY7A 3WWZA 2J3JA 4WLEA 3ZNQA 3DAFA 3WLEA 3ZWYA 2O3TA 2VHWA 4N5LA 4BOYA 2HDHA 3F4BA 1WNTA 4LVCA 4PVCA 5A9SA 4XQCA 4YAIA 4FBGA 1HT0A 1NQAO 4HKTA 2PGLA 1I36A 5GMOA 4ZQEA 1Y8QB 2X7HA 3AM5A 4YPOA 1CWUA 1I5RA 1U28A 3E1KA 3OQBA 2IRWA 4CLRB 1MA0A 2Q1TA 3I52A 3ZV4A 4BNHA 3ZU5A 1IPEA 4YT2A 2X4GA 1H94A 4BUCA 3KSZO 5A02A 3D4NA 2EGHA 3PFWO 3IP3A 1W0CA 1DPGA 3OEWA 2V6FA 5G0UA 4CM8A 1DO8A 1A9ZA 1GQQA 3MJTA 5H82A 1WAMA 4TWRA 3CMCO 1E7RA 1F0YA 3QP9A 4CODB 4Q3EA 1P1IA 4ESOA 1N92A 3U62A 1HDCA 2P2SA 1N1GA 3PQEA 4NFSA 4UEKA 1UH5A 1W6UA 3GEDA 9LDTA 3KZVA 5A3JA 3L6OO 1DFGA 1MG0A 1ZSVA 3LDHA 4JBIA 2IXAA 1P0CA 1EUZA 4M86A 3JTMA 2WWRA 3DL2A 4CLXA 1DRWA 1BHSA 2P5YA 1KVRA 2YQ5A 4WLUA 2BFAA 2VWPA 1RM3A 3TOZA 2I5PO 5JXWA 3ZHBA 1TT5A 5A5EA 4LK3A 1E3EA 1F8GA 3JQEA 4AJ4A 1QXSA 4TRMA 2A35A 2X5OA 5HBRA 3O8QA 4XYBA 1F14A 3HQ4O 4H3VA 3KVOA 4BQPA 3GVXA 1B0AA 3ASUA 4EW6A 4PN3A 1C0PA 5KJFA 3Q1LA 3KLMX 3VDQA 1IYZA 3H9EO 2F1KA 1AUPA 1T4DA 3WLFA 5C37A 5I8WA 2GPTA 3P2OA 3GVIA 4EEXA 5L7YA 3INRA 1UDBA 4MO2A 1UZMA 1BW9A 4NJOA 1XLTA 5B4UA 4CL8A 3ZWCA 4WEOA 1PJLA 1ZXBA 3MJSA 2BKAA 2VHYA 3ORFA 5BSGA 2W8ZA 2YDYA 1YQXA 5KVQA 4YWJA 4GX0A 2J8ZA 4B3HA 3FI9A 3OM9A 4BNLA 4RV9A 2B35A 4FCCA 4U7WA 5HS4A 4J4HA 2EKPA 4R1NA 4YQZA 4NBWA 4OKIA 4RVUA 2O7SA 3TWOA 2Y0CA 4MINA 4J3FA 4O5OA 4P4LA 4Q9NA 1PZFA 3ON5A 4WLOA 3AY7A 1ZK0A 1IHXA 2NVBA 1PJSA 1B2LA 3L4BA 5ES3A 3GN2A 5K9ZA 4QFCA 5B1YA 2WM3A 4GWKA 4D79A 1UP6A 1GDHA 3T7EA 2O3RA 3AOGA 4E30A 1NHWA 2X9VA 3U4IA 2WJPA 2CNBA 4CL3A 1BXZA 2Y68A 3KTDA 3NTQA 4YRAA 5I7EA 2HO5A 1U5CA 4CLOA 1OOEA 1WZEA 3QWFA 3HE3A 3GPIA 4NR0A 3FRJA 5ILGA 3CMMA 1DC3A 4W7HA 4LISA 4MVJA 2PTGA 1O0SA 5U9CA 4OAQA 1ISGA 3AOEC 3VH3A 1I30A 2GD1O 3EK2A 4BGUA 4FB5A 4H15A 2Q49A 4CV0A 1CETA 1PR3A 3NKLA 2OHXA 4CM9D 3GHYA 3LSYA 5IAAA 1XQ6A 3PYXA 3NX4A 1JTVA 4R01A 3ZCXA 3ZWOA 2YW9A 1ZK3A 3EYWA 1L1FA 4EJ0A 2RBEA 1H6AA 1XA0A 3K73O 1AXEA 2VYVD 4FD3A 4GSLA 4IQGA 2O4CA 4MIEA 2P68A 2I67A 4FJ1A 2PKRA 2RH8A 3WQQA 1ZH8A 1OMOA 2AQHA 4EUFA 1U2GA 4I5DA 3WGQA 3AUAA 3E48A 1N9GB 1KEWA 2PKQO 2Q1SA 1W8DA 5JCJA 3UH1A 4CV2A 2BD0A 3MTGA 1LRKA 2Q99A 1PS0A 4TKLA 3JQAD 1E6EA 4ALLA 2X0RA 3CINA 4FOSA 4N18A 3B6ZA 3A06A 1E3WB 2O50A 5FFFA 3HJAA 1YH3A 1JA9A 4INAA 5CG2A 1XELA 1P45A 4ND3A 1GCOA 4XKJA 2HMVA 3NGXA 5G0SA 4HV4A 1ZEJA 3E9NA 1E5LA 4MJLA 1HDZA 2BGMA 4KUEA 1IE3A 3VHRA 3C7CB 2AHRA 3HNPA 1DAPA 1GY8A 1ZCJA 3PJFA 3VDRA 2FZWA 3GZNB 2EP7A 4XGIA 4UVDA 1BXGA 1ONOA 2FHSA 2NVWA 5B4TA 5CEJA 4BNFA 3PYLA 4CMAA 3RD5A 1MFZA 1P33A 4LN1A 4WCFB 1NQTA 1R12A 3JSAA 2W2KA 2V6GA 2PGJA 1U8XX 2DVMA 4L9RA 4BNWA 4E6PA 3P19A 3V2UA 3RAJA 2OP1A 2ZATA 2CY0A 3DZKA 5DT9A 5A05A 1I10A 2FWMX 1UUFA 4M8SA 1CJCA 3ROPA 1PJTA 3C7AA 1E3JA 3U4DA 4OXYA 4HWKA 1E3LA 5TX7A 7MDHA 4YT4A 1XDWA 1ADCA 4BMSA 1U3TA 4Y67A 2BHLA 3JQBA 5JW6A 1YL5A 3WX0A 4DIFA 3H4VA 5IDXA 4G5HA 3TJRA 4EDFA 2WYUA 1HTBA 4Y98A 2ZQYA 1Y8RA 3GVCA 1PEDA 4J0FA 4YBZA 5L45A 1LSSA 4L76A 2VOEA 3FNEA 3GR6A 2PKQP 5I7FA 1I3KA 3I1JA 3GMDA 2VRCA 2GDZA 1ISIA 3KYCA 5BSHA 4CQMD 4W9NC 4NU5A 3GNSA 1DIRA 5ICMA 1XSEA 4ZU3A 5G0VA 3RC1A 4KUHA 1A4IA 1X0XA 4YRBA 3WSWA 1TI7A 3BMCA 4JN6B 4C7JA 1U8FO 2I3AA 3K6JA 3SC4A 4ZRNA 1R4MB 3MOGA 5TT0A 2BFOA 1X14A 3CSDA 4Q3BA 4AJKA 4FC6A 2Q4BA 5G4KB 5I9MA 2CF6A 5I7VA 1EVYA 4TROA 1LTHR 2YYYA 1PGPA 1VJTA 4OJNA 2ZQZA 4II2A 1H93A 1HXHA 1T2EA 3DMTC 3GNTA 5TF4A 1IOLA 4BO3A 3ETEA 2O4UX 1GR0A 1TXGA 1NPTO 2XAAA 2G5CA 1XCBA 4H7PA 1UDAA 3ROMA 1SB8A 5HTOA 1HETA 1E7QA 1PL8A 3F1KA 1FJHA 1HYGA 5DP1A 4CMIA 4JJFA 2FR0A 3FBGA 2A9FA 1E5QA 1U5AA 3JD3A 1Z75A 3JYLA 3RROA 4J6FA 3ZU2A 1JQBA 3JD0A 1DOHA 3BTSA 