1NKSA

Adenylate kinase from sulfolobus acidocaldarius
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
MKIGIVTGIPGVGKSTVLAKVKEILDNQGINNKIINYGDFMLATALKLGYAKDRDEMRKLSVEKQKKLQIDAAKGIAEEARAGGEGYLFIDTHAVIRTPSGYLPGLPSYVITEINPSVIFLLEADPKIILSRQKRDTTRNRNDYSDESVILETINFARYAATASAVLAGSTVKVIVNVEGDPSIAANEIIRSMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Kinase
molecule keywords ADENYLATE KINASE
publication title The structure of a trimeric archaeal adenylate kinase.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 64
structure length 194
sequence length 194
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1998-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13207 AAA_17 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nksA00
3H0KA 1FW6A 2A2ZA 1JALA 2QE7A 1H8ED 2GHIA 3I3SR 5KSYA 1Z6GA 4OQNA 1S4QA 2XAUA 2CLSA 1KI6A 1Q3TA 2E87A 4LJAA 1L4UA 2QAGA 3AF4A 3BH7A 1TQDA 4IFEA 4TLDA 4X8LA 3EPLA 3RABA 2HXSA 4Q1EA 2QSZA 1U9IA 5CYPA 4KBGA 5KHOC 2WM9B 2GAAA 5ANRB 5HCNA 3WMGA 5BQ5A 4GMDA 5BN3A 2IYXA 3CB4A 3OEED 1R0ZA 3GLHB 1XB2A 2OFOA 1GIAA 3MMPA 5G41A 1IY2A 1HYQA 1CBUA 1E32A 2FEOA 1N6OA 2JJ8A 2GEVA 2OHFA 5C1BA 2ZYVX 4Q01A 4TYNA 5AR1A 2VTKA 2XITA 2I1QA 2VLIA 4KU4A 4PANA 4ZO4A 4XVRA 2OFXA 4KAXA 1Z2AA 4WZ6A 1DAIA 2CK3D 4PAQA 3NEJA 3NWJA 4BFVA 3NBXX 3W5JA 2FGJA 2WZQA 1DOAA 4PC6A 2CBZA 5G53C 1T0JB 2VH5R 4KYIB 4M53A 4ACAA 4TQUS 5FR2A 1L7VC 3GQBA 5M04A 2IHBA 2QY9A 3GMTA 4B3FX 2Q9CA 4XVUA 2WJIA 4B2PA 5C2JB 2NO7A 2YWFA 2CL0X 4KODA 3LD9A 4JLBA 2IXEA 3M1IA 1G17A 2IS4A 3LVQE 1ZVQA 4HLUC 1OJLA 3TW4A 2OAQ1 4P4UA 3VNUA 1OXTA 2Z6VA 2BBOA 2UVQA 4OQMA 4QGAA 1IN4A 2QROA 4F4JA 3MWKA 4TLBA 2QG6A 3KDSE 1G8PA 1CRQA 4YMWA 1F3OA 1U8ZA 2R2AA 4MITA 2WJVA 3IGFA 2RB4A 3MGCA 2NZ8A 5DSZA 3P4XA 4FMCF 2B8TA 3ZVRA 4BLTA 5JRJA 5EP2A 1WA5A 2ZROA 3DMNA 4A9AA 3LFUA 1GRQA 1Z06A 1CJUC 2GCOB 2XTZA 5G3YA 1LS6A 3GLGE 4YLGA 2BJWA 5JZVA 4MYUA 3GLIE 2BMDA 1KYIA 2ZJZA 5CITA 1EFTA 3CNOA 3THOA 4EUNA 1N5KA 4Q7LA 3ZZ0A 2O8EB 4HAZA 4NCHA 1E6CA 1Z0IA 2Z4SA 4QFMA 4D6PA 2JASA 3VQTA 1CKEA 1ZNYA 4K81B 2ZR7A 1E2QA 4A8JC 5FTNA 1KIMA 5J4VA 1E2GA 4NHOA 1DAKA 2H92A 5EJEA 1IN8A 1QG4A 1ZM3A 2F6RA 3CX8A 4CEHB 4ZKDA 3REGA 4OHVA 3LV8A 2FGKA 2J0UA 4JLDA 1TQ4A 5J4YA 1IHUA 3CPEA 2F3RA 2ZSAA 1E94E 4Q21A 3EIEA 4B6EA 2OM2A 5FOTA 3MWLA 2ONJA 3THYB 1KK0A 2QM8A 4MYCA 1Q57A 3OAAD 3R8CA 4US1R 3W6OA 3PXGA 1LS1A 4HB2A 1Z08A 2EQBA 1YVDA 5FPYA 4A2WA 1VG1A 3CRRA 2IYUA 4CGZA 4TTRA 2ZRCA 3VKGA 2VRWA 4QBFA 3B5JA 1SXJC 4V0KA 3U7HB 2W0SA 1XD2B 2ZYTX 1JEDA 1TPZA 3HP1A 3A6PC 1NIPA 4M4SA 2QBYA 1HQCA 4G0NA 4FIDA 2IYLD 4A2QA 5FPKA 3SYLA 4M1OA 2AK3A 2EWVA 1HA3A 3A58B 121PA 3AF0A 2REXB 1YU9A 4G5GA 3VHLB 4NTZA 3WYGA 5EE9A 4YXWD 1FX0B 3C15C 4NPHA 4OK5A 5HTKA 3KQKA 1NF3A 2GF9A 4FW9A 2ZRMA 3NBZC 3W9YA 2GF0A 1OH6A 2P67A 3KFXA 1HY3A 1II9A 1XMSA 1UKVY 1GILA 4JT4A 3B1ZA 3PR1A 2CEAA 2PEZA 3LXXA 1M1YE 4JL8A 3CRVA 4PFSA 3R7WA 1SXJB 1ZM4A 2QA5A 5TY0A 5BYJA 1TEXA 3KB2A 2AXPA 4WXPA 3ZZUA 1X1RA 2GILA 3MRSA 4ITRC 2V3CC 4P4SA 2KE5A 4KITB 2MMGA 3PUZA 4FMBB 1SXJD 3K8YA 5HE9A 3AVQA 1ZNXA 5DHFA 4KV9A 2QSYA 5BN4A 2XTMA 1FUKA 1US8B 2FPLA 3CBQA 3EC1A 4ZDJA 2BHRA 2ZR0A 1TTTA 3U5ZB 3RRMA 3ND8A 4JMPA 4ZDKA 2KBEA 2O8CB 1U0JA 2GVDC 4BLPA 1GNPA 3UMFA 4IOLA 5IK2D 4PO1A 1WXQA 2RGNC 1Q21A 3EPJA 3QSYA 2BM0A 2QMUA 4DLYA 5ELXA 4XWOA 4B6FA 2GZHA 2V55B 4FWIB 1JI0A 1II8B 3QG1A 4NYMR 4PHHA 1E0KA 4Z8XA 2VP9A 5JEDA 3TKLA 2QTVB 4XTCS 1EFRD 2H18A 1E4VA 1NBMA 1X6VA 5FPHA 4Z1MA 3EXAA 1G19A 4JLJA 1NSFA 2J46A 3WMEA 1OYYA 4ASUA 4DHEA 1AS0A 1W5SA 3IBYA 3IHWA 3K09C 3MLEA 1IONA 4L5BA 2W6IA 1IJEA 1R5BA 4M9XA 4Q1FA 4DLXA 4EPRA 3Q85A 1IXRC 2GEUA 1EFUA 1KK3A 2VQSA 4AYTA 3SZRA 1LB1B 4GNKA 1GRNA 3OEHD 4PAOA 1SZPA 4IOKA 2H7VA 3UWOA 3W5IA 3GFPA 1AGPA 1BMFD 1F2TB 3NDPA 4DLUA 1QVAA 2CCJA 5J4HA 2RGXA 1KY3A 2BDTA 2RGCA 4HLDA 2CCGA 3ZD6A 4K46A 4L4UA 3AEZA 1XCMA 5DYGA 2P65A 4ZCMA 5J47A 3ADDA 4BWYA 1ZP6A 2ZR9A 4S2EA 4IW3B 2O5VA 4U5XA 3EG5A 2ZPTX 5E7IA 3RSLA 4RVCA 1D6JA 2AFIE 2DWQA 2L0XA 4OHXA 1Z0JA 1KMHB 4UXIA 1ZNZA 5FFMA 3ASZA 4B71A 5IF9A 3G82C 2CL7X 2G6BA 1ZCAA 1D2NA 1T8UA 5L8VA 3EPHA 3BIFA 1N0UA 4EJSA 3NKVA 1OFHA 1R8QA 2ZJ2A 1ZM9A 3PENA 2F1RA 5GJBA 3SC3A 3B82A 1OB2A 1R7RA 1GM5A 2G0NA 1MH1A 1EX7A 1VPLA 2R6CA 3C8UA 3LX8A 1RW4A 2REBA 4C0JA 3U3OA 1RIFA 1P61B 3GJ8A 2IBMA 1KAGA 2R62A 4FI3C 1UFQA 2IWHA 1VKJA 2H57A 3ZGXA 2ZJOA 2XNDD 4HDOB 4RFSB 4XVQA 5JEEA 3KKPA 2OBLA 3QUSA 2QAGC 4PTLA 1KDRA 2ZVPX 1OT3A 4NONA 3C7KA 1WDTA 2KB0A 1TADA 1U9IC 4A92A 5J4KA 1NN1A 1COWA 1P6XA 4ZI2A 3U44B 3AF3A 2DCUA 3GLFE 3HYRA 3A1SA 1VDZA 3NBFA 3QF4B 4LHVA 3LWNA 4M1KA 1HT1E 2Q3FA 4DB4A 3WMFA 1OFTA 5F9FA 4A0HA 4B34A 2VP5A 2IS1A 1CS4C 4DLVA 2O0KA 2J45A 1E3MA 2O0HA 1AZSC 2IUUA 3NC0C 2G9NA 3R8FA 1NLFA 5HPYB 2HT6A 3O8CA 2GWHA 4TYQA 5KPJA 2YC2C 1EGAA 4HB4A 1HQYE 2MSDB 3KB1A 2WOOA 1G5PA 4GT1A 2VF8A 3K70B 3RLFA 3RDPA 3GEIA 4AC9A 4BQSA 2B92A 5FTJA 2C9YA 4GOJA 1JAHA 1BKDR 2JCSA 3KQNA 4ZDWA 3LVRE 5AJYA 3V9PA 1Q0UA 2XZLA 1GDDA 2WWYA 1TF5A 4Q03A 4KYUA 2AD5A 1IXZA 3KL4A 3LBIA 3UKDA 3EZ9A 3NXSA 2DB3A 1G7CA 3LRPA 4GOKA 3UIEA 3QKSB 3WY9A 4HLCA 2C03A 2CXXA 