1NKSA

Adenylate kinase from sulfolobus acidocaldarius
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
b'MKIGIVTGIPGVGKSTVLAKVKEILDNQGINNKIINYGDFMLATALKLGYAKDRDEMRKLSVEKQKKLQIDAAKGIAEEARAGGEGYLFIDTHAVIRTPSGYLPGLPSYVITEINPSVIFLLEADPKIILSRQKRDTTRNRNDYSDESVILETINFARYAATASAVLAGSTVKVIVNVEGDPSIAANEIIRSMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE
molecule tags Kinase
source organism Sulfolobus acidocaldarius
publication title The structure of a trimeric archaeal adenylate kinase.
pubmed doi rcsb
total genus 64
structure length 194
sequence length 194
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1998-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13207 AAA_17 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nksA00
3P27A 1WBBA 4IEIA 1M1YE 3NG1A 3Q5DA 4XWOA 1XEWY 5KNCA 1KYIA 2WPDA 3EWSA 4HB2A 4M1MA 4FMCB 1W0JD 4JMPA 2F3RA 2GEUA 1E0JA 4CEIB 4A6PA 3ZS9A 1G6OA 2ZU0C 2VF7A 3ZVRA 3A58B 5GADl 4Q03A 3DO6A 2QA5A 3C7KA 3QUSA 4NHOA 3NH9A 3VHLB 3GLIB 2GBLA 2C2HA 1JEEA 3WY9A 1KNXA 2HUPA 3F0TA 1S9DA 4TYYA 1VCMA 4MRPA 1PUIA 4OI4A 4JBWA 3E1SA 3RABA 3EC2A 4KXFB 1U0HC 4S35A 2ZTSA 2QP4A 2J0UB 3M6AA 4MGYR 2WWXA 4YXWA 2AXPA 5AUOB 1MRNA 2D4HA 4IOLA 4B6EA 1A7JA 2V9PA 1Z0KA 5DHAA 3GD7A 3X1DA 4OHYA 1S3SA 4QBFA 2RAPA 2IYSA 4NYMQ 4TYNA 1RZ3A 4BRWA 2BEKA 1SVOA 2HXYA 2QSZA 2QPTA 3B1ZA 4FCTA 5F9FA 2YC4C 4E22A 2FSIA 2N42A 3AVOA 5L3QB 4A8JC 1TL7C 5HE8A 3RRNA 4KFSA 3DKPA 1GVNB 1NBMD 2B92A 4UXHA 3TVTA 1P2SA 2OAQ1 1VHLA 3OIYA 1W2GA 5CJPA 5AR1A 3NHBA 3KQNA 1GWNA 2Z83A 2Z0MA 4Z54A 2PMDA 4UXJA 4KITB 3QPVA 4QNRA 3HJNA 1S8FA 2X2FA 3BB1A 4V0LA 1F2TB 4M9QA 3UPUA 2D06A 4AYXA 2VSFA 3CZPA 1XXHA 1AZSC 2R65A 4IVRA 1DS6A 1WF3A 2HT6A 2QE7D 4FXPA 1IJEA 3HYRA 1N5LA 4IVPA 1G20E 5FBWB 1Z6TA 3A4NA 4DDUA 1C1YA 4PC1A 4PXAA 4DKXA 2PJRA 1JPJA 1T0JB 2F6RA 4N0DA 1C4OA 1YVDA 3RS3A 1PVOA 3PXGA 2R9VA 1XZQA 2QNRA 4NPHA 4RVCA 3Q72A 3I61A 4XWAA 3R7WA 3Q9LA 2FFQA 1XMJA 1ZM2A 1S3GA 4EFNA 3EPJA 3AP2A 2B7CA 2Z4SA 3MRSA 4TTQA 2KBFA 1IXSB 1NY6A 2GVZC 3IBGA 3EZFA 1TUIA 2OLJA 3AF3A 1IXZA 3MWYW 3TLXA 2QL6A 1XZPA 3KQHA 4EPWA 4JL8A 2O8DB 3GFOA 3WNDA 1QZXA 3O8BA 3A4LA 4TL8A 1XEXB 2K5UA 1CJMA 2VTKA 1SXJA 1ODFA 2MSCB 2ZYTX 3CRRA 3VKHA 1G9XA 2QAGC 4HZUA 4A0RA 1E9SA 2BMDA 1KK1A 1EFUA 2JATA 1E9CA 1FNMA 2CMKA 1XTKA 1E32A 1G3UA 3QOFA 4JKYA 2ZI7A 2D74A 1TF5A 3AQ4A 3SEAA 3V9PA 3ZDQA 2FA9A 1C9KA 2QUZA 4YMWA 1UKEA 3W34A 2CL6X 3NBXX 2V6IA 3W9YA 2OO7A 1E2KA 2GA8A 1DAMA 2NGRA 1QHIA 2Q3HA 3VKWA 2PT5A 1LB1B 2H5EA 3QVVA 3NH6A 2AK2A 2JLRA 5DISB 1D6JA 3BC1A 1IY2A 2HCJB 1X1RA 1NIPA 5JRZA 4ARZB 3WNBA 3JVUA 5HZHA 1G16A 3F3YA 4BFXA 4KVGA 2NMVA 2XNSA 3RC8A 1YE8A 2OSBA 1ZBDA 3O8CA 1OIVA 2YOFA 2WSMA 1G7SA 3BD9A 3PUVA 4G5RA 5FOUA 4LV5B 2NO6A 3CX8A 3MD0A 4I4LA 3CPEA 1CRPA 2GBLC 1OLOA 1AGRA 1N6RA 2RH5A 4OQFA 4TZ6A 4XJXA 1R8SA 3EWAA 3W6PA 2FGJA 1W0KA 2HJGA 1QHHB 1W4CA 2OFXA 3GJ6A 1T91A 4TL7A 3GJ3A 3GPLA 4U7DA 4U00A 5EQTA 3AEZA 3K9LA 1GNPA 2B21A 2P65A 2NPIA 4Q02A 4Q4HB 4CEJA 1KTVA 3HPQA 4M1WA 4C30A 821PA 2MSDB 4QHTA 1FX0B 2NO9A 4AKHA 1SZPA 3VR4A 1F2UB 1W4BA 3LRPA 3RSLA 1AKYA 1T3LA 1YRAA 3FFBA 1LW7A 1XU4A 3G5UA 1KIMA 1F6BA 4RKFA 1OJLA 1XBTA 1N6LA 3TSZA 1OHHD 2XB4A 4OQNA 3WRYC 3H1TA 2F43A 4KCGA 1JAIA 1T0HB 1F2TA 4HSEA 5FTMA 2ZR7A 3IBYA 3K9HA 4GNKA 1GFIA 2A5JA 1HEIA 2PMKA 3BOSA 3DOFA 2VEDA 5CLQA 4R9UC 1X6VA 1GZSA 1FTNA 3KJGA 3OAAA 2W2TA 2L0XA 2XTNA 2CHGA 3W3AA 1CTQA 3BS4A 2HV8A 2OT3B 1VYTA 5LD2C 4Q1BA 4U02A 1OV4A 5TDHA 3R20A 2WAYA 1KZ7B 2YWHA 4L4UA 1AS0A 4PO9A 3SE0A 1H8HD 4I1UA 2GNOA 4FD2A 4DZZA 5KYKA 1UDXA 3X1WA 3EC1A 2OCYC 2XTZA 3MGCA 1E6CA 3B85A 3ZS8A 2CCJA 2C03A 1E98A 2FFHA 4WVFA 1SKQA 1Z2AA 2G3YA 4LRWA 1JALA 2JIZD 4NYIR 4URUR 3THXB 2WWIA 4NP6A 1GNRA 1KKMA 1WQ1R 3FGNA 2Q9AA 3AKCA 4IOJA 4IOKA 1R8QA 3CB4A 4YMVA 1T3SA 3GFPA 3GLIE 3OFNA 1D9ZA 1YZUA 2ZITA 1XTJA 4KAXA 1WA5A 3QF7A 1KK3A 2G1KA 2XNDD 2EWWA 4OHWA 4PO8A 2V6JA 3BFKA 1BKDR 2IS1A 2R6AA 4TL6A 1E3MA 1H65A 1US8A 2F1IA 2Z6VA 1JI0A 1E9AA 2BC9A 1MKYA 2PL3A 3K1JA 4BZQA 1EXMA 4XIGS 2AL7A 2XB2A 3PVSA 5FI0B 3LBIA 1SXJE 2OXRA 2O0KA 1XEXA 1JB1A 1XRJA 3K0AA 4R7ZA 3ADBA 1W36B 3NBFA 4A2QA 4DLWA 1WXQA 3EX7C 1KJYA 4M21A 2FSHA 1XJ0A 3CRQA 4TYWA 2VHTA 3L0SA 2J5XA 5KPJA 4PZLA 2C98A 3I32A 4IRUB 1TQDA 4V0KA 1AS2A 2AD5A 1U81A 1L4YA 2BM1A 5JHGB 3CLVA 3K0FA 3T1TA 1QRAA 2VP2A 2G6BA 1UDWA 2FPMA 2VL7A 2XTMA 4J0QA 5DIFA 1Q1EA 1IJFA 1AIPA 2ONJA 1COWD 3TMKA 3GLGE 1Z0AA 4A4DA 3D6TB 2YWEA 2YHSA 4D26A 4AC9A 4A0HA 3LV8A 4ARZA 1MABA 5UKDA 4Q4JA 3KKOA 1JQLB 1XTRA 1GDDA 4ZO4A 1MO4A 1G3MA 3I5XA 3TVDA 1YR7A 3UMSA 5EP1A 5KPDA 2JLVA 2WMOB 4Q01A 2J0SA 2QAGA 5JEDA 3FE2A 2IWHA 1Q12A 4Q9LA 1UKYA 4ZCMA 5TB5A 4NYIQ 3SS8A 1P2VA 1Q1BA 1XEFA 1W46A 5DYIA 1RRFA 4BECA 1Z3IX 1OXTA 4L9WA 2J7KA 1GUAA 2RGBA 4JYCA 1E2JA 2HEIA 2OXCA 3B82A 3TQCA 2ZRHA 2J41A 4MRVA 4NYMR 4FWIB 3CRMA 2QTVB 5KOYA 2DFTA 1OSNA 4PTLA 1FNNA 5DE3A 4CVNA 1BYIA 2YJTD 3I3SR 4GP7A 1WP9A 4Q66C 3VR6A 3H86A 1PLJA 4PPQA 3R8CA 1O3YA 1Q20A 3L0PA 4O0MA 4DDTA 4JVNA 4LBZA 2IS6A 2BV3A 2WZQA 2GTPA 1E9BA 1XPUA 1EGAA 4C7OA 1TQ6A 4KFUA 3MUFA 1RW4A 4DLSA 4W9MC 2J9RA 1SHZA 4AIIA 3M1IA 