1E3TA

Solution structure of the nadp(h) binding component (diii) of proton-translocating transhydrogenase from rhodospirillum rubrum
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
175
structure length
175
Chain Sequence
RSVKAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transhydrogenase
molecule keywords NICOTINAMIDE NUCLEOTIDE TRANSHYDROGENASE (SUBUNIT BETA)
publication title Solution Structure of the Nadp(H)-Binding Component (Diii) of Proton-Translocating Transhydrogenase from Rhodospirillum Rubrum
pubmed doi rcsb
source organism Rhodospirillum rubrum
total genus 24
structure length 175
sequence length 175
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2000-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1e3tA00
1T9AA 3GLSA 3ZGOA 2H2FA 1YC5A 4L2IA 3LQ1A 4IG9A 5K6TA 1ZPDA 2OD9A 3U3DA 2PGNA 4UTRA 4QPZA 1U31A 4QELA 2H2HA 1PNQA 4JUFA 1PNOA 1D4OA 4MPJA 1OZHA 2H4HA 3GLUA 2JI9A 2AG0A 3PDHA 2EZUA 4RMHA 4MPRA 1M2HA 3OE1A 1POWA 4KGDA 1S5PA 2IHVA 2C31A 2Q27A 3PKJA 4FVTA 1PO7A 2UZ1A 4RJJA 2JI8A 4BVEA 3RIGA 5EJ5A 5DEIA 3HWX1 4UU7A 5FYQA 3U31A 5BWOA 1NM5C 5K3SA 2QQGA 1JSCA 2Q29A 4JU8A 4V1CI 5IMSA 2WVHA 4V1CA 1S7GA 4UTZA 1UPBA 3D7KA 4BN5A 1POXA 1ICIA 4UU8A 1PYDA 2H2GA 1M2JA 1Y9DA 5BWLA 4C78A 1UPCA 2VJYA 4Y6OA 1YI0A 1M2GA 1YHYA 4GPEA 1EFPA 5MFPA 3CF4G 3E9YA 4RJKA 3CLTD 4BUZA 2AG1A 2OORC 2VK1A 2JIBA 4TWJA 3GLTA 1E3TA 1Q6ZA 2JLAA 1PTJC 3RIYA 5D7NA 5EJ4A 2Q5LA 1PVDA 4MZXA 4JUCA 1YHZA 5DGDA 4Q9DA 4J1TC 4KPUA 1Q14A 4Y6QA 2H4JA 3FZNA 4K9PA 1YTLA 2WVAA 4G1CA 1O97D 4UUAA 1U28C 2DJIA 4IF6A 4RMIA 4GP9A 2A1UA 4K9NA 4D5EA 4GG1A 2Q5QA 3FLMA 1N0HA 2HJHA 2W93A 4BVBA 3IAFA 4JD5A 1YI1A 1OZGA 4TWIA 1V5EA 1MCZA 4HD8A 4FEGA 4UTNA 1T9DA 1DJLA 1SZCA 5EJ9A 2OD2A 4K9QA 1V5FA 2QQFA 5K2OA 4BV2A 2FN3A 4L3OA 4K9MA 4GM4A 4UTVA 5MFZA 3CLUD 4F56A 1U2DC 2EZTA 4JUAA 1EFVA 4MQ5A 4V1CB 1SZDA 4UTXA 2WVGA 2VK8A 1PT9A 2FSVC 4ZP1A 2EZ8A 1OVMA 2H2DA 2Q28A 4BVGA 2EZ9A 4FEEA 3JWPA 4ZZIA 4JT8A 2FWNA 2A1TR 4Y6LA 1QPBA 3EY9A 4KXQA 4RMGA 2B4YA 4K9LA 1U2GC 1Q1AA 5EJMA 3EA4A 3EYAA 4F4UA 3HWWA 2VBIA 2VK4A 2OD7A 4O8ZA 5DGTA 4BV3A 2H59A 2IHTA 3K35A 2NYRA 4RMJA 1M2KA 1XLTC 4FZ3A 2VBGA 1PI3A 4COKA 1YC2A 4MPPA 4X3OA 3D81A 1V5GA 4BVFA 2EZ4A 1O96B 1M2NA 5EJ7A 2FR8C 3CLRD 1OZFA 5EJAA 2UZ1B 4BVHA 4JSRA 1HZZC 2JI7A 1YBHA 3GLRA 4JUDX 3PKIA 5FEMA 5K6RA 3IAEA 5BWNA 5AHKA 1UPAA 2H2IA 2PGOA 4RJIA 2BRUC 3D4BA 1Q17A 4K9KA 1MA3A 2V3WA 1Z8NA 4JU9A 1J8FA 3ZG6A 4R8MA 2VBFA 1YNOA 3FSJX 2OO5C 4K9OA 1T9CA 3CLSD 1BFDA 1T9BA 4BN4A 3ZGVA 4QQ8A 4D5GA 4HDAA 4J16C 4GM1A 2JLCA 2Q5JA 5EJ6A 3F6EX 2NXWA 4JUBA 4UUBA 3F6BX 5MGNA 4X3PA 2X7JA 3JR3A 4IAOA 4GM0A 2H4FA 5EJ8A 4I5IA 2Q5OA 4JT9A 2PANA 2JI6A 2IHUA 5MF6A 4C7BA 2FRDC
chains in the Genus database with same CATH superfamily
2H16A 4YALA 3AZQA 4D8WA 1T9AA 2OCDA 2FDXA 3CM0A 1VBKA 1CSEE 5JXGA 3PFWO 4BN0A 4YB8A 3K1ZA 4WWHA 3NDJA 3IPXA 1X7YB 3R23A 3RABA 5KHLB 1G0OA 2FU5C 4PE5B 2I3GA 1T1IA 3BL5A 2ATXA 1KI6A 3ZGZA 1TTPB 3A8TA 1V16A 3D4LA 1DBWA 1E1QA 2C20A 2I6SA 2OBNA 3GAAA 4BS9A 4RJTA 1DC5A 4K6MA 2NM0A 1ZPDA 4EITA 2O9JA 2Q1SA 3TM5A 5BUZA 5K6TA 2PGNA 1A4RA 4IVNA 4MJ7A 2ARKA 1PUJA 4IM7A 5BNTA 2BYTA 4YAWA 1J39A 2QUJA 1YTUA 4Q7QA 5IANA 5HXAA 2XQJA 2YHSA 3CZPA 2A67A 1NXVA 4EIWA 5IVPA 2ZRFA 3RBZA 3V4LA 1V11A 2YMPA 5JCOA 2EP5A 2QVXX 1JAXA 1JE1A 3L0CA 3LV8A 4GT1A 2MU1A 3RJ9A 4JIMA 2IIBA 3HR4A 4GRIA 1TRHA 4XWAA 3S28A 2QM0A 3PIDA 3UXEA 4CKYA 1AV6A 4EB0A 3BVPA 4JC4A 5BUSA 3ORQA 1XF1A 1YZGA 4CM5A 1RRVA 1IBRA 4U7HA 3W1WA 4GQBA 1Z6ZA 1VHDA 2QTTA 3IBYA 4PX3A 1J90A 2ZT5A 5DTRA 1FJXA 3AJ8A 4GPIB 4NEGA 1BXGA 1Z0UA 3RHFA 1EG7A 4RQAA 1Z7BA 5K0JA 5KOHA 4DBVO 2EZUA 1JAIA 1KJWA 1TZCA 1SB8A 2P6MA 2QZ9A 5KMGB 3KSRA 3JVDA 3FDJA 3VH1A 4ZHSA 4HQFA 4IDQA 1WDWB 2RK6A 1L5HA 3RRZA 4O08A 2I2BA 1BXZA 1D7OA 2UZAA 3THXB 4JJFA 1EFLA 3QFTA 2VWQA 4H3VA 4Q3CA 2HQSA 4EI8A 1VCHA 1U1DA 2QD5A 5ADUS 1L7EA 4ESVA 2F1KA 4MS3B 1I1NA 3GLVA 4I36A 5IXJA 1TZBA 3NEJA 3ZHOA 2XYQA 5LWQA 4QBIA 1AMOA 1CULC 1MC8A 1ML4A 4GNRA 4JYMA 3FHTA 1NVMB 1EHIA 4E2YA 3QG5A 5A3VA 1MV8A 3KJGA 4BV9A 1PO7A 2YWXA 3JQFA 1KVUA 3A1TA 3GJ3A 3H2SA 5EHQA 5KYGA 3VR2A 1QHHB 4BVEA 1ESZA 5FBZA 1UJ5A 3R77A 1ONBA 4PXSA 1GADO 1TJ3A 4WECA 2EQBA 3DYIA 4YAFA 3K9FC 2YW2A 4LWQA 4LY9A 4YC7A 1AF7A 3PUVA 2AEJA 4QOHA 1SM4A 1RC0A 3RO7A 4IEEA 4JJKA 5EZQA 3U81A 4RD0A 3JPWA 3VH4A 5FWXB 2A9QA 2JAPA 2EFEB 3C3KA 3JR7A 4RKWA 3FLAA 4CM8A 3OF3A 1C1YA 3P20A 1RQPA 2G76A 3UJ6A 3MGBA 1SOMA 3GQVA 2QTWB 2W8ZA 3DOEA 4GQIA 1DBIA 4JNCA 3R7NA 4E30A 3B70A 1JG1A 4JX9A 1KAHA 1LUAA 1T0PA 1SU6A 3JZIA 4PPGA 3LC0A 1MVNA 4NENB 3OOWA 3KCQA 4XQCA 2FZKA 1Q21A 1N1EA 3FPLA 4KDEA 4WJKB 3ZX5A 3E3OA 4RDCA 2GOYA 3AETA 4F4DA 3FOWA 1F4LA 3NETA 4WNAA 3UOGA 4O4HF 3THWA 2Z5FA 2IW1A 4QG7A 1E66A 4ES6A 1FX0A 2YV5A 1K63A 5KYKA 5BO5A 5SV2A 1ENYA 1NXPA 1C41A 2GHTA 3CRQA 4TV8A 3JASB 1FNDA 1OBFO 3WGUA 3PXAA 4BHTA 4V0LA 4LXHA 5CYPA 1Y89A 2WM3A 4L16A 2F3SA 4PZUA 4UUPA 1GSOA 5IAJA 1WD5A 1U0OC 3CNQS 5BRNA 4FM9A 1QJCA 4NEQA 2H6EA 2RG1A 1UZUA 5I7HA 5KHOC 5LIPA 1JTFA 2IJGX 2ZIGA 4XEHA 4JXXA 4AYXA 4DLNA 2IUFA 4UEWA 2X3FA 4IZOA 3LC1O 