1C14A 1I2ZA 4PRKA 1XHLA 1KEVA 4OXNA 3I6IA 3JD2A 4DTIA 4E5KA 1AN9A 1U7TA 4OOEA 3SLKA 3WYEA 3P7MA 5TS3A 2NVUA 3GPDG 3C1TA 1UXGA 1GUFA 3B1KA 3NT2A 4KWHA 4WKGA 4BO0A 3AW9A 3DBHA 2C7VA 1YB1A 4YYZA 2FSVA 4ITUA 4PFJA 4CR8A 3KYBA 1HYEA 3D1LA 3OA2A 2DFDA 3B1JA 2X1HA 3WGTA 3DFUA 2VWHA 2WYWA 3QVOA 1QP8A 4EYEA 3K5PA 4FJ0A 4IJKA 4XB1A 4GLLA 4MVJI 1A7AA 1Y8QA 2Q2WA 3OH8A 4DBVO 2EGGA 4BHTA 3PZBA 2O3UA 3OJFA 4CLRA 2VOJA 1KOLA 3FNFA 1MB4A 3Q2IA 3M1AA 3BMOB 3STHA 1B7GO 1QG6A 2B36A 2B4QA 4DQVA 3QWBA 3WQRA 2GERA 2FZEA 2DUUA 1Q1NA 3OP4A 4I9UA 3MTJA 4BO6A 1P1RA 4H16A 1CRWG 2RCYA 2WMDA 4HFNA 3A9WA 4R68A 2C07A 1C0LA 1MGOA 1Y6JA 1BSVA 3V5NA 3DOCA 2TMGA 3H7AA 4I5FA 4MIOA 4M54A 1K89A 1KVQA 2JHFA 5DCYA 4YA6A 3T7CA 4QO7A 3I9KA 4IQ8A 4PG4A 4DPLA 5JYEA 4CM7A 3GDGA 3TDKA 3R3JA 3DBVO 1YWGO 5T8KA 2NU8A 4PG6A 3C24A 2D59A 1T2FA 4RVGA 2YQ4A 5AOVA 4A10A 3U4CA 3IJRA 1Z74A 1K5HA 1ZJZA 1O94A 5EQFA 1N7GA 3DBLB 4I5EA 4J9VA 2YFHA 2SCUA 3RU9A 2CF5A 3W6ZA 3HSKA 5F5NA 3BTVA 4B7CA 2IE0A 5AVOA 4BNKA 3ZWMA 3VPGA 2GN6A 5DBGA 4DXHA 3GT0A 5T67A 4BNYA 1GD1O 2JCVA 4J2OA 4O1MA 4TVBA 1EBUA 1PJBA 4KP7A 5EPOA 4DYVA 2YDXA 2VTEA 3M1LA 4URFA 1RJWA 1YGYA 4J7UA 3NGLA 3FN4A 3GEGA 3GG2A 4A5OA 1ONNA 2PV7A 2NACA 3GHHA 4RQUA 3Q0EA 4YJHB 4U5QA 1XGKA 1W73A 1YQDA 3G0OA 4DYDA 1Q7GA 4HNGA 1ORRA 1QYXA 2O2YA 2DT5A 1ZIDA 5BNFA 3IJPA 2QX7A 3H3JA 4JBHA 3JQGB 5ENDA 2AEJA 4DLAA 1LC3A 1ENOA 3OQ1A 2CDAA 1HWYA 4XD2A 4HP8A 3QJ5A 1KS9A 1YONA 1TA4A 1XKQA 4XQ9A 4J1TA 1O5IA 4CLDA 4DVJA 4CMHA 3KBOA 1Q7CA 3U0BA 2Z1MA 1K2WA 3VOSA 1EK6A 4B7UA 3JQ9C 3FTNA 3I9NA 1QLHA 3L9XA 4MVJD 1KC1A 1KETA 1S6YA 4Z3DA 4IINA 4LVUA 3SLGA 4E5PA 2Z5LA 1YB5A 3INTA 2QZZA 2V65A 4N5NA 4J4BA 3E18A 1X1TA 3NT5A 2ZB7A 3WDSA 1NWHA 3WR5A 3DHNA 3PIDA 3VH1A 3M2PA 3RBXA 3JCZA 1GEEA 4DQUA 4TZKA 1U4OA 1PX0A 4P4GA 1U9JA 2H1SA 3FTPA 4G2NA 4WJZA 4GBJA 2JHGA 4RF2A 4WLVA 3VPHA 2B83A 2PZJA 3DZBA 4FS3A 5H81A 4XJSA 5JLAA 1WDKA 2B37A 1B8PA 5CPBA 1IULA 4KTVE 1EMDA 3QE3A 2IYPA 5G0TA 3GEMA 1T25A 3OECA 1D1SA 4BNJA 5JCJD 5DCWA 4B4WA 4CMKA 1PS9A 4BGIA 2AMFA 4RQTA 2JL1A 4XJTA 3HWRA 1JU9A 3AY3A 2ZKLA 2XPCA 4CMEA 2DM6A 4RVDA 1QORA 3FPLA 3UCXA 3ZWXA 3SJ7A 4Z9YA 4II3A 5B12A 2NU7A 2YZ7A 3ENNA 3ENKA 3W8FA 4CM1A 4CR6A 1IUKA 2R6JA 3E5RA 1ZZEA 2E37A 1PQPA 2DTDA 4YAJA 4WOJA 2CVOA 3DOJA 1N9GA 3FSRA 4KDEA 3X2EA 4LMRA 4NNJA 2JAPA 3WBBA 1P1FA 3H9UA 2J5RA 5JY6A 1V6AA 4OGWA 3M2TA 3LLSA 5CDTA 5C7IO 2UUPA 1LA2A 3JQ7B 3AFNA 3OICA 1PJQA 3ZWPA 3EMKA 5ER9A 3HDJA 1LUAA 1ADFA 5JDCA 3AWDA 3GZ4A 4RLSA 1J49A 1DLIA 1E3WA 3VH2A 3ONEA 4GKVA 4LSMA 2HMWA 4LGVA 4LRTB 2OBNA 1A9YA 4J0EA 3MJEA 4ZGWA 4BKUA 4NI5A 3PIIA 4JGBA 3OIFA 1FDVA 3BHMA 4KZPA 3I3OA 4I1IA 2UVDA 1ID1A 5G0WA 1VM6A 1KERA 4BNTA 3GZNA 4EUHA 4ZD6A 1O6ZA 2FPIA 3HDQA 4BNGA 5JY1A 1ISJA 3JV7A 2C2YA 3NJ8A 1NFRA 2G82A 1OZAA 5IG2A 4E12A 4RPLA 2NM0A 4RZHA 1B3RA 1DXYA 3W4IA 3ETDA 3I6QA 1M6WA 3BHIA 4P38A 5DP2A 2QYTA 5TRTA 2VYNA 1SCUA 1QV7A 1PWZA 3UHAA 2VRCD 2HRZA 1LEHA 3AFMA 3I9MA 4WCFC 2BGLA 4BGVA 2BI8A 1TB4A 1YJQA 2PA3A 2VZ0A 3ZHXA 5FEUA 4NDNE 2IEDA 3WG9A 5IZCC 1VJ1A 3LZ6A 1R37A 3U5TA 2DC1A 4R1TA 3EZLA 2V7PA 3BMQB 3EDMA 5CAEA 5KCZA 2HCTA 1PJ3A 2ILTA 2O7QA 3IMFA 4B7XA 3EGOA 2J5KA 4IZHA 1IY8A 1T4BA 4CMGA 5BQFA 1VL8A 3S55A 3HUDA 4RPHA 1WP4A 3WNVA 2B4RO 3L77A 2VWQA 1DFIA 2JD1A 2QG4A 1BDBA 3DXFA 4OMUA 4M49A 4Q39A 4XR9A 1NP3A 3VC7A 4ND2A 4FDAA 1U4SA 2HQ1A 1V35A 2DBQA 1Q0LA 2C54A 4XIJA 4CMBA 3DQPA 2Z1NA 3DZGA 1P0FA 4OSPA 4DIBA 3F5SA 3ETGA 1M75A 2J3IA 3H3FA 3U3XA 3QQPA 4PIVA 3KEOA 4D41A 4PLHA 1HLDA 3C3XA 1T2DA 5C5IA 4RORA 1R4MA 4YACA 4YRDA 3RWBA 4OM8A 5EINA 1JKJA 5JAZA 