1XU7A

Crystal structure of the interface open conformation of tetrameric 11b-hsd1
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
263
structure length
263
Chain Sequence
QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Flexibility in Crystal Structures of Human 11beta-hydroxysteroid dehydrogenase type I provide insights into glucocorticoid interconversion and enzyme regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase, isozyme 1
total genus 103
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2004-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xu7A00
5HS6A 1I3LA 3PHJA 4I1IA 1H94A 4ZQEA 1LDEA 2B37A 1B26A 4XYGA 3H4VA 3DXFA 3GGOA 1PQPA 1DIRA 3BMQA 2X7HA 3NDRA 5KVCA 1Q7CA 4R9SA 1BW9B 2VHXA 4XYMA 4ALIA 4Q3AA 2C2XA 4BKQA 5DDIP 4UVEA 2O7QA 3AFNA 3ASVA 4PLPA 3WTBA 4PLVA 1MC4A 3M1AA 1U5CA 5IN5A 4CMEA 2EERA 2FY8A 1U9JA 1V3UA 5AXAA 1E3JA 4NU6A 1Q7GA 5IZCA 3AUSA 4IGFA 4IDDA 2BRUA 5A5FA 4NI5A 3IP3A 1PZHA 4DLAA 3WX0A 4Y6PA 1S6YA 3CMCO 2WSBA 3E5MA 1ZBQA 1ZXLA 4ND4A 3ORFA 3JQAB 1LSJA 2JAHA 3GZ4A 1IB6A 3H5NA 5KJ6A 4QO8A 2UUOA 5L51A 3TZHA 5JC8A 4BNIA 5BNFA 1KVUA 3P2YA 5DOVA 7ADHA 1ZFNA 2ZJ1A 3DBHA 1DC6A 1R4NA 1LRLA 3HB5X 1KC3A 5JAZA 3QHAA 4L9RA 1IUKA 3I3OA 3OEWA 1AN9A 4ALMA 1C0LA 1FMCA 5ICMA 1L7DA 5IN4A 3KZVA 2NM0A 4LMRA 3H9JA 4J4HA 3QVSA 1GAEO 1O5IA 2AQKA 4ZN6A 3CMMA 3F1LA 4WJZA 2VRBA 3HUDA 3JQAA 1M75A 5HM8A 5JSFA 1BRMA 5I8ZA 3WLEA 2FR1A 4A26A 3PJFA 2I76A 3KRTA 4JX8A 5CDTA 2C7VA 3V2GA 2RCYA 4LRTB 2PZMA 1CYDA 5A5EA 1B8VA 4FFRA 1EFKA 2UYYA 2H6EA 3DOOA 3PYLA 3IIEA 4NH4A 4PCVA 1GCUA 2BF7A 1HE5A 3HG7A 2FR8A 4OXNA 2W2LA 4XRRA 4YAKA 2D2IA 4EITA 4J91A 4IJVA 2X9GA 3WB9A 1IHYA 1O6ZA 1A7KA 3GRPA 3RROA 5L4SA 4KWIA 2VUSA 3WTCA 1PQWA 3BMQB 2OMEA 1PSDA 4KDFA 1I5RA 4M49A 3WXBA 4ZQGA 4CLEA 1NR7A 2ILTA 3ONFA 3ZHXA 2EW2A 2PNFA 1JKJA 3TF5A 3KYCA 3E6AA 4XA8A 4BIIA 4HP8A 4MVJH 1Y1PA 3ZI0A 3DZJA 4TSKA 4AJ4A 4K6FA 3C7CB 4JN6B 4XCVA 3GH3A 3SBOA 4DQVA 5JDCA 3ITKA 5L3ZA 1P9LA 4G2NA 4JQCA 4ZRNA 1WMBA 4XJSA 1ML3A 4H15A 4MPDA 3TZKA 3GHHA 4BNUA 5FEUA 1P1KA 1MP0A 3JQDA 4JBHA 4XQGA 1HDZA 3QE3A 7MDHA 3GNTA 3JTMA 2HMWA 2HAEA 4MP3A 2JD1A 2Q1SA 4ILKA 3WGOA 4BNZA 3JYOA 4XR9A 1NP3A 3OH8A 2V6GA 3VVBA 1DFGA 4L4RA 2ZTMA 3RBZA 2UVDA 2WWRA 1NQ5A 3FR7A 1JVSA 1DAPA 1H6CA 1H0KA 4XKJA 3UOGA 2GYYA 4GLOA 5A04A 3EY4A 1T25A 4ALNA 1R0SA 3DHYA 4GAEA 2P9CA 4CV3A 3QWFA 2Y67A 2AQHA 1PJTA 3WYBA 2XPCA 3L6DA 2VYNA 3ZWYA 1UJMA 4E31A 4B4WA 1UZLA 4URFA 5JLAA 2O3UA 3IOYA 2AHRA 4FGSA 4GMGA 4R54A 3PJEA 2V6FA 1JKFA 3WGTA 1VJ0A 3K92A 5A05A 4HADA 1CIVA 4NZ9A 4P8RA 2Q2WA 4O0LA 4BMNA 5DF1A 4D3DA 4N5MA 1XELA 1VRWA 4PGFA 5ILOA 3DQPA 3W4IA 2X5KO 4PZEA 3I4CA 4NG5A 1ZUD1 2ZATA 3EC7A 4WCFC 1IYZA 5U1PA 4MKRA 1L1FA 2C59A 3H9QA 3VPFA 4OHUA 3U0BA 1UXGA 2BFAA 3BAZA 4CR7A 1LSUA 4PLTA 1N7HA 3EHEA 5JBIA 4NU5A 1YWGO 1E3EA 2IZZA 4L8VA 1C14A 4MOWA 4UVDA 5F1PA 3CSDA 3F4LA 4CMKA 1A9YA 2PD3A 4RQTA 1C1XA 5A3VA 1V3VA 3ON5A 1F0YA 1SEVA 4IJUA 1LSOA 4Z9YA 1E5QA 3VPXA 3ENNA 5JDIC 2W2LD 4IDGA 3AI3A 3H9UA 5BNIA 4ZICA 1ULSA 4C7KA 1ZXBA 4ZA2A 1E5LA 3UW3A 5G0VA 1E7SA 2G1UA 2OUIA 3OJ0A 3M2PA 3GEDA 4YJDA 4R4JA 3GZNA 1E1LA 1XKQA 1RJWA 3NT4A 3GK3A 3K96A 5TRTA 1PGNA 3U4IA 1XEAA 2AG5A 1CEQA 4YT5A 3K30A 3IQDB 4AJOA 4DA9A 2D5AA 2JJYA 5G0UA 3KSZO 4LCEA 2C07A 5JMWA 3GAZA 1R12A 3JQ9A 1B8UA 1XA0A 5DT9A 4JK3A 3SLKA 1T1SA 1LDGA 4WCFB 2F00A 1EK6A 1OAAA 4QEDA 4YRBA 5KJFA 5EINA 3FD8A 2DC1A 4J4BA 3WIEA 3W4JA 3F47A 1FDTA 3QWHA 1EVYA 1EBUA 1PZFA 3RD5A 3COSA 1QLHA 1BSVA 3JQCA 3AM5A 4CV2A 3NRCA 1GQYA 5JO0A 3QA9A 1YDWA 1SZJG 3ZHZA 4AFNA 4FPXA 2C5AA 4RF5A 1NHWA 1SOWA 4ONEA 1ZK1A 2AQIA 1I30A 4P38A 4CLRB 3ZNOA 1I8TA 1Y8RB 3Q6IA 4Y8VA 1CETA 1HZZA 4J2OA 4CQMB 3NTQA 3GUYA 4BOYA 4FJ1A 2B4RO 3JYPA 3OQ6A 2E4AA 5G0SA 3GF4A 1KEUA 2ZB8A 2DBRA 3H2ZA 4IXWA 1R16A 2J3IA 2Q50A 1XHLA 4MP8A 3HDYA 4F46A 2VZ8A 5DP2A 4ZVVA 1IZ0A 2JHGA 3LLVA 2X8LA 3TJRA 2X0JA 4LGVA 1LRKA 3RFXA 1P77A 2Q2VA 4D79A 4UEJA 4Q3EA 3UHAA 2EKPA 1PL8A 4GBJA 2NVUA 4IJKA 1Q1NA 3H2SA 4OSOA 1X7GA 4OQYA 3D4OA 4AJJA 4N5NA 2FZWA 5DP1A 1SO8A 1UP4A 2O3TA 4IDEA 3UXYA 3TOXA 1CDOA 1YL6A 1U7HA 1BVRA 1PGQA 3C3XA 4L76A 1Y81A 4EUHA 4EJ6A 2DU8A 4FFNA 3GFBA 8ADHA 1HTBA 2BELA 4J7XA 5A1TA 1KBZA 3DTTA 5DNAA 2EJWA 1R4MA 1GZ4A 1HT0A 1HL3A 4W7IA 3WGQA 5I9MA 1HYEA 2GF2A 2OBYA 4UEKA 1H5QA 1ADCA 1HDRA 4H3VA 3N74A 2W2KA 4IDBA 2E37A 4YRAA 5B4VA 4LSWA 2AEJA 4R5HA 2GRAA 3S1LA 4KOAA 4DYDA 2D59A 3QP9A 1RM3A 1SNYA 2EG9A 5G2OA 4YWJA 4E4YA 4YB8A 1MXFA 3OA2A 4B8ZA 4W9NC 4QO7A 4Q3BA 2FHSA 3OIGA 4U8GA 4RLSA 1ZIDA 1W6UA 3Q2IA 3BTUA 3QVTA 1F17A 3DZKA 1GYPA 4K1LA 5DN9A 3IJPA 4IPTA 3FNHA 3GEGA 3HFGA 2O3JA 1EBFA 3L4BC 4TRJA 3B70A 5CDGA 3H9EO 2B36A 3JD4A 2VWQA 1UZMA 4J2HA 1HEUA 1VKOA 4BNLA 1E7MA 4B3JA 1LQTA 4D42A 3E5RA 1TXGA 1NQTA 4ZQFA 4C4OA 1B16A 4OQZA 3SX2A 1AHIA 1I10A 1KY5A 2IEDA 1WDLA 3ZWPA 4XGIA 4E5PA 2YQ4A 4EEZA 1E3IA 1R15A 2JD0A 3MZ0A 4S1VA 1LC0A 2CDCA 2QQ5A 4JP2A 4U0JA 3QW2A 5IFLA 1GZ6A 1K6JA 1X7DA 3O8QB 3DWFA 1K2WA 2X6TA 1LLDA 5CDSA 5CFZA 3VPHA 1KC1A 4CJXA 5C3MA 4TZTA 1I2BA 3D5TA 5TLSA 4CLRA 4WLNA 4WLVA 1GEEA 4ALLA 3GR6A 4BNWA 