1CJMA 3THXB 3P4YA 3TRFA 2KBFA 2ZI4A 2IEZA 3DKPA 5LDDC 1X1SA 2J3EA 3BD9A 4HZUA 4IOJA 2RKOA 3AVXA 1N6IA 2QMHA 2CJWB 3TIFA 2OCBA 2IYSA 5IT5A 3BK7A 2ZM5A 3MUFA 3TR5A 4GRAA 2ASEA 2PX0A 2W2XA 4RSGA 4RJLA 5B57C 4LCBA 3GJ5A 3UG6A 4EKDA 3CW2A 4J0QA 1KK2A 1P2UA 2A5JA 1EWRA 1CULC 2QUZA 3LNCA 2O8BA 1NIJA 3N70A 1AQYA 5G40A 1W0KA 4HEJA 4IXNA 1OHHA 1NMZA 1OB5A 3TMKA 1SVKA 5AJZA 5LBIA 3SNHA 2HYIC 2EWWA 4M22A 4MKFA 1P2TA 4CEJA 1S3GA 4Q9KA 4JYBA 3BFVA 1B0UA 2VP6A 1UADA 4OL0A 5EXTA 1IAQA 1VCNA 4UNNA 2ZI5A 1RJ9A 3LLUA 1K5DA 4AG6A 4Q9HA 3F0TA 1Q1BA 3BORA 4LJ7A 4CW7A 2BMEA 4A1FA 3CKLA 1S3SA 4UNPA 2OCYC 2WWIA 5CIWA 1G3RA 2BC9A 4HZIA 3H4MA 2O52A 4NU0A 2ZI3A 3LBNA 1Z3IX 1DAGA 4V0NA 1JB1A 2YZ2A 4QGHA 4TQAA 3T34A 2J0SA 1W36C 4V0OA 3CR7A 4LC0A 1G4AE 1RE0A 3RWOA 3W3AA 2R65A 1XEXB 1XTRA 3KTAB 4HAYA 3RS7A 5CK4A 4DKXA 3MG9A 3QPVA 5FUVA 2W2TA 3I4LA 5CYOA 3MCAA 2CVFA 4TYPA 4HUQB 4GL2A 4FWTA 2JLYA 1Z6TA 1XDBA 2QPOA 4M1YA 4UNRA 5KUTA 1R5NA 3UG7A 5CB8A 4F91B 3IIKA 2JDID 4B43A 4PXAA 2OLJA 4FCWA 1QVRA 2C8VA 4K8OA 4DSTA 5E3HA 8OHMA 1ZD1A 1ZUNB 2C95A 3L8ZA 2CHGA 2H16A 1E9EA 4LJ9A 1G7TA 3LBHA 3PEWA 1QG2A 2V7QA 3R9WA 2F9LA 2HF8A 2WMOB 3NHBA 1DEKA 4NCKA 3VAAA 1W7AA 4YMVA 2QGNA 2ZJYA 1G291 3MD0A 1W36D 1M74A 2OLKA 4NP6A 3FFBA 3W8NA 2C9CA 2JIZA 1XMIA 2IYZA 4QJ4A 2OILA 4M1MA 3TLXA 3BXZA 4BFYA 5FBRB 5EXXA 5JFGA 4TQ9A 3AVYA 1NBME 1ZCBA 1ODFA 2CHQA 4MRSA 1QHHB 2X19A 1RYHA 3VR3A 1YR9A 3CZPA 2ZRHA 1CR0A 5FI0B 3K0CA 1VHLA 2O8DA 3EZFA 1NVUQ 2V6IA 3L8YA 4HDCA 2NPFA 4V0MA 3R7WB 2ZQ5A 3L43A 5UKDA 4BLOA 1YHNA 3RVBA 3VR2A 4OJQA 1G3QA 2QQEA 2IL1A 4LHYA 5GJCA 5H68A 1C4OA 1RC8A 3C16C 5FOXA 2HXYA 4R71A 1XRJA 4I1OA 1ZM2A 3RS2A 5K8UA 2G3YA 1ZU4A 3EZ7A 1KSGA 1HT2E 4UNSA 1BIFA 1RKBA 5FOVA 2QMOA 5F3WB 3BWDD 1N6PA 2WWFA 2CNWD 3I1FA 5HCIA 1UKYA 1OW3B 1T6NA 2ZJ8A 4RD6A 1IXSB 5IDVA 1YQTA 2HEIA 3RC8A 6Q21A 4G5SA 1E2LA 5JMTA 3HYTA 4Z8YA 2PZFA 3CH4B 4Q4LA 4KFTA 3S1AA 3D8BA 3THWA 4L16A 5B30A 4I1SA 3T12A 5B64A 1IY0A 4OQFA 3PEUA 4QXAA 4BEBA 1AN0A 4WIAA 1VHTA 3HU1A 1R6BX 2NQ2C 3A1UA 3IQXA 1NBMD 4FCTA 3H2YA 5TV2A 1ZC4A 3D31A 1DE0A 1E79A 4RY2A 4DT1A 3CRMA 4Z1MD 3V4RA 5CM8B 4ASUD 4YQFA 1D9ZA 3WBKA 1PJRA 1QF9A 2W6ID 2CLDX 3SYNA 4NYMQ 5F2EA 4OBEA 3K0AB 4A15A 1OF1A 1UJ2A 4GFDA 1SVWA 4DLZA 2WVJA 3AP3A 3BGWA 3CRQA 1G7SA 1XZQA 3Q72A 4FMDF 5E95A 3KKNA 3WNDA 4IDHA 4HDQB 1WB9A 2F1JA 3CR8A 1S8FA 4M21A 1DPFA 1P7CA 2DWOA 3TSOA 4DJTA 3Q3JB 4DCVA 4Q47A 3A1TA 3SE0A 3WYAA 3NG1A 3BS4A 4D4LA 1QHYA 5E4FA 1N5LA 3BAFA 3SN6A 421PA 3B1WA 3EASA 4D4KA 3GD7A 3GP8A 4C7OA 1W0JA 2Q6TA 1DELA 5J5CA 4GDFA 4LYFA 1GKYA 2VYFA 3QXCA 3AVVA 3R20A 2V9PA 4D0NA 5C4MA 1E1RA 4LBYA 4YC7A 3PVSA 1P60A 2RHMA 3VU9A 2FWRA 4YDHB 3DPUA 1G41A 5BN5A 1T8TA 3LQRA 4B32A 2BIFA 1DTSA 2PZEA 4CVNA 1G6OA 1MT0A 1NLZA 4DCSA 2JEOA 4I81A 4V0LA 1VG0B 1KNQA 1U99A 5DYIA 3WNBA 4GP7A 4OQXA 4B75A 2E1RA 2GZAA 4LYAA 2VO1A 3RS4A 4MKHA 2V54A 3LQQA 3I61A 3A4NA 1A2KC 5JSZB 1A2BA 2YOFA 5AJWA 1CR2A 1LTQA 1T91A 1P5ZB 3P1JA 2G0TA 3NIBA 4JYCA 2ZVQX 1KI1A 4JLOA 3SOPA 3VHXA 1XTKA 2GJKA 3I8SA 1E9SA 2IYRA 5DGXA 2FJUA 5CJPA 4TMWA 2O8FA 2FNAA 2XOKA 5DNYB 3FMOB 1VIAA 5KTYA 1SVOA 1B23P 4CT4B 5JWRA 2BWJA 3EX7C 3NVAA 2GCPA 3LLMA 1N25A 1TU4A 2JJ1A 3C4JA 2ERYA 4G5OA 3VR4A 2FDCA 4Q4HA 5JBQA 5IHPA 2QT0A 3U4QA 3AGQA 1D5CA 3HPQA 3QKRB 2HYDA 1JQLB 5KDOA 2R6DA 3VNVA 4JJZA 1D2EA 4LDJA 4X8MA 3PFIA 2ZS9A 2HCBA 4WAUA 5GVSA 4Z51A 4XOIA 2J7PA 3I32A 3K0FA 4GPTA 4O2LA 4BLQA 5D3MA 2QP3A 1YR7A 2ZSFA 3Q5EA 4JIMA 3OE7A 3L2OB 2GXQA 3ZDQA 1JQJC 4A6XA 1E9CA 1XTJA 4FMDB 4KSBA 3I92A 4MGYR 3QEJA 2GAOA 1LY1A 5L3RA 4TTQA 1E9FA 1EXMA 2B7CA 2FOLA 3EZ6A 5FI1B 3B1XA 3U3MA 1IY1A 2OAP1 2YINC 4KFSA 4NCNA 3IQWA 2C99A 3GLFA 3BRWD 1NSTA 1QDEA 4UQOA 5CLLA 2ZRPA 5HKKD 4C0LA 2HLDA 4ACBA 2MMCA 2VF7A 4C3ZA 4PX9A 1TF7A 3B1VA 1Q44A 1IN6A 3WYFA 4PQRA 4DLTA 2R6GA 5KOYA 1AZTA 3TAHA 4MRNA 4MQBA 1AQUA 5FL7A 2Q9AA 1XD9A 1W0KD 2OEPA 4DRZA 2ORWA 3F3YA 1OHHD 2GDJA 3ND9A 1KY2A 2ATVA 1M7BA 1QHSA 4H1VA 4DCNA 4ON9A 3TVDA 2JLZA 1JECA 3FTQA 5LB2A 1I2MA 2G1JA 4EQ6B 2GEDA 5FUYA 1MO3A 3EW9A 4GBMA 3GJ4A 4DCTA 2JA1A 3LY5A 4M8NE 4PO9A 4V03A 1NMXA 2REOA 3QIAA 1OH8A 2QQ0A 3T15A 5DI3B 2RMKA 4QNRA 4Q4JB 2ZRJA 3CH5A 4M9SA 2OBNA 3CX6A 3IHLA 3CNLA 2YWHA 4FN5A 4DBLC 4LGMA 3UPUA 2JLXA 2ZRAA 5TDHA 3PUVA 1OV4A 2ZRBA 4V0ME 1VG9B 1KDOA 3KXKA 1F2UB 1M8PA 3WRXC 2IW3A 4PO8A 1NVWQ 1TNDA 4GZLA 4PPFA 4F7WA 4BZXA 1G16A 1WRBA 2TMKA 1E2PA 1TQ6A 1UKEA 1XEWX 5CM9C 5DLQC 3UATA 3LAWA 1Z63A 3BOSA 4HLQB 4Q4AA 1AKYA 1A7JA 1AS3A 1E1QA 1GNQA 2V4ZA 5JHGB 3U61B 2XB4A 4OHWA 4JSYA 4POAA 1ZMXA 4Q66C 4U00A 4Q9LA 1JPNA 4B3GA 4BUJA 2JGNA 3D3QA 4NBSA 2WTUA 5AUOB 3Q8XB 1G5TA 3OIVA 3RRNA 4DEXA 3QQ5A 2JJ2A 2NO0A 2OFWA 4YMTA 2J0VA 4A8JB 2NOAA 1KNXA 2P6NA 3PJRA 4D26A 4AI6A 4A6PA 1P72A 3FE2A 1W2HA 1S9HA 3GLGB 3KX2A 2D7DA 5EZ5A 4LHWA 4PZZA 4P32A 2HJGA 1O87A 1T3HA 4WZAE 3GLIB 5A0FA 4ARZA 2D74A 1XZPA 1MABA 3DZ8A 4LJ6A 5CLQA 5H8WA 3ICEA 4R2HA 5L3QA 1P9RA 1JR3E 3T5GA 3M4YA 1HE1C 3NC1C 3DOFA 4CIDA 5C46F 1XWIA 3NTUA 3QOFA 2WJYA 1W49A 4XH9B 1P2SA 2W00A 1J2JA 4FINA 1A1VA 4XWAA 1X86B 4QM7A 4JVSB 4XD7A 4RD1A 2QN6A 4B44A 3TVTA 1F5NA 4LJ4A 2PT7A 