1NKSA

Adenylate kinase from sulfolobus acidocaldarius
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
MKIGIVTGIPGVGKSTVLAKVKEILDNQGINNKIINYGDFMLATALKLGYAKDRDEMRKLSVEKQKKLQIDAAKGIAEEARAGGEGYLFIDTHAVIRTPSGYLPGLPSYVITEINPSVIFLLEADPKIILSRQKRDTTRNRNDYSDESVILETINFARYAATASAVLAGSTVKVIVNVEGDPSIAANEIIRSMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE
publication title The structure of a trimeric archaeal adenylate kinase.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Kinase
total genus 64
structure length 194
sequence length 194
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1998-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13207 AAA_17 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nksA00
1EFRD 3T12A 2IYZA 2OHFA 3NH9A 3KTAA 4KBGA 4NCJA 4TN1A 4M21A 3BFKA 4WAUA 3K70B 2CJWB 2WWWA 3VHXA 3FTQA 3PEVA 3HU2A 4EFMA 3AH8A 4XH9B 1C9KA 4HLUA 5L3QA 4ZV4A 2F43B 2OEPA 1KAOA 1T5IA 3TAHA 3CKLA 1AKYA 2YHSA 4GPTA 2VHTA 4R9UC 2FEMA 1XJQA 3HPRA 1TADA 2PZFA 1K8RA 1U2RA 1DAKA 2AFIE 4NONA 2WIBA 4BLQA 2HYIC 3BD9A 3ZQ6A 1G3UA 2F1HA 1E9DA 2O8CA 2OILA 2O5VA 4ABYA 3TVTA 4LJ5A 2WSSA 3CX6A 3C14C 3I8XA 1D2EA 3VR6A 1P9NA 1S1MA 3VKWA 4OK6A 1ZP6A 3IEUA 1G19A 1KSFX 1T6NA 5JMTA 1N5IA 1UFQA 1GVNB 3CWZA 4XWKA 1Q44A 3T61A 3B1VA 4WW0A 4NYJR 4HLUC 1LFDB 3CRQA 1PLKA 2CHQA 4NTZA 4TSFA 1NI3A 3D3QA 2SHKA 1JB1A 4M1KA 4UXJA 1MO5A 3H2YA 3SZRA 1WE2A 5FOUA 1RRCA 4FWIB 1OXUA 1OW3B 3ZH9B 4ASUD 2W6ID 1GRQA 2YYZA 3T1VA 1KK1A 2JEOA 3W9YA 4B48A 3O8BA 4NL4H 1BS1A 2ZRKA 2VP9A 5GJVC 1DAHA 4B44A 5EUMA 1NVVQ 5IHPA 3V4RA 2ZYWX 1X8KA 2BC9A 4OK3A 4B74A 4C0JA 2QENA 2QUZA 2J0SA 3U3RA 5TV2A 1G3MA 3G82C 1GWNA 1SVKA 1T8UA 4JSTA 4EPVA 2XB2A 2F1RA 4PC1A 4Q1CA 4A0RA 5HCIA 2W2XA 3BE4A 2CCJA 1DO0A 4ARZB 3ETLA 4GL2A 2O8EA 4OHYA 1KIMA 5FL7A 5BN5A 1WBDA 1RJ9A 3HP1A 1U0JA 1ZIPA 5E7MA 1JR6A 4IW3B 2ZI7A 3A4MA 2RH5A 2CL7X 3ZS9A 1TF2A 4DT1B 4EQ6A 4LJYA 2J0VA 4DCNA 3L8ZA 4D6PA 1B23P 3MUFA 3QIAA 4B73A 1CS4C 1US8B 3CH5A 3MWJA 3RSOA 2GXQA 4BASA 3K0AB 3B5JA 5DHAA 1RYFA 1FTSA 1X86B 3CH4B 5BN4A 4HZUA 3O8CA 1RYHA 1UBEA 1DO2A 1SKYE 1E1QA 3AVYA 4QKQA 2FX3A 3U2QA 4O25A 2FSHA 4W5HA 2CHVA 4B3FX 4IOLA 1DBSA 1X6VA 2IYUA 4KSCA 2ZANA 3NVAA 3ZS8A 1E2JA 2B6HA 3PENA 2RGGA 1JNYA 1GL7A 2O8BB 1G5TA 4UXIA 4DCTA 1KSGA 4AK9A 3U3MA 3VR3A 1NLYA 2ZJ8A 4Q4JB 2R6AA 2VP6A 4D0GA 5J47A 3QVUA 1T9HA 5AJYA 5EZ6B 3REGA 3EPKA 3SR0A 3SN6A 4U02A 2LKCA 2OLKA 4FMBB 4KITB 4TYNA 3K1JA 3NH6A 2GXUA 3QEOA 2QPOA 5JCZA 2R8RA 4JVNA 2NOAA 2C77A 4EPRA 2OBLA 4UNPA 5D3QA 3P20A 2V7QD 2J87A 3NDBB 1XCMA 2F7SA 4XSHA 5FL3A 1UF9A 5TARA 3RWMB 1X8LA 4U5XA 1XEFA 3AV0B 1X1SA 4Q47A 2GF0A 1FP6A 1LS6A 1HYQA 3LV8A 2N1BA 1OIWA 5B2ZA 2ERYA 1NVXQ 2VH5R 1E0JA 2QSYA 1DAMA 1FNMA 1JJVA 2YINC 4ZCMA 2F1JA 3QF4B 1TF7A 5LD2C 3IIMA 4C7OB 4ZIRA 4Q1DA 3MWLA 4CDGA 1RRFA 4JVMA 4PTLA 5CB6A 1AN0A 1P9WA 3R7WA 3WNCA 3PIRA 2F6RA 1XBTA 4WVFA 1JALA 2ZSBA 3AF2A 3S1AA 3HR8A 1M1YE 4DCSA 3LDAA 3SBDA 2ECKA 4IKEA 5DYGA 2GJSA 1ZD8A 3KZ1E 1TX4B 5CYPA 2AX4A 2G83A 2QORA 1QF9A 4Y0VA 1G7CA 1T3SA 4L9WA 4Q19A 2PCJA 2IHBA 5B64A 4HB4A 1DADA 2A5YB 1PJRA 1FMJA 1BO6A 3IBGA 3PUVA 3N70A 3AVVA 1S8FA 3J81k 3X1DA 1QHGA 4ZDIA 2WHXA 2ZTSA 4OYHA 5ANRB 2R2AA 2TMKA 3VU9B 2DCUA 4WOPA 1MKYA 3MFYA 2BBOA 4US1R 3GLGE 4K46A 3DKPA 1FUKA 2JJ8A 1FNNA 2ZAMA 3RWOA 3QI2A 4AD8A 2OLJA 4HAUA 4F92B 2YKGA 1IY0A 2D2FA 4MUBA 5DGXA 1AS3A 1UKYA 1TU3A 2WKQA 3CPHA 3PR1A 5B57C 4IVRA 1EESA 5IT5A 4QGFA 4JLBA 4V0LA 5FOWA 3IGFA 4ZDJA 2WWYA 2ZRIA 3EPHA 4A36A 1BIFA 4FIDA 4H1UA 4LPKA 3GEIA 5AJVB 1P72A 3TUIC 1EFHA 1TUEA 2RKOA 4JLVA 2DBYA 4JLDA 4TQUS 2OAQ1 2KWIA 3O8DA 1VHLA 1ELOA 1XP8A 1KI2A 4XTCS 2WV9A 3TGPA 4Q7LA 1DOAA 1I2MA 1Q1QA 3UPUA 4FWTA 1PV4A 2OCBA 1W4BA 4C9BA 1EK0A 2MSDB 3W6PA 1NRJB 2XOKD 5L3SB 5H70A 4DJTA 5KSOA 2CVHA 3PVSA 3VHLB 3SBEA 1U98A 1GM5A 4FN5A 1N6LA 4Q1EA 1NSTA 3ADKA 4EPXA 3GLIE 2Q3HA 2BV3A 5FR1A 3QKRA 2XZLA 4QC2A 3RS0A 3KKMA 2ORWA 5EP1A 4URVR 4F93B 1XPUA 4DUGD 2ZJOA 1AS0A 1TUIA 1XXHA 3I5YA 1HT1E 1KOFA 1CJMA 4JIMA 3KJHA 4R98A 4E22A 4NH0A 2BMJA 4GOJA 1LY1A 1G8PA 5F2EA 5CDFA 4MDEA 4JBXA 2DYKA 4D81A 3GJ5A 2F9LA 1E2PA 4A2WA 1NN0A 2GJKA 1EX6A 4PC6A 5FPSA 3A6PC 1E1RD 2ZRGA 4PHGA 1G16A 3GJ3A 4O3MA 4KI0A 4I81A 1F2TA 2C78A 3RRMA 4K8OA 3SE0A 4DLWA 3CZPA 2OO7A 4WZBE 1E98A 1AZSC 4DSNA 5H8WA 1KI9A 1NSFA 2Q0HA 1YU9A 1DEKA 3IKJA 4P4TA 1S4QA 1CR4A 1UKZA 3A4NA 3U3KA 1GKIA 4I1OA 5CLQA 4DB2A 4IFBA 3D6TB 5J4LA 3KB1A 3L0IB 2GBLA 4RZUA 5CM8B 1W0JA 4PZZA 2O8FA 2QTFA 3FHOA 4PQYA 5FUYA 2ASEA 3DPUA 4HB3A 3THWB 2FSFA 1E9BA 2FG5A 4R2HA 1W49A 3VR4A 1NMYA 4V0KA 3KKPA 3CNLA 4RFSB 5JS7A 3FDIA 3GPLA 4RZXA 3UK6A 4ILEA 2DY1A 4RJLA 3UMSA 2VHQA 3OIYA 2JLYA 2WSMA 1W4RA 1OXSC 4LY6A 2P6NA 3EZFA 1QVAA 1WDTA 4MYCA 1KDPA 1U8YA 1HV8A 2DFTA 2P3SA 2ZRAA 4LGMA 4YDSA 1D9ZA 3KKOA 3VQTA 3ZLJA 1FFHA 2DHRA 5CIWA 4DCUA 1M74A 4LJ6A 5KPDA 1N5JA 4Q4AB 2GJAA 4IDNA 3REFA 2GBLC 1AJEA 1OYYA 2OAP1 2P0EA 4TYQA 2O0JA 3K9LA 1JR3D 4PPNA 4ESVA 2XEXA 4FCVA 4QJ5A 1F2UA 3SHWA 2GETA 5DH9A 3IPXA 5KO2A 1LF5A 1CXZA 3LQRA 3PFIA 3AP2A 2DWQA 3UWKA 1K5GA 5JFGA 4KV9A 4I1UA 5SZKB 4IEIA 3DOEA 1DG3A 2VBCA 2B92A 