2IYVA 1Z6XA 1IY1A 1ZUHA 2ZJ5A 4A0GA 1U99A 4KYUA 3TE6A 2X2EA 3K0CC 1OH7A 1OFIA 1E9FA 1F3OA 2XAUA 1U8ZA 1VCNA 2NO0A 2WKQA 3A4MA 5FOSA 1E79A 3LDAA 4Q1EA 1U90A 2QTHA 2VQSA 2ZRGA 3OEED 1AN0A 2C8VA 4GRAA 1YR6A 3NHAA 4HI0E 5CDFE 1XEWX 3D3QA 5FPSA 2DHRA 1FQKA 4Z8XA 1ZM7A 3N5CA 3Q85A 3RHFA 1P6XA 4X8OA 1U8AA 1Q0UA 4BFTA 4DCTA 4PC3A 4PC6A 2QORA 4EUNA 3RS4A 4ERNA 1NSTA 2ODNA 2OG2A 1II0A 1Q22A 3RVBA 3QXHA 4IXNA 4PQRA 2C9CA 3VR2A 2IS4A 3CRVA 5F2EA 1QVAA 1QHHA 1Z6AA 1SVMA 2REOA 2W83A 4RZUA 1K8RA 3TAUA 4B71A 3W6OA 3VU9A 2YOGA 3QXCA 4Q9IA 5CJ2A 5F9HA 4Q4JB 3Q8XB 4M9XA 4MRNA 4RSGA 3THWA 1E4VA 4X8MA 3NC0C 1W7AA 3VR1A 2QMOA 4FCVA 4H1UA 5EXPA 1P73A 1SVWA 3VX4A 5IT5A 4BFYA 4N0EA 2B7BA 4C0BA 2J46A 2CL0X 4UJ3A 2HYIC 1W48A 4CRWB 4MGKR 1W2HA 1RRCA 1T8UA 3HP1A 3M4YA 3N2IA 4DJTA 1QBKC 1GSIA 1ZCAA 2QGNA 2ZU6A 4QNMA 4M9SA 3WNCA 2VP0A 2YWGA 3X1ZA 2JLQA 4PPGA 2VA8A 1DBSA 2XJ9A 1G3RA 4RJLA 3H0KA 3FKSA 3AKEA 3RRZA 4AURA 3IO3A 2Y8EA 2ZREA 5CM8B 4Q4HA 1K6MA 1KDPA 1SVIA 3CONA 3K9GA 3ND9A 2H18A 1ELOA 1K5DA 1ZYUA 1M8PA 4NYJR 4MYCA 3U3MA 4A0FA 4AD8A 4LYFA 4HUTA 3NTUA 4HAXA 1W4AA 1V5WA 1U0LA 1NRJB 3SR0A 2OFOA 3EPKA 2OHFA 4GZMA 5DI3A 3PQCA 4E5UA 4YMUA 1BS1A 3LO5A 3LLMA 3VNVA 2G0NA 5FOVA 3K0SA 3OE7A 4DLXA 3TUJC 1S4QA 1HT1E 3IPYA 1W47A 1DG1G 2G1JA 5E4FA 5JSZA 4W5HA 2VHJA 1AK2A 3DDCA 1NBMA 1RJ9B 3KB1A 4JL6A 1E2IA 3VAAA 2IBMA 4AY2A 5KNDA 4P32A 4ASUD 1UBEA 3EIEA 4HLQB 3PUYA 4LYHA 4EIWA 1A1VA 3SJAA 1E2FA 1CJUC 4QOSA 2HCBA 4B76A 1CXZA 1DARA 3TJZA 2VSXA 5HE9A 3RDPA 1GL7A 1H8ED 3I72A 2NO1A 1XF9A 4DBLC 2O5VA 1DAHA 2H7VA 3HU3A 1U98A 2ZRNA 4B6FA 2ZS9A 4C3ZA 2KI5A 2RGDA 1COWA 3OZXA 1ZW6A 3RRMA 2QMEA 3O8RA 4A8JA 3GLHA 4I1OA 3X2SA 3T34A 1VYVA 4D0LB 1IY0A 3PCRB 4DLYA 5GJCA 1SXJB 3U7GA 4K8OA 4PSKA 1JQJC 2BM0A 3C41J 4G1UC 1G17A 2ZE5A 4HB3A 4HYYA 5JS8A 3AP3A 1YKSA 3A8TA 1VG0B 3EIHA 4LGMA 1ZM9A 4C7OB 2C5LA 4M22A 1IXRC 1LVGA 2VHCA 1W5SA 3OFND 2P2LA 2EVWX 2FF7A 4C0LA 4AG5A 1VPLA 1SVKA 1N25A 1U2RA 1FQJA 3VNUA 2FJUA 1ZNZA 1DO0A 2B8WA 2JJ8A 3A1TA 2BJVA 2EYUA 3KKNA 4CYMA 4EFLA 3ZLJA 4Q1DA 5AJWA 1PV4A 4DB4A 2GZAA 3ZJYA 5HKKD 2ZYVX 4JLVA 4NCNA 1N0UA 3QPUA 2CHVA 5AUNB 1IQPA 1H8HA 2RGGA 1P9NA 4RD1A 4NL4H 1Q3TA 4MYHA 3VTKA 2JIZA 4JVSB 3GLFA 1MH1A 3U3RA 3CR8A 5FL3A 2ZXUA 2IYXA 1DAGA 2ORIA 1KK2A 4EPVA 2JA1A 2P5TB 2WWFA 1G8YA 4UKDA 4C0KA 1D2MA 2HT1A 4PR0A 3SHWA 2ZRIA 1T5LA 3BIFA 1MV5A 2QTFA 2W0SA 4CEJB 4PSVA 1PZNA 2Q9CA 3AF1A 5EE5B 1RPZA 5C4GB 1M6NA 3KJEA 2O8EA 3N70A 1EESA 3C16C 5CDFA 3ICQB 1FX0A 2GEDA 1GTVA 4UQOA 1LF0A 1A2KC 1P9WA 621PA 5FR2A 1WE2A 2N46A 4NH0A 3UXMA 3R9XA 4DUGD 1Z22A 5JJKA 3ZIAD 5E7JA 3EAQA 3PFIA 1IN4A 1ZD1A 2ZRKA 4LBVA 3KX2A 1BOFA 4JIMA 2QZ4A 3IDQA 1FTSA 3FHOA 2CEAA 3KQUA 2ZYUX 2AWNA 4Q9JA 4O2RA 2FNAA 5CYOA 3AVWA 3BAFA 5BN3A 4RZXA 1N0VC 4FMDF 1G19A 2ZI3A 4K46A 4TQAA 1LS6A 4B2PA 3O47A 1NLFA 1J2JA 3THYB 4Q9HA 1CEEA 2VRWA 4Q4AA 2OCBA 2WSSA 1ZD9A 1IONA 2QG6A 4BLSA 4DSNA 1E69A 4DWJA 3QG1A 4XSGA 2OUKA 1Z07A 4ZI3A 1KGDA 2ZRAA 3RYTC 4PQFA 2DPXA 3LH5A 2KB0A 3NKVA 4GPTA 4KO8A 3FHCB 5JJLA 4QKQA 3NDBB 3CKLA 3DPUA 3QEJA 1KI6A 1UEIA 1ZC3A 5B64A 3OE7D 3IHLA 4OK6A 2RHMA 4KVAA 2I1QA 1N6NA 2ZSBA 3U7HB 3OIVA 2FWRA 3AVYA 1CJTC 1RIFA 4MKHA 221PA 3GEEA 1OXUA 1R7RA 2BBSA 4BASA 3P20A 1RVDA 1HQYE 2I3BA 5D3MA 1E0SA 1ZCBA 2AD1A 2Z43A 4MDFA 2PLFA 1RRGA 2ZM5A 1AM4D 3FKSD 4MA4A 3QKRA 1ZNXA 4G5SA 5DN6A 5IK2A 1L2TA 1SXJD 1RE0A 5FBLB 4JBYA 2FZLA 2JEOA 4TMWA 2JDIA 3IQWA 1JR6A 1UJ2A 1NN1A 1W36D 2QT0A 3PR1A 4RD3A 1FPMA 1QF9A 4P33A 2AKYA 1HV8A 4A1FA 3KJIA 4C0JA 2ZJ2A 4FIDA 2QT1A 2W0MA 1N6PA 1ZRHA 2BOVA 1G6HA 2ZJAA 5EXSA 3IHWA 3NEJA 1E9EA 2O0HA 3SJBA 4BRUA 3SQWA 5FUXA 4BLTA 2CCGA 3MMPA 3PEYA 5F3WB 1LV7A 4DEXA 2VIIA 3KKPA 3I62A 1E9DA 3EARA 1XMVA 1KDRA 3VKGA 4EFMA 2JJ1D 3RC3A 3WMEA 4P31A 1BYUA 3B6EA 2QAGB 3P4XA 1G5PA 2DFNA 1NNEA 4M0LA 4MUAA 3NBYC 2AFHE 4OHZA 2NTYC 1TPZA 1XPOA 2FMXA 2XGJA 4KFRA 4TMXA 1AGPA 1P3JA 2QSYA 1JJVA 3T61A 1ANKA 4HDOB 8OHMA 4WXRA 4LJAA 4HAYA 1J90A 4Q4AB 4DUGA 4E09A 3C4JA 5DN6D 1R5OA 4GSYA 1UAAA 3ADDA 1GITA 2W6ID 1P2UA 4KBFA 3ZGXA 4FINA 3CNLA 2REXB 1TEXA 1JR3D 4ILEA 1YZLA 2PZGA 1VG9B 1XJQA 2YNMA 2QQ0A 2VBCA 1XD2B 4Q7LA 1JXOA 1NVXQ 2QM7A 5SZJA 2JLYA 1HE1C 5EP3A 421PA 4QHYA 5CK4A 1KJZA 1ZU4A 4BEBA 2O52A 1TQ4A 3ZH9B 1E1RA 4HB0A 4NONA 1YZNA 1TX4B 1UPTA 2J0VA 5J4YA 1CP2A 4W5WA 5KTYA 4Q18A 2DY1A 2WVJA 1X8JA 3KZ1E 2PX0A 3T06B 3C5HA 3QKSA 1GAJA 2IYLD 3SDZA 4TYPA 4ZDWA 5EZ6B 3GJXC 3QKTA 1Q44A 3TIFA 5TV2A 2WWGA 4G0NA 2AX4A 2CNWD 4TYQA 1RRPA 1D5CA 4MGZR 4QM7A 1DE0A 1I2MA 3ONWA 4LJ7A 2G88A 4Q1FA 1UEJA 2Q0HA 3TSOA 1W5TA 4AWXA 2WMNB 4URZR 1JAHA 4A82A 3PV0A 1SVSA 4EPXA 1WDTA 3EW9A 4KHZA 5KHOC 3REFA 2DCUA 5E95A 3X1XA 2O8CB 2W2XA 1BIFA 2IEYA 4QGGA 1J7KA 5HR5A 3QY0A 3C14C 3EPLA 2QPOA 4MYTA 2IWRA 1AQYA 3WXMA 4OJKA 1JJ7A 1KI3A 4LZZA 4MKFA 4OI1A 4B34A 4A36A 2C78A 1KY2A 1N5KA 1P7CA 1PLLA 1YU9A 4POAA 3BJIC 3VQTA 3PUWA 2ZEJA 2ZI5A 3NC1C 4QM6A 2WJVA 1XXHE 1IN6A 4XSHA 1GL9B 5KNBA 3TRFA 2VPPA 4HDQB 1A82A 4DVGA 1ETUA 2JJ2D 4N3NA 4BLPA 4DSOA 5L3VA 3S1AA 1Z8FA 1OH6A 1SVLA 1FL9A 2ZRPA 2WJJA 1D2EA 3QXJA 4XVRA 4TMVA 1HY3A 4R98A 3BH6A 1CR2A 1F60A 2ATVA 4ASUA 