3AK4A 3DTYA 4W7HA 2WE7A 3ZH2A 2BFOA 1EVJA 3KB6A 2VZ0A 2YW9A 3INGA 5DBFA 2OP1A 4EUFA 3TQHA 4DRYA 1CERA 1Y9EA 3BIOA 5TQVA 2Q2QA 3V1UA 1B14A 4D0SA 2JFFA 1AGNA 3BYZA 5I7VA 1U3TA 1W0CA 3D7LA 1A71A 1RPNA 3RBVA 1B15A 4AICA 4NQZA 5DCWA 1NVTA 4CL3A 5TJHA 2NQTA 1QXSA 1DAOA 1XR3A 2BD0A 2CNBA 3DBLB 3F3SA 2HK8A 4QSMA 3CINA 1CRWG 1DFIA 1QMGA 2O4CA 1YOVB 9LDTA 5I7EA 2WMDA 1PJLA 4EGFA 2DAPA 1OFGA 1WZEA 1UR5A 1GPJA 4ALKA 2PH5A 1KY4A 1Z6ZA 2Q4EA 2I67A 4MDHA 3P19A 3PLNA 3DOCA 4DUPA 1HSOA 2RAFA 1N9GA 3QWAA 4NMHA 1QR6A 5B4TA 4BL5A 4HFJA 3GT0A 3AFMA 4YJFA 1SEPA 4A5OA 3BZUA 3JD0A 4DQUA 5HRUA 4J90A 4XJTA 1GFSA 1K3TA 4FC6A 4MO2A 5COQA 4BNXA 5IXSA 5IJZA 1ENZA 3NT5A 3KXDA 4D0RA 3PQEA 4KWHA 1LC3A 1MA0A 2X5JO 3DAFA 2EIHA 4E21A 3ANLA 3TZ6A 1MX3A 1BDMA 2H5LA 4BKOA 3NYWA 2VTEA 1E1NA 1MXHA 3OECA 1FJHA 3QWBA 4I9UA 3UCXA 2EW8A 2X23A 1TVEA 1M2WA 4YT8A 5JNLA 1DOHA 2O48X 2F1KA 1MFPA 1T26A 1VM6A 5L7YA 1LNQA 4F3YA 1GUFA 1P44A 3ZU4A 3O9ZA 3K73O 5JCJD 1YS4A 3LDHA 1AE1A 4PRKA 2CMDA 4DC0A 3ZDFA 4FS3A 3QQPA 4E6PA 5CG1A 1C1DA 1Y7TA 2YY7A 1Q0LA 4R16A 3I9OA 4XQ9A 5GMOA 2PGLA 1BW9A 1BWSA 4BV8A 4D45A 1M76A 2HRBA 3TOZA 2VWPA 3SXPA 3EYWA 4CM4B 4FCCA 3WGIA 4LSMA 2D4AA 3X2EA 4IXTA 1E6UA 1HDGO 3WNQA 1I3NA 4LN1A 4IQ0A 5L95A 4RL6A 2PV7A 3OJLA 2FPIA 2PZJA 5CDYA 2I9PA 4WLOA 1GD1O 4UEOA 3RI3A 1KEVA 2Y1GA 2ZYDA 3IUSA 1YRLA 2YHIB 3BTVA 5U4QA 1BG6A 4A73A 4MIOA 1QP8A 1O8CA 1ZW1A 1NQAO 3KEQA 1O9BA 3AOEA 2GSDA 2DFDA 1X1TA 1X7HA 2NNLD 4ITUA 4IINA 1DC4A 4E2YA 5T8KC 4DVJA 5CAEA 3DZHA 5B1YA 4YPOA 1WP4A 2BGMA 4K28A 1OOEA 1YQGA 3E18A 1ZJYA 4IQGA 1KOLA 4D41A 3Q1LA 5B12A 3OMLA 1VSVA 3EAGA 1O94A 3CE6A 1HYGA 5G4LA 1B0AA 2EHDA 1A72A 1IULA 2FZEA 5L7TA 3GNQA 3OBBA 4II2A 2EXXA 3ROKA 5JCXA 3EVTA 1PWXA 1TLTA 2DT5A 3EVNA 4CUKA 3MJCA 1PJ2A 2VNAA 3F5QA 3UUWA 4KTVE 1PR9A 5G0WA 3QVWA 4IS2A 2QZZA 5ILGA 2HK7A 3DZBA 1OC2A 3S2GA 2VOJA 5KVSA 2CUKA 3I9JA 3CTMA 2OOSA 1V3TA 5B4UA 3MOIA 4KUHA 4YAEA 5LCXA 1SBYA 3L9XA 1ZVMA 1HDOA 2GDZA 3NT2A 4DPKA 4XRGA 2DBVO 3SEFA 1T4BA 5ENDA 2FMUA 1PL7A 2D1YA 3BTSA 3KYDA 3RBXA 2B5WA 3GVHA 1E7WA 3DBRA 1YQDA 3LLSA 3PWZA 4PVDA 2FN7A 3ZV6A 3MTGA 3DEYX 1HDCA 1YB5A 4HKTA 4UAGA 4MVJG 3OQBA 1KYQA 1XDWA 4R3WA 2Q99A 2YDYA 1XG5A 1DB3A 2V7PA 3MJTA 2DPGA 3WQRA 2FOIA 1PJQA 3VH1A 1F14A 2O3QA 5EJ2A 4JJFA 5JAIA 5JYDA 2WYVA 3WNVA 5ITWA 4MVJP 3FF4A 2ZTVA 2X0RA 3JCZA 1G1AA 5HS4A 2AE2A 3QWIA 5ITVA 1J0XO 2V6BA 5T64A 1YKFA 3E1KA 2O7SA 4LRSB 1NYTA 3V1YA 4R41A 1PL6A 4I5DA 4RF3A 1ZCJA 1FDWA 3PK0A 4AJ2A 1E3WA 3QY9A 3WWZA 4DIBA 3BMCA 2B5VA 5BR7A 3TFQA 1HYHA 3GVPA 4J1QA 4WOJA 3C1TA 1B3BA 2D0IA 4BNTA 2Q46A 4BVAA 4FGWA 2HO5A 4D44A 4PG7A 1NBOA 1R4NB 1YDEA 4CL8A 3U3XA 1VJ1A 1J49A 1YQXA 3EZYA 2Z5LA 4J7UA 1NVMB 4GLLA 5TSDA 3JQ8A 3ENKA 4PFJA 5GZ3A 5BSGA 1WDKA 4CPDA 4UVGA 4O1MA 4E5YA 1UXJA 4J9UE 3A28A 1GDHA 1GQQA 1ZK2A 2ZJ0A 2PTGA 3PIDA 3EW7A 5KWEA 3ST7A 1OBFO 5HTOA 2X1HA 2VWGA 4YEDA 1W73A 2IE0A 3ZWMA 3U09A 1EUZA 1VKNA 4NHEA 4RDIA 3SJUA 4AJHA 2BGKA 3RJ5A 3UN1A 2VQ3A 1ISJA 2Y68A 4HX5A 3ZU5A 3TL2A 3WGGA 4WECA 2YV1A 2UDPA 2AEFA 4Z9XA 3WBBA 2QX7A 3FWNA 1ID1A 2IZ1A 3OETA 3TPCA 3HB4X 1J6UA 3Q0EA 1WXDA 2OL4A 3EUWA 1T2DA 1JDJA 4RZHA 4GVLA 4UUMA 3QJ5A 1OMOA 4Z9FA 4BKPA 1QYXA 1PS0A 4YT4A 1NR1A 3GPDG 3RFVA 2PKRA 3PP8A 1JKIA 1YXMA 2HMTA 2IYPA 2HK9A 3P2OA 4Q3CA 1ADGA 5DCUA 4DQXA 1I01A 3KSDO 1EEHA 3RKUA 4XD2A 1H2BA 3RFTA 5DOZA 5A9SA 1P3DA 2EF1A 4A03A 5BNTA 2WEKA 3AW9A 4EYEA 5KOIA 2Q1WA 2D5CA 4JROA 3FNGA 1GTMA 3UVEA 4QT0A 3HDHA 4D46A 3FN4A 2CF6A 3VOSA 4CM1A 4L4SA 2RH4A 4I9HA 1H2HA 3IP1A 4TRRA 4Z0PA 1UAYA 1P33A 1K6XA 1JU9A 1EQUA 4PZDA 1ZJZA 3KV3O 4B7XA 4OH1A 4PLYA 1GZ3A 4WE3A 4XR4A 4EJMA 4UUPA 1R37A 3LC2O 2EP5A 3S2IA 1PJBA 4A27A 2BI7A 3RCBA 1H9AA 3ZCXA 1LDMA 1H6DA 1DBVO 1YJQA 3ETEA 4J3FA 4PG6A 3WMXA 1E6WA 4BNMA 3ROQA 5K6AA 1BXGB 1XGKA 3KOUA 1NQOA 4F6LA 1RYEA 1P1RA 4W4TA 3GGGA 1HF3A 2GO1A 2Y1EA 4K6CA 5B37A 4M87A 5BSEA 2DPHA 4CQLB 2P4QA 3GDGA 3WGYA 1RM4A 1VL0A 2I3AA 3BHIA 5IDYA 1EFLA 1XU7A 1E1KA 1ZK0A 3IUPA 3W8EA 5FI5A 4YQYA 5IZCC 4I08A 4JCOA 2OORA 1XQ1A 1XCBA 5C7IO 1NPYA 3JQEA 4DMLA 4B79A 1LQUA 4P22A 1A7AA 3LT1A 3ZHYA 4CR6A 1ZSYA 4E2WA 1QLJA 4CLOA 5KJCA 3AU8A 2XAAA 5DBIA 1VJTA 4O59O 4ALJA 1TI7A 4DMMA 2W98A 4WPGA 1BDBA 1R0KA 4OYRA 4GGOA 2I65A 2C5EA 2DM6A 1RKXA 2BGLA 3NEPX 2QIOA 4IUYA 3W8FA 1P1IA 4DWVA 1ONNA 1ZMTA 1G0OA 1V6AA 2YV3A 1TT7A 4MIYA 1YJ8A 5COAA 1I2CA 4IY1A 4L0QA 3GPIA 4IZIA 2AE1A 4CM8A 3VKUA 2V6MA 3WYCA 4RCVA 4AVYA 3PRJA 3BHMA 2DLDA 3PPIA 3V5NA 3PDJA 2POQX 2NQ8A 2DTEA 5JE8A 1GYQA 4INAA 4NK4A 3D64A 4FD3A 3CIFA 3SJ7A 5TS3A 5CEJA 2YFQA 2P9GA 5EL0A 1EQ2A 2VRCA 1EDOA 5LDHA 1HDXA 3JQBC 3TN7A 3I83A 2OP0A 1YBVA 2WD7A 4WK6A 2E82A 4GWGA 1NFFA 3GHYA 4YBZA 1DFHA 4M55A 4BO9A 4PN3A 3R3JA 1I24A 1XQ6A 3G1UA 4J49A 4N18A 2R00A 4OSPA 3RASA 5EQFA 1HE2A 3NV9A 2TMGA 1UXIA 3JD3A 4B3HA 3G79A 1HWYA 2QYTA 3UCEA 1LXCA 2W4QA 1F8GA 1D4FA 3LYLA 1EE2A 5A03A 2GLXA 3KTDA 2YJZA 2NU6A 1KVQA 1P1HA 2R00C 3AI2A 4R1SA 3JQ7A 3H3JA 5MDHA 3AUUA 5FI3A 2HMSA 4R68A 3PYXA 1U2DA 2PR2A 2B69A 3GN1A 4XQCA 5JPIA 1GL3A 1KVTA 1R66A 2YUTA 4IDFA 3MEQA 3UGKA 4P4NA 5JS6A 5ICSA 3CXRA 1QSGA 