1X1RA 1BYIA 1AQUA 2W2TA 4DLZA 2DFNA 2I1VB 2NIPA 4KBFA 4F91B 1E69A 3C16C 4AI6A 3WNDA 3P27A 4P0TA 2ZUDA 3ASYA 4QGGA 5EE9A 5CK5A 2V4ZA 1R5OA 3VR2A 2PZEA 4HUQB 2QZ4A 4BLPA 1YR7A 1GITA 5HE8A 1TQDA 4D0LB 3FMFA 4YXWA 1FX0A 4HATA 5DE3A 2CXXA 3AB3A 4KFTA 5JHGB 4J0QA 4KHZA 4OQNA 5DIFA 5CYOA 4LUCA 1T5LA 5L3SA 2BBWA 5TXGA 1ZD1A 4YLGA 2ZQ5A 3A1SA 5JCPA 3U44B 4Q48A 4GOKA 3WHKA 3NBFA 4JBYA 3TW8B 1QG2A 4TMKA 2W83A 1G7RA 2OSBA 3FMOB 5FBVB 3SU8A 2VF7A 3RS4A 4LYAA 3PJRA 2PT7A 4KU4A 2FJUA 2WKRA 4BEBA 5K8LA 2C95A 3ADCA 2RAPA 2CE7A 4JYBA 4AYXA 4B34A 2WJIA 3OFNA 3FVQA 2ZM5A 2BMFA 2JJ2D 2QMOA 5HKKD 2OXRA 2HUPA 2ONJA 4OI4A 4EKDA 1OHHD 1GILA 4M1MA 2RCNA 3CX8A 2J7PA 5K8IA 1HUQA 4BFTA 4GMXA 2ZIAA 2YWGA 2GCNA 1P60A 3OF5A 2HT1A 2V3CC 2C99A 1J70A 1XJ0A 1C4OA 2E9SA 5EP2A 1Z47A 3CF0A 4BUJA 3CPJB 4B3XA 1P7CA 2UZ3A 4IDHA 3BERA 3QJYA 4BFUA 3P1JA 1ZM3A 4Z1MD 1J8MF 1VG0B 1GL6A 1M8PA 2BDTA 4PSVA 5EE0A 4BZXA 3ADDA 1ZM4A 1KO7A 2WOJA 2ATVA 4DDVA 1S9DA 1CP2A 3ICEA 3TSWA 4QHTA 1TMKA 1ZBDA 2GTPA 1MO4A 3TR0A 1R0WA 3GFPA 1JAHA 4N1AA 5J40A 3SJBA 2PLFA 4ZI2A 4E03A 3LWNA 1E0KA 4MRSA 5H1YA 5C2JB 2BCGY 3UANA 2R6DA 1TPZA 4QHSA 1JR3E 3GMTA 3W5JA 2FOLA 3B1WA 3WBJA 1XTKA 4TLCA 2IWHA 3B9QA 3C15C 3GLHB 4V0MA 2FMXA 4AG5A 1NJFA 1AKEA 1KI7A 4ZKEA 2OCAA 3U3JA 2ZYVX 2VLIA 4CIDA 1ZNXA 4XD7D 4LJ7A 2ZS7A 2EYUA 1AK2A 2IUTA 4G3XA 4P4SB 2A5FA 4TL6A 2YWHA 2JLQA 3DOFA 1G17A 3IIKA 4KJZA 3VR1A 4V0NA 1CRPA 1W36C 1MH1A 2HCBA 2A5GA 2WPDD 4IVQA 2H1LA 4HUTA 4R7ZA 1G8FA 1XF9A 2H18A 3DMNA 1UKVY 3KTAB 3MG9A 3KJGA 5FTNA 1FQJA 1YHNA 2NPFA 2D4HA 5H68A 3L0PA 1R6BX 5G3YA 5FR2A 3T1QA 2Q3FA 3OZXA 4A8JA 2IYRA 5L3QB 2ZS8A 3W90A 1J90A 2CBZA 4LX0A 5E95A 3T35A 3QE0A 5HCNA 1O87A 5EXSA 4A9AA 3AUXA 1KJWA 4GMDA 3SHFA 1SVLA 4DDWA 3U4QA 5L8VA 2QNRA 1AQYA 4ON9A 1P2TA 5JRZA 2IBMA 2Q21A 2O8CB 5JS8A 2EFEB 4QBGB 4M9QA 4Q9IA 4ZCIA 3W5IA 3B7GA 3LW8A 4HLQB 2VP2A 4LBYA 4MGIR 4OKSA 2EVWX 4HAWA 5JBQA 4A8JC 1LF0A 4M8NE 5EP3A 4FINA 1XMSA 1IXZA 3BC1A 3OE7A 4UXHA 2XAUA 3CRW1 4MRRA 2VP4A 1NKSA 4B43A 1NY5A 3GJ6A 3G5UA 1E9AA 1R4AA 1IOZA 2RB4A 3K0FB 4OQXA 4TT3A 1DTSA 3KXIA 3Q85A 2GHIA 2ZRBA 3VFDA 3GJXC 2KJQA 2MSEB 3WBKA 1JAIA 1S1CA 1OH6A 3AVPA 3KX2A 5GJWC 3IHLA 2ZUCA 1W4CA 4JLKA 2HF8A 2QE7D 3W6OA 4I99A 5G3ZA 3H0KA 4MRVA 3I62A 1R8SA 2YV5A 3FWYA 4BPBA 3GJ8A 4C4PA 4JLAA 2G9NA 1GNRA 1CJUC 1E9RA 4HI0E 4KXFB 2CNWA 1ZNWA 3GFOA 1JQLB 4LBZA 3ZZ0A 4TL8A 4B32A 3EX7C 4B2PA 1ZM2A 3AP1A 5BYKA 1P62B 2O8EB 3Q5EA 2CEAA 4OL0A 1GSIA 2ZI9A 1RJ9B 2QAGA 4AYWA 4B3CA 3OEHA 5FUWA 4CT5A 3QXSA 5M04A 4CEIA 1G18A 3BGWA 4TTQA 4PO8A 4EQ6B 1Z28A 4M2LA 4ZKDA 4AG6A 4TLBA 3I5XA 2NO7A 4BZQA 2JIZA 4DXAA 2BWJA 3DM5A 1J8YF 1N25A 1JECA 4GFDA 4IOJA 3RDPA 3U7HB 1F5NA 1FZQA 3QXCA 1MV5A 4HZUB 2DFLA 2Z6VA 5GVRA 2HLDA 4L5BA 1IN5A 1IM2A 4PO1A 3OIUA 3KJEA 1XPRA 2IUSA 1XDBA 3H4MA 4Z51A 2QAGC 2O8DA 1MRSA 1KMQA 1IXSB 1KI8A 4IDQA 4Q9HA 2BJVA 5JWOA 3B78A 5F98A 2QBYA 3I73A 3SNHA 1SULA 1ZNZA 3TSOA 4B33A 2IYQA 4UJ5A 5FBWB 3CF6R 1Q57A 3L0OA 1G9XA 1YZUA 2BMEA 1Z6XA 3CRMA 2N46A 5LD2B 2DWPA 4Q7JB 1OJLA 3OEED 3ZZTA 4W7SA 4RD6A 4TSFD 2QSZA 3FE2A 1X8JA 3C4JA 2X2EA 2QU8A 1T4GA 3DZDA 6Q21A 4XVRA 5L3RA 3TUZC 1W4AA 4KLZA 1A2BA 2P6RA 1IQPA 1KI4A 4EPTA 2R6FA 3I72A 4OHZA 4KVGA 1Z63A 4TQAA 1BYUA 4U7DA 1ZJ6A 5FOXA 4QBIA 4PSAA 2R44A 1QHNA 2ODWA 4KYIB 4QBFA 3X1YA 2OBMA 5G40A 3ZD7A 3LXXA 1ZIOA 5KDDA 3MMPA 5TMPA 1Q12A 2Z0MA 4UKDA 4B75A 3KQKA 1NLZA 4ZIRB 2KBFA 3O47A 1AGRA 4WIAA 1P6XA 2JGNA 1KYIA 3R7WB 4TZ6A 2EYQA 1RE0A 3S1AB 4JVLA 3PXGA 4URYR 3ZVLA 3CNNA 3TLXA 4BWYA 2GVDC 2GK6A 3OEEA 4GI7A 1GRNA 2ZJ2A 1XD9A 2GAOA 4MQBA 3ZDQA 1G3QA 5FL7D 3MAAC 2EU8A 2REXB 2QEQA 1GIAA 3GLFA 3R8FA 3NDPA 2FGKA 5AK0A 3AF0A 1MT0A 1YZTA 3K0FA 4LV8B 3GLHE 4MH0R 4S2EA 3W8NA 2WTUA 1MR3F 1TF5A 1VKJA 4TL7A 4TYPA 4MGKR 4A92A 1QHYA 4P3YA 2AWNA 3CO5A 4B76A 2GDJA 2QPTA 2HCJB 2EWWA 4F4IA 1XEWY 1E1QD 1NG9A 2WM9B 1CR0A 3JVVA 1KO4A 4RCZA 3BB4A 2ZI6A 3ZIAD 2JLUA 3A1VA 4EFLA 2OXCA 2YOGA 3T5DA 3KB2A 1SVSA 1SXJA 1Z0DA 2WOOA 5A5GA 1WB9A 2C5LA 3BRWD 4P31A 1G41A 3K0CA 3LLUA 5F9FA 1XCGB 4NYMR 2C98A 3UXMA 2OV2A 1IN8A 3GJ4A 4D4LA 1ZCAA 1CTQA 3VTKA 4JT2A 5J4VA 3PEUA 1NIPA 5DSZA 1UEIA 4IHQA 4US2R 1LV7A 3LNCA 4DLUA 2VYFA 1E4VA 1XD2A 2EW1A 2QP9X 4CGZA 1YRBA 3NIBA 4D80A 1S0UA 2ZI3A 4AIIA 2DR3A 4DIDA 1KNXA 1MO3A 1G21E 4BFSA 4IOKA 2QAJA 2NO1A 4OHXA 1XTJA 4Q7KA 5FTKA 2P65A 5JJIA 2Z4RA 1ONBA 3CB4A 1VMAA 3SJZA 4Q5IA 5KNDA 1JEEA 3SOPA 2Y8EA 1SXJC 1W46A 3L0SA 4JJZA 2P5SA 3QKRB 3K0CC 3A4LA 5CITA 1E2KA 3ZIAA 3CM0A 2E1RA 4LBVA 1GUAA 1KKMA 1XXHB 4ESHA 3C41J 5CIQA 1U99A 2ZR7A 2X77A 3RRYA 3QKSA 2ZU0C 1KJZA 4JKIA 4JJKA 2C9CA 3TMKA 3HU3A 4ACAA 4UNNA 2QMEA 4V0OA 3BK7A 3RANA 3ZQJA 1GDDA 3VR5A 1FQKA 2EFDB 3EW9A 4E5UA 3Q7PA 5JI2E 1YQTA 5CLLA 1A4RA 2YWEA 1ANKA 1KDOA 1F2TB 2V9PA 2ZRCA 2GK7A 2C8VA 2ZAOA 3FGNA 4KFRA 4JVSB 5HPYB 3TR5A 4ZPXA 3TH5A 2FSGA 3NBZC 1QHIA 4JBWA 3CPEA 1E2FA 3HYTA 4HLDA 4WBSA 3WRYC 1D8TA 4H9GA 4JLOA 3BBPA 4P4UA 4LJ8A 4C30A 1HQCA 2QQ0A 4FMCF 2Z4SA 1OFTA 1G4UR 1AZTA 1ZM7A 4IJMA 2D62A 2RGDA 4P33A 3EAQA 3W34A 4BECA 4IVPA 2XTZA 1U0LA 2O8FB 5JJLA 2ZYUX 1VYUA 3L8YA 5FOVA 4BFXA 1EFTA 1V43A 4URXR 2VSXA 