4CZ2A 3RANA 2CJWB 2XZLA 4YDSA 4IW3B 4MYUA 2D7DA 2OBMA 4DT1B 1ZIOA 5J40A 4JLOA 1KMHA 1NLZA 2IYRA 1RFLA 4Q5IA 3EZ6A 5EXXA 1WBDA 2AFIE 5H70A 4R71A 4ZDKA 2OESA 1G8HA 3TBKA 4CGZA 1E2MA 2SHKA 2H16A 1XWIA 1XXHB 3GQBA 4GI7A 4PHHA 3FB4A 1AA9A 3IIKA 4LC0A 2QMHA 4NCHA 4UXIA 4YC7A 1NN3A 3MJHA 1KI7A 2BDTA 2P6NA 4LSGA 1KSGA 5K8LA 1YZKA 4EJSA 2J3EA 4YLGA 4OKSA 3W5IA 3PIRA 2YYZA 1FUKA 1T5IA 4JZKA 3LQRA 4V02A 5ELXA 3AGPA 3LA6A 4I81A 4Q1CA 5H1YA 1NP6A 2G9NA 2EQBA 1N6IA 3KTAA 2IYWA 1XD9A 4M8NE 4GT1A 4PO1A 3ZVNA 3WYFA 3D8BA 3PEWA 3OHMA 2MMGA 3WRXC 5FPYA 4NTZA 3RWMB 3SI7A 1G21E 3CX6A 3T5DA 1R0WA 3IUYA 3HU2A 3E5HA 2J87A 3H4MA 1KI1A 2H92A 1NG1A 2YZ2A 1R4AA 2RGNA 4O3MA 1GOTA 1OKKA 4NCIA 5G41A 2O8BA 2ZETA 1P60A 2OEPA 5EE3A 5JZVA 2A3RA 3E70C 1P72A 3E2IA 1IOZA 4F92B 5AJZA 5JHHB 1KKLA 1XTQA 1E79D 3SQXA 2QM8A 1N6OA 2IYQA 3SFVA 1QG4A 4KJZA 2PZFA 5JBQA 4QGAA 4QG7A 3P1JA 2ZVQX 2QPAA 1II8B 3IPXA 1IHUA 1Z2CA 4Q7MB 4LUCA 4OBEA 5F98A 3RRYA 1AJEA 1IAQA 4P4SB 4XD7A 3VU9B 1N0WA 1NKSA 3LD9A 2E1RA 4AG6A 4D25A 3LAWA 3THWB 3AP1A 1KAGA 1RYHA 4Y0VA 4JVMA 5D3MB 4DHEA 1CRQA 5CB6A 3EASA 4B74A 3A1VA 3MWKA 1KHTA 2F9LA 3K09C 2DYKA 2D62A 2OFWA 2I1VB 1KOFA 3HU1A 4TLCA 1Q57A 4US0R 2QI9C 2C9OA 1XNJA 2ATXA 3U3JA 2PT7A 1G64A 2WIAA 4M1TA 4B43A 5J4VA 3S1AB 4D0NA 2GXSA 2O8CA 2ECKA 3VR3A 4NZYA 4AYTA 1QVRA 2JLUA 1W4RA 4EPTA 1E2QA 2ZRCA 5CB8A 5KDDA 4GMDA 3U7FB 2A9KA 2HLDD 3QENA 3LBHA 2R62A 3UMFA 3KB2A 5FOXA 2KWIA 1A2BA 2F3TA 3WP0A 4IKEA 5AUQA 4HLCA 3BFXA 3RWOA 4JLDA 1OIWA 1D2NA 1YJ5A 2Q21A 5HCNA 1NMYA 1UADA 2NG1A 4KLNA 2NZ8A 2V1XA 2CHQA 3A1WA 4LX0A 5JEEA 3QF4B 3B7GA 4KLZA 3IKJA 2WWWA 4FMCF 5IF9A 1S1CA 1JR3E 3ASZA 3FMFA 5EUQB 2ZAMA 3DL0A 3LW8A 1VG8A 2P6RA 4LJ4A 1FW6A 1EX7A 3AVPA 4LWZA 3QIAA 2JGNA 1MT0A 1M7BA 1OH5A 1M7HA 5E7MA 4NCJA 3PENA 4TMKA 1GILA 4DCVA 2FN4A 3CRW1 2O8BB 1ESMA 4MUBA 1KSFX 1BO6A 1OXSC 3AF0A 1G4AE 2CCKA 4L8GA 5FH9A 1DG3A 4MH0R 3SU8A 1NY5A 4OQXA 3DKVA 5FI1B 4D80A 4IDNA 2AHOA 2ODBA 3SYKA 2CLCX 2VP9A 3CM0A 1R5NA 3HR7A 3ECCA 3GJ8A 2ORWA 1F48A 2JASA 1SQ5A 2FPKA 3CIOA 1ZP6A 2IHYA 5FPHA 4C9BA 1NMXA 2XX3A 1ZM3A 4LC1A 2E9SA 3CX7A 3JZAA 3RS7A 4TTPA 3OIWA 4TQUS 2BMFA 1VDZA 4M1OA 1NI3A 2J1LA 2QRZA 2X1VA 2D3WA 3IIMA 4Q47A 2ZJBA 4DLZA 3KTAB 4DIDA 5DLQC 1GRQA 4ZIRB 3PEUA 1JXMA 3FMPB 1HQCA 5FTJA 3UATA 4FN5A 3AUXA 3CH5A 4DC9A 2GJKA 3GMTA 3SYLA 3FMOB 1XMSA 2ZUDA 4GMXA 5G3YA 1CF4A 2C77A 3I8SA 2A7QA 4IJMA 1FUUA 2EFEB 3V00A 3IEUA 3CWZA 4DEYA 3TNFA 3B1WA 1L8QA 5SZIA 3K0AB 5HCIA 4PSAA 1XPRA 3U60B 4TLBA 1G3IA 1T6NA 2ZQ5A 3B13B 1H8EA 2ZI6A 4F93B 4Q7KA 1CJKC 3U4QB 4QJ4A 1ESNA 3QEOA 2W6JA 3L0IB 2WJHA 4QJ5A 2CDNA 4Z8YA 4DCUA 1XD8A 2QP3A 3WHLA 3B1VA 3AV0B 3L8YA 1SHKA 2WAXA 2ZANA 1ZUIA 2ZYWX 2GEVA 3W90A 4S2EA 1IN8A 5AK0A 4OQLA 2ZVPX 1TQ2A 2OAP1 4XTRA 3L8ZA 4JKIA 3U6BA 1EK0A 1HTWA 4Q1AA 2O8EB 1NVVR 1R6BX 2CJWA 1L4UA 1Z0FA 3JZMA 4DCNA 4AK9A 2OLKA 2ZRLA 1Z6YA 1HURA 1MO6A 2KJQA 1Y3AA 2O0JA 3DZ8A 3IQXA 4RCYA 4WZAE 1G18A 2GZDA 4HAWA 2VP6A 4JS0A 4PPNA 3W3ZB 4B2IA 2X19A 4F7WA 3K70C 1X8KA 1IBRA 5JI3E 4HB4A 4DIEA 1CBUA 4D82A 1O87A 1T4GA 1L7VC 2CXXA 2ZRBA 4LHVA 4D81A 3L0OA 1DAIA 3GEHA 2GCNA 4P0TA 4LOAA 1OYYA 3MFYA 2E87A 4QBHA 4JLAA 5AJYA 5GJWC 3U2QA 3VR5A 2WKRA 2WJGA 2CNWA 3UWOA 4LHYA 3B1YA 2B6HA 2I4IA 5DGXA 1E0AA 4DRZA 2BEJA 1ZNYA 4LPSA 5K8IA 1ZU5A 2W6IA 4M1YA 1JNYA 4GP6A 2YC2C 1I4TD 2HF9A 3Q5EA 4GZLA 2AKAB 1S96A 1FMJA 1NJFA 4FCWA 2OBNA 3KQLA 1TADA 1R0ZA 3B1XA 5JWHA 4IEEA 4US2R 3B9PA 1N6KA 1G41A 2RGNC 1OPXA 5J4KA 3TR0A 3K70B 2J0QA 2ZJOA 4BGDA 1EFTA 5HZKA 3GEIA 1AZTA 2DB3A 2W58A 5BN5A 5BW8A 4CEHB 3BE4A 2WOOA 3B78A 5AUPB 2FV8A 2R6CA 1B23P 5BQ5A 4D4MA 3U5ZB 4GDFA 1M7GA 3PJRA 1G7TA 4RD0A 3LNCA 2O8DA 4O25A 4C0SA 2KBEA 3HPRA 4TSFA 5JS7A 4Z1MA 2ANBA 4CT5A 3LVRE 3C5CA 2IF2A 3OAAD 3PUZA 2FG5A 2F55A 3LBNA 3ZVLA 3BXZA 5JECA 1Q21A 1II8A 1FZQA 3ZQ6A 3LW7A 1PJRA 4C0AC 3ZD7A 3KKQA 1KI9A 4MDEA 2KE5A 2GF0A 1TF2A 5GVRA 5A4JA 5KU1A 4PAOA 4W5JA 4BQSA 2ERXA 3QBTA 2O8FB 5JSZB 2ERYA 4BEJA 3GJ7A 4RZ2A 2C9YA 2QU8A 2R44A 1AS3A 3A6PC 2BBTA 4RFSA 4AI6A 1F5NA 1LNZA 2GXQA 4Q48A 1F2UA 2NQ2C 1ZM4A 4OJQA 1KO8A 2DFKB 2P3SA 4JBXA 2WIBA 4RKEA 4I1VA 5FUWA 2GXUA 2XJ4A 3MCAA 4OI2A 2ZI9A 2EFCB 1NN0A 1D8TA 2RB4A 5K8UA 2IXGA 2UZ3A 2WKPA 5L3QA 5GJBA 4HUQB 4F38A 3WYGA 5EXTA 3QVUA 5HPYB 2Q3FA 1E2GA 1S2MA 3B60A 5EE0A 4EDHA 4YMSA 5KDLA 4PZZA 3T1VA 1NN5A 4UNRA 2QBYA 3ZQJA 3IILA 4QFMA 4QBGB 4MKGA 3U44A 2BKUA 3DEFA 5DI9A 1GRRA 3AF2A 2AN9A 2EU8A 1VTKA 1YZGA 4NU0A 1T9HA 2AR7A 2D7CA 4NE2A 2EWVA 4YXWD 4IDQA 4V0ME 3BRWD 4TLDA 4TWZA 4JT2A 4BZXA 1Z28A 2V1UA 3MSXA 5KSOA 1QG2A 3T35A 2AK3A 1X1SA 2GZHA 4N1AA 4NKRA 3GLGB 1UBGA 2OCPA 3I1FA 1OB2A 3IIJA 3L43A 1W1WA 1WCV1 1MRSA 1XDBA 1DADA 4PFSA 1YR9A 2FSFA 2IF0A 2BBOA 4XWKA 4GOKA 3T5GA 3UMRA 1CKEA 1MOZA 1UKZA 4Y0AA 3C8UA 1P62B 4BFWA 4LJ6A 2WOJA 3QXXA 1KI6B 4Q9KA 4DSTA 4FI3C 2HJVA 5EP2A 4Z51A 3K0FB 3T15A 3IEVA 2QE7A 3W8NA 1XCMA 4P3YA 1FOEB 1NBME 1VCOA 2V7QA 1YR8A 3MG9A 4XH9B 2O8FA 3WHKA 4KSCA 5LBIA 4LBYA 5E7IA 3BH7A 4JLKA 2VP5A 1Z0JA 3ZIAA 2F1RA 5TXGA 1KSJA 3UANA 4ZCIA 5L8VA 3WBKA 2FSGA 1RYFA 4WBSA 1Z83A 1ZD8A 2WPDD 2R8RA 1ZC4A 1KI8A 2R6FA 4K81B 1NVWQ 