1DAFA 3ZHRA 4YDRA 2H4WA 2OM6A 2VZLA 3E9YA 2GXSA 3MQ4A 1O0BA 5LDDC 4KHPB 4EM6A 3QEJA 3WNBA 3QLTA 3CZCA 2ZKLA 3USES 4AURA 1R0BA 4ND6A 3IV7A 4MV0A 5C34B 3C8ZA 3VDRA 4JI4B 1ZU5A 1G2IA 1NI3A 1ZIOA 3CZ9A 4DZRA 1VHWA 2YVUA 5L3VA 5CB8A 1H2AS 3NBKA 4MHTA 1V4VA 2WU0A 2BLNA 4YRRA 2OZKA 5JXJA 1NLUA 3KBBA 1RM5A 1Q11A 3CUTA 3X1WA 2HO5A 1BE8A 4JJAA 2IXAA 1G8MA 4JLKA 3MYRA 1NLZA 4F6CA 5TEVA 3FRIA 2PX8A 2CHUA 3N2GA 4HAXA 3N2ZB 4UBIA 4UUMA 1Y3BE 4AO8A 3AEKA 2IPLA 4ZZ3A 4FPXA 2WF9A 3GFOA 3W5DA 4Y7DA 4TRNA 2HPVA 1IM8A 4OCZA 2D54A 4CR7A 1OILA 1QJ4A 4G5SA 1OI2A 5KTSA 3SQWA 5GVRA 221PA 3DWFA 2H4JA 2QJWA 1IJBA 3OLZA 1XZDA 4RK6A 3VZSA 2MSWA 4AM8A 3UUFA 1LJLA 1TM2A 4XIYA 4XUDA 1QB8A 4A8JB 3LKVA 3R0IA 1G21E 3JQDA 3VKUA 5GZ3A 1Z4NA 3C8MA 4OB6A 3R5XA 4UULA 5EIAA 4G0WA 2YH2A 4M89A 3FZYA 1FTYA 4FMPA 4GP9A 4U2BA 4URXR 1W1WA 3E7DA 2D8MA 4LC0A 4PSAA 1UBHS 5EKUA 5FBRB 5HWSA 4X1KB 1AN0A 1MPTA 2FZCA 2XUFA 4S2EA 5B3KA 1ZFNA 3UKOA 4GGPA 4QGFA 2LR0A 1XE3A 2HYDA 3CNEA 3DHYA 1A7KA 1CF2O 1GUFA 4RK4A 3DFUA 1UODA 4ND1A 5L9AA 1GNPA 2FUEA 2NSLA 1AG9A 1S02A 4UBKA 4KXNA 3TX6A 3O6VA 2D74A 2OV6A 3MT0A 1NI4A 3FYUC 5HRCA 5IT9A 1ZK0A 2AX3A 2J1LA 4IIEA 4ZXPA 5J2UF 2KX7A 3JSXA 4AP6A 1W25A 2E6KA 3VX3A 1CLEA 4GKBA 5JRDS 1LW7A 2P6RA 3W5VA 5LZ2A 2XIQA 2ZT6A 1JDSA 3QKSA 3SR4A 4JQYA 2FGJA 1HDZA 2P1DA 2CKMA 4EJ2A 4XAQA 4UTNA 1E5QA 1ULTA 1T3SA 1ISPA 3MTIA 1PSZA 5ALLA 3L8HA 1JPJA 3MWGA 4ON9A 5TS3A 1T1EA 1QH8A 1A5AB 2R1ZA 2DECA 2BTQB 3N07A 3NEYA 4FXPA 4QA9A 3ZZ0A 2V6IA 2X7XA 3I64A 2WV7A 4J4TA 1OYYA 4RD4A 4N7MA 2QBYB 4ZYLA 2O59A 3ICVA 5CNKA 3A36A 4CEJB 3WGOA 4LYJA 2R2GA 4HH1A 4C3ZA 3OM8A 1UWKA 4PRZA 4D44A 4DM4A 4ENSA 3CVYA 2I1WA 3FMIA 3GD5A 3K1TA 3NYIA 4FS8A 3MWFA 2YNMD 1P0IA 3DT6A 4KXXA 1PFKA 2P9CA 4WASA 5D86A 3UJ8A 2JLXA 2C1EA 4RIEA 1Y3FE 3FCOA 1C7QA 1RJWA 4GE0A 5E2BA 3W6PA 2D5LA 3QV1A 3OUUA 1JYFA 4BNWA 2W2OA 3DCNA 4GICA 1GA6A 3O3CA 1K0UA 2P4EA 3P5SA 1JSLA 1NUHA 2JFNA 4QUBA 4FSDA 5FLXA 3SZLA 1O1YA 3HCPA 5M29A 1E1QD 3GVCA 2VPYA 3NEAA 1JA9A 1Z0JA 2B35A 4FLMA 4ZEXA 4BE7B 5I7FA 4TZ0A 2I3DA 3UBMA 1RYEA 4LRSB 3W2TA 2HUNA 1YRAA 2V9ZA 4AIRA 4BUCA 1GDHA 2B9EA 2DX7A 2OESA 3P9CA 2LBPA 5AOAA 2QB5A 2XF8A 4AN0A 4M0LA 1U6JA 5JCPA 3ISTA 1R8XA 2PZJA 3ETHA 3UG6A 3LE8A 1Z45A 1LBQA 2QTAA 3I09A 4X1YA 3UWSA 1SVMA 3PHBE 4F3RA 1AT1A 2IOFK 2ORYA 3DQPA 5B4TA 1U02A 4J03A 3MAAC 4E5KA 1XDSA 4LISA 3K16A 3L6BA 1T4MA 2VHJA 1F20A 4ND5A 3CF0A 4P80A 4XARA 1ZVMA 4U9HS 1K7XB 1ISHA 2XMPA 4ALLA 1S01A 2XD9A 3E5HA 3VNAA 4J4HA 1YE3A 2XADA 3LDAA 3IBCA 4B44A 1AB6A 1L8LA 1GV0A 3C5HA 4N4AA 4TLBA 3EZNA 5CVVA 1XXHA 1YQEA 3IAXA 3LO5A 3WGKA 1NONA 2BFMA 3AVWA 3IVMA 2YXDA 3L01A 2BONA 1CHNA 1QMPA 1Y80A 2J3DA 1Z7GA 2HYIC 1K8QA 1RM4A 1Z5GA 2DPLA 4DVJA 1M67A 2FPSA 2HFJA 3PWKA 3QNMA 3F3YA 2I9KA 1LDBA 3K09C 3UK2A 4JITA 2O2EA 1P5ZB 3H5WA 5HE9A 3T5BA 1CNMA 1UCFA 3G1TA 3KQYA 4HMPA 4KXQA 1II0A 1C0EA 4NESA 3UMCA 5IC4A 1C9KA 3EUEA 3KOOA 5AT1A 1LQUA 5A0TA 2PUBA 4D96A 3F71A 1K06A 2IU3A 1QYCA 4RVNA 2CC2A 1XAGA 2RMKA 2RB4A 1PQYA 1H69A 2D6FA 1U2GC 1BU5A 2KJQA 3OEYA 4BVJA 1KHTA 3UV3A 3RODA 3OZXA 4H35A 2OFWA 5BY2A 2C7RA 3ESRA 3CB2A 5DI9A 2AFHB 4IY1A 3F97A 4EY4A 1BGVA 4M6WA 3LMKA 4KQ6A 3UUEA 1MJHA 5JYDA 1Z7WA 3U19A 5JS1A 3VR2D 4R2IA 1KC1A 2VUSA 3RRBA 3WB1A 4B79A 1WUTA 4NBTA 4C7OA 4J43A 1G2QA 3GJXC 3L1HA 1LK0A 3AYXB 4KJXA 3G3EA 1W88A 1P7VA 1LI7A 1YCHA 4ZIRA 3OT1B 1T1SA 1B74A 2CDBA 3GAZA 4L5CA 4N5LA 2IA5A 5ALGA 2WU4A 5DNVA 5HFNA 4CUJA 2F9FA 1NYQA 4LKOA 4EGJA 5L53A 4KXFB 2QLJA 2XTJA 3AJRA 4MUAA 2WTAA 3A37A 3KDPA 4LDJA 1IYZA 3H1FA 3QU7A 3CZ4A 5I4IA 5LMUB 5JALA 4RMNA 3FROA 1OXTA 1Z6GA 2DKFA 5BN3B 2QE6A 4JI8B 5TNXA 4IQ8A 2YQ5A 2ZATA 1XR3A 4MAMA 3ZXSA 4K1XA 3RVBA 2VRCA 5TEWA 4OUDB 3PFKA 1LKZA 1Y8QB 2A14A 3KX2A 3TB6A 3X1MA 1E5DA 2ALJA 1LF0A 2DWQA 4ZCMA 1VPTA 1SPBS 2X15A 2R8EA 5TVKA 1BTOA 2MWMA 2YC4C 3I2HA 1C4KA 1YS6A 4EPYA 1SQGA 2Y1XA 1CD5A 4ARZB 2BFDB 3RLIA 5AJYA 1HYGA 3GO4A 4DRXB 4KE8A 3V4SA 2X40A 2J09A 5HMMA 1SNYA 4BNJA 3B1WA 4AULA 3HA7A 1E8NA 3RYCB 4HDQB 1FYXA 5C4MA 1ZN9A 3ET5A 4HDKA 3PRKE 1HDEA 1DRJA 1FW8A 1YQQA 3PQ8A 4FGWA 4EG5A 3QIAA 3ITNA 3R7AA 5EMJA 1IHDA 3CRZA 3BQ9A 2C8JA 2FPLA 2H63A 5EKTA 3F67A 3RQIA 5EZSA 5C8VA 2IEBA 1EWKA 1HKHA 2I29A 2XSZD 4X71A 1ZHOA 1FDVA 2PZMA 1R27A 2E7ZA 2D0IA 3PQ5A 4XX0A 3VO8A 4NZOA 4BLOA 4Z7JA 1KK3A 4YUVA 1RU3A 3DBLA 1TOAA 1Z08A 2OPBA 4MUHA 2VDJA 4PG5A 2XNDA 3IEPA 4Q01A 4HNAB 5LA6A 4AMUA 3DZKA 2BMDA 2RCYA 1GRQA 4DT1A 2K7ZA 4MV7A 1TZ2A 5C5DA 4JSTA 1AJEA 1BW9A 3J81A 3X1KA 3DDWA 5ALZA 4HZUB 1E69A 3CVWA 2O6HA 1E3QA 3ER9A 3DBOB 5HBGA 4EEKA 1XTSA 2RD2A 2FQXA 1PJCA 4XVCA 5PNTA 1KEEA 4US1R 1GV1A 4EZEA 1M34A 3KHTA 1E9VA 4TTTS 1B0AA 4OQQA 3B9PA 2FV8A 3O3OB 1XCPA 4R16A 1SKAA 4K5QA 4AW9A 1CQZA 3BN3A 2VQ6A 2AN5A 1G8AA 2DBZA 1YFZA 5K01A 3G49A 1ZYUA 4N6OA 3V1TC 1SXJB 3MCUA 5H82A 3ZWBA 4NCKA 4ZDWA 2V98A 2PZFA 3KHKA 3TXAA 3SFTA 3A26A 2YIJA 1SA0B 3FSEA 4LJAA 1UM9A 2HV8A 3FVRA 1Z4PX 2AEFA 2CLKB 1BAPA 1T9BA 2I2XB 2VPTA 4OQNA 2O2XA 4CKBA 1CEEA 1F06A 2BZSA 2BWJA 1QLHA 2GCPA 3PX7A 2ZPTX 4YT4A 4QZVA 1GCAA 2BCGY 1UMDB 3ILHA 5ITZB 3AIKA 5AM0A 5EJ6A 5K8TA 4OJKA 4X41A 4JC0A 4QOJA 2AMFA 2PS9A 