4AKEA 3TQFA 5ELXA 1DE0A 1Z6YA 2J0QA 1G6OA 1Z06A 4HSEA 5EUQB 4NZYA 5GVSA 1S2MA 1UAAA 3EIHA 3BXZA 4L15A 3HJNA 1Z6TA 3NBXX 4XWAA 1YZQA 1I4LD 2ATXA 1KI6B 1M34E 1BH2A 4QNMA 1TEXA 1PUIA 1JXOA 4KAXA 821PA 1E2EA 1DPFA 3GLIA 1KNQA 2KSQA 4LV6A 4UQOA 1RPZA 3WMFA 2RGXA 4PR0A 4TMWA 3LVQE 3CF2A 1E2NA 3CNOA 3CR8A 4LJAA 1F2UB 3DKVA 1W44A 4OI2A 1H8HA 1KAGA 3AUYA 2W58A 5JWHA 3I4LA 2I4IA 1L4UA 1YRAA 4QBHA 4V02A 1C1YA 2QMHA 3PG5A 2PMKA 1P2SA 1CIPA 3SEAA 2W6JA 2P2LA 4W9MC 2GRJA 4E07A 1FTNA 1CEEA 3VAAA 1KY2A 2CCGA 2V6JA 4MGZR 4M4SA 4DBLC 4C0SA 2PZGA 5J4HA 3WP1B 4TLAA 1G8GA 1Z2CA 2Z43A 2ZPTX 3B1YA 3EA0A 3GJ7A 2AKYA 3GQBA 2F9MA 2X8AA 1KI1A 1TU4A 1U90A 3EZ6A 1KZ7B 1FX0B 221PA 3U7EB 3EIEA 3EPJA 4RFVA 1UDWA 4PPGA 1NMXA 3JZMA 3WMGA 3RC3A 5KYKA 3QQ5A 1TNDA 3FPAA 3ZGXA 1E2MA 1FL9A 2C96A 2NGRA 2V55B 2A5DA 4L8GA 4NE2A 4KLNA 1Z6GA 4HAYA 1RZ3A 4AKGA 3IO5A 5CJ2A 2XSZA 2GJ9A 1TQ6A 2BCJQ 1MOZA 2WJYA 4Q7MB 1J99A 1OIXA 2J0UA 1T3LA 3MJRA 5IK2A 3VMFA 1W0JD 3MGCA 4B47A 3PEYA 3FOZA 3WY9A 1NL3A 2QRZA 2IHYA 3VX4A 4KFUA 4FCTA 5C18A 2OFWA 2ZI4A 1NN5A 1VIAA 1II9A 1OPXA 1ZAKA 5FPHA 3KQHA 4DEYA 4UNQA 1E4YA 3H1TA 3I32A 2JLSA 1OT3A 3E5HA 1N0UA 4M1OA 2J5XA 3EASA 2QTVB 4O0MA 5EP4A 2ZE6A 3SYLA 5AR1A 2C2HA 1Z0JA 4LC0A 1Z0AA 4RD2A 2BKEA 2PJRA 2MSCB 3BB3A 3TW4A 5HZHA 2ZU6A 3B9PA 2AK2A 3X1XA 1I4TD 3RABA 4LDJA 1XPOA 1E6CA 4MYUA 4PC2A 2A3RA 1MABA 1GFIA 3D8BA 1RVDA 2B8TA 1OB2A 1OYWA 1CF4A 1M7BA 1J7KA 1DS6A 1ZD9A 3B13B 1CR2A 1NKTA 2GEVA 4QFMA 2GXAA 3W3AA 2J41A 5IF9A 2QGZA 1JPNA 4B2IA 4EJSA 1R0XA 2GA8A 3RVBA 4OQMA 5EE1A 1W48A 2RGBA 1GTVA 2J59A 3CIOA 4OBEA 2XITA 1W36B 4GDFA 1ZC4A 3QG1A 4A6XA 4IDPA 1ZVQA 1GKUB 1YZLA 3PITA 4YMUA 1KI6A 2IS4A 1BKDR 1JBKA 1N0VC 1PZNA 2QI9C 4RD4A 4DIEA 4M53A 2BKUA 1A1VA 4LYFA 1I2DA 3T1OA 3RC8A 2WJJA 4YXWD 5KDLA 1S96A 3B6EA 4Q4LA 1HH4A 2ZEJA 3NWJA 4GRAA 1OIVA 5EJEA 3IEVA 3CRRA 3GFTA 5AUOB 5C4MA 3LQQA 4YMVA 3A1TA 3AKEA 1UJ2A 4EJSC 2AR7A 4LCBA 2ZJBA 1ZMXA 4OJKA 3EXAA 4X8HA 1HTWA 1OKKA 2VP0A 1UADA 1E9FA 1EWRA 1GKYA 4G01B 5CDFE 1H8EA 1XZPA 5EXXA 5DN6D 3U7GA 3KQUA 1II8A 4B6FA 1FUUA 1D6JA 3HR7A 4WZ6A 5JECA 1KGDA 5K8UA 2QMUA 1UBCA 3FB4A 1NBMD 1Q0UA 1G4AE 3BJIC 2FA9A 2ZRPA 1I4DD 1NIJA 2MMCA 3OFND 4GSYA 4A8JB 1SVWA 4W5WA 1U8AA 1NF3A 5KHOC 1Q3HA 5A4JA 2ZRMA 3M1IA 3W6NA 3THOA 2J7PD 3V4FA 1VCMA 2X19A 2WWGA 3RS2A 3U4QB 1Z8FA 2BM0A 2ZS9A 3MD0A 3L82B 1QHSA 1LB1B 3OESA 1IXRC 1GRRA 3B82A 5KUTA 5BN3A 4Q4HA 1E9SA 2ZJAA 5BW8A 3VKGA 1GP2A 3QNUA 3TQCA 5DN6A 2GZDA 4BFWA 4ZCLA 2VSOA 3SI7A 2F55A 1DVRA 1YZGA 5HR5A 1E2GA 3I3SR 4Q66C 2VP5A 1U94A 3IO3A 2GAAA 2G1KA 2HV8A 4OQFA 3TUJC 2PH1A 3X2SA 2ZUBA 1NBMA 4G5SA 1OXVA 1E0AA 2AWOA 3F0TA 2DB3A 4QXAA 4QM7A 2ZE7A 4URZR 3I1FA 1W36D 4AURA 5G53C 1Z0KA 3QY0A 3R8CA 2ZI5A 3QPVA 4NPHA 4PHFA 4MYTA 2WAXA 3FKQA 4JMPA 2BEKA 4LJ9A 2DFKB 4TQ9A 4UNRA 4X8LA 1II0A 4JYCA 2GF9A 1KSJA 1EG7A 2FF7A 3BIFA 3QPWA 3BH0A 5AUPB 2JASA 3DDCA 4HB2A 4RCYA 4PX9A 4BFVA 2KI5A 3DVLA 1XNJA 2P67A 3CX7A 3P26A 5F9HA 3B2EA 4PQRA 4A2QA 2QL6A 1N6KA 3FMPB 2ONKA 4US0R 3VX3A 2RGCA 3QENA 2QAGB 2L0XA 2XZPA 2OT3B 2X2FA 4TMZA 3IIJA 1IY2A 4CEIB 4B71A 4FI3C 1XTQA 2XX3A 1EFUA 5HTKA 3I8SA 1E2HA 4C0BA 4I4LA 1N6RA 5E3HA 5FPTA 3KXLA 5JEEA 5GJBA 2QQEA 2JLXA 1JI0A 1OFUX 2GILA 4NCHA 1ZUIA 3SJCA 3AKCA 1N6OA 4OHVA 3AVXA 1Z22A 1P61B 3EZ2A 1M6NA 4R2IA 3B60A 2NO6A 1XJCA 1SZPA 3RHFA 1FPMA 2X1VA 2O8DB 1YE8A 1N5LA 4IRUB 1RC8A 2BJWA 1R0YA 1Y3AA 3DHWC 5EXTA 4DLVA 4EFNA 2QBYB 4A0GA 5K8TA 4QNRA 5SZHB 1U9IA 4URUR 2FN4A 2JA1A 1PUJA 3P32A 4TLEA 1V5WA 3ZVRA 4DZZA 2J45A 2AK3A 3AVTA 2ZYTX 1XCPA 3OE7D 2VHCA 4GOXA 1L4YA 1VG1A 1W0KA 1Q1ZA 4IEEA 4F4JA 2AD5A 1XTRA 2NZJA 1NNEA 4RD1A 3A58B 1E0SA 4TT3D 3ICQB 4Q9KA 4YMWA 2QP4A 1W7AA 3MCAA 2XNDA 4BFZA 4PHTA 2YVUA 5JWRA 4CEJA 5EXPA 1HE8B 2O0HA 2ZE5A 3IQWA 4EDHA 3QPUA 2GZAA 3HWSA 1XRJA 4KYUA 1F3OA 4LZZA 3AF4A 3KXKA 2BBSA 4FMCB 1RW4A 3TIFA 3SFVA 2WMNB 2QA5A 3FKSA 1QVRA 1IY1A 3QXXA 2CNWD 5FTMA 1XFAA 2VSFA 1ZW6A 2OCYC 3H84A 1Q1EA 4Z8XA 4GNKA 1HA3A 1UDXA 1ZU4A 3OIWA 4OHWA 2XZOA 1Z0IA 4NHOA 1IN6A 2IXGA 4MUAA 1A2KC 2R6GA 1Z07A 1Z0FA 3AKDA 3SQXA 2YNMA 1ZC3A 1TQ2A 5EZ5A 1F6BA 2IX3A 2GEUA 3GLFB 4PPQA 5EQTA 4N0EA 1DAFA 1CJTC 3OEHD 4JZKA 3ECCA 4YONB 1SKYB 2RMKA 3R9WA 1EWQA 4PQFA 2D7DA 4V0ME 4KO8A 2QP3A 5FPYA 4RVCA 1DAEA 2QRNA 2AXPA 3DMDA 1CLUA 2JIZD 4JLNA 2AFHE 2R62A 4X8MA 1PLJA 4WXRA 5FTJA 3TNFA 1CJKC 4II7A 4CZ2A 1R7RA 2CK3A 2RHMA 2W00A 4ITRC 3EG5A 3R9XA 4Q02A 4LYJA 2FNAA 3A1WA 1MO6A 2HLDD 1HEIA 5FFMA 4DHEA 4HAVA 2H57A 3QBVA 1COWA 1TL7C 2GVZC 3RS7A 1OB5A 4K81B 1KK0A 1SXJB 1WXQA 3W8RA 2IF2A 1IBRA 3T15A 3MWYW 1A82A 1HURA 3QXHA 2GCOA 2ZRJA 1NN3A 4F38A 1NVVR 3KJIA 3N2IA 1AS2A 2QG6A 5IDVA 1HY3A 1G8YA 4LHWA 1R8QA 4HAXA 4FMDB 1XEWX 5LBIA 1YZNA 2ZROA 1SHKA 1XD2B 1ESMA 2WIAA 1VYTA 1Y63A 2IUUA 5CB8A 5KNBA 3F8TA 3KKNA 1UKEA 2PT5A 1G3IA 4RKEA 4D2IA 2C9OA 3AGQA 1GG2A 1KHTA 1IAQA 2W2VA 1G7SA 2P6UA 4B3GA 2NMVA 2D06A 3BFXA 1Q3TA 2IEZA 3H86A 4XOIA 5C1BA 4F4CA 2BOVA 2JJ1D 3WYAA 2JCSA 3KL4A 3PQCA 4RZ3A 2YZ2A 1GOTA 4LPSA 2Z83A 2I3BA 1TEVA 2BBTA 1OXXK 5EE3A 1CKEA 1QHHA 2PX0A 4TMVA 1LS1A 3QKSB 3TBKA 3FHCB 1GNQA 4MRPA 1W5TA 2O0KA 5KNCA 2QTHA 