3KFVA 4Q7JB 3ETLA 1UF9A 5LB4A 4JSYA 1X86B 2ZJYA 3FYHA 4LJ5A 1TU3A 1YHNA 5FL7A 2QGZA 3TR5A 3KDSE 5DYGA 2A5DA 3QNUA 5FTKA 3DZDA 3G82C 4B3BA 2GDJA 4ZKDA 1GL6A 1P5ZB 1KJWA 2ZRDA 1MABB 1J8YF 3SJCA 4A2WA 1JR3A 4AKGA 3GJ5A 3RS0A 2JJ2A 2HF8A 1SXJC 2IL1A 3GLFE 2P67A 1DTSA 3UG6A 2A5GA 2PBRA 4ON9A 3FKQA 4ACBA 1R2QA 1J8MF 1KDOA 3TW8B 5EE9A 3SN6A 1ZIPA 5JLJA 1D9XA 2FGKA 1R10A 2GJAA 1E1QA 2YV5A 4YMTA 4LYAA 1S0UA 4PANA 3ICEA 1SKYB 1ZVQA 2CL7X 3AKYA 2J7PD 1GKIA 3CO5A 3BB3A 3I4LA 1GNQA 1M34E 2CLDX 1DPFA 2EFDB 2X77A 4MRSA 2OM2A 2VO1A 1DELA 1KO5A 3QF4A 2NPFA 2BWJA 5ANRB 1I4DD 4FMDB 4HUQA 2FU5C 2ZS8A 1GP2A 1UM8A 4HLDA 4LJ8A 1EFRD 1U9IA 4IHQA 2FEMA 2XXAB 3B8HA 4BZPA 2IYYA 3T1QA 2YKGA 3U6KA 2FH5B 2JCSA 5SZKB 4RD2A 2PX3A 721PA 1N5IA 5H68A 1EFHA 4OHXA 1VMAA 5DSZA 2JLZA 1Q1ZA 4H9GA 5L3RA 3KJHA 2QROA 2QN6A 4WZBE 2PEYA 1RKBA 3LVQE 2CLSA 1E9RA 2IYTA 3MWJA 1X3SA 4OL0A 4PHFA 2EFGA 2OILA 1Z0DA 4PAMA 4DSUA 1KI4A 1Z06A 4C0HA 2C99A 1OB5A 5FFMA 1WRBA 4QJ3A 1U8YA 1R0YA 3KXIA 3K9NA 3CW2A 3V4RA 3G0HA 3QJYA 2DBYA 1ZMXA 5A5GA 2FZ4A 4OQMA 3SOPA 1MR3F 4LCBA 4QGHA 4WW0A 4G5QA 5GJVC 4XVUA 1CJVC 4LDJA 4EJSC 3QKUA 4GOXA 4MGIR 1V43A 3Q7PA 4QRHA 1UBFA 2IX3A 2IS2A 1S1MA 3TH5A 2YOHA 3AVVA 2ZJZA 1GM5A 4BPBA 3CZQA 5KSZA 1E96A 2QY9A 4WA7A 2IW3A 5EE1A 2ZS7A 1CS4C 4DB2A 3WYAA 4CIDA 1E2LA 2UVQA 2IUSA 3MLEA 4IDOA 5B30A 2GXAA 1EFRA 1OFHA 4CDGA 1KDTA 1TAGA 1LS1A 2A5FA 2ZR9A 5JMTA 2F43B 4LJ9A 5LD2B 4GL2A 2GJ8A 2VF8A 1R0XA 4JLMA 4R2HA 4DLRA 4M9ZA 5BYJA 4PPFA 1KAOA 2UKDA 4BUJA 2WSSD 4JT4A 2J7PA 3W6NA 2NO7A 2ZRFA 1BMFA 3CPHA 1J70A 3NBZC 1ZUNB 3IGFA 4HAVA 1DVRA 1KNQA 4KV9A 5JWOA 1KMHB 3A1UA 4PZYA 3Q3JB 4M1SA 4NCKA 3LX5A 4URWR 2ZSAA 4TL9A 1N3BA 1XTSA 2GCPA 3U44B 4L5BA 1YZTA 3TW4A 4FW9A 2F1JA 3TK1A 5SZHB 3ZZTA 4A8JB 1TU4A 4D0GA 3QXSA 4QBIA 2YINC 4B75A 5BYKA 1E1QD 3A37A 1HT2E 2QEQA 2WV9A 5IHPA 2RGAA 4URXR 3CBQA 5IK2D 4L9SA 1VCIA 1NJGA 2OE2A 3LWNA 1AKEA 1E0KA 1E2DA 1TF7A 4B47A 3OEEA 3K09A 1OXVA 2FDCA 3THXA 3FVQA 3HWSA 1BH2A 3P32A 4PX9A 4DXAA 3T12A 1ZNWA 1XD2A 4G5OA 4PHGA 2ZAOA 1TMKA 1QHXA 2XSZA 2GAAA 3EPHA 4B3FX 2VH5R 4I1SA 2A78A 2AWOA 5HKKA 4A9AA 3AVQA 3FFAA 2RMKA 3D31A 1XCPA 4L15A 3TUIC 4CEHA 3GLGA 1RC8A 1YRBA 2D2FA 4G3XA 4QHSA 2V7QD 2XZOA 3GCGA 2RHDA 4B73A 4DT1A 2ZE7A 2LCFA 5G3ZA 4ITRC 4G5GA 2BMEA 2FFBA 2C04A 5GVSA 1OFTA 2GHIA 521PA 2ODEA 1OIXA 2YWFA 1TEVA 3R8FA 3QBVA 4PC2A 2TMKA 5FTNA 4V0MA 1CIPA 3NVAA 3M0EA 5C46F 2XOKD 4M2LA 1G3QA 4TMZA 4URVR 1RJ9A 5JCZA 1GIAA 3QI2A 2ZRJA 3EZ2A 1I2DA 2Q6TA 4IXMA 1EFCA 1OFUX 4LV6A 4LV8B 3K70D 1Z63A 1EG7A 1AQUA 5KSYA 2XZPA 4X8LA 3KXLA 4I99A 2OCAA 4RCZA 5C1BA 1ZJ6A 1U0JA 3FMIA 4B48A 5IDVA 2IEZA 4JLJA 1DO2A 1Z6GA 1HYQA 5C18A 4MKIA 1OXXK 1EX6A 1FP6A 2GESA 3EIQA 3LX8A 2R6DA 3RS2A 1KO7A 2W6JD 4LYJA 4ZIRA 5TVKA 5J47A 4C2TA 1W0JA 5FUYA 3MAAC 4IOMA 5BWMA 4KSBA 3WP1B 4RZ3A 1NG9A 4DLVA 2C95A 1JECA 3EG5A 5CYPA 1X8LA 3RLFA 1IM2A 1FFHA 4OI0A 2OBLA 4WZ6A 2V54A 3ASYA 4P4TA 1KY3A 4JJKA 5J4HA 3GLIA 4D6PA 3IO5A 3TQFA 4UNPA 2FE4A 3OEHD 1W36C 2QAJA 2EFHB 1P61B 1WMSA 3HYTA 1GKUB 2PEZA 3SC3A 3MWLA 5TARA 3H2YA 3VMFA 2ZUCA 2UZIR 3ZD6A 4O2LA 3U4QA 4GFDA 1G4UR 2A2ZA 2WBLC 1KMQA 2OZEA 1EWQA 2XXAA 4IFBA 1YQTA 1Z0IA 2HDNB 3RAPR 3UKDA 2BCJQ 1IN7A 1GG2A 2HLDA 3GJ4A 4WXPA 1UBCA 2VYFA 5FR1A 5KSPA 3WMGA 1OE0A 1KZGB 2CBZA 4V03A 5DO9A 2VP4A 1UFQA 5CK5A 3EA5A 1QDEA 1VG1A 2MMCA 2CE7A 4CT4B 1P75A 4EQ6B 2WJIA 4QXAA 5BN4A 4CW7A 4TT3A 2V55B 2CK3D 1W44A 2ZE8A 2XNDA 2IYUA 1N6HA 3FDIA 4ZPXA 1LTQA 3AF4A 1NKTA 2IUTA 4MRRA 1G5RA 2JLWA 1FP7A 4ACAA 1PLKA 2H57A 121PA 4EJSB 2QRNA 3H84A 1CR1A 1DAFA 4HLUA 2V8OA 4HATA 5HTKA 4DCSA 1E4YA 5A0FA 4EQ6A 3QKRB 4TTRA 4MITA 3TSWA 1KI2A 4HLUC 3N2EA 2ORVA 4JYBA 4WOPA 5EJEA 5LPNA 3U61B 3AVTA 4JJZA 2GJ9A 4IDHA 2PZEA 4JLPA 4D4LA 1NL3A 2VSOA 1NVVQ 3CH4B 4QGFA 4D4JA 2RKOA 4B33A 3BK7A 4ESVA 1DEKA 5FBRB 3LQQA 2NZJA 4UJ5A 1XB2A 2P5SA 4YONB 1GKYA 4B3XA 1OT3A 3FPAA 2P6UA 3KL4A 1US8B 1T3HA 2RCNA 5CITA 1N2CE 5P21A 2BBWA 2Z4RA 2R6GA 2ZE6A 4D2IA 3C15C 4M1KA 4XVQA 3ZYCA 2IT1A 4QL3A 1XCGB 1Z08A 3AKDA 4ZI2A 3HDTA 1KO4A 2PCLA 3GJ0A 3SBDA 4ZKEA 5DH9A 4DLUA 4IVQA 2LKDA 3R9WA 4LJYA 1CU1A 1NMZA 3SNHA 2NIPA 3CWQA 3CF2A 2ZUBA 2G0TA 4NBSA 5FUVA 4BFUA 2IXEA 1U9IC 4Q4LA 1OW3B 3L82B 3QPWA 4HEJA 1E2HA 4KFTA 5B2ZA 5J4LA 5EZ5A 2V3CC 1XJCA 1QHGA 2GK7A 4C4PA 4V0NA 3A36A 4JLBA 3EZ9A 2ZSFA 4KBGA 2BJWA 4PHTA 5FBQB 5G53C 4BLOA 4C0QC 4ZCLA 5JJIA 1CR4A 3B9QA 5CIWA 2JAQA 3ND8A 4KODA 3AM1A 2IK8A 4JL5A 1XMIA 1VKJA 2IXFA 3WBJA 4AKIA 2Q9BA 4B35A 4BLRA 1M74A 2J0UA 5EP4A 2FPLA 1DAKA 1EWRA 2F1HA 3PUXA 5AWFC 3KQKA 1M2OB 3TGPA 1W49A 3REGA 3BH0A 4ABYA 3KXKA 4OHVA 2FX3A 3QG5A 2G77B 2BVNA 2ZSDA 2GRJA 3BBPA 3QKSB 2LKCA 2QQEA 3KKMA 5JRJA 1S9HA 2FOLA 3B2EA 2YVUA 5AJVB 2F9MA 4XD7D 3RS5A 4AKEA 2IYZA 2JLSA 4EPRA 2QMUA 2A30A 3CF6R 5L3SB 1G291 3V4FA 2NOAA 3ADKA 1OF1A 2DWQA 2WWYA 2BHRA 4HDCA 2WTUA 3BWDD 3SBEA 3DM9B 5FOWA 4OK3A 2RGEA 5FTLA 1JEDA 3KFXA 4B2LA 4R2IA 2IUUA 4IFEA 4PQYA 4LPKA 2QENA 5AJXA 3GFTA 5L3SA 3FWYA 4JLNA 1G8FA 3OEHA 1G5TA 1K5GA 4TMTA 2CVHA 3I5YA 3QSYA 3SFZA 4BLQA 4FMBB 4LHZA 5JWRA 2XEXA 4CEIA 4P4SA 2GVDC 3UK6A 4KI0A 2GJSA 4TZ0A 1T8TA 1TTTA 