4D9FA 5MGNA 2XZLA 1SOUA 2E4UA 5K8LA 3DOIA 1B73A 2ZOSA 4WZAB 1ZIPA 2H7VA 3PRHA 9LDTA 5IAAA 1UMCB 3PHIA 1OYOA 3NRCA 1TVEA 2BKXA 1A8IA 1OW3B 5GADl 1AGPA 1KS9A 1H4SA 5CEEA 4JOCA 2DVMA 2OGTA 2V1UA 1D2MA 3LBYA 2AFIA 5A02A 1SOAA 3KYIB 3ZV3A 5HP4A 2PUAA 2QORA 3GRYA 4L85A 4F6LA 3DTYA 4CFYA 4U2KA 4CMEC 3FB4A 2RJOA 2O54A 3DH0A 2AQHA 3AWDA 2IQ5A 3O3NB 4Z9FA 3OU6A 4C1BA 1LWOA 1WLSA 3O9VA 3U3XA 1DXOA 4BFYA 3Q9UA 4KMSA 1P2TA 1PZHA 2GBLC 1OTHA 1VE6A 6REQA 4AY2A 2FEOA 2V96A 3C6XA 2Q9UA 3DFMA 4RWZA 4C07A 4BO6A 3HVRA 2OLEA 1H1DA 1XA4A 2PUHA 2V4ZA 4Q4LA 3T95A 1WXHA 3AOEA 3DFZA 4TTPA 2GPYA 1GFWA 2IYWA 5IJAA 3C1UA 4F5YA 1T0UA 5JARA 3NVMB 2B36A 1T2FA 2QTCA 1A96A 1ISSA 1V5WA 3RVSA 1WVGA 1SBZA 3ONWA 3ZZUA 3OTGA 1UEIA 4TXHA 4ZOAA 2FZ4A 2ONJA 1T26A 1G291 1INLA 1SGWA 4JENA 4BAZA 1GL6A 3UYLA 1AXGA 3OZCA 3FKJA 3S2GA 3DE5X 4QOGA 3GLIE 1EFHA 1ZJJA 2AC2A 1TT5B 4XDYA 2B4RO 2YYYA 1D0IA 3EGEA 4XH9B 3G85A 4MVJI 4TLCA 2BTEA 3KYBA 2HA6A 1NLMA 4O4LF 2YRWA 1PQWA 5EXPA 1KWGA 2DQSA 1B14A 1DOHA 4X20B 5DX0A 5IC5A 2IODA 3C5CA 3SIRA 4KR0A 5DM2A 1QGDA 1J56A 2CV0A 4A23A 1IM2A 3T5CA 2AQKA 3GPLA 2Z3ZA 4BZWA 2QWXA 1TKRA 3A2LA 4B48A 2TMYA 4FMCB 5FWDA 3TKAA 4AROA 4UBLA 3DXYA 5E4FA 1QHYA 1KJJA 3T0IA 4LMRA 5JCJA 3ZCTA 4OQDA 3Q6NA 3HUTA 5FNVA 1TEZA 3OY2A 3SYNA 2JFGA 4MPRA 2VA9A 5TMDA 3VU3A 2WR8A 2V4MA 1H2WA 3FWYA 1TAQA 4O02B 3R74A 3KT0A 3MQFA 3ZE9A 4LNUA 4H27A 1AGYA 1LK7A 4D46A 2GCEA 4WZBE 3O5AA 1TCUA 1OWPA 2YJNA 2ZXUA 1X1CA 3KSMA 1LB1B 1KYIA 4NCAA 3ETLA 5AVQA 3ZJ4A 4EHDA 4Z0HO 2X2OA 1R4NA 1DXYA 2AB0A 2G80A 3D1LA 1NF8A 3PF8A 3R0ZA 1ZJZA 1KH1A 4TKMA 4V2IA 2BFPA 1XZEA 3JSAA 2IRWA 3N2KB 4RYLA 1P4JA 1FZQA 4BAGA 3CHYA 3EXEA 1NAHA 1Z38A 3QJ5A 2Q0QA 3GLFB 2ZCJA 4H7HA 521PA 4K0KB 2ROQA 1DUIA 1ZK3A 3CNLA 2X8JB 3Q85A 4KQ9A 5ECWA 1TCBA 2FEXA 4J90A 3BHJA 2B8NA 3AEXA 4TV9A 3ZU5A 5CLFA 4BP3A 2QPTA 1FRZA 3T5TA 2IBTA 3FFWA 1PR1A 5CT5A 5TMBA 3RS0A 4UVIA 1T10A 4DTCA 1JILA 5AKJA 1CEXA 2FDRA 2IEZA 3VNUA 1FPMA 5GONB 2SKCA 2GF9A 2AFHE 1EP3B 4LCBA 3V9PA 1Z6XA 4FB4A 3FOBA 4DV6B 4M1WA 2FJUA 3BMXA 2G82A 2Z98A 1TW3A 2DUNA 5EIHA 2C42A 1FSZA 2NG1A 2W43A 3DBRA 3ASZA 1QYIA 3BOSA 1P19A 3OQPA 5HF6A 2ZETA 4KDFA 1PV4A 3K31A 1AK2A 4K46A 2AWOA 4N1AA 4OHOA 4M76B 1E3WB 4QDJA 1VPWA 2IYVA 3VYSB 4JJIA 5L4LA 4LDQA 1WSDA 4BU0A 4OKSA 4O2RA 2HPHA 3L0PA 3RE1A 5B6JA 1I7SB 3OQNA 1KL7A 1P4GA 2VJYA 2XWBF 2H52A 3B1XA 3ZWMA 2CUKA 2WQ6A 4BZPA 4CLDA 5BW8A 4EHJA 2AR9A 3WRWA 2P9TA 2GILA 3ETDA 2EFGA 2G0TA 2IPOA 3CU5A 1WXFA 4C0BA 3DPUA 2XB8A 2RFLA 2VRCD 1JXQA 4XQ0A 3NHRA 1I2MA 1KO7A 3PU6A 4S0ZA 4CMJA 3ZI7A 2FF5A 4GUDA 2I55A 2NVUA 3LY8A 1EJ0A 2SHKA 4PQGA 4WFIA 4NBNA 5JXWA 4O2BB 3HO8A 3VU1A 2QRLA 4NCNA 3ZV5A 4B6FA 3SCZA 5IWAB 3OWOA 3IQIX 2WU3A 2VF4X 2XW6A 3AI3A 4ESHA 2IBSA 1PEYA 4LV5B 1NJFA 2PR7A 3WI7A 3Q1LA 4GKVA 4DUPA 4C4YA 4FCTA 5K7SA 2RGUA 2E87A 2FW8A 1QE3A 3AFGA 2IV3A 5ES4B 3H86A 4I1IA 4X1IB 1OXKB 5AKXA 5KYTA 3IDZA 1O4VA 3QLVC 1M2WA 2J3MA 2GARA 2ZCVA 4LW8A 3SZMA 4RZ2A 2PKEA 2N47A 2FPPB 5EWLB 4QUHA 4E5UA 4IJ6A 4BMYA 3EXHC 2I67A 4HQLA 3F5SA 3AHCA 3EXIB 5JVDA 1TCCA 1JZQA 4HJXA 1QGUB 5CDUA 4G01B 3TSYA 2XNDD 4NZYA 2GX6A 3SHVA 1AZLA 1DAEA 2I1QA 3PXXA 4NLLA 4ANFA 1ULBA 3CNBA 4ZAWA 3BF7A 5A4IS 4EF4A 4YRZA 3DWGA 2O8EB 4CKWA 1MMFB 4UFPA 1FMJA 1QR2A 1XELA 4N82A 2XTZA 1QYDA 1RTKA 3VU9A 5F9MA 2IPNA 3ZU4A 1LSSA 1BSVA 3J80A 4RAQA 2VQDA 5FD8A 1EP2B 1XNGA 2NQTA 2OMEA 5KKNB 4KR7A 6LDHA 3L7LA 1HOTA 1UFOA 2ZS8A 4BATA 4MP3A 1ZI6A 3LD9A 3NVAA 2FN8A 1XDWA 4HVTA 4AN1A 1Z5UA 2Y0EA 1Y3AA 4LYEA 10MHA 1LQTA 1N3YA 2AS0A 4ESEA 1HF3A 1N5JA 2KLHA 2NSYA 5G3YA 4O1MA 3TRIA 2FHPA 2YINC 1Z3CA 1XQYA 2O0LA 3G2MA 2IF0A 5JBNA 1ID8A 3FYTA 4L57A 1ZONA 1GTL1 4V0ME 4CQLA 4RY2A 4CNQA 1IXSB 4LWOA 5CDSA 4PNPA 5IULC 3MJTA 1QG0A 3EA5A 4KSBA 1PWHA 5COQA 3SM9A 4OI1A 2GAJA 1FP1D 4DV0B 3AHEA 1Y1QA 3BMQB 3GJ5A 2Z6QA 1FP2A 4L72A 2HL6A 1NLYA 3PFNA 2BPOA 2BRUA 3RK0A 1NHWA 1G6Q1 3E9NA 2HDHA 5AJUA 5HF5A 4MMYB 4RK0A 2I2DA 1DJLA 4TWRA 2EJUA 4PPQA 3WAJA 2QRNA 2X9GA 1DUSA 1R6BX 1WXIA 3G8BA 3CCBA 3DBIA 3GP8A 3WWZA 3ID6C 1SUWA 4GOLD 4IHKA 2C9BA 1ZS9A 3UMJA 2QTMA 2IWHA 5JZBA 1U7OA 1W6UA 5IJ9B 1HTWA 5C80A 4ZOLA 2OYCA 3B48A 3ZWPA 4YP7A 2RHJA 2JIMA 1VDZA 3I9OA 2JVIA 1P4HA 4EHHA 3UGJA 2HRQA 3JRNA 2C7VA 1MG0A 2PMBA 4PHHA 4R6WA 4R81A 1YJXA 3FE2A 4FX2A 3CCCA 4JROA 5DTEA 1BA3A 5C1PA 5LN1A 4XWGA 5H3CA 4UVGA 4F56A 4LJ9A 1CUZA 1Z7YA 3UHAA 1NG9A 4ZD6A 3VO9A 3WIVA 1UPFA 1DP4A 4U6SA 7ABPA 4J76A 4MR9B 4WCVA 1VC2A 3EC7A 4UATA 5BW4A 1ZMXA 4MNTA 4TVBA 3H7IA 1USIA 1T5TA 4Q02A 4NTZA 5B37A 3SVZA 4G0ZA 1MP0A 1HQCA 5CXXA 1C4XA 1H0SA 2Y0PA 1LDMA 1R8JA 3CJQA 2XRYA 4GSLA 4U7GA 4BP9A 4JEUA 2OL4A 4B1FA 2JG3A 3ISVA 1XTPA 4DR7B 1HFKA 2HA2A 3HL0A 2Z30A 5AXAA 4DSNA 4GMXA 2XBMA 3LQ4A 5AJXA 4BVKA 3ZE6A 3FNHA 3T0FA 2HMUA 1T9HA 2YIVX 4R1QA 4XGQA 3T7CA 1NVFA 1Z06A 2JFZA 1BHQ1 4C5CA 2ZRLA 1D6SA 1E3MA 2CXQA 1YZVA 2ECPA 1S2DA 3KPWA 3TB4A 2J9FB 4L7VA 3TCNA 4AZ0B 4E07A 5JYEA 2HCRA 2EFYA 2NV2B 1ONSA 2O20A 3BFXA 3ZEIA 1J2UA 4CM3A 1T2CA 1E0DA 2INGX 2X9VA 4G63A 3UTCA 4YDSA 1FXSA 3KWMA 4G8BA 2CL0X 1XUOA 3OU2A 4ZWNA 1DCTA 2CNKA 1VE5A 4R1SA 5ARDA 5JCJD 4CV3A 5CW1A 2MIIA 2UZ0A 3LO8A 