4G0NA 3ZVMA 4G5QA 2FEOA 2UVQA 3E70C 4HB0A 3B1ZA 1XWIA 4EPYA 1CBUA 1WQ1R 2FGJA 1Q21A 2JLRA 3BB1A 4G1UC 1E79A 3X1WA 4IXMA 5BWMA 4PAMA 2XJ9A 3TSZA 1CR1A 4TMXA 1T8TA 4M1TA 1WMSA 2FWRA 2GEDA 4PXAA 2YWFA 2FSIA 3MJHA 4S35A 3UMFA 3K9NA 4DDUA 5P21A 5LB4A 2ZETA 1DARA 2AHOA 1KI3A 2VIIA 5AJXA 2F3RA 2R6CA 1OH8A 2QN6A 1J2JA 2JJ1A 3AQ4A 3QUSA 4L9SA 4CW7A 3N2EA 5D3MA 4BZPA 3T5GA 2A78A 4CEHA 3KQLA 4M22A 3CUEF 1W5SA 3D7MA 2V1XA 3WRXC 4BEJA 2XXAA 2ZRFA 1G1MA 2IYWA 3ZZUA 5C4GB 2AKAB 3OAAA 1SKQA 4A1FA 5KSYA 4LHZA 3THXB 3KQNA 4NCNA 1SVMA 2IW3A 2LKDA 4XSGA 4ZI3A 5KOYA 1Z2AA 2D3WA 2H7VA 2QY9A 2WJGA 1VDZA 3NHAA 2J1LA 5GADl 1XU4A 1G6HA 1BMFA 1QRAA 1SXJD 1YR6A 3NEJA 4G5RA 2NPIA 2G3YA 1U0HC 3Q9LA 4KFSA 4DVGA 4JL5A 4NU0A 4PSKA 1A7JA 3EIQA 4CRWB 2IYVA 3MRSA 1OFHA 2ZRDA 3GLIB 4KSBA 2PLRA 2AN9A 2ANBA 2FPMA 2NG1A 2IS2A 2R9VA 3Q5DA 1G5PA 3THYA 5JHHB 4PO9A 3CLVA 4TWZA 1VHTA 1PVOA 2PBRA 1XB2A 2VHUA 1DG1G 4BFYA 2CL0X 1EGAA 1EFRA 1KY3A 2EWVA 3LX8A 2FPLA 1T91A 3N5CA 4YC7A 4DSOA 3I61A 4N3NA 3ONWA 2ZRNA 1KK2A 1AIPA 1IHUA 3RS5A 2FE4A 1KZGB 4Z8YA 3CONA 3SC3A 3QSYA 1JEDA 2ORVA 1VPLA 3U7FB 4F7WA 2IYXA 3BS4A 4DEXA 5J4YA 3NTUA 4G5GA 2BVNA 2N42A 5FOSA 3ZJYA 3QKTA 4TTRA 1FMLA 3AVWA 4RKFA 2BMDA 2O52A 1P2UA 2Q9CA 3QF7A 3ADBA 2P5TB 4B3DA 2G6BA 2A2ZA 4RSGA 5UKDA 1YZKA 4O2RA 2YJTD 3T34A 1N0WA 3QG5A 5TDHA 2UKDA 1Z29A 1KJYA 4C3ZA 3ND8A 1SVOA 1ETUA 5CM9C 3NBYC 4B2LA 3RRZA 4NBSA 1OSNA 1NLFA 4QHYA 3TK1A 2PMDA 1KMHA 4GZLA 2OFXA 2G1JA 4QG7A 4DC9A 4DLRA 1GZSA 3NC1C 2XGJA 1CU1A 1GNPA 2OCPA 1UBGA 1TQ4A 5LDDC 1OH7A 2HJVA 5JSZA 3WHLA 4KVAA 2J0UB 2A7QA 4ASUA 2W6IA 3HDTA 4NYIQ 2V8OA 1D9XA 1M7GA 3PUXA 2QPAA 3UKDA 2GWHA 5FTLA 1E99A 3K70D 2H16A 4I1SA 4JLPA 3GLFE 2MMGA 3U61B 3CR7A 4D26A 4YQFA 5JRJA 1XEXA 4MITA 4BGDA 2ZREA 2B7CA 1QG4A 2OZEA 3HPQA 4HDQB 4E09A 4AKIA 2DPXA 5CJPA 1JJ7A 1G20E 1SGWA 1CJVC 1VCIA 1N5KA 1Z5ZA 4AY2A 3GLGA 2VTKA 3SJAA 1NVWQ 2QT1A 1N2CE 1WA5A 4GP7A 4A0HA 5FPKA 1ZRHA 1XTIA 3K9GA 2XTNA 1S3SA 2VQSA 4IDOA 3LO5A 2JLWA 1HE1C 1FOEB 2PEZA 1AGPA 3O8RA 3LLMA 3EPLA 4OQLA 1W47A 5TVKA 4FD2A 3UMRA 1NJGA 4H1VA 1MABB 5DI3A 4Q9LA 4BE7B 3EC1A 2FPKA 1SXJE 1H8HD 2H17A 4Q21A 1TTTA 1N6NA 2FU5C 2QM7A 4PAOA 3K9HA 4IFEA 3THXA 3GCGA 2CJWA 3OHMA 4LC1A 2PJZA 4IXNA 4EJSB 4QJ3A 2WWXA 2W6JD 4HLCA 3VKHA 2F43A 3LFUA 4L4UA 2BIFA 3LD9A 4MKGA 3RYTC 4DLYA 4Z54A 4UJ3A 3BAFA 4C2UA 3E2IA 4LOAA 2J9RA 1NVUQ 1R2QA 2G0NA 2WAYA 2A9KA 4IOMA 4LV5B 4QL3A 1IJFA 4NYJQ 1QHXA 4LHVA 2XJ4A 4PC3A 1LW7A 1XMJA 2ZSEA 2CMKA 4YMTA 3RLFA 4BLSA 5FBLB 2XB4A 1K5DA 1AM4D 3HYRA 3QBTA 2PL3A 4HZIA 3KDSE 5JI3E 5GJCA 1Z6AA 1ZU5A 1Z08A 2BHRA 5B58C 3BH7A 3BH6A 5DI9A 2ZVQX 3SYKA 1JXMA 1NY6A 5DHFA 2EFCB 3K70C 2WWFA 2ZJ5A 1HT2E 4DSTA 1TAGA 4EUNA 1K6MA 1XD8A 5DO9A 3LY5A 3AP3A 2BEJA 1FP7A 2ZJZA 4W5JA 2CLSA 2V7QA 3A37A 3W3ZB 3AEZA 2XSZD 4C0LA 4DKXA 5DISB 2YC2C 4CVNA 1UBFA 2ANCA 1KO5A 3PCRB 4PZLA 8OHMA 4TMTA 1II8B 2OUKA 1KTVA 5IK2D 3F5FA 4LWZA 1IN7A 1F60A 4DLSA 4I1VA 2GXSA 3K0SA 2QT0A 1E96A 4FMDF 4PAQA 2IS6A 5B30A 3ASZA 2QGNA 2DWOA 3KKQA 5L3VA 4NYMQ 2C03A 1ESNA 2IYSA 4JS0A 4KODA 2VHJA 3M0EA 1KKLA 1YKSA 4BRUA 5LB2A 2G77B 2IYLD 2VPPA 4JLJA 1L2TA 4M9XA 2RGAA 1KDTA 1EFCA 2WVJA 1NG1A 3AVOA 3DM9B 1G291 5E7IA 1T3HA 4A6PA 1T0JB 3IUYA 4AC9A 1IN4A 4GP6A 5J5CA 1RIFA 3G0HA 4MA4A 3MLEA 3RNLA 4ARZA 3UATA 3Q3JB 2IC5A 4LYHA 4Q4HB 2H8KA 2FV8A 3NKVA 4HEJA 5FBRB 2C04A 4N0DA 3WYGA 2FFHA 1DAIA 4DT1A 2IS1A 1D2MA 4ZDKA 3V9PA 4Y0AA 4D82A 5JJKA 2GESA 1US8A 1LTQA 1D5CA 3UWOA 1XZQA 3K0AA 3TKLA 5AUQA 4QGHA 4OK5A 4Q03A 5KSPA 1VYVA 421PA 1LNZA 2BM1A 1ODFA 1VECA 2G88A 3LBHA 4EPWA 1U81A 3QKUA 5HE9A 5EE5B 2J46A 4Q18A 2FZLA 2O8BA 1ZM9A 4JKYA 4A2PA 2CHGA 4G5OA 4JT4A 4Q4JA 5KTYA 5HZKA 3LX5A 3PV0A 1E2IA 1E3MA 2HF9A 4MRNA 1Q20A 5F3WB 4JSYA 1XTSA 2GNOA 3B85A 1G5RA 1OKKD 3BORA 1O3YA 121PA 4HDCA 2XOKA 1VG8A 5FI0B 2OESA 3BFVA 3PUZA 1P75A 1H8ED 2JLZA 1M2OB 2VO1A 2XTMA 2ORIA 5G41A 1G7TA 1E2LA 4DSUA 2WZQA 3KFVA 1ZINA 3CW2A 4JL6A 4JL8A 2WWIA 3R20A 1Z83A 1G8HA 3SDZA 4DUGA 4D0NA 1WP9A 3AVQA 4LI0A 1G64A 2ZE8A 3WMEA 5KDOA 2B21A 2ODEA 4A4DA 3QF4A 2WKPA 4PANA 3FYHA 1WCV1 3M6AA 4Q1AA 4XTRA 3UIEA 4C7OA 2ZRHA 4GBMA 4RD0A 3ZVNA 4FCWA 3IDQA 1OF1A 3HU1A 3P4XA 1X3SA 1L7VC 4XIGS 4EIWA 4RY2A 4GZMA 1XXHE 4JLMA 1CULC 1E1RA 2JATA 2IK8A 5AJZA 3WYFA 5KSZA 2K5UA 2IL1A 3C8UA 4B35A 1B0UA 4LHYA 4D4MA 1P2VA 3TRFA 1W2GA 4C0AC 3LH5A 1T0HB 2EQBA 2IA5A 5KPJA 3U3OA 2PCLA 4URWR 3VU9A 2IT1A 3T06B 3K8YA 2F3TA 4Q9JA 1LVGA 2YC4C 4MKFA 2FFAA 2Q6TA 3QEJA 3FFBA 3JZAA 3Q8XB 3R9IA 2OM2A 3FHTA 3MSXA 2WICA 4CEJB 2HYDA 5DLQC 3EA5A 4QOSA 4XWOA 3NG1A 4CYMA 3PEWA 4RD3A 1E2QA 3TJZA 3EZ7A 1XX6A 2NQ2C 1N6PA 4ZDWA 2V1UA 1XMVA 3WP0A 1ZUHA 5FBQB 5C46F 3D31A 2G0TA 1JR3A 4X8OA 2AD1A 1ZUNB 3SYNA 4WXPA 4L16A 5FUXA 3T1TA 2OFOA 4TYWA 2D2EA 2IXEA 3LVRE 2WJHA 1Z3IX 3PUWA 3C7KA 3CBQA 4TZ0A 2HXSA 3FFAA 3TAUA 4YMSA 3ZD6A 1VTKA 2CCKA 3A1UA 2FZ4A 1QBKC 3VNUA 3NHBA 3UG6A 2LWIA 2QROA 3CWQA 1VCOA 2REBA 1OH5A 4V03A 3WNBA 3RSLA 3KUCA 1VCNA 2E87A 3DO6A 5TB5A 4C0QC 4PFSA 4LRWA 2RHDA 2F1IA 4QM6A 3EWAA 2NTYC 1VG9B 1QZXA 1KK3A 2GCPA 2ZXUA 2KBEA 4QRHA 1SVIA 2GZHA 3A8TA 2NZ8A 2LCFA 4O2LA 3ZYCA 