1DRWA 4L73A 1Q0HA 4BO8A 1P45A 4CUJA 4EW6A 1AUPA 1GEGA 3F9IA 3FR8A 2EKLA 4J9VA 3FPLA 1KVRA 4J6FA 5DBGA 2A94A 2QZ9A 1Y5RA 1LLCA 1NAHA 3U4DA 1WZIA 4P4LA 3T7CA 5AQ1A 2BMAA 4L75A 1EVIA 4U0KA 2D3TA 1BXGA 2RH8A 1WNTA 1IE3A 1PS9A 3PHIA 3R6DA 4I5FA 4XIYA 3RJ9A 4CM3A 1B2LA 3A9WA 4O6VA 4L4XA 3NTOA 3LT4A 3C1OA 1A27A 2LDXA 5I9NA 1QYWA 3WJAA 1LEHA 1WPQA 2BFPA 2JCYA 3WG9A 3JYLA 2GASA 1DHRA 2AQ8A 3KEOA 1SAYA 2O23A 4TRMA 1A5ZA 4WEQA 3VKVA 2Q1TA 2AMFA 3ICPA 4MIEA 3HQ4O 3QVXA 3C8MA 4N54A 4NNJA 3QVOA 4BHTA 4UREA 4GX0A 2Q49A 4OOFA 1UDAA 1ONPA 1B3RA 2YQ5A 2BI8A 3CZMA 4ZJUA 1WLYA 4YAGA 1QKIA 3W6UA 2GUGA 4I5GA 4AJEA 5JYEA 4KP7A 3KM0A 5AXBA 3RUCA 4BNHA 3GOHA 5F5LA 4E13A 4CMAA 2CD9A 3ANNA 5A9TA 4Z0HO 4OAQA 3HFSA 5KCZA 3ZWBA 1JTVA 3HE3A 5GY7A 4OM8A 3RIHA 3JQFA 3HNPA 4W9NA 3PGXA 3H3FA 3LQFA 3GLQA 1NM5A 4RQUA 2QRLA 3SC6A 4B7UA 2CVQA 2NTJA 3HN2A 4BNYA 4GH5A 2NVBA 4TVOA 3TZCA 4NJMB 1K89A 1ISIA 1N5DA 3W1VA 1JLLA 1GU7A 1NFRA 2W8ZA 5DCYA 2PZKA 1ADBA 2AW5A 5I7SA 3H7AA 3D3WA 1ZSNA 1UXHA 4YT2A 4Q3NA 4J1NA 2A35A 1ONOA 1YB4A 1VPDA 3ETGA 3G17A 2EV9A 1PJ4A 4ZGWA 1C3VA 5AXCA 4DYVA 4JNKA 3B1JA 1DO8A 3PWKA 3RC1A 5JW6A 3ZNPA 2WD7B 5A02A 5TGDA 1PGPA 5TT1A 2I99A 4IJWA 3AY7A 4CMIA 4IMPA 4R9RA 3LT0A 1ZO8A 2NUAA 1UXKA 3BMOA 4KQWA 4Y6SA 5J23A 4BO4A 3NTRA 1HRDA 2B35A 1UH5A 3GVCA 5F3RA 3OA0A 4BO7A 3AJRA 4CR8A 2HLPA 4IZHA 3INTA 1WW8A 5GZ6A 4A2CA 3ANMA 2I66A 1T2FA 2P91A 4TVBA 1JN0A 1GQ2A 5K6AC 1F06A 1G6KA 3PJGA 3SLGA 4BMVA 1SB9A 5I8WA 3RUHA 1N7GA 4PRLA 4BNFA 5JO9A 1ADFA 4CMIB 5EESA 3BMNA 1ISGA 3DMTC 4YJHA 3PHLA 2DBZA 5CPBA 4NBTA 5FYDA 1LU9A 2H1SA 2OO5A 3HZZA 4A10A 5K0ZA 1M6WA 2FSSA 3PGJA 1FDSA 3QLJA 3L77A 3UFXA 1U1IA 2BH9A 4UVIA 3W6ZA 4OIMA 1WDMA 4DL9A 2Z95A 4GWKA 1BXZA 2D8AA 4XIJA 3RUIA 4M8SA 3WFIA 4GSLA 4BO5A 1IZ9A 2FRDA 2X9VA 3BTOA 4R5MA 3VPSA 3D1LA 1D8AA 2BFMA 4FFLA 3AM3A 3L6OO 2DTDA 3U5TA 1ZH8A 3D4NA 3ULKA 3WQSB 4BNVA 1B8PA 1DIGA 1HDYA 3PQFA 2QYSA 1KEPA 2GNAA 1RM0A 2RHCA 4PG8A 4YDRA 3Q9NA 3H5AA 1Y8QA 2O3RA 1MG5A 3Q3CA 1U8FO 3FPCA 5KJEA 3A14A 4DIFA 4JXKA 3WR5A 3WMWA 2HMUA 4XGKA 4D7AA 4RVSA 2RBEA 4N5LA 1RYDA 4Y98A 1NX6A 5TNXA 1D1SA 1GV1A 1MB4A 2GN8A 2PGDA 3WICA 3AOEC 3JSAA 3RAJA 4ZQBA 1UUFA 4GX5A 5EPOA 1QYDA 4JJGA 1K6IA 3JD1A 4JGBA 4PLCA 4CLHA 3NX4A 1U3UA 5TF4A 3PWSA 1UDCA 4Z3DA 2P9EA 2GN4A 1F12A 3IMFA 3ZWVA 4FBGA 1A4UA 3IKTA 4GMFA 2EKQA 1UDBA 4RPHA 2ZCUA 3ABIA 1ZK4A 2ZCVA 4MP6A 2DVMA 3JD2A 1XLTA 3GDFA 1J5PA 3CKYA 4OO3A 3RSHA 1LLQA 4PLZA 4AJIA 2Q1UA 3G0OA 4BO6A 4J0EA 1NPTO 2QG4A 1CQJA 5JAQA 4NBRA 4E5KA 3I4FA 1NHGA 2HCTA 2E6UX 2A92A 2QRJA 3DONA 1TEHA 1KERA 3I1JA 4QECA 4CMHA 3I9LA 2DUWA 2NWQA 2VZ9A 3PLRA 4HWKA 1UP6A 2FPGA 3C7DB 1DIAA 4YACA 1J4AA 1KETA 4XX0A 1C0PA 2J5KA 4CODB 3IS3A 2FP4A 2NV6A 5JXWA 1HXHA 3KO8A 5TJ9A 1Y5MA 3OQ1A 2HMVA 1A4IA 1Q7BA 2XXBA 3H65A 3U4HA 4CLDA 2NLOA 3R0IA 1ZKMA 1QV7A 4KQXA 1NPDA 5CHEA 4CM5A 1EDZA 1DSSG 3N7UA 1ENPA 1YH3A 1H6BA 1Q2XA 4KUEA 4JJIA 2BHLA 2VNSA 2YV2A 3TFOA 3VZQA 3O26A 1MGOA 1D7OA 1LJ8A 1Y9AA 1D1TA 4QQRA 5F5NA 3DMTA 3LT2A 1N2SA 1Z7BA 4PG4A 3RKRA 5KIAA 1Y6JA 4XEHA 2HQ1A 4XQEA 3EMKA 2ZQZA 4M86A 1S7CA 1GCOA 4YJGA 2GERA 1DRUA 1XYGA 3JYQA 1VI2A 2Y99A 2PH3A 3KVOA 1X13A 4RZIA 4XYLA 1ZEMA 1FDVA 3VPGA 4E12A 3Q11A 2Y66A 3EDMA 3U49A 2ZTUA 2X22A 3ADPA 2ZQYA 2GN9A 4M89A 1GADO 1NFQA 1SCUA 4BKUA 3I52A 2DKNA 4ND1A 1ZK3A 1HE4A 5H81A 3INRA 4N7RA 5JDCC 1E7QA 3NDIA 5CG2A 1NXQA 4WLEA 3KLPX 2WTBA 3DOJA 3L0DA 2JCVA 1E0DA 4RPLA 5ER6A 1TT5B 1UP7A 3ZZNA 3T7EA 1E3LA 1N9GB 2P5UA 2G5CA 4E2XA 4R1UA 3WLFA 9LDBA 3K2EA 5I7FA 5IAAA 3U9LA 3VHRA 2JD2A 1U7TA 1R6DA 1YVEI 1O95A 1JWAB 2IEBA 1HZJA 1OC4A 3ZNNA 1YOVA 4MKXA 3CEAA 2Y1OA 5L45A 1T2AA 5C5IA 4BUCA 3NJ4A 4AJLA 2C54A 4H7PA 2P2SA 4NR0A 4L74A 4PG5A 4YJHB 4Z0TA 3L4BA 3LZ6A 1AHHA 1H9BA 5AOVA 5IG2A 5T57A 4B4UA 4BO0A 3PEFA 3E82A 4ROSA 2GZ3A 2JHFA 2ZKLA 4D3SA 4ESOA 4NBUA 4NIMA 4WCDA 4J7CA 4J4TA 4KUGA 1YONA 5KVVA 2VT3A 3ROPA 3W8DA 4TWRA 5BSFA 3WSWA 3PHHA 3GG2A 3NAQA 3BA1A 4ND3A 5HWSA 5A4DA 4KMSA 5THKA 2OXIA 2CF5A 5BSHA 3KETA 1FF9A 4Q3DA 3WOHA 2R6JA 3JQ6A 4C7JA 3EGOA 4BB6A 1ZMOA 1WMAA 5TT0A 4XZ3A 3GRKA 1TB4A 3ZWOA 2CSUA 3P7MA 3F4BA 4ZU3A 5AXDA 2GD1O 5U9CA 2GR9A 4G81A 5COBA 4OXKA 2XF8A 3U62A 3MJVA 4DBZA 3ICCA 1DJNA 2Q4BA 4J0FA 4UUNA 5AVOA 1YB1A 3RC7A 2GCGA 1GUZA 4XB2A 3IJRA 2X5OA 4WLUA 4A0SA 3D3WB 4GL4A 4DLLA 3B1FA 1I2ZA 4RPKA 2GZ1A 3ZV4A 1DEHA 1KS9A 1VC2A 2VUTA 1E7RA 4BO2A 3LK7A 2I5PO 4YRDA 1PU2A 4QFCA 2AG8A 2J3JA 1IY8A 1U4OA 2J8ZA 1NNUA 1XIVA 1E3SA 5FF9A 3H8VA 4RLHA 1HSZA 1F8FA 4A7PA 2X86A 2ZB7A 3MWEB 3OJOA 4GGPA 4XDZA 2DUUA 2VTDA 1P0FA 5HA5A 4KZPA 4I5EA 4E33A 1K0UA 4RF2A 2I3GA 3I6QA 4FFMA 4E3ZA 8LDHA 1YL7A 4FQ8A 5KNLA 2E48A 4LISA 4LVCA 3PHGA 3WJ7A 2JAPA 4II3A 2G17A 4GKBA 4ND2A 4DREA 2UV8A 4BMSA 2VHYA 4TKLA 4I9NA 2PGJA 4Z3KA 2O50A 3GEMA 1W4ZA 1M67A 1NTOA 1R4MB 4JBIA 4BO3A 3KUXA 1TA4A 4J1TA 2HRZA 1NASA 1NVGA 2Z1MA 1YL5A 4I8XA 2WYUA 1CJCA 1X15A 3OIDA 1JAYA 4Y6RA 4MVJD 5ADHA 3I5MA 3JQBA 1C1DB 1N8KA 4QUKA 4RVHA 2J5RA 3DO5A 2C20A 4BS9A 4CM6A 1E1MA 3VH2A 3GFGA 1D3AA 2FWMX 4CMGA 1H93A 4DTIA 3TRIA 3RU7A 5L9AA 5C37A 2RIRA 2Y0DA 3TNLA 4RGBA 4LMPA 2CZCA 3FCOA 1Y8QB 4GX1A 4Y9DA 3GUCA 4LVUA 4IBOA 5JFOA 5JY1A 1KVSA 1JW9B 2B0JA 2H9IA 3G49A 1ZEJA 4MKZA 3ZU2A 3GG9A 3PJDA 3GMSA 4G5HA 3WSVA 5L40A 3I9NA 4FB5A 4AJKA 4ZHSA 3OICA 4M54A 4R1NA 1P1FA 2HU2A 1U3WA 3C7AA 3HWRA 4CQMA 4WOKA 2I6TA 1M66A 4H16A 2EGGA 4BNNA 5CP8A 2IXAA 3BHJA 4IIUA 4OKNA 1I3KA 3GNSA 3KHUA 4EJ0A 1RWBA 4U7WA 2DFVA 1I33A 2XOXA 3HN7A 3PTZA 2NU8A 4MINA 2Y0EA 4ZRMA 3LU1A 3STHA 3ONEA 4X54A 4YYZA 4TMFA 4Y67A 1QG6A 2JKVA 3N58A 2DQ4A 3PFWO 3PXXA 3HADA 1GV0A 4CLOB 4PZCA 3I9KA 3WGHA 2V65A 4FJ2A 2CVZA 2IODA 5TC4A 3AOGA 3PFFA 3IKVA 5JDIA 1EE9A 5EERA 3RWBA 1TT5A 4NFHA 5L4LA 1T2EA 2VHZA 3QIVA 4CMJA 5BT9A 3NDJA 4FFOA 4EDFA 3PZRA 2YDXA 3A4VA 3DL2A 4LW8A 4BQPA 1SB8A 2CVOA 3LF1A 2VYVD 2BLLA 2W90A 1PJCA 2AXQA 2VOEA 3O38A 3WWYA 3VVCA 4O5OA 3KBOA 4PLWA 4M1QA 5THQA 2PD6A 4XWYA 1U3VA 1V35A 1I36A 3BMOB 4DBVO 2UUPA 3AU9A 3RUEA 1IOLA 1BHSA 4P4GA 2PD4A 4YXFA 2HUNA 4XGNA 2X4GA 2WYWA 2UAGA 3HDJA 2EWMA 2P5YA 1QYVA 3DMYA 3K5PA 1JQBA 3FBGA 3IDSA 1UAGA 4AL4A 1ISHA 2J3HA 4BKRA 2QRKA 2EEZA 4OKIA 1C1XB 5BQFA 2GGSA 2X0NA 4GQAA 3GDOA 4GSKA 2OBNA 3PVZA 4IGEA 4DGSA 5L53A 1BXKA 4NFYA 1LSSA 1FDUA 1KIFA 2SCUA 3M1LA 5LDGA 2VYVA 3E9QA 6LDHA 4IDCA 4BNJA 3D5QA 2ZYGA 1E92A 3LC7O 4XYBA 3H6KA 3PZBA 3PQDA 1SOVA 1M6HA 2EGHA 2HKIA 1MLDA 4B8WA 3D0OA 2GPTA 3AM4A 5A3JA 1EZ4A 1O0SA 3EZLA 3FSRA 2OHXA 3B1KA 1XWFA 3K2BA 3MJ4A 4TRNA 2G76A 1PJ3A 2C2YA 4QTZA 1GUYA 4NBWA 1PJSA 3ASUA 3ITDA 4WNIA 4PLGA 2X58A 3O03A 3SC4A 3WS7A 1MV8A 2YHIA 3TSCA 1E6EA 1AXGA 3T4XA 2O3SA 3B6ZA 5EN4A 4CM9A 4EI2A 2OGUA 5KKCA 1IL0A 1BGVA 2WJPA 4RDHA 5EIOA 5ES3A 4YR9A 5CEFA 4FC7A 4IIVA 2NU7A 2QHXA 1VLLA 3W4KA 5ER9A 3HSKA 1U4SA 3I9MA 4GX2A 4PLHA 5T5QA 5T67A 3WFJA 2NSDA 1MC5A 3RC2A 5TIIA 3E9NA 1JVBA 3I6IA 3K9QO 3WYEA 4JBGA 5I9LA 4ZQHA 1JA9A 4BGVA 1PGOA 1GY8A 2PA3A 3S2EA 3JQFC 3VZSA 2EJVA 4RVUA 2VUUA 3L9WA 4AG3A 3PYMA 1Z7EA 3E8XA 3OHSX 4JP3A 3DFZA 4ND5A 1QV6A 3OF2A 2NACA 3MOGA 3RC9A 3RUAA 4W82A 4R69A 5DULA 1DLIA 3TWOA 2IDZA 3S8MA 1A9ZA 2ZTLA 3H9GA 3GVIA 4U6SA 4DPLA 1VL8A 1DXYA 3VZPA 5A9SB 3DZFA 3TZQA 1PR3A 4R01A 4CMCA 3NGLA 3VDQA 3E48A 3CZRA 5CEEA 4KDEA 2QW8A 4TZKA 3AUTA 2OFPA 3S55A 3F5SA 2BKAA 4OMUA 3VH3A 4CM7A 3UKOA 4EBFA 1LTHR 4TROA 4FJ0A 4W6ZA 5FFFA 3UAGA 3C24A 4OXYA 4UVHA 4XYEA 4Z6KA 4B4OA 4GI2A 4CUZA 2O4UX 3AUAA 2FSVA 1PWZA 2O2YA 3PDUA 4K9DA 1T4DA 3ZV5A 1ISFA 2OZPA 4G65A 1DC3A 1CQIA 3ZWAA 3ZV3A 4CV1A 4WEOA 1WWKA 2VHVA 4MJLA 3GY0A 3ZW8A 2B4TO 4J16A 3OSUA 4MVJI 4U5QA 3RUDA 1LA2A 2Y05A 1MUUA 1R0LA 1VSUA 5ENVA 4S3MA 3BXXA 1YGYA 1EVZA 1SC6A 2CFCA 4WLFA 3F46A 3DZIA 1DLJA 2G0TA 2ZK7A 3RUFA 3VTZA 4BO1A 3L6EA 4MVJM 1YBMA 1BTOA 1Z73A 2IZ0A 2YHUA 1WVGA 2ZB3A 4WCFA 3TL3A 2Y93A 3QV1A 4RVGA 1Q0QA 2VYND 2E49A 5DZSA 1DIHA 1U28A 5EQDA 4BV9A 4BGUA 3JQ8B 4BNKA 1HLDA 1Z74A 4IMRA 5C7OO 4HUJA 1P31A 4J43A 3DFUA 1ULUA 4E5MA 3ETDA 4RPJA 2C29D 3LC1O 1W8DA 2HJSA 2IXBA 2YFHA 2Z1NA 1PZGA 1N1GA 1PZEA 1E3WB 2CY0A 3MJEA 4FIZA 2J6IA 4HY3A 4UUOA 2ZIZA 1U5AA 2PKQP 3O8QA 4RVFA 4YJGB 3ZWWA 4WGGA 3GGPA 4ID9A 3FWZA 2NADA 4YQZA 3KSUA 3KYBA 4WUVA 1X14A 3P5SA 3VDRA 3E03A 1HE3A 4D3FA 1YE3A 4EUEA 3JV7A 1LLUA 5JAMA 3VAZA 1PTJA 4ZD6A 2ZB4A 2CDBA 1ZSVA 3FNFA 1P74A 3WGZA 1XU9A 1DRVA 2AA3A 4PIVA 1PS8A 1IPFA 2VCYA 3FRJA 4FN4A 3QRWA 1PX0A 1T24A 4E2ZA 1X0XA 3PI7A 3NGXA 5IDXA 1I0ZA 5JY6A 1RM5A 3DBRB 4OJNA 3WQQA 1OZAA 5MGBA 3JQ9C 3VC7A 5L7WA 4MVJA 4W99A 3HHPA 5G0TA 1IPEA 4HNGA 2HSDA 4CMEC 1FK8A 4YCAA 4B4VA 2XXJA 3UF0A 1EMDA 3AY6A 2B83A 1C0KA 1Z82A 4YA6A 1O89A 3UICA 3GN2A 2WM3A 3GVXA 4RO0A 3H5RA 1YO6A 2IRWA 1C0IA 4R3NA 3ZN2A 4F6CA 1WAMA 1DIBA 4QXMA 3UCFA 3AWDA 5KTKA 3ZHBA 3AI1A 3JQGB 4BGIA 2DBQA 3OJFA 1DC5A 3KLMX 3ONDA 3WDSA 1AXEA 2RHRA 4OOEA 1V9LA 4IQ8A 4XB1A 1NWHA 1DJQA 4IM7A 4IDAA 2YZ7A 3FTNA 3LVFO 3G1TA 4CM4A 4CM9D 2ET6A 3FBTA 5H82A 1HLPA 4PLFA 2IYOA 1P1JA 1MFZA 3R3SA 3IL2A 5TX7A 1NAIA 2PZLA 3LSYA 3MCVA 2PWZA 2PFGA 3I23A 4NDNE 3FNEA 1G0NA 4EEXA 2P68A 2NU9A 4PVCA 1HKUA 4GPD1 3V2HA 3MWDB 2NVUB 5IDQA 2C0CA 4E5NA 5IXYA 3NKLA 3V2UA 1HETA 4YVFA 5FWNA 2VWHA 5JC1A 5T8KA 3PIIA 5F21A 4GVXA 3OEYA 2HJRA 2TMDA 2A9FA 1E77A 3U4CA 2C7GA 3FI9A 3GAFA 4WNCA 2VRCD 4DIOA 1DPGA 2WDZA 3CUKA 4JIGA 4B7CA 3OFSA 1ORRA 4FOSA 1PIWA 3KYCB 5EMHA 1KEWA 2GN6A 3DBVO 3OM9A 3DAPA 4JLWA 4NFSA 1ENOA 4CV0A 4DXHA 4YJFB 1I3MA 3D4PA 3CPSA 1Y8RA 3JQ7B 4BGEA 4FR5A 3UH1A 2WD8A 2Y1DA 2H63A 4BB5A 4RPGA 3DHEA 4KTTE 1GR0A 3O4RA 1I32A 3IAHA 3V8BA 5CDUA 3DC2A 4CMBA 5LC1A 4D43A 4RORA 3VZRA 2AEMA 3K6JA 4XDYA 3Q2KA 2Y0CA 3ZWXA 1P0CA 1VL6A 1L7EA 3OP4A 3VH4A 5K9ZA 1LUAA 5GZ1A 1K5HA 2ZYAA 2P4HX 3M2TA 1LDYA 4FSHA 3GMDA 3L07A 3BMNB 2C82A 4BQRA 2JL1A 1U2GA 4WASA 3FTPA 3DZGA 3X2FA 1ISMA 3DB2A 5H83A 1B7GO 2VHWA 3C85A 5G4KB 3MJSA 4R1TA 6ADHA 2Q45A 4CM8B 4Q39A 4LCJA 3DDNA 1QORA 2DTXA 1N1EA 3ROMA 3SVTA 5IF3A 3K8ZA 1OI7A 1ZNQO 4OL9A 5HBRA 1LDNA 5A06A 3GZNB 2NTVA 5CPFA 3BMCB 4AJNA 3DBHB 1VE9A 5IDWA 1LX6A 2Y1CA 2VT2A 3JYNA 4NBVA 4HFNA 1ARZA 3LF2A 5G4KA 1ZZEA 2PY6A 4AJ1A 4DPMA 3RVDA 2VN8A 4E0BA 1UZNA 2FR0A 2O2SA 3GQVA 1X1EA 4YTEA 1LBEA 4QX6A 4UULA 3DBLA 3MTJA 3DHNA 4R51A 3R1IA 1T1RA 3WIDA 3ZU3A 1DHTA 2A4KA 1FXSA 5A9RA 2JFHA 