4BQRA 2BF7A 3H9GA 3UGKA 5KOIA 1DB3A 4R3NA 3CTMA 1FDSA 3GQVA 4GSKA 1C0KA 4CUJA 1K6XA 4FFMA 2VHVA 1Q2XA 1ISMA 2AG8A 2VZ9A 3ZWVA 2X22A 1DBVO 1LBEA 1YBAA 1EFKA 2QQ5A 5L7WA 5CEFA 3WYBA 2YV1A 5ITVA 4GQAA 2R00C 1P74A 4TKMA 2ZK7A 4RZIA 2DBVO 4UVIA 4I8XA 5K0ZA 2VT2A 2JFFA 1A5ZA 1HDGO 3LF1A 4ND4A 4B8ZA 3TFOA 1S7CA 4J7XA 2Q2QA 5EL0A 1PL6A 4R51A 1TVEA 4XR4A 3WMWA 1NYTA 4CUKA 4HADA 3OA0A 3WFIA 3TNLA 1YQGA 1FF9A 3K9QO 4P4NA 2OUIA 3D5TA 4CMCA 1DJNA 3CZMA 4DWVA 5EESA 1SEVA 1LLCA 4O63O 3GVPA 4YDRA 3SC6A 1AHHA 1MV8A 1F17A 4YCAA 1LXCA 4E2XA 4NK5A 4JLWA 4CMJA 2X86A 3GGOA 2DU8A 1Y9EA 1GQ2A 4Z9FA 1WDMA 5EN4A 2EKQA 1ARZA 2AEMA 1MX3A 3IS3A 3BMOA 3L07A 3TPCA 1X7DA 4BNVA 2AW5A 2NWQA 4D44A 3CUKA 2HAEA 3NJ4A 4BNNA 5TIIA 1DIBA 3RC2A 4NJMB 3ZU4A 5KKAA 2VHZA 4FJ2A 1RYDA 3WS7A 1Z6ZA 5L53A 1BVRA 3AOEA 1OAAA 4IS3A 4NG5A 4YTEA 3E82A 4BKOA 3F3SA 2OZPA 4E5MA 5TSDA 3U9LA 4ZRMA 3W1VA 1DDOA 3BTUA 4Z9XA 4YJFA 5JAQA 3ZGYA 3WIDA 5IN5A 1RM5A 5CFZA 3JQAB 3PGXA 5A3VA 5JNLA 1WZIA 3PQDA 1HE4A 4MP3A 2CVZA 5JPIA 3ZHZA 3DBLA 3DO5A 3NEPX 1RYEA 1VPDA 4TVOA 2ZJ1A 3IC5A 4MVJH 2V6MA 3VPFA 3WWYA 3H65A 4CLEA 4F45A 5A06A 4CPDA 5C3MA 1LDYA 2GZ2A 4YJGB 4BO4A 3QVXA 1C1XB 3IQDB 4I08A 4XZ3A 4OIMA 2PH5A 4BKRA 4ZQFA 2QHXA 1IL0A 1UDCA 1CQIA 1XIVA 2QIOA 4BV8A 1ZBQA 5I9LA 1SMKA 2JKVA 1SEPA 4R41A 3U49A 4EBFA 3WBFA 1HL3A 4BNIA 1EBFA 2HU2A 2PD3A 2P91A 3PWZA 3LT0A 2HUNA 1R4NA 2GNAA 4NBUA 1N5DA 3UOGA 2B69A 4YJHA 3DOOA 2AA3A 4NFYA 4E2WA 1PZHA 1SZJG 4L4XA 1SB9A 1RM4A 3DZIA 2PD4A 3K92A 2I6TA 3RUFA 3RFTA 3K96A 3AJRA 4GKBA 3RUAA 4MVJF 3R6DA 4CQLA 3CH6A 4JX8A 3LC7O 1R66A 3C1AA 3DONA 3R3SA 3TL3A 5G4LA 4WE3A 1OC4A 3JQ8B 4HFRA 5DNAA 4NHEA 1NR7A 4R4JA 4D45A 3IUPA 4RO0A 3E03A 2OP0A 1E1LA 4W82A 2YJZA 1NAHA 1WLYA 2UDPA 3ZU3A 1KBZA 3I5MA 2VQ3A 1WMAA 3E9MA 2CD9A 4DC1A 3H6KA 3PP8A 4RCVA 2ZB3A 3WB9A 1LLQA 4B4UA 4R3WA 1P1HA 1CDOA 1X15A 1Y5MA 3C7DB 1EZ4A 3QY9A 1JDJA 3S2GA 3A28A 1VL0A 3RQSA 3SJUA 2Q1WA 3DHEA 3PHJA 2FOIA 2ZB8A 4EZBA 1HE5A 4PZEA 1SO8A 1XR3A 4BO7A 3GK3A 4DUPA 3GLQA 4TMFA 1DLJA 4AICA 1BWSA 1GV1A 1KYQA 3EHEA 4P8RA 4FW8A 3UXYA 1DSSG 4CQMB 3L6DA 4L73A 1XYGA 2J5QA 1GADO 1Y7TA 2Y99A 5U4QA 2WSBA 2BFPA 1I3LA 5DBIA 4CJXA 2AE2A 3S1LA 1UAGA 4HFJA 2YY7A 2QW8A 1KC3A 4L74A 4IGEA
chains in the Genus database with same CATH superfamily
3BDIA 1M7GA 5CYFA 2QUBA 4DLVA 1GIAA 2Q1XA 4DRXA 2ZIEA 1R9GA 3PWSA 1KS2A 2R1TB 4W9NA 5CX1B 4EKYA 4Z1MD 1X7XA 4ALJA 4TZ0A 4TMZA 1OA1A 3ZDEA 3K05A 4EVQA 3V6MA 1DXHA 2ZB4A 2W90A 1FDIA 2FK8A 4KQIA 3HP1A 2OV3A 4TYNA 5KWVA 3U3DA 3VHXB 1VKZA 1LW7A 1QB8A 3GH1A 5LA6A 4AYWA 1UMCA 3K0FA 4J94A 1IDOA 2WD7A 4NH4A 5IS2A 3WLLA 1NVWQ 3QSYA 1JSCA 3DE7X 1N2BA 4ZCSA 3AM1A 1IZYA 2V3WA 4F6RB 2G76A 1O0BA 2ZRAA 2WW8A 4GGOA 3OOWA 1JFRA 2EFYA 2HEGA 1DCKA 2B8WA 2ECQA 3A6EA 1YOBA 4HN9A 2VF5X 4MNTA 3MSCA 3U2QA 4EATA 1CS0A 3QLJA 4ND7A 4HNUA 1PLJA 4HR7A 4Q4AB 4GVPA 2OZKA 4K28A 1T9KA 3LHFA 2QN6A 4GYYA 3HL0A 3PEEA 3QKSA 4XIGS 2Y67A 1T1RA 4MUKA 2WILA 1HRDA 2M32A 1XZAA 3THRA 1F12A 2COEA 3LCRA 4C0BA 2WRZA 5JH7B 2H1WA 1WQ3A 1QRDA 2FPGA 3O4HA 4UOZA 1D2HA 2DFPA 3VC2A 3C97A 3L0ZA 3WQSB 3ONDA 1JVSA 3NEAA 4WD3A 3FMIA 4XB2A 4C7BA 5JS6A 3L4KA 4P4UA 5K03A 5ITWA 2ERCA 2IC5A 3BDVA 1Q1QA 4HB2A 3TAXA 2QRPA 3USZA 4OQXA 5AKYA 3WTCA 1XZFA 1ADGA 1IIBA 2H9YA 4YR9A 2VYND 3UQZA 3RSSA 1Q0TA 2E4AA 4ZK2A 5JBIA 5K5EA 3GFBA 1N2SA 2XLCA 1LNQA 3ESQA 1ZUD1 3AWIA 4WIAA 1EDOA 5B6JA 2VA8A 3I72A 4N49A 5CNIA 1K88A 1J7KA 3PV0A 2WJWA 2G63A 3PWKA 1DC5A 3KJGA 5JY6A 1NJ1A 3A9RA 2VZLA 3AKCA 4FLMA 4D3DA 2LDBA 2JHAA 3FCCA 2FEOA 2QLMA 4Y6QA 3R3YA 8ADHA 1XWFA 1B16A 2PZFA 2H4ZA 