1NKSA

Adenylate kinase from sulfolobus acidocaldarius
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
MKIGIVTGIPGVGKSTVLAKVKEILDNQGINNKIINYGDFMLATALKLGYAKDRDEMRKLSVEKQKKLQIDAAKGIAEEARAGGEGYLFIDTHAVIRTPSGYLPGLPSYVITEINPSVIFLLEADPKIILSRQKRDTTRNRNDYSDESVILETINFARYAATASAVLAGSTVKVIVNVEGDPSIAANEIIRSMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a trimeric archaeal adenylate kinase.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Kinase
molecule keywords ADENYLATE KINASE
total genus 64
structure length 194
sequence length 194
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1998-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13207 AAA_17 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nksA00
4C30A 1SXJC 2FE4A 5KDDA 4QM6A 4AC9A 3CH5A 3NH6A 4Q7KA 4CEIB 1U98A 1LS6A 4WXRA 4DDUA 1GL7A 1DADA 3AVQA 4M1SA 3VU9B 4UNRA 1O3YA 4U7DA 5BN4A 2FG5A 2PEYA 1Q3HA 4U02A 4GL2A 2GCOB 5K8LA 4S2EA 4QNMA 5BYKA 2JATA 2EFEB 4UJ5A 4YXWD 2SHKA 1NY6A 3SYKA 4HAVA 3NDBB 2ASEA 3NIBA 2CCGA 3NH9A 5JHHB 4EQ6B 3DOEA 2QMEA 1KK3A 4QGGA 4DXAA 1KI8A 2FV8A 2ZTSA 4CDGA 4RJLA 3CX8A 3VR2A 4B47A 3V4RA 3R9WA 5E7MA 2L0XA 8OHMA 3GMTA 1S2MA 3WP0A 4YMWA 3IIKA 4KHZA 2ZXUA 2B8TA 2ZRHA 4XSGA 4A92A 1DAGA 4ZCLA 1ZM9A 2A5GA 4U5XA 4EJSB 1OHHD 1OV4A 3B82A 3EASA 2ORVA 2IYUA 5EZ5A 2AKAB 4ZDKA 1Z0DA 2A2ZA 3X1XA 1CJTC 1UADA 2C9YA 1J90A 2IYSA 4BEBA 3RS0A 5KPJA 4OQMA 2BEJA 1G8PA 4LBVA 4NYJR 1C9KA 2ZR7A 1VCNA 2WKRA 4IDHA 1U8YA 5B64A 1DAHA 1UFQA 3AVPA 4PZLA 5L3VA 3FGNA 1R0YA 3PEUA 1Q57A 4P4TA 2ZI4A 4Q1FA 3EC2A 4B48A 4EPRA 4A0HA 4BRWA 2YWGA 2FWRA 4TSFA 3HR8A 4AKIA 2G0NA 3TAUA 1GILA 3UMSA 1Z29A 1AN0A 1OLOA 4TN1A 5HPYB 3I73A 4BASA 1FMJA 2QBYB 3ZD7A 4PC3A 4FCVA 2OT3B 4R2IA 1HY3A 2HCJB 1BIFA 3ADBA 1GWNA 2FEOA 3KJGA 4QBFA 2ODNA 1ANKA 4M22A 2VP0A 4JLBA 4AYWA 5C18A 2J45A 2Q9BA 1E2FA 4E07A 4P31A 4MDEA 1CKEA 4P0TA 2IW3A 1VIYA 2CHQA 2P67A 3SR0A 4BLRA 1KI7A 2IS6A 2XSZA 2J0VA 1JPNA 4DT1B 2ODBA 3AKCA 3KQUA 4FWTA 4CW7A 2IS1A 2OAQ1 1VHLA 4PAMA 4Q1DA 3OEED 1FX0A 4Q4LA 3UG7A 3IPXA 3ADDA 1CTQA 3L8ZA 3TUJC 1ZCAA 4PFSA 3AP2A 2QBYA 1G6OA 1Z2CA 2J87A 1E94E 5JS8A 4BRUA 1AGPA 1JEEA 1NVXQ 3SBEA 3KFVA 3T1QA 5FTLA 1OXUA 5EUQB 3RSLA 4ZI2A 2ZRLA 3MJRA 2RCNA 1RJ9A 2OAP1 5E4FA 3BC1A 5E7IA 2QM8A 3A4LA 1WDTA 2D7CA 1YR8A 4QL3A 5A5GA 4Z51A 1QVRA 1JXMA 2ZJ8A 2KBFA 4OHYA 1ZD1A 4AYTA 1FP6A 1SVLA 1Z6AA 2Q3MA 1TEVA 4G0NA 4IVPA 1ZMXA 2HXYA 3QBVA 2JCSA 3KXIA 1S3GA 4D82A 3E2IA 4RD4A 4GT1A 5F9FA 4MGYR 2AXNA 3I72A 1T6NA 5EXXA 2JA1A 5LBIA 1FX0B 2AD1A 2I4IA 3SDZA 4JYCA 1MABB 1E9RA 2YHSA 3OIWA 2IS4A 2QL6A 4DCNA 4PANA 4TMTA 1KO8A 4M53A 1VMAA 4OHVA 1FNMA 2O8EA 1ZC3A 2UZIR 3BH6A 4JLAA 4MRSA 4PQFA 4EPVA 3TKLA 1KIMA 5JCPA 4ABYA 1N5LA 1Q22A 4JS0A 4JLOA 3B78A 4NCJA 1CJMA 1OSNA 5HTKA 1EK0A 5K8UA 3AP1A 3OESA 3TAHA 4QXAA 1PLLA 4M9SA 1G7CA 2VTKA 3LBHA 1XJ0A 2R6GA 1QHNA 4PHFA 2EYQA 2OEPA 2P6RA 2QQ0A 2R6FA 1GFIA 4NL4H 3TR0A 4TLEA 5JEDA 4A1FA 4YDHB 4PXAA 2ORIA 1U9IA 4GMXA 4RD6A 4DLWA 4D0NA 4M1KA 4M9QA 3B13B 1YZQA 2GVDC 1FTSA 4DLRA 2EYUA 4JLNA 4HUTA 4Q48A 1VPLA 4JVMA 3OFND 2AWOA 1W36D 1BH2A 2JASA 4DSUA 4TLDA 5JJIA 2G88A 3X1YA 3QXSA 3I92A 1E2DA 2Q21A 3F5FA 1II0A 4JVSB 3BIFA 3IO5A 3CBQA 2QE7A 1GNRA 3OFNA 1N5IA 3PQCA 2XB4A 2GBLA 1XEXB 3U6BA 1KDTA 3LH5A 4RZXA 3KJEA 2BM0A 3KXKA 5F2EA 1KNXA 2BOVA 1XXHE 3H4MA 3RSOA 4I81A 2RHMA 1WF3A 4C0AC 1UKYA 2EU8A 1RYHA 1N6NA 2WSSD 3BFXA 1CLUA 3BXZA 1E79D 3BRWD 3EZFA 4KYIB 4EPWA 2XXAA 1ZD8A 3LBIA 5GADl 1MO4A 4D4LA 4IOJA 2IBMA 4RFSB 2J0SA 4TLCA 5B58C 2OXRA 1M8PA 1M1YE 4XD7D 5C4GB 5FBWB 2XTMA 1QG2A 3C41J 2QPOA 4M0LA 1AK2A 3GJ8A 2IXFA 2VQSA 4CYMA 2WJJA 2OFWA 3Q72A 4NYJQ 4BFWA 3O8CA 3OHMA 4FD2A 1E9DA 1XJQA 5TVKA 1GM5A 2VP2A 1BYIA 2FH5B 3QEOA 3FFAA 3AV0B 3L8YA 3CX6A 2VA8A 2OZEA 4M1WA 3R8CA 3Q8XB 4IEEA 4B3CA 4BLTA 3UK6A 1S3SA 2IXEA 2QTVB 2V1UA 2Z43A 2QI9C 3LVRE 2DFTA 2CVHA 4JLMA 1IJFA 4P4SA 4MUAA 1XTIA 2RHDA 3ASYA 3NC0C 3TQFA 4GDFA 2VHTA 2WPDD 1WE2A 1TQDA 2OO7A 5K8IA 4CVNA 2WHXA 4M2LA 1Z08A 1G17A 1U99A 3AH8A 4DCTA 3CX7A 1CF4A 1VG8A 1U2RA 4C0LA 1GG2A 3HPRA 3NBZC 2ZUCA 5GJWC 5L3SB 1IBRA 5KSOA 1MOZA 3J81k 4OQFA 1R10A 2X1VA 2J0UB 3LW7A 2P6UA 4Q7LA 1DO0A 4JL6A 4DBLC 2VP6A 4TYWA 2KI5A 1HQYE 2HF8A 1FQKA 4US1R 1FP7A 4C7OA 1KZ7B 1YJ5A 2R8RA 4KVGA 3KUCA 1G20E 4D2IA 2CE7A 2YOFA 3CRRA 4DZZA 1W36B 2ZYUX 1S1MA 4URYR 4GFDA 1LF5A 1M34E 1G3UA 1OXXK 1YRBA 1J2JA 3CRW1 4B3FX 3RHFA 3WMEA 4HLUC 1D2NA 2XOKA 5EP3A 1ESMA 4KBGA 3GQBA 2CNWD 4Q01A 3NBFA 1OFHA 1HYQA 1N0WA 4W9MC 5HCIA 1EFRD 5J4KA 5JI2E 1F2UA 4E5UA 1R7RA 4Q03A 1RFLA 1HH4A 2W83A 4UJ3A 5L3SA 3IHWA 3GJ5A 1MO3A 1KKLA 1SHZA 1FZQA 2ZI6A 2C5LA 2WAXA 5GJBA 4LX0A 2VHCA 3AVYA 1TUEA 1US8B 2ZJZA 1N6OA 1FTNA 1JQJC 1WA5A 3CNOA 3SS8A 2F1RA 4PO1A 4IDQA 1ZIPA 5AJZA 1S4QA 3TMKA 2HDNB 4ZIRA 4FMDF 3LD9A 3VFDA 2DBYA 4ZI3A 3Q5DA 1UBCA 4B3DA 1P2SA 3TSWA 5KO2A 4V0NA 1N5JA 3VNUA 4CEHB 5HR5A 2VPPA 3H84A 3HYTA 2F1IA 2V6IA 1JR6A 3TLXA 4GSYA 3PEYA 1TADA 1T0HB 4B43A 3I62A 1P9RA 2O52A 3H86A 1P7CA 1R2QA 4MKHA 1SGWA 3EA5A 3WMFA 4LK2A 4C0QC 4LJ4A 1DPFA 3CWZA 3TNFA 3LY5A 3NBXX 2A9KA 4QHSA 4OQLA 3U44A 2PCJA 4MH0R 1MABA 4LUCA 