3THOA 4JSTA 4G01B 5B57C 2Q3MA 3W8RA 4B3GA 1P2TA 2V4ZA 3I92A 2VHQA 3U7EB 5DNYB 4B3CA 5DHFA 1ONBA 5C2JB 4U5XA 2MSEB 4RD4A 3GLHB 3AVUA 1P9RA 3AVXA 4B32A 2OV2A 2G83A 1NLYA 4LBWA 1Y63A 4ZV4A 3SZRA 2BKEA 1Z5ZA 3BERA 2IHBA 4EKDA 4DDVA 3CR7A 5JFGA 3CPJB 4DLTA 2REBA 1LY1A 3ADCA 4RY2A 3A1SA 5IRCD 1CULC 4TN1A 5KDOA 4V0OA 3VX3A 1A4RA 3LXXA 1CR0A 1SKYE 2GCOB 2XOKA 4OYHA 4BWYA 1XX6A 1II9A 2F7SA 3D7MA 3AUYA 3HR8A 4PAQA 1B0UA 1VYUA 2ASEA 2VHUA 4TT3D 1DOAA 5LDDC 3KUCA 3OESA 2WM9B 1MO5A 5CIQA 1HA3A 3DOEA 2H1LA 3X1YA 1E2NA 5FL7D 2XSZD 3I73A 2W00A 4LI0A 2ZR0A 3W5JA 1HH4A 3PG5A 2DR3A 2GWHA 4F4IA 4HZIA 1J99A 4IDPA 4Q00A 1Z29A 3P26A 3VHXA 3FHTA 5FBVB 2JLXA 2EW1A 3AGQA 4PC7A 1Q1QA 4QC2A 3CNNA 4YQFA 2C96A 3DM5A 1G7CA 4UNQA 3NXSA 3R9IA 3PEVA 3SHFA 4CF7A 2A5YB 2ODWA 2X8AA 2HXSA 3F5FA 5H8WA 4RFVA 4TLAA 5J5CA 4ZDJA 3UWKA 2ZI4A 4UNNA 4W7SA 2CE2X 1XP8A 3P4YA 1WB9A 4RFSB 1XFAA 2BIFA 3OF5A 5LB2A 4A2PA 5JI2E 1VECA 1ZAKA 2IA5A 4EPYA 2DFLA 2ZPTX 3CNOA 1DAEA 2AXNA 2RGXA 3THYA 2ZIAA 2W2VA 3FOZA 4LK2A 2ZJ8A 1KSHA 3OIUA 4NDZA 3ZZUA 5CM9C 3UIEA 1JPNA 2QBYB 1NF3A 2ANCA 3Q7QA 4OK5A 1HUQA 1PUJA 4RD6A 4M53A 3GLHE 4TQ9A 2RGCA 2R2AA 4A92A 4Q19A 4KU4A 5BXQC 4II7A 5CLLA 1G7RA 2CVFA 1W0KD 2LWIA 1E1RD 1Q3HA 4X8HA 2H8KA 2FFAA 4JVLA 5D3QA 2ZRMA 4H1VA 1ZINA 4LHXA 3T1OA 1BMFD 3RNLA 4A15A 3CUEF 4F4CA 2VLIA 4LHWA 3BORA 5EUMA 1SULA 2ZROA 3EXAA 3EA0A 1NVUQ 3BB4A 3K8YA 2GKSA 5TY0A 3TAHA 2GF9A 1NIJA 1LF5A 2DWPA 3F8TA 2WICA 1E2PA 3GLFB 3ZVMA 4BFVA 3DMNA 1I4LD 1NSFA 4ESHA 2ZSEA 1LFDB 3MJRA 1OKKD 3K0EA 4GBMA 1U94A 2XITA 3K53A 1JBKA 1TNDA 4NMMA 3SJZA 4D4KA 2DWOA 4XTCS 2WHXA 3KUDA 2PLRA 1QHSA 1GRNA 1OYWA 1E94E 4GOJA 2H17A 4YDHB 5TMPA 3DVLA 2GAOA 4BE7B 5G40A 4B44A 2JJ1A 1IN5A 2FEOA 1G8GA 3JVVA 2BCGY 4US1R 3L2OB 3K0CA 5JCPA 4E03A 1VIYA 3I8XA 5B58C 2D2EA 2HYDA 2KSQA 3LXRA 1A5TA 4ZDIA 4NYJQ 3UG7A 3J81k 5KO2A 4FWTA 1FMLA 3NWJA 1N5JA 3LY5A 3DHWC 3LFUA 3NEYA 2PJZA 1OHHA 2WWHA 2WJYA 3AB3A 3QE0A 4BFSA 4EAQA 5E3HA 2PH1A 2IC5A 1KO1A 3GP8A 2PCJA 1UKVY 4B3DA 1CLUA 1QHYA 4UNSA 4P4UA 4DDWA 1QHNA 3CF0A 3DMDA 4MQBA 3O8DA 1SGWA 3AH8A 2Z5FA 4Z1MD 3EZ7A 4TSFD 1E99A 3U3KA 1TUEA 4URYR 4HAUA 1G1MA 2QP9X 3QQ5A 1G8PA 4XOIA 4C2UA 1OH8A 2CK3A 3RSOA 3SYNA 4AYWA 1YZQA 4Q21A 4HZUB 1R5BA 1KK0A 2EYQA 3BGWA 4BFZA 6Q21A 4KYIB 2JDID 4WIAA 2BMJA 4F4JA 2ONKA 5FPTA 3LLUA 2B8TA 1XTIA 5FPKA 4F91B 1Z47A 3NDPA 4E07A 5KUTA 5K8TA 2GK6A 2P0EA 4HAZA 5FOTA 5C4MA 4LY6A 5DI3B 2GILA 2N1BA 1MO3A 3ZZ0A 3PITA 1HE8B 1P4SA 2J59A 4M4SA 3TKLA 3TUZC 4WAUA 1VHTA 5M04A 4L16A 2J45A 3R7WB 2GETA 3B5JA 1E2EA 4TLEA 3U3OA 3NIBA 3BFVA 1VIAA 3VFDA 4A6XA 2GCOA 3FTQA 3WMFA
chains in the Genus database with same CATH superfamily
2OP0A 1SB9A 3HG7A 3P27A 4QA9A 1M1YE 5FWNA 5C8YB 3NG1A 2BH9A 1L4EA 3Q5DA 4RH3A 1GKKA 1JLLB 1ND6A 4YT2A 4JC8A 2XKBA 4M1MA 1MEOA 3BTVA 4HB2A 4FMCB 2ZUWA 3ICEA 1NM5C 2QM3A 3BCHA 3NIFB 4JMPA 4XSVA 4CU2A 4ND7A 3E2PA 3HLTA 4ZCTA 1QFSA 5EIXA 3FH0A 2O07A 3OICA 3CVVA 4O1HA 3I1JA 1JDJA 3C7KA 2Y6UA 3N0RA 4QNNA 5A9TA 4BGVA 1JEEA 4M6WB 3WY9A 4XWTA 1PUIA 2VATA 4IIJA 1FJGB 1Q6YA 1JXAA 1LUAA 1PFYA 5LXTB 1K63A 1QR6A 4LY0A 3HVHA 4CGYA 3D9QX 4S35A 1XQ1A 3H5IA 2ECQA 5F5XA 2ZTSA 2QP4A 4XX0A 2IBSA 2P9GA 2WWXA 4YXWA 3ZJ4A 5AUOB 1N5MA 2FCRA 2V9PA 1TQ8A 3CLSC 3QJGA 3AI2A 4WFQA 1S3SA 1ZH8A 2B25A 1KZHA 1XCOA 2IYSA 1PL7A 3VV2A 3PR3A 3IFSA 5KTTA 1PBNA 2PYIA 3AHIA 3UA4A 4JDPA 5F9FA 4P2GA 5EIFA 2YC4C 2JGRA 2ZRQA 1W88A 4YAEA 2XIJA 5HE8A 1Q11A 4ZT3A 4BE4A 3RGGA 3EH2A 3ILHA 1GVNB 2QXTA 3OIYA 1VHLA 3CBGA 3OLVA 2FX2A 5CJPA 5AR1A 5BSVA 1JE0A 3D7KA 4NV0A 1R4ZA 2Q1TA 3EY9A 4KITB 1WXEA 2CNLA 4QNRA 1J0DA 1MEJA 2FQYA 4Y9RA 2CXRA 3I9NA 4M9QA 3X44A 1QHFA 1XAJA 3SVZA 4ED9A 1HNXB 1RPNA 5K2MA 3S2FA 3WLTA 2R65A 4I9GA 4WXYB 2HT6A 2QE7D 2RK3A 4FXPA 1KXJA 1G4HA 1N5LA 1WW3A 3DO5A 1G20E 3JAKA 1Z6TA 3A4NA 4DDUA 1WX1A 4W5QA 2H2IA 1C7EA 3BMOA 3WIDA 2PJRA 1UKAA 3ESRA 2BGNA 4N0DA 1YVDA 3QP9A 3JD0A 3V1UA 2AZDA 3PXEA 2J3IA 3KZCA 2P79A 1S2DA 5DTMA 4CQMB 1CR6A 2O1WA 3A1EA 3U81A 3NAQA 1USGA 3JVEA 3N6VA 5TE9A 1NVBA 2D5IA 2A33A 4P54A 2C54A 1E64A 1K4KA 3Q9LA 3QFHA 4D8WA 3GEPA 3E0XA 1PGQA 4E21A 3WO1A 3EPJA 3U4MA 2B7CA 2WDPA 5B3JA 2Q0QA 3FJOA 2GVZC 2Y1GA 1MENA 1LLUA 3D2BA 4ZAVA 2LCQA 4JI2B 2OLJA 1IXZA 3K35A 3MWYW 4LVOA 3TLXA 5KIAA 3MWGA 3NR2A 4JL8A 2O8DB 3GT4A 1LI4A 4MR9A 4RC9A 1IQUA 4BNDA 3D8TA 3CISA 5AXBA 3IDFA 3A9TA 3RUIA 2XQJA 4ZMRA 3GWGA 1SXJA 1ODFA 1F8UA 2AJCA 1SXGA 3UKOA 2UUCB 3VKHA 2PIDA 3JSAA 3L07A 1QK5A 2QAGC 2PZJA 4HZUA 3NM6B 3SX4A 1JBEA 1KK1A 1ZLXA 3K5IA 3WJ7A 1C3VA 3GELA 2IGBA 5E38A 2I6UA 3CSSA 3QOFA 4JKYA 3V9PA 3AYZB 3QEBZ 3TGLA 2FA9A 4P7GA 4HRVA 5CW2A 1C9KA 2ZBVA 4QG3A 2HAEA 4M8LA 2V6IA 4D1YA 4JX9A 5T8KC 5FDFA 3WLJA 4P35A 3WLSA 2NGRA 1DAMA 4LYYA 1J0AA 3GRZA 2RHWA 3WICA 3IS3A 4E30A 4HWPA 4KQIA 1JPUA 5DISB 4XB6B 1JDNA 2Q45A 3QNMA 1A2OA 1JDUA 3A05A 1V25A 5JRZA 1T8RA 3HB7A 4ARZB 1MVNA 2X6RA 2PGDA 1Y33E 2J9YB 3GU3A 4P92A 3JVUA 3S55A 1G16A 1K27A 1LNQA 3M4ZA 4KVGA 4YCJA 2GK4A 2XNSA 3ZU6A 3HN7A 3U7QB 1I6MA 1OC4A 2Q29A 5HMMA 3F46A 4EUHA 4Z53A 4J8PA 5JR3A 5KMGA 4KR7A 2WSMA 4G5RA 3PUVA 4F6RB 4BJHB 1LRKA 2V6BA 4B6JA 3E3MA 4IV8A 