4A0FA 4DLXA 1AA9A 2VF8A 3TVDA 3BWDD 4RZ2A 1E9CA 1CRQA 2V6IA 2ZSFA 2GCOB 2KB0A 2W0MA 3NC0C 4C0KA 3LA6A 2CLCX 2JDID 1OXTA 4M0LA 4LK2A 3C5HA 5DNYB 1PLLA 1P73A 2QM8A 4LBWA 3LW7A 1GAJA 4PPFA 1F48A 5E4FA 4BLOA 2IEYA 3QVVA 2YOFA 3IILA 3B1XA 4BLRA 5IRCD 1W0KD 4M9ZA 4WA7A 1E94E 1DELA 3U6BA 2ODNA 4DB4A 4HYYA 1N6HA 4CT4B 2CDNA 2C9YA 1M7HA 5AUNB 3GEEA 3THWA 4NP6A 1P5ZB 4NCKA 4ZO4A 4CF7A 4RFSA 1NP6A 1OFIA 2JJ2A 2XNDD 2ZR9A 4Q00A 2CL6X 1FW6A 5HKKA 3AKYA 1BOFA 3NXSA 5FUVA 1E9EA 4M1SA 1WRBA 1OHHA 3U60B 4C2TA 1QHHB 2VA8A 2B7BA 4BLTA 4DLTA 3GEHA 3Q7QA 2VRWA 4LSGA 3LBIA 4B3BA 1H65A 3A36A 4OJQA 3K53A 4GT1A 1GL9B 3EZ9A 4LHXA 4MYHA 1QDEA 2JDIA 5FH9A 3FKSD 1Q1BA 4EAQA 4DDTA 1NBME 4P32A 2JLVA 2ZSAA 2WJVA 4POAA 4R71A 1RFLA 4HAZA 2ZRLA 4Q4AA 4AYTA 4DRZA 2XNSA 1R5BA 2FFBA 1E32A 4PHHA 3M4YA 2W0SA 1P4SA 4PZYA 2EFHB 3L43A 4D25A 3LAWA 4PC7A 3I92A 2CE2X 2ZJYA 4Z1MA 1UEJA 4FW9A 2FDCA 2ERXA 3SQWA 2VEDA 1R0ZA 2RGNA 1UM8A 4MDFA 5SZIA 1OV4A 5BQ5A 2B8WA 2OG2A 721PA 5D3MB 5FOTA 3IQXA 4CEHB 3CRVA 4XJXA 521PA 3RAPR 1JPJA 5FI1B 1U9IC 3DL0A 2J7KA 4ACBA 3AGPA 2XXAB 3AF1A 4MGYR 1RKBA 2KE5A 2CK3D 1N6IA 3LBNA 4XVQA 2HJGA 4M9SA 4Q1FA 3LRPA 4HUQA 3P4YA 4LJ4A 5E7JA 4YDHB 2Q9BA 3RS3A 1W1WA 2D74A 1COWD 2ZVPX 4BRWA 3EWSA 5JEDA 4A15A 2ZR0A 4OI0A 1ZNYA 2CLDX 4QJ4A 3TE6A 3B8HA 3GJ0A 1W2HA 2WWHA 3IBYA 1KDRA 1YR9A 4M1WA 5AJWA 2A5JA 1ZYUA 4DWJA 4XD7A 2RGNC 3L2OB 2WBLC 1P3JA 2H92A 3U44A 5LPNA 2HDNB 1IJEA 2REOA 1SHZA 2ZITA 1A5TA 4KCGA 5BXQC 1HQYE 3IHWA 5JLJA 3K09A 1G3RA 1YVDA 2OBNA 3THYB 3SFZA 1MRNA 2WPDA 2FFQA 3OIVA 3KUDA 2EFGA 2NO0A 2Z5FA 1JQJC 3QXJA 1RRPA 3BOSA 1YR8A 2WMOB 3GP8A 1NN1A 2GKSA 3RRNA 3NEYA 4C0HA 3VNVA 1N3BA 3U5ZB 2ZSDA 2IF0A 3K0EA 5TY0A 2H5EA 5BYJA 1U8ZA 4AKHA 3FMIA 3WXMA 4WZAE 4DCVA 3V00A 2FH5B 3CZQA 1R5NA 4NKRA 4MKIA 3C5CA 1WBBA 4TLDA 1OE0A 1RRGA 4Q1BA 3K09C 2YOHA 3KFXA 4U00A 2J3EA 4HDOB 4TTPA 3JVUA 1Q22A 2A30A 2HXYA 5SZJA 3QOFA 1E79D 3AVUA 2ODBA 4QGAA 1ZCBA 5J4KA 5DYIA 2V54A 2GJ8A 3IPYA 4FXPA 4D4KA 5KU1A 4TYYA 3ND9A 3E1SA 4MKHA 1KO8A 1XMIA 4UNSA 3F3YA 2VL7A 4TL9A 2Q9AA 2AL7A 4D4JA 3DEFA 1KMHB 1EXMA 2OE2A 2IXFA 5AWFC 2CVFA 2I1QA 5JSZB 3PUYA 4OI1A 1E2DA 1L8QA 2HT6A 1R10A 1YJ5A 2RGEA 3Q72A 3OAAD 3AM1A 2JAQA 1P9RA 4NMMA 3X1ZA 2QE7A 621PA 3U6KA 2HEIA 3EARA 4Q01A 4NDZA 2UZIR 1XEXB 3GLHA 1DAGA 1BMFD 4A82A 4B6EA 1S9HA 3EC2A 4M1YA 1UPTA 5CK4A 5A0FA 1NMZA 2IYTA 2Q3MA 1VIYA 3UG7A 2PX3A 2R65A 2D7CA 3GLGB 3GD7A 2IYYA 3AF3A 1IONA 4NYIR 4P4SA 4AWXA 1WF3A 2NO9A 4XVUA 4ERNA 3LXRA 2AXNA 1D2NA 2WSSD 3DZ8A 1S3GA 1SQ5A 1KO1A 3SS8A 2PEYA 3MWKA 4BQSA 4NCIA 1OLOA 1EX7A 2IWRA 5JZVA 5DI3B 1KSHA
chains in the Genus database with same CATH superfamily
3DEAA 2DH6A 2IYZA 3NH9A 4EW2A 3IOYA 3OOWA 3U4CA 5AW5A 4Y9SA 1NVFA 1T6ZA 2ZJ6A 2BFEA 2D2XA 2AG0A 3CKKA 1WHTB 1M2GA 4WAUA 1WMBA 1L5NA 3K70B 3PEVA 3HU2A 5L3QA 2ID7A 3D0OA 1FVFA 4HLUA 3GCXA 4XH9B 2OEPA 5HDQA 1T5IA 3BRCA 3CKLA 4LOJA 4FEEA 2AN5A 3LWZA 3USCS 4CG2A 3RPEA 4ZV9A 1YFJA 1FFWA 1XC7A 2AGVA 1JHXA 3HPRA 3T38A 4DABA 4R1TA 1K8RA 5L7YA 1DAKA 2AFIE 4LYYA 4L2IA 4DIFA 5M5BA 5EZYF 5CLHA 2F1HA 1E9DA 4RHCA 1RQ2A 2OILA 3QY9A 1UDRA 5DX0A 3C14C 3P9SA 1D2EA 1SAYA 3CLTC 3TW6A 4CM6A 2HKIA 1YQDA 4J6EA 5JYBA 2DCMA 3FNBA 4Q3LA 1ISRA 1N5IA 5BR7A 3TNLA 4XE5A 5EIBC 3RADC 3GR6A 3D0RA 1Q44A 4XWKA 2VWQA 2B5WA 2J4CA 3KVNA 4TTSA 5GZ6A 3T61A 4NYJR 4B8ZA 4HLUC 4C03A 1LFDB 4LRQA 4HGZA 3ASUA 5FWYB 4EL5A 4TSFA 2QMQA 2PNJA 4E11A 3EK2A 3JZIA 4ZHSA 3ZE8A 4XA8A 3EDCA 4X84A 2PLAA 3GRZA 3HZRA 1QHFA 1ZCZA 3JYPA 4PZAA 2ZBPA 3H2YA 2XKBA 2H4ZA 3QVGB 5I48A 1ZWLA 4BC1A 3M89A 1DRWA 1RQRA 3MXTA 4LRTB 3QZUA 3ZH9B 4BNJA 5KS2A 1PX0A 2SBTA 5DTRA 2PQMA 3W9YA 4DADA 2BGLA 4EG5A 2YYAA 3IJ5A 4J3NA 2PAAA 5K0FA 1A04A 5GJVC 1H5NA 5LBTA 3E35A 1DAHA 1NDQA 4C78A 5EUMA 2EBWA 1NVVQ 2P78A 3C6MA 3M9LA 3LWDA 4YALA 5DYTA 3SSNA 4AMVA 2R7LA 5IHPA 4MYRA 1DCTA 3I01A 4IVNA 1A8IA 1N5RA 2BFFB 3ESCA 3IALA 4QARA 4EKNB 1H5UA 4EX7A 4F45A 5TV2A 5P8WA 1JI3A 1G3MA 2OAGA 2W2PA 3EBPA 3L6OO 4Q3CA 3D3WB 1C30A 1XROA 4L8VA 4Q1VA 4RK0A 4HGYA 4EPVA 5BSEA 2PJUA 5EQDA 2Q4BA 2XB2A 3G1TA 5HBGA 2W43A 3OX4A 4Q39A 1EB9A 4MUHA 4YK7A 5AH0A 2WYIA 5FNVB 1WHSA 1WBDA 1NHGA 3UNXA 3VNBA 3HLTA 3C3PA 4C5BA 3AJRA 1RAGA 3HLYA 3WK6A 4AS3A 1JR6A 3A3NA 2ZI7A 1HFJA 1AUVA 2CL7X 4ZU3A 4DT1B 3DZBA 3GI1A 1G2IA 4LJYA 2OQRA 5FO1A 4W7IA 1M34A 3I5MA 4HEA6 5C51B 1DHRA 1SQ6A 3R23A 5GPBA 3CH5A 3T0IA 2ZBDA 5AVOA 3K6SA 2ALJA 3N8IA 5IAJA 4HQFA 4RK5A 2EW2A 1NATA 3DQQA 3K0AB 3O5AA 4OEHA 3P2OA 1ZK1A 5DHAA 3RROA 4MKZA 3EVGA 3L7JA 5LOVA 1RYHA 1SKYE 1E1QA 4W99A 2FX3A 3U2QA 4EZBA 5CR9A 1DBSA 1X6VA 3CW9A 3GIWA 1FRQA 2P6MA 2O2YA 3D64A 3NM4A 4WV3A 3S1SA 3NVAA 4WN9A 4G09A 4ZVKA 1IBCA 4BQPA 2R86A 2RGGA 4O2BF 1G5TA 1LLDA 4MMYB 4AK9A 3QVOA 4FYKA 3VR3A 1NLYA 1QPBA 2ACWA 3BYZA 2C9DA 3HCBA 4ZXPA 2Q27A 1HYHA 2AG6A 1PJ3A 3QVUA 1T9HA 5AJYA 5EZ6B 1PNVA 3BL6A 5CDHA 2LD4A 4LN1A 2QN3A 1D0VA 3SN6A 4U02A 3SR0A 2D3TA 3VU8A 4Y3UA 5IAKA 3RYIA 2VCEA 2GXUA 2H4WA 2Y4OA 3KZOA 1GTRA 1H0KA 2QPOA 3KO8A 5JCZA 2E85A 1MX5A 2AE1A 2IZ7A 2C77A 4LGYA 4UNPA 1ZCFA 1U8EA 5D3QA 2J87A 4L5IA 3RWMB 4DOMA 2AJ8A 5KYUA 2NZUG 1X8LA 1C3OA 1YMUA 1XEFA 