3OOJA 3G1UA 4NMHA 5CD1A 3C7AA 2QW0X 1CC1S 4HPWA 4LJ7A 2DUWA 2X23A 2WD7B 3NKLA 1U5AA 4C4OA 3WQSB 3H2BA 5TC4A 5JNTA 2B4YA 2R7MA 1UBKS 4J07A 2EF0A 4BU1A 3WFJA 3JZAA 2WBLC 2JLBA 3M5PA 5BQPA 2Q6IA 4ABYA 5A9SB 4MYTA 3X44A 3EISA 1XTVA 3B6EA 3MQ2A 3TSWA 2OAP1 3KR1A 3RF7A 3LHKA 3T1OA 5JJCA 2FZLA 1OY1A 4RTSA 3GLFE 3CH6A 2WSBA 1UBSB 4QOFA 4CDRA 3OJOA 3N59A 1TF5A 1W2WB 1QMGA 3TR6A 2EQ5A 4Q7KA 1VL5A 3CIFA 1T5BA 4LN1A 4C0JA 2H08A 3N8IA 3PEWA 1PLKA 1V1JA 4NYJR 1UBJS 3K8QA 4ALKA 4GR4A 3QKIA 4Z7QB 5DNUA 4BFSA 1C1XA 3I5UA 2VJMA 3PSHA 3RFXA 4XSHA 4B84A 1RYDA 2DPHA 3JV7A 4K87A 1KJIA 4LNHA 2FEKA 3MTGA 1BWPA 3JTMA 1UBCA 4D02A 5KSZA 4YONB 5AIBA 2OZPA 3I1JA 4R31A 5JW6A 3GRPA 2HHJA 3L46A 4LJYA 3U4DA 1NX6A 3HFRA 4A7PA 2ZAIA 2X19A 3HN2A 1ARZA 4OI2A 2VVTA 2V0GA 2QGNA 2UVPB 3F4BA 2CUZA 4Z0NA 4II7A 2I4OA 1XVVA 4JJ4A 4RACA 1TQDA 5FI3A 5EIWA 1Z12A 4R7TA 4OI0A 1NVVQ 2AMJA 2CHEA 2V03A 4MRPA 2FA9A 4BVFA 1SHZA 1CUWA 2FY8A 5HZHA 4LPKA 2G9UA 3MJHA 3UA4A 4MS3A 1X77A 4GI1A 1C3OA 3Q41A 1SU8A 2GNAA 3PBKA 4IH1A 1NV8A 3R7DA 4A8PA 4FZJA 4OMCA 1FFAA 3ZCPA 4K1LA 3NOVA 5I9LA 3OT5A 4OQ4A 3V6MA 3W3AA 3TE7A 2FPOA 4E5PA 2FX5A 3EQ7A 4M1QA 1TKBA 1ZVVA 3CO5A 1K6MA 2Z9DA 3DWIA 3WICA 2Q3HA 1CY1A 3OFSA 4ND4A 3VHQA 4PLCA 5CMLA 5DXFA 4MS1B 1U0NA 4JUDX 5C5IA 2XB9A 4FFBB 2RHWA 3V4FA 2RC5A 3C16C 3VZQA 1SVWA 4JBHA 1TVKA 5D6OA 4RL4A 4W7IA 2J0EA 3K71B 4MRMB 4ZCIA 3OO0A 4OYLA 1J49A 1K88A 1YZYA 2B7CA 1M1NA 5JNSA 5LP6B 2AZXA 4MI3A 4BBAA 4DBLE 3D3JA 1T5SA 2CXHA 3N8HA 1BQEA 5BVHA 5KPJA 4TLAA 2NU9A 5B7PA 4EY7A 3ANTA 1N8TA 5B3JC 1NW9B 2AKAB 4MR8B 4AKGA 3MUNA 3F47A 1QCZA 1DAIA 2P9QA 1QRSA 1SG9A 2QXYA 4BQRA 4F1WA 4Y2RA 4BNXA 2YXPX 2WNSA 1O54A 2CDNA 2X1HA 3F4LA 4C3UA 2AI1A 4FIZA 1NBIA 1U63A 2OK7A 2XX3A 1ESMA 1R8QA 4BWYA 4MLZA 1NPTO 2JK1A 5KVCA 4ZJZA 4UBMA 1UQTA 3JXEA 4BP1A 1WPXA 4F1JA 4QQ8A 3TVYA 2GWHA 4B82A 2QRQA 4Y9UA 3GH3A 1BMTA 4PQFA 1PTJA 2COKA 3C7DB 4AJLA 2VEOA 4AQDA 4RTLA 3PLRA 3GDGA 1I3KA 4YJ3A 3GK3A 3ZHYA 3S1LA 3K2IA 1E7SA 1SAYA 4NSNA 3ZD6A 5C9ZA 2C78A 2IKSA 2DQZA 1JG4A 3EGWA 5CX1B 1S3SA 1RE0A 4BYGA 3PPIA 4KWIA 4LWPA 1L3CA 4G5GA 3HNRA 4AFNA 3QF4B 4DAOA 2XMCA 2J3HA 1GWNA 5GIOE 2IIVA 1G16A 1EFAA 3VKGA 2OZLA 2IYYA 3MTDA 3KLOA 1XEXB 4IO0A 5C7IO 1FUUA 1QFXA 2PZBA 1RLUA 3WLAA 3MXTA 4AC9A 4N39A 4DS3A 3H99A 2XWJI 1HO3A 5FOQA 1MOQA 3HYLA 2MTBA 1P4RA 1JLLB 1UT5A 1AZSC 1V35A 2POCA 2QSUA 2VL7A 2W71A 5FNZA 1L5NA 3U4QA 4AO7A 4G5HA 4F21A 2XB2A 1W5AA 3QVUA 3ODPA 1M6NA 1DAOA 1IIBA 2ZUBA 1W29A 2C5GA 1CZNA 2IK8A 3T7DA 2OCXA 4W5QA 2FFHA 2R6HA 4MIEA 5A0VA 1I1OA 2QENA 1ENOA 1LPMA 1DJMA 5HCNA 3PPXA 4B8WA 2WLTA 3JY6A 4TTJA 2RJNA 1X7WB 3QBJA 4I4TF 4NQZA 3U62A 3PEVA 4TMTA 1JU4A 2CVZA 4Y6PA 3VZCA 4Z53A 1FNMA 1U31A 5A7HA 3DPIA 1KXZA 4HLUA 3FHLA 4BNHA 2F1HA 2FXVA 2HEGA 3CUKA 2IBMA 1XPRA 1TU3A 3RC7A 1PNOA 8GPBA 3Q9SA 1KF0A 2C7GA 4NOLA 3OX4A 4JDPA 2P2DA 2QLMA 2C9ZA 5HR5A 3PNYA 1Z0KA 1D1QA 3O94A 1BOOA 4DVGA 4EGQA 3R8FA 2G7ZA 1CQXA 3DFFA 3VPFA 2VPZA 4RNCA 3VVMA 3PXBA 3LLCA 2XNCA 4KBFA 1E79A 3P4UA 4PPFA 3UJBA 3RT9A 3IQWA 4P5EA 4WXHA 3K6JA 2IE8A 1LRLA 1E3IA 2AN9A 2D1FA 2HX1A 2R1VA 2FMIA 5CT9A 1XMOB 3QENA 3LUHA 4UU1A 3COVA 4P08A 1E2UA 1D4ZA 4IDAA 2D1SA 3DHWC 4ZFNA 2XVMA 1V8DA 4CMKA 5HBRA 4GGMX 5ER9A 2RI1A 3Q9NA 4Q1DA 4ZP1A 2UZ4A 3NS7A 4EHBA 4O3FA 3T1HB 1ODIA 3SE0A 2HMWA 1PR3A 2QI9F 2JFQA 4CM4B 1W6RA 4WY2A 5DM70 3GLGA 4WBXC 5JO9A 3OEHA 5IS2A 2ZCUA 5JNRA 3H9GA 3LPNA 3VR3A 4DY6A 3ND5A 5SZIA 1OWMA 3OE1A 1DC6A 1UOQA 1PL0A 2W90A 3CX7A 1T4BA 4KSYA 3STTA 4EZIA 1W581 1ZJYA 5D3KA 4JN6B 4INAA 1FDTA 3VSDA 4O63O 3W9YA 1QZTA 5A7GA 2HHHB 4GZ3A 1KI7A 1RPZA 3OPYA 3PKJA 2HV9A 4F8EA 2IH4A 4FVTA 5AW8A 2QBYA 1ZEMA 3QPBA 1XCBA 4PO1A 3WWPA 3G8DA 1E0KA 5IF9A 2PSDA 4P92A 2I3ZA 2PQMA 1OD6A 2D4HA 2KE5A 1T13A 2QNBA 2ZRCA 1B42A 3CRVA 4HDOB 4TXMA 1Q12A 1JBEA 3DXFA 1LGYA 2VG8A 3D31A 3DR5A 1CZLA 3HWX1 2ZI7A 4JEIA 1N7JA 4NNPA 4PHCA 1U7WA 4WK0B 4ZQHA 1NXSA 1T8RA 2J7PA 4RKQA 1WNFA 2IDMA 4EJSB 2GF0A 2GNOA 4MA4A 5JMPA 4IGKA 1T9GS 4HGYA 3RC2A 3NBUA 4CV1A 1MLDA 4I1PA 1XCGB 1BJRE 1R64A 3EEFA 3M89A 1ACJA 2Z1DA 3MINB 1FDRA 4CMIA 2HLNA 4MQFA 5D01A 2FFJA 3WGMA 3V34A 1LPAB 4KPGA 3T1NA 3WGVA 2A9VA 1U98A 3FPJA 4BN5A 2QTZA 3B1JA 2ZI4A 2MSDB 1UPUA 4XQGA 5DNAA 1GKYA 1XCJA 3GUHA 4YJKA 1LC3A 2HGZA 4WGGA 1KYZA 3BIXA 5KJ6A 5B55A 1PQ4A 1ADYA 1RKUA 4ZHQB 2BKLA 1MB2A 2VJKA 3BXZA 5BP7A 3IOCA 1S8FA 4B87A 4OB8A 3HDVA 4WUTA 4E4TA 4N5IX 1EX6A 3LUKA 1XK7A 1ZX1A 2DH6A 2J32A 2WZDA 2ZBGA 3KWLA 3LBIA 4EJ0A 4NARA 2AYXA 2OA0A 3U48A 4DLKA 3RC8A 1NRXA 3ZZMA 2AE1A 1PHPA 3GIWA 3TLGA 1I7LA 5CDHA 1U3UA 3V1KA 3H5VA 3RSQA 3T9DA 1TECE 4IKPA 2JD2A 2G9RA 4E13A 5SYNA 2HA5A 4R54A 2O8EA 4ZO7A 2XOKA 4PYKA 3SBEA 1JTEA 2QRKA 3AG6A 4HFRA 3VZBA 3ZKAA 1QZXA 4A0HA 8AT1A 2HNKA 3BZWA 4N9QA 4YLEA 4FWBA 3ZH9B 4BX8A 3RTBA 2ZG6A 5SYMA 4XTCS 2NYVA 1OU0A 3BEDA 4A1OA 5IJZA 1MA0A 2VPQA 4KXYA 1WWKA 4LOLA 1KA9H 1MHTA 2OLKA 1B4DA 3I9JA 3WQBA 2QP3A 4DB4A 3OTQA 4URVR 3EH1A 4EA6A 4QUDA 4BMZA 1XD8A 3TOVA 1FLDA 3WIBA 3ZIDA 4REQB 2GD0A 2NU8B 3ZDBA 5HRAA 4S05A 5DYYA 2WD8A 1T3GA 4U2DA 1T9KA 4CZ2A 5ELLA 4DR3B 2G1PA 1M34E 3NCHA 1DO0A 3PT9A 4BJHB 1H1LB 5B2EA 1FFGA 3I76A 