1P62B 1XD2B 1E2HA 3Q85A 2V9PA 2PL3A 4QGFA 2O0HA 1Q1ZA 2F43A 2LKDA 2NO0A 3DM5A 4RKEA 2WJGA 4UNSA 2XTZA 3QKRA 2HT1A 1XP8A 6Q21A 3AKYA 3DMNA 4JYBA 1R5BA 4BZPA 1AA9A 4AKGA 3N2EA 4R9UC 1OPXA 2UVQA 4DKXA 3CWQA 3HU1A 4CEJB 3GP8A 1E9BA 3BFKA 5AUNB 5C2JB 3D7MA 2ZM5A 2R62A 5CITA 1Z2AA 3K9HA 2C98A 2FZ4A 2I1VB 2RGBA 2HLDD 1N6HA 2ZSEA 1VHTA 4MYUA 1LW7A 4TMVA 4TZ6A 1X8JA 4E03A 2DB3A 5F3WB 1NMYA 4B3BA 3IHLA 3O8BA 2WWGA 3E70C 3TIFA 2F6RA 5FTMA 1W4RA 3UWKA 3I61A 1OB5A 1G64A 2WSMA 1W1WA 5CK5A 3GLFE 3MMPA 4QHYA 1NLYA 1CJVC 2OFOA 3ZVNA 2W2XA 4L9SA 4A8JB 4PHGA 1KZGB 3KJHA 2B7BA 2A5YB 4TL7A 4LYHA 1JR3E 3CPEA 3MWLA 1X8LA 4OL0A 1G8HA 1COWD 1N5KA 4AK9A 2FF7A 4TSFD 3I5YA 3SC3A 4I1VA 2QSYA 1W36C 3FMIA 1VECA 2FDCA 2PMKA 4MKGA 3FDIA 3HDTA 3TUZC 4XD7A 4UNPA 4Q4AB 1GRRA 1OF1A 3QVVA 4YMUA 2ZSDA 2REBA 5J5CA 4DRZA 5KSZA 2RGGA 4FMCB 1G4AE 2QP9X 4TYQA 3U3RA 1OXTA 4BE7B 5CDFA 3TBKA 2RGCA 1T3SA 4MRNA 4EFNA 3IBGA 4EPTA 5EE9A 4IFEA 1E9FA 1L7VC 2QUZA 2D4HA 1KSJA 2E1RA 4FINA 4LY6A 3LW8A 4JKYA 3ND9A 4H9GA 3FMOB 1Q1EA 4HDCA 2C78A 1KHTA 2XEXA 2WMNB 5G53C 4R2HA 1SXJD 4V0ME 1TTTA 1YQTA 3SNHA 4ASUA 3PCRB 2YJTD 1IM2A 4G3XA 2BDTA 1IHUA 1UEIA 1NJFA 2CJWB 4HAWA 4LRWA 1ONBA 3K0SA 2R44A 2CDNA 1ZP6A 1QHXA 1E2GA 2CMKA 2ZS9A 4AURA 3BBPA 2J59A 4DHEA 3GLHB 4MDFA 3GFPA 1PZNA 5FUVA 1RRGA 4GRAA 5KHOC 5FR2A 4DCVA 1LNZA 2QENA 4QC2A 1BMFD 3I8SA 2HCBA 2FFAA 4XOIA 1R0WA 1JBKA 3CRMA 3WP1B 3GLHE 1G3MA 3K70D 2WTUA 2O0KA 3BS4A 4LJ8A 2BVNA 2QU8A 2BCJQ 4LC1A 4YC7A 1FL9A 2OCBA 4C0HA 1OIWA 4PC2A 3RRMA 5EJEA 1QG4A 3QVUA 1D9XA 5TV2A 1L4UA 1XTQA 1GAJA 1HV8A 1LVGA 3LDAA 3R9IA 4M1MA 2R2AA 3MFYA 3CZQA 1B23P 4BFUA 2WJIA 4EQ6A 2OESA 3PUVA 1AZTA 4Q1EA 2CXXA 2UZ3A 5EXTA 4XWOA 4PHTA 4XWKA 4QM7A 4RZUA 2Q9CA 2GEVA 4B34A 4MITA 4DSTA 2VYFA 3B60A 2GXAA 3P1JA 3EW9A 1PUIA 1XMVA 2ZS8A 2J7PD 5G3YA 2IX3A 4QBIA 1F5NA 1BOFA 5TY0A 1ZUHA 2O8EB 4A6XA 3DPUA 1TPZA 4GBMA 3CF2A 5CM8B 3OIYA 1PV4A 4A4DA 3BERA 1S1CA 2GILA 2VL7A 1E9EA 2BBWA 1FW6A 5KNDA 1XPRA 2YWEA 1D9ZA 3VKWA 3GFTA 1ZU4A 2OBNA 3SYLA 3T5GA 3K0AB 1KY2A 4DSOA 3WNDA 4HAYA 4HB3A 4NZYA 1SVKA 1GKYA 1GIAA 2BHRA 1JR3D 3UIEA 4R71A 2BMDA 2ANCA 4IJMA 1NSTA 3R7WB 3U6KA 2YKGA 1L2TA 1Z0AA 1Q1BA 2WVJA 3QF4A 1OFIA 4I4LA 4TLAA 1N2CE 5HZKA 4Z1MD 3S1AB 1E9AA 1W2HA 3HP1A 2AHOA 3QIAA 5TDHA 1CBUA 5LB2A 2IYVA 2IYXA 2AX4A 2JJ8A 4DLVA 2XITA 1NLZA 1NP6A 2BEKA 3ICEA 3LQQA 1OH8A 4MGIR 5FBRB 4B35A 3OAAA 4WXPA 1ZINA 5KOYA 1Y63A 2QROA 2ZSAA 1A82A 5D3MB 1KI9A 4UKDA 4MYTA 1XWIA 1KDRA 2ZUBA 3U2QA 1XPOA 2F3RA 2WWFA 2QRNA 1Q0UA 2ZI9A 3VX3A 1SZPA 1FUKA 3A4NA 1XD2A 4OI4A 4V0MA 2DWOA 4OHWA 3QKTA 4IDOA 4F91B 1Z83A 2HJGA 2E9SA 4JBYA 4D80A 1W49A 2BCGY 1JPJA 1KTVA 3CNNA 1MRSA 1XEFA 4NYIQ 2GA8A 2H7VA 4RY2A 1P60A 1HTWA 2ZJBA 1NG9A 1P9WA 3L82B 3JZMA 1UDXA 4PZYA 2YC2C 4RFSA 3EZ7A 1ESNA 1NN3A 1SKYB 2V7QA 1JNYA 4DDWA 4BZXA 1P9NA 3ZD6A 2H17A 4GPTA 3CB4A 2WJYA 3ZIAA 2O8FB 2H16A 3PEWA 3I4LA 3P32A 1U94A 2ZRJA 1XFAA 2B8WA 2V54A 4ACAA 1II8A 2J0QA 3T12A 3TR5A 5DYGA 5E95A 2FPKA 3ZZUA 4I1OA 2OXCA 4Q9JA 2AFHE 1Z5ZA 2ZS7A 1I2MA 1G16A 3FHOA 4RCZA 2QTFA 2C2HA 1FOEB 3I3SR 4G5GA 4CIDA 4GZMA 4EFLA 1TMKA 3UMRA 2P0EA 2GTPA 2A7QA 1BMFA 3T61A 1XF9A 1N3BA 3AUXA 4C0BA 3THWA 4PAQA 5IT5A 2N46A 4HLUA 4URUR 1MRNA 3A4MA 4YLGA 1OYWA 1Z0FA 2QQEA 1J70A 1WMSA 1AJEA 3EZ2A 5JZVA 1ZBDA 3D31A 2WMOB 4NE2A 2PZFA 3KQLA 3A8TA 3LX5A 1H8ED 1RC8A 4C3ZA 2ZQ5A 4HLQB 3IQWA 1T0JB 1NN5A 3U3MA 3QJYA 3HR7A 4KFSA 2XJ9A 2DFLA 5AWFC 2JDIA 5EE0A 1ZNWA 2NG1A 4MGZR 5GJVC 2J0UA 4TQAA 4B44A 4BGDA 3U7HB 1QHYA 4WBSA 1VG0B 2JLRA 3RWOA 1XRJA 4Q4HA 4NONA 1A5TA 4B6FA 4MRVA 1IY2A 2QAGB 4JIMA 1HE1C 4NCKA 1FMLA 3AF3A 1E0JA 2XNDA 2JJ1A 2C99A 1WP9A 4OQNA 1GL9B 1W0JD 3MJHA 1WBBA 4AKHA 1G291 5FL7D 4JSTA 3PR1A 3IQXA 2O8CA 1AM4D 1DEKA 2JLWA 3EA0A 2WBLC 3SJZA 1DOAA 2BMEA 3RWMB 1NNEA 4Q9IA 3TW8B 2D62A 4B33A 2HJVA 1XCPA 5EZ6B 1W0KD 3X1DA 2ZUDA 1L8QA 4B75A 3AVUA 1R8SA 4TTPA 2X2FA 1P75A 3KL4A 4F4CA 4QOSA 4A2QA 1E4YA 3GEHA 3GLHA 4LV6A 1BYUA 3KJIA 4LHYA 4TYYA 4Z54A 1U0HC 4GOXA 1FUUA 3BH7A 5EUMA 3PEVA 5IRCD 2GAOA 1K5GA 2A30A 4H1VA 4HLDA 5FTJA 2ECKA 3TVDA 1EFCA 3QQ5A 1NBMA 1YE8A 3RRYA 2BBTA 1SQ5A 4GMDA 3ZS9A 4HZUA 1PUJA 3KDSE 4KLNA 1KOFA 2PJZA 3PUZA 5C4MA 2C8VA 2JJ1D 3JZAA 1NVWQ 4KV9A 4LHZA 2KJQA 4BLSA 1R6BX 2QGNA 2XX3A 3LA6A 4NDZA 4GOKA 4HATA 2BM1A 1ZUNB 4Q4JA 3N5CA 1MR3F 4C2UA 2GAAA 1L4YA 1XZPA 1G3QA 3CRQA 5DHFA 1ZC4A 1T8TA 1QHGA 2VO1A 3AVVA 3FKSA 1MO6A 3DDCA 2VHJA 4LPKA 4U00A 3TSOA 3U44B 3QBTA 1E79A 3AGQA 2PZGA 1NMZA 2YWHA 3R8FA 4Q47A 3U7GA 2GK7A 1IQPA 1ZM2A 5FOXA 4BFSA 1X86B 5EXPA 5FBVB 3RS2A 3C14C 1Z3IX 2CLCX 4EKDA 1YZKA 3CPJB 1LB1B 2VP5A 1GKUB 2XTNA 2W6JA 4JLKA 1OH7A 2J7PA 2J3EA 3CUEF 1GL6A 2ZI3A 1XD8A 4C2TA 1GRQA 1F48A 5C1BA 4CEJA 3NG1A 4LBZA 1T5IA 4HAZA 3UG6A 4D6PA 4TTQA 1IY0A 4CF7A 3PXGA 4A2WA 4XVUA 2Q9AA 3DMDA 3ONWA 4B74A 1I4TD 3W3AA 5L3QB 2YINC 4FXPA 3DHWC 3WY9A 2QRZA 5JWRA 2BV3A 2GXUA 3KXLA 4AIIA 2GZHA 1GRNA 4LYJA 1XMJA 1IXRC 1T4GA 1T5LA 3PJRA 4LHVA 3C16C 4KLZA 1VKJA 3PUWA 1E1QA 3FHCB 3GLGE 1IXSB 2NZ8A 1BKDR 4P4UA 5HE8A 2V7QD 5KSYA 1QZXA 1YRAA 4ZV4A 3TGPA 2ZE8A 3KTAA 3MRSA 1AKYA 4HAXA 3AF1A 2QMUA 1H8HD 4AYXA 