3M4NA 3AV0B 2WI8A 2WNSA 4CF3A 4YYZA 5T6BA 1R00A 3JAWB 2OD2A 3IMFA 4FQ7A 1ST3A 2P9HA 3PNQA 5IX8A 5TEVA 1LS6A 1HLGA 1M5TA 1AXEA 1FUEA 5ALLA 2BMAA 1J0XO 2VH5R 3KLBA 5DYWA 3PRHA 4RPJA 2RG1A 3EVTA 4KL8S 3VDQA 3WHPA 4BIMA 1I51A 2X4IA 5T4HA 3WGTA 1JJVA 3NJ8A 2C7PA 1OU0A 4IV8A 2ZAGA 3B7WA 4PBSA 2XAAA 3CHYA 1OAAA 1JA0A 1J7JA 1EXWA 2C94A 4CDGA 1T8RA 4GL4A 5ECDA 3R7WA 3WNCA 3FCEA 5E4JA 1WOMA 1XBTA 1EP2B 1V8PA 2NSHA 2OCIA 4HTAA 5H83A 5K3BA 4L0QA 1KMCA 1RQXA 3LDAA 3LQYA 2R8ZA 3PGLA 1KWGA 2JCVA 2XMCA 5I9NA 5B58T 1ZD8A 3KZ1E 1TX4B 4QRIA 2CLMB 1Y4AE 3L6CA 2QLTA 3SZLA 4Q19A 3RNOA 2OMEA 1YC5A 1P1BA 1MP0A 4V3BA 4KR6A 3DBHB 1ODIA 3H6GA 1DADA 3VRHA 4YRKA 1JEQA 1PJRA 1Z7BA 2JGMA 3L8MA 1BO6A 3PUVA 4Y6LA 5JJ5A 2X5KO 4P9NA 1S8FA 2DHDA 4S0XA 3PDHA 1UZAA 1W5BA 4GRIA 2B5OA 2WHXA 4OYHA 1KPHA 4IO0A 3DQPA 3MFYA 4N3GA 2BBOA 4OXQA 1TYZA 3CISA 4K46A 4NS1A 4US1R 1YDWA 4MARA 1H1DA 1HYBA 2Y2UA 4NFHA 4QO8A 4AD8A 2YKGA 4HAUA 5KWVA 2D2FA 1IH8A 4GI3A 5AOCA 1BEZA 3UAGA 1VJ5A 3LXMA 5KOHA 1UKYA 5AHOA 4ARVA 4WPGA 3CPHA 3EEOA 1L8OA 4IVRA 3CH7A 1PSWA 1Y6QA 1EESA 2D6FA 4NBLA 4V0LA 5IABA 4XWTA 3KQQA 2WWYA 2IIQA 2ZRIA 1PAUA 2XRZA 4FIDA 3V2GA 4E70A 2DJIA 2Z2IA 3WL6A 3L8GA 4JJAA 4QBKA 3TUIC 1TUEA 3LUJA 3QEKA 2RKOA 4JLVA 4HDMA 4QJBA 2I55A 4KRFA 2GLTA 2KWIA 1OVMA 1J33A 1ELOA 1QG6A 1VHLA 3O8DA 4WH0A 3RIHA 2ZSHA 4XTCS 2WV9A 1FZTA 4D0SA 1V7PC 4Q7LA 5FPPA 2D13A 5A6SA 2KPOA 2Q1XA 3IS3A 4X0EA 2R8XA 4LVUA 4EGSA 3WK4A 2MSDB 1NRJB 5L3SB 3HCFA 4F5EA 1XZJA 4DWWA 3HUTA 3SBEA 3WA6A 1WPGA 3HABA 3M6LA 1BRMA 3PQ5A 5K9ZA 2XBMA 3SNKA 1M6HA 1ZIXA 1ORIA 2BV3A 5FR1A 5TGTA 3UJ8A 4BWVA 5JQGB 2XZLA 2ORWA 5EP1A 1XPUA 5JJBA 4OYRA 4CLEA 3JYHA 2MR6A 4FYJA 1A50B 5AW6A 2AC7A 5B6JA 4K87A 3BWMA 4EWLA 2PFGA 5CA0F 2LTAA 3SD7A 3T4XA 3LX4A 4BJ1A 4BKOA 2I4TA 1AKQA 3KJHA 1RM5A 3USZA 2ZDGA 4R98A 3BQNB 1G8PA 1AY0A 4K1LA 3NASA 2R751 4ZANA 4B81A 2G36A 4E4RA 3LQFA 2BUCA 3WZ2A 1AQLA 3D4LA 1OU4A 1ZD5A 4QO7A 5DLDA 4D81A 1DHTA 4IZHA 3RYHB 4Y1RA 2PUVA 5A4FS 2YDYA 4OHUA 4MQLA 1GY8A 3QNWA 4CMEA 3N0TA 4GXRA 3V32A 2JGLA 4KI0A 3VZCA 2XD4A 4O3MA 1VZ2A 3L0ZA 2OO7A 1E98A 2H11A 1KDVA 1SBZA 4DN6A 1KI9A 4MINA 4BO9A 1YU9A 1DEKA 3J81A 2OECA 1JDNA 2B34A 3L05A 3PRYA 5AIAA 3W6ZA 4BMXA 1CR4A 3V8EA 2L2QA 4JWTA 4LZPA 3U3KA 3HADA 4I1OA 3T1YB 5KNBH 4I1IA 4GNRA 4AQ7A 3KB1A 3EQZA 3NPMA 1T4CA 4Y2SA 3OFSA 4PO3X 5CM8B 2PA0A 3FHOA 1W9MA 1ZVMA 4K7JA 3ZBQA 3ZU5A 2ASEA 3DPUA 4BVGA 1ZMBA 5HZMA 1HZJA 1X1AA 3FYDA 3DD1A 1E9BA 1X7XA 2GYYA 4CKBA 3HRIA 3M3DA 5C8YB 4CMEC 1RHJA 1QFXA 3CNLA 4RFSB 5JS7A 1ZONA 4JOSA 1CNEA 2Q3DA 2IYFA 4TKVA 2LW7A 3ZOZA 4BV9A 3BHNA 1IL0A 3SZGA 1OXSC 2BHLA 4LY6A 4RHTA 2ZT8A 4AN0A 2WWRA 1U8YA 2PKXA 3QFSA 5H4HA 4LGMA 2W4QA 2J3IA 5D1NA 5DNDA 3OWXA 3VGJA 1FFHA 2P2CA 1RJGA 1AOXA 2H08A 4LJ6A 1DJQA 4R6XA 4E2XA 5IJ9B 2VF2A 4QASA 1X7ZA 4Q4AB 2ZBUA 1EXNA 4IHJB 1MN6A 3UV7A 2AI2A 1D1SA 1H6BA 1VMEA 2OAP1 3CE9A 5HK9A 1LRKA 3NDIA 3IP6A 4EECA 3AOEA 1IATA 4ESVA 3ZGNA 5E6RB 1F2UA 4R69A 1N4AA 3K2IA 3SHWA 1GPLA 2PZ8A 1NR1A 1RE1A 2R00A 4FVTA 5KO2A 4DE5A 4YV7A 1Y1KE 3HS3A 5JZMA 4HJRA 2R8YA 4ZI7B 2OWEA 3V8BA 4KV9A 1W4ZA 1J2UA 1H4VB 3NI2A 2FKAA 3ZDZB 1DG3A 2VBCA 1F14A 1XVLA 2B92A 2EFJA 4QOHA 3WFZA 4F2DA 1QRRA 1UKAA 3U19A 2PX6A 3NAZA 4FJ2A 3QFHA 4EFKA 2DFNA 2I1VB 4F91B 3OPYI 1E69A 3C16C 3EZXA 4HL6A 4AI6A 5BQ3A 3Q0IA 4UTNA 3UAXA 4LJRA 1DCFA 4RMHA 3BZBA 3VR2A 1EVIA 2C82A 2W4MA 2XYQA 3ZIDA 2SICE 2QZ4A 4KRGA 4XPIB 4D45A 1GITA 2OV8A 4OVKA 3SSMA 2JCBA 1X1QA 3AZOA 3FMFA 4EVRA 2GERA 3DHVA 3OPQA 4GE0A 3C3JA 1QH1B 1XQYA 4H7IA 4I08A 4M1ZA 2R00C 1WD7A 3RSGA 2PLWA 4HATA 4YT8A 2CXXA 4KXUA 3HKBA 4R2JA 4TKZA 1CNFA 3ZDDA 1U9YA 2GZSA 2POQX 4KHZA 2HC9A 4A0QA 2Z8ZA 3GGCA 1J07A 3HWX1 4OPMA 2BBWA 4ALMA 2VK1A 5TXGA 4NV0A 3ZW8A 1USUA 4ECEA 2ZQ5A 4IKPA 2FK8A 3A1SA 3LE8A 4ETNA 1CP3A 2NV0A 4U63A 1FJ2A 3WHKA 1DIHA 3DOUA 4TMKA 2NZVG 2B9EA 2IEAA 2FZVA 3VR6H 4C07A 3M33A 5ERYA 2Y1WA 4HS4A 3R3ZA 1ZJJA 3Q7TA 3DW3X 1CZKA 2PT7A 1JQKA 3CG4A 1I3OA 4LGVA 2OYCA 5MFZA 4KU4A 3ZIUA 3UFXB 2VYVD 1U04A 5AVXA 1GKLA 1Y5MA 2CE7A 4JYBA 5HQJA 4PTZA 4KVFA 2X1MA 3PXBA 3AL0C 1R4MA 1CY0A 2XF2A 5AXAA 3O0DA 1EFDN 2X2PA 4MVJD 3HWRA 5FFNA 4QQ8A 2C4WA 1ONNA 4L8LA 2ONJA 4DR5B 1THGA 1OHHD 5I4CA 3WLTA 2GK3A 4G0OA 3L1KA 2O4CA 1Z8NA 4WXHA 4BFTA 3ISVA 4OYYA 2QTVA 3TVYA 4YLEA 2YWGA 3D43A 3ZG6A 5FUQA 2HT1A 4BFCA 1AU9A 5GMOA 1NWCA 4B6GA 5E38A 3JYLA 4FFRA 2E9SA 2P2SA 3IX7A 3N5KA 4N01A 3DBOB 5EP2A 1NXOA 2I67A 1KQNA 1C9NA 1SMKA 1Z47A 2AMVA 4M0PA 5FV7A 9LDTA 1TYEB 1P7CA 2HU2A 1PJ4A 4IDHA 5U1PA 4RS4A 1GA6A 3LT5A 3I39X 2XCTB 2VJBA 1C2TA 3WNQA 4QSHA 2G04A 1PR5A 3GBSA 1GL6A 3S27A 1MTZA 4BZXA 2H1OA 4P58A 2WOJA 5KQLA 2ATVA 3LDUA 1SCAA 2OA0A 2KQUA 1OFUA 2R4UA 3OH8A 1YT5A 2F17A 3NETA 4QHTA 3GEGA 5EHQA 5IM4F 3Q7RA 5TC4A 3PRJA 4YO7A 1R0WA 3GFPA 5J40A 3TLJA 3SJBA 1YUBA 4ZVUA 3C97A 2GKOA 3LWNA 4UZEA 5C2JB 1TLLA 2P9EA 3IAFA 4YUAA 1XL1A 1TPZA 5AI6A 3MT9A 2ZAIA 3R3HA 4E33A 2RD2A 4PGMA 3B1WA 1CY8A 4J1TA 1TZ2A 3FR8A 4FOSA 1KYZA 1G9SA 1XTKA 2IWHA 2PQ2A 1J56A 3I64A 3NX4A 2FMXA 3H65A 3ZWYA 2Q6KA 2JGKA 3COVA 2YV2A 1ECLA 2DM6A 1QQ5A 8ATCA 4B7ZA 4MCJA 1LCIA 3ID6C 4RH0A 4A10A 