3PHLA 1SQFA 4IR7A 2D8AA 1XMIA 3V1NA 1GNSA 2YXNA 5A3JA 3CEPB 3EFOA 4NRDA 5IDQA 2P9ZA 4P3OA 3BWBA 2CZQA 2JFBA 1CG6A 3P9KA 4FHZA 4HQKA 3WB9A 3OCJA 3ZCRA 1MEEA 1N2OA 2Z9CA 1U3DA 5JCXA 2OHJA 4L6IA 4F92B 5FPKA 5C51B 2REOA 2RSLA 1CLUA 3G82C 3R7LA 3GZNA 3B6IA 1A9XA 1PJ8A 3PUKA 5JE8A 1N4AA 4OUDA 1M8GA 4AZTA 1PDWA 2VP9A 3IUJA 3OJCA 1CY8A 1J21A 1YOVA 3T7JA 1NNLA 3VFDA 4ED9A 2XZOA 1FW6A 1U80A 4HH4A 2BFDA 1PG2A 2HDWA 2ZTHA 3BXOA 4KAFA 3UK6A 2RIPA 2SKEA 3QKRA 4KODA 1K92A 1U3CA 3L7IA 1N3LA 4JIGA 4Y2VA 1FFCA 4I14A 4O4JB 1TJ4A 1DS6A 2X5NA 3OT4A 1TC2A 2BSAA 4RELA 1M6VB 2FUG6 5IM4A 3L9XA 4B9AA 2AFIE 4AY5A 3MPOA 5HILA 4YX9A 1RI5A 2B94A 2HOQA 1RLJA 1T9DA 2IY8A 2WP8J 1Y6QA 3JQRA 4TROA 4L7QA 4BXOB 1ZN8A 3ORHA 4J0FA 1LBEA 2ZJ0A 2QUZA 3T9BA 5IYZA 1GKUB 5DEOA 3U7FB 1SCQA 3KXIA 1J0BA 3U7JA 4B47A 1XMVA 2C2XA 3P5BA 3AF5A 1TQ6A 2JHGA 3D8NA 4HNAA 1B6RA 3HCCA 1A8HA 1MJGA 4HDRA 1VGVA 5TQVA 1EVZA 2SICE 1QAMA 5K2OA 2P11A 2VYQA 3K05A 3NWOA 4WN3A 3U1TA 3WBBA 1ZK2A 2QL5A 3OFNA 3W3ZB 1QIHA 1JA0A 3SSAA 4WESA 3PJFA 4EJ6A 1C30B 1HFWA 4MMZB 4BKUA 1A2OA 1PYGA 3BXGA 3LVBA 3W5UA 4DWWA 4F4CA 3KU4A 4HK4A 4WA8A 3ZE7A 4GM4A 3DJFA 3AB8A 4WOPA 4WXRA 4EUHA 1KI4A 1J8VA 1ZXLA 5JSZB 2DCUA 1H3EA 1NVDA 4KX5A 4ZXFA 4L78A 2ZBDA 3DMPA 2NSHA 3GAFA 5E4JA 1GJRA 1ZJ5A 2PUDA 1P8JA 3DVQX 2KYRA 3ORYA 1R0YA 3RADC 5LMCA 1KFKB 4IJQA 2XXAA 4TL6A 4OGWA 2ZXEA 1X2EA 3F6SA 4XD2A 1IK6A 5KYXA 2KWIA 2LNDA 3L49A 5E8RA 1GCUA 1JU9A 3M6MD 4K26A 3AM5A 4FZVA 3WWOA 1Q22A 1SA0A 3SKYA 4JKIA 2FRVA 4AT1A 3K0SA 3P8ZA 2F62A 1E96A 2N1MA 4M8SA 4B73A 1D2GA 1I51A 1I6LA 2I33A 4YHBA 3PWTA 3OE7A 4Z3DA 1UMDA 1Z34A 5DHTA 4BX3A 4D8TA 3PD0A 2ZWIA 5K6AC 5DBIA 1GNRA 4U2GA 5JC1A 2DM6A 3HBFA 1TQ8A 4RPCA 3JAMA 2O5RA 3I30X 2P9GA 1N6HA 3KNZA 3L8CA 4LTDA 4RD2A 3TNYA 3G2HA 4Q7LA 4ZOEA 4XPIA 1QF6A 2NMVA 4EA7A 1E79D 3PEFA 4BQOA 4QWMA 3O95A 2D7CA 4C0KA 2EZ9A 3GUYA 3ZJYA 4B75A 5TV2A 4BECA 2YS7A 2PGXA 3D7SA 4CMHA 5L3SA 4XIGS 4AJNA 2P7HA 1RR6A 2DEUA 3JQ6A 4MQMA 3VHXA 3VOSA 1YS4A 2PWPA 4MKIA 2BC9A 1RI2A 1HA3A 1NT4A 4J0CA 4BFVA 1RAHA 4B3GA 3USZA 4NU0A 3PNLA 3FNGA 1QH1B 3MEQA 5JSKA 3OEHD 3RT1A 3A6HA 2YWEA 3HYTA 3NXSA 4QT4A 3N9IA 4XE5A 5EZ5A 4M88A 2Z2JA 4LS3A 1S8OA 5LU9A 2QVLA 4AJEA 3RV3A 4EB8A 3HS3A 3RCBA 4P82A 1FMFA 5JBIA 3DLIA 5FOVA 1ZY2A 4LBWA 3ZWAA 2RGCA 3GCWA 3WRXA 3ES9A 3FA2A 1Y6JA 5CGZA 4F06A 1SZJG 3CWCA 3ET4A 3FYUB 3VR5H 4JI7B 4LF9B 2AVNA 2F8TA 1PR6A 4LHEA 4NV0A 4GI3A 5JDCC 3WR5A 4WGFA 3RC9A 1TPYA 3AR7A 4RF2A 2QXTA 3DMDA 3QP9A 2VRWA 2GTIA 2VJAA 4LBZA 2FR8A 2J7PD 2H54A 3L6CA 2FNAA 2VDWB 3TECE 4Z4GA 4EO7A 2XUIA 3PGA1 1X1AA 3IT0A 5I7EA 4AS3A 1FNBA 1DCFA 2DC1A 3A11A 3IERA 3QUBA 4BBJA 4CJXA 3GCGA 2RARA 4O2AB 2Z8YA 1G5HA 3QTTA 4A0SA 2ERCA 4OFBA 1G63A 4M0FA 3B20A 5G0UA 3R6LA 5FFNA 5KSPA 1QQTA 4UAUA 2XRMA 1ORWA 1ZINA 1U2RA 2C77A 5I9BA 1H5UA 1M1YA 3BMOA 4DF3A 4EYOA 5L7TA 3ZLJA 5C18A 3ER8A 3C3DA 1AY0A 3S1SA 4PF1A 5ES3A 1OC4A 2VBGA 3ZWDA 3OHMA 5CDGA 1AQJA 3LTNC 4EUNA 3I04A 3HZZA 4MPPA 3AUAA 3U6KA 3UAOA 2GMWA 4NYMR 1HM5A 1L4HA 4OP1A 4WCFC 2Y0DA 2REQA 2AI2A 4FN5A 2DZDA 3MTQA 4H0CA 4ZGGA 3W5HA 3AHFA 5ESRA 2Y2VA 2P1RA 3EZ6A 1DO8A 3ADOA 4GUAA 4IX1A 3AF3A 4AZ3B 1OIXA 4XVHA 4X6YA 5DHAA 2XCQA 2V97A 2F1OA 3ZGLA 2ZRDA 2JVJA 1Z16A 4Q9HA 1H5NA 3DC7A 3DKIA 2I2AA 4IWXA 4WA7A 3GZTB 1CEYA 1ID1A 1OREA 1AK9A 1PT7A 5BYBA 2NTVA 2YVLA 2NZ8A 3F1LA 4WKPA 4D8XA 4E21A 4B4VA 4EFNA 1W59A 3T7TA 1LNZA 1H3NA 1L5WA 2JFVA 4HO1X 5HZGA 3OX1A 3ROEA 3CG4A 1RWOA 2P4HX 2XXBA 1FQJA 2A0UA 2JJ2D 2LTAA 1MX5A 4I50F 1T4CA 1WXEA 2JASA 1II9A 4YPFA 1H85A 5C2JB 1I30A 2XOKD 2RHBA 5IZCA 3X1XA 4KRFA 2XEDA 4C29A 1A8UA 3C8UA 4J2OA 4LZWA 2SCUA 5CVJA 2G40A 2AWNA 4G0MA 3KC2A 3T4XA 2VHVA 3DCIA 3IVAA 4ZVSA 1SXQA 4DWOA 3D5TA 1LQ2A 5J4VA 3L7NA 3N8DA 2ZQYA 3ZY2A 2YZGA 3BIWA 4TGLA 1G5IA 4XGNA 3E9CA 1W4AA 3WLJA 4K9KA 3G0HA 4K81B 2H29A 2VTVA 1LDEA 3QQPA 5LJLA 4JYCA 3EGXA 1HMYA 1X7XB 4YAKA 2F43B 2HJVA 3F2IA 2DBYA 5DOZA 4YQFA 3ZG6A 2K87A 4GLJA 4GWLA 1XYVA 4ME6A 2FPUA 4M9QA 1CT9A 5L95A 4RV9A 1EZ4A 3UCFA 1HRDA 4BNKA 2I80A 4KQMA 4ZTBA 1RWNA 4MDHA 4G85A 4KE7A 4X7BA 1XU7A 5FA5A 1P73A 3CCFA 4RLFA 4UJ3A 5I01A 5MN6A 3DMGA 2C84A 3D43A 5K45A 1JMVA 4GM1A 3E03A 3K9HA 3GR6A 2X4GA 3F9CA 5FTJA 4L5YA 3UATA 5C81A 3QE3A 1UWLA 4ZI7B 1UF9A 2PX5A 2OXEA 3W8DA 2BFNA 3FXAA 4FYIA 4KWCA 4WPGA 4ZT3A 1HFEL 5AVWA 2GN4A 5ETJA 3L7JA 4FMDB 2CB9A 4LHWA 4UOEA 4UTPA 5CA1B 2I3BA 3BQMB 4MIKA 2FEWB 2VZEA 1MBZA 3KXLA 3MSXA 1WOMA 1JFFA 4Y2UA 3ZTYA 2HIHA 3SICE 4FKBA 4GOJA 1YA6A 3PYLA 1GPLA 2OCLA 3I4LA 4E5SA 2QUIA 5CB4B 4C7BA 2OGUA 1N6RA 1VE1A 3LP8A 7REQB 3QW2A 1IN1A 2FPPA 2AN4A 2DUJA 5EWLA 1T5HX 1A4UA 2JCBA 4DANA 2GN9A 1V45E 3KQOA 1PJLA 2IYOA 1LV7A 1ZGCA 4BOYA 4F5DA 5JAHA 3I04M 2OP0A 4KR2A 1T43A 3I34X 5EMMA 3Q8MA 4I46A 5B4VA 2BUBA 3UGKA 1J1ZA 3HLTA 3OQIB 2R86A 2QSZA 4IG9A 1HDGO 4NECA 1WQ3A 1J7JA 1Q7CA 2AA3A 2M6LA 4L4UA 3WKBA 4MB2A 3N2NA 3OFND 3D0QA 4IDNA 4FKZA 1A69A 3H2YA 4BNNA 5JG7A 4BB5A 1ZVJA 1V9SA 4C0SA 2FOIA 5KJFA 4JJ8A 1EDZA 3RFUA 3EE6A 121PA 3BRQA 3NGMA 3KQPA 3PXDA 3QVVA 5GAJA 1JH8A 3GRVA 4L4YA 2YJ4A 4FCCA 2L17A 4P35A 4H1VA 5ILQA 3ZUGA 4R9NA 3UHPA 4E09A 2H4HA 2A0FA 3B38A 1I94B 4I08A 3K72B 3ELUA 3I6QA 5GV7A 1WB4A 1X1DA 1XDGA 3BJZA 3EPLA 1ZM4A 2GM3A 3BMNA 1KY3A 4P7JA 1C7RA 3B9RA 4S0XA 3WBJA 1EAYA 3NT2A 4NYIR 5A3QA 3EW7A 4B76A 3NPMA 5REQA 1T15A 1KC3A 4LQDA 3INTA 1EBBA 4G1MB 1XEFA 3EXFA 5DXJA 3PQDA 5DT2A 4A92A 1Y1SA 1RM3A 3KJNA 1P1BA 2AOTA 1HC7A 3ZI4A 4RSGA 2PMFA 1KVSA 4TL9A 1AKMA 4BO5A 4HRYA 3HCEA 2YYAA 1KERA 3GA7A 1NA5A 3GRZA 1M75A 2VTEA 1O4WA 3KLNA 3OE7D 1BYUA 5ALHA 5EI5A 421PA 1KWKA 4OJYA 3IJEB 4ZO9A 1IHPA 3G0BA 5I7WA 4LX0A 1S5PA 3P2YA 1M7GA 2CUTA 4PG8A 3IB6A 4QXOA 2IHVA 1RAGA 1W0KA 3R1IA 5EPUA 5AUQA 3WK6A 4EDHA 4F2GA 2FWIA 5LDHA 1Y7PA 3O0DA 1SBCA 3CW2A 4F2HA 5IJ9A 2CDAA 3OOEA 1DOZA 1F14A 2HWYA 1QG4A 1BWSA 1D6JA 2GJ4A 2PD3A 3GLQA 5K51A 2ON6A 3UWOA 1Z29A 1EUDA 2V7UA 4H17A 4IH9A 1JFSA 2IS1A 3FPBA 4P54A 4P3NA 4QEZA 1N0VC 1L7QA 3DDNA 3M81A 4HGOA 4QTUB 1U0EA 1E1NA 1NVKA 3D1JA 4PLZA 4UU7A 3REQA 3GOQA 1VLLA 2BCJQ 4R7GA 1T24A 3JYQA 1KJNA 3WIEA 2H0AA 5BOSB 3CR7A 1Z63A 4NJOA 4PZYA 1SHJA 1CJKC 2J6IA 3EIHA 2NW6A 2KW5A 4BMSA 4CG0A 2GZRA 4XM0A 2WSYB 5E6SA 3W1VA 4CL0A 3ON5A 1OH6A 5FYDA 4NBRA 2D00A 4QARA 3KZMA 5L8VA 3OJFA 3ENKA 2WG1A 3MMSA 2EFCB 2VPIA 4FYHA 3AVVA 1KJQA 3QE9Y 3L4BC 2FW6A 4CG1A 1C3EA 3T52A 1WJGA 3ICCA 2DOKA 1SMKA 3CGWA 3M4NA 4BNUA 1Z6QA 1CY6A 2H07A 2FE4A 4CKCB 4OK5A 5TT1A 2VF2A 3FFAA 5CA0B 2HMAA 4XYMA 3IP9A 3GUVA 3H8JA 3I8XA 1G8HA 2BHTA 4PFKA 2AF3C 5JPIA 2ZUTA 4UZSA 1U8XX 3D2BA 4IIHA 3VC3A 2JIRA 2JI4A 3EXG2 4W6QA 4Y6OA 2J3LA 3R9KA 1KZ9A 1L6RA 4DMHA 4K9RA 5IXYA 4HLNA 4Q9NA 5DLYA 3QVSA 3WMGA 3FTNA 4LZNA 4B09A 3ROQA 1SURA 2NU7B 2V55B 2CJYA 1YXMA 4FFLA 1U9ZA 5CK4A 4MUXA 4DR2B 1JPNA 3WXMA 1CUBA 2ZTLA 3FPKA 4IHJB 4TMZA 4LTNA 4GMHA 3B9QA 1SD2A 4IMPA 1PZMA 1IXZA 2F2TA 2QT0A 3ZWQA 1PL8A 1WUKS 4EUFA 4HTFB 5JDIC 4H7KA 1JQBA 1NVXQ 3P9PA 3CSSA 5DRYA 3LWBA 4LXUA 4WVLA 4YRJA 3V2IA 1ESCA 4FWIB 2MR5A 3M9XA 3TNDA 2PKWA 1B8PA 4JT4A 4L4ZA 1XL0A 3TUJC 2V5AA 2YXLA 4J2TA 1MO2A 4AF6A 3H4MA 3LAWA 4KQWA 2CV2A 2E5LB 2PSSA 2O0HA 4I3HA 3KSZO 3U5ZB 3T15A 5CLLA 5T4FA 1MB4A 1T5OA 1Z2PX 3JRWA 1OFVA 4EFDA 4FYWA 1SD5A 1N0IA 2VP4A 4P3XA 5A9SA 3L7OA 3W2FA 5DYGA 4DJFC 4FTWA 4DZZA 1IUNA 1XLTA 1UJNA 3FB1A 4QYMA 4FFVA 2ZYRA 1EGVB 5ITWA 3RS2A 1XEWY 2H85A 1T4DA 1MC4A 5BSRA 4M0KA 3M0EA 1NUUA 2HLHA 5AJZA 2G77B 2XLBA 4DGSA 1YU6A 2ZZMA 3Q72A 3ZU6A 3NC1C 3NO4A 3NHSA 4I55F 4NNJA 4RVCA 1CVIA 3KB6A 4GVLA 5FWYA 1N2EA 4MS4B 4WCDA 2O8VA 2PT7A 3EWNA 2HK6A 3HUDA 5J2TF 3FDXA 3TD9A 1C7JA 1O0SA 1V3UA 2PRJA 2V7TA 2ZLBA 1PAUA 3CLUC 3JQCA 4DYHA 2XDQA 5B30A 5JSQA 3MD9A 1RHRA 1QUFA 5KDOA 4W4TA 1RHJA 2HUPA 3AVXA 3WGTA 3EVGA 1FP4B 1SN7A 1WL8A 5HFJA 5BPHA 2C0CA 4BO4A 5EQJB 1N0HA 4L3VA 3UJHA 1XLUA 1BXRA 1JQ3A 2FN9A 3E9MA 1O94A 1RP1A 4UM7A 2J5XA 2QM3A 3LC7O 4Y9DA 2UVPA 5GP1A 1RYNA 2MCFA 3BAZA 4QYIB 3GNQA 1HE1C 4GP7A 4CEIB 2FI1A 1GCOA 2DSNA 2ZYIA 5FTKA 1MGPA 3BHMA 2IXBA 2YOGA 5LXTF 2ECOA 3W2GA 2I0FA 2CE7A 1RWBA 2KB0A 4KR9A 5I7VA 4LRUA 3TL6A 3QKWA 4EZBA 3GT3A 3PGKA 2YN2A 3F0TA 3VHRA 3PFCA 1QB7A 4V0NA 3ZQUA 2DETA 2DFLA 4PIMA 4L8YA 4UEJA 1RFLA 3KALA 3AJDA 1KE2A 3H1GA 4MWOA 1RXYA 1CE8B 2ZT8A 2XZDA 4FDTA 3DEHA 3LP6A 3KV1A 3QVMA 1V5FA 1W1UA 1N2SA 1Q1QA 1NHGA 1ZLYA 4AX8A 3O7MA 1FNSA 3VTKA 2IU0A 4ZZ1A 2C5SA 5DWQA 4FDAA 3NDPA 4NP6A 5F33A 4FFBA 3T9CA 3TM4A 4D99A 1F3LA 2YXEA 3EF3A 3T7SA 4EYGA 1VYUA 5F5XA 4M60A 4UQOA 4G81A 4OG2A 4OU5A 3WZMA 4QVKA 1MRZA 4KITB 4L3OA 5EP1A 3UAVA 1ZI8A 2IU4A 3IUQA 4MRMA 3W05A 4EK9A 2CKDA 1S3GA 3NGLA 3RNOA 1F9AA 2I6TA 1ECLA 4DSOA 4UTVA 2YL2A 2DPMA 5ECGC 1GRCA 3N39C 3RS9A 2I91A 1FUYB 2GA9A 3LXUX 4JOBA 4MR8A 1ZD9A 1GRNA 3HJRA 3OIVA 1AKUA 2ZSHA 4J0JA 3V4VB 3N8GA 1ST2A 2VDKB 5DI3B 4HDNA 2OBBA 3BXPA 2X1VA 1FXWF 3G2OA 3SNKA 3KQHA 1AX9A 1RT9A 1P74A 2BUAA 2C4WA 2UUAB 1NULA 5JNLA 1Y37A 2F8SA 3H9CA 1YB1A 1RXWA 1S1MA 1SZDA 1UADA 1WRBA 4JR1A 4AIIA 3CN9A 1OPRA 3KL2A 4LHZA 3U4CA 3NTUA 5J2UA 4XUCA 1ISGA 1EUCB 3C4JA 3C43A 3SC2B 4AJOA 4ER0A 1GTRA 2D7JA 1L8QA 1UT8A 2ZSAA 3DE3X 4URFA 5B6PA 4Y6RA 3AVOA 5E3IA 2CSXA 3Q7SA 4OLBA 1T36B 3NIWA 3VJLA 3CF4A 1A4IA 2SNIE 4KEAA 4UU0A 2VT3A 3D3KA 3H4IA 3WL5A 3A6EA 1XAHA 3HZHA 5ANRB 1ZD5A 4RV4A 2EFHB 1EESA 2FH5B 4I0WB 1KPIA 2QTVB 3KXPA 1BQ4A 1DSSG 2HRCA 2OOKA 1YVEI 3H6GA 2MYPA 2VCYA 3EXHB 3M1AA 3QM1A 5DTQA 4HVCA 4ZCTA 4GX1A 5I4CA 1UC4B 3BBPA 3BGOS 3W4IA 3ZWYA 3SM3A 2E49A 2AV6A 3UCEA 1ZIDA 3GEMA 3O91A 1RIIA 2GD2A 4N01A 3KTDA 3IKVA 1UAYA 1JAHA 4G5YA 4RA6A 3H5OA 4HI0E 1N2ZA 4XJVA 2M6RA 4XZ3A 3MMXA 3RDPA 2V54A 3TBFA 2JJYA 4LF8B 3U0BA 3BWMA 1WUHS 3V8BA 4M49A 4GBED 4DJ5X 1XQ1A 2RHLA 2BMFA 2O07A 2BFWA 5E6UB 1CF4A 2IC5A 2IW3A 1IQUA 1JWBB 2C5AA 2FWNA 3I83A 3PNBA 4MLPA 1AO0A 2WPDA 3IEVA 1DEKA 1E2BA 1JV2B 2JIOA 2UYQA 3AWIA 2RGAA 3KVRA 3GDHA 4CIAA 2PLFA 4RMGA 3RRYA 6AT1A 4IQ0A 3DB1A 3PFBA 2G71A 4LMBA 3L4KA 2R4QA 1S2NA 4KQKA 4OI4A 4KFRA 2GEUA 3RJTA 2GO7A 1Q20A 1W0KD 1XNHA 2DKOA 3C5EA 3I9LA 1V8PA 3PNQA 1JIVA 2NXJA 2R4TA 3H4TA 3R2JA 5AVUA 2HHCA 3EPRA 3FPSA 1UFQA 4F4UA 3Q0IA 4IS2A 5E7IA 4AQYB 4TT3A 2W6MA 1TYZA 1Q84A 1DAMA 4JL8A 3HB5X 3LBNA 5CT8A 3DLAA 3D2CA 5C3MA 3MJDA 4KQEA 2CLSA 1V3TA 3AKCA 5DV9A 1Y8RA 1LK5A 1TYAE 3L7MA 4O5AA 4XQ9A 5IAKA 1F7UA 4YJGB 1FUEA 1AM4D 4U9UA 4DIEA 2B25A 