5TARA 2WWWA 1YJ5A 5JRZA 3DM9B 1EESA 2R6FA 1GOTA 3WBJA 621PA 1ZYUA 4QM6A 3U60B 3ICQB 2IWRA 4FMCB 4C4PA 4YMSA 1E2FA 4JLAA 221PA 1HH4A 1KO1A 3GEHA 4CEIB 1S2MA 4IHQA 1NVXQ 4WXRA 3S1AB 4XIGS 2PMKA 1JXOA 3DL0A 3PIRA 4BASA 2ANCA 1ZD9A 4L9SA 4LPKA 4UXJA 1MR3F 4BZQA 3EIHA 3JVUA 2ZUDA 2D2EA 3VFDA 5FPSA 1QHGA 1GZSA 1Z6XA 2V1XA 2P6RA 2Z0MA 2ZI9A 3KKMA 4LJ8A 4TMKA 2CE2X 2BJVA 2F9MA 4TT3A 2ZRIA 2C5LA 2JLWA 1DO0A 1TU3A 1QRAA 1P73A 1A82A 3ZQ6A 2FSFA 4AWXA 2CDNA 1N6LA 1J90A 2NZJA 2DFTA 4OHYA 5GJWC 2HJVA 2H17A 4FCVA 4OQLA 3SJBA 5FBQB 1NL3A 2NG1A 1XPRA 4DDVA 4WBSA 4B76A 2FV8A 3WP0A 3E5HA 1KOFA 5JI3E 1ETUA 1W4CA 5FTKA 3RYTC 3AH8A 4UNQA 2ZRGA 3VR1A 1LVGA 1Z5ZA 1XEFA 2OCAA 2ODBA 2ZRFA 4DSOA 4JL5A 1DAFA 5SZJA 1LF0A 5JS8A 4Q19A 3O8DA 1E98A 4TLCA 4BFTA 1J99A 1TAGA 4ZKEA 2C98A 5CJ2A 3SBEA 2ZYUX 4IDPA 1W0JD 3ZH9B 2A5DA 5KU1A 2XXAB 3H1TA 3KXIA 1L2TA 1FNNA 4QHYA 3GCGA 5SZHB 2Z5FA 4ESVA 1E1RD 3X1DA 2IYVA 4LRWA 4Q00A 4MH0R 3GFTA 3CLVA 4KVGA 4BLRA 3NHAA 1FUUA 5GJVC 2Q21A 4R98A 3X1YA 2V6JA 1KSHA 2AL7A 4LY6A 1SVLA 1VIYA 1VYVA 2HV8A 3JZMA 3H84A 5JJIA 4D25A 4F93B 3SI7A 1W48A 3VX4A 4AK9A 1Q3HA 3LDAA 2QEQA 3QVUA 4PC3A 4QBGB 4EFLA 3AM1A 5LPNA 1L4YA 1DG1G 4QJ5A 3TUJC 4TL9A 2ZU0C 1Z22A 3TSZA 1TUIA 2XJ4A 1KAOA 1UM8A 2WWGA 4O0MA 1YZTA 2XOKD 2A78A 4DUGD 1XTQA 3MWYW 1U98A 3QG5A 1IOZA 4NCJA 2FF7A 4QC2A 4C0HA 5EE1A 5FUWA 5TVKA 2IXGA 1E2EA 2JJ1D 4TTPA 2VA8A 1Z29A 1ZU5A 4Q9JA 1HUQA 1NMYA 3ZIAA 4JJKA 2IYYA 1KI6B 2P6UA 2QAGB 2QNRA 3UMRA 4R2IA 1E9RA 3JZAA 4Q7JB 4OK3A 4TL6A 2YJTD 3SFVA 2QE7D 2ONKA 3O8BA 2DR3A 2ZREA 2AXNA 2NTYC 3Q7PA 3WHKA 3KQHA 1N0VC 4L9WA 4GOXA 4D0GA 5JLJA 3SFZA 1UBEA 2J9RA 4OHZA 2ZYWX 2FEMA 4E5UA 5EUQB 4ZPXA 5L3VA 3IDQA 1TMKA 2ZI7A 4ZIRA 521PA 3IUYA 2AWOA 2W2VA 1KZ7B 4KO8A 1HV8A 1XCPA 2NO9A 1MOZA 1E2JA 2JAQA 2ZUBA 3AKDA 3CWQA 1DG3A 2PMDA 2ZUCA 3DOEA 2VPPA 3DDCA 5KNBA 3K0SA 4M0LA 2MSCB 4Q18A 4PC2A 821PA 1PZNA 3BB3A 2WOJA 2LWIA 4AYWA 1YRAA 1ZBDA 2ZEJA 3N2EA 1J8YF 1OH7A 1UAAA 3KUDA 4TMXA 4BPBA 2H1LA 4HAVA 1E2DA 1QHNA 1P4SA 1E99A 2QM7A 5BYKA 4X8OA 4P4TA 3OEEA 2KI5A 2D7CA 3QXJA 4BRWA 1Y63A 2A5YB 2PJZA 3WRYC 1TQ2A 4A82A 2WIAA 3TQCA 1DO2A 1TEVA 3GLHA 4D2IA 2P5SA 2OV2A 4OKSA 5FL7D 1WMSA 2LCFA 2RAPA 2PCLA 1E9BA 4QKQA 2CK3A 1W1WA 2GJSA 3OHMA 4QHSA 3W3ZB 4G3XA 3X1WA 3PG5A 2PJRA 4LK2A 5HZKA 2OESA 3ZZTA 3EC2A 2PCJA 1VTKA 1R5OA 1Z2CA 4MUBA 3DVLA 4DDTA 5AJXA 3U7GA 5JWOA 4LV6A 4R9UC 5C4GB 4RD2A 1SVSA 2N42A 2QL6A 4JL6A 4US0R 2BCGY 1G8FA 2R6AA 3IO3A 1T5LA 4NDZA 5BXQC 3W8RA 1DVRA 3U7EB 1NG9A 2FZ4A 4URUR 3TH5A 4JBYA 2DYKA 4GZMA 1GL7A 3A37A 3FHCB 4PPNA 4DSUA 1VCMA 3DKVA 3KJEA 2J0UB 5EQTA 4BFSA 4BFWA 4M1SA 4KSCA 4KBFA 3ZD7A 1ZRHA 1N6HA 1SHKA 4BLSA 1D8TA 2FFQA 3DO6A 4HB3A 4URYR 4B3DA 3I5YA 4LJ5A 3QXSA 1TL7C 4UJ3A 3H86A 1Z47A 1Z8FA 2GK7A 4NKRA 4TSFA 2GVZC 2OZEA 1XXHE 1XJ0A 2GCOA 1KTVA 1PVOA 1E1QD 4PHFA 3QKTA 3Q7QA 1SGWA 2I3BA 3TQFA 5EE0A 2O8EA 4RCYA 5FBWB 1W36B 2IHYA 3ZVLA 1U8YA 2FFAA 1VMAA 1N6RA 1DBSA 5CK5A 4URZR 4BFXA 4ZV4A 2QBYB 4N3NA 3TR0A 1U81A 2DBYA 4ARZB 1I4DD 2VSOA 5KNDA 4CRWB 5GADl 4CEHA 3ZS9A 2FSGA 1E4YA 2OXCA 2WMNB 2ZU6A 3SJCA 1KI9A 4C9BA 2ZETA 3FFAA 5F98A 4NL4H 2KJQA 4IDOA 4LBZA 1LW7A 4JLPA 2ZIAA 4OI2A 3THYA 1Z6AA 2B21A 2CL6X 2ZJ5A 3ETLA 3OFNA 3T61A 1XMVA 1W4RA 1G18A 2F3TA 2I1VB 3EZ2A 1T4GA 1LV7A 3V00A 1HURA 1E2MA 5FOSA 2LKCA 4P4SB 1KGDA 1GNRA 5LB4A 2V8OA 1U0LA 4XD7D 1DAEA 4A0FA 4DSNA 1FFHA 4PAMA 4GI7A 4JLVA 4W5HA 2YOGA 3ADKA 4HUTA 1OIVA 5CDFE 3K1JA 3AF1A 3T1QA 4I4LA 3AUYA 2H8KA 3TUZC 3C5HA 2B8WA 3CM0A 1TUEA 3QKUA 3BERA 1SKYE 3FVQA 3LXRA 2X77A 1GL9B 3P27A 3U6BA 1CJVC 1P2VA 1FX0A 3CPJB 5TB5A 3WXMA 4OK6A 1RRPA 2IYWA 1E2IA 4LPSA 1YR6A 2CCKA 2W83A 4CDGA 2JLVA 4LSGA 3ZVNA 2OO7A 2VHCA 4KLZA 4TMTA 1D9XA 4AYXA 4Y0AA 2AN9A 4Q48A 4NYJR 5AJVB 5KPDA 1KI8A 4WZBE 3GFOA 3U3KA 4JBWA 1PUIA 5KSOA 1KI3A 1NKSA 4MYHA 2IUTA 1SXJA 1Z83A 3VMFA 4W5WA 1CXZA 4KVAA 3MSXA 5J4LA 4P31A 2D3WA 2QRZA 5DO9A 2XZPA 1BOFA 1ZUHA 1JR3A 2IYTA 3A8TA 5AWFC 4AG5A 2WPDA 3AKCA 3L0IB 4RCZA 2BV3A 3QPUA 1M7GA 4O3MA 3SS8A 1V43A 2QU8A 3OZXA 1CR4A 4EJSC 1X8LA 4OI0A 4IXMA 5IK2A 5JCPA 5AUQA 1US8A 3AVTA 1T3LA 1XF9A 1KO8A 4UXHA 1WQ1R 1CEEA 2G88A 1I4LD 1SHZA 4A0GA 4GMXA 3RNLA 2QMEA 2O8CA 2ZXUA 2AKAB 2AX4A 1CTQA 2X2EA 3B8HA 1KI7A 2OXRA 2CHVA 3ECCA 1NI3A 2GKSA 2C78A 1II8A 3I73A 1H65A 1GWNA 2IYQA 1ZAKA 2FE4A 1E0SA 3LW8A 3RS0A 1P9WA 1GVNB 2QTFA 5EUMA 1Q1EA 4IVRA 2AR7A 3RANA 4EJSB 5KYKA 1RYFA 2G83A 4KFRA 1BMFA 4KFUA 3AF2A 2J0QA 1G5RA 3FDIA 3QBTA 4PR0A 2FZLA 1KO5A 1NN0A 4LZZA 2BMJA 1GRRA 3E1SA 4DIEA 3I62A 3TK1A 4AKHA 1EX6A 1P3JA 1F6BA 2RGBA 1F2TA 3B7GA 4Q1DA 4QG7A 2WAYA 3CX7A 4TN1A 3FMIA 1FP6A 2VP4A 1OKKA 2VSFA 2YOHA 4JLMA 4LX0A 1NJGA 1XD8A 2BOVA 1Z07A 2QRNA 3IIJA 2V1UA 1M2OB 5E7JA 1RFLA 1CP2A 1KJYA 2GCNA 1KMHA 4RD3A 3IPYA 2BBSA 1N2CE 3HR7A 4PHTA 3K09A 3KZ1E 4NYIR 1OFIA 3GJ7A 3SJAA 1IN5A 1Q22A 3HU3A 3QBVA 3A36A 1COWD 4LC1A 4KI0A 3AVPA 4MKIA 1LF5A 1NY6A 4Q1BA 4B2IA 2HUPA 2GTPA 2PT5A 4FXPA 2XNDA 3NH6A 1NLYA 1RVDA 2UZ3A 1N5JA 4OJKA 2VP2A 4BEJA 4RZXA 3SJZA 3U3JA 1XCGB 1P75A 3FYHA 5EP3A 2NO1A 2J87A 2ZTSA 5J40A 5JWHA 4JZKA 4KHZA 1BYIA 2PH1A 3QE0A 4RFSA 1AK2A 3GLHE 