5JMPA 5KVQA 2R2GA 4YAJA 4RV9A 3K31A 3Q9UA 3TDKA 3T4EA 5JCJA 4NJMA 3G3EA 1H6AA 2PKQO 4HV4A 2NVWA 4EZBA 3CH6A 3ZWCA 2J3KA 3GC6A 4DC1A 1BVUA 3ZNQA 3C1AA 3F6YA 4CQLA 3FHLA 1GYRA 3ADOA 3KYDB 1LDBA 4HBGA 4LK3A 4U6QA 1PGJA 2PK3A 1X0VA 3E9MA 1DDOA 1QYCA 4FDAA 3B20A 3RU9A 4AJPA 1CWUA 1ENYA 1PEDA 4F45A 1SMKA 3A1NA 3JQAD 4NJOA 1V8BA 1SPXA 3HJAA 4HFMA 4OGWA 4E30A 2Y1FA 1Z75A 1EUCA 2PLAA 2LDBA 3GA0A 3OIFA 1U8XX 4HXYA 4CLXA 3ZGYA 4MVJE 4NPCA 4Q9NA 2GZ2A 3AY3A 3EK2A 5KKAA 3ZWNA 3V1TC 4FOOA 3DR3A 1LI4A 1BMDA 4K26A 4J1SA 2EP7A 4IS3A 5F1OA 3NUGA 4BNGA 4HNHA 4WKGA 1LRJA 5T6BA 4NK5A 1QRRA 2CDAA 2B4QA 4MVJF 2J5QA 4RVDA 1GPDG 3D3EA 1IHXA 1T2CA 3S2FA 5F1KA 3OJEA 2G82A 3DAGA 4FFPA 1E7YA 2HDHA 4RF4A 1NWCA 4TQGA 4TKMA 3A06A 5L4NA 4QFDA 1PQUA 2JFGA 4B3IA 3NJ8A 4HFRA 3M6IA 3RQSA 3WBFA 2YYYA 3F1KA 1YBAA 4GKVA 2WE8A 1N92A 1JWBB 2Q3EA 5C7LO 5IZ4A 1V0JA 3L4SO 1MG0A 2X0IA 3IC5A 4FW8A 1XSEA 4O63O 3ZW9A 2NTNA 4CQMD 4E32A 4RJTA 1CF2O 1JAXA 2FPPA 5AYVA 4DLBA 3JQGA 1EUDA 2W2KB 1Z45A 1EK5A 2X9NA 3QSGA 3HDQA 3VTFA 4YAIA 2JCXA 5KJ1A
chains in the Genus database with same CATH superfamily
1V4VA 2LGJA 5ALQA 2BZSA 5HS6A 3PWTA 1NLMA 3UWMA 4BN5A 2FQXA 3C16C 5HR5A 5LLDA 4JSRA 3AF5A 2QVXX 4HAYA 4XYGA 2OYRA 4AXXA 1P39A 1FNDA 2WDPA 3EWIA 3H4VA 1UT8A 5CLLA 4D9NA 2VRNA 2X7HA 3ZE1B 2NU6B 1Q95A 3HR8A 2HLDA 1Q7CA 4O4IA 3EFHA 4JI5B 1MO5A 5KVCA 3R9XA 4ALIA 4BKQA 2AC7A 2C2XA 2XWBF 4P33A 2WTAA 3P2EA 1TVKA 4ILEA 1U2RA 1Y3IA 4V1CA 3RT1A 1HH4A 4YX9A 1OH6A 1D9ZA 4IJ5A 3JATB 3RNLA 4KLCA 3M1AA 1U5CA 4S35A 2EERA 2OCYC 3BM5A 2O0MA 1XRSB 1U9JA 3D31A 4J0HA 4EGAA 1V3UA 3OQHA 3WA7A 1PJRA 4WHMA 1YIAA 5DHPA 2O2EA 4J16C 5F78A 1DCKA 1ZM7A 2EHJA 5M3BA 2GK6A 5CFRA 1B74A 3AUSA 4UCXA 4IGFA 2PO5A 2BFDB 2BRUA 5KNDD 4NI5A 3IP3A 1S6YA 3CMCO 2YWFA 3LKBA 4M9CA 4X93A 3HBAA 5J2TB 1M1YA 4MS3B 3QKWA 2HHAA 4BN4A 1O03A 3ORFA 2W2QA 3IA2A 3L05A 1IBMB 4P08A 3H5NA 3KQUA 5CLJA 1VSQA 2UUOA 2YVAA 2PAAA 4Y0AA 3QLVA 4F4CA 2WAAA 5JC8A 1KVUA 1PK8A 3WV4A 2QUAA 3ONNA 1MX1A 1ZFNA 4ER0A 4ZI7A 1LRLA 1TTPB 1C9KA 2VJBA 4LJ8A 3I2HA 4MWGA 5IWCA 4PZYA 1ZVJA 1PSZA 1QQ7A 5JAZA 1BX3A 4U2CA 5LQKA 1BVYF 4CKEA 4IIHA 1AN9A 2YL2A 4RADA 3IR5A 1C0LA 3NVKI 4RHCA 1IN7A 3A9VA 5IN4A 1L7DA 1USGA 2IW1A 1JEAA 4ARUA 3FFBA 1L3BA 2NM0A 2O2IA 3K35A 1KJZA 2WJAA 4ZO4A 5CUQA 2OECA 3VPCA 2QQ0A 3R0ZA 1FMLA 2BMJA 1GAEO 1UZAA 4GOND 3UA3A 3TX2A 3WI7A 4WJZA 1ICEA 3HUDA 3JQAA 1I4WA 3G0IA 2IXFA 2GJ9A 3FX2A 4K9RA 2OQIA 3FH0A 3BWVA 3MINB 4FMBB 4N1AA 4HNVA 2I1WA 4RA6B 3WLEA 2ZOSA 3WLRA 4L3WA 2F48A 3PVCA 4DR1B 3TEJA 4DLPA 1V3QE 2VDWA 5CVUA 3KRTA 1JRLA 4GYWA 1CJUC 4PU0A 1SOMA 2RCYA 2GZHA 3GX1A 2C61A 1WB6A 2PZMA 1CYDA 3WK8A 1G6OA 4FFRA 1EFKA 2UYYA 1YCHA 1MAVA 3PYLA 4Y1EA 4Y6QA 1DAEA 1T13A 4WSOA 2BF7A 1VBMA 4JUDX 4YAKA 1PTKA 1CEEA 4R2LA 3L0IB 4J91A 4XSHA 3IDAA 5CDFA 4IJVA 3S8EA 4AUMA 1KY2A 3CNEA 1A7KA 1RFLA 1HMPA 1C81A 1FSFA 1CQIB 2AFVA 2G9RA 2XT0A 3GRPA 3L1VA 3CONA 4OQLA 4PX5A 3PC4A 3GJ3A 2OFOA 5FQOA 1R3DA 1LPBB 1XROA 1ZX1A 3WTCA 1Y89A 4C0LA 4YV7A 1IIRA 1CNFA 4NOMA 5CK5A 5CVVA 1PSDA 1YR9A 4KDFA 5JALA 4TT8A 5L7TA 2CK3A 5K09A 3ND9A 2EW2A 2MYPA 3G9XA 1E18A 2VP5A 1R7RA 4HP8A 4MVJH 5K0BA 1DQZA 1G20E 3QEJA 3RHFA 3SHFA 5FOVA 3SZGA 1KOJA 4NCXA 4EZIA 2F67A 4EENA 5BV1A 4ZIRB 4JN6B 1FJ2A 1RRMA 3R8FA 3UB3A 5E6UA 3SBOA 1HQKA 4MUNA 4F93B 1H23A 5JDCA 5L3ZA 4PAQA 3OAAD 4G2NA 4R1PA 4ZRNA 4NV1A 1ML3A 4MPDA 3TZKA 1EFPB 5K05A 4V39A 3OVMA 4QVGA 3GHHA 1NP7A 4ISCA 4QRIA 1BOOA 1UOEA 4IO1A 5TR9A 3W05A 4KXVA 5CXXA 1WTCA 2YV5A 5EPEA 5SY4A 3TQRA 4HQLA 3IO3A 4LI3X 2VCEA 1AHPA 2OC4A 1TLLA 1AUOA 3CZ4A 5IKPA 2ZS9A 4XR9A 1MVLA 1QHGA 1ZM3A 4UKDA 4YJ2F 3X43A 4B34A 3D2CA 1WCXA 2V6GA 1XKXA 4P7FA 4L4RA 5EZ5A 3UV6A 4AJ9A 4PYRA 4OK3A 1X9HA 4HDNA 2RKBA 5J2UB 3U2QA 4AP6A 5LKAA 5LFAA 1H0KA 4W5OA 4DJDC 1OASA 5AO9A 4RTLA 5A04A 3EY4A 1WXWA 2Q1YA 2XUGA 2TMKA 1T25A 3I5UA 1R27A 3OUZA 1ZN2A 2J0VA 4IYRA 4JBXA 1R0SA 2RHJA 2RGWA 1JLKA 1R4ZA 2FMXA 3DHYA 3H1BA 3KE8A 4FYWA 4FKZA 1EFPA 4KQ9A 3PDHA 2ZJ5A 2B25A 2VK8A 1W2HA 3GYBA 3D8HA 1NA5A 1I13A 1PJTA 3LUBA 3N9IA 5TB5A 1G4HA 3VR6H 5A2GA 3L6DA 3WWYA 5CD9A 3ZWYA 5CYFA 2FWAA 1SVNA 4R2XA 1Z36A 4B4WA 2BP7B 1UM9A 4RWEA 2DF8A 2J46A 4K46A 2H4XA 4LZPA 5GV8A 3SZOA 5A3RA 2PUCA 5JXHA 2H31A 5E7MA 4HADA 2JHAA 3R24A 4N7MA 1RXVA 3K71B 4PO9A 1ZLXA 4NZ9A 4PZ0A 1NV8A 2DUJA 2Q2WA 2R5FA 2WUEA 4U7JA 1L5RA 4WINA 4CT0A 4YV1A 2BGNA 5AJXA 2Z8XA 1NN1A 2J0QA 1QHSA 3FMFA 3DQPA 1J8FA 2HWWA 1OH5A 2FHPA 3FMGA 4MUFA 1ZUD1 2Z8ZA 4G36A 4QU0A 4WCFC 2GBGA 2O0KA 4MKRA 3VPFA 3C3MA 2JVJA 1WVMA 1WD7A 2WF7A 4CR7A 2D4HA 4BECA 2BKXA 2CXNA 3MIZA 3WKAA 2CHVA 2H2GA 4KLNA 4MRNA 2VPPA 2XBMA 4PIPA 3DOHA 2KBFA 3K70D 3LUPA 3ZQ6A 1C14A 4K6KA 3C5WP 1FCJA 1C1HA 3HXTA 4UVDA 3CSDA 5K2MA 3PNPA 4HAZA 3GPBA 4RQTA 2QX4A 1KJIA 1KMMA 1MEEA 1F0YA 1SEVA 4IJUA 1LSOA 2EWWA 2GAFA 3O1HB 4OHXA 4R2KA 1CRPA 1HPLA 1E5QA 3R9IA 2AMVA 1UBKS 3ENNA 4E1AA 4G0ZA 3GQBA 3VSDA 3IKMB 1YZQA 3AI3A 1R3UA 2LPMA 1RI4A 3UJAA 1N0VC 4W1PA 4OL0A 2VUIB 3M2PA 2GZAA 2H0QA 1EGVB 3HO8A 2I4MA 4YJDA 4F2HA 3VR0A 3LUDA 1XKQA 1PYOA 4TWBA 2D7DA 3UJ8A 1J2TA 3NT4A 4JFRA 5LZ7A 4MYTA 1JG6A 3V8NA 2CB0A 3Q3JB 3U4IA 3U1TA 2CLLB 3FETA 3R0XA 3L49A 4LMAA 2XX3A 4C2AA 4B0OA 2FPKA 1S8AA 1T5TA 3DV2A 1U9IA 3DM5A 2VHTA 4AJOA 1KSHA 2J3MA 4DA9A 1WRBA 2JJYA 3B13B 5G0UA 2QS9A 3KSZO 4JVMA 4O1HA 2YJNA 1OLXA 5GWXA 2JRLA 4MS3A 2J0SA 5DT9A 5FOXA 2OCAA 4JK3A 5AD1A 3FCAA 5IBQA 2H65A 5B2ZA 3S28A 2Z6VA 3Q98A 4KR9A 4QEDA 4WD3A 1W2WB 5EINA 4HDSA 2I4NA 2M1XA 2Y6VA 2NW6A 4F71A 4FWTA 4DANA 1KMCA 3CUTA 2P2ZA 1EBUA 1PZFA 1AH2A 1X8KA 4LHSA 3IRVA 1GQYA 2AYZA 5JO0A 4O25A 2ETXA 1SZJG 3ZHZA 5FTMA 2Q6LA 2JLUA 4MVWA 4TTVA 1KJJA 2SICE 3NP7A 1NHWA 1SOWA 2ZYRA 4L72A 2AQIA 5HX7A 2FE1A 3WLHA 4O4HB 1OWNA 4Y8VA 3EQ6A 4Q5IA 2ZUSA 3U37A 2A0YA 5B6PA 4BOYA 1Q84A 4PWYA 3BE4A 2E4AA 1VCHA 1P4JA 4N4AA 4TMTA 4P6VF 3UK1A 1KZ9A 1GPWB 1ZOLA 2FUCA 1XL0A 1NVFA 3PRHA 4AMZA 1WQ3A 1A0OA 2V8OA 1RXYA 2JFXA 4BFZA 1KARA 4LHYA 1ZICA 3NBUA 1DT3A 4LGVA 3N86A 3L8GA 4NMLA 4A2QA 3RFXA 4GQBA 4D79A 5HVNA 4OLAA 1M34A 2YOHA 3DFFA 1MW9X 4M8KA 4EAAA 2EKPA 4GBJA 4ENVA 1NDUA 4IJKA 4L9AA 1Q1QA 3G5TA 3BCHA 3MAAC 3BCUA 3WK9A 2UZ1B 3CRNA 1UP4A 3K0FA 5GVSA 2V1XA 3IFSA 4IDEA 3TLYA 3OCYA 1CDOA 3Q5DA 4G8CA 4MPTA 3LKVA 3UAXA 3TRFA 3UXYA 2F1OA 1FX0B 4F2PA 5C5EA 1AV7A 1W29A 4EUHA 5JD4A 2ZJ8A 4C0XA 2DU8A 5F77A 3AR6A 4FFNA 2INGX 2BELA 1SVMA 4JR2A 2OR3A 5A1TA 1T8YA 4DLKA 2A86A 2IVZA 4W6QA 2M32A 4CEJB 1Z3CA 3ND5A 3UMSA 4WZBA 2LCIA 4Y7CA 1GZ4A 4W7IA 2V54A 4G8DA 3WGQA 4RAQA 4Z53A 5KSPA 5I9MA 1RXEA 4ZTZB 1QDLB 2OBYA 1YK1A 4DV5B 1HDRA 3KU4A 3L7JA 5J4KA 5CK4A 1EWQA 4DG5A 1IHDA 2VAMA 4XOIA 5D3QA 1WV1A 1M73E 4R5HA 4DG9A 1EWKA 3L41A 3L4KA 1TW2A 2ZVQX 3QP9A 2WFLB 4YWJA 5G2OA 4QG3A 2NP6A 3EJWA 4QGGA 1AF4A 3F6BX 4IIBA 4C5BA 3QMPA 4W9NC 1HY3A 1NULA 1ZOOA 4EB0A 4Q3BA 1N3IA 2C98A 5DHAA 2V8BA 3F3YA 3PR2B 2UVPA 4AQ7A 2CYCA 1F17A 2CXRA 4Q9HA 3ER8A 1XA4A 3N0XA 3IJPA 4LYHA 5F2KA 3GEGA 3UAZA 1R0CA 3HJFA 1EBFA 3L4BC 2PT9A 4KO3S 4TRJA 2WVGA 3DEHA 4OJTA 4D8YA 3B70A 2J33A 4B6GA 2B8TA 4JWTA 3N0TA 4OHRA 1Y9JA 3ZWQA 1G7SA 1MH9A 1QZXA 4M76B 4TKVB 4NV0A 5G41A 1T5HX 4KKVA 2VPYA 3LCUA 4Z3OA 3QOXA 4D42A 3EGEA 4HQFA 3EXEA 4C4OA 3GARA 3GPCA 5DBHX 1B16A 2OHOA 4OQZA 1AHIA 1P6UA 1KY5A 2IEDA 1WDLA 2QAGB 3BKWA 3BXOA 4XGIA 4LJYA 4MMZB 4EEZA 1W4BA 4FE4A 4DNFA 1N2GA 1X7YB 1JDZA 4MW5A 4NATA 1A04A 4B75A 4YJ3B 5BN4A 2JD0A 1KQNA 1TKCA 3W04A 3MZ0A 5H80A 4L3VA 4XJXA 4U0JA 2QQ5A 1CX9B 4YRFA 1EZZA 2FWIA 2XNDD 3RSGA 1BE8A 3O8QB 3IKLA 4OGGA 1ID8A 3KWJA 5BRNA 2X6TA 4RTMA 2C58A 4JQOA 4UDXX 1G9XA 4LY3A 3Q15C 5CFZA 1NI5A 2JRCA 3VPHA 3FFTA 1KC1A 2CNWA 5AI9A 3NVAA 4WGFA 3UK2A 2HM7A 4XAQA 4CLRA 4IIGA 3VVLA 2WU0A 1F51E 1SQSA 3GR6A 5BP7A 1Y1LA 4H6PA 2AOTA 2WE7A 3LY9A 2RI6A 3FDZB 4KFSA 4PZAA 4RU1A 2DHRA 5K3CA 3ZH2A 1VLJA 1ORTA 1RP1A 2JLQA 3Q5GA 2OP1A 4M6WA 3U4QB 1DAHA 4KIWA 2W6NA 1ZH4A 3TQHA 3ZY3A 2AKAB 3BIOA 3K1YA 1TUBB 3LP5A 1G66A 4J3JA 3WISA 1AGNA 4UOQA 1U3TA 4GP7A 3D7LA 1HNXB 2EJTA 5AI6A 4EATA 5ENZA 1A71A 4JXJA 3RBVA 4AICA 1NKSA 4DWOA 4CL3A 1R0WA 5TJHA 4ENQA 1QXSA 1SKYE 1XR3A 2BD0A 3DBLB 3HJUA 5BN1A 2JI8A 5GPBA 1CUVA 1KXZA 1Z17A 1DFIA 2NO7A 3FFAA 2O4CA 9LDTA 4ZO8A 1CZUA 2B9VA 2PLRA 1RJ9A 4QYSA 3K70C 1GTZA 4M6WB 4OLJA 1OFGA 4FM9A 1S0UA 5LBIA 3OI7A 2ZUFA 2QAGC 2XD9A 4OA5A 1GPJA 1XRLA 4XASA 3GFTA 2Q4EA 4MDHA 5ESDA 3V2IA 2I8LA 3PLNA 5KWVA 3AJ8A 1R50A 3HB1A 3DOCA 4G5OA 1J5EB 2P62A 1K3UB 2EYQA 1GVHA 1HFEL 2RSLA 4NTZA 2CDRA 3D7SA 3DMDA 3ITNA 3QWAA 4TYWA 2O59A 4B3GA 3L6CA 3MWYW 3OCJA 5ESRA 1QVRA 2JBAA 3BZUA 3DJYA 3JD0A 3LY7A 2PSEA 4LWQA 1GFSA 3CIOA 1SVKA 4RA9B 5IXSA 2NZ2A 2OWEA 4TLAA 1W1IA 1UBSB 2XKBA 5T4EA 4X65B 2GPAA 3NRBA 4KWHA 2C1XA 4WV3A 2GZMA 3VTKA 4E21A 1HQYE 3TZ6A 4E5DA 1YZGA 1MX3A 2H5LA 3R5KA 2YNMA 5K20A 1BQ4A 3HVKA 2WAMA 3CLKA 3RYIB 1R8YA 1UAAA 3QWBA 3G8YA 4IV0A 4I9UA 5KZMB 5HNKA 1QDUA 3ZE0B 1H42A 1QGDA 3F8WA 2O48X 3PS9A 2F1KA 3R4CA 3WV5A 5I9LA 4ZDJA 1MFPA 5JS8A 3CZPA 1Y7IA 2VJOA 4CE6A 4DZZA 4Q9IA 4Q00A 4M9XA 2NUPB 3ZU4A 1NOIA 3EXHC 1N0HA 1C4WA 5TPWB 1L8XA 2FPXA 4I36A 1YS4A 2GKOA 2WLTA 3LHFA 4Y2SA 2WSSD 3ETHA 3AT1A 3WMGA 2FPOA 4JIMA 4EVSA 2BM9A 4NBKA 1VE7A 4FS3A 3EFBA 1G9TA 3QQPA 4E6PA 3PC8C 3L1HA 3O4HA 4LTNA 4DMKA 1K7CA 1SKMA 2C8LA 2VK4A 2NZVG 1GN8A 4H08A 4H1UA 1VGQA 1LW6E 2UVPB 1J33A 2YY7A 4YAFA 1M2HA 4CIXA 4XQ9A 2UUAB 5BXYA 1NSFA 4O4IB 1T9HA 2HRBA 1QIEA 2QY9A 4CM4B 4FCCA 5TGTA 1SZCA 4W63A 2D4AA 1RYMA 1EI9A 2OZVA 3BIJA 1Q7EA 1G5QA 2ZUBA 2DPLA 2Q27A 1L5LA 1I3NA 4LN1A 3WNQA 4M0DA 5AVQA 5L95A 1RLOA 4X62B 2FPIA 4HB4A 2DKFA 4IEFB 4KN9S 2C7QA 3EYAA 4B7AA 4X1KB 4LYEA 3J80A 1M6VB 4YJ3F 3AYXB 3U4AA 3SX4A 3B2EA 4LYDA 1RZRD 1RSZA 2P0AA 1ORWA 3ID6C 3KELA 2FPPB 2QYHA 4OI4A 1U8UA 3LTNC 4IXDA 1PJZA 1J97A 1Z4MA 4QG7A 4U2BA 1XZLA 5U4QA 3AM1A 1AKQA 5CT4A 5ALWA 3R9WA 4O2AB 4P3YA 1BG6A 4HBZA 5E0KB 4KN8A 4F72A 4XPZA 4JEUA 1S9HA 3LVBA 3Q87B 2ZR9A 4P2BA 2DFDA 3P8ZA 1X7HA 1QH0A 2NNLD 1TKRA 4ER5A 2XLCA 1DKQA 1FX0A 1GGEA 2F59A 2B1IA 3ETNA 4MAMA 4MS4B 4LRUA 4DVJA 2QLJA 1XOIA 4AO7A 5DK6A 4D74A 2X1VA 3K0FB 1JLSA 2BGMA 4K28A 1OOEA 1RQ2A 1XALA 1I7LA 2VL7A 2LWIA 2JCGA 3ECCA 2XNHA 3OMLA 3DE4X 1VSVA 1U0GA 1XDDA 3VH2A 3MBKA 4JSTA 4U9IS 1R6UA 1QF6A 2F1HA 4ITRC 1ND6A 5EE5B 1L4UA 5CA0B 4I1PA 4AKEA 2EXXA 5DU2A 5JCXA 1V5EA 2GXUA 2QUBA 4YRPA 3VR5A 1G8GA 3M6LA 3EVNA 4ME6A 3FNBA 1JEQA 1F8YA 3QPCA 4WTOA 5CH5A 1Y82A 1Z6QA 2VNAA 4G67A 3RVPA 3UUWA 3EGWA 3WWOA 2FK8A 2I4LA 3RAFC 2VKTA 2IL1A 4JOCA 2Q0SA 1MIOB 1JG3A 3B8EA 2GTIA 2CUKA 3FGZA 2OOSA 2ZJAA 3FDXA 3MOIA 4KUHA 1W4RA 5B58T 3AL2A 2GDZA 1HDOA 1R8SA 4XRGA 3PR1A 2V98A 5LQNA 1XLVA 1RFGE 4MGIR 1PL7A 2EZ8A 3NHLA 2FE4A 2XUJA 5K3BA 1OE0A 3NIGB 1VMKA 4WZBE 4XTRA 3IEUA 5GVRA 1E7WA 3EQ8A 5DHTA 3PWZA 4MPPA 3ZV6A 2ZI3A 4DZRA 1TJPB 3QX7A 5L8VA 1YB5A 4HKTA 2CXQA 1J70A 2H5IA 1XDWA 3GJQA 2BFFA 4LF7B 1SR8A 4GMDA 1PFWA 1DB3A 2DPGA 2PXXA 3TSAA 3WQRA 2FOIA 1LF0A 2ZT5A 3I58A 2MDTA 2FG6C 2O3QA 3VH1A 5JYDA 1CY4A 1QCDA 2VJQA 3R3UA 4G0UA 3FB1A 5KSZA 5BRAA 3ESXA 3MNFA 1G5PA 4MNTA 4WN9B 4FDVA 3A6GA 3MYYA 2AE2A 1QFYA 3QEOA 1FDOA 2V6BA 3K0HA 3IQZA 2Q2OA 3ET4A 3CX3A 1NJ2A 1GRCA 4WMLA 2ZLBA 2XNJA 3ZY2A 2C2OA 2PUFA 1VJCA 1C9NA 3DCJA 3ETJA 3N3BC 4I5DA 1ULBA 3MBIA 4ZVQA 3X1KA 3O4GA 3LPLA 1NUAA 3ELWA 1RAGA 4H27A 4YRLA 1U02A 5TV2A 2ZJ7A 4QUHA 4AB1A 1KJ8A 1BKDR 3K16A 5TPZA 3ZTTA 4YCLA 3DCNA 3CLRD 1G5TA 3C1TA 4B47A 3PXDA 1B3BA 4FLMA 1EAMA 2A0FA 2Q46A 4FIDA 1UEJA 4KE9A 4JZYA 3T5CA 2I0FA 1QIGA 1YDEA 1AK1A 4LECA 1QK5A 3U3XA 1EZ1A 1TZ2A 1VJ1A 3DVSX 5KHOC 1J49A 1QS0B 3CG4A 3ZDQA 4J7UA 2DHEA 2ZUDA 2MWMA 4JXXA 2IEAA 1NVMB 1T5LA 1Z62A 3D6NB 1GNTA 2XH8A 1WCWA 3A3KA 2C5GA 4Q34A 4HLNA 2NSYA 5GZ3A 5HQJA 5BSGA 4XWTA 1WDKA 4H17A 1DZIA 4CPDA 5K8UA 1GAWA 1P2BA 5JISA 3C7TA 4XFDA 3A28A 1GQQA 1KP3A 1ZK2A 1MT3A 2OGZA 3MRXA 4PV7A 4ZO6A 2VPZA 4Q66C 3PIDA 3WLAA 5KWEA 3ORQA 2QMZA 1HEIA 3ST7A 3MUFA 3CNHA 1MQSA 1YHYA 1PW5A 1DP4A 1AURA 1NYLA 2GD6A 1M1ZA 3S2SA 5FDFA 4QPCA 4B87A 2YJ6A 4JDPA 1RRPA 1NI4B 3K1AA 3LE8A 4P0TA 4ZVOA 2DCUA 3TRJA 3VR3D 3A6FA 2ASVA 3B53X 3IPCA 1ISJA 2DSNA 1G8FA 2Y68A 4E22A 3T5BA 1BQ3A 4X7PA 3QVKA 3TL2A 5I5EA 3WGGA 4JOSA 2YV1A 4QGSA 3EZXA 2XHEA 3ZGOA 4C4SA 2AEFA 2N9UA 2AFIA 3QMWA 4QOHA 5JG7A 1O5OA 2QOEA 2QX7A 5HIIA 1ID1A 4OJQA 5K3OA 3H8JA 1RC0A 1J6UA 3HB4X 3IEKA 5K3FA 4D02A 3B6IA 2IUFA 3DKVA 5JCPA 3JU3A 4JODA 3SQLA 1U2GC 2M98A 4GVLA 4PE5B 5K0GA 4BKPA 1PS0A 1ZCBA 4YT4A 1NR1A 4PYJA 1E1CB 3GPDG 3GZJA 1K5GA 2PKRA 4IGAA 1KK2A 3PP8A 4JKYA 2ORYA 4AY6A 2W8BA 3P2OA 4EY5A 2ERYA 4W9MC 1YKSA 2VF7A 4JP1A 4B8YA 2QA5A 4ZHQF 4LV8B 2AUMA 5BV7A 5DCUA 3IAAA 5IANA 1MC8A 3N75A 2B8JA 1JR2A 1MBZA 2C3MA 2KLBA 1SBHA 2P1DA 4GR4A 4ZC8A 5SICE 4QKQA 5KOIA 2D5CA 1L0BA 3MWDA 5JANA 4G0QA 3TOSA 2A0WA 1H5UA 1U2DC 1E2LA 5JAHA 2ZCJA 2UXBB 1UXOA 3V7FA 1XDGA 1QC5A 2XZOA 4MULA 5KYYA 5IJ9A 4CM1A 1OAOA 2G80A 4YASA 4DUGD 3PFHA 1KZ1A 2RH4A 3V1MA 4F7DA 4HDRA 3SZMA 3A7DA 4ZMBA 5F2OA 2JZCA 2WKRA 4RYLA 1QZZA 2OVBA 3IP1A 1W4LA 3BH7A 3E3OA 3BKXA 3C5VA 1GXSA 2PHZA 2B92A 3F9RA 3PQ4A 2HMAA 4JMLA 5J9FA 3T1HB 1UC8A 1XZJA 2FMTA 4J94A 4GBGA 4PZDA 3SICE 4PPGA 1N8SA 5LP6C 4QHYA 4BASA 3E35A 4LF5B 2LV8A 1XVTA 5LLTA 3Q4GA 4YR7A 1GDTA 6ABPA 3U4MA 3K8OE 4L15A 2FQWA 1WW2A 2FQYA 1E6CA 1WX1A 2XADA 5FWAA 3WL8A 2XUAA 5C1DA 5JZ9A 3LC2O 2R6ZA 2EP5A 1GL9B 1JJVA 1XJ5A 2BI7A 2IPOA 2JI4A 2JVKA 3NW9A 1NLFA 1WXQA 4QGFA 1W5TA 4ZEXA 4QXPA 1JS1X 3ZCXA 1M83A 4QT4A 3HXOA 4XI9A 5HPYB 1U6IA 5BWBA 1EPUA 1INLA 1T5BA 4Q16A 1YJQA 3ETEA 2QRNA 4J3FA 4PG6A 1E6WA 2WQ6A 1JLMA 1XVLA 3EN0A 4DABA 1KI9A 5KNBH 4AULA 3Q5EA 3VVCA 1X3LA 4F6LA 1RYEA 2WQZA 3I9V6 4F91B 1P1RA 2GO1A 2P2DA 1NY6A 4KZKA 1H2AS 4S1PA 1QE3A 4C3OB 4D2IA 1TK9A 3EPRA 4CQLB 1AKYA 5J4LA 1OBVA 3NAMA 4DLRA 2RHMA 5CFLA 1E1DA 2I3AA 3ABRB 3BHIA 4ZCIA 5B2EA 1TC1A 4OHPA 4YIKA 2B34A 3EWAA 4MX8A 4C6RA 5KREA 4LF8B 3M33A 5FI5A 1Q1EA 1NC1A 3SS7X 1R5BA 3RJZA 3NBFA 2ZI5A 1XXLA 2WHPB 1NATA 3HR7A 2CMGA 3HWX1 3PHBE 3FIUA 3UV7A 3A6PC 2PXHA 1N2OA 2CL0X 4ARCA 1S3SA 3JQEA 3P2JA 5KUTA 1OFUX 3C8HA 3AB7A 5EIEA 2GAJA 4FKMA 1A7AA 3LT1A 3SU8A 5ED4A 2AT1A 1Z63A 4CR6A 3AEZA 1I9GA 4IAOA 4TLEA 1AN0A 2B3DA 2EZ4A 3OPXA 4AMGA 2HADA 3D8RA 5JQGB 3OKFA 4ISBA 4HHEA 4O59O 5HJ2A 2WMNB 4LF6B 2E55A 2XTNA 1JT2A 5CJPA 4WPGA 1F20A 5TDHA 1NVBA 1BDBA 2Y4NA 4QLBA 3H4MA 4U8HA 2NU8B 4K0KB 1QWOA 4FOPA 4MRRA 1DZ3A 4I4LA 3O93A 2OWDA 2C5EA 4GW3A 3O94A 4F86A 4W5WA 3ABQB 1RKXA 4IUYA 4UHFA 3K1TA 3Q85A 4PRZA 5DX0A 4B80A 4BX2A 1V6AA 2YV3A 4DA8A 5ALIA 2XMPA 2QZPA 4ZEWA 4LXUA 1D6MA 4AWXA 1NLUA 3KKPA 5ALUA 4DY4A 5D3MA 4ZI7B 1KRXA 4KPUA 3AR8A 2DR2A 2V6MA 5SZJA 2PGOA 2GPJA 3BXEA 5AKXA 4AVYA 5TGZA 2PKCA 4RQAA 4QIHA 3OT5A 4G5QA 3PPIA 1E9BA 2BFNA 5ALPA 1ODFA 2I22A 4AO6A 1G18A 5FUXA 3SXUB 2VJCA 5DMHA 2F8SA 2DTEA 4D8XA 2VP3A 2GHRA 5IAEA 3TSZA 4GE0A 3CIFA 3ZXXA 1SXQA 2BSQA 2P9GA 1OQAA 1A50B 1TLFA 4NZZA 2BFDA 3HA2A 4EABA 3P2IA 2BR4A 5AVWA 2PG3A 1WF6A 2WILA 2IHUA 2ZRLA 3TN7A 2J32A 1YBVA 2EX1A 4K8RB 4WK6A 3T3MB 1NJFA 2WW8A 3JARA 4GWGA 1JZQA 2IXTA 4O3MA 1C3LA 1SA0A 4YBZA 1RTKA 1LWOA 2P9YA 1L7OA 4IL5A 3S7TA 3ZLTA 1BMFD 1NTRA 3UAVA 2E87A 3GROA 4Y2RA 4OSPA 3M34A 2P6NA 3K0CA 4FEAA 1T8WA 4EG7A 1YRWA 5EJMA 3JD3A 4B3HA 3Q0TA 1HWYA 4HZUB 4UQLA 3GJ6A 1D4FA 2H16A 1U6JA 3DUWA 1L4MA 1T4CA 3KTDA 3P2KA 3SM3A 3KQVA 4ZT6A 1Y3CE 2YZMA 5IK2A 3R9XB 4WK0B 1P1HA 3UOWA 3AI2A 1I7SB 4XPIA 1TA9A 1ZCAA 2QRQA 4LNUB 1L5WA 2V4MA 2GPWA 2IDJA 4NCNA 1Z28A 3E23A 