2AFHA 5B5SA 4Y67A 5EIEA 1L1QA 4MV9A 2OC4A 4PW0A 1MXHA 2HA7A 1EK1A 1FDOA 4B4VA 3DBIA 5HWSA 3TLBA 3DD5A 3EXHA 2JBWA 3GGDA 3JYNA 1W36C 1MH1A 3U0VA 5CH3A 2A9QA 2D1FA 2V7BA 2WJ4A 2WPDD 5TT0A 3NQ41 2IY7A 3KUXA 1T36A 3HB1A 4J1TC 2J5QA 2UZ1A 4KB5A 2JVIA 1RXCA 2WYWA 2YBDA 5AO9A 2VZ9A 2X8JA 5KHAA 3L6EA 4HJXA 5A9TA 4EG6A 5A0VA 2D4HA 4I50A 5H68A 3L0PA 2IU6A 3T1QA 5BVHB 3VHXB 3CJRA 3EFEA 3OZXA 3TM5A 1NULA 2IYRA 3RGWS 1CHNA 5ALTA 5E95A 3EH1A 1V96A 2E5WA 3S5UA 1LA2A 1JLSA 3HVKA 1LFAA 1NVAA 1O87A 1P4RA 4KE7A 2XNJA 1BZYA 2O5RA 5KX5B 3EXHC 3T3OA 1RWQA 2EGGA 1GUYA 3TQOA 4U7GA 2FYTA 2QUAA 3MMZA 4QUHA 1CW2B 4RE5A 5C7LO 4ZOAA 2IBMA 4P81A 2O8CB 2ZIXA 3SP1A 3ILYA 3SZOA 3ILSA 4AMGA 1QTIA 3NIWA 3X2FA 4LBYA 1CZRA 3OQ6A 4JCCA 4MGIR 4OKSA 4MVJE 4MPRA 2NXEA 3RJMA 2EVWX 4HAWA 4RZIA 4AF7A 4F4UA 2WFZA 5JBQA 2CDRA 2GPYA 5G4LA 1MAWA 2YRWA 1ZH4A 4MPDA 4KR9A 1Z12A 3OE7A 1ZOLA 3A2LA 2XAUA 3QIVA 5I4IA 4MRRA 1PEDA 2DR0A 3O3NB 4EA8A 3ZK9A 1HGXA 2IEGA 1PNOA 3G5UA 2XQJA 4B83A 3FI9A 1U7OA 1U3FA 1UK9A 2K6GA 2PHZA 3N3BC 3TJMA 4IDAA 4FDAA 1G20B 2G07A 3Q85A 2GHIA 2ZRBA 2JGAA 1KPIA 5BQXA 2KJQA 2E6KA 1S1CA 5EMNA 5HBRA 3IHLA 3ENWA 2HF8A 2Y1OA 2J6HA 3MYYA 4MRVA 5G3ZA 1RLOA 4BX8A 5A9RA 1EYZA 1GZDA 3GY0A 3VNRA 3WK5A 5I8PA 3GJ8A 4BXOA 4GH5A 1E9RA 2OXTA 3VYTB 2VNSA 4HI0E 2M6LA 2CNWA 3A10A 3F9CA 2R1UA 2QXYA 3FOFC 4PG5A 4TL8A 4B32A 1M2WA 4G07A 1QCCA 4LJSA 3AP1A 3D02A 3ZX5A 2WF5A 2H59A 3PUIA 1P62B 1MB2A 4ID9A 4XQ9A 2O8EB 1NU8A 4HMPA 3PX2A 1V9LA 4NMHA 5JMOA 2Y1DA 4UHBA 4JR1A 1Z33A 1ZXBA 1RJ9B 4AYWA 3W7BA 4DARA 2OO3A 3WTBA 4RANA 3F1LA 4PO8A 4E14A 4EQ6B 3OX3A 4KG7A 4QSMA 3EVDA 2R6HA 4PBTA 3M6XA 5TQ0A 3I5XA 4RZQA 2JI7A 2JIZA 3IP3A 1WVMA 3LY8A 3IR5A 3UK1A 2BWJA 1ONOA 1J8YF 3NRBA 3ETNA 4R1SA 4BO4A 3U7HB 3RAFC 4FBMA 3OLCX 4HZUB 2M6RA 1A9QA 3JASA 4K3UA 2AJBA 1VE5A 1WCYA 1GV1A 1IM2A 3ZD8A 4D79A 3GJSA 3KJEA 4ZGGA 1NF2A 4B4WA 2IUSA 4H7JA 1XDBA 1RPAA 3H4MA 4Z51A 1YMVA 4NNJA 1Q11A 1CEQA 2DT5A 5ER6A 3HACA 1U0EA 4PG6A 1LKZA 3E18A 4IDQA 2BJVA 4XIYA 5JWOA 1TLFA 3H7AA 5F98A 3DCIA 2NM0A 2NU8A 4UJ5A 2C4UA 1VJRA 2AA3A 3IPRA 5FBWB 3CF6R 4N8EA 3L0OA 2XMZA 3B1KA 3BGDA 3U1TA 1W87A 4GVXA 4EUSA 2NUAB 1AVTA 2AZTA 2DWPA 4QBTA 1M8KA 3OEED 5IVPA 2ZZKA 3U4QA 2A3NA 2NADA 4RD6A 4LMPA 5AICA 4IMJB 2GPNA 3UCXA 3WZLA 3A2KA 3GHHA 5JCJD 2CXSA 3FGPA 3M81A 5TMDA 4ZJZA 1EXVA 3LPDA 1QAMA 1T4GA 2WTBA 3DTVD 3DZDA 3PFCA 4UM7A 4DLNA 3TUZC 5IWAB 1M1UA 1W25A 1A2BA 2AG8A 4O1MA 1JVBA 4P4NA 4ZVMA 1SIWA 5A4DA 2VHZA 3I72A 1FBTA 3DWFA 4TQAA 5HF6A 4RJJA 5JT1A 2GM9A 3A6DA 3VOAA 3DXYA 1YMQA 4QBIA 4PSAA 2R44A 1QHNA 2ATCA 2ODWA 1GQRA 3OMLA 4NFSA 1ORVA 5G40A 3ZD7A 3SF8B 1FMTA 2A0XA 3CT4A 3LUKA 1YKGA 4M54A 2JGRA 4R1UA 3OSUA 4ZAGA 3L4BA 3C3EA 1NBOA 1SXGA 4FYMA 1W34A 1GGNA 1P6XA 3FDZA 2I4LA 3NP9A 4EW6A 1J97A 3MWFA 1Q0ZA 1RE0A 4MJLA 2YIDA 4A8TA 4MZXA 5LP1A 3Q6MA 5KKNB 5I3CA 1J9EA 2GK6A 4GI7A 1MF7A 4RIEA 4U6QA 2IRWA 2ZJ2A 1EJ0A 3F96A 3ZDQA 4QGBA 2REXB 2IIVA 2XWJI 5C1IA 4LY9A 1RLJA 3FPSA 4WFKA 3UWDA 3R8FA 1LDEA 3L1JA 5EPEA 2HGSA 3V1MA 4I66A 3K5PA 2CXOA 2MTBA 1YZTA 2JJMA 1QQ7A 3VOTA 1ZJYA 3EIXA 3FF1A 3MGKA 5A4IS 2HMUA 5CBPB 2VQ6A 3L4BC 4OOFA 4EEXA 4NJEA 3ILVA 4TL7A 2Z1MA 4MGKR 2DTXA 3ESQA 1QPGA 4KH1A 1JTVA 1W85B 4KGVA 4QT0A 5CLIA 1N2CA 1QHYA 1ARZA 1YULA 1E18A 2OLEA 2HCJB 4EB8A 4F4IA 1XEWY 1QFJA 3LP6A 1R16A 1Q6ZA 2WM9B 4IQ4A 2UYCA 2XMBA 1MAUA 3T7AA 1VLJA 4RYDA 3D6UA 3MWEA 3EJWA 4S04A 1DEAA 1RHQA 2JLUA 1W73A 3T5DA 1QXSA 4PCUA 1P29A 4EY5A 1ND5A 2FPUA 3K0CA 1AQ6A 3FHJA 3HYLA 4OATA 1Y8AA 2D5IA 4RTKA 4CKCB 2CV1A 4N65A 1IN8A 4P5PA 1XP5A 3UWMA 4NSNA 3VTKA 3ZWNA 4ZXFA 1HLPA 2YS6A 2CZGA 3RW9A 4D9JA 2X15A 3E5NA 1X94A 1L5ZA 3HN6A 4DY6A 4US2R 2PG3A 3LNCA 4DLUA 4DJ5X 4JX9A 1E4VA 4CGZA 4J9UE 4RHEA 3TBFA 1TIPA 3BRQA 4AIIA 1HT0A 2ZPAA 3HDYA 3QTTA 3JD0A 1Q6YA 3ANSA 2QAJA 2NO1A 3KR0A 2YRFA 4J91A 4KPUA 2YJGA 5AI8A 3LSTA 4ZEOA 5JXJA 3PGVA 5FXMA 3L7LA 5E2IA 1RI1A 2IYEA 3KUUA 2AH5A 2PWPA 3RC2A 4EHIA 4XVCA 3K0CC 4ZJPA 1TCAA 4P1ZA 2YMLA 4O2AA 3QU2A 3ZIAA 3ME5A 3EZGA 2E1RA 5CNKA 1NBWB 3INYA 1GUAA 4HG2A 4LBVA 5ALOA 3ABQB 1XXHB 5I7UA 1IZ7A 2XOEA 5CIQA 1K5HA 5JNVA 2D00A 1XZNA 2PGIA 3E3MA 4DM3A 4WNIA 4EYGA 1KJZA 4V0SA 2H54A 3TLYA 5HA5A 4UW9A 1LVHA 3DUFB 2C9CA 3FZYA 3T3EA 4ACAA 5I9LA 1UINA 1L7RA 3I9V6 4U2GA 2QMEA 2PDAA 3T41A 3AM3A 1VPVA 3KZCA 3ZQJA 5CDUA 2H4JA 4JP8A 2FR8A 2A5LA 2YWEA 1J23A 1Z4IA 5IMBA 3OZEA 5C31A 1F2TB 1SPXA 1V39A 2C8VA 3IVCA 4QULA 2ZAOA 1UDBA 4MIOA 3FGNA 4TWAA 1AZWA 3U26A 4F6RB 4TM8A 2VT6A 1PR0A 3V1KA 1ECJA 4RMIA 1G5HA 1NNSA 1MORA 2H1WA 3KPVA 4I4TB 2NUTB 3Q0EA 4JBWA 3WB1A 3TKAA 3HYTA 1F0YA 2QTZA 3BX1A 3FNFA 2PYDA 4JLOA 3W7AA 4LJ8A 1HQCA 2QQ0A 2GAIA 2B1JA 3GDFA 4U6NA 1OFTA 4IJMA 5ES3A 1O0BA 2BFCB 2CLKB 4P7JA 3TDNA 3EAQA 1ORRA 5BNIA 3W34A 4BECA 4DQKA 2VDUE 1U0LA 3AUKA 1NNUA 5B4UA 3BF8A 5CFZA 4X1OA 5K3DA 2HPHA 3BDIA 1TJ5A 5GM1A 1V43A 2CYCA 2FR8C 4PX5A 3BHMA 1YD7A 3OVMA 4BB0A 2WHPA 2E89A 1O95D 1O96B 1VMDA 4HSEA 2W8BA 5EUQB 4BVJA 3RBVA 1UAAA 1GCOA 2PZMA 2EHJA 2QTMA 3RYFA 2G9UA 4ENVA 1SB8A 3HJNA 4HK4A 1YQGA 2HH9A 3E0QA 4OA8A 5BNFA 3T3NA 3PGXA 3TIGA 3O8OB 1Z7YA 4QNMA 1TEXA 4NCXA 2QJTA 3CUKA 4WK0B 