1IBRA 5CIQA 3VKWA 4C0SA 1N0WA 1G4UR 2Z4RA 4G5RA 3ZIAD 3VR5A 2F1HA 1CRPA 1QHIA 2ODWA 3RSOA 4L8GA 5IRCD 1Q1ZA 3B6EA 4QJ3A 4V02A 3HR8A 3B1YA 3U44A 5LD2C 4MKGA 3RHFA 2AWNA 2WKRA 3D7MA 3QPWA 3PEYA 1XJQA 3A4MA 2ZE7A 4AKEA 3QF4A 1Z6YA 2QGZA 1OXXK 2PX3A 1C9KA 3LW7A 4TYYA 1G64A 2ZE5A 5F9HA 1R4AA 1W2GA 4DDWA 2OT3B 4EAQA 1JBKA 4PC1A 2IUSA 2VHTA 1H8HA 4A0RA 4RZUA 3IEUA 4HZUB 4LV5B 1ESMA 3V4FA 4KLNA 5KDLA 2J41A 1WP9A 2J1LA 5DN6A 1PUJA 2D2FA 3NDBB 1Y3AA 1G1MA 3OIYA 1VG8A 5FOUA 1W44A 3KKQA 3B9QA 1MO5A 3X1XA 2QAJA 2YHSA 5B58C 2ZS7A 4W7SA 4AY2A 4D81A 1Q12A 4IFBA 2VBCA 2RGGA 5LD2B 4LYJA 2O8BB 3W34A 3FKQA 4MRVA 1JJVA 1U8AA 2NPIA 2BBTA 1KJZA 3K53A 3QNUA 4BFZA 5FOWA 2IXFA 2WV9A 2IF2A 3PCRB 3QKSA 4CT5A 4CEJB 2LKDA 3CUEF 3THXA 3PUWA 2PZGA 1VCIA 2FX3A 4QBIA 1J70A 1K6MA 4D80A 3SR0A 3ONWA 1R2QA 1RJ9B 2NMVA 2VHJA 4W9MC 3WHLA 2FMXA 1II0A 2GXSA 4DVGA 2CJWA 3KQLA 1R10A 3FMPB 3HPRA 3U2QA 1SVMA 1I2DA 3X1ZA 3FHOA 4IEEA 4M1TA 1WCV1 4HATA 3AP1A 3T5DA 1AA9A 1W5TA 2P0EA 3UK6A 1ZJ6A 1OLOA 4Q9IA 3EWSA 4MA4A 4B3XA 3MJRA 3SYKA 2ZAMA 1WE2A 1FOEB 1RRGA 4TMZA 2R9VA 4H9GA 1YZNA 4G5QA 3IKJA 3SEAA 2K5UA 3AB3A 4WA7A 1U90A 1Z0DA 5H70A 5AUPB 1KJWA 2G1KA 3DHWC 1D2MA 1OYWA 4MRRA 1OH5A 4EPXA 2R8RA 1KK1A 1KDPA 3C14C 5DIFA 2Q3MA 4Q7KA 2OE2A 4RKFA 1XEWY 3KFVA 1FMLA 1GUAA 2WSSA 3FWYA 4QHTA 3NBYC 2DFKB 3K0CC 4NH0A 3CNNA 4PPGA 2HF9A 4PSKA 3GEEA 5H1YA 3FMFA 4TSFD 4BFUA 5JJKA 3E70C 4JVNA 1UBFA 4LYHA 1RPZA 2XB2A 3QF7A 2W6JA 3BB4A 2XGJA 4W5JA 3O47A 1VYTA 1OE0A 2X8AA 4C0QC 3L0SA 1P9NA 4BE7B 4G1UC 1EG7A 1KDTA 3M6AA 5E7MA 4F38A 3IBGA 4DLSA 4CZ2A 3FOZA 1BS1A 1FPMA 4QNMA 1XEXA 1IJFA 3KTAA 2RCNA 3DEFA 4HAWA 5KSPA 4UKDA 5DE3A 2V7QD 1GTVA 4DLWA 4Y0VA 1OSNA 2JATA 2JDIA 3W6PA 3B13B 2MSEB 1SXJE 2IK8A 2VL7A 4HUQA 2FH5B 4HYYA 4E22A 2EFCB 3FPAA 2JIZD 2AKYA 3TNFA 4MYTA 1G6HA 1JPJA 2O8DB 1SKQA 2FG5A 4Q1AA 3K9HA 1ZW6A 1J8MF 1CF4A 2ODEA 1X8KA 4DB2A 2N1BA 4YDSA 2WJGA 5FTLA 3OFND 4S35A 1ZNWA 2WWXA 1G9XA 4TMVA 3MAAC 2F7SA 4TYWA 1O3YA 4B33A 2BEKA 1HTWA 4IJMA 1G20E 1P62B 4PC7A 4IKEA 3TGPA 2ANBA 3OESA 1NVVR 1YE8A 2IC5A 2CMKA 2BKUA 5BWMA 2J59A 2EYQA 2F43A 4TLAA 1JR6A 4Q02A 3KUCA 1XXHA 4ZCLA 5K8LA 2D06A 1JAIA 3B2EA 4US2R 1IM2A 1GL6A 1QHHA 4NZYA 1ELOA 4AIIA 1TF2A 1W47A 4PQYA 4URWR 4C0BA 1UBCA 2EFHB 3I72A 3QXXA 3X2SA 1U2RA 3IIMA 3ADCA 3THWB 2FFBA 1ZIOA 3T1VA 5KDDA 1YKSA 2Q9BA 2CE7A 1ZIPA 1Z0KA 1G8YA 1S1CA 1UEIA 4B3CA 1F60A 4I1UA 2BCJQ 1LNZA 1JEEA 2CNWA 3TUIC 1G3UA 4TWZA 3RRYA 4DT1B 4TZ0A 5FL3A 3BH6A 2YKGA 1OIWA 1AM4D 1FMJA 2DWPA 3CPHA 1S9DA 3U6KA 4NYJQ 4RD0A 4B3BA 1JR3D 4TLEA 2WPDD 4NE2A 4YMUA 2C04A 2JLUA 4XTRA 4JS0A 2WIBA 2GJAA 3FB4A 1E79D 1N6KA 4N0DA 4HI0E 5JECA 1KZGB 3N2IA 4EPYA 2QPTA 3EAQA 3F8TA 5A5GA 3SU8A 3IO5A 4JLNA 2VHQA 1FQJA 5DISB 5FR1A 1OIXA 3MJHA 3CWZA 2QP4A 2W58A 1YZUA 5D3QA 2XSZA 3A1VA 4RZ2A 3LA6A 5EE3A 2G77B 1FL9A 4NCIA 2A5GA 5G3ZA 5CDFA 2NGRA 1ONBA 2ZSDA 4F92B 5L3SA 3E2IA 2VEDA 3EA5A 5FH9A 3GJ6A 1EWQA 4M2LA 1ZINA 2KSQA 4B2LA 4D82A 1NN3A 3D6TB 4C7OB 1CJKC 4KCGA 1GP2A 1XU4A 4BECA 4JBXA 1XNJA 2YV5A 5KO2A 3U7FB 1KHTA 2ZJBA 2FPKA 4EPVA 3AQ4A 2C2HA 2DHRA 4AD8A 3T1TA 4JVMA 1RRCA 5JHHB 2WHXA 1N3BA 2BBWA 4LV8B 4UJ5A 3HJNA 1KMQA 1KO4A 1ZD8A 1UDWA 3K0AA 3VU9B 1SQ5A 2QPAA 3CRW1 4IOMA 1XPUA 2QENA 3P26A 5HZHA 1NKTA 3LO5A 2VSXA 1IN7A 4P33A 3RWMB 4E03A 1YZLA 4R7ZA 3REFA 4IRUB 4PSVA 4X8HA 1GKIA 3KJIA 1OFUX 3AGPA 3ZYCA 4TZ6A 4LI0A 4DZZA 1OKKD 3MFYA 5EP1A 3C5CA 1EFCA 3AKEA 3T06B 4N1AA 2J5XA 1DARA 3CO5A 4C30A 4Q1CA 2W0MA 1ESNA 2EFGA 3I8XA 2GBLA 2AFHE 3EPKA 4XSHA 2O8FB 5C18A 2EU8A 3EWAA 3B78A 4II7A 4LJYA 1SVIA 4WOPA 3SQWA 3HWSA 2O0JA 1KSFX 2XX3A 1T9HA 1G8HA 4GP6A 3RRZA 2QI9C 3PQCA 2NIPA 4Q4HB 3T1OA 3U4QB 2PL3A 1XTIA 2RH5A 3AUXA 2R44A 4B47A 4NYIQ 1JJ7A 3K70C 2SHKA 1BYUA 3FKSA 1PV4A 2GK6A 3L0OA 3P32A 4RD4A 5JSZA 3CF2A 1WBBA 3K0FB 4B48A 2QZ4A 1G3MA 2B6HA 1IQPA 2GJ9A 5D3MB 2B7BA 3KXLA 4E09A 3IEVA 2XTNA 1ANKA 1U94A 2D62A 2YWEA 4PHGA 3W90A 4F4IA 4U02A 4P0TA 1ZM7A 2GA8A 5DH9A 2J7PD 3DMDA 3EIQA 1KO7A 4DC9A 1G3IA 1RZ3A 3BFXA 2A3RA 2CVHA 1G7RA 1RRFA 1YZKA 3OE7D 4H1UA 4LOAA 4QL3A 2IEYA 2C96A 4C2UA 4LWZA 3PV0A 1XBTA 4I1VA 1KI2A 4YONB 5JCZA 3C41J 3CF0A 1H8EA 1X8JA 2A7QA 2HCJB 1H8HD 3DM5A 3TW8B 3K9GA 1AJEA 1W46A 3CIOA 1GSIA 1X3SA 2YC4C 3GLFB 3QKRA 3CZQA 5DN6D 1MRSA 1E2HA 2WJHA 3LH5A 3TBKA 3T35A 2QT1A 3K70D 3B60A 5AK0A 3R9XA 3GJXC 2IS2A 3AVUA 1BH2A 4DEYA 5FTMA 3ZS8A 2WICA 1Z28A 4LHZA 1JNYA 4C0KA 4M1WA 2HLDD 3WNCA 4CYMA 2D4HA 2Z43A 2Y8EA 4JSTA 3QI2A 4IEIA 1T0HB 4OYHA 1Q1QA 3UANA 4ZCIA 4ILEA 2ZRDA 3ASYA 4A4DA 5HKKA 3PEVA 4OI1A 4O25A 2PBRA 1E69A 3ADBA 3HDTA 1Z0FA 2P5TB 2N46A 4PQFA 2J7KA 1MRNA 3K9LA 2DY1A 4BGDA 3M0EA 1WBDA 2WKPA 4M9ZA 4MDFA 4BRUA 2ZS8A 1YRBA 3VX3A 5DHAA 3FHTA 2DFNA 2WWHA 3VTKA 3A4LA 3BBPA 1FZQA 5HR5A 2JLSA 5JS7A 3QVVA 3ZLJA 1MO4A 3OF5A 2GESA 1NG1A 2E9SA 4HSEA 2DPXA 4B74A 4FD2A 2BM1A 1R0WA 1DAHA 2YVUA 5FBVB 5FPTA 3BFKA 3QY0A 2ZRNA 3UWKA 4Q4AB 1BO6A 4EQ6A 5TMPA 1CJTC 4D4MA 2BMFA 1WF3A 2WJJA 2FU5C 2WSSD 5A4JA 4P3YA 4U7DA 2IF0A 2ZRLA 4DWJA 3P20A 2ZAOA 1E96A 1M34E 1FQKA 2WAXA 3AV0B 2YNMA 5DI3A 4QGGA 1KKMA 4Q4JA 2BEJA 1E0JA 1FP7A 2GZDA 3GJ0A 2W6JD 3QXHA 