2J3LA 4M1WA 1CF9A 3L84A 1HE3A 1DHRA 4PR0A 4DAOA 3QEMB 2C9DA 1TYZA 2QRNA 4OQYA 4FSHA 4BLWA 5B3JC 5HGXA 3IAS6 3ESAA 2Z5FA 4DT1A 2YWFA 1DJPA 3VZPA 1WBBA 1BX1A 4E31A 3F5QA 4NXNB 1N1MA 2DUJA 2C4KA 2FN7A 3N6RA 4OO3A 4Z99A 2XKAA 4BYMA 5HHTA 4LE1A 3QKRB 2C4TA 1TT5B 3O5AA 5DLDA 4QE3A 4JI3B 1J22A 2GR9A 3Q12A 4PNEA 5JCJD 4W7SA 3OBIA 4PLTA 3RJ5A 5KU7A 4YJ2B 4MYRA 1XJCA 4GECA 3O8QB 5EA2A 4KR9A 3B70A 5DLYA 1SPXA 2F43A 3CX8A 4OVKA 4DA9A 3IDAA 2DULA 2Q29A 5AM3A 1MRZA 2UYHA 2IH4A 1LDGA 3NAZA 2ONCA 4ER3A 3KYJB 2QRGA 4MSUA 2BH9A 2XBUA 4MQBA 5LYJA 4LDNA 2CJXA 4A2QA 1O6GA 3E9QA 2Y76A 1MAVA 2GD0A 2FHPA 2GLXA 4QL3A 1T1SA 4IV8A 3BWDD 3Q2KA 4CR7A 1VCOA 1CJTC 2GM9A 1PE0A 3V4RA 5FBHA 2QJRA 4CCSA 3DLTA 4U00A 2QM7A 3TF5A 1M6EX 3W9YA 4EIWA 1YHYA 1EVJA 3KLPX 2IV2X 3TTSA 4QUBA 5L9AA 2CLEB 3RK1A 4H2DA 5CDUA 4M1QA 4PSKA 2PZMA 4YWHA 5JNTA 4OOFA 1JSZA 3OJWA 4F6LA 4FR0A 4LDJA 3HCNA 2ZJ8A 4YRLA 4BTLA 3PJEA 4JAVC 3ZI0A 2PWZA 4I8DA 3T5PA 1R16A 5A5FA 1IBCA 2QQ0A 1D4AA 1Z83A 3G5TA 5F3WB 2QGZA 1LQTA 5EQDA 1YJXA 5ETJA 3NATA 4ZYUA 3PUWA 1VBFA 1NBWB 2V58A 1R2QA 1NI4B 2Y0EA 4XA8A 3RIYA 4UMVA 1Q7BA 2X19A 3W9BA 1G42A 5DM4A 3WV5A 4DG5A 3A1NA 3DM9B 3NHKA 1VLQA 3DMHA 3PC3A 2M6LA 3UVEA 3O8CA 2EP5A 3AETA 2ZJ6A 3GLRA 8MHTA 2HMTA 4ACBA 3OQIA 5JROA 4XFKA 1B73A 4M98A 1YZ3A 2I6QA 4WBNB 1OLUB 1SA0A 2LD4A 1QO0A 1SULA 3H86A 4ZWNA 1GKYA 1FMCA 2P9QA 5DVZA 2XE8A 3PFFA 4YLYA 4XASA 4OHWA 1ZXXA 1KDRA 1ISSA 4BX9A 1JHDA 4S1TA 4CGZA 1I0LA 3WIEA 5ALVA 1Q1EA 2P2LA 4CDNA 1CDZA 3R5XA 2ASEA 1Y5RA 1YKGA 3W5AA 2GEFA 5T4FA 2RGGA 1AKUA 5IJ0A 1RXSA 4IXWA 1AO3A 4Q3NA 1HDXA 1YAJA 1N57A 4N48A 4MKXA 2XWBF 3Q9NA 3GCWA 4MPTA 3DKPA 3GJ6A 4ZAGA 2JI4A 3VNAA 1H2EA 3W04A 1RPAA 4B48A 5BN5A 3RRJA 1WXEA 3RNLA 4JT2A 3PC8C 4JP2A 5FNVF 3U5ZB 1A71A 2GBPA 1IUPA 1JAXA 5K45A 3J80A 2H1HA 4G0QA 4ENWA 1KEZA 4ALNA 3SOZA 4OFBA 4DV2B 4KSBA 1PZXA 5CW1A 1NPDA 3B9QA 3KOXA 3O8OB 5FJJA 3FFTA 2ZG6A 3VR6A 2FV8A 4PVDA 3WI7A 4LJSA 4Y7CA 1PZEA 4ARVA 1P4RA 1I8TA 2WYOA 4DV4B 3THWB 2BJHA 3P5SA 2MSLA 1DL5A 2WUVA 4H7EA 2AD1A 3PQ4A 4F2WA 3BZBA 3DBRB 2CHGA 1E5TA 4OQMA 3LOUA 3T8YA 4DMLA 1G20A 1SNYA 4ZOLF 3PHIA 1IPHA 3KUKA 2XWPA 1VLLA 3HMQA 2JLCA 5ALDA 1X7ZB 2CHEA 4QBHA 5DHSA 4C0AC 1GAQA 1NNLA 3FTCA 4G5YA 2ZI5A 3SNKA 2LP4Y 1TAHA 5FV7A 4OIFA 1ZFNA 2R2GA 2ES4A 1L7EA 1J1IA 4HI0E 1BXKA 4NJMA 4AULA 4M8NE 3EXG1 3HRKA 3HYLA 4YJ3F 3CVVA 1JXQA 3OURA 1YL7A 3V6LA 1QZ3A 3SDBA 1WSAA 3EZXA 1PU2A 3BJMA 3DKIA 3SXUB 2AI2A 2DCMA 3A70A 4NBTA 3KXKA 3HB5X 3KUDA 1A95A 1DKRA 2G6TA 3DTYA 3KDAA 1X7WB 4PG7A 2CDBA 3R0XA 2VHEA 3D4BA 2A59A 2JH8A 3G8DA 1H5QA 4E33A 2A92A 5LBTA 1KRWA 3R3UA 3KB2A 4Q05A 2CVHA 1EUCB 1GVNB 4IIYA 2IYYA 2ACVA 2JRCA 2W7TA 5D84A 3R7DA 3MVEA 1T1IA 2ZUDA 5E6UA 2C7BA 3QF4A 4HDSA 4UE3S 1GRQA 4FFDA 3A6ZA 1U90A 2C7QA 3WGYA 4A36A 1NU8A 1I4LD 1W4LA 2IH2A 1N8TA 5AP9A 3E3OA 2Y3IA 1S2DA 3PUKA 4YJGA 4K05A 5AJWA 2NU9A 1C1XA 1FSGA 4A26A 3CF4G 3H18A 1UCFA 2WTAA 1NJ8A 1XD9A 3IXLA 1HV8A 3G2IA 4GX1A 5FL7A 5L4SA 3WZ2A 1BTOA 5ITSA 1T26A 1CEQA 2J3HA 2JAHA 3N2ZB 5ENZA 3UWPA 5BW5A 2YOHA 5H83A 4AJ2A 2O8DA 1JU4A 2GPSA 1QYDA 3JTEA 2OBXA 2DHCA 3ZE0B 1A2BA 5KOJA 2QZ9A 1XXHA 3CEHA 4CIDA 2EG5A 1N5OX 3O4IA 1J00A 3C5EA 1ADBA 1BNCA 4XIYA 5KNBH 1II0A 1ESMA 2QQEA 3V48A 3DAOA 4CN9A 16PKA 5IFKA 2ET6A 4D0LB 4XVHA 3QE4A 2AZXA 3RC9A 5GM1A 4DEXA 1U1EA 3OZTA 4WECA 5A4DA 3EQ8A 4DKJA 4K5QA 2HA6A 5AXCA 1CZKA 3B1YA 4UULA 1QCCA 1DMSA 1MX1A 3VSDA 2L0XA 3DHWC 4X1YA 5K6AC 2ZSDA 2RHRA 3G9XA 2A5DA 2A7QA 2OWDA 3V3TA 2IEGA 2V6BA 1FJGB 1IXRC 1RPNA 1ZK2A 2HK9A 1QFJA 3VSBA 3EIQA 1QK5A 5EFZA 4JENA 1WETA 1ICEA 4BJ3A 3LC2O 2OK7A 