2VSXA 4TZ0A 4L5BA 1XTKA 1DG1G 4D81A 3HU2A 2W2TA 1C1YA 1IJEA 1UDWA 2CNWA 1G8GA 2ZR9A 3A58B 1IAQA 4GZLA 4R98A 1D8TA 1OJLA 2PH1A 4LJYA 4F4IA 3QPUA 2D2FA 1JEDA 5TB5A 2JLUA 3REFA 1E99A 1RKBA 2GJ8A 2WOOA 5AJXA 3RC8A 5DNYB 2R9VA 2GNOA 3FKSD 4FIDA 2VBCA 1Q3TA 3GCGA 1HQCA 1J8MF 4QBHA 4O25A 2NMVA 3WYFA 4NMMA 2W6ID 1ZM4A 1KO7A 3A37A 4HDOB 3T35A 2F9LA 4E09A 3B1WA 4KFRA 4IVRA 5BXQC 4Q5IA 1KJWA 3B9QA 3LWNA 4PQRA 4NYIR 1EESA 1JI0A 2ATVA 3FPAA 4BFTA 2D3WA 2VP4A 2QEQA 3AF2A 4TQUS 1Z28A 3EPHA 2N42A 3QKSB 3RDPA 4DCSA 1HUQA 2A5JA 1US8A 1NVVQ 4E22A 1JR3A 4DLYA 4I1UA 1Q12A 3I32A 3BH0A 2EFHB 4AWXA 3NEYA 3VMFA 3G5UA 2JAQA 1J99A 2YVUA 4Q02A 1EWQA 3VR1A 3IPYA 4A8JC 4F38A 3UATA 1ZD9A 1Z0KA 3G82C 2ZR0A 1NY5A 1XCMA 2IYYA 1XEWX 1KJZA 3Q7PA 3BB1A 2OCYC 3VNVA 2REOA 4HSEA 1U90A 1SVWA 5FI0B 3QI2A 2Q6TA 4ARZA 3P20A 4EFMA 3ICQB 4GP6A 4FMCF 1XTSA 1W5SA 2B21A 2MSCB 2VIIA 1S9HA 1Y3AA 1XEWY 2WSSA 3QKSA 4H1UA 4QHTA 3VR5A 2ORWA 4JBXA 1EFHA 2C04A 4HUQA 1CP2A 1K6MA 3BK7A 2CLSA 4LJAA 5H70A 3P4YA 3BB4A 4RSGA 3DO6A 3QKUA 5FOSA 3CO5A 3SFVA 4B73A 3SN6A 2JDID 3VKGA 3Q7QA 2K5UA 3DZDA 5JJKA 3EARA 5H1YA 5FPSA 2P6NA 4KODA 1XEXA 2IF2A 2RB4A 2HYIC 3K9NA 3SQWA 2FOLA 2KE5A 1WXQA 2WWXA 4WVFA 3AVWA 3AVTA 3RYTC 4CEHA 4D25A 1W0JA 3EG5A 5J4LA 1UJ2A 1Z63A 4OYHA 2Z0MA 1QRAA 2ZE7A 1E1QD 1XB2A 1DS6A 1AS2A 1OKKA 2GF9A 5EXSA 4B6EA 4NH0A 2NIPA 4ARZB 1S0UA 3F0TA 1F60A 2CL7X 1YR9A 2FSGA 4LCBA 3TH5A 1G5RA 4LC0A 1E2MA 2CK3D 2F3TA 1W7AA 1SXJB 3K0EA 5HKKD 3QOFA 2VSFA 4BPBA 4Q9HA 1T3LA 3EZ6A 4KI0A 3K0CC 4OK6A 5DISB 4LJ9A 4RD1A 1E0AA 2BJVA 2AKYA 2PZEA 1RIFA 4AG6A 1E2KA 4ZCIA 3K1JA 3K09A 1DBSA 3ND8A 1E2EA 1U81A 4IHQA 2IYZA 1PVOA 3CR8A 5FPKA 1KSGA 4A6PA 2IHYA 3NC1C 2CLDX 2DY1A 2ZRFA 4OJKA 1M74A 1KI1A 5FUWA 3N2IA 4QGHA 4TQ9A 1XMSA 821PA 5FR1A 3WNBA 2QY9A 5CB8A 1CULC 2EWVA 1RJ9B 3PIRA 1DO2A 1K8RA 1VIAA 2EQBA 4V02A 1JALA 4WOPA 3FHTA 4WZAE 5F9HA 2H5EA 1NIJA 4OQXA 4FMDB 3ZH9B 3BWDD 1ZU5A 3MGCA 3ZLJA 2F55A 1P72A 1IOZA 1P4SA 4LZZA 5CJ2A 1CU1A 1FFHA 3RRNA 4RZ3A 5JJLA 4JVNA 2GXSA 2V55B 3GEEA 3ZZTA 2TMKA 1UAAA 2W0SA 4PQYA 1X1SA 2GJ9A 3RNLA 3GJ0A 3U4QB 1FQJA 1KAGA 1XCGB 3K09C 1DAKA 4M9XA 1Q44A 3LXXA 3W9YA 1AQYA 1HURA 5FPYA 3C5HA 3GLFB 1UBFA 1YKSA 3K0CA 4PC1A 1AZSC 4IEIA 4HLCA 4IOMA 4UNNA 1R5NA 4Q1CA 2RMKA 4LV8B 5A0FA 4A0FA 1W0KA 4L8GA 3QXHA 1ZCBA 3MCAA 4OHXA 2GCNA 4AD8A 2UKDA 2CHGA 3QENA 2JJ2D 1E2IA 1RRCA 3NXSA 4NKRA 3R9XA 1P2VA 3AKEA 3AF0A 3W8RA 1S9DA 4IW3B 2ODEA 1GITA 2OBLA 2FX3A 2NGRA 3TQCA 2Q3HA 3M0EA 1J8YF 1NRJB 2DFKB 4OHZA 1F2TB 1CR0A 1E0SA 2ZSFA 3RRZA 2WJHA 2BBSA 1E2NA 1HT2E 4ZCMA 1E96A 3PUYA 4RCYA 1VCOA 1IN6A 3LO5A 5CM9C 4A0GA 3WNCA 4RZ2A 4DC9A 4ZDJA 1M2OB 4LBYA 4D4KA 4G5RA 2DWQA 1KO4A 4ACBA 5JI3E 2ZRDA 3FFBA 3QKRB 2GKSA 1W46A 5B30A 4DUGA 2FSIA 3AKDA 3M1IA 1E69A 4O2LA 1XNJA 4X8OA 4ERNA 3PV0A 4UXIA 5CB6A 3SHWA 3ZVMA 4IDPA 2YWFA 2XNSA 1P6XA 4PPFA 4Q4HB 521PA 1IN8A 1X3SA 2ODWA 2DHRA 2ERYA 4V0OA 5B57C 3VKHA 1KK0A 2LCFA 3WYAA 3X1ZA 4ESHA 2WWYA 1EX7A 1TF5A 4MYHA 4RVCA 5LB4A 2XZPA 2G9NA 3K0AA 1Q21A 4BFXA 5CLQA 2V6JA 3MWYW 3ZQJA 4BLOA 1T8UA 1X1RA 3WRXC 2AR7A 1H8EA 3F8TA 4AKEA 2G1JA 1CRQA 2XXAB 2QZ4A 1AKEA 4TTRA 2XZLA 2H18A 3QF4B 3QG1A 2QGZA 3U3OA 3S1AA 1KI6A 4A8JA 1MV5A 2IS2A 4TL8A 1DELA 3PUXA 3W34A 3LRPA 2WKPA 4D4JA 3THXB 2J41A 3CNLA 1R0XA 1G7SA 3VX4A 1G1MA 2WJVA 3BORA 2WICA 4UNQA 2JLSA 1ZNYA 3AP3A 3OEHD 2IYTA 5K8TA 1XTJA 2QT0A 5H8WA 2JLVA 1KMHB 4DEXA 1E2JA 4HZUB 3BOSA 4CT4B 4BWYA 5DN6D 3L0SA 2OUKA 4OI0A 1DVRA 4QGAA 2FEMA 2BC9A 4YMVA 3U5ZB 1MH1A 4Q4JB 3CIOA 2D2EA 2XOKD 2ZRPA 4DB4A 2AK3A 2CBZA 5JFGA 3ETLA 3NBYC 4OK5A 4MKFA 2DFNA 4Q1AA 1TUIA 1EG7A 1DE0A 2PT7A 3QXCA 1KK1A 1DAIA 5E7JA 3X1WA 3B1ZA 5BWMA 4JLJA 5EP1A 4TWZA 4URWR 3THXA 1LFDB 3V00A 5CIWA 4LJ6A 4KVAA 1LTQA 1B0UA 2LWIA 2JLYA 4NCIA 1N0UA 5EP2A 1A1VA 3ADCA 2EWWA 4JVLA 1J7KA 4QFMA 1TU4A 4ASUD 1Z07A 3D8BA 3TJZA 2IWHA 1P3JA 4A0RA 4PSVA 1E2PA 4P32A 4CGZA 3HWSA 4X8HA 2ZETA 4JSYA 1XZQA 1UKEA 4TYPA 3CR7A 3I5XA 2MMGA 5SZIA 2ZITA 1PJRA 2VF7A 4R7ZA 1XPUA 2B7CA 1YZGA 1KI3A 4LWZA 1IY1A 1NVVR 4A36A 4YONB 1VYUA 3PG5A 2IYLD 3CH4B 1E1RD 4US0R 5ANRB 4B2PA 3UXMA 2GZAA 1OH6A 4TT3A 5FH9A 2WIBA 3A6PC 1BS1A 2RGAA 3O8DA 5JS7A 1P2UA 1GUAA 2R65A 1AIPA 4V03A 3U3JA 1RRFA 1M7GA 4JL8A 3RS4A 1YU9A 4NU0A 4KSBA 4B32A 4DEYA 3AM1A 1COWA 3KTAB 4JLDA 4X8LA 5FL7A 4BECA 1EGAA 4FWIB 2FGKA 2WAYA 4IOLA 1NF3A 3MD0A 4JJZA 3MWKA 3KKMA 4BFVA 1YZTA 1XXHA 3FYHA 3A1TA 4LYFA 3O47A 4O2RA 4PX9A 1G21E 2QAGA 2BMFA 1OH5A 3PENA 5JLJA 2IYQA 2FFBA 3D3QA 3HYRA 1OFTA 3AB3A 3UWOA 1QHHA 1R8QA 3QF7A 1V43A 2BKEA 1IONA 2HF9A 3SJBA 4NBSA 1W47A 3W6OA 2O8BA 1NN1A 4BFYA 3ZZ0A 3K9LA 3AF4A 1TAGA 2GDJA 5JMTA 1DAMA 4M1YA 4IFBA 1D2EA 1QF9A 3PITA 1G7RA 5IF9A 1S8FA 2FGJA 4JJKA 2V1XA 4MUBA 5FUXA 4TYNA 1E4VA 3GJ7A 1GOTA 1OKKD 2P5SA 2H1LA 2FFHA 2YC4C 2YZ2A 4N0DA 1LF0A 2IUTA 1YR7A 2ONKA 4BFZA 1EX6A 4CT5A 4PO8A 2KB0A 1ZRHA 2RGNC 4K8OA 3B1XA 4HEJA 5HKKA 1JJ7A 1QHHB 3OEHA 4G5SA 4ZO4A 1ODFA 2QORA 2DYKA 4D0LB 2PLFA 1DAFA 2NPIA 5JECA 4YXWA 1SXJE 1NBME 1NI3A 1XJCA 2Q3FA 2ZRCA 3RANA 3AGPA 2JIZA 1GDDA 1XTRA 2ZIAA 2HYDA 1CR1A 4CEIA 2O8CB 1NIPA 2C9OA 3GJ6A 5IK2D 2OLKA 2AL7A 3FB4A 4S35A 4IRUB 2ZI7A 4FN5A 1O87A 4TL9A 2ANBA 1OB2A 4DLUA 2RGXA 3K0FB 5C46F 3UMFA 2CCJA 4LOAA 5AUOB 1OIXA 3CLVA 3EX7C 3THYA 4BLPA 1KO5A 1XD9A 4IXNA 4IOKA 3U7EB 2RKOA 5KNCA 4L4UA 2WZQA 1ZYUA 3IIJA 1N6IA 2GHIA 5FOWA 1T91A 3KZ1E 4KYUA 4Z1MA 5BN3A 3ZYCA 4ZPXA 3ZDQA 3K70C 3DEFA 4IXMA 2XAUA 3WHLA 5D3MA 2OG2A 2O8FA 3EIQA 3BJIC 1NMXA 1JAHA 1I4LD 3OAAD 2ZROA 1U0JA 3VU9A 5DO9A 5L3QA 3NTUA 2H92A 2F9MA 1VYTA 1VTKA 2NZJA 3NDPA 4K46A 1GZSA 2QPAA 1C4OA 2ZU6A 3I1FA 3VAAA 2QAJA 4Y0VA 2ZPTX 1YZLA 5FTKA 2QM7A 3GLIA 4JLVA 4TT3D 2G0TA 3KQKA 4F93B 1T9HA 1JECA 2VEDA 2F1JA 2IYWA 1G8YA 1SULA 4MQBA 1RYFA 4CZ2A 2V8OA 5FTNA 1E2LA 2AK2A 3A1SA 3LLUA 1CJKC 3ECCA 4Q19A 1GKIA 1GTVA 2JJ2A 1G7TA 3C8UA 1X8KA 3GJ4A 3BB3A 3L0IB 5FUYA 5KDLA 2RGNA 1ZM3A 1W4CA 2NPFA 2WOJA 5AUQA 5KPDA 5FFMA 2JEOA 221PA 1TQ4A 4PR0A 1MKYA 4FCTA 5FI1B 2BJWA 2CHVA 4NTZA 4C4PA 3QSYA 3DVLA 3DZ8A 2QTHA 2A5FA 3IBYA 4XWAA 3SJCA 4D4MA 5TMPA 1NKSA 3SQXA 4M4SA 1LY1A 4NYMR 2D06A 3KX2A 2EVWX 1BO6A 1ZVQA 3WHKA 2NTYC 2PLRA 3DM9B 5L3RA 2PJRA 2Y8EA 4NYMQ 1CIPA 1KDOA 1TF7A 1TF2A 3FKQA 1Z06A 1E9CA 3PVSA 3FOZA 2VHQA 1A4RA 1PLJA 3C4JA 4N1AA 4XVRA 3W5IA 1MT0A 3RC3A 4GP7A 1N6PA 1G9XA 3MLEA 4IKEA 1OIVA 4DT1A 4DWJA 2KSQA 4W5HA 4ILEA 4OK3A 5F98A 1E9SA 3QEJA 2DWPA 2GBLC 3LQRA 3QXJA 3AVOA 4G1UC 5SZHB 2MMCA 2ZANA 1TEXA 2CEAA 4KAXA 3AQ4A 3EWAA 1YVDA 3RS5A 4UXJA 3K53A 1KK2A 3UANA 2FPLA 2C96A 3T06B 1VDZA 4UXHA 4LJ5A 3NKVA 4W5JA 5EE1A 2Z5FA 3E1SA 1ZIOA 4FI3C 3NVAA 2R6DA 5JSZB 1IN7A 4G5QA 4DCUA 4Q7MB 1KJYA 1Z47A 3GEIA 1IXZA 5KYKA 2MSDB 2ZAMA 1DG3A 2V4ZA 2WKQA 2ZVQX 5JHGB 4HUQB 5DI3B 2IWRA 3EPJA 2KBEA 2DCUA 4I1SA 4DLTA 3DL0A 4QJ3A 2QMHA 3CZPA 2IL1A 4L15A 2DR3A 3QXXA 2ZAOA 2ZSBA 2IT1A 3KKNA 3RLFA 4HB2A 3MAAC 5DLQC 4PO9A 1NL3A 4B71A 3WYGA 2CCKA 1G41A 3K70B 4LJ7A 3RAPR 5DSZA 4URVR 2ZYVX 3KUDA 3Q3JB 5KSPA 5L8VA 3OE7A 1Z6GA 3B7GA 3CM0A 3CPHA 1OW3B 2GEUA 4KFTA 1X6VA 4M1TA 3LBNA 3SU8A 1I2DA 5TARA 5H68A 2RGDA 2AWNA 3T34A 2DPXA 4YMSA 4QJ5A 2KWIA 1KGDA 4NHOA 3PFIA 2AXPA 2JLXA 2G1KA 2V3CC 2VHUA 4AY2A 3KB1A 3A1VA 4FMBB 1Z22A 4UQOA 2ZE6A 3SBDA 2WM9B 4W5WA 4DDTA 3B9PA 4JL5A 2IUSA 5A4JA 5UKDA 4DLZA 3T1VA 3U7FB 1E2QA 3Q5EA 2W00A 3O8RA 4AG5A 1E0KA 4OI1A 1OFUX 1OYYA 4WZ6A 5JBQA 2XZOA 1QHIA 2P65A 1WRBA 3H2YA 4HZIA 4GI7A 3SE0A 3VR6A 4MRPA 5DHAA 4DIEA 1HT1E 3B1VA 3BE4A 3MG9A 4IDNA 2QA5A 2OSBA 3GJXC 4ZKEA 1II8B 1TQ2A 2XSZD 3OE7D 2ZJAA 1UPTA 2BKUA 2QN6A 1G19A 2FMXA 4XTRA 5HCNA 4WZBE 4C0JA 5IHPA 5EE5B 3QUSA 1RE0A 4PPNA 3AUYA 2NOAA 5CLLA 3QE0A 2G77B 1LS1A 4ON9A 3TE6A 1NVUQ 3EC1A 3IEVA 4HAUA 4F4JA 1SKYE 3U60B 721PA 1WCV1 4NP6A 2QSZA 1KSFX 1G4UR 5DN6A 4RD0A 3RABA 3SHFA 1UEJA 5GVRA 1RW4A 2ZYWX 3IEUA 2ONJA 4V0LA 3OF5A 3EPLA 5BW8A 2W6IA 3T1TA 4TMXA 1G6HA 4MGKR 3M6AA 4PZZA 3RS7A 3QY0A 3EZ9A 3THOA 4RKFA 3LVQE 1A2KC 4RD3A 1F6BA 5J4HA 2PMDA 2GWHA 3U3KA 2WV9A 1DAEA 1QVAA 2W2VA 4OI2A 2JIZD 1A7JA 2LKCA 4ZDIA 3IGFA 2J7KA 2F1HA 3SI7A 2OCAA 5J4VA 2GVZC 3L43A 5KUTA 3M4YA 1WB9A 1W44A 2IHBA 1KYIA 3AEZA 1ETUA 1YZUA 3GLIE 3EXAA 2RAPA 2HT6A 4Q18A 4WA7A 3GLGB 1RZ3A 1FNNA 5FOVA 3REGA 1U8ZA 3SFZA 1UKVY 4LHXA 3DKPA 2OLJA 3L2OB 1JAIA 2J9RA 3TW4A 3D6TB 1GNQA 1M7BA 4YQFA 3QG5A 1TU3A 5P21A 3KKOA 5CYPA 3EIHA 3IDQA 2FSFA 3ZIAD 5DI9A 621PA 2X8AA 2ZRKA 3QPVA 3W6PA 1R0ZA 3LFUA 1JXOA 2ATXA 2IXGA 3P4XA 3W6NA 3A1UA 1N6LA 2ZRBA 2CE2X 3SYNA 4QNRA 5EQTA 2Z4SA 2Z4RA 1Z6XA 1N25A 1CS4C 2W6JD 3BFVA 5EE3A 1Z0IA 4DB2A 2A5DA 1TL7C 2PT5A 2Z6VA 2D74A 4JBWA 4N3NA 3U61B 3V9PA 5JCZA 1F3OA 2PEZA 1FPMA 1N6RA 3K8YA 3WXMA 3IO3A 1CEEA 1SVSA 3E5HA 3HJNA 3CF0A 5IDVA 1D2MA 3ZGXA 3VR4A 1U8AA 3OZXA 2CJWA 1Q1QA 1ZW6A 1H65A 4QBGB 3B1YA 1KI6B 2GK6A 4JLPA 1QHSA 4KBFA 5KNBA 3CW2A 1P2TA 1SXJA 2QP3A 4Q00A 5E3HA 4II7A 4Q21A 5GVSA 1Z6YA 5HZHA 5LD2B 4C7OB 2GF0A 2IEZA 3CKLA 4G01B 5BYJA 3UPUA 4DIDA 2I1QA 2QNRA 1HA3A 2HV8A 3EAQA 4PHHA 4Q7JB 4RFVA 3ZVLA 3VR3A 1EFTA 4XTCS 4J0QA 2X2EA 4URZR 1SVMA 4Z8XA 4PTLA 1G3IA 5DIFA 4PC7A 2OCPA 1P5ZB 2QP4A 2ZRNA 4BQSA 4L9WA 5JSZA 2XJ4A 4MKIA 4EDHA 1A2BA 3ASZA 4EJSA 2ZRIA 1UBGA 2XNDD 1M6NA 4B2LA 2ZREA 1GSIA 1DARA 2WPDA 1F2UB 4M8NE 5CJPA 5FBLB 3TK1A 2G83A 3W3ZB 4OJQA 5DYIA 4ESVA 2G6BA 4Q9KA 1V5WA 2CVFA 3KKPA 2ZYTX 2A3RA 4BZQA 3R20A 4CRWB 3IIMA 2JGNA 3KKQA 2C77A 4KFUA 5EP4A 1E6CA 3IKJA 2VH5R 1II9A 2GCPA 3C15C 2F43B 2IA5A 1SVIA 4N0EA 3AVXA 2Z83A 1JJVA 2ZEJA 1UF9A 2J46A 1XDBA 1VYVA 3DOFA 3NEJA 4A9AA 2B6HA 2O5VA 4URXR 4KITB 1AQUA 2HEIA 5AJVB 5HE9A 2O8DA 2WWIA 4POAA 1SKQA 2GEDA 4NCHA 3T15A 3SZRA 3KQNA 4KO8A 2Q0HA 1M7HA 1TQ6A 4PPGA 2ZVPX 4G5OA 3NHAA 3B85A 3U4QA 3K9GA 4Q66C 5G3ZA 4TMWA 2IYRA 2R6AA 3VTKA 2GXQA 4FCWA 1CR4A 1P61B 2NO1A 2YNMA 3GLFA 5FL3A 2JLZA 3W8NA 4TL6A 2R6CA 3N70A 2E87A 3FWYA 2HUPA 2PCLA 1OHHA 3A36A 4LDJA 4P33A 1OXVA 2VF8A 2OM2A 2XGJA 1XX6A 1CR2A 1YZNA 3W5JA 3B2EA 3JVUA 4DLXA 5IK2A 3X2SA 4WAUA 1NKTA 2FN4A 3TUIC 4A82A 4NPHA 4O0MA 2BBOA 1KDPA 2EFDB 4LI0A 1NJGA 1OE0A 2FPMA 2ZJ2A 1KI4A 4KSCA 4XIGS 2O8DB 4EPXA 5TXGA 3TRFA 4DLSA 1ZM7A 4D26A 2OE2A 1S96A 1EXMA 4PPQA 4ZKDA 4DSNA 3P26A 2OFXA 4YMTA 4EUNA 4LBWA 3LLMA 4Q4AA 2CL0X 3EWSA 5LD2C 2ZJOA 3KB2A 5FOUA 2BWJA 4LYAA 3DKVA 4A15A 3VHLB 5AJYA 3FE2A 4W7SA 4LHWA 1RVDA 3WMGA 4MA4A 2PX3A 2W0MA 1NN0A 4P4SB 1F2TA 3LXRA 4JMPA 4LSGA 5BN5A 5JRZA 2GJSA 4HB4A 2IK8A 4BUJA 3EPKA 4HB0A 5CYOA 1NSFA 1SVOA 2EFCB 5JEEA 4WIAA 3ZS8A 3KQHA 3H0KA 3ZJYA 1YHNA 2FSHA 2QAGC 3TVTA 4ITRC 2YYZA 4M1OA 1N6KA 3F3YA 2GJAA 1QBKC 2OHFA 3W90A 5DE3A 1XXHB 4HI0E 2HLDA 1KY3A 4V0KA 1NBMD 2J1LA 5FOTA 1SHKA 4JZKA 4YDSA 1DTSA 3G0HA 4PSKA 2FNAA 2P5TB 5J40A 2NO6A 2G3YA 2GESA 4KU4A 1AS3A 1G8FA 2IEYA 3GLGA 2YOHA 3CRVA 1KO1A 3OEEA 1CRPA 1U9IC 5J4YA 1JQLB 1OXSC 2O8BB 2PX0A 1JB1A 1E3MA 1E32A 2EW1A 4WW0A 2H57A 2MSEB 4DVGA 1XU4A 1ZUIA 2FZLA 3CF6R 1W4BA 4PSAA 3THYB 1D5CA 2RH5A 3BGWA 5LPNA 1AS0A 4GOJA 1U0LA 1ZJ6A 4P3YA 4B2IA 2NO9A 5G40A 1G5TA 2YV5A 3HU3A 3P27A 2XB2A 3ADKA 2EFGA 3CONA 3C7KA 4DDVA 1NG1A 3VHXA 1RPZA 4IVQA 2QPTA 1UM8A 4M9ZA 4ZIRB 4KCGA 1N0VC 2GRJA 5DH9A 4F7WA 1VCMA 1KMHA 2N1BA 3WBJA 3T1OA 3GFOA 1EWRA 121PA 1PLKA 1TX4B 3JVVA 1EFUA 5SZKB 1VG9B 3BAFA 3ZQ6A 4OKSA 1D6JA 1T3HA 2VP9A 3HPQA 3OIVA 5CDFE 1W4AA 1GNPA 2JLQA 1HEIA 1UKZA 3SEAA 4HYYA 421PA 4B3GA 3QPWA 1R5OA 2BMJA 5SZJA 1OT3A 4QKQA 5JWOA 1Z0JA 1KAOA 2O0JA 4K81B 2A78A 1LV7A 2GZDA 4BEJA 1QDEA 1ELOA 2X77A 2ZJYA 4L16A 4XH9B 2BIFA 2FJUA 3K0FA 3QNUA 3FMFA 2C95A 1Z6TA 3H1TA 2HXSA 2D7DA 2GETA 1P73A 3R7WA 2QE7D 2QG6A 1ZNXA 4PAOA 1H8HA 1NLFA 2ERXA 4QG7A 5KDOA 2GJKA 3B5JA 5FBQB 3RVBA 4EAQA 1ZNZA 1W2GA 3GD7A 3IUYA 3IILA 1KSHA 4MYCA 4OBEA 2WWHA 2IUUA 2FFQA 2ZRMA 3Q9LA 2WWWA 3FMPB 5FPTA 3LAWA 4I99A 1HE8B 1MO5A 1G3RA 2VLIA 3A1WA 4B3XA 5GJCA 1VG1A 5M04A 4C9BA 2I3BA 4M21A 4JT4A 4LPSA 4EPYA 3KFXA 4C0SA 2ZE5A 5CK4A 5JRJA 3UKDA 3MSXA 5CIQA 3FVQA 3V4FA 2J5XA 4DUGD 2W58A 1GVNB 1XBTA 2CK3A 2ZU0C 4DJTA 5J47A 3NWJA 3GLIB 3LV8A 5G41A 3GPLA 3MWJA 2F7SA 3B6EA 4EIWA 1WBDA 5D3QA 1ZAKA 2B92A 3OIUA 4TMZA 2P2LA 4PC6A 3WRYC 4C0KA 3C5CA 4Q1BA 4QJ4A 1E98A 4XSHA 1EFRA 1VCIA 3NHBA 1G18A 2NO7A 4GNKA 3RS3A 5ELXA 1CXZA 4AI6A 1CJUC 2P3SA 2REXB 2ZI5A 5B2ZA 2WIAA 3EIEA 5KU1A 3SJAA 2FU5C 1R4AA 2PBRA 3SOPA 1AGRA 2NQ2C 5FPHA 2C9CA 1G5PA 4XJXA 2RGEA 3GJ3A 1K5DA 3VQTA 4JT2A 2OILA 4Y0AA 5DGXA 1WQ1R 2IC5A 1KMQA 2ZRAA 4QRHA 4XVQA 2QT1A 1W48A 2ZJ5A 5AUPB 3FTQA 1I4DD 3LNCA 4FW9A 4Q9LA 5AK0A 5AR1A 4TLBA 4KJZA 2H8KA 5AJWA 2VRWA 2AN9A 5BQ5A 4O3MA 2C03A 5JWHA 2AFIE 2YOGA 1E1RA 2FA9A 3I8XA 4ZDWA 1GP2A 3B8HA 3MUFA 4HDQB 3LX8A 2CL6X 3ZVRA 3THWB 5DI3A 4A2PA 1KNQA 2OV2A 4BLQA 5LDDC 4MRRA 2GCOA 2X19A 5KTYA 1UBEA 1XMIA 2IF0A 4EJSC 2AD5A 1IN4A 4F92B 1Z8FA 4KXFB 3WBKA 1W5TA 4X8MA 1KI2A 4TMKA 3L0OA 4JKIA 4LGMA 4RD2A 2ZRGA 1KKMA 4D0GA 1RRPA 4US2R 2VSOA 1Q20A 3L0PA 2QMOA 1IN5A 1YR6A 2OBMA 3BD9A 4LV5B 4NCNA 4B76A 3TSZA 3T5DA 4Z8YA 1TNDA
chains in the Genus database with same CATH superfamily
4HWTA 4C30A 2FE4A 1PZEA 3Q10A 4RXUA 1E61A 3ZGVA 2UUOA 1Q1GA 2D5IA 4UHDA 1NVAA 4BB9A 2OCLA 3KT0A 5I4CA 1DV2A 5CT4A 5HF9A 1DADA 3AVQA 4M1SA 2WFLB 4LXQA 1NBHA 2PH5A 2AC7A 3D0RA 3T8YA 4UNRA 3M3HA 4UPEA 2XLCA 1U7WA 1Q3HA 5K8LA 3MELA 3IHTA 4S2EA 4QNMA 2I8AA 1Z0UA 3A4YA 4Z9BA 1E5TA 2O2GA 4UJ5A 4HWSA 4M49A 2SHKA 1NY6A 4YXWD 2GSDA 4NBVA 4P7JA 4BDSA 3NH9A 1A2OA 3DOEA 4RVHA 2QLBA 3LLSA 2FV8A 3G49A 3NETA 4N6NA 4QGGA 4YV7A 3EY4A 3IJ5A 1ZVVA 1GUBA 4RJLA 2OGWA 3CX8A 5ALWA 1NPTO 1QE3A 1Y3IA 2LZ0A 3AHHA 4QJBA 5E7MA 4B47A 3R9WA 3IVCA 1I6KA 4DCPA 1YVUA 3IIKA 3FZGA 4RQBA 1N9GB 3F7NA 2YTZA 3B12A 3LQKA 2A4MA 3S2SA 4CM7A 4XSGA 4A92A 5AVVA 3H83A 1RBZA 3TZLA 4MLCA 2WWRA 4DVJA 2R00A 4XDYA 4LIPD 3INYA 2XYRA 1ZM9A 3IJPA 3V8PA 1QFSA 3INNA 4HRYA 4U5XA 5I4IA 2BEWB 3HFRA 1CZRA 3ZDRA 1GA6A 3H13A 1CW2B 4Q3OA 1Z0DA 1T5HX 3X1XA 2R5NA 1UADA 1JMYA 5CGZA 3C3DA 5JQGA 2G28A 3WBBA 1VZ3A 3JRXA 4QVIA 4OQMA 1ECPA 4CMKA 4MA0A 2RD2A 2WK1A 2D8AA 3G13A 4A2CA 2NAPA 4PZLA 3FGNA 4PXYA 1NUSA 1A88A 1Q57A 5AMXA 2XA1A 5EMMA 3BWBA 1CUEA 1F17A 3FSJX 4R1MA 5DNCA 1BU5A 3SYRA 1XQ9A 4FBMA 4I55F 5HOEA 4A0HA 5K4GA 2YWGA 1N2EA 3E9DA 1YKFA 4AKIA 1L5WA 2G0NA 1GILA 2O7NA 1DZ3A 1DEOA 1M1NA 1JHQA 1F9EA 2I6TA 3ESYA 4H1TA 4IIGA 3VUEA 2I4MA 4UDNA 1BXRA 1F20A 4HEQA 1FMJA 1SC6A 3N8KA 4ZCTA 1Z56C 4FCVA 3OQ6A 4YRIA 4LJRA 4LMAA 1ES9A 3G0OA 1YQEA 2D5CA 2ODNA 3MTQA 2JK0A 1KEUA 5CYFA 4M22A 1GQOA 1I13A 3VDXA 1IWPB 4UEKA 5C18A 4P5EA 3ZJ5A 2QD2A 5A0TA 1E2FA 2XRMA 4RYDA 2A67A 4P31A 4DG9A 4MDEA 1CKEA 1R4NA 2Z8YA 4P0TA 1WPQA 1VIYA 3SR0A 4CG0A 5JW6A 4NIMA 5KB3A 4BMPB 1QAMA 1MOSA 4FKZA 1BHO1 1JPNA 5TF0A 4K6CA 1LBEA 4HQLA 2ODBA 4XR9A 3KQUA 1YRWA 4DKJA 3ZQ4A 1J22A 3OTWA 5DTIA 1VHLA 3K9QO 5BURA 1UBNA 4PAMA 4R84A 3BT7A 5FD8A 3L4BA 3IDAA 3IPXA 1HNNA 1V8PA 1CTQA 1XZAA 1JEQB 1RCUA 2C7VA 1ZGZA 3E82A 1C3LA 3L8ZA 3OPYI 4IM7A 3JALA 4ENSA 4ALKA 4WGGA 4EI7A 1G6OA 4ZC1A 2J87A 1E94E 2FUG6 4D0SA 4DR6B 1NVXQ 1LBSA 3SBEA 2CMDA 3KFVA 4GICA 1JAYA 3R5FA 1CSEE 1Q1AA 1T4CA 2XE7A 4LRXA 4UM8B 3MMNA 4CFYA 1MIOA 4HNHA 3STHA 5C51B 3GPCA 1RYZA 3C4QA 3P2JA 1JZQA 3RU7A 4AICA 5EPUA 3TOCA 3HO1A 2QM8A 2HPVA 1WDTA 3A4LA 2DT5A 1YR8A 1VB3A 1WLSA 1G9SA 2NACA 2Z57A 3JYQA 3KOXA 4QL3A 3RGGA 4Z51A 3RH0A 4ZTUB 1JXMA 2ZJ8A 4ZAYA 4C4OA 3RG2A 3UAWA 1SVLA 4TS3A 1GZHB 4N3GA 4Q4DA 4G0NA 1M75A 3PPXA 2H0RA 2X13A 4F2PA 4UNIA 4ZRMA 4UUNA 4NOKA 4PG8A 5BP7A 1KRHA 4F4CA 2JCSA 3O2QB 5I45A 1EU1A 2V3WA 3E2IA 4FU0A 4ODIA 