4MDEA 2RGEA 2XJ9A 1T3SA 2VHUA 1XJCA 2ODNA 3Q5DA 5K8IA 4ZI3A 3K0EA 3I5XA 3G0HA 3SBDA 2JJ2D 1GITA 1CLUA 4DIDA 4IDQA 2Q3HA 1GKUB 1F2UA 1QBKC 4HLUA 2Q0HA 4AKIA 1MABB 4OI4A 4EFMA 5L3QB 5EXPA 3VKHA 4DCUA 4B35A 1FTSA 1QZXA 4MRPA 3OAAA 3SHFA 2F55A 1JXMA 3QJYA 1CR1A 1R8SA 3BH0A 3OIUA 4KJZA 5KSZA 1HE8B 4LUCA 2C77A 3JVVA 1J7KA 1PLLA 1Z0AA 2GETA 1S0UA 1W4AA 4LBWA 3TJZA 2GXAA 1XPOA 4L15A 1EK0A 4PZLA 2AD1A 3SDZA 3KJGA 2OG2A 3F5FA 4D0LB 2C9OA 2GJ8A 1OXUA 1W4BA 1V5WA 1GG2A 2EYUA 3TAUA 1MV5A 1UDXA 1R0XA 3L82B 4A8JA 2BVNA 2F43B 1N6NA 5EZ6B 1XD2A 1XXHB 2OSBA 2OUKA 2QORA 2ZSEA 2ZJAA 4M9QA 3IPXA 3GLGA 3AVWA 2EFEB 3EA0A 4YXWA 2X2FA 5KNCA 4JT2A 4HAUA 2X1VA 3UXMA 4D4JA 3GLIA 4O2RA 2Z83A 3TE6A 2FFHA 2JLRA 3GJ3A 1GAJA 3BE4A 4EPWA 3HU2A 2AHOA 3NEYA 1KI4A 2WKQA 5EE5B 3MWJA 2H5EA 2P2LA 4TL8A 1G21E 1E9DA 1T5IA 2I4IA 1NVVQ 1UEJA 3WP1B 3RC3A 2CLCX 3O8RA 2ORVA 1AGRA 4WVFA 1NP6A 2IX3A 4NMMA 2ZE6A 4F4CA 1LFDB 4RZ3A 4Z54A 2HT1A 4CF7A 3AVOA 3U3RA 1ZC3A 5FBLB 1M7HA 1XX6A 4URXR 2XZOA 2RHDA 3QEOA 5TXGA 4E07A 4C2TA 2IT1A 1DADA 3AP2A 721PA 1OXVA 4EDHA 1NN5A 3B85A 4TT3D 1XTSA 2VP0A 4XSGA 4PZYA 5HE8A 2A5FA 4RKEA 4A2PA 4LHXA 3OIWA 2ZRKA 3EARA 4QGFA 3RS3A 5SZIA 2AK2A 3QENA 3K9NA 3CONA 4I99A 2OCPA 4CEIA 2GXUA 1TX4B 2YYZA 4QOSA 5BW8A 2RGAA 1OXSC 1UPTA 1NNEA 5L3SB 1A5TA 1NJFA 1EFRA 5AUNB 3L0PA 1UBGA 3R9IA 1A4RA 1M6NA 2OBMA 2QP9X 1OPXA 4G01B 4MGIR 3GPLA 1S1MA 2XSZD 1VCOA 1SKYB 5EP4A 4MGZR 2KWIA 2EW1A 2UZIR 4DLRA 4XWKA 4Q7MB 4XJXA 2GRJA 4PSAA 1U0HC 3Q9LA 2NO6A 4MGKR 1ZUIA 2GBLC 2ZANA 1R0YA 5JI2E 5JJLA 2RGDA 2ECKA 1SULA 3OEHA 1AKEA 4HB0A 1I4TD 2XEXA 4IDNA 2XNSA 2YWGA 4AURA 3SHWA 5EXSA 1E9AA 1N5IA 4HAXA 3A1WA 3DZDA 1UKZA 1FNMA 3BJIC 4WW0A 3RS5A 2PEYA 4RFVA 1G8GA 1HEIA 2IS6A 1KKLA 1K5GA 4MUAA 2A30A 3PUXA 3VR6A 1CU1A 4ESHA 1E0AA 2RGNA 1YZGA 3N5CA 3ZJYA 2FSHA 4C0AC 1VYUA 3RAPR 4ABYA 1C1YA 3ZQJA 1DS6A 2FN4A 3PUYA 2ERXA 1K8RA 1Q20A 2HDNB 1XFAA 2FSIA 1S96A 4IVPA 1QHXA 4KXFB 4BZPA 4EFNA 1E2NA 1NY5A 5FUXA 3KQUA 2PLRA 2QTHA 4JVLA 2DFLA 3UMSA 2GNOA 2A9KA 4ZDIA 2EVWX 1CIPA 1YR8A 2WBLC 3ZVMA 3LX5A 4GSYA 3KKOA 4PPQA 3TSWA 4JLKA 2XXAA 2ZI6A 1F48A 2FPMA 2VIIA 4TL7A 1L8QA 1FTNA 3AKYA 4ERNA 4EIWA 4LBVA 3SQXA 1AS2A 4QBHA 3PITA 3G5UA 3B9PA 3J81k 5P21A 5K8TA 1PLJA 5DI9A 3CF6R 1MKYA 3IILA 1MO6A 3FGNA 4EPTA 5SZKB 2P3SA 3FKSD 4QRHA 5CB6A 2EFDB 4Q5IA 4URVR 4AKGA 3KJHA 2ZSBA 4JKIA 5B2ZA 3BC1A 1EFHA 2PLFA 4B73A 4DXAA 1UF9A 4DDUA 4JKYA 4DUGA 1KSJA 1NRJB 2UKDA 2ORIA 2ZE8A 4N0EA 1GFIA 2JLQA 1PLKA 1XP8A 4ZIRB 1AIPA 2FA9A 2WSMA 3BB1A 1YZQA 3W6NA 4A36A 2ZITA 1VECA 5GVRA 1XMJA 4IVQA 1DAMA 1E2KA 2BKEA 2ATXA 3NH9A 2F1IA 2IA5A
chains in the Genus database with same CATH superfamily
5LZ7A 1MAVA 3H0KA 4KODA 4MGHA 5ALPA 2CD7A 2O2CA 2YWCA 1LBEA 4Q9JA 1H8ED 4YMGA 1FJGB 4FEAA 5IYZB 1KI6A 1T3TA 1L4UA 5JNRA 5IH7A 1EQAA 5C7YA 4HHEA 5IJWA 3OZEA 4Q1EA 4ZQGA 3VTAA 4NXNB 3AJDA 2HOQA 4OHRA 1DCTA 4CI0B 2CXNA 5ALUA 5KHOC 1VPTA 4UBMA 4X45A 5TF4A 5JDCC 2GAAA 4KMSA 5ANRB 4OP2A 1C30B 5DF1A 5BN3A 1BN7A 4MJ7A 2GLTA 4OO3A 1G38A 2XUZA 2NTJA 5F9MA 2RARA 2UXBB 2G09A 2NNLD 1XB2A 2BM9A 3CLSD 3DLPX 5SY6A 2P78A 2RHLA 4PLVA 5G41A 1CBUA 1HYQA 1NNSA 3EUWA 4MW0A 1N6OA 3SS9X 2I99A 3W4KA 1XZDA 4PIMA 1IWBB 4YJHA 5F1KA 3GGPA 4LXHA 1PFKA 2D0PB 4Q01A 3KPVA 3B52X 2O05A 2BLLA 3B36A 3FETA 3BREA 2VJMB 4QT4A 4TYNA 3D8UA 2NU6A 4R3NA 4DZRA 1XZBA 1LTKA 4UARA 4XVRA 2ZSKA 1DAIA 3ZZ1A 3V42A 4HEA1 1LQUA 1Z5VA 3NBXX 3PA8A 4MWBA 3I9MA 5A02A 1DKUA 2WM2A 4YCCA 2YNMC 4R8KA 4PC6A 3O2JA 5EFZA 2VH5R 4M53A 2OOSA 4EKYA 3MGGA 4K0KB 2IHBA 2QY9A 3GMTA 4O1IA 1PZGA 5DW3A 3ZE1B 2AW3A 2Q9CA 4KE8A 4Q37A 5HS6A 3ZHUA 1JFLA 4ITVA 5C2JB 4HDMA 5K0NA 5K0GA 3A3KA 3D1JA 2CL0X 1KBOA 3IAS6 4S1PA 1QG0A 1ZRSA 3U37A 1JNXX 4JOBA 3OD1A 2DLDA 2ZVJA 3LFHA 5K7SA 3TLBA 2JIPA 2OAQ1 3PNOA 4IX1A 5IJAA 4RSMA 5E0KB 4EHJA 4BCDA 5IC4A 2XVYA 3KEOA 1WVMA 1EGHA 1XP5A 3L06A 1HRKA 5TT1A 4TLBA 2B2NA 3PUIA 3NHUA 1CRQA 1F3OA 1H2AS 2EGGA 1TYEB 2RB4A 3DGEC 2NZ8A 4UTZA 4XM2A 4BLTA 2B8TA 2CMGA 2IZ6A 4YUAA 1I1HA 3MBOA 4PBSA 3LG2A 4PLHA 1F0KA 2XTZA 1CUWA 3U1BA 5G3YA 1H2WA 1LS6A 1Q77A 4PPYA 2FSVA 2XCLA 3NALA 2BJWA 5AKHA 3SP1A 5EXDA 5EJ5A 5JZVA 4ZVPA 4W5QA 1E0DA 4MYUA 2BMDA 4RTQA 4QYIB 3U4GA 1ZHOA 4Z7OB 1U3DA 2SBTA 1O95D 1UXKA 2F8LA 4HWKA 3HVKA 3R0XA 2PXXA 3L02A 3PUHA 4K81B 2ZR7A 3LHKA 5FTNA 1GRCA 2R85A 2EX0A 3LOUA 3NTRA 5JG7A 5J4VA 4NHOA 3ZDEA 3AB7A 4AY4A 3DR3A 1H3NA 2R0QC 5EAIA 4OHVA 3C87A 3MWDA 5H16A 2DHQA 2ZTHA 1XF1A 1W25A 3UQYS 4JLDA 1TQ4A 4YS6A 3STWA 1M2JA 3HJUA 3CPEA 1HTBA 4IUBS 4KAFA 2ZSAA 4BMCA 3P8ZA 1ES9A 3VNBA 3R3ZA 5AP9A 4BO5A 5KNDD 4CV1A 5JT1A 1X92A 2AN4A 4FOSA 4DTIA 2ONJA 2Z09A 1KK0A 1M6EX 4MYCA 2OXFA 1Q57A 1KQNA 5CDGA 3R8CA 1U7HA 5BSFA 3JTEA 1QCDA 5DGDA 3NETA 2ZT5A 3OJFA 4ER7A 3V7YA 4F4UA 1WW8A 1A9YA 3OKAA 1O5IA 1YZHA 4IKOA 1EP3B 1U9JA 1RXYA 2DX7A 4HXFB 4A2WA 3QLUC 3P9SA 1AGXA 4TGLA 4B2YA 3K8QA 3JYQA 1MZVA 2A0XA 4RQTA 4D9FA 3HP1A 5CW1A 1PDWA 1NXWA 4MPRA 5ICMA 1NIPA 4M4SA 5DX0A 4YCJA 4YJDA 4RFLA 3RSHA 4B6JA 2JGDB 3QVMA 3ED1A 4FIDA 4PZCA 4ZMRA 2H6EA 1OA0A 3SYLA 1SCKA 3ESCA 2EWVA 1HA3A 2GHQA 121PA 1A7KA 2N9UA 3A58B 3AZPA 4UHEA 3VHLB 4CI9A 