5HM8A 5CA1A 3ZIDA 1S2LA 1VCMA 1YT5A 2EZTA 2HRCA 2O2DA 4DBLC 5JDIC 1U2DA 1P1KA 2WZBA 2WG2A 1KO1A 2ZUCA 3FHCB 4IICA 3REQB 3DD1A 4K9DA 4F9GA 1WM1A 2X76A 4X3PA 1L4GA 5DI3B 5FUVA 3SBOA 3AEKB 3CO5A 1N32B 4JQZA 1M66A 2QT9A 3CUSA 1IXSB 3QKWA 3O4RA 4RSGA 2ZE7A 1M6NA 2ONKA 2P8SA 1OT5A 1YULA 3RAEC 1NMEA 5CGZA 3GEHA 1RYYA 4TWIA 3BT7A 3ZQKA 3DL0A 3GRZA 1LC0A 3UFXA 4BKQA 2R8OA 2EJTA 3L5KA 1UZNA 3K9WA 2OFXA 3D3WB 3NASA 4FC7A 3VU9B 3ZZNA 2WIAA 3MNFA 2R11A 4MUJA 4BMSA 2PUDA 3PEYA 1ZVMA 1C9YA 4NBKA 2D7DA 2Q3FA 3G23A 5K8LA 2YXBA 2XTAA 2D54A 1C9EA 1J21A 2JEYA 3MAGA 3REFA 3FOZA 2MYPA 3WL5A 1ZN7A 2ACKA 1WCIA 4J07A 4BMOB 4W5HA 5KYWB 3DQQA 2C20A 4I4TA 1CR0A 4IJWA 4C0JA 5I7UA 2VIIA 1OR8A 2A1TR 4JHLA 1G6KA 4TSRA 1KKUA 2JNWA 3CJRA 3VA7A 1KDPA 4HGPA 4OV6B 1M72A 3IB6A 3CLSD 4I50B 4DIKA 4G0WA 1G60A 3PDIB 4HZUB 2RKBA 4ML3A 3A11A 5LU9A 4XQGA 5ILQA 3W5IA 1A2OA 4O6VA 3FNIA 3UKOA 4CMIB 1H0KA 5SZIA 5T57A 4RY0A 3M7IA 2GBLC 2WE7A 4FYMA 4QYWA 1GGFA 4WFIA 9ATCA 5A0TA 4MVJM 4XWKA 2FUCA 1N7JA 4U3JA 5JO9A 1HEIA 2ZT8A 3O7WA 4TS1A 5F4ZA 3WTBA 1EZZA 1ZAYA 2BLNA 3DBIA 2JATA 2I3GA 4ASUA 3W77A 1WBDA 2XV1A 4XWOA 1BVHA 2PXAA 3I9LA 4O4HB 3QXCA 5E1OA 1ZUHA 5CP8A 1PQYA 1TEXA 2OORA 2NOAA 5TR9A 1N4AA 4QYTA 3H5VA 1NJSA 2VCEA 3BFXA 4HMOA 1DNPA 1K0FA 1KHTA 2OBMA 3E22A 5DTIA 1PQUA 1WPXA 3A3YA 1UKAA 3EDYA 3TIGA 4NMHA 3C8UA 3G9ZA 4S3MA 1U7UA 1UT6A 1A0OA 4DLYA 2ORWA 3NHMA 1P8JA 3NALA 1O57A 1R6BX 3OPVA 3A36A 1SRQA 3K5WA 3HN2A 4IFIA 3TCXB 1AHIA 2IZ1A 1FNBA 3PUYA 5LP1A 1CHDA 5J1SB 3IUEA 1U3VA 2JCGA 5KSWB 1PK7A 5A3RA 1CUEA 2JA2A 4OH7A 3T94A 5IM4F 5BW6B 5T6BA 5BR4A 5DHTA 3PJDA 1E2LA 1V3VA 2R86A 2V4UA 3ODPA 3LTEA 5E9QA 1L3CA 2EERA 4OBBA 1Z8FA 2C88A 1W4BA 3UYKA 1QHIA 2YVUA 3OM0A 1FLNA 4HB4A 3OBBA 4EKNB 2Y1FA 2V7WA 4D98A 3HJUA 5DF1A 5JE8A 3VI4B 2B2NA 4U8GA 4MDEA 4K7JA 1U28C 1E1YA 3ADKA 3QY0A 4HX5A 4O0MA 4PCVA 5GM2A 2E9SA 2QMYA 3IQWA 2QX9A 5HF9A 1M8PA 4RD2A 1IXKA 4CM4B 1MG5A 1K27A 4RHEA 1IEWA 3QVKA 4BVAA 3BXXA 5E6SA 1TDJA 1XJWA 3H1BA 5IJXA 4QLBA 3O8NA 3ZN2A 3BSSA 2QTVB 3WMEA 2V7UA 1OBFO 4CRWB 4EKGA 2PZLA 4O3MA 3CT6A 2Q50A 3OUZA 3CVOA 3FFWA 3S1SA 1J2JA 4FYIA 4HGOA 4RJTA 2IBTA 3VTAA 2R97A 4FPXA 1VI2A 5JO0A 1HQCA 4PS1A 1A7KA 5LC1A 3R7WB 5J23A 2QLBA 3EOAI 4CLHA 1YDWA 1JVBA 1UT8A 5HSGA 2J0QA 1YB2A 1P1JA 1Q91A 1E1QD 4AF8A 5FX2A 2POQX 2H7CA 3KJNA 1SC4A 3OCJA 4V1CB 2RAPA 5JAMA 3ND7A 1D5CA 1TPYA 2WT8A 2VQFB 1HDOA 3V1YA 2O2GA 1G5QA 1SUWA 3MJVA 3O38A 2ZQ5A 3UK7A 3U3KA 2PRJA 3OT4A 3OWXA 4YX9A 1DRVA 4IOKA 5LP6B 1JHQA 5EJ2A 5AJXA 3JYQA 4RADA 4EA6A 3GV0A 1FTNA 1X0VA 3OX4A 1W44A 4UPDA 4W7IA 2A7XA 3IDSA 3HRHA 4PZPA 5JJBA 1DV2A 3DAGA 1ZI9A 2WU0A 4NVRA 2V0GA 3DTTA 2G1PA 1Z07A 4HNVA 1NMZA 1O95D 2DFVA 2FF7A 1RWBA 1ZD3A 2IHTA 4WOPA 3K71B 4WCDA 4ZXPA 1P2DA 2BLLA 2I1QA 2Q8QA 4JU8A 5BORA 3R24A 2HNKA 4P7KA 2ZUBA 1A76A 1BN7A 1F8FA 3IELA 3BIFA 5CHEA 5FI5A 3TNFA 4I55F 3GDOA 3HXPA 2ZS7A 3PS9A 1YKFA 1YRBA 2FI1A 4FFRA 1FDRA 4BTVA 3KSUA 3MXTA 5EMHA 1ESNA 1S8AA 2EBHX 4P33A 1BMFA 4QYIA 3RBVA 3LUCA 5JCXA 1PYGA 2ZYVX 1QO7A 4ZV7A 4PONA 1JG3A 1KL7A 2G4CA 3IV9A 1L1QA 3ECAA 5JSKA 2JDIA 5IDWA 1GFZA 1QC5B 3RGWS 4DIMA 3H0EA 1QU2A 4HY3A 1E1KA 3B5JA 4TYQA 1NVXQ 1WHTA 2VNAA 1G21B 2XKJE 4J2HA 5FT9A 5BN3B 3UCEA 4KXWA 2PJDA 1UJNA 2QU8A 1IN7A 4J1QA 3A05A 3WL6A 1UJCA 4G65A 4RHFA 1ZOPA 4E32A 2X40A 3E9CA 3CPSA 5ERGB 3GROA 5ED4A 1PVOA 4G89A 3GZTB 5B57C 3BSWA 3IR6A 4B5LA 3DEHA 3AEQA 4NYJR 1W7AA 5JMWA 3D5EA 3Q87B 1E2BA 3ROKA 3OIUA 5BNZA 1OI2A 3R1IA 2AG6A 3UNXA 2ID8A 2D5AA 4N8SA 2IYOA 2P9JA 3FZQA 2NXNA 4J0HA 1NU6A 5HIIA 3EDRA 2VPTA 1RR6A 4MVCA 3DVSX 3VDMA 3PDHA 1SKBA 1A77A 2QVBA 3L0YA 3LLCA 3BHNA 3FAZA 4WZAB 5EUMA 4Y1FA 4KV9A 4BKPA 4BEWA 5KYTA 3KJXA 1QPZA 4CCWA 1VLJA 4NC9A 1RRGA 3V8RA 3ZVRA 1NDQA 1Z29A 3KZCA 4YCBA 5BQXA 5LQUA 1E6CA 1G3RA 1HDYA 1UAAA 3MMSA 4EG1A 3PNLA 1S8FA 3VUFA 4D5EA 4A1OA 2ZRQA 3GA0A 1OGYA 2BW0A 5CFMA 4QYSA 2XXJA 1HZJA 3ZGNA 3SF8A 2NU6B 2VJBA 3BGVA 3K6RA 4LQDA 3ZEIA 5TF0A 4XJVA 5COBA 3T95A 1UAYA 4O2AF 3T7KA 5C8XA 1U5BB 4N40A 1B41A 4ZOBA 2AFIE 3H04A 3E8XA 3HUTA 1TAUA 5J2UF 2OGZA 4F6CA 4XGKA 3LPNA 4XPIA 1GA6A 1V5IA 3KQNA 4O4LA 1BKDR 3UAGA 4EG3A 1BG6A 2XW6A 2DAPA 4PYIA 4Z2YA 1P7VA 1QTRA 4TV8F 2NUAA 4Y9DA 5AUNB 1P9LA 2BY4A 1ZXLA 3L18A 4UXHA 3UFBA 1SU6A 3NJRA 1KQPA 2FPSA 2FWBA 1UXJA 1TMOA 2VNKA 3HCRA 4KAFA 3HFSA 1BU5A 3RSQA 4BVJA 4OUDB 2Q5EA 3HY6A 2NGRA 3DOEA 3FM9A 4OKSA 3KJHA 1GUDA 3D43A 5KYNA 4JJIA 3X2FA 5JFOA 2X5JO 2ZYUX 4L3OA 4Y6RA 3K0SA 2C5FA 3IIEA 2RSLA 4BFZA 2VAVA 3F97A 3UENA 3UYLA 2Z4RA 3D3JA 3QKUA 4LRSB 5FJIA 2WR8A 3B3FA 3S8MA 3SM3A 1JQ5A 1LY1A 5ELXA 3GLIE 1Z08A 3DZ8A 2PR2A 4MZDA 2ATVA 1LPMA 3IJ5A 4TL9A 5IASA 5DSTA 4QTTB 3WB0A 5CD9A 4M0PA 3BZUA 4AJ9A 5FBKA 5KVVA 1UQRA 2QLNA 4G84A 5CH8A 4OHXA 4YDSA 4L5IA 2JVJA 4AF6A 3IEVA 3EXIA 2P0AA 4K6OA 4ZPXA 1W76A 2ZRKA 4DEYA 1R9JA 1BMDA 4E5DA 4ZYLA 1T9GR 5BPHA 3ZHYA 1Z73A 3DULA 1GXSA 4A6DA 5AOCA 2EGUA 4DMCA 1H65A 1PUJA 3QLTA 2XT6A 4YREA 2EJBA 2XMQA 5A6SB 3VI3B 4JY7A 4QIHA 5K4HA 1HF3A 4M0LA 2CMGA 1RYNA 2WF7A 3CH4B 1CYEA 2B9VA 4YCMA 2PX8A 1C7IA 1U81A 4GR9A 4KOAA 4P53A 3WL4A 3VKUA 1J42A 4TN5A 3ZW9A 3BB4A 4QQRA 5AVVA 1P4JA 3TVYA 3ZPXA 3EC2A 3GC6A 1Z7GA 2AN9A 3HI6A 3G0DA 1OE0A 4L3WA 4Q48A 3KD3A 2AJTA 2QGFA 3DP9A 3W3AD 1OPXA 2HB6A 4DBLE 1Y1LA 2B5WA 1XAHA 2A94A 2Y1XA 1NZJA 4PLCA 1UC4B 2O8CA 3CZQA 3U1VA 3GGPA 1NOKA 2W4MA 1RCTE 2ZCVA 3D02A 5K0FA 3BFKA 3U4AA 5CJPA 3SIRA 3IKTA 1HNWB 1J25A 2JCSA 4QDJA 4S1NA 2C29D 3OZEA 1ABEA 4G1BA 4PSVA 3H5IA 4S12A 1PLKA 4D6PA 4F3YA 1R0SA 3HB1A 1U7XA 4A2CA 5A9SB 4YRKA 4PLGA 2HU7A 1KDVA 4FN5A 2E55A 3AEXA 3IXMA 1NQOA 1SXJC 4RJKA 1PTKA 4U1RA 5EE1A 1E2PA 1VSBA 3NOVA 1T1EA 3O2JA 3QWIA 2UXBB 1GT6A 3K0CC 2XYPA 1TLTA 2LZ0A 3Q3JB 4TUYA 5JRDS 4B84A 3O8LA 1T0PA 1VKRA 1XZPA 4I2VA 4WZBB 2R48A 2UYQA 4OH1A 3QV2A 5DBEX 4QTYA 2VTBB 1IQ0A 1Y63A 2UZ3A 4M53A 3QV1A 4I6JA 4B79A 2X42A 1F2VA 3CEAA 1JVNA 5E4JA 1U2QA 2FUNB 2XTMA 1RAFA 3ICVA 2QTRA 5B3JA 3EHDA 3N2NA 3N2EA 3ZJYA 1MP0A 4F3KA 3QEAZ 5K0GA 3G5MA 3D6FA 3FAKA 1MW8X 1Z2DA 1ACLA 3W5VA 4YNBA 3RT7A 2I1WA 2GSDA 2X8LA 3I4CA 3RHZA 1I3NA 4KAXA 3DAYA 1DE0A 1M2OB 4M9RA 1ZJ5A 4OGGA 3TYXA 4US2R 3VTZA 2BFMA 2PU5A 3CR3C 2VZ8A 3KV1A 2IP1A 1UXIA 3RC7A 1NVUQ 1DG3A 3V2GA 4AS2A 5HA5A 1W4ZA 2VAWA 1EI9A 2OE2A 3N6XA 4RJIA 3OMXA 4K8RB 4X3OA 5EJFA 2NQTA 3SQDA 1CE8A 1M2WA 1R0ZA 2FP3A 3E81A 3MTAA 3RCBA 4D4MA 3M5DA 2FMUA 5KVSA 4AS1A 1JDSA 5JMOA 5MGBA 2BE9A 4MQ5A 2WV9A 3C8ZA 3V1TC 3LYLA 1MO4A 5L7TA 1JHZA 1FMJA 1HYQA 1QKJA 1Y4UA 3MHTA 5EE5B 2IS6A 4N41A 1N9ZA 1CRLA 2ZRLA 1OFGA 3HCFA 1E2IA 3FYUB 3MD9A 3PIRA 4HATA 4KB5A 3T4EA 3V34A 2VTVA 1JQLB 3R5SA 4TSKA 3VR4A 5LOVA 5FBLB 1JIXA 4BFSA 1G0OA 2MTBA 3ESBA 1BFDA 1RHMA 3GNLA 3NBFA 1TVCA 4FGKA 1JECA 5HCNA 3SEFA 1W85B 4C4RA 5JSHA 2V74B 3VPAA 2CLDX 1OIVA 3VR4H 2Z9DA 3A9SA 3MWDA 4ILKA 4C05A 2JLSA 2ZRCA 2ODBA 4YJKA 2FX5A 4S1OA 5CCEA 3ZZ0A 2EZUA 3OCWA 1BMTA 1QMGA 3DXYA 3EC7A 3L7CA 3ZKWB 4WXPA 1P7PA 2QM0A 4RD4A 3ZD8A 2QMEA 1Q74A 1F6WA 2IV7A 3P2MA 4EK9A 3RYCA 1ECFA 1QH1A 4CIAA 3NRCA 3TRHA 3CLTD 4W6ZA 3TG8A 2OEPA 4QVGA 4FD2A 2GYYA 5IYZB 2XECA 2REOA 4DJJA 3D9QX 2A84A 1DJQA 1D6JA 1F9AA 1MR3F 2WTXA 3UT5A 3EWNA 4RABA 1Q22A 1BRMA 2DXIA 1XCOA 2D4HA 3DNMA 4UBIA 4EPXA 2AZ4A 2EBWA 3LC1O 