3E3AA 4QSHA 2WJVA 4XFDA 2CDRA 4H77A 4JQCA 2Y1DA 4G8CA 3LVQE 3LPAA 2XODA 2BMEA 5I3ZA 4CQNA 4LF6B 3ORFA 4QDOA 5KUTA 4DQDA 3UYKA 4Y1RB 1TO2E 1ORTA 2IYLD 3ZDQA 3O73A 5LYJA 1TU4A 4FZ3A 4Q3OA 2WFZA 5EUCA 1H2XA 3V5NA 4YPVA 2ZBQA 1KQPA 4OOEA 3QX7A 2F4NA 3WL4A 2Q1XA 5HEKA 3PE6A 4JOQA 3DV2A 1I7QB 1RMYA 5D5HA 5F2OA 1MDFA 3OUZA 1R0RE 2JZNA 3TTUA 1Z13A 4XJTA 1UC5B 2P0EA 3N58A 4RD3A 3SE7A 2ST1A 4QUGA 5ALKA 4F6RB 4ZICA 2WMOB 1BX0A 3LGSA 4TMYA 4TKLA 4KC0A 2FP3A 3BSYA 3S3TA 2C2HA 1JEOA 1N3BA 4NDNE 1O8BA 4FT2A 5CIYA 1YO6A 3DV0A 3T3GA 4W9NA 5JNVA 3ESAA 1O95C 1RAAA 1HDIA 3I2GA 3IOMA 3V32A 4DB2A 4MUJA 4X91A 3R09A 4TV8F 1E9BA 1ADCA 4S12A 1Y33E 3SSOA 4FINA 3RAFC 2YN0A 4CQJA 2ODEA 1Z4QA 1K75A 2PSHA 3G8AA 3NV7A 5EUMA 5JAZA 1M2VA 2R44A 3IEMA 3ADPA 3IAM1 3EIXA 6CHYA 2CLCX 1G59A 1ZVQA 4DLSA 1CFJA 4EJSA 5K6RA 3DTVB 3V33A 1D03A 1GCIA 3Q1KA 1JUDA 2QVGA 4TXLA 5F23A 5AUNB 2XUAA 1UPAA 2AHOA 2Q45A 1O58A 4W8OA 1WZCA 1CWUA 3S68A 3AKDA 2VSYA 1NG1A 5KNBA 3DVLA 3D4BA 2QX6A 3OQVA 3CUEF 4IMIB 1MA3A 2JH9A 3MINA 2PXAA 1TDJA 4BNLA 4LK3A 1KTVA 2QX4A 2NTYC 1CUIA 3TIXB 3SEQA 2Q9BA 1G1AA 1HURA 1Z8NA 1COZA 4KO2S 5DKFA 2G09A 5FBKA 1JFVA 2PWBA 1E1RA 3T0GA 2V7QA 1TKAA 1XI2A 3I58A 2BEWA 1V39A 5P21A 4ASUA 4P4NA 2HQOA 3R3JA 2X0JA 3DMNA 1AF4A 3PUZA 4R3WA 4HG2A 2QMYA 3SAJA 2YICA 4D56A 5JANA 1L7DA 3PV0A 1GA1A 4KO1S 5MGBA 3EHDA 3MXOA 4XR9A 1XP5A 1HXHA 2OORA 1KDTA 3H2HA 3LVRE 4IDDA 4XI9A 3R7FA 1NN1A 3TLEA 5D8DA 4D4HA 4HMOA 3VV2A 3ZHBA 1KVRA 2AKEA 1QIKA 3NATA 1YRYE 2AEEA 2JEOA 3LW8A 3OJLA 4IJVA 4J16C 4PW0A 4BASA 3IAAA 4NWIA 5K8UA 5E2IA 1U8YA 3OQMA 2BM1A 1G5FA 2GUGA 5LZ9A 4NJEB 3T5MA 4UNSA 4ARCA 4G89A 5ALJA 1GL9B 2CXNA 3VZDA 2WTEA 3BH0A 2A33A 3MOIA 1T5IA 3R4CA 4WY8A 1SVOA 2WJGA 3BFKA 1E1MA 4HQ0A 3GJ6A 1VLJA 1XP8A 2YJGA 1IVYA 1SCJA 1X1BA 3ND6A 4O6VA 3H16A 1P81A 2DPXA 2WYUA 1H23A 1YDHA 2QI9C 3ZHTA 2C2BA 2A5DA 2QAIA 3T5GA 4YXWD 1QAQA 3GT7A 4PS1A 5LBUA 3GB9A 4BO1A 5JJLA 2XWQA 3H65A 3JVEA 2J7KA 3O4IA 1R0LA 3TLYA 4IDGA 5FTWA 2WP0A 3WZLA 4B17A 3AZPA 4EW3A 4M9RA 4HQNA 2QUAA 4OLAA 1Z6PA 2ZYSA 3CQ9A 3X1YA 3ZV4A 3TKYA 3V46A 1TD1A 5G0VA 3WK4A 1PWXA 2JLYA 1TM3E 5C52B 2OECA 1M8KA 1DT3A 4AG6A 1Y63A 3CX3A 1IOLA 2ACVA 3GOHA 3LBAA 3D6UA 1HI9A 4U6NA 4DMMA 5KTPA 2HU2A 4ZVPA 4DYVA 4OHRA 3AW9A 5KX5A 3RQSA 3GLKA 4NBWA 2H2FA 3U39A 1ZM9A 1R4MA 2BFBB 3EN0A 4RF3A 4KGVA 3TQCA 5LM3A 4C87A 1H1LA 1W4LA 3DCJA 4GOKA 3OZRA 4KPUB 1GPKA 4CV2A 2QVBA 3TTTA 3RT7A 3WWDA 5E9JA 3KELA 3LDUA 3CTMA 2EARA 2R1TA 1SG0A 2R6ZA 4QD3A 1ZOOA 4JSYA 4KRYA 4J9VA 4BO3A 3K6SB 4M37A 5JHHB 3MLEA 3EUFA 1ZG3A 3GY0A 1UANA 4Q4HB 2A1UB 2DHQA 1EWTA 3MWLA 3D4IA 4XR4A 3TNFA 1C9MA 1ZJWA 2OQRA 4RABA 1XRRA 1O9BA 3A9SA 3DONA 2BGNA 4YAOA 4DY4A 4PHGA 4N12A 3DLPX 5C1BA 3DFIA 2IUEA 3CN7A 2FR1A 3EAQA 4HDMA 4NC9A 3UXYA 4B7UA 2R3SA 2PKQO 3ZW9A 4BMNA 5JQWA 2E4ZA 1CDEA 1QIGA 1VRVA 5IKOA 5C1IA 1R6DA 3DBVO 1O3YA 3OSUA 2C3OA 2XAUA 4BFXA 3LLUA 1ZESA 1SBNE 1J07A 3LFHA 4Q3AA 2O2SA 4UBNA 1JIUA 3H97A 2QRMA 2YWGA 5JD5A 4KUEA 4FI3C 4XFKA 1XHLA 4YH1A 1XPJA 3IRUA 4BUJA 3V8VA 4L95C 4MTLA 2YMQA 2EW2A 2GPJA 2Z04A 2WIKA 5C5CA 1P2SA 3TL2A 4WBNA 1JDJA 1NLFA 2ID4A 2QR2A 4ALNA 5IMBA 2V9PA 4DG5A 5FEUA 1LZLA 5COBA 1EKXA 3B3AA 4BB9A 3U44A 2F9LA 2IGTA 1GAJA 5DPMA 1L5YA 1NASA 3ZWKA 2V8BA 4DDKA 1BDJA 2JGMA 4PYQA 1L2TA 5IEJA 3O4HA 3P9NA 4QUAA 2R8RA 1KSGA 4UEOA 4QPCA 4PNEA 1GZSA 4TYQA 4AMYA 1MVOA 4CL8A 1EJ6A 5A0FA 1NXOA 4HWTA 3N2YA 1MD9A 5E38A 4LF5B 2EEPA 1C3LA 1AXRA 2Q6TA 3Q7EA 5JS8A 2HF2A 1Y98A 1HNZB 2FP4A 5JTUA 1WX1A 2IZ6A 1U0JA 1JKJA 5KYYB 3HGMA 5CH3A 3THSA 5T5QA 2WPDD 4KFUA 5K0LA 5A5GA 1XTZA 2CJFA 4P2GA 1Q74A 4WD3A 2XCUA 1JR3A 1NM5C 4D9NA 2W2KB 1JN0A 1B43A 1DQRA 4MKFA 3KB8A 4DC9A 4ECAA 1Z33A 2FUNB 1JLHA 1ODKA 2O3JA 3LSYA 2WVHA 3NNDA 4B43A 4EG0A 5CCBA 5KQSA 1VGQA 5EERA 5TY0A 3SQXA 4UTZA 1RLIA 2PCLA 2I6UA 4LE2A 4EG6A 3S40A 3GMSA 1G1MA 1GZDA 2FMHA 3K2EA 4UNQA 4UU8A 1REQA 4XRGA 1KEWA 3OZEA 1B16A 4TT3D 3USCS 5CFLA 3LX4A 2K7FA 1CS0B 1TQ4A 2YVAA 1X42A 3NALA 5LFAA 5IF3A 4QUIA 4M1ZA 2XGMA 1E2JA 4JR0A 1BJKA 3NTLA 4OXQA 4L08A 2XA1A 3E84A 1LV8A 2OAQ1 2ZQZA 1R0ZA 4G9BA 2IXEA 1NPDA 3PWSA 2GCNA 4LZPA 1RVDA 4KOEC 1X0XA 3W5CA 2IUSA 2WYIA 2OFPA 3RBVA 3PQ7A 4FQ5A 4DSTA 2PBLA 3GAMA 4KVGA 3CC8A 3NR2A 4GO1A 4M2LA 2QX9A 1RQ2A 4K88A 2NPIA 3SJAA 1UAAA 1QYVA 2XR1A 2ZVJA 4NFLA 3KDAA 1WPQA 5EMNA 2C7QA 1YRQA 3OOYA 4MP8A 3JAKB 4B35A 4YYEA 2HBYA 2WM2A 3VAZA 3LY5A 4DJAA 5JZMA 4J29A 1TMOA 3DE7X 3E23A 3QLEA 3WVNA 2CLFB 4RTJA 1W19A 4J3JA 3LW7A 4GMFA 4WK4B 3T4EA 3EWSA 4B2PA 5F9FA 4J6FA 4OHKA 1ZGZA 4S1PA 4DCGA 4WOKA 2JIBA 2CL7X 4E1BA 3I73A 4URUR 1DQPA 1RYBA 3G13A 5E7MA 5J1TB 5BNWA 1QQAA 4MH0R 1VI6A 3B3FA 4KIFA 4PFQA 2PY6A 3DNFA 1P9OA 3I9NA 1IZ7A 2BGMA 3ANXA 3OJ0A 4O4HB 3IYLW 1KXJA 1X8JA 2GJKA 2PPVA 4Q9IA 4PLGA 5CLIA 1LF5A 5B36A 5MHTA 1PTKA 1V37A 2P3LA 1A77A 1YZ3A 2F7SA 1FRVA 4JI1B 1KBZA 5BYKA 5AICA 2F3TA 4AQ7A 3TFOA 4QDXA 4C4AA 1CZOA 4KR3A 3D3WB 4YNBA 5AYVA 1UM8A 5A7FA 4PANA 4Y6QA 3MB8A 2VCHA 4YRAA 3GP5A 5KVQA 2O8FA 1YRLA 3BA6A 3WLPA 1PG5A 2W2XA 3MJVA 1U65A 1L5GB 3TSAA 2BFFA 1UJ6A 4TKUA 4CTMA 5LA6F 1L8OA 1L9XA 3UK0A 4BLVA 4LXIA 4O2AA 4QDTA 5EIBD 1IN5A 5KNBD 