4YRBA 1JFFB 2HA2A 3VOAA 4BX2A 5EE9A 3HC7A 3C15C 3TLYA 3CUSA 1WSBA 3KQKA 3ONNA 1NF3A 1P1KA 3I37X 2X0JA 1KEVA 1CR6A 4FXOA 9ABPA 1JGTA 5AVUA 1C1HA 2XT9A 1OH6A 2XIJA 1K4MA 3GZNB 1GILA 1T2VA 1SNYA 3DDWA 1Z2EA 2V3WA 4JR0A 4PZ9A 3TBFA 4NZ9A 3TNDA 1T2DA 4JL8A 1TUGA 4PFSA 2QN1A 4KGDA 1XVUA 2OB1A 1SXJB 1ZM4A 1OGYA 3JD2A 1NJ2A 5TY0A 2VYQA 5JCXA 4NCAA 3TL3A 4PZAA 3KB2A 4WXPA 2ZWOA 2DJ5A 3GLTA 3B89A 4CFSA 1ECBA 1UJMA 4ITRC 1QQ5A 3VPSA 2X9QA 3AEKA 3B8EA 4NPAA 4DMUB 1SOMA 1WX1A 1UMDA 3DBRB 2XZDA 5DASA 5ED0A 3PUZA 3ZWVA 3K8YA 1YA4A 2ZTMA 1GNTA 3AVQA 5BN4A 3J81A 3QRWA 1V6AA 2GEJA 1U31A 3F47A 3GIDA 1YR1A 2BHRA 1QYVA 3FPFA 2XUGA 3U5ZB 4JMPA 3R76A 2KBEA 1AVTA 1YS4A 1VBNA 1W85A 2P62A 1U0JA 4I3GA 4BLPA 3FY4A 4RK5A 3UMFA 5IK2D 3GT0A 1X42A 3MM4A 4KI7A 3I23A 2TMDA 4FYWA 4HOYA 4OM8A 4ENVA 5MFPA 3QSYA 2HWXA 5A4MS 4XWOA 4B6FA 2MCFA 2GZHA 3FVVA 3VH1A 3Q15C 3SEFA 5JEDA 3RYFB 4NYMR 4Z8XA 4M3NA 1NVTA 1OX4A 4IKPA 4XTCS 4CJXA 3A7EA 1R66A 5DGCA 1ACLA 1NBMA 1X6VA 5DEOA 3IRVA 5FPHA 4CQLA 3BF7A 4O2BA 1ISFA 5L6LB 4PLCA 3WMEA 4ASUA 2I78A 3AY7A 3DVAB 4C06A 5A9SA 1XKTA 3IBYA 4EPRA 4F5DA 2DWCA 2AJLI 2DQ4A 4ZHQB 3Q85A 1GZ4A 2GDZA 3QWIA 4BL5A 3D7KA 3RIHA 8ATCA 1IXRC 1ODKA 4GPBA 2PRSA 2FN7A 3DC7A 4UUAA 1EFUA 4AYTA 1LB1B 1J0EA 1GRNA 4PAOA 1BMFD 1YUMA 2VAMA 1KEKA 2XVAA 1J07A 4MO2A 1HMPA 5DDIP 2VDPB 5EEHA 4ZD6A 5JD3A 1SIUA 1J4AA 2CXPA 2ZB7A 3IB6A 4LI3X 3W5VA 1X7GA 1XCMA 2RG1A 5DYGA 1LLFA 3ZZNA 1HE5A 1ZP6A 2HD4A 4BJ1A 2F9FA 2AFIE 3PDJA 2WD8A 4ZZ0A 1X0VA 2L0XA 5CLIA 3MIZA 5B58T 4PZDA 3KEQA 4OHXA 2FW7A 5AKZA 2ZWPA 4TTTS 3KALA 4CIWA 3NTQA 2AZDA 2JFOA 3E2PA 4CMEC 4FW8A 3ZCTA 4Q16A 3HY6A 1JMYA 1D2NA 1LW6E 3GP3A 4HF7A 4RA6B 2ZK7A 1N0UA 4G8JA 5L8VA 1ATZA 5ALSA 4Z9FA 1D4AA 1KZ6A 1XHLA 2F1RA 4EG6A 5TLSA 4UBJA 4FGKA 2C7VA 3D2LA 1GM5A 4BXOA 3L79A 1QOZA 5CAEA 1EX7A 1VPLA 3V7NA 5DHTA 1IDOA 4AF6A 3FGZA 1OQAA 4GOLD 4C0JA 3UK0A 3GJ8A 1P61B 1HF3A 4GDMA 3DQPA 1UFQA 1XNRB 4HQLA 4EWLA 3O82A 2LD4A 2XQFA 3GBPA 4XFDA 3RFTA 4YV0A 3UV3A 2HW8A 4RFSB 4XVQA 4QULA 5JEEA 5LM3A 2AMFA 2ZVPX 3I9NA 1H6BA 3L46A 4QQKA 2M6LA 3W4JA 1PSWA 3E53A 3T5MA 5C1OA 3TZHA 3ZIUA 2I6GA 3C7KA 3MYRA 1TADA 4H3VA 4ZVMA 4AW9A 4FFLA 1P6XA 5EC8A 4KKXB 1F8FA 4D4GA 2N3ZA 2NZWA 4U0JA 1EWKA 1I2CA 3OWHA 2KYRA 4LDQA 4CQMA 3LWNA 4M1KA 1V11A 2VNKA 2VT3A 3R74A 3SLRA 1EZ4A 3RIXA 5B6PA 4JGGA 1OFTA 1UIMA 3KOMA 4N48A 2PD3A 4ZV9A 3WYCA 3IQDB 1NF2A 1CS4C 3RTAA 4W9NA 2G07A 4U2EA 1V6SA 2O0KA 4DLVA 3UGKA 4BYMA 1XZEA 5E6SB 3UUWA 2IJGX 3EBLA 3R8FA 2HT6A 3SXPA 1JQEA 2C0CA 3NUZA 1Y9EA 2XVXA 2RAVA 3AHIA 3PNQA 2Y71A 4TYQA 5K6RA 1E77A 2YC2C 4KPGA 2OFPA 4OHOA 1TJ3A 5EKDA 1G5PA 3R4CA 4UAUA 4AC9A 3GEIA 4ETIA 1XZFA 2B92A 5FTJA 2BZ1A 1BW9B 2C9YA 4WXYB 5LA6A 3D8RA 2JLAA 2NU7A 4WASA 1AV7A 2JCSA 3OZUA 2ZIEA 3LVRE 1JLMA 1CUFA 5KI6A 3V9PA 3R5JA 1GDDA 4ENUA 4RW0A 1AXRA 2ZDQA 4HYQA 4Q03A 4ZODA 1ZA1A 4KYUA 3LBIA 5KZMB 3EZ9A 2HJWA 2VWPA 2X9GA 4ZVUA 2DB3A 3ORYA 1QFJA 3V8QA 1DNPA 3DHEA 4ZFNA 3PQ4A 3G7UA 1CJMA 1N9KA 3THXB 2FEKA 4HYEA 3UYLA 3WKEA 3P4YA 1N2SA 2IELA 2Q5EA 2ZI4A 1CYEA 3QW4B 2G71A 1DDIA 1HDOA 3MFQA 4KK4A 5JASA 3BXOA 1WEKA 2J3EA 4ER6A 1XALA 2OHVA 3BD9A 4Q39A 4WOJA 1MW9X 4MINA 3CVWA 2RKOA 4WDRA 3SM3A 2MINA 1Z4NA 3AVXA 4QWMA 2ZBGA 4I36A 2XUKA 2SICE 5DCUA 2OCBA 2IYSA 4MW5A 2FAXA 3DA8A 4EITA 3CH7A 5LKAA 2FSVC 5T57A 2KLBA 3MUFA 3RBZA 2X7XA 1R6DA 4A8PA 4OPMA 4RJLA 4E5NA 3GWZA 4FDTA 4QGBA 4EW3A 3OX2A 3VYRB 2GEKA 5FIUA 3UG6A 4JI8B 1G5HA 1OBVA 1OUMA 2A5JA 2QUZA 2A4MA 4RZIA 5DBGA 3KEMA 1LA2A 1PR2A 2EAUA 3CYFA 5AVQA 2FI1A 3JCZA 1EIWA 3CZ5A 1AQYA 1QKIA 1Y8QA 2QX6A 4HDSA 4MTCA 4QX6A 4R2KA 5HDQA 4BNNA 3P9CA 1GQQA 3N53A 2WHPA 1J49A 1DBQA 4E1BA 1K8ZB 1SVKA 2K6GA 3QWFA 4DM7A 5LBIA 4MS1A 3SNHA 2EWWA 3WIEA 4CEJA 1A5ZA 1M2WA 3N2YA 5IJ0A 4UD6A 4QUEA 3BFVA 3H6GA 4MPJA 5EXTA 1WUIS 3FRJA 3THSA 2VDJA 1RJ9A 4GX0A 5F1OA 5K51A 1UMCA 2V0NA 1ID1A 4K9LA 4QVGA 4W82A 1ZI8A 3BORA 4DWWA 1ZHHA 1U2PA 1X1DA 1HDXA 3FSGA 2WWIA 1GGHA 2RHHA 2BC9A 2NZ2A 4HZIA 3PKIA 2O52A 3H5OA 5BV1A 5ALFA 4GEGA 3BUSA 2BTOA 3WV4A 1R9GA 1P4RA 4AKTA 4FE3A 3NVMB 4V0NA 5DM1A 1LD3A 1OAOA 2QAIA 2J0SA 2V6GA 3RVKA 2C8LA 5JSYA 2DH5A 3EGXA 1PAUA 3HBFA 4WCDA 2WT8A 4MNTA 4E2YA 1U1IA 4BX8A 3MRTA 1XTPA 2Q4DA 3G59A 4TTAA 2C9DA 4O2BF 5CK4A 4DKXA 1FRNA 1W19A 2GKOA 1ISJA 3CEAA 4X3OA 5KJFA 4WX2B 4TYPA 3I0ZA 4ZVRA 1USVA 2JNWA 4I4TA 3RASA 1HYBA 1ZVMA 3CSSA 2W6MA 4ZN6A 4B17A 2QPOA 2VRCD 3RSCA 4EY8A 4QXMA 4F91B 1A9QA 4YRIA 1WHSA 3OZTA 4B43A 4PXAA 1KJ9A 2IDKA 2ZSUA 4INOA 4D1YA 5EUCA 2JBHA 3NT4A 4HMOA 3CLTC 3F4LA 4QU9A 1KEPA 1OJ7A 3WJ1A 1KVUA 3RVDA 1XVIA 1ZUNB 4D79A 5I9SA 3O73A 2YMMA 3B12A 2Y66A 2HSZA 3U9SA 2FK7A 4BGEA 2RD2A 1UOPA 3KWJA 1RWOA 3JQ8A 2WMOB 5AKIA 2EZ4A 3Q3IA 5DGHA 3W78A 4AJ1A 1HKHA 4C6RA 4OL9A 1G291 3CR3C 4FQ7A 2OLKA 3WMXA 3AEUA 2ENWA 3W8NA 5D8DA 4AKSA 4Y2GA 1I33A 1VA4A 2OILA 2V7BA 2H9IA 1UR5A 3C8MA 5ULLA 3BXZA 4BFYA 5FBRB 1M34B 1PS8A 1NBME 2OGZA 1H42A 3NPAA 2VT2A 3HE3A 5IT0A 4MRSA 2J33A 1QQTA 3NATA 4NJOA 2V7XA 3KOUA 1X1CA 3JATA 4AP9A 4ZAZA 4F12A 2HI0A 2JB9A 2ZRHA 3K0CA 4GR4A 1JQDA 1CZNA 4MDHA 1PQWA 3ICWA 1FVFA 2CDCA 3DS8A 3L8YA 3L0BA 4EG7A 1RHUA 1WSWA 1AG9A 