3TGWA 4GT1A 4IQ8A 2W6MA 2P4QA 3I72A 3OT1B 5EJ9A 1U4NA 3HXMA 2FUEA 3O8OB 1SEVA 5AQEA 2I7DA 3L46A 2Q2OA 1ZG3A 1MABB 2YHSA 3D3EA 2IS4A 4DCNA 1FDSA 5A5FA 2O8EA 1GARA 1UBUS 2UZIR 3UAYA 4ZYXA 3BH6A 1DRKA 2QR2A 4JLAA 4MRSA 4DNFA 4PZEA 1KC3A 3TKLA 3ON5A 4KWHA 5A5VA 4NK5A 2Z56A 5SYMA 5JCPA 4HDRB 5KOHA 2X40A 1XWWA 2DKFA 2Y9PB 1PJBA 4XQ9A 1JWLA 4Y2QA 4CIXA 5L53A 1CJMA 3CZAA 3CVUA 5K8UA 3IAUA 5JYBA 2O23A 4F3TA 3TAHA 2GN6A 4QXAA 2GOYA 2P40A 5FI5A 1G7CA 3FOBA 4KRXA 3CHYA 5JPIA 3ZTTA 1XJ0A 3C6MA 4BKMA 4CI9A 2H54A 3U4CA 4BZZA 2JGFA 2O2XA 3WQRA 5F64A 1SBNE 2CB9A 1GFIA 2QQ0A 2R6FA 3R7LA 4ENPA 3STVA 4EG5A 1GTG1 4A3SA 4JI1B 2WU8A 2XMGA 3G1UA 4PEVA 5DTMA 3TTVA 3JQQA 5PGMA 4M9QA 4G1MB 1DKLA 4GL4A 2O54A 3B13B 3MB8A 2GVDC 2YY7A 4LS3A 4MKRA 5KQGA 3W5BA 2EYUA 3C7TA 4AUKA 3FI9A 5DU2A 3E3MA 1VPLA 4QQNA 4LFCB 5C9ZA 3KPYA 1HRKA 2Q4TA 3T35A 3L7YA 4Q24A 2G5PA 2PQ6A 4GOMD 5TC4A 4PGFA 1XEAA 1XROA 1GL3A 2Q21A 4X1YA 1II0A 4NPCA 3BIFA 1LPAB 3A0RB 1DDOA 4GGMX 1PR4A 2PZBA 1Q0HA 3CBQA 4FOOA 1GNRA 1TLFA 3F4KA 3OFNA 4HO1X 1JKIA 3PQCA 2G63A 2V0NA 2GBLA 2XB4A 1FFWA 1M83A 3DOHA 3OE5A 3QVJA 4ZAZA 5B3KA 1TAQA 2BUAA 5LFAA 3U6BA 2J30A 3IUNA 3N3BC 2LCIA 1AG9A 2FLVA 1A69A 4Y6RA 4G97A 4KRYA 3ENNA 2WHPA 4JC0A 1AGNA 5HFJA 4FS8A 1MT3A 3DE3X 1XMPA 5JNLA 4I81A 3BMOA 5HGXA 1P7VA 1NR5A 4KWEA 1TC2A 4Q82A 2VWQA 3LXUX 5U4QA 3T3HA 4CL3A 1N6NA 4LE1A 4BGIA 2YWXA 4HMQA 1OX6A 3P2YA 2FPOA 3E6AA 4TLLB 4EPWA 1KWGA 1RM5A 3GA7A 3IOMA 2IBMA 3CMMA 3OLWA 2E4ZA 3V3TA 5LQMA 3KLMX 2EIHA 5J59A 1TJNA 2Z04A 3DT8A 4XD7D 5FBWB 4RE5A 3S55A 3HY6A 2XTMA 1FU4A 1QG2A 5ALJA 3C41J 3Q2OA 2QPOA 2NVUA 1SQ6A 3W5CA 4IJUA 2BCEA 4RMJA 4KQEA 2DWCA 3GJ8A 2IXFA 2VQSA 3OQOA 4EY4A 2ZK7A 3Q72A 4QARA 4NYJQ 3PHJA 2FLKA 1EXNA 5GONB 4YIHA 5FADA 5TVKA 2CVQA 4MMZB 1FK8A 2VBGA 3B70A 4N7RA 3C3EA 3QEOA 4N39A 3LNTA 3SM3A 1QQAA 3ROKA 2OV1A 2YXDA 1QX4A 4CIWA 4YUZA 2LIVA 2VA8A 4ZVSA 5SYNA 3WTBA 1SBYA 1RNLA 3OTQA 2OBBA 2QTVB 4MNTA 2DPHA 2W4IA 5CCXA 4JLMA 3SMQA 1YZFA 2X8JB 4U2EA 2R6JA 1LDEA 1TYZA 1UDRA 3DE2X 3FGPA 1Y5IA 4M3NA 3V8QA 1WSBA 4ZU6X 4JCCA 2WPDD 1WE2A 2HRDA 2FFRA 2M9MA 2F2TA 4MLPA 4PVDA 2C4TA 1JDTA 1SZDA 1TJPB 1Z08A 2HHCA 1TGYA 1SKUA 5CDGA 4WCFA 4Q4CA 1BDIA 1BSVA 5DSTA 1MVLA 1U9ZA 1CHNA 3JXEA 4NVRA 4YECA 5L3SB 1B41A 3KZOA 3OLQA 1EQAA 3LW7A 5EJ2A 4D9BA 4GAEA 2Z6QA 3DZBA 3FNGA 5D6NA 5BSGA 4TYWA 1UP6A 1A76A 1PSZA 3BE5A 1HQYE 4D4IA 4AJ2A 5LQNA 1FP7A 2FUKA 5TPWA 2RJ3A 4C7OA 2BDUA 1KZ7B 2JVJA 5K99A 1YJ5A 3IOEA 4KVGA 3DUFA 1G20E 2AVDA 4D56A 4KPUA 2CE7A 2YOFA 2W4MA 4UAUA 3U1BA 1JSZA 1RQ2A 5D7NA 4CMBA 3LKDA 4E5YA 2J3MA 1OXXK 3CRW1 3OWXA 2HK7A 3AO0B 3GJRA 1TRHA 4B3FX 1Q2XA 3RHFA 5BNTA 2NZWA 4W5TA 3COVA 3UN1A 3ZCPA 4Z7QB 3A4IA 5EP3A 2E5FA 1ESMA 1WDMA 5K45A 2Y71A 3TLCA 4WN9B 4A16A 1ZRMA 1OFGA 1NJ2A 4TS1A 3PSAA 1L4KA 3OPXA 4PLZA 3UT0A 3F9CA 3RAEC 4ZAFA 3I6QA 1F2UA 1HTTA 2BI7A 3OT4A 3V2IA 1NMSA 2W83A 1SH7A 3ORRA 4XGNA 2R7AA 4QLOA 1GXSA 4GQBA 2WTXA 4WI1A 3NYWA 2NU9B 1JWBB 1UBSB 5GJBA 3JALB 1Z6QA 2HMTA 3AR4A 1IOVA 3I45A 2VHCA 4IF4A 4IVNA 1XYYA 1Q0SA 1TUEA 1US8B 3F71A 1WA5A 3T9AA 5K3FA 4BV8A 8MHTA 1PDOA 3VSEA 2F1RA 3LX6A 4XCXA 3M6WA 4IDQA 5DBGA 1S4QA 1XRNA 4BTEA 1ZSVA 4FKBA 4AF7A 4ZIRA 4FMDF 4H08A 3VFDA 1WMEA 1UBCA 4B0OA 2B98A 2C4NA 1FVOA 1TOAA 5HR5A 3GGPA 3HYTA 2F1IA 4XB6B 2V6IA 3B3QA 5DBHX 2RI1A 3R6GA 4QICA 1T0HB 3I62A 1P9RA 2O52A 3H86A 4MKHA 1R2QA 2HNKA 1A3CA 1ISIA 1ICEA 2EG5A 1BXZA 4FFDA 4LK2A 1P7WA 3HK2A 1G5QA 3CWZA 3DMYA 5AQ1A 2A9KA 2JZCA 3GLTA 1GU0A 1I0IA 4FDUA 4C4AA 2CJPA 5E0OA 2JGDA 1MABA 2AJDA 4LUCA 3VOBA 1OX5A 4MHSA 2QZPA 2V9PA 4OJYA 2GH1A 2F43A 4RKEA 1KQFA 1O57A 2X0KA 4UNSA 3FJYA 3QKRA 5GWXA 3F6BX 5E6UB 1A5AB 3L06A 6Q21A 2NZUG 3I6MA 2P77A 1AOXA 4KXLA 4MIKA 2P4UA 1TAHA 3E35A 5C4IA 1ZAYA 4G2TA 5KCMA 2MSKA 4Z2AA 1U2DA 2UVQA 4DKXA 2ISSD 5BN1A 2IZ5A 1VJCA 1J23A 2JAUA 3LBFA 2P9FA 1M9NA 1LLCA 2O3RA 2RGBA 3EVDA 5AKZA 4D8VA 2HLDD 1N6HA 7MDHA 3Q9NA 2ZSEA 4IPTA 4MYUA 3MQ2A 1D6MA 4A1OA 4DJ5X 4GMKA 3V1LA 1X8JA 4WXYB 1NM5C 1USKA 4YRLA 4CN8A 5KNCH 2HDHA 1NMYA 2AQIA 3PLNA 4HR7A 3TIFA 3WJAA 2DB3A 2OCDA 3I61A 1BWPA 1G64A 2Y0EA 2OLEA 1T3ZA 2EQAA 3NIWA 4BO2A 3MMPA 4QHYA 4Y98A 2AS0A 3R3UA 3GFSA 2LW7A 1ODKA 1QO0A 2P5UA 2PD4A 2W2XA 3R6TA 3P0IA 2G1PA 4HDSA 4CLOA 1ZGCA 2JFOA 3G9XA 1JXQA 3HWWA 3WQSB 3EQ2A 1JR3E 3DEKA 3MWLA 5LMNB 3I9JA 1K1EA 1SCKA 2NT4A 2PQ2A 1N92A 1MB3A 4EVQA 2I87A 4TSFD 2QUBA 1T8RA 4RS4A 1E6EA 4GXNA 3SC3A 2OOSA 3VAYA 3ZD8A 1A5SB 4N5MA 3DZGA 5BQOA 3SXUA 2PX2A 1W36C 2H4ZA 2E48A 1UKCA 3CRZA 1DEXA 4X1IB 2C5BA 5J5AA 1IUOA 3KTDA 5IFLA 5EPEA 2PMKA 2I29A 2DZDA 3HDTA 1V26A 3FGOA 4K6KA 4DMMA 2Q07A 5A5DA 4Z4EA 3QUTA 3FMVA 2HF2A 1SCAA 3BK1A 1WS6A 4MDHA 3UJ6A 2REBA 3VJMA 5KSZA 1R66A 4FMCB 4BE7B 2QP9X 3ROZA 4FFVA 1IE3A 1PVVA 2ADOA 4BO0A 3B1FA 4P84A 4Y9DA 1ZL2A 4IHAA 2XD4A 4OHRA 1E9FA 1LPBB 2QUZA 4ZXFA 16PKA 4OO3A 4D3DA 1AGXA 3NKFA 5JARA 3EJWA 3R7NA 3N07A 1JHYA 5JNRA 2DKOA 1XMXA 3ZUGA 4F4FA 4LF5B 2XEXA 3G8BA 3EMDA 4MQFA 2FWIA 2OBXA 1SXJD 2WD8A 1OZHA 1TTTA 3SNHA 1XL1A 1I3CA 3IA2A 4G85A 5E2BA 4JZYA 4YWHA 4Y2UA 2H4WA 4ASUA 3NPMA 1RM0A 2V59A 1B1AA 4G3XA 3SIXA 3C45A 1SC3A 1UEIA 1EFLA 