4LV5B 1IC6A 3F6SA 3IOCA 3CPEA 4C3VA 4R9NA 2RH5A 4ZQHA 5NLLA 4XJXA 1X1EA 2R97A 3EWAA 3KQNA 2G9ZA 4CM5A 1W4CA 3GJ6A 1ZQ1A 2OFXA 4R7GA 2V8BA 5AJTA 3GPLA 4ZVRA 2A1UA 5EZSA 1XZNA 2IHZA 1IQ0A 2OV3A 3IMFA 1NJ1A 3AEZA 1GNPA 2B21A 2BM8A 2NPIA 3QX7A 4JT9A 4Q02A 4Q4HB 4BVGA 1MJNA 1KETA 1L5GB 1Y6GA 1Z37A 1MA0A 1UWLA 2RHTA 3A10A 3CTPA 3DEIA 4WFJA 1Q91A 9GPBA 3T7JA 3HJTA 3GNQA 2JI8A 4PYRA 4AKHA 5L9AA 3CGGA 1SIWA 2HMAA 3C6XA 3VR4A 2RE8A 3PXDA 3LRPA 2VDLB 3N8IA 4BTEA 3RSLA 1AKYA 2JGIA 4D4GA 4R1LA 3R3VA 1XQVA 2Y9MB 2FY8A 4LYGA 1QX4A 3G5UA 2I29A 2SNIE 1KIMA 3L7CA 3Q88A 4M86A 4OSOA 3GFRA 3IP1A 1BJKA 2GN2A 3JZDA 1OHHD 4OQNA 2HL6A 3WRYC 2RJOA 3L0CA 4BYGA 3R6TA 2A57A 5DIZA 3VDQA 4BN0A 1S8NA 1T0HB 3P71T 4YAWA 1FNSA 2BD0A 1GFIA 4NNPA 3V46A 1L1EA 1JFFB 3LC1O 2BTQA 4J1NA 5B7QA 2YMPA 3S4YA 5B55A 5EWMA 3KJGA 4ND4A 1ISFA 2BM9A 3DNMA 1NXVA 1UEXC 1MC5A 2G72A 1NXTA 3PGJA 1CTQA 4N12A 3IVCA 2NLOA 1NKVA 4IPTA 3WLHA 3LIPA 4CIAA 2W8BA 1BS2A 3AK4A 5GM1A 1L5LA 5HQJA 4OHCA 1DDGA 1OX4B 5TDHA 2WAYA 4L4UA 4PO9A 1C4WA 1RYMA 4I1UA 3EFHA 3KHTA 1W94A 2BFDA 4DZZA 1UDXA 2XPCA 3LZ6A 2OCYC 3BMQA 3CLUD 1ZS9A 1YS4A 2PUFA 3U62A 3LT2A 2AQIA 2H8GA 4KL8S 2NU6A 1S89A 4K26A 1TAHA 1TA0A 4F97A 5JDIC 4B09A 1M1UA 1RWVA 1H4QA 4MJXA 4A5OA 5B1IA 1GPNA 1N2GA 1U7HA 1Z2AA 3KJXA 5EWLA 4AVYA 1JALA 2LUOA 4JYZA 1H2BA 1Y98A 2JIZD 2O20A 3MBIA 3PSHA 3QE2A 1KFBB 3FBTA 5K7SA 4NP6A 1NYLA 1KKMA 4II2A 1WQ1R 3JQBC 3L05A 4IF4A 4EECA 2I3ZA 4IOJA 3CB4A 1AMUA 5D2CA 5HIIA 1L5QA 3A7DA 4IL5A 1YZUA 4KAXA 1ODKA 1FBTA 3ME5A 1HYHA 2YS7A 3UB4A 2G1KA 2Z04A 4TQGA 3R9WA 3LUAA 1N32B 1U3DA 2E49A 2NUAA 1BKDR 2V6JA 4NQRA 3PNPA 2F1IA 1CY6A 3QLJA 4NV3A 3ONVA 3UJ3X 4AY6A 5TPWB 1EXMA 1J33A 5EVJA 3EC7A 4K6OA 4O3FA 3LBIA 4JITA 5K6RA 3I05A 1XEXA 1BHO1 1XRJA 1V96A 1XRLA 3GA5A 1FE8A 3K0AA 2H4XA 3RV4A 5CDGA 3NBFA 1H0HA 1WXQA 5DHQA 4DLWA 1PFUA 1E4EA 1KJYA 3OUUA 4F86A 1XJ0A 3OQMA 2R11A 4MWEA 4IMJB 4NAVA 2VHTA 2J5XA 1Y1TA 4KXVA 5DK6A 3T7RA 1RR6A 1QG6A 3TZHA 5IEJA 4L8LA 1ONPA 2Y76A 5A02A 1EFDN 1RM4A 4GRDA 4Z7NB 3PB3A 1R6DA 2EQ5A 3KHKA 4I8IA 3HXLA 3NKFA 1Q1GA 3R2JA 2FPMA 1DRWA 2VL7A 2ZYGA 1GZ5A 3CLHA 1Q1EA 1Y6ZA 4NY1A 5DOZA 5IVIA 3AM4A 5GPBA 1YS6A 5AHOA 1COWD 1GLNA 1QE0A 2DQYA 3GLGE 1QRDA 1NUSA 1OXMA 2VJDA 4ARAA 4B82A 2CUZA 2Q6VA 4A73A 4D26A 5IYZB 4I5EA 2HA7A 1UP4A 1OI3A 3LV8A 5IMBA 4IWNA 3OT5A 5UKDA 4YRCA 5HMLA 1XZMA 5H81A 1MO4A 1G3MA 3DDOA 1G2IA 3JQ9C 1R6VA 2PX4A 5COBA 1YQ9A 3NCTA 1PYGA 1ZWKA 4H4DA 4L5YA 4XIIA 5D00A 3Q7EA 1ORDA 2J0SA 5FNVB 3FYUA 4FR0A 3TD9A 1PCXA 2K4MA 1Q12A 2QIOA 5IJWA 3QUTA 5C80A 1UKYA 1QIIA 1EVYA 3SS8A 2VDNB 3AOGA 1XEFA 3SG0A 5IZCC 5DYIA 1V7CA 4IDGA 1OXTA 1HEUA 3E4CA 3JD3A 3ANYB 1ZGGA 2RGBA 1E2JA 2HEIA 2OXCA 3BMNB 2YVQA 3M5WA 3FVWA 3TQCA 5C7IO 1KORA 4O1IA 4J43A 4RDHA 2AMYA 2MSKA 5JNLA 4PTLA 1OSNA 2NYAA 4MMZB 1F20A 4DQDA 2DUMA 1O9HA 3S8MA 3I3SR 1GNVA 1FTQA 4GP7A 4RVOA 1V95A 3T4EA 3E1GA 1P1FA 1SCUA 3LK7A 5C35A 4JXJA 2JGJA 2AA3A 3LPAA 3R8CA 3EVCA 4DLNA 2YIDA 1Q20A 4IM7A 4O0MA 4I5FA 2HCRA 3SLRA 3RJ5A 1UK9A 1GT91 3OKPA 3R3HA 4TKZA 1MFPA 1E3QA 1MRZA 3WDSA 2WZQA 1E9BA 2XBUA 3WYNA 4IX1A 3IDOA 4C7OA 1TQ6A 2GCEA 1A8PA 2QZPA 1YR1A 3MUFA 4DLSA 1P77A 3NATA 1RADA 2CXHA 2VJPA 3KSBC 1YVEI 2CDBA 1YB4A 3M1IA 4JENA 4F2GA 1IY1A 2KX7A 4AF8A 4DWVA 1N7IA 4TVOA 4KQFA 5SY6A 2AUTA 3SR3A 3TE6A 4S1TA 2H59A 1YJAA 5JAHA 1BA3A 1E9FA 2XAUA 3OQBA 1U8ZA 2GZRA 2NO0A 5KU7A 3TECE 2IIPA 1U90A 3T3DA 2XNHA 2YQZA 3CO0S 2O3QA 1YR6A 3NHAA 1T2FA 2UZ1A 3H1AA 3ZCRA 5A1JA 4QUBA 4KFCA 4B3IA 1ML4A 1QXSA 1GGHA 1FQKA 2BZ0A 1ZM7A 2MJLA 4KRXA 3UJNA 5BYBA 1P6XA 1TRKA 1SBHA 1MVOA 3BBLA 3N07A 4IUYA 5IUJC 4MV9A 1CV2A 2JAWA 3B7PA 5EC8A 5JXIA 3TOSA 4F1JA 4BQRA 3W1WA 5C1IA 4ZOLF 4DIKA 1X13A 3F5MA 1RFGE 3TEMA 3UGTA 1I7SB 3RUFA 1KFEB 3QXHA 3S6JA 5MN5A 1IYZA 1KEZA 1KU0A 3VTAA 2G70A 1GTRA 3VR2A 1PR1A 4QFCA 4H7EA 1SVMA 2W83A 1JKJA 3HRIA 3L6CA 3NWEA 1KOGA 4ID9A 4BN4A 2HREA 2M6KA 4AT1A 4DV0B 3QXCA 4Q9IA 2WHPA 4Q4JB 4N01A 1DQRA 1XEAA 4L7QA 5CD9A 1OV6A 2LZ0A 4M1ZA 2C5AA 4C89A 3HS3A 4UVIA 3W4IA 4E1BA 5FAKA 4RYDA 2YUTA 3R0VA 2FB9A 3M89A 4FCVA 2Y0CA 3IKVA 3BXPA 2DE0X 2CNOA 4N0EA 5TT1A 1GFWA 1I0IA 1VBKA 2A9RA 2CL0X 2J46A 4UJ3A 4BVFA 4EJ6A 4CRWB 1E92A 4F1WA 1M1XB 1T24A 3VNSA 3E8SA 1Y6RA 2PGJA 2W2QA 2WU1A 2QGNA 3R6GA 6PFKA 2HTEA 2VQ6A 4EGSA 2VUSA 3O4GA 2G9UA 4GHWA 3VAYA 4M9SA 3D02A 2YWGA 5FLEX 3RO7A 2X0DA 2XUKA 3C6KA 3E15A 1ZEMA 4PPGA 1QRTA 4RJLA 3TNLA 1GCAA 2D1YA 1LX6A 2Q5FA 3AKEA 3FKSA 4YGXB 1XUOA 3B3AA 4BQPA 5AJUA 3W8EA 5CM8B 4Q4HA 1RLUA 1KDPA 5ER6A 4I2VA 1F7VA 1ELOA 4RNCA 3U3MA 1M8PA 4HUTA 2ZWOA 2NQTA 4MYCA 3ZK8A 4DADA 1E5DA 3DZHA 2ZIUB 3HBNA 1VRVA 1U0LA 4ALMA 4IYRA 5BW5A 1K7YA 2OHFA 4QBKA 2PAAA 3PIDA 4J07A 1Q92A 1I3NA 2D0DA 3PQCA 3F6RA 5AXDA 2JW5A 3BK2A 4E5UA 4LS3A 3LO5A 3VNVA 1WDKA 2E5WA 2G0NA 2L42A 3F3SA 3K8ZA 2AH5A 3OE7A 4LY3A 2YHIB 1S4QA 3WK6A 3K2IA 4KR6A 3A6JA 2G1JA 2XUIA 3E58A 1C3XA 3IPYA 2F64A 3JU3A 2R751 4W5HA 3GAMA 5IH3A 1C9DB 1C8LA 3DDCA 2AG8A 1QCCA 2XUHA 4GQIA 4JL6A 1C30B 1Y4SA 5AK5A 2IBMA 1LRLA 1MIHA 2D7JA 3H1FA 3UYKA 1U11A 3KQTA 1I0LA 1I4EB 4B5KA 1CY8A 5C5IA 4CNQA 2JEYA 3HKDB 5ADWA 4QOSA 4BNWA 1CXZA 3LGAA 5ALUA 2GZSA 1Y3DE 1CQIA 4JGBA 5H9VA 3I72A 4NZOA 4COKA 1E1CB 1EFVB 1K7FB 2NO1A 1YQXA 3NHFA 2O5VA 4W6ZA 3H9UA 3RARA 4AWBA 4B6FA 1M8GA 3M3HA 5DGTA 3DEJA 2QX4A 2V7WA 4XR4A 5EQDA 4EB0A 3U7IA 3VKVA 3WGOA 2OBFA 3ZE0B 3LUDA 1UXHA 4A8TA 3X2SA 3MELA 1N33B 4KH1A 2F00A 4Q05A 4D0LB 1O5OA 3U7GA 4I1PA 2A9PA 1XWFA 4L6CA 4PNEA 2J33A 4IO0A 4PCVA 4G1UC 1ECPA 3ZLBA 4AP6A 1LTHR 2GLXA 4UD2A 3AP3A 3H1BA 4WK0B 5EWLB 1GGMA 2G4CA 3WIEA 4YT4A 4KIJA 4GS5A 2C5LA 4D3DA 1IXRC 2B8NA 2VHCA 1SBTA 1W5SA 4O4JB 1DT5A 1WCYA 1Y3BE 1N3IA 1MN6A 2CYAA 4Q7QA 1HBJA 1VPLA 3KELA 1SVKA 2PKRA 5DBFA 5CA1A 1FQJA 1ORRA 1ZD3A 4I0WB 4Z9XA 5ALWA 4QZVA 1DO0A 2JJ8A 4G56A 4ZVKA 1M72A 2WZBA 3GP3A 4LHSA 5AJWA 1PV4A 1PEYA 2J4FA 1S2NA 1AC5A 2VCEA 1EE9A 1RI2A 2QX7A 3G2OA 3CB2A 4AWAA 1LX7A 4YCCA 1MTZA 5JJ5A 1Q0RA 3RC9A 1H8HA 4Z4FA 2LIPA 1JZQA 5GONF 4RD1A 1X7WB 1Q74A 3L7AA 4C01A 4JVSB 1MTOA 2Y99A 5H3CA 2VDWB 3CR8A 4Q6WA 4MVJE 5T57A 4ZGGA 1H2ZA 3DE4X 3WNZA 2IYXA 3DBHB 4NFSA 4YACA 1EFPB 3UJ6A 4C06A 4EPVA 1HI9A 1ZOSA 1VE5A 1ZMOA 3O82A 4UKDA 4ZO6A 4RA6A 1T5LA 2X41A 5TJHA 4EB3A 4P08A 1V3UA 3SQMA 4BLWA 2W0SA 2P7HA 2JGAA 3A6DA 5EE5B 3PWTA 3GOQA 3QXGA 2HK9A 3L93A 3ONFA 2A0KA 5EIEA 2VWPA 3HVKA 4R3NA 5CDFA 4JI1B 1R3UA 3DUFA 1GTVA 4IYJA 2EZ9A 3SF8A 4DQXA 4CTNA 1HDGO 1LF0A 2ZJ7A 3NNDA 5FR2A 2D5LA 2FN8A 4FTWA 4KO1S 5JT1A 1FYDA 1K97A 3TXXA 4I8XA 4M0KA 1E9VA 3KHSA 3HR4A 4FGKA 1IOVA 1Q0HA 3EGXA 1VMIA 5DFAA 5JVDA 4ZJYA 3A4IA 4KBYA 1ZD1A 2C7BA 2DSNA 1C4XA 1EIWA 3E9DA 3H5LA 1FTSA 3FJYA 4OPMA 2CEAA 3ZHCA 3GYBA 4BUJA 2AWNA 4I9NA 4J7XA 4KZPA 1X77A 2RFLA 5LMUB 3F78A 5ADUS 3OPYI 2Z95A 1PJCA 4O2RA 4DJJA 3JPWA 3ZE6A 3NDJA 3AVWA 1VLZA 5CLGA 1JS1X 1J9EA 1N0VC 3QBDA 1MB2A 3AHGA 1G19A 2GPWA 3L6BA 4TQAA 1KVRA 1LS6A 3O47A 1JHQA 2EKLA 2PUCA 2IH2A 3MCTA 4Q4AA 1RP7A 1KWGA 3VPHA 4H27A 2CXQA 2IEBA 3ROZA 5B7NA 2QG6A 1J2RA 1E69A 2EDCA 3AWIA 5ULLA 4DWJA 4ONEA 5AM0A 4WUTA 3NW9A 3DONA 2OUKA 2A9QA 1KGDA 2BI4A 5KYNA 2DPXA 3AONB 3K9FC 2CFCA 3DVQX 2YVKA 4GPTA 4B79A 5LC1A 3NDBB 3CKLA 5B1EA 4YJ3A 4WXEA 3HY4A 3KNZA 3HJRA 4PYOA 1MAHA 2PS1A 1UEIA 3PVCA 4U3JA 4XRGA 5B64A 1UMDB 1LBSA 4EMSA 2V7EA 5C8YA 3UMMA 2DOKA 4YXFA 1FS6A 3ENNA 3OIVA 4KQ6A 1RIFA 5BW4A 5BXYA 221PA 1U2DA 1R7RA 1M6HA 3MPUA 1RVDA 1OI4A 4ER5A 4DANA 1BHJA 1OPRA 5DGCA 4C7XA 1R5JA 1HQYE 1W9MA 3FCCA 4RE6A 5AI8A 5H80A 3KKKA 1OU4A 2QY6A 2OXIA 4UARA 2YWJA 4TZKA 4DNPA 3Q8KA 1AM4D 1M83A 5AI4A 2IODA 3FKSD 2IV7A 2ONYA 3QKRA 2ZG6A 4EGCB 5DXFA 3T8YA 4PG8A 5IK2A 2YR0A 1C2TA 2A0FA 3FROA 1RE0A 4DJFC 4JBYA 1FS5A 2C58A 2HRZA 1GEGA 3IQWA 4YUXA 5CUQA 1BQEA 1A98A 4X1OA 5DVZA 3T38A 1R0BA 3MYYA 3KEMA 1BX1A 3VMMA 1WSWA 2VJNA 4A16A 5BNTA 1PL0A 2WK1A 3IR7A 1Y9ZA 2AKYA 2FPOA 5BUZA 1GPWB 4A3SA 3M2TA 1OBCA 4C0JA 3CEPB 4C78A 3PEEA 2A58A 1XRRA 4AO7A 4ZHQB 2QT1A 4H7DA 5K3BA 3I39X 5CX1B 1QIJA 2DHQA 1SURA 1G6HA 3O26A 1E7MA 3QLEA 1L4GA 2HC9A 4MJ3A 2GPYA 3AMVA 4RK6A 5EXSA 1DC8A 1GLVA 2GQ0A 2VAMA 1Q1NA 3CCBA 3GDWA 4WY5A 4BLTA 4DF3A 2G5TA 4BP8A 3PEYA 4S1VA 2Y9PB 3GN1A 3AG6A 2HGSA 1GQRA 4PGFA 3EARA 3KCQA 4R8LA 1LC0A 3LQYA 7GPBA 1KDRA 1PO7A 3AL2A 2JJ1D 3OT1A 2ATIA 1B15A 5EKXA 2O2DA 4ZEVA 1VLMA 4M1QA 3B6EA 1LK7A 3F7MA 2R96A 5A9SB 2B4RO 4UUNA 3NRBA 2DFNA 3GLTA 4N7MA 3NBYC 4LZOA 3CTMA 4C4OA 5E2AA 1TPZA 3TLGB 4E5NA 2PL5A 3BIJA 3ZCTA 1NVFA 4S24A 1NWCA 1CZKA 1P3JA 4G85A 5F52A 1JJVA 1YVUA 2HJSA 2V5VA 3KLNA 3RYHB 4BC1A 3C3PA 5E0OA 3EUWA 4E15A 4HAYA 4QFDA 1J90A 2F48A 4IJ6A 2XZTA 3JPYA 3FI0A 3K2QA 3RTCA 2JH9A 1OLUA 1R5OA 1CYDA 1DXOA 5ITVA 1FFSA 1HKHA 1Z5UA 5H9WA 3OJ0A 3E8XA 3ZGXA 4A03A 2Q5CA 3DKKA 1NRWA 3DMFA 4ILEA 1CVRA 1YZLA 3OO0A 4JR0A 4X00A 2XLCA 1LDNA 2CFRA 4WK4B 2YNMA 3T9AA 5AW4A 1A72A 1LLDA 1JXOA 1NVXQ 5THXA 1QDUA 2Z2XA 4DEVA 2CLMB 4BE9A 4J75A 4EA7A 5EWJB 3AXTA 4OCZA 4QHYA 5EP3A 3FOFC 1ZU4A 4BEBA 5IVKA 1HNWB 5GOZA 3E81A 3R0ZA 4GUDA 2PGAA 2J0VA 3A6FA 1KVUA 5DCYA 4PZ0A 2BJHA 2FPUA 3D8HA 3G9XA 3LKBA 2DY1A 4I9FA 5KHAA 5KTYA 1HPLA 3KZ1E 3M9XA 1XRQA 3OSZA 5DEOA 2OOKA 4TS9A 3T06B 1Y0BA 2IYLD 2IZ0A 4MEAA 4R1NA 3T99A 1ZQ9A 4BNXA 4ZYWA 3H8VA 1V4BA 1ZIYA 2NO5A 4G0NA 1DINA 2RH8A 1AKWA 1SHLA 3AOEA 2NT4A 4HDKB 4X93A 5FUBA 1N1DA 2HXGA 5H02A 5A1TA 1I2MA 3KWFA 4YT5A 1KS9A 4QXQA 1M1YA 3ZDEA 3TSOA 2WILA 5CHEA 4CKWA 4IGIA 4YCSA 4PXYA 4URZR 4B46A 1JAHA 4C6TA 4NIMA 4A82A 4EPXA 2V7BA 1Z4LA 2H31A 1QIGA 2DCUA 4B3JA 1M1NB 1T3ZA 4S0ZA 5E9AA 3VPCA 4CNBA 2A35A 1UP7A 4J1SA 1SVUA 4ZA2A 3UGJA 5EA2A 4EB6A 2AMJA 3C14C 5CNIA 5JO9A 1GUDA 3GJYA 3SF0A 2JCVA 2IWRA 1ENOA 1NMQA 4TKUA 4BS9A 5IDYA 1KI3A 4CXMA 4MKFA 3UAVA 3AEXA 4NFHA 1N5KA 3D3NA 4U7FA 1IXYA 4PGHA 4W1QA 1U80A 4POAA 1BXGA 2AFRA 3BJIC 4IIEA 4EJMA 1IY9A 1OA1A 1WZNA 5AHRA 3WIVA 3AL0C 5TPZD 2JZCA 1SBNE 4QM6A 3G2JA 1MNAA 4NMXB 1E3WA 1P0MA 3ANNA 4GEKA 4NXMB 4K0RA 1A82A 4DVGA 4N3NA 1IIBA 4FFSA 4BLPA 1TPYA 4C7BA 3C74A 1V8BA 4Q9DA 4EI9A 1OH6A 3RRJA 5ERXA 2XUAA 1FL9A 1W6RA 1YI8A 1D2EA 1RLTA 3HI6A 3M2PA 4LWOA 1GZ4A 1Q7CA 4D9HA 1F60A 2AG6A 4U8HA 2ATVA 5T4EA 4CZ2A 3I9LA 2CJWB 4PNHA 1OWOA 1CUBA 1YS2X 2M6RA 2OBMA 1ZH2A 1ZIOA 3O94A 4FQ5A 4ZTZB 5MHTA 2RG1A 1RFLA 3EZ6A 3RG2A 4NBTA 4F9EA 2GZ1A 4K3VA 1G8MA 3V3TA 1YUNA 4M9CA 2AFIE 1ZH6A 