2H2AA 2P9TA 3OMLA 4PIVA 3WGJA 2ZQ5A 4GH5A 5FUBA 5UKDA 4D6XA 2ZBRA 3CXUA 1YHNA 2ICAA 4N40A 4FQ5A 5TEWA 3RVBA 3ZY6A 1C9NA 2PY6A 1M2KA 2IY7A 2IL1A 5GJCA 3UAYA 3W6UA 1E3WB 1IZ7A 1L3CA 1RC8A 2HXYA 1MF7A 5AW1A 3D4IA 1XZJA 3ZK9A 2Z2JA 5K8UA 1ZU4A 1HT2E 2ILTA 8LDHA 3O90A 5KTTA 1LI5A 3SYRA 2P8JA 5MN6A 3MERA 3HBAA 3I1FA 1LJLA 1DQSA 3DC2A 4I08A 4TYYA 1CUUA 1OT5A 4KDFA 2ATCA 2ZJ8A 4RD6A 5AD1A 4CMIB 5K20A 1DCKA 1YQTA 2JHFA 3ZXXA 2C9BA 5B7PA 2ZW9A 3FDJA 4LF8B 2DECA 4PNHA 4EA6A 5E9AA 1NV9A 2EW2A 1UEXC 2H4JA 4QEKA 1G59A 1E2LA 4PSUA 2JPDA 4CCYA 3HM2A 4B7XA 4RIFA 1C8KA 2P75A 5CCEA 3OJLA 4Z8YA 2ZYAA 1E92A 2B3DA 3ANYB 4Q4LA 4KFTA 5C0OE 3ZNPA 1YB2A 4L16A 4WZAA 3RT1A 3W9UA 4UPDA 4XLZA 3V46A 2XTJA 4QXAA 4Y2UA 2VOEA 3RUHA 1VHTA 5KYYB 3G9XA 3OTGA 4GS5A 2QVGA 2FXVA 2X8LA 1W52X 3E9QA 5LA6F 1DIOB 1OI2A 2FPWA 1C7IA 1W93A 2C5HA 5I9BA 1E79A 3V4RA 1T1SA 1JF8A 3CRMA 4WKCA 1PV2A 4EI7A 5CIYA 2ZUEA 5DIZA 3F3SA 1EFPA 1KDZA 2HPHA 2JGMA 2QTGA 4M87A 5IXSA 2JFXA 1KPGA 1MX5A 2Q4BA 2C3MA 2L42A 3L1VA 3AUUA 1U63A 4KKVA 3SFTA 1M1YA 4KMRA 3UQZA 4Z7JA 9LDBA 2PTGA 2LBPA 3FF1A 3RF7A 3W5CA 1JPVA 1D8AA 3IMGA 4JNCA 1T8PA 5GQSA 1EK2A 1VC2A 4FMDF 4RA9B 5FRDA 1WY7A 4Q6BA 1S8FA 1DPFA 3GT3A 4DJTA 2SNIE 5JNSA 1T35A 2L18A 3HUFA 4J29A 3NG1A 3PE4A 5NULA 3IBFA 1JKJA 2C7RA 5E4FA 1JA1A 3SN6A 2HO5A 5B1SA 3B1WA 1O77A 3GO4A 3IUJA 1NU6A 4MWCA 1TFRA 4D4KA 1P4JA 5HGXA 1DWQA 4C7OA 1Y42X 1R27A 2UV8A 3DNFA 1NQOA 1AQ6A 2XE8A 2ZIWB 3D7SA 3HJGA 4XIJA 5AI8A 5EHZA 3JAKB 1U2TA 5TMBA 2AZ4A 3EF3A 4L5JA 3MIIA 1DU4A 3DBLA 3Q10A 4JB3A 1RADA 1IBCA 4W9NC 4X20A 2V9PA 3OJOA 4IJUA 4LBYA 1MD9A 4YC7A 3CJRA 3HXQA 2A1IA 1JYSA 1UPXA 2FWRA 3LI2A 3DPUA 4OQEA 4YDHB 1NQ5A 5KU7A 1UBRS 3LWDA 2PZEA 1NI4A 3BX1A 4CVNA 4YRKA 3GFFA 3KZVA 1NLZA 4XR4A 4DF3A 3OUTA 5DYIA 2VUTA 4OQXA 4D5EA 3H11B 2HBZA 2QQGA 1CF2O 3ETNA 1ESZA 2DQZA 3KOXA 3LQQA 4MKHA 4QEZA 3VGJA 4CL0A 3ASUA 3EXG2 4H6VA 3ZU3A 5L7TA 1LXCA 5AJWA 4OAPA 3MD9A 5JISA 1A98A 1P5ZB 3F6PA 2H2IA 4X44A 4A73A 2H07A 4JYCA 1R0KA 1P3DA 2REQA 5T4EA 1TRKA 1XE3A 1XTKA 4HY3A 4R9NA 3I8SA 3UTDA 2XOKA 5H9WA 5DNYB 4UOEA 5KTYA 2HPVA 2P7HA 2VDRB 2XCOA 4HEA6 4LYYA 4CT4B 5IKEA 1CRLA 2JEYA 2X8WA 3Q11A 1L5HA 3ZGNA 3DMTA 3I8OA 4D3DA 4KP7A 2DHDA 1PNQA 3QE2A 1TU4A 1EQUA 2JJ1A 1W35A 2QN9A 2ERYA 1N1MA 1NLUA 5JVDB 4F6CA 3A2KA 4S3MA 1Z7BA 3DFZA 4K2AA 5IARA 5TVGA 2GD2A 2YWXA 3G2LA 5JBQA 2O2GA 1Y6ZA 1JG1A 1D5CA 1G2QA 4I4TF 1U3CA 1VHQA 1IOLA 1SIBE 1XKXA 1NI5A 1CSEE 3FNHA 3KOOA 4CM4B 3PGJA 3L92A 3L5KA 1OVMA 3D4LA 3KAQA 1U2EA 2A1UB 1HYEA 4GM0A 1E1NA 4R31A 1EGMB 1VIVA 2PZBA 1JXAA 3K9BA 4A0SA 1CYDA 5GVSA 1JHVA 3A9UA 4LNHA 4O2LA 3ZKWA 2FPUA 5AICA 2QP3A 5GZ3A 4IY1A 3DULA 4GR5A 1W34A 2W4MA 4BWFB 4Y1EA 3L4KA 1ZXXA 2GXQA 3WO1A 4KSBA 1XTJA 3F49S 1K0FA 5CDYA 4XLTA 1XCOA 3NHFA 3T3NA 3AF5A 2D1RA 3GRVA 3E9ZA 3KXDA 4Y2XA 5EMMA 1XRSB 4BMXA 4TTQA 1EXMA 1ML4A 2RKBA 1AE1A 3EZ6A 3NAGA 2YRWA 3UMCA 1TZ2A 2ALJA 4KFSA 2C99A 3DWIA 3I62A 3BRWD 4UQOA 4B0PA 1VXRA 2DQSA 3M6MD 4EHBA 1L4BA 4ACBA 1DJOA 2J9FA 1T4DA 1OAOC 5BWLA 1TF7A 3B1VA 2IHKA 2WUFA 3PQ3A 3NASA 4QDUA 3WYFA 1NDHA 4Y6QA 5L4NA 3OPYB 5FXMA 5HTOA 2D5IA 3HGMA 1RWBA 3FI0A 3TAHA 1CF9A 1TK2A 3NBKA 3O3OB 4YNBA 5FL7A 3HG7A 2PS1A 5K8JB 1RJGA 3JARA 3CKKA 4B6OA 1QIMA 2O5RA 1OHHD 4BWVA 3ND9A 2VJKA 4PINA 5CPBA 5FUMA 2C3YA 4ZJZA 4H1VA 3KCQA 4GNRA 5F5NA 3DFFA 3VVCA 3FDXA 3FTQA 4R8VA 5CNJA 4GI2A 5AXAA 2XQIA 2CVPA 3DTNA 1MO3A 1RNLA 4GBMA 4G0OA 3SSNA 2GEBA 5AK4A 4RVHA 4K03A 2RHRA 1J25A 2H4WA 3LT5A 4V03A 1NMXA 2REOA 2OUIA 3OCZA 2OO5C 2NTNA 3FF4A 4XFJA 1B41A 1KL7A 2X6QA 5DHPA 3BWYA 4M9SA 1JDSA 2OBNA 2YZNA 3AV3A 3GPCA 3INGA 3COZA 3CX6A 5E8JA 3ZY4A 4WGGA 4FN5A 2HJRA 3C8DA 4F8YA 3UPUA 1OR8A 3I1IA 4ND3A 4XJVA 5E3JA 1NP3A 4W8GA 1KDOA 4IDEA 3DFIA 3W3AD 2H9YA 3EFOB 3AFNA 5IHXA 3TG8A 1M8PA 2XNCA 3MJEA 3OQBA 4YI5A 1N5RA 1K7XB 3EMDA 1K66A 4XLLA 4YRLA 2ZFUA 4YLYA 4LYDA 4TV8A 3TGWA 2JHGA 5A5FA 1NVWQ 3AKZA 1J2YA 1QGED 3KSUA 5L7WA 4GZLA 4F7WA 2DY0A 1G16A 1L5MA 2TMKA 3HB9A 1UKEA 1XEWX 1Y8RB 4CM9A 1OX6A 1RWMA 5DLQC 2I62A 4QVIA 1Z63A 3BHNA 5I6DA 3AFMA 4LDAA 1GZ5A 3WKCA 1QV6A 4B3SB 1KPHA 1A7JA 3OECA 2V4ZA 5JHGB 3KQTA 4REMA 4YWJA 2MSKA 4EY4A 2XB4A 3U61B 2JD2A 1L6IA 4Q66C 1FQOA 4U00A 1WKVA 4UZEA 4B3GA 1F4PA 3ZD9A 1NF9A 2C94A 5AUOB 3Q8XB 2R60A 1VL5A 2JJ2A 2ZSHA 1Y3DE 4HJXA 4YLEA 1S4MA 3QE9Y 2OFWA 4YMTA 2PGDA 4I0WB 3K6SA 2GBCA 2J0VA 3IT1A 1DXHA 4JFAA 4YIHA 5ADVA 1OWLA 4D26A 3PJRA 2PX8A 1JU3A 4IRMA 3SXJA 4A6PA 2YN0A 2BD0A 3CW9A 1DC3A 1SBCA 2XB8A 2ZIXB 3FE2A 2OXEA 3H18A 3QE4A 1C0IA 1ODLA 4PZZA 1Y4DE 4Q3KA 4WZAE 3IVMA 4G0VA 3PIDA 2GN8A 5AKGA 2B78A 2VAXA 4ARZA 3UXYA 2NT4A 5L3QA 3C3PA 5C32A 3K92A 4PCUA 3T5GA 1OX5A 3D1LA 5L9AA 2I87A 3O31A 4DTCA 3NAMA 3HZOA 5EOVA 4I50A 2QR5A 5JPIA 1EJBA 2IIVA 3ELWA 4NF2A 3QOFA 3OY7A 2WJYA 5SV2A 1DKOA 3NHLA 4U2FA 1W49A 4EG3A 5H3HA 3FLEA 1UXJA 1QIJA 2P2CA 4GXRA 3IP5A 2ZCVA 3LUGA 5HVNA 1JWLA 2I1WA 4KPFC 4BAZA 3CVYA 4TTJA 3HKBB 3I6YA 4TOIA 2IE8A 2QN6A 2YIJA 3PKZA 3T3IA 2Y1LA 4B44A 2V8BA 5J2UB 4P3KA 3TVTA 1NQVA 2V7UA 2WWRA 4G4IA 3EY9A 4LJ4A 5AI5A 4YUXA 3WS7A 1FVHA 3N2NA 4R54A 4OCZA 4DM4A 2UZ0A 1EWYA 2X5OA 4OHFA 1I2AA 5IULC 