2QX8A 5FWXA 4ZI7B 4MQEB 1FQOA 2WSIA 2P2CA 2H5LA 2Y9MB 2CJWB 2YICA 1ZI8A 3AEQB 3KLNA 4HAWA 1HQKA 5TX7A 1NQWA 2Q0XA 1ZISA 4LRSB 3GLSA 1E3EA 1LK7A 5ESWA 1CDDA 5DX1A 1QHEA 2R7KA 4GR5A 5JYCA 4YAWA 3H16A 2QPLA 1UBMS 3BBPA 3HI4A 3HBMA 1OTXA 1PZNA 2NWQA 3F6PA 3UAXA 4ZEMA 1LNZA 1Z4IA 1Q19A 3L7DA 1DQYA 2HCBA 2GBCA 5EWJA 3JS5A 3F7MA 1R0WA 3X2EA 4PU0A 1HDZA 3O3OB 3ZLBA 3PR3A 1KEVA 3DZFA 3K70D 4P0QB 1JAZA 1MORA 2NXCA 2VJYA 3CUWA 1J4AA 1G8JA 2HFKA 1XLTA 2CNNA 1C30B 4O6VA 4WKPA 3ZWYA 1JG3A 1KC1A 2Q46A 3M5WA 3VMMA 3PL1A 1N9KA 4K9OA 4KYVA 3RRMA 3ER8A 2PKQP 2GGSA 3AI7A 2XWPA 1PP4A 1GAJA 5AKJA 2M6LA 3ETEA 2BF4A 1TZKA 4RCVA 1PNRA 3AHIA 3DBIA 3Q3HA 2E5LB 3B9BA 5J63A 4BFUA 4DUZB 1WPRA 3SDBA 4XUEA 4INAA 3S8MA 3WA7A 2OESA 2SKDA 3PC4A 3VYSB 4X71A 3RVNA 3HBNA 3GLUA 3ZK8A 3CCFA 4EHKA 2Q9CA 2GEVA 3PDHA 4B34A 3ET4A 2QVYX 3OPNA 3QLTA 1NVBA 5ALZA 2HBZA 3B60A 4RAOA 2J5QA 2CUZA 2HK8A 3P1JA 1ZD4A 3KALA 1B6GA 1I3LA 1XMVA 3IPAA 4JX8A 4RHUA 3SZOA 2C5HA 2IX3A 3WJ7A 5CH8A 5DYYA 1X9HA 4LZNA 2VZEA 1ULSA 3KAPA 3QVMA 4HP8A 3WIUA 2O8EB 1FLVA 1TPZA 1EVJA 1RLJA 2DTXA 3G88A 4GBMA 2Q8PA 5CM8B 3WMXA 5LU9A 1PV4A 3BERA 4WN9A 1O54A 1K0FA 4E14A 4WZAA 3SGLA 4CCYA 4EHAA 4RJTA 4YMHA 1ILEA 1M6VA 3EZGA 4MEJA 5KNDA 4YT4A 2PXAA 3Q8WA 1H4VB 1NJSA 2C8JA 2DJIA 2EBFX 3DNPA 3SYLA 2OBNA 3T5GA 1SIBE 2XH8A 3K0AB 3V4ZA 2C5AA 1R00A 1C0IA 3ONDA 3IQZA 3DFIA 3VI3B 4DDMA 3ZWDA 1N5OX 2PA0A 4KQHA 4R71A 1JR3D 2XUKA 5IJ0B 1CZHA 2BMDA 4LRUA 1R6DA 2YKGA 4MB0A 1L2TA 3MK31 1Q1BA 3VNQA 4QQFA 2BAGA 4BHTA 1TXGA 4E5MA 1OFIA 4I4LA 4EVIA 3LPLA 4HYTA 4TLAA 1N2CE 2DH6A 4Z1MD 1YWGO 3QIAA 4PRKA 5HF8A 5LB2A 2INGX 4N65A 4POOA 2JJ8A 2DU8A 1XG5A 1NLZA 2JFPA 3IMGA 2TMDA 3R6DA 5JAIA 1FJXA 2J0EA 3KVRA 3LQQA 3Q2IA 1DFHA 3DLCA 3F5SA 2OXEA 1OQAA 3BQ9A 3OAAA 3BA1A 2OO5A 3LM8A 4Q6BA 4WXPA 1Y5LA 3D6FA 4GXRA 3W2HA 4CQJA 4OF4A 2QROA 1A4UA 3GRFA 1FRZA 1CF9A 1ZQ9A 1DBWA 3PC2A 4RQAA 1D7OA 2AI2A 5KYUB 2PGJA 4QFBA 3HKBB 3U2QA 4W8GA 2JGJA 4MUMA 1GQRA 2WWFA 4XWTA 3CX3A 2R1ZA 5JASA 3EXFA 4RTPA 3GLVA 3VX3A 1J24A 3UBMA 4C01A 2JGDB 3H2SA 2ZXEA 4FDLA 5AM2A 2DETA 2OGTA 2R97A 1CF2O 4HMOA 1JQ5A 4ZTBA 3VKFA 1ZN2A 4JBYA 4MV7A 4D80A 2I3GA 2QD5A 2XGGA 4WKOA 4C0XA 1IIBA 3CNNA 3HJCA 4WK6A 4YRDA 4HH0A 2VTDA 3VH4A 3O73A 1I1OA 1P60A 3R74A 4E5NA 2ZJBA 3LOPA 1E7RA 4HWGA 2BHTA 2PQ0A 3JZMA 4PZYA 3GRCA 3UA4A 1ESNA 1NN3A 3IC5A 4DDWA 4BXOB 3VV3A 5DK4A 2H17A 4TUYB 3RJTA 4FZ3A 3WLSA 2WJYA 2H2DA 3TD9A 4CWAA 4NV1A 2ZYAA 5DM2A 3RUEA 1U94A 3ZU2A 1R8XA 1XA0A 1XFAA 3I6BA 2XMZA 4AN1A 2EWMA 4OA8A 3DAFA 4QU0A 4D41A 3OHPA 5EESA 2X58A 3TR5A 5DYGA 4QT4A 3VPBA 3ONEA 1T4CB 1DKPA 1D2CA 2B1JA 3DTVD 4PYNA 3ZZUA 4Q9JA 5MN4A 3OLVA 2ZWAA 2ZS7A 3NTXA 4DJJA 3IEIA 3AZPA 1XLUA 2C2HA 4GXTA 2DQKA 3I3SR 1RRKA 4B8ZA 1AQNA 4G5GA 2R96A 4L3WA 3T7KA 1C2YA 2XMPA 3CJRA 3U9SA 3MTGA 4E12A 4J0FA 1P2DA 2YJ3A 3A05A 3UHJA 3AUXA 3ILHA 2DTDA 5A1JA 2PFKA 4PAQA 5CURA 5IT5A 4HLUA 2PE5A 1CY7A 4W63A 4WPGA 1YT5A 5A7GA 4CQMD 2X7JA 1EG2A 1FDRA 3PZBA 3D8SA 3G85A 1EFDN 4TV8B 4ATNA 3M2TA 4BB5A 5AVRA 1ORHA 4J75A 1SU8A 4NE2A 2PZFA 5ES4B 3G2QA 1YMUA 1RC8A 4EG4A 2D59A 5CLGA 4UMDA 1YXMA 3IQWA 1Y6ZA 2F59A 3QJYA 4KNYA 3DR3A 2XJ9A 4NDAA 5AWFC 2ZWOA 5EE0A 5GJVC 2NG1A 4AZ0B 2H6EA 3RIYA 2M1ZA 4TQAA 1XP5A 2EEPA 2QTWB 2UYYA 4TRMA 1CY0A 3L7KA 1O5IA 2UYOA 4Q4HA 2IIPA 4DZTA 2J9FB 4N0MA 1M6WA 4B6FA 1WM1A 3O31A 1JLKA 1HE1C 1QORA 3DAGA 2ZPAA 5L7WA 1FMLA 3AF3A 2IE8A 2XZDA 3CURA 4WD3A 5EJMA 4BB0A 4U7HA 2XE4A 4KQXA 4TM7A 5LP6C 2ZTMA 1W0JD 3MJHA 1O5OA 3ZE1B 1PG0A 1CD5A 4QDTA 1EQ2A 2WZDA 3PIIA 4L07A 1OREA 5ENDA 3X2FA 2H2WA 2BR3A 3IQXA 3PR1A 1AKNA 1BHJA 4G4SP 1QRSA 1ZICA 1KYVA 1DQPA 1IZ7A 2YIMA 3E3AA 3ID6C 2VWGA 4XB1A 1NNEA 2P91A 3CUUA 3HTXA 2HJVA 3ZXUB 1XCPA 4BQFA 3MGGA 3O1JC 1W0KD 4OFWA 5EJGA 2YY6A 5C5IA 1L8QA 3QOYA 3STUA 1NXSA 1HFWA 2X2FA 3KL4A 4I36A 4YCDA 4IDGA 1E4YA 1Y6QA 4PVCA 2Q5QA 1L5YA 3SY8A 1U0HC 4Z54A 4TYYA 1ADBA 4MUNA 2H8GA 3FDZB 4YV0A 2GAOA 3T5MA 2A30A 3A9TA 4O2BA 1MJ5A 5LA6A 3UPDA 3PT5A 2BI4A 3LRXA 3ZWAA 3T7IA 4BU1A 3RRYA 3TM4A 2ACWA 2IHVA 4IDBA 2P9HA 3GV0A 1KOFA 3PUZA 4KLNA 4YJ3F 2G06A 5E9JA 3JZAA 5IBCA 2KJQA 4KPEC 1U0BB 2BGLA 2RH4A 4TRRA 1XVUA 3ZKWB 3RS9A 5HFAA 1G38A 2BM1A 5GZ6A 1JA9A 4ZYZA 4B4WA 1H3NA 1ULHA 2XT9A 2UYCA 3HKCB 4C2UA 2GAAA 1BN7A 1XZPA 1ZBQA 1QAQA 3EEOA 3CRQA 5DHFA 5FJIA 3IODA 3G79A 2YV2A 1RXSA 2FUG1 1EHYA 1V6AA 3GJYA 5CDHA 4LZWA 1X87A 5T4HA 3TSOA 4J2TA 1X7YA 2YWHA 1AVTA 5A9TA 3ANTA 1SQGA 4PR3A 2B4KA 3JQFC 4C07A 1BHSA 4BKPA 1HG0A 2JZNA 1DTWA 4IFIA 3WLKX 1X86B 2O7SA 4BFSA 5C80A 2Z30A 4ZANA 5FBVB 4AW9A 3RS2A 1BXKA 3UC5A 3WADA 4DYVA 2CLCX 2GS9A 2YRWA 3CPJB 1LB1B 1W1UA 1SZCA 1GKUB 4JLKA 2JFZA 1E1MA 2EZ9A 4UEOA 5EQJB 3D7RA 4C03A 2ES4A 5EOVA 4W82A 1GRQA 1KZ1A 4JOSA 3JD4A 1X70A 5HZMA 4EY8A 5EWLB 2NT3A 5JMOA 3NUGA 1TYAE 3PXGA 1NW5A 3HJHA 5LDHA 1SQSA 6REQB 4X44A 3RSSA 5L3QB 2N9UA 1FDTA 5DBFA 2WTNA 4J0JA 2VYQA 3ABQB 4PZPA 3DHWC 3VYRB 4DWWA 1VJGA 2B1IA 2CZQA 1VHDA 5GONF 2GZHA 4A5OA 1I3KA 4D44A 4S04A 3VZBA 1I32A 3GYBA 5EMLA 4O4IA 4MO9A 4LHVA 3C16C 1YNSA 4KLZA 4D79A 5HIJA 3PUWA 2YWDA 3FHCB 2R1TB 4QOGA 5LOVA 4GGPA 4N5IX 2IEIA 1VJTA 3AEYA 2XGSA 4P54A 