4NJEB 2ZE6A 4LXHA 2IEBA 4NYIQ 1V8ZA 1Z5NA 2FGJA 5K3FB 1BDMA 5CDGA 1A8UA 5DZSA 5IC4A 1IHPA 2FEAA 1EGVB 3VOBA 2YN2A 5HUJA 4KMRA 2V98A 1BA2A 3ILHA 3RFXA 2VYQA 3PGKA 2IWRA 3AY6A 2UKDA 2N1BA 3OU6A 3U44B 1PGNA 2FY8A 3FH0A 5AW2A 1KMHA 4I6EA 1KVUA 4MPJA 1GG5A 5F51A 3PFHA 1U3FA 4R9SA 4W99A 3HU5A 1FUEA 1PSWA 1Y7LA 5EZQA 1GGHA 2R6GA 5KWIA 1GRVA 5D2CA 3ZH2A 1GCUA 3TLXA 4X85A 3TUIC 1AK2A 2JFNA 2K87A 5HS6A 4QICA 2ADMA 3NTOA 3UMGA 1G5IA 1BRTA 4KI7A 2A0UA 4QU5A 3PYMA 4O0LA 4EL5A 2XB8A 3GJ4A 4ENVA 2G7MC 4I9NA 3AM4A 1ZUIA 4YHBA 2ENUA 4F5ZA 2GCOA 1B6RA 1OD6A 2YR0A 3PC8A 4YJFB 3FVWA 3GJ8A 5I9TA 1KE1A 4C89A 4JLDA 4BIIA 1G2IA 5HYVA 1DC7A 5C7YA 1JNYA 3O9ZA 2DB3A 1OXVA 2VWGA 5JNVA 1KPGA 5C52B 2JA1A 1Y89A 2OXFA 4MWSA 3OTHA 3PRJA 2G9UA 5COQA 4CIWA 3K2EA 4IGFA 3OETA 5I3ZA 4NBLA 2QZPA 2R751 3GNQA 3LX8A 2JLUA 4AJIA 1K66A 4DCTA 3ODGA 2A9OA 2QU7A 2XT0A 2NXWA 1PKXA 3OE5A 3K2QA 3RODA 2GUGA 4IDFA 4OQZA 5L3SA 4X44A 3U09A 2IXBA 3ONFA 2YXLA 4IYJA 4PG8A 1R0WA 1SELA 2VPXA 2CJFA 3EW7A 4L15A 5L3QA 2VXBA 2X1MA 3E5NA 1B8VA 3BMNA 2AFHA 2BFFA 3RTEA 2H92A 2YVQA 5JECA 4WDQA 5KSYA 2EF1A 4IDOA 5TVKA 3OOJA 4KQGA 2J5BA 2AFIA 1NX6A 2PYZA 4RZQA 5DYWA 1NBME 4YCLA 4QUGA 1EFPA 4CM9A 4EHJA 3KHUA 1HORA 1NULA 1GV0A 1WY7A 4EB0A 2H07A 2J3EA 3GD5A 1VLMA 4OJKA 4TWBA 4N54A 3HM9A 1JJ7A 4HAVA 3RDPA 3S0JA 4CQLB 2GDJA 4Z86A 2EIHA 4FZVA 4AK9A 2TSYB 1G59A 4KR3A 3DE1X 4DRYA 3IBYA 1IY9A 4Q7LA 1SIWA 3B6KA 3CCCA 4WXMA 4HTAA 2JIRA 3S2FA 4EYSA 2FPPA 4J2TA 1EHYA 3WYAA 5K3OA 4E14A 2QBYA 1UXKA 4YASA 3ZWKA 3SICE 1DCFA 4MW0A 4L8FA 3W05A 4ZC1A 1PDWA 3ZXYA 2RJOA 3GLUA 4AKIA 5HE8A 2C2XA 2ZBRA 4YS6A 1U1GA 2JH3A 2XIQA 4IYRA 4E03A 1CF2O 2QT0A 3OEHA 4JBYA 4UTXA 4ZANA 5C1DA 4F4CA 3VKGA 2IY8A 2XYRA 1K98A 3TBFA 3GLIA 4JNKA 3TGPA 1RJGA 2BEVB 1FUIA 2CBGA 3C1OA 1DG9A 4MAMA 4RXMA 4E3ZA 5LNK1 3UKJA 5DRYA 5KMGB 1LZLA 2O2XA 1IFXA 1JQJC 2CVFA 4Q7JB 4WEQA 4XFDA 3JARB 1QGYA 2VA9A 3RPEA 4IS2A 4Q4LA 3PQFA 1LI4A 5BOSA 2GVNA 4YRSA 4XEHA 2ZXUA 4W9RA 2RCNA 1K6JA 1Q1BA 1CUVA 3DEIA 4W63A 4QAQA 1OLSB 2QE7A 4AL4A 2YC2C 4MYUA 4R9RA 1KOFA 3E2PA 4DSAA 1N5JA 4GRDA 3FPGA 4JLVA 2FH5B 1S89A 4I0WB 5EP3A 2VAMA 2FZ4A 1E2QA 1EEHA 1T1JA 5K6AA 1DDGA 1KAGA 2ZYWX 3GAMA 1LX6A 5AQ1A 3KM0A 4OQDA 3MJHA 2C2BA 4IIEA 2VNSA 1MKYA 1NW8A 2CYCA 5KINB 1G5PA 4OAPA 1WF6A 4DREA 1IAQA 5LYYA 1ST2A 2FN3A 4LNUA 5JDIA 5K0JA 1Q0HA 4LQCA 3RBZA 1VKHA 2I9KA 3IQHX 3DEYX 4YRPA 4LYJA 3E9YA 3V42A 3ZY2A 4RD3A 4GM4A 3EIHA 4L3VA 2BFBB 2KW5A 2NV6A 3IEKA 2Z6UA 3OF2A 2GBCA 4GOND 2FGKA 3OE4A 4PLFA 1GQFA 2VEDA 2GHRA 2H65A 1T8PA 3VR5H 4ID9A 3BHJA 4TQ9A 4F8YA 5KSZA 2O8FB 1PJ4A 3LX6A 3PUHA 1QCZA 4OQFA 1CVIA 4MIYA 2P4HX 1KJJA 4ARIA 2FFRA 4BN5A 2K5UA 1D2NA 2GRAA 3G0IA 3QBVA 4R1MA 4E4YA 3EGDB 3R3WA 4IDEA 2DH5A 2JLRA 1XOIA 4X61A 2IYSA 2UYGA 4BQFA 1ZUNA 2I6XA 2P1RA 4XB6B 3U9SA 1ESDA 4D9EA 3DMYA 5ANRB 3P71T 1FDUA 1UJMA 3MQ2A 2D7JA 1P1CA 2BEJA 3JRNA 1RHJA 4HDMB 4D3FA 2AI3A 4NYMR 1SBCA 4INJA 1XAGA 1TECE 1V5GA 2J0EA 3DC2A 3OOEA 5GONA 5C34B 1A4UA 3W78A 3WP1B 5HK8A 5CTAA 4NOJA 4M4SA 3ZVLA 3H2SA 1Y1PA 3GFTA 2W0MA 3NHSA 2GBLA 3OLQA 4GMFA 1G0NA 5AVRA 1NI5A 1D7OA 2P6RA 1GLVA 3I2YX 2CNWA 5NLLA 3ZBTA 4AY3A 4H7HA 2E5WA 3DL7A 4F1WA 2FR1A 1L5RA 3RKSA 1HNNA 2QUKA 13PKA 1KJNA 2HF2A 5D5PA 3PHLA 1IHDA 4KXYA 1SQFA 1SXJE 2XYHA 4AY5A 2UXDB 2WFLA 4WLNA 5HKLA 2QIPA 1A98A 1V0JA 3BA1A 1V8BA 3BQ9A 1VZ2A 2QD2A 3OJEA 1G9SA 3QXSA 3TMYA 3U7HB 2MR5A 1C8VB 1JT9A 2GBGA 3R2JA 4FXPA 5D7NA 3L2OB 5BRNA 2XEDA 1USWA 1KIFA 1Q3HA 1DAFA 2QSZA 3FUCA 3MZ0A 1Q2UA 3EGWA 4PXYA 2OLEA 2ZJ0A 1GCAA 3OLXA 5B1HA 2P4UA 4F11A 3EH1A 3GW8A 4ZVKA 5C9ZA 4RDXA 2AIRA 