1DC3A 1CR1A 4FUTA 2P6NA 4BBZA 3RUHA 3GUUA 4BJ1A 1A2BA 2PUJA 1ZKMA 2GWRA 4CHTA 5KTKA 3PEYA 1EP9A 4K8RB 4EQ6B 1A5TA 1N4DA 4V3BA 4A15A 1PWZA 4IIJB 1SR8A 2Y6UA 1E2EA 4R41A 2V7QD 2WV9A 1HT2E 5HKKA 1UJ2A 2YV3A 4ASUD 1E64A 1YCDA 2FF7A 1XZKA 1DADA 1ZUHA 3E22A 4UDXX 1VJRA 2EFJA 5CXUA 3GP3A 2IDJA 2OHFA 1Q2XA 3MT8A 4AZ3A 3RVDA 2A5LA 2F17A 5JISA 5H68A 1XD2B 3JQ7A 4BFLA 1OYWA 3H75A 4OK6A 4EMTA 1RHQA 1B26A 4D9JA 1RQ7A 4C0LA 4FEGA 3W90A 1ODCA 1LY1A 1U8CB 1TM4E 1B1AA 3F74A 2XTNA 4Y9TA 4EVRA 1KH3A 3T99A 4UFOA 4F3YA 4FNMA 2IYPA 3A6JA 4PGMA 1BGXT 3QI2A 2A6PA 1AGNA 1NXQA 1PEDA 4MGEA 4PC7A 2AFRA 5KTMA 2MINB 1I4OA 1P0CA 2DBVO 1FQWA 1U9IA 3K5WA 621PA 4US2R 1J0AA 4R2HA 3TLCA 3WC4A 5L4SA 4A0GA 2I62A 4KMOA 3RVLA 1YH3A 4EFKA 1IQ0A 2FLWA 2A57A 4WLEA 4HMQA 3SZUA 1QVRA 3V7YA 4ZAYA 4HDSB 4XVQA 2YJZA 2GEBA 1UFVA 2A7QA 4MMXB 3OC0A 4WZ6A 2NUPB 4NIMA 4XYBA 4OP3A 4RKFA 5TT0A 2O2IA 1TAUA 3L0SA 3WK5A 2VP6A 1QZUA 4JP2A 1TCAA 1SOWA 1C2YA 2DR3A 3O8DA 2YFYA 4LDZA 5E2AA 4YREA 3ROZA 4AS2A 3QHAA 5BSMA 4F9GA 3W5AA 4EEXA 4Z2AA 2J85A 3WL6A 4CDNA 4L07A 5E7JA 1IM5A 2WG2A 3HU3A 5AW9A 3FCXA 3T6KA 1OVGA 1DQSA 2PH5A 3K6RA 3MLAA 4ZREA 3BB1A 1EFVA 2X14A 4MQ5A 4KP7A 4V1CB 2QSJA 2HU8A 2AJBA 3UT5B 3CVXA 3OZVA 4NMMA 3T3HA 1ULAA 2HTEA 1AUXA 3FDFA 4FYKA 4EWLA 4KNYA 3B2EA 1K2VN 2ERXA 1Q1BA 4OK3A 3U7RA 5K3OA 3FOFC 4BCDA 4E1VA 4TN5A 3UJPA 4M7OA 2BE7A 3OEWA 5U9CA 4XGIA 2ZPAA 4QIHA 2CEAA 1IG3A 5IJXA 5JLJA 3IHWA 4UNRA 4DMFA 1NUSA 1OBOA 2AQ8A 2B4AA 2D4AA 4D8UA 2ZIEA 3GI1A 4GBMA 1NMYA 1VCNA 5FPQA 3AGPA 3W4JA 4YV7A 3RG8A 1HEIA 3CJRA 1T8YA 5A4MS 2FEPA 3JX9A 1WZNA 5FV4A 1GNVA 1KZGB 4P32A 4B8ZA 2PN1A 3KUDA 1P6QA 4JLAA 3DAPA 3AVUA 3RTEA 4PM4A 1VSUA 2LPMA 4O1HA 2NTEA 1OLUB 1YS1X 2XE4A 5ERYA 4WAUA 2WUEA 1ACMA 3AUUA 5DLQC 3U5TA 1JJBA 3CBGA 3CG0A 3DE6X 4D9MA 2C4KA 2JHAA 4E7PA 1PW5A 1FNNA 2P9FA 3SHTA 3VISA 4OA8A 3WRVA 1H6AA 2G04A 5AK5A 5DFAA 4LPSA 7AT1A 1DEHA 3NHJA 4PU0A 4XJSA 2GM4A 3ICEA 1TD9A 5JY1A 1GTMA 3IEIA 1XZ8A 1VI2A 4ZO6A 3SS8A 4K0RA 2NN3C 1SVUA 4NZMA 4PONA 4KPFC 4EO9A 1Q1AA 3AINA 4P4SB 4Z4QA 4H31A 3EYAA 4QICA 3UPUA 5T3UA 1L6IA 2Q1YA 4A2PA 3EVAA 3LVFO 3W77A 1WUIS 1JQJC 4DJTA 1YDEA 3O1JC 3QY9A 5FLYA 4DG8A 2DWUA 3DOOA 4HNSA 2QVZX 2MDTA 4O5OA 5I9MA 4Y2QA 3IJ5A 2RKOA 2EX4A 3N1UA 5DASA 4UXIA 2OD7A 2XNKA 4CIVA 5BMVA 2ADOA 4D4IA 2OWDA 2H1LA 4BKMA 4ENWA 1IZ8A 1YACA 1YJ5A 3GPCA 3N3BC 1JR3D 2BMWA 3IX7A 3QKTA 1K6EA 1ZU4A 4ZC1A 1NQWA 3ZC3A 5K8VA 3ZYCA 3R9XA 1EBUA 3LHDA 3Q98A 5DCLA 4LI0A 4F1KA 3F90A 1B1CA 2R7KA 3ZBTA 4TV9F 4F2PA 2G70A 4RQUA 2VNIA 3D4OA 3HJAA 3LRTA 5DNWA 4ZVTA 5JY6A 1Q0PA 2W4QA 1J8DA 2C95A 1E9AA 2OBXA 2QGZA 5DJ5A 3NM6B 4JYZA 5B58T 5F7JA 1QTRA 4X8HA 3OLQA 4DM7A 1C8VB 3QY0A 2ODWA 4JLVA 1DCKA 1U7TA 1C1DA 5GJWC 4PSUA 4XOUA 2QU8A 4EFLA 1RKQA 1NQUA 4XJXA 4UVHA 2NUTB 1J70A 4UM5A 4ZAGA 3IEUA 4LZAA 2WJWA 2HA3A 2AIRA 2Q6LA 5AI6A 4GPBA 1D2NA 4RSRA 1M9NA 3VC2A 2XUGA 4OY3A 4IUCS 1SD1A 3S27A 1HETA 3OZAA 1UBEA 2BBSA 1J2JA 4PZ0A 3A4IA 1A9ZA 1DKMA 1J9EA 3D8BA 3S8YA 4QSMA 2A0XA 1CJBA 1T1JA 2TMDA 3T7KA 1BHO1 5K0FA 4MV5A 4KFSA 1SVNA 3DA8A 2IYAA 2GVZC 1E5VA 2I6GA 1RAIA 1MABA 2R00C 1TA0A 1N57A 2JFUA 2P67A 4KO4S 3WYCA 4DQUA 5JNUA 3GELA 1U3TA 3SJCA 2V7VA 2ZJAA 1ONNA 4HUQA 3SI7A 1DAPA 2XRZA 4H6WA 1KYTA 2CK3A 5HCIA 5E6RB 5BOSA 3NDBB 2J31A 4LBVA 1NC1A 1OT5A 3RYIB 3GGDA 4HGRA 4U1RA 4YDQA 1KFEB 4EI2A 5EP2A 5AW7A 5ALIA 1OXSC 2WYWA 4EJFA 4O4IB 3UH1A 5LWHA 1P5HA 3L4EA 3TW4A 1ECCA 2DCMA 2PJUA 4G0XA 4DC1A 3A1NA 2WIFA 4X93A 4XXHA 4MUNA 3G5MA 3RYHA 5EHXA 1U2EA 2FJPA 3WA6A 4PAQA 1E2HA 1XZHA 2XUJA 3SXUB 3U3RA 1SCKA 3KXKA 3CNHA 3L8MA 4G5FA 4MCJA 3UWMA 1D0VA 3M34A 2JHPA 3IQHX 3D7NA 5I8WA 4CMEA 1V1RB 5LOVB 3WMXA 3KLPX 3NUQA 1KU6A 5JVDF 1SKYB 1IH8A 1CJVC 4U0JA 4Z3KA 4BAUA 1YIOA 5AW1A 2FEMA 2CEKA 2HIMA 3B2QA 3IEXA 2C57A 2V7PA 1EFDN 3SSNA 2XUZA 4G37A 1TEVA 3TD6A 1BO6A 2P40A 3FRJA 3N0WA 4HLCA 3DZJA 4ZCQA 2CHVA 4MRVA 5SY4A 2Q5JA 4TMWA 2I87A 3JD3A 1U04A 2NU7A 4IP0A 5CVCA 3QELA 5IBRA 2GCOA 4RH0A 1EFPB 4F46A 1Q0QA 3UCXA 4IHJA 2UVDA 3I37X 1J97A 1VBFA 2GVDC 4W1RA 2ZP1A 2I65A 1CQJB 4G1UC 2YKGA 4HTFA 5DP2A 1A0OA 1EVQA 1IE3A 5BRAA 5HKKD 4OX9B 3KL4A 1LXCA 4O3MA 2OSVA 4X63A 2RHOA 5KOJB 3KYDB 3U3JA 4ECEA 1SULA 2FG7C 1P1JA 3HY3A 3IE0A 5KOIA 2FDCA 1W85A 1MVLA 2IP2A 1XU4A 3ED1A 2H7XA 3G68A 3KOMA 2QM7A 4OYRA 4YT8A 5I45A 1WZIA 2F3QA 2HF9A 2XAAA 3H6KA 4QFBA 2IELA 3ZNOA 4ALMA 1GGVA 2JGLA 1C14A 5I47A 4QFDA 4E88A 5EFOA 2GZSA 2QLBA 4DADA 1EXNA 2V7GA 3PUIA 4NE9A 4DE5A 3EPJA 3JWIA 4RA9B 5ECYA 3SYTA 3G2NA 3TLMA 3FMGA 1GNQA 2OKGA 2HK7A 3OSZA 4P98A 3IUEA 5I9NA 1A2KC 2VZ9A 1TQ2A 4D3DA 4DV4B 3LT1A 2WU8A 2W48A 4YIKA 5FO1A 4WCFB 1ZCAA 3HKDB 5DOVA 3TCKA 4CMBA 2E4WA 1P60A 3AY0A 1QVWA 5HKBA 4S35A 2DLCX 1YK0A 3VKVA 5HIJA 4UTRA 1HDOA 4KYVA 4LVCA 3WTBA 4F9TA 1BWRA 3O83A 4KH0A 5I7SA 3T3PB 3FTEA 3OZTA 4C2BA 3ICQB 4N5HX 5DMXA 4YBZA 1HE5A 3AUFA 2ZJ1A 1RRCA 1FDOA 4N48A 2FYTA 2Q0HA 2Z5GA 1D4OA 3Q40A 5JAOA 2XZPA 3HKBA 4BEVA 1FVFA 2ZBRA 4U9IS 1VLZA 4I81A 1OF1A 1LX6A 4BJ5A 2Z8XA 2DPYA 3KJQA 2OBMA 4YCMA 2H18A 4C89A 5K4HA 1NRWA 3IXLA 3HDTA 2QR3A 2Q0SA 1FLNA 4CEHB 1HDYA 3UMGA 3V8EA 1AKVA 3PRYA 2UV8A 3FY4A 5EYPB 1PG0A