1EXVA 3RUHA 5KWIA 3ZHOA 2C4VA 5DDIP 3T99A 1HZZC 2W8ZA 5CBPA 4O5AA 4HAXA 3AF1A 3P7MA 3QVOA 2QMUA 4YV2A 1VE3A 4L5BA 1DG1G 3LY8A 1UMKA 3NOXA 1NP3A 1QGAA 4TVSA 4D8UA 3CIFA 1IJEA 1SHJA 2CNWA 2WIKA 1NLUA 2L19A 3F90A 4BUZA 5BV0A 4GZLA 3RTBA 2PH1A 5ADHA 1H2HA 1ZS9A 4KE8A 3FPCA 3JQ9C 4NC9A 4WEOA 5AW1A 1PU2A 2JIMA 3ZHVA 4BGUA 5BNIA 4ZJUA 4LRYA 3IT1A 1RKBA 3OIGA 2WOOA 3OU6A 4ZHQB 3RC8A 3FKSD 3PHCA 5D00A 3MCUA 4X20A 2VBCA 1Z39A 1NP7A 3S28A 4N41A 4GEKA 5J3JA 3H1FA 4O25A 2NMVA 3SHVA 1ZGGA 1VE5A 1O8BA 2W6ID 3A37A 4E94A 3LYHA 2OK8A 4C3UA 1NBEA 1YA8A 4HXGA 1SXIA 1K0UA 1E4OA 2F9LA 3B1WA 1WZEA 3ETGA 4IVRA 4OXIA 4EHDA 5C7OO 2YUIA 1KJWA 3LI2A 4IL5A 3ZE8A 4R2KA 4NYIR 5K0NA 1JI0A 1L8XA 3BVPA 1I5OA 4OKIA 3FPAA 4LGVA 5JD6A 3WB2A 1WHSA 4BFTA 3SKVA 5IXJA 4TUYA 5G0UA 1S89A 1XYGA 2QEQA 2ZBRA 3D6VA 3HRHA 4ZPJA 2Y0CA 2YIDA 3WYCA 4TQUS 2AZMA 1B26A 1VHWA 3W1EA 3CCCA 1AKVA 2X6TA 4R3NA 1HUQA 2A5JA 1US8A 5C5DA 2YJ5A 3IV7A 1KJQA 5K3FB 4E22A 2BGUA 1JLSA 4YGYA 3WV5A 4ZODA 2FW7A 2R2GA 3SZGA 1KH1A 1YBHA 4UTRA 2EFHB 3UT5B 1NJ5A 3NEYA 3VMFA 3DGFC 3L6RA 1QM5A 3I0ZA 3N8DA 2DQ4A 2C1XA 2DHDA 4DMRA 3LZDA 1DMRA 4A8JC 4EW2A 3KUXA 4HQOA 3IVGA 5KI6A 1X77A 1F0YA 4P1ZA 4YMIA 1YZHA 3WGTA 5K05A 4H3SA 3EXG2 2YJ4A 2ZR0A 3GXOA 1NY5A 1XCMA 2IYYA 2O2JA 3FDFA 3RK1A 3P0HA 4OP2A 3Q7PA 3E7XA 2CD9A 2OCYC 4DA0A 4HSEA 1ZZEA 1JWAB 4ZC8A 2VPIA 2W98A 1UZAA 5TVGA 5IZCC 3QI2A 4J29A 4EFMA 1DMSA 3IBCA 1SCDA 2WY2D 4YWJA 1PFVA 2VHVA 1W5SA 4ZAVA 1VIMA 1PYGA 3R7FA 4BMCA 3ZGLA 2WSSA 1XEWY 3WJ2A 3L8EA 2C7RA 3UVEA 4ND4A 4C7BA 3CBGA 2WYUA 1X92A 3QE3A 4C7MA 2H29A 1IDOA 2CLSA 2G67A 2I8LA 3DWFA 4UZFA 4LJAA 3RTCA 3VYUB 4RVNA 5FOSA 2JDID 4P9NA 4DNXA 1G42A 3DDWA 5J2TF 5JJKA 3EARA 4HT3B 1ISPA 4KODA 1XEXA 2IF2A 2RB4A 4KGXA 3K9NA 4UBIA 2ASVA 1GSHA 5CA1A 2QSJA 1K9VF 1GEGA 2YMMA 4MI6A 3KEFA 3MPOA 1ESCA 1V16A 3A28A 4CEHA 2ZQYA 4IY1A 3PC8C 2EHDA 1LLUA 2NXWA 1Y9JA 2VNKA 3ORYA 4OMUA 3VU8A 1QRAA 2ZE7A 1E1QD 2R8PA 3CMCO 1OKKA 3IPCA 2GF9A 4OIMA 4PYOA 3VO8A 2NIPA 4YJKA 4ARZB 1XNGA 5EL0A 1S0UA 1DT3A 4OQ4A 4JP3A 3K2EA 1BMTA 2CL7X 1MJGM 4RTLA 3EG9A 3QU9A 5COAA 5ALKA 1GLVA 1E2MA 3TJRA 3LUPA 1MAHA 3K0EA 1CUXA 3ZKAA 1WB4A 1CERA 2XWSA 3QOFA 2AFIB 4ES6A 5DXJA 1HFEL 5LQCA 3H0EA 2OHHA 5C3MA 1Y82A 2H2HA 3H11B 3N0RA 1LBHA 1QIIA 2GCEA 3V1TC 1QR2A 3TRHA 4F4DA 1I7DA 4RV5A 1BFKA 1FU7A 2KS6A 3K0CC 1M1YA 1XE3A 3WMRA 3LTEA 1QCCA 4BQQA 5JAOA 3R3XA 4MS1B 2AKYA 1JFFB 5K6RA 4CQNA 1E2KA 1PHRA 1GGMA 3IELA 3K1JA 3V8MA 4F9FA 1SQFA 1XZEA 2YS7A 3ND8A 3F6EX 2WFAA 5IT9A 2BFBB 4ZCPA 4JB8A 4BATA 1YAHA 4YXFA 3PI6A 3R40A 1SHLA 2GRUA 2BONA 1T2CA 2QW0X 4LX8A 4MKXA 2UVDA 3WLPA 5C31A 4P7GA 3WAJA 4OJKA 1M74A 1JNXX 2V7PA 4IZIA 4WOKA 5FUWA 1H2ZA 1T3TA 4F3NA 1PFGA 2NM0A 821PA 2CV2A 1VLHA 3WNBA 2R1VA 4FFBA 4A0QA 1UIRA 1CCWA 3L93A 1GSOA 1UK9A 1KJ9A 2PSEA 4RVDA 1RJ9B 3QV2A 2J07A 3L5OA 3PIRA 4U2GA 5BWLA 3FOCA 1ZSYA 1HK7A 1RCTE 3UMBA 4D9IA 3FHTA 1TCUA 5AW7A 3K3PA 4RNCA 3KK0A 2ZT5A 4UREA 4OUKX 1SB9A 1ST2A 1Y4DE 1A98A 3W5VA 3K72B 3MGCA 1L7AA 2RHBA 3HUEA 7YASA 1P72A 3EEIA 3UA3A 1IOZA 1POXA 1P4SA 5FWXB 3RT7A 4LZZA 3UNXA 1OBFO 4ZI5A 5I01A 1P91A 1U6JA 2K6GA 4XLLA 1P0QA 5JJLA 3F6CA 3PR2B 4JVNA 3LVBA 1KGSA 2V7XA 2H4XA 2GXSA 3TYXA 1E6LA 2V55B 1QKIA 2YS6A 3A1EA 3ZZTA 1GTRA 4DR7B 4O4LB 1X1SA 3EBPA 1SD1A 1GT91 1YCDA 3RNLA 2P7HA 3K09C 4KQ6A 4LYEA 4DL9A 4X63A 3LXXA 2BGKA 4LECA 1AQYA 1C1DB 5EIFA 3C5HA 3NDRA 2XGOA 3FZQA 5KS2A 2ZIXB 5KVSA 4Q1CA 4L78A 3GRPA 3HCPA 1W0KA 4EB3A 3QXHA 4LQ4A 1QANA 1UOQA 1JBEA 2IKSA 3MCAA 4E4TA 5C1PA 3S1SA 3EH1A 1PJQA 3ZWPA 3FPKA 2UKDA 3QENA 1FRVA 1RRCA 2QJOA 1CNMA 3G1WA 4DSAA 1EK6A 4E5VA 4DV2B 1JHVA 1XVLA 1KQ3A 4KMOA 2DAPA 3W8RA 1GU7A 4GMHA 4N12A 2FX3A 5BPFA 1ONOA 3CEJA 1C81A 3QEAZ 1J8YF 2J67A 3PQ2A 5K9ZA 1E0SA 1VYHA 3RRZA 5JZ9A 4M8SA 1DRWA 5MHTA 3ZI7A 1ECLA 2BBSA 1E2NA 4JK3A 2Q1XA 2C20A 3GWGA 2QR3A 2BGWA 3HP7A 4IMPA 4IBOA 1IN6A 5CM9C 4ND6A 1T4MA 5HF5A 3WB1A 3WNCA 4LBYA 1OI7A 3LDUA 2JIRA 2HA5A 4PS0A 4Q9NA 5U9CA 2GKSA 4JEMA 1FU8A 5B30A 3HXOA 4NS1A 3VBCA 2FSIA 4O2LA 3V33A 5CLIA 4UXIA 3TLMA 4LSWA 3VOAA 3EOBI 4AWAA 2YWFA 4WA8A 4QPCA 3L0YA 4IMIB 4P3OA 2MYNA 3OM9A 4PPFA 5BUZA 2Z6UA 1EGMB 1NW3A 1TIBA 3AERA 4ALMA 4H4DA 3V8VA 2ERYA 1MA3A 5B57C 1EH5A 3CUYA 1UEXC 4IJQA 1ENZA 2E1PA 4XDGA 1HDCA 3W04A 3X1ZA 4ESHA 2BFWA 2E55A 2O14A 1BKYA 1ZK0A 2QV7A 2WINI 3OQJA 2X9VA 5COBA 3K0AA 2G9NA 1A9XA 4XM2A 2ENWA 2A0UA 2QVGA 3QRWA 4WXEA 1XTZA 1R6XA 3E22B 3OJOA 5CLQA 1WCXA 1X1BA 1X1RA 2J3QA 1X3LA 2AR7A 1P2BA 2DQZA 1ZFNA 1JV2B 3GZ4A 4MUYA 2O07A 2Y1CA 1R4MA 3FCYA 2G1JA 2BFPA 3EXIA 4JJEA 5EG5A 1OYOA 2QZ4A 2YDYA 3GDFA 4HBGA 3SCZA 3G0CA 4GMGA 1AKEA 5B55A 2XZLA 2H18A 2RHGB 3OI7A 3AJDA 5G0SA 2QGZA 1HEYA 3G2HA 1JU4A 2HBQA 2IS2A 2LV8A 1DELA 2WQZA 1UCFA 3IUMA 4RGVA 4C1NA 3M5DA 2JFYA 3PUXA 3PQ6A 3W34A 3LRPA 4N5NA 5KNCD 2OKCA 4MICA 1R0XA 1P19A 2W2MA 5DNDA 3SQOA 3AY7A 4CU2A 1NUHA 2L42A 3A3OA 4YJ2A 2XMCA 3BORA 4TV9B 4UNQA 5HUJA 2CJYA 5C8VA 4EF5A 4B82A 4DR4B 2QT0A 4E5SA 1H93A 1X9GA 4P4NA 3QBEA 4CT4B 3LWDA 3OM0A 4RABA 3WGMA 1RXIA 3R1IA 2J3IA 1FDOA 1V96A 4YMVA 3U5ZB 3I1JA 1MH1A 3FMGA 1UZUA 3HADA 3TZCA 4E31A 2I7CA 4EL0A 4TV8F 1T9DA