1GOTA 3WBJA 1RCTE 2NNWB 2G25A 2IP4A 2FSSA 4Q3CA 3U60B 2OXIA 3M5CA 3ZV7A 4C4PA 3SJ7A 3ITEA 2D1YA 3UV6A 4ZYYA 5K0TA 4N8DA 1M1NA 1TM3E 4B4DA 1NM5C 3TLAA 1IUPA 2O20A 3HY3A 4PXYA 1CUCA 4CEIB 1P80A 1JU4A 4HXYA 4PZ0A 4DJ5X 4PS1A 4YY3B 1RWNA 6YASA 3L05A 5BVHA 1TCBA 4LZJA 1QXSA 1JXOA 2V4UA 3PIRA 2ANCA 1ENYA 1O54A 2LR0A 4G5XA 3OZWA 4UXJA 2A67A 5IFLA 2VWHA 5EVCA 1GPWB 3AW8A 1FDWA 2D2EA 4FE7A 1TJ4A 1PR9A 4UASA 1Q0PA 1QHGA 1Z6XA 3M3HA 3HCPA 4MLDA 1Z82A 2WTNA 3CEPB 4N39A 3W8EA 4LJ8A 1NVBA 4WLVA 2BJVA 2I9PA 1MB0A 1PZXA 2AFRA 2F9MA 2ZIVB 3FWKA 4I9NA 2B82A 4TT3A 5GWXA 3BIXA 1JE0A 2OCLA 2JLWA 1DO0A 1X7ZA 3PL1A 4QBTA 1X80A 1JZTA 1NE7A 2VR1A 3GLKA 3K2IA 1W4LA 4HNAA 1UBNA 2C31A 2CDNA 2W37A 3E5RA 4HH1A 3S29A 5C1IA 5C4IA 4NVRA 3B6ZA 3OH8A 1LH0A 2NYVA 3TXYA 2NZJA 4HNVA 4Z0TA 4OHYA 4IIYA 3OFSA 5BURA 3ZGOA 5BNTA 3ET4A 3O94A 1RQLA 5I5EA 2PR7A 2NG1A 3A1NA 3LUKA 1XK6A 2XYHA 3LM8A 4C29A 5A71A 2YZKA 1RKXA 1A04A 4M54A 3EUEA 1IBKB 1OWNA 1GL3A 3AH8A 4UNQA 5ALNA 1WIWA 3TCXB 1U8TA 4I1YA 4HG2A 1TW2A 3EDMA 4MHTA 3OZ7A 2Q3DA 1F20A 4BQEA 3FUTA 3FYDA 2HA6A 2ODBA 2ZRFA 4DSOA 4LMAA 2NYAA 3EPRA 4BKQA 1M33A 4EH1A 2IEAA 1J8QA 1S2DA 4Q19A 3DO8A 5I9MA 4D4HA 5JS8A 2UUAB 1JKMA 3CE6A 3K05A 1J99A 4BFTA 5LZ9A 1CCWA 3EFBA 1XMQB 2C1ZA 5F77A 3QVGB 1SBHA 4MWDA 2HK9A 4UMFA 3L41A 4EHLA 3DMTC 2XXAB 3KXIA 3FSRA 1NVKA 2AZMA 1R0SA 3LDUA 2I3ZA 3CLHA 3EOAI 2ZGVA 4QHYA 5SZHB 3GH3A 1MN6A 1E1RD 3U4AA 1S89A 2IZ7A 4RHCA 4Q00A 1RQ2A 2ZYHA 4GLFA 4HYTA 4L5IA 3TRIA 3K0BA 3VSBA 1FUUA 2VCYA 2IUYA 4R98A 5FTWA 5IT9A 1RC1A 2PUCA 2HV8A 3BHJA 5FV7A 2PAAA 5H81A 1NA5A 2O0MA 2OGSA 4D25A 4KQCA 4FZJA 2BEWA 2LP4Y 2P9HA 4XUDA 1Q3HA 1DC5A 4K3UA 1EGVB 1FYEA 4KVZA 4QBGB 2WYIA 2X4DA 4C1BA 4F2WA 5LPNA 2IP2A 1KR2A 2FF5A 3LF1A 3TUJC 1C0LA 1J22A 1AO3A 4PGFA 3EGDB 1TQHA 1VZ3A 1SU6A 3AEQA 3QWBA 5DULA 2WIDA 1RBZA 2G36A 1ABEA 4YJ3B 1KAOA 2VDOB 1UM8A 3HA3A 5J58A 3GT7A 5H0IA 4Q3BA 1XTQA 2NZYA 1U98A 4TRMA 1B2RA 1IOZA 4NCJA 4OEHA 5LLTA 1XR3A 4QYXA 2FF7A 4QC2A 5DB4A 5EE1A 4CKEA 4X00A 2IXGA 4MVJD 4TV8F 2VTVA 1KFBB 4QBKA 1V9CA 1S02A 4TTPA 1B76A 5CT4A 3D8HA 3WSWA 1RLIA 2IYYA 4EKIA 1UDCA 5IUNC 4KNWA 4WD3A 4YYZA 2WB2A 5LZ5A 1JPUA 1UT5A 2QK4A 1A9OA 2NUTA 3TRDA 1GUDA 3CGGA 5BSUA 4JU8A 4EO4A 2CYCA 2C20A 1TD9A 5DTRA 2NTYC 3Q7PA 3V97A 3LOPA 2QM3A 3OI7A 1H9BA 4GOXA 2H85A 2L19A 2YV4A 1JHZA 1UBEA 2FEMA 3HM9A 5LUAA 3FWHA 4GYYA 2C2OA 3WJ2A 1KA9H 1K4YA 4XEHA 3UUFA 521PA 5LVAA 3IUYA 2E5LB 4KAJA 2FPGA 3CLUD 3OT1A 2ZUBA 3R2JA 2JAQA 4B1FA 4L8WB 3RBVA 5JY6A 3K0SA 1EEXB 1NT4A 2G76A 1FFAA 1UBHS 4RS4A 1J42A 4GPIB 1GNSA 4PC2A 4Q18A 3SWWA 1FTYA 2YXEA 3FWNA 2YUIA 1E1KA 2R1VA 4R01A 5SYNA 3IA7A 1ZBDA 3N2EA 3ZR4B 1WU7A 1B0PA 5TF0A 1V9SA 4EOGA 4HH0A 1UAAA 1FYVA 4I50F 5CA1A 2JJQA 3KQMA 4NARA 2Y1CA 3NJRA 2QM7A 3P45A 2O2DA 4Q05A 2C2ZA 3RRFA 3ZK8A 5BYKA 2AOTA 4K9NA 3GH1A 4ZTBA 5ABPA 1IEVA 2KI5A 4HNSA 4IL5A 3H5RA 4CTOA 4EF4A 1NRIA 2PJZA 2A5YB 3O4FA 4KTVE 4W7HA 2PUTA 3P9NA 4OLHA 5AIBA 4I4CA 1J7JA 3BKWA 1HNNA 3GLHA 4D2IA 3AESA 1VLHA 2XLCA 2XR1A 4C6HA 4OKSA 4EABA 1Q2XA 2LCFA 2Y2VA 3DSRA 1E9BA 4EJ6A 4QKQA 2W2LD 5AESA 5KWVA 3GXOA 2ZM6B 5AJTA 4WRRA 2C42A 4BO9A 2PUEA 1PEYA 2ID7A 3AL0C 2RI6A 4YP6A 4ABTA 2A9JA 5HZKA 1HG0A 2C5SA 4HWGA 4ZK2A 2PWYA 3EC2A 3MLAA 2AC4A 1DDOA 4IG9A 4BNKA 3DVLA 3IDAA 4ND7A 3G9ZA 4R9UC 3M82A 2EJCA 2VQEB 1EVLA 3OU7A 2W2PA 4H77A 4US0R 3NYIA 2BCGY 2F3SA 4GGMX 4AN4A 1HK7A 1LSSA 4N03A 1BVYF 3EA4A 3IO3A 5BUZA 3UYKA 2FZWA 4JC0A 4P4LA 1BDJA 1W73A 1ZOSA 3U7EB 4DFDA 2PVCA 3TH5A 4MUFA 2KQUA 2Q46A 1W1IA 2DYKA 4V38A 1GL7A 4GM4A 1D6SA 2HMYB 3FHCB 4PPNA 4Z7QB 3OX4A 2O2YA 2VWGA 5K01A 3LFTA 1MIOB 2I76A 1Q92A 1XMPA 4S1VA 3T0GA 4KSCA 3ZD7A 2GAFA 4KBFA 1SCAA 1QGZA 4X9XA 1I9CA 2XE6A 1E3TA 1E3DA 3OOWA 1N6HA 1T43A 3TFWA 3BMOB 1FSFA 2FFQA 3DO6A 4QQFA 4URYR 3RUPA 2YJ4A 5C5IA 3I5YA 1TL7C 1LRLA 2VAPA 1E5DA 3AIIA 5K3AA 2QXTA 3OO0A 4NNJA 4ZJUA 4ZA2A 1GHTA 1U0RA 1Z8FA 4A16A 5BRAA 1QH8A 4KX5A 2OZEA 2ACWA 4QARA 1XJ0A 2ZYIA 4PVDA 2GCOA 1UXHA 1KTVA 5FHRA 4H3KB 4DQ0A 4YJ2A 2XCSB 4HTFB 5EFOA 3L93A 3TB6A 3C98A 2Y1WA 1QC5A 3CEJA 2I3BA 2O8EA 1TKBA 4QTUB 1H2EA 5K0LA 4FFWA 2VFAA 4A03A 1XZMA 2Y67A 2HFKA 2QD3A 2X3YA 4URZR 5JC1A 2JIOA 3O74A 1ISSA 3VZQA 2QBYB 3JQ6A 4H1WA 1EBFA 3V1YA 2VSOA 3H19A 4EJ0A 5KNDA 3NIGB 4C08A 2WNIA 3HI6A 3NJ8A 3RVLA 2FRXA 1OPRA 2WMNB 2R6HA 2ZU6A 2JHAA 1JHQA 2ZETA 1W30A 2HHCA 4X91A 2HJSA 3L8GA 4YP7A 5PNTA 4ZMBA 3DMPA 1YAJA 3S2IA 5IJZA 1VBKA 4NL4H 5LWQA 2KJQA 2W2MA 3IVAA 1T5BA 2LPMA 3S8EA 1LW7A 3EMBA 2ZIAA 1WCWA 4JLPA 3THYA 1K97A 1ZDMA 3A25A 2ZJ5A 3ETLA 3PNBA 3T61A 4BNVA 5HIAA 3E7DA 4WBXC 3JAMA 1W4RA 1G18A 2F3TA 2RAFA 3NB0A 1Y6RA 4I55B 4FEYA 3BZWA 1S2IA 1E66A 4JXXA 2RAUA 5AW2A 1H23A 3BGVA 5H3CA 3S8YA 1VJ5A 1WZNA 4UUPA 3TW0A 1U1CA 2FDRA 1QX3A 1QWSA 1XOIA 4H0NA 4HT3B 1GGKA 2PSJA 3M34A 4K9DA 1U0LA 3KUXA 4OHKA 4A0FA 3KP1A 4KOEC 1B1CA 1K9SA 3O2QB 4GI7A 4PAMA 4S0ZA 2YOGA 1NW8A 4W5HA 3RF6A 2WPNA 1MC8A 3JD1A 3GCDA 3VRHA 1IK4A 2E6KA 4HCJA 3CM0A 5E9JA 3FVQA 1SKYE 3A9RA 1YC5A 1W8IA 3GZTB 4GPEA 4KGXA 2HKIA 2QUIA 4QT0A 1KMMA 3N39C 1YR6A 4CDGA 1QPBA 3WLLA 1VLLA 2JCGA 3GCXA 4LSGA 3ZVNA 3P19A 3EK2A 4KOAA 2JLVA