3QMMA 1POXA 3N05A 1YQQA 5H70A 3LU1A 4LGVA 2QRVA 3TBKA 3BQNB 3SGLA 2UYYA 3LYUA 4GYJA 3VVLA 4LMRA 3RB8A 2K2QB 4L1KA 4IX9A 3BZBA 3W6ZA 3THSA 1VGQA 4YC7A 3ZNQA 3ENVA 3H65A 3P5SA 5KYVA 5B7GA 4LSGA 3VZPA 4WV3A 1YZKA 1JA0A 4JOSA 1NFQA 5LZ2A 1FUKA 1QRUA 5ELXA 2JJYA 2OQRA 4BO8A 2CMDA 5JZ9A 3R7BA 3LA6A 4HDMA 1Z5PA 4Q1CA 4E5KA 5JQGF 4GI3A 4J1TA 3SCZA 2P11A 1EVJA 3L5KA 4Q15A 1KF0A 1PZGA 2PZAA 4PBSA 2G9NA 1HG0A 3E35A 3UB2A 3H6HA 2G1PA 2BR5A 4V3CA 4FN4A 2J9FA 3PA6A 3RNOA 5FORA 3WYFA 2INGX 2OCLA 3S29A 2ZT6A 5A5DA 2ZJ4A 3GARA 5CNMA 4FZ5A 3ITKA 3WAGA 2JHFA 4LF8B 1QH8B 3P52A 3SI7A 1ZO8A 3CX6A 5D84A 3U26A 1R0WA 3MJVA 1CZLA 2CXOA 2QL7A 2J87A 3GG9A 3L9XA 3H4MA 3RPEA 1XROA 5I7RA 2XY4A 1EDBA 2YV3A 5AJHA 1GU0A 2IY8A 2VDOB 4O3MA 4E6EA 3C4VA 2DC1A 2ZETA 2JBAB 1P60A 3S44A 5LQAA 4IV5A 1V8PA 1T1JA 3LG2A 3M8KA 3E2IA 3MTBA 4OHUA 1P7WA 1QVWA 2B99A 3LO8A 5AJZA 5CEJA 1XR3A 4KXUA 4DY6A 1J9GA 3CZRA 4X90A 2OGZA 5AM3A 3ICPA 2YJ6A 4QGAA 2FXIA 1RMYA 2JH3A 1NX6A 2QPAA 1VIVA 2DTEA 1IHUA 2FW1A 4Q7MB 2Y0PA 9MHTA 1KRWA 3PUJA 1CNFA 3TLYA 4G09A 3V2HA 3IESA 1PVDA 3N87A 4GOLD 2CSUA 3F49S 3A6GA 4D25A 3KR0A 1ISGA 3ICWA 1G21B 1LLFA 4Y0VA 4JVMA 5L4NA 4HGZA 2VP3A 5DYTA 2XADA 5CB6A 4YBRA 1V8OA 3H1PA 2YFQA 4GPIB 5E9JA 2QN9A 5E6UA 1VL5A 3PKJA 1IH8A 3IPAA 3RU9A 3IRVA 5D6OA 7MDHA 1OILA 2M1XA 5SY4A 1E6UA 2BHLA 1KOFA 2OFWA 2FQQA 3H7AA 3HU1A 5DBOA 1RXVA 5KOHB 2VJKA 3DW1X 1K6IA 2WIAA 5EIWA 2IHUA 3OJXA 1GPYA 3UT5B 1VBMA 3E9CA 2FWNA 1DJOA 1U2QA 1BW9A 3DULA 2JLUA 4BMXA 4M89A 3U48A 1E2QA 1N4DA 4RKRA 3S2UA 4DQKA 1L3IA 4PY2A 3BF7A 4RHYA 5CB8A 5E6UB 3C85A 3UT6A 2X5NA 2HLDD 3JQAB 3AW8A 4WADA 4ZV9A 5B3JC 1IB6A 2IZ1A 2R62A 3AETA 3LBHA 4QQRA 2ZULA 1NFRA 3KB2A 4UBLA 1U7OA 3S1SA 2F3TA 1A2BA 1FU4A 1TLTA 3AJAA 3FBGA 2LRHA 4IKEA 4AY4A 5I3ZA 2XDAA 4L73A 3EN0A 1HX7A 5GAJA 1AE1A 3PUHA 3RWOA 3OU7A 4JNKA 5GGYA 1ZMRA 1OIWA 4XJVA 4UTPA 2FK8A 1PF7E 1O96A 1WMDA 3RS9A 3ITDA 1J2YA 4KLNA 1YUBA 3QMVA 1NURA 4I50F 5AW5A 1W9HA 1TO1E 2HBYA 1P39A 3CF4G 3ESDA 4LX0A 3WYEA 4EGJA 2FWJA 4KLZA 2XLBA 4WKPA 3DE3X 5K1ZA 2COEA 4C03A 1QLWA 1S1CA 3UUFA 3EG9A 3ASZA 1KYQA 3FMFA 3K1TA 3AZQA 3D6NB 3EVTA 3ZBQA 3U3DA 1VG8A 2P6RA 4ND6A 4H08A 1LZKA 2BFEB 4FDUA 3A1NA 2GT1A 3IAAA 3IEKA 3JS5A 4Y2JA 5HUJA 3OQNA 2O48X 1MT0A 3A3PA 1LC3A 1M7BA 3A6HA 4LECA 1OH5A 1DQSA 1REQA 3G7SA 2FW6A 1TM2A 1X87A 4RJ2A 4DCVA 2O8BB 2FN4A 2XQVA 2XE4A 5ESRA 1XZFA 2CXSA 1BO6A 2DPMA 1NMEA 1R4MA 1SQSA 1VDMA 2CCKA 4L8GA 5F21A 1DG3A 5FH9A 3JV7A 1YHYA 4UTVA 5JFTA 2IDZA 4HWTA 4MH0R 5ADVA 4F85A 5KTNA 3T3IA 3PFNA 5TT0A 1A0OA 4OQXA 3STXA 3DPIA 3V34A 1DRVA 9LDTA 1ACJA 3FWZA 5DHTA 3LBAA 2YIJA 3OIFA 4RPLA 4XCVA 4C4RA 3DYBA 3N7UA 2EHJA 2YXDA 2CLCX 1V8DA 2EX1A 4WPGA 3HVJA 3ZWXA 3O21A 4L02A 3GJ8A 1P3DA 3RQIA 2B4QA 2Q2VA 1K7EB 4OJYA 3ZWPA 4DNXA 1WBJB 4M83A 4M38A 1JKXA 1ZP6A 2IHYA 1UCFA 3TG2A 5CXXA 1NT2A 1B1CA 2RHBA 1E5XA 4QRDA 2E9SA 2BFBA 5IYZA 2COKA 1D7OA 1RM5A 2BKAA 2VNAA 4D8VA 5LLSA 1L3CA 2H4FA 2WTBA 5J2UB 1EAYA 4KOAA 1JMVA 3B89A 1VJDA 2ZJBA 3FCAA 1GRQA 3KE9A 3USZA 4TTIA 1C0IA 2HF7A 1WP4A 2NN3C 1W88B 3OQHA 3PDJA 5C9ZA 1OAKA 3HYSA 5K3SA 3G89A 3UATA 4A0SA 3SYLA 4OXYA 2AHRA 2L18A 4OLAA 1AT1A 1HFJA 1M0SA 3G9QA 3CUYA 4FI3F 4I6EA 1CF4A 2ECPA 1C4KA 3T5PA 2AFVA 4PF1A 4X1KA 3PK0A 3V00A 4F71A 3D0RA 2ZTUA 1DUIA 4OREX 5HCIA 4ZJZA 1NRXA 3DZCA 2LGJA 3MTEA 1ATZA 1JUDA 3B13B 4W8OA 4XLZA 3RSGA 4Q7KA 5KI6A 1CJKC 1GPMA 1EBUA 2QYTA 4EDFA 2C2OA 4QJ5A 4UDYX 4DCUA 4TRJA 5AO9A 2CZGA 3AV0B 1KFJB 1QC5A 4MUJA 3L8YA 1R8YA 2WAXA 5ILGA 1NQOA 1L9XA 1M2VA 2NUTB 3A9CA 1C7IA 2YY5A 1PYOA 3A4TA 3BL5A 5H16A 3L5OA 1G0OA 1ZCZA 1M8JA 1UJMA 2HBQA 5AK0A 1IFXA 3AM3A 3ANXA 1XKLA 4JUIA 2BHNA 4IH1A 4PNZA 3WBFA 3L8ZA 3WWEA 3ZKWB 1NVTA 5HRCA 1QCDA 1AF7A 2AIRA 3VR4D 1A9QA 4CM7A 1MX5A 3CC8A 5GJCA 3LQKA 4BAZA 3FNIA 3DE0X 4N0QA 4Y2VA 3PNBA 1JA1A 1SD5A 3ZDZB 4CQMA 2VP6A 3W3ZB 4DUPA 5LN1A 4MWSA 4KREA 4H60A 2X19A 4YAJA 5EJIA 4XYBA 1RPAA 1WPGA 2W8BB 2P5UA 4GWLA 4CKEA 3PTAA 3PUKA 1K9VF 5D7BA 2AGVA 3L7IA 5CEFA 1U0SY 4D82A 3IXQA 1RXWA 3JY6A 2C3YA 4BLVA 2Z8YA 3TMYA 4CKZA 4UM9D 4DYHA 1W96A 3GEHA 3JQGA 2YQ5A 3MFYA 2E87A 3KSRA 1ZGJA 1XU7A 3PNLA 4J03A 5DJ5A 3RSCA 3VNQA 2ROQA 1P8AA 2E4AA 4WMLA 2CNWA 3GT3A 3NRJA 5DNDA 3U0BA 4Q7EA 1WG8A 3TM5A 1GUZA 3WWYA 2B6HA 3PFFA 1UAGA 5DMXA 3VJMA 4D9IA 2QRLA 1TUBB 2W6IA 1S02A 5LLDA 5EFZA 2BZGA 2AKAB 3ER6A 5HUQA 3C6YA 2JKVA 4E70A 1NNSA 4RTPA 3LNTA 1TADA 1R0ZA 5HF5A 1D0VA 3QUQA 4IEEA 4US2R 3F9CA 5EZYA 2XGSA 4NU5A 5LP1A 2AOXA 1OPXA 4KV7A 3EOAI 4MNTA 1W4ZA 4MVXA 4RPIA 4WNCA 4BGDA 1UXGA 3FZGA 2ZIWB 3NIWA 1LBQA 1MB4A 3RUPA 1KDZA 2Q8QA 4L4YA 4UU7A 4XQ9A 3R5KA 5AUPB 2FV8A 1VFPA 1XMXA 2JIMA 4ID3A 4GMFA 4XWYA 3U5ZB 1NVEA 1ECLA 2IV3A 1L4BA 1M7GA 2CV2A 3DHYA 1KYZA 5FHQA 2CVOA 2DLDA 3LVRE 2IF2A 1ATIA 4KN9S 4E4TA 1NHGA 5DW3A 5K0JA 4JI0B 3GO4A 3H9GA 1N34B 1WHTB 5JECA 1R00A 8ABPA 3KYJB 2NXEA 3KUKA 3DXYA 1VMDA 4MW7A 4ARVA 4WBNA 4YUZA 5BORA 1PJRA 1NLMA 5EG5A 2IIQA 1K5HA 2GF0A 5DPMA 2EJVA 1YC2A 4FR2A 5KU1A 2I2FA 2LDBA 2X0RA 1JU3A 1VHJA 3C3CA 3IAXA 2J3DA 3Q5GA 1GR1A 4TWRA 3K71B 3QBTA 4E3WA 2X9VA 3L4KA 4D0SA 3C8ZA 1QNLA 2I4NA 3PUIA 1NGSA 4G0PA 2CFIA 4YO7A