1XMPA 2F6RA 3N76A 5BWBA 4BUZA 4KI0A 4RJLA 3LU1A 3FGPA 4GL4A 4RFSA 2ZP1A 4HQNA 4OL0A 2C0CA 3PXBA 3ZXIA 4E09A 1BQ3A 5HF6A 1TA0A 4JBGA 3S8EA 4AYTA 3MUEA 2O3TA 2X5XA 4BOYA 4XIFA 5FCDA 1XTVA 2B98A 1IZ7A 3F4BA 4LVCA 2BBOA 5LJIA 1F8XA 3KYIB 4B47A 1NQAO 1Y48E 3LNTA 3K6SB 3GRVA 4UEWA 1QQAA 1E5XA 4ZQEA 1GNQA 3NW9A 2HV8A 5K05A 3E1KA 1U28A 2YVKA 2I7TA 3QXJA 1X39A 4MAAA 4QDKA 4CLRB 5CCXA 3W2IA 2Q1TA 2WU3A 3I52A 5AVSA 3VUEA 3Q7TA 1IPEA 4EBBA 3W06A 2HLDD 1WW3A 2X4GA 1AF7A 2HSEA 2RHLA 3DHVA 4JV5B 1QG0A 1ZS9A 2ZCJA 3IP3A 1W0CA 2BMFA 1WMFA 3A4IA 1G5FA 4HMQA 2VQDA 5DFAA 3AJ9A 5E0KB 3F5FA 1M1NB 2KBFA 1GQQA 1BDHA 1GVHA 4M7RA 3L5OA 3GLFA 4TWRA 1YRYE 4R71A 4LRUA 3QVLA 2XCRB 3GLHB 1NUAA 1U8TA 1V8DA 1YVUA 4MQ4A 4Q3EA 1N4DA 1AKNA 1P1IA 5FNVB 4C88A 5LNK6 2F48A 5JS7A 1ZM4A 2HBRA 2YH2A 4QUIA 3HL4A 2FQWA 1GL6A 3L6OO 1MG0A 2OK8A 5E9WA 1ML4A 4L6IA 4B33A 4AI6A 3TSAA 3JTMA 3QEMA 1EK0A 3DL2A 1OFHA 5I47A 2ZM6B 1DRWA 1FOEB 3FOWA 4F5WA 1FLVA 1UINA 2YQ5A 2J0SA 4F9FA 4MQLA 1QKKA 3KPVA 5IVDA 2VWPA 1RM3A 5JXWA 2I5PO 3RVBA 3CBGA 1TT5A 2ODNA 5A5EA 4OUKX 3ENZA 2AC2A 4IGAA 4ZOLB 3I64A 4AJ4A 3OZDA 3HJBA 4YJ2A 2DUMA 2XDQB 5HBRA 2B1JA 3O8QA 1W2HA 1Z13A 2FVYA 3TBHA 3F0TA 3I12A 2P11A 3UJ9A 4BLRA 1Y42X 4R1OA 3GVXA 4EW6A 3IOBA 2H2AA 3KJIA 3MMPA 4XJXA 4YUVA 3U37A 4FDVA 5I45A 3AKYA 2I80A 3H9EO 2F1KA 1A97A 1E9SA 1SCAA 4YJ3B 3T3OA 1E1RA 1ORWA 2ZR9A 5KOHA 4R6XA 4TTSA 1Z5UA 2OHJA 2GPTA 4LX8A 4MDYA 1SXPA 2BTEA 5AW5A 2VDVE 2BKVA 2WU4A 5EXTA 1RE0A 2XYQA 4MO2A 2I2CA 2QMHA 4KFTA 1O77A 4PTZA 3TLEA 3I04M 5KEIA 3QM1A 3GD7A 1GZDA 3LYAA 4NJOA 4UHJA 1EBBA 3Q8MA 2NV0A 3O3MB 3CVUA 4IILA 4QPDA 5C80A 1K97A 4AKHA 3SCZA 1NDHA 3GFOA 3MJSA 3G85A 2V9PA 3ORFA 2BMVA 3PEUA 5BSGA 2WI8A 2C0PA 2YDYA 5K8IA 4F4FA 2C98A 2FVXA 3KAKA 3HPQA 4B3HA 5LQNA 3FI9A 1IVSA 3ER8A 3J7TA 5TEWA 1JL3A 1CSEE 4RV9A 2B35A 1DTWB 3QUTA 3HEBA 1VJGA 3BERA 2VP5A 4IVNA 4U7WA 4IF6A 4FHDA 1T3TA 4QNRA 4YQZA 3EZNA 3WLPA 3B5IA 2O7SA 3GFPA 3SYMA 4BVGA 5IUKC 2BM0A 2EKZA 5AVXA 2MDTA 1CV2A 4O5OA 4WV3A 1PZFA 3KKEA 3AY7A 5LZ8A 1NQXA 4JLNA 3PLAE 3NANA 3P0RA 3KEMA 3DEFA 4QLOA 1GKKA 1ZLXA 1F6BA 1W46A 2D1SA 3GT7A 2WM3A 3PCRB 3U1TA 1ZRNA 2ZRHA 2FZLA 3NH6A 4LECA 1GDHA 1OFUX 4U63A 3M4YA 2XKBA 3TD6A 1E96A 1MC8A 2X9VA 2IS2A 1OIWA 2OT3B 4WX2B 1GTVA 3NTQA 1JA1A 1ZN2A 4NEHB 3UUGA 5B36A 2QW1A 3FRJA 5LZ9A 2P79A 3EUFA 3F8SA 3M89A 5JU6A 1DC3A 3A1EA 4ZOCA 5LUBA 2XNDD 4BVEA 4NZZA 4D9CA 3O2NA 1OWNA 1ISGA 3KS9A 2X0EA 5DMXA 1I30A 2R4TA 1YTLA 2VEOA 2CXNA 4PYRA 2HA7A 2AN4A 4PSCA 4RNCA 4BGUA 2CL6X 3BG5A 5E6RB 2CUNA 4CV0A 3VMFA 3I6MA 1JXMA 4R9VA 5FOSA 1XQ6A 3PL1A 3PYXA 3NX4A 3EX7C 1U2PA 2C4HA 1DQPA 4L07A 3SOPA 2II6A 1V45E 2XMZA 1YMVA 3C5HA 3CKKA 5GOTA 1L1FA 1Y1SA 2BT4A 4MRAA 4LF6B 3HKEB 3AF4A 4EJ0A 2RBEA 2AB0A 2WA1A 1JIVA 3PNYA 1AK1A 1XQVA 3SEAA 2ALJA 1PR1A 1JDVA 2G1JA 4V0OA 1CUAA 5LLDA 2RH8A 3MUFA 1Z4MA 1ZH8A 4REQB 3O8OA 4EUFA 1BHQ1 1PG0A 4EB3A 3JWIA 5A6VA 2J08A 1SWWA 2OENG 3DQZA 2XXAA 2AK3A 4I5DA 1NQVA 4Q02A 4DZZA 3AUAA 3OF3A 5JATA 4OYLA 1SVNA 2PKQO 1MF7A 1V37A 4RNDB 1NKVA 5JCJA 3ADBA 1EVQA 4KQCA 4P34A 3UH1A 2JIQA 4Q7QA 2BD0A 3VNUA 3DVQX 5DTMA 1PFWA 5AKJA 4BQQA 4LXTA 5AICA 3UMCA 3IRUA 1NVAA 3HGQA 1PS0A 5GVRA 3BICA 3TOCA 2C3UA 3R09A 1X7ZA 4TKLA 2D13A 3ENVA 5CFQA 2YJ3A 5K7SA 1E6EA 2QJWA 1MVOA 1TZBA 4KG7A 3UHOA 1XQWA 1XZQA 1XRMA 3CJQA 3QNUA 4WFQA 1TZMA 2ZVQX 3A06A 3AUYA 3N7AA 4D9HA 4EHHA 3HJAA 4HX2A 4DC9A 1B0PA 2C9YA 5GV7A 4HWGA 1QM5A 4RD6A 1CQJB 4KQHA 2OQIA 3IDOA 4INAA 5JT1A 4BDTA 5AVQA 1CG6A 3QI7A 1X7WA 5HGJA 1DXQA 4XKJA 2A57A 3L1VA 2HHJA 3E9NA 5EE3A 4BMPB 3TL6A 1HDZA 1O5OA 2HU5A 4FBLA