3HGMA 3OE1A 5FI3A 4YCBA 4Q15A 1Z9BA 3GN1A 3MGKA 3ZCVA 1OX4A 1VIAA 1R0XA 4IDFA 3UGKA 1XTIA 3SHWA 4EK9A 4OQNA 2XZDA 4DIUA 4M36A 2Q3HA 5CFQA 1FPMA 3CXRA 1DRWA 3ZBQA 1JQ3A 2WG0A 3NDBB 4BO8A 1P45A 4CUJA 2CWWA 1AUPA 3HU5A 3F9IA 4CTJA 1P8AA 3ZE9A 1WKCA 1G2OA 1S4MA 3L01A 1JGTA 2EKDA 2QZ9A 1B00A 3B48A 1NAHA 3W2TA 3IUMA 2IX3A 1WZIA 4P4LA 3NOQA 3T7CA 5AQ1A 1QHIA 3WAGA 2XEDA 4A4DA 2H52A 3BXPA 1L6RA 4C07A 1BWRA 2QTBA 4U6NA 2JZOA 2UZIR 5ADUS 4RVCA 4UU1A 4UHCA 4KWCA 4XIYA 4EGSA 4QEKA 5DM1A 3KDPA 1COWA 2FZCA 4CM3A 3TD9A 4FINA 1ZNZA 2MSLA 5FLYA 3SS8A 5JJCA 1GQFA 3I1IA 2R6GA 4QAJA 5I9NA 1QYWA 1K86A 5BORA 2BONA 3BWBA 1WPQA 1JBQA 1YIDA 2BFPA 2PJZA 5T3UA 3WG9A 3O21A 4COOA 4LJ6A 2GASA 5YASA 2Z30A 1RCTE 1RC8A 1YTLA 1DHRA 2FN8A 3JRXA 3KALA 4BMXA 4MUIA 4LHVA 4DJEC 3Q8XB 1TM1E 3K0CC 4M21A 4WEQA 1PL0A 2I3DA 2Q1TA 3P0HA 3HFJA 2EJCA 5I9IA 3ICPA 1VMIA 3SQMA 4LTDA 2ZVDA 4LHEA 1ZWKA 1FTSA 2H2WA 3HQ4O 3QVXA 4N54A 4NNJA 4NS4A 2QX6A 3NTVA 5ALFA 5EKXA 4MB6A 3TG8A 1MJHA 4OOFA 2GXQA 5KOHB 4YXWD 2QTGA 2VXOA 3FVTA 1QC5B 1W85A 1XK7A 3LX5A 5EXEA 4YAGA 4I5GA 4B44A 1NW3A 4R1LA 2GFIA 1AC5A 1X86B 2FDRA 2ZI7A 4KP7A 4DTCA 3RUCA 2XXAB 2XB8A 1GLGA 4E13A 4Z1OA 1R88A 1PLLA 3GEPA 3DTVA 2R8EA 4GYKA 5A9TA 4OAQA 2CLKB 5FBZA 5ALNA 1JTVA 3FTQA 3GJ7A 4OCZA 4FEYA 4TXJA 2FW1A 1XQVA 3PGXA 3V9AA 5AKIA 1VKHA 2AD1A 1DKRA 1NM5A 1WPXA 2QRLA 2YWEA 1QOQB 2CVQA 1FLNA 2NTJA 2XYVA 3DT6A 3GRAA 3T7IA 4D9CA 3TZCA 3RS3A 1LB1B 1K89A 2P4UA 2C3YA 3V7UA 3R7BA 3MMPA 1NFRA 3QKRA 5C1OA 5LVAA 5M2QA 2PZKA 4E2FA 1ADBA 2J9XB 5EWMB 1S89A 3KOMA 4ZCLA 1V47A 5ALJA 4H1HA 2I4TA 5IULC 1ZSNA 1UXHA 3A0RB 3PFKA 3S68A 4DSAA 4M53A 2OFWA 4RD4A 1L8QA 2VP9A 1JHYA 4H4EA 3NPAA 5NLLA 2AJBA 3SDSA 1IQPA 2OLJA 1YB4A 1FW6A 1VPDA 1LWNA 1P4SA 1PV1A 1S1MA 1Z6TA 2EV9A 2BISA 1IXZA 3HVRA 1G98A 4ZGWA 2IS6A 4IG9A 3M4XA 2KW5A 3EIUA 3FCYA 3ZS8A 4JNKA 3DEZA 4F5YA 1JG2A 5KYUB 1DO8A 2R47A 2WD7B 3KFXA 3DFKA 4KRYA 1PZMA 1GL6A 1VB5A 4EGCB 5A02A 4IFBA 1H0SA 5TGDA 1PGPA 5TT1A 2I99A 4A91A 3E4CA 3AY7A 5DI3A 2G25A 3ZLVA 5ADVA 4IMPA 4TQAA 4ZZIA 3HACA 4KQWA 4I3GA 1HGXA 1HRDA 5F3RA 3GVCA 5HCUA 2Q8PA 2W42A 1B0ZA 4HRAA 2WOJA 1PDOA 2HLPA 3MTAA 1QFXA 4YI5A 1VSTA 3TCXB 1FW8A 3GRYA 3PGA1 2WSYB 3ANMA 3QFTA 2I66A 4OJMX 3QF4B 1SCUB 1Z15A 3K0EA 1JN0A 1XL1A 3V1LA 2JFZA 4QM6A 3CZQA 5KPDA 1SB9A 2O1SA 2XUZA 5I8WA 1N7GA 3ETCA 5A7HA 1YZ3A 2H0AA 2X0KA 4CMIB 3MJFA 5FL7A 1QCYA 3UMRA 1DVRA 3Q9SA 3DMTC 2PS1A 4J6EA 5FBLB 5A6SB 5CPBA 4ENUA 3VHXA 5K0JA 1KI6B 3FVWA 5LQSA 3MT0A 1G6Q1 3AW8A 3HZZA 1KPGA 2EDAA 3W5VA 1RQNA 1RE1A 3PGJA 2XOKD 2ZREA 1CY6A 3QLJA 1LPNA 3W6ZA 4ADSG 4KO4S 4I99A 3ZHSA 2BEKA 3D6HA 3WQBA 5LXTB 2Z95A 1NRXA 4C3UA 8GPBA 5BRJA 2GPYA 1FXWF 2IUYA 2JGMA 3RUIA 1Q74A 5E7QA 4M8SA 4ZT4A 4GSLA 1SCNE 1IZ9A 2ACKA 4R5MA 3VPSA 3D1LA 4IW3B 1NC3A 3DE2X 4L4YA 3BK2A 4FFLA 3AM3A 1VE3A 4XVQA 2XRYA 4MUXA 3U5TA 4W5NA 3UQZA 2LXNA 3WQSB 3IOEA 3LV8A 4FBLA 4DB2A 1HDYA 4IX1A 5AOCA 2BFFB 4K7JA 3FWPA 2QYSA 1OFHA 1OIVA 3HSYA 2DQSA 4OD0A 3T9FA 2I7XA 1RM0A 2VVTA 2WM2A 4BRWA 4C1BA 4C0JA 3P9CA 2JAWA 2RHCA 3P0EA 4HUQB 5B3AA 1RRKA 5EJAA 3H5AA 2PT5A 4BRUA 1Q50A 3HNOA 3Q3CA 1DKUA 4LDNA 3CUSA 2H08A 2RGDA 3ILYA 1IM5A 5FNZA 3W2HA 3E8MA 4C04A 1W36B 3UWOA 4XGKA 5BUZA 4KHZA 1FXWA 2GAIA 2XBLA 4CEHA 3EDRA 1NF3A 3VR4D 1F38A 2PBZA 3GELA 5ALHA 1OREA 3WWPA 3I5AA 3WICA 4FP9A 2GHTA 4PICA 1C3EA 3RSLA 1C7QA 2WWXA 3LP8A 4BU1A 1DL5A 2IF2A 2RKOA 4GX5A 4IH1A 5DHRA 4JGBA 2HMYB 4CKYA 3NX4A 5TF4A 4MRVA 4WFJA 1UDCA 4DIDA 2C7RA 1KQPA 2CSXA 4M0FA 3JASB 4GICA 5REQB 4X8LA 1G3QA 2PN1A 1U2TA 1DARA 2VNKA 3H0CA 4FBMA 4ENRA 3IKTA 2OM2A 4PNEA 4GMFA 2AC2A 3LWDA 1UDBA 5EKUA 4RPHA 3H42B 4DWWA 2I3BA 1TEVA 1ZK4A 2QD1A 3BAFA 4MP6A 1AS0A 2NXCA 2H1CA 2ZRAA 3PFIA 2C4WA 4E07A 9ABPA 4L08A 3GDFA 5E2BA 1J5PA 4QQ8A 4EG6A 1B6TA 4P80A 3SFVA 5C31A 4EI7A 3T9DA 2ECPA 3R4VA 4YP9A 4BO6A 1CQJA 3B60A 1ODJA 4NBRA 1E5TA 3I4FA 1AG9A 2HCTA 4I1RA 3R7LA 5AUOB 3C5EA 3H7IA 1JX6A 4UATA 4HQKA 1TEHA 2F43B 3GDHA 4LJKA 1SWVA 3I9LA 1RWMA 1P5FA 2DUWA 1L7AA 2NWQA 3G6WA 2Q5JA 3VR4H 5JSQA 4TMVA 4QBKA 1M2NA 2YZGA 1MOZA 4JI2B 4HCJA 2P4EA 2I1LA 2J5KA 4XX0A 5CNJA 3HP7A 2FFAA 2FP4A 2JHCA 5JXWA 1QP7A 1W4CA 5AJUA 2FJUA 5TJ9A 4BMYA 5JROA 1JXMA 2R7LA 2PS3A 4DCGA 2QEQA 3K9BA 3AI7A 4K9OA 3H65A 3O6VA 2V7GA 3T94A 3GP8A 2V96A 2NLOA 1NPDA 2G77B 4U7GA 1ENPA 5IVIA 2FSUA 2C4UA 3KTFA 1ACJA 1JE1A 3CW9A 3ZZTA 4YCMA 1G8KA 3D0RA 3O26A 2QBYA 1Z5UA 4JWKA 2ATCA 2IHTA 4NJEB 4DSNA 1Y9AA 3WAKA 2ZPUA 1XI2A 1TK3A 1JAIA 3PE6A 4LX8A 4QQRA 2IDKA 3L1UA 5IEJA 3E9EA 1J39A 4PFSA 2BBWA 4RSHA 1AKRA 5H5JA 4EJSC 1Z7BA 3DE6X 3HDVA 3RKRA 2QR5A 3A6KA 4BQSA 2ADFA 5AVXA 1V5FA 4XEHA 3IAM1 4F4UA 4YIHA 2ZQZA 5AHXA 1DG3A 1GCOA 1S7CA 1ZUNB 1DRUA 1XYGA 2Q5EA 3LQYA 4QTUB 2ZWPA 3R41A 3ZJ5A 1CY1A 4A0HA 5SZKB 5CM9C 1X13A 4XYLA 2YYSA 3L6RA 1FDVA 3PC8A 4UBMA 2G09A 2WJZB 3PUZA 3STTA 1SBIA 3AIMA 2J59A 4P3XA 1DE0A 1RS0A 3T1VA 4OQ4A 2Z2YA 3ADPA 2AZDA 1J23A 2J4CA 2YOGA 4GMHA 2GN9A 4HXGA 2GDJA 4NCIA 1NNSA 5FFMA 3T3GA 4NYIQ 4YV0A 1TA0A 2V9CA 3KSMA 3T54A 2IV7A 3P9ZA 1ZK3A 4X45A 2WTEA 3OPQA 3FY4A 3N70A 4GP6A 3AR9A 4I4TA 2OGSA 2QN3A 2WTBA 1E2MA 1JBKA