1RRVA 1VHJA 4E4YA 5BVGB 2ENUA 5HS6A 3WMXA 4S05A 2KSQA 4UQOA 1UL1X 3AFOA 3MNFA 3T7DA 4BPRA 2VNIA 3CNBA 2GUGA 2BEUA 3DE1X 1V1MA 2HHHB 1EQAA 3CR8A 4UU1A 1Q50A 4ZC8A 4ZC1A 1E6MA 1UC4B 3DZKA 1W44A 2Z3VA 4C6TB 2ECFA 1SXPA 3KWMA 3AUYA 2VH1A 3I4LA 2I4IA 1XVIA 5AOVA 3O1LA 5BV8A 1J2RA 3PG5A 4RMGA 3GUCA 1XNGA 2PMKA 4WLVA 3JD4A 3QJGA 1RP7A 2PLNA 4CGYA 2JLBA 3TRKA 4YJGB 2W6JA 3L07A 2FG7C 2RHGB 3H2SA 4E07A 4EK9A 3RAEC 1FTNA 1VGVA 3UHOA 1CEEA 2CCGA 1J49A 5A4MS 2E49A 5KQRA 4NABA 1QF6A 4HWSA 3QE2A 2D2VA 4NQZA 1P1FA 2GN1A 3PFHA 3Q4GA 4P34A 3UEOA 4TLAA 4IYJA 4Q3OA 4R8VA 1WW2A 1T9KA 5A5EA 3PJGA 5AW3A 1DNPA 2X8AA 1G6Q1 1TU4A 3W06A 4DBVO 3ETCA 5IYZA 1UMCA 1C3EA 2IOQA 3A11A 1FX0B 1ZSNA 5D00A 5LZ7A 3S44A 2D1QA 2FPIA 3FBWA 2BEWA 5HHTA 3K32A 3B5IA 4MRMA 5A9SA 4BZZA 3E03A 4RLHA 1UANA 5LOVF 1SM4A 2YQZA 2I7CA 4JQZA 3QQ5A 1OX6A 3ER8A 1I6WA 4UEWA 4E5VA 2C96A 5AVWA 1WXDA 4DC0A 1JXAA 1DIBA 1R37A 1UBSB 2A5DA 4LF6B 2HJWA 5CA1A 2GQ0A 4HAYA 2IYOA 3S3TA 3URMA 3TQRA 1RZ3A 1M1ZA 1U8FO 3CVJA 4YQEA 4AKGA 2WJ6A 1XN4A 2J3DA 4D4GA 1PZEA 1N2ZA 1FY2A 2RI0A 1NW8A 3ZVKA 4GYKA 4MR8A 5IAEA 1T3LA 4HYQA 3ZTTA 3VMFA 5DZSA 1W0JD 3MGCA 4H27A 1A97A 4WDRA 5IAAA 4XJTA 4QQNA 1V5FA 1WXFA 2CFRA 3R77A 4AX8A 4IILA 5IZ4A 3KIPA 1JP7A 1NL3A 3MC1A 3R7NA 3TRJA 3WY9A 4FCTA 4OAQA 4PWZA 1JHRA 2R68A 4QXMA 4B5KA 3UMMA 5LQJA 4DEYA 2JHFA 3OOEA 3H1TA 3I32A 2JLSA 4HDRB 3E8MA 1CZHA 3E5HA 4DZTA 4XIJA 1N0UA 2PUFA 5F78A 1A4XA 2J5XA 3HDQA 3DONA 5T64A 1Z5OA 2PWAA 4QDXA 5FWNA 1K4MA 4O0MA 2Y1XA 1XAGA 1GPUA 3TRHA 3HU5A 4FHFA 3TSCA 1GTZA 2Q2OA 3OCVA 3PQ7A 4F1JA 2WJZB 3OQIB 1I7SB 1FIUA 2BKEA 1PGNA 2QG9A 4HNRA 2DT8A 3DMTA 1I4TD 3FCXA 1KFCB 4NMWA 3NAMA 3D8BA 2AI3A 4MDHA 4OLJA 1KE1A 3CRZA 1M7BA 3OKAA 3PHIA 3B13B 4KQKA 1VDMA 1TUBA 2H9YA 2I2XB 3QSGA 3HBLA 4ZU1X 3V6LA 3WGKA 3W3AA 4F72A 2J41A 1GGMA 3VH3A 1JPNA 4B2IA 4EJSA 1JHMA 1EPUA 1Z2EA 3HDJA 4PZPA 3RE1A 1XMQB 1FF9A 2WT8A 3D3NA 2F8MA 1W48A 4HNSA 2C3MA 4OBEA 2GSDA 3QG1A 4RVHA 4CI9A 1GKUB 1YZLA 4YMUA 5EIHA 1KMNA 2A9JA 1PZNA 2QI9C 3DMTC 2COKA 3I5AA 3NNSA 4RD4A 2VJYA 4M53A 2YCLA 4XEUA 2CVPA 3RS9A 1I2DA 3T1OA 4IH4A 1IHYA 1R9GA 1SWWA 4M0UA 5J2UB 3BHIA 3VOBA 2J6CA 2FX5A 2IZOA 1HH4A 2ZEJA 3IE0A 3NWJA 5AVTA 4RULA 1AV7A 2CJPA 2OK8A 3I6ZA 1PJTA 4XIIA 3IEVA 4JB0A 3AHHA 2I6TA 4RPGA 3ZLUA 1L3IA 5F3DA 4YMVA 3A1TA 4EJSC 2O50A 4GOND 3U17A 3EXAA 1MT3A 3R0VA 2WAOA 3LPAA 3UQYS 3BL5A 2R97A 1E9FA 2HEGA 1NV8A 1ZX1A 3UTCA 3RIXA 4G01B 1NJSA 4CR8A 1XZPA 2ZCUA 3PKJA 3GP3A 2LZ0A 3IXLA 2R6JA 1FYWA 1D6JA 3ASVA 4ER7A 3IUJA 4RFLA 2ZK7A 1P0IA 3B7PA 3IUSA 2OD7A 1P9OA 3NHZA 5CB4A 3UB2A 3FB4A 1BMDA 4XGIA 2VTEA 5F35A 1IPHA 2FA9A 2ZRPA 3E84A 3OFND 1Q1NA 1OI7A 4XJSA 1H3FA 2Z08A 4W5WA 2XDAA 2I9KA 1RAFA 4OUDA 2PL1A 3LX6A 4MQFB 2GD1O 3W6NA 5KWJA 1YCHA 2C2YA 2FMHA 3EUWA 3RUCA 3OEWA 5GZ3A 2J7PD 4OH7A 4J76A 2QTAA 1H2EA 2I7VA 2O05A 3JR7A 5B7QA 4LZNA 3Q7IA 3RS2A 3U4QB 3VH2A 1Z8FA 1W29A 4IWYA 2BM0A 4BE9A 1R8JA 3MD0A 4GECA 2YWXA 3N3AC 2HIHA 2D8AA 5ALZA 1IZZA 1GJRA 1GRRA 1D7AA 1FW8A 4JJ6A 3F9IA 2QUIA 3ABIA 4RKWA 1CIJA 3R3XA 2OB1A 1A3CA 3MMSA 2GZDA 1NF8A 3BKXA 3F8SA 3PC6A 3TCKA 5DTJA 1DVRA 3CQ9A 1VB3A 2Y93A 4JJFA 4KACA 2GYWA 1I33A 4U2DA 3TUJC 2GO1A 2HV8A 2RKBA 3ELYA 1SJ9A 1NBMA 2G9ZA 1NW7A 2QD2A 3GPDG 4CV3A 4WL0A 3F0TA 4FXOA 1ZGJA 4NBKA 5AW1A 2FFRA 3ODPA 1LK0A 3OO0A 4Q34A 5HM6A 4QM7A 1QV7A 3RHSA 2PKYX 4E0BA 2XI4A 2YUIA 1C3LA 4AURA 2FRXA 3DT6A 3WOHA 5BW4A 2H31A 2WU4A 1QIHA 2EKPA 2HGZA 2MYNA 4BGEA 4CLRB 3K4HA 5CT6A 2QWXA 2WAXA 4P7BA 2CXRA 5HKBA 3IVRA 1N3IA 1RBQA 3B9BA 1HE4A 3PWSA 5K2MA 3K3PA 3KALA 4X8LA 4UNRA 2W71A 1KSJA 1WU8A 2AXEA 2FF7A 3BTVA 3I0ZA 4G1EB 1HSZA 5EKSA 3OE4A 2RAFA 4IXWA 4U7FA 2KHZA 4BFVA 3JQ9A 1FLDA 3FZGA 3D3EA 4A2CA 1NUPA 3STWA 1M10A 5ESXA 2DFVA 4E2FA 2IY8A 3GG2A 4DMGA 8ADHA 1U2PA 3EBOA 1WVIA 1WF6A 2HNBA 3B2EA 1BJKA 1R0LA 3NRJA 2IPNA 3STUA 4TM7A 5IKOA 4LQDA 5JXGA 2GTHA 2CYBA 4OP2A 5TX7A 2J09A 4JI2B 2QAGB 5EEGA 4R8RA 5IT4A 4JFAA 3I1IA 4EM6A 1U3CA 1P5HA 2F62A 2X2FA 4TMZA 2C7QA 4P8RA 2EJTA 1IY2A 4CEIB 1DMSA 4FI3C 1DRJA 3I9OA 4B84A 4U0KA 1KVTA 3ILHA 3L7OA 5EJFA 1FYDA 1JIJA 1N6RA 4RWZA 5FPTA 3ZE0B 1ZI9A 4A5OA 2JLXA 5FBKA 1JI0A 3IAS6 2GILA 1JT2A 4DMMA 1E7YA 5EFOA 2ZBVA 2H2FA 4HQRA 3ZNNA 1F2DA 1OC2A 1KOJA 4OHVA 3Q6IA 4TUYB 1Z22A 3JQ9C 4LZJA 2X8WA 1WV1A 3VTZA 4DQVA 3B60A 2NO6A 3RG2A 2JAOA 4IMRA 4J29A 3RHFA 3BCRA 4EY3A 3RC9A 4J7AA 1FPMA 3OQOA 5EEHA 5GONA 1PHRA 1R0CA 1N5LA 1Z2DA 5LIPA 4I55B 1MQSA 2BJWA 3HKDB 3GRKA 1Y3AA 4YRRA 5EXTA 5CT9A 5FPQA 1NSYA 2QBYB 3M5WA 2Q1TA 2XGMA 4LSWA 4EBFA 1KFJB 4WK2B 1YO6A 3T4UA 3UAZA 5A0TA 3IBTA 2AX3A 2W4IA 3LLVA 3BUSA 4TLEA 1CUUA 1V5WA 4E2YA 3F9RA 3EEQA 4JJ8A 2AK3A 5AKZA 3BDAA 2QJRA 5L4NA 3G1WA 4NV3A 1NVKA 4H0NA 5BQFA 5JZ9A 1FFXB 4FGZA 2RK6A 5JPDA 5KVVA 5KTTA 3PHBE 1V71A 2NZJA 2NV2B 1K27A 7AT1A 3DGEC 1T2UA 4RD1A 3A58B 3LFTA 4BL5A 4G67A 4PG4A 2HLHA 1PJ8A 3R7BA 1G2OA 2JS7A 4Q9KA 2QP4A 4H3VA 5IC6A 1W96A 3REQA 4CEJA 2O0HA 1ENZA 4HXGA 4L72A 3TF5A 3HWSA 1ZVKA 3IUBA 3PR2B 1F3OA 1WR8A 1PV2A 4GX2A 5HMLA 3II6X 3WBBA 4Z0NA 4ZHQA 2O1XA 3H1FA 1EH5A 5FTMA 2VSFA 3CG0A 1ZW6A 4I6EA 1TT5B 4N0QA 4PNHA 3T3MB 5BSHA 3KQOA 3ORH