5C35A

Constitutively active sin recombinase cataltyic domain - t77ii100t/q115r
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
124
structure length
124
Chain Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKQSGKSIENRPILQKALNFVEMGDRFIVESIDRLGRNYNEVIHIVNYLKDKEVQLMITSLPMMNEVTGNPLLDKFMKDLIIRILAMVSEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of a molecular swivel in action
doi rcsb
source organism Staphylococcus aureus
molecule tags Recombination
molecule keywords Recombinase Sin
total genus 40
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c35A00
2MHCA 3ILXA 2RSLA 2GM5A 3BVPA 3GUVA 3UJ3X 3G13A 1GDTA 5C35A 5C31A 1ZR2A 3LHKA 3LHFA 1HX7A 2GM4A 5C32A 5C34B 4BQQA 1ZR4A 1GHTA 2R0QC 3PKZA
chains in the Genus database with same CATH superfamily
4OBXA 1KOLA 1RQ7A 3TW6A 2D2VA 4LIPD 4D3ZA 1Z6TA 3AIOA 2J4FA 3PNPA 2JAPA 3K16A 1L1FA 5JD6A 2AF4C 4TT8A 2Q2QA 3EGWA 4JYPA 2Q5OA 1YRLA 4URXR 2P77A 4M2LA 4B4WA 3TSCA 2CMDA 1RYBA 4RJIA 2IPAB 3OZDA 1JJVA 2XQFA 1W6RA 3JZIA 2HH9A 3UH0A 3EBPA 1WCWA 4PQRA 4U7HA 4ER5A 5DTJA 3RREA 1CJVC 3SS8A 4K40A 1JQBA 4Y7DA 5IJ9A 1Q3KA 4DE5A 1DAMA 1HEYA 3H1EA 4ZCQA 2RHHA 4J1QA 1Y9ZA 3V97A 1QYXA 1YSCA 4J43A 1BQ3A 3MQ4A 4FXPA 2QPAA 2RAUA 1GEEA 4FK8A 3WGMA 2X2PA 4O3FA 2G40A 1Y7LA 2WAXA 1C3EA 1D4AA 2O6HA 2O2ZA 3EXHB 3GZNB 2QU8A 3LCRA 5CJJA 1OIVA 4G4SO 4GPZA 2UXBB 4HWPA 5J63A 1PW5A 1KIMA 4JYZA 1R66A 1VL5A 4YECA 3RTDA 3U3XA 4TMKA 2GBFA 4D43A 4Z4QA 1ST2A 2B92A 2TMGA 3LDAA 3MCUA 4L02A 5J1TB 1ZO8A 3OOSA 1QPZA 2C7GA 4U8HA 2GFHA 5ALXA 1NHGA 3OOHA 3LUHA 4US0R 4W6QA 4UUQA 3UWMA 1N5DA 5BR1A 1HORA 4TYYA 1GPH1 3A6JA 4BQQA 4V1CI 3EBOA 1XDWA 4AY3A 3PWTA 2O8EB 1NR7A 4L8YA 3VVCA 1KZGB 3A14A 3UK0A 5H9WA 4G97A 5FQOA 3MUEA 2O8DB 3CISA 3GA0A 1M9NA 4AXXA 4PYJA 5BRAA 5BN4A 2B2CA 2RC6A 3OZEA 3CIOA 1SELA 5BN5A 1ES9A 1OAKA 4LMAA 3UHJA 1IM8A 3QVWA 2D4HA 3MOIA 4JYCA 3ZWNA 2FN3A 1CQXA 2WPDD 2J1LA 2FXIA 5HKKA 5C31A 1OBCA 4FKBA 2XSZA 1EX7A 4QUGA 3AR9A 4CW7A 3JYQA 1O5IA 4TGLA 2BOVA 1HZJA 1QOPB 4EFKA 3HC7A 3NM4A 4HS9A 3HY3A 2HAEA 4K9OA 4BZXA 3CX4A 4I5GA 1TKRA 3B6ZA 4HO1X 5KDLA 4ZVTA 5KKAA 3TEJA 1VPDA 3JARB 3X2FA 3FMFA 4K9RA 1ULAA 4WCFC 1NVFA 1TJ5A 4NBTA 2W42A 2CKDA 2ZJ5A 5AI6A 2C7PA 1PO7A 4QPDA 3I4FA 5E9WA 2ZT5A 3GJ0A 1U8EA 3FYUC 2YRFA 2IF2A 2IPOA 1D1TA 4BX3A 1F5NA 2HHAA 4OK3A 4RF2A 3WLSA 4IQGA 2O8BA 4UDNA 5H02A 3HDVA 3KYDB 3DBRA 1MV5A 1OAOA 2XA1A 3C8MA 3I28A 4D6YA 1JZTA 3HUUA 4YDHB 3ZGZA 2VA9A 3NC0C 3OKPA 1YIDA 1SVNA 4LDQA 2FMFA 4JWTA 4OIMA 4REQB 5H4GA 3GD7A 4A0SA 1REQB 4EAQA 4V1CB 4CMGA 1JAIA 4Q03A 4Q4AA 5KNDD 1NVEA 1CR2A 4PG4A 3EFEA 5FFNA 2WUDA 5FDFA 4QGSA 2E49A 4OCZA 3GRKA 1DBQA 4DA4A 2WJAA 4LS3A 2GHQA 4TSFD 4RMIA 5FQNA 4C21A 2C2GA 4H18A 4EB6A 1TM4E 5FO1A 3REQB 3VR5A 1LKZA 3USES 2D4AA 2EQAA 3OU2A 1HE2A 1X15A 3UF0A 2I80A 4JDPA 1LJUA 5IP5A 3CSUA 4K3UA 4QRIA 5IANA 2B20A 1LPPA 2RIPA 4S2EA 4WACA 3FBWA 3WLJA 2FHPA 3RVBA 1QYWA 1M6WA 3S2GA 4HPJB 5AW0A 3VV2A 2PH3A 4OMFG 2W43A 1G60A 3G2MA 3Q1LA 4YCCA 3VR3D 2M1ZA 1C1DB 2QS9A 3EIOA 5IAKA 1DTSA 5JNWA 1UMKA 5C51B 3S40A 2GH1A 1QRTA 2A3RA 2IHBA 1QOZA 1E4EB 1TJ4A 2JFPA 1M1YA 2Q3LA 4HZGA 5FP0A 3IVMA 3RIGA 1YE5A 4BNXA 4D97A 1ZJWA 1MKYA 1G7CA 3P9RA 1D0SA 1BJTA 1KBZA 2OHXA 3L6OO 3SU8A 2JFOA 3PGMA 2WWVD 2V0GA 4UAJA 4X85A 1JVNA 2P5YA 1XZQA 5I01A 4RACA 4B6EA 4HWOA 3E1SA 3FVVA 1PR0A 2IYTA 1Z16A 1VBFA 3NHBA 1CY7A 4ZI7F 5FTLA 2ZIWB 1ODJA 4O2AA 2FPWA 5DIFA 3LCCA 2P8JA 2O8CA 1J20A 4JB8A 4MVJE 2PHZA 1P1HA 4WCVA 4Y67A 4QAJA 4I7EA 3WK5A 1O94A 2XMRA 3OBIA 3WFIA 4QTTB 4DDMA 5JWRA 1JI3A 4V02A 4KP7A 2OXIA 3OPNA 5TGZA 3QVKA 1G4AE 4MLCA 2OHVA 1VBMA 4DVGA 1FY2A 2PXAA 1A9YA 5AVKA 1SXJC 3FDXA 3IBCA 4YRLA 1QLWA 3HYTA 4WLVA 1BNCA 1F4PA 1X1CA 1JPNA 4KXMA 1UEJA 1P0MA 1GTG1 1W87A 1XRQA 1WR8A 2BGUA 2EJWA 3OOEA 4CKWB 2VDRB 2PWAA 5B1EA 1CZLA 1BEEA 1X7XA 4N0PA 5GJWC 4BAZA 1NRJB 5TMBA 1CXZA 4DIFA 2BR4A 1J90A 2VDPB 4OFWA 3CX3A 2ECFA 4HH1A 1H9CA 4J0EA 1JQJC 2YN0A 5CXSA 1Q0HA 3QQPA 2GEVA 3RUIA 4PPGA 2RJOA 4HLDA 4MEJA 4EPYA 3CRNA 1ZN9A 4HN9A 1Y4ZA 4DBLE 2KHZA 5JR3A 4EY6A 5J3JA 4BPBA 3TQHA 1BXKA 2DJIA 2KLBA 2RGNC 1E96A 1GPJA 2C84A 3A11A 1ISRA 3B9PA 3H6HA 1IBSA 1XRPA 2RGBA 4DW8A 3BN3A 4XVRA 1VIYA 2DPLA 1A5BB 4BQIA 3VFDA 3VYTB 3ZE7A 3M6MD 2XJ9A 5IAEA 2H2WA 3OHMA 5CAEB 2OPBA 2CBXA 2MT9A 4F46A 1BDIA 4NRDA 4K0KB 3BCUA 3DD5A 3GYGA 4CM4B 5BXQC 4CR6A 5GIOE 2OGUA 1KPIA 4M1OA 2EJTA 1WXDA 1SFRA 5FI1B 5IJ9B 3ZGXA 5DHSA 4LV6A 1RQXA 2RGWA 3JD3A 5LQNA 3N8GA 5D2CA 5JFGA 3PCTA 1PUJA 2FDCA 4HDRB 1JIQA 1T5SA 4JI0B 3QVVA 5EMLA 1JA9A 4HOYA 5JSFA 5IT9A 2G3YA 5C4GB 4DCTA 4PXYA 2XODA 3WRYA 4MV0A 5ICFA 1FEZA 1Q0RA 3EGXB 4QELA 1U81A 2ES4A 2OO3A 3PP8A 4PYLA 2BM9A 2NACA 3RYFB 5DHQA 4GQBA 4G5GA 2I6SA 1XJ0A 1E3EA 5CNIA 1IXRC 2CHEA 1US8B 3MTJA 4NZMA 2P4SA 4QTYA 2ECPA 1DRKA 1OSNA 1V4BA 4PAQA 2PX5A 1PR1A 1RPAA 1L9KA 5JZBA 4GWKA 2OD9A 1UM9B 1H6BA 1VCOA 1HX7A 1U0EA 3S5UA 5FPQA 4A91A 4BLRA 3KLPX 4I9FA 3DZDA 4KX5A 1NUTA 2FMKA 1I0IA 3OEHD 2AHRA 4JENA 1XTZA 1HT3A 3Q1KA 3ZWBA 2VH1A 2AYXA 2VHQA 4BMVA 4ZXFA 3IR6A 3E18A 3TRFA 2ZB2A 4XVUA 1EDOA 4N8SA 4OMCA 1UIMA 2UVDA 2ZETA 4TSFA 1RSZA 2LV8A 1FSPA 5BMVB 3BCHA 4M1ZA 4OF4A 3TK1A 2FPGB 3PFWO 3EFBA 1JRLA 2RHWA 1NV9A 3EVTA 1JHMA 2IOHA 3U9LA 4FMDB 2FPXA 3L4KA 3PFNA 3TDKA 2J41A 3HR7A 1VECA 4WJZA 5BMOA 3K6SB 4KRYA 3QWBA 5K8TA 4US1R 3L93A 5L7TA 1ZFNA 1U9ZA 2EJVA 1PG2A 1X1EA 1T3LA 2FV8A 2VHXA 2FF5A 4INPA 3HNOA 4UBJA 5ITZB 3P2EA 2ONJA 3TECE 1R4NB 2WTMA 4IWNA 2X4LA 4WXPA 1DG9A 1Z4NA 4JFAA 1ND5A 3F98A 1EINA 1MOPA 2H5JA 3L40A 3VPSA 2FQWA 3STVA 1NIJA 4MGZR 5DTMA 3FCSB 4J4BA 2C8LA 1V7CA 2Q9AA 5AKJA 1IHDA 5HZHA 3A10A 4RORA 4PICA 4V24A 1URPA 4ACAA 4BMYA 4BNYA 2O2XA 2R85A 1E99A 1V35A 2RH4A 1BU8A 1P7VA 2QB5A 1B1CA 3GIWA 5KVSA 2IC5A 2RARA 4O1MA 3UB2A 4X3CA 2GESA 3R5TA 2LBPA 2YW9A 1A8UA 3CXUA 3O90A 3KQNA 3RFUA 2EFYA 1JIXA 3NT4A 4G65A 5BVGB 3DM9B 3GGPA 3L1VA 3EMDA 1DARA 1MPXA 2GPBA 4TTSA 4FNAA 3RKRA 3RIYA 4TN1A 1L1QA 3OZ7A 3Q3GE 1VKOA 5EE9A 1K3TA 2WJVA 2XB4A 3SHWA 5CB4B 4OATA 1Y6GA 4LJKA 5EZYF 1T26A 1X1SA 4HDQB 5F2KA 1IUKA 2IU3A 3S55A 4B6GA 1IAVA 2BEKA 1SKUA 5CVCA 3TGLA 1F12A 3FLEA 4ZQGA 1XZNA 1KO7A 4L3OA 1LI7A 4WPGA 1NN3A 2IYYA 3GUCA 1HETA 1RNLA 4JJ7A 1JSCA 1T2DA 1CVIA 2Z3ZA 4J0CA 4QPPA 5TT1A 3MCTA 1GGEA 3CLTD 3I76A 3WA7A 3OZRA 4UXJA 4X8HA 5HWSA 1UK6A 1ZNQO 2ZWMA 5AXAA 4ER6A 4ZO6A 4PBRA 5A6SB 4ZQIA 3V1NA 4YQFA 4R4JA 1VPLA 3EZXA 3FI0A 1T9ZA 1A2BA 4QOJA 1FNBA 4DV1B 1V48A 3QQ5A 1O9GA 3EUFA 4XI9A 5K2OA 1EP2B 3C43A 3SM3A 2GBIA 1MNAA 4C2AA 1JPUA 2JLSA 2K87A 3E22B 3RBVA 4QGBA 5IAJA 2CHGA 2C4WA 2W2LA 4XYBA 2DETA 3CF0A 4E94A 1Z6ZA 3PUVA 3P2JA 1QU3A 1OFVA 3E7WA 1RRVA 3F8SA 4N5LA 3D5EA 1MJ5A 2B69A 5JIBA 1Y3IA 5BVHB 4RJLA 1GG8A 3OLYA 1YKGA 3KWLA 4KAAA 2P2YA 3KRTA 1XTIA 2ACWA 4RDIA 1JEYA 2Y68A 4LZAA 3KHKA 1NFRA 4MCHA 4RESA 3WRWA 3AVXA 1VHQA 3PX3A 2B4QA 3H0EA 4YEDA 2O8FB 1SG6A 2B21A 4TXJA 3ACCA 4DG9A 4HB4A 4UVIA 5BN3B 4FJ1A 4QEZA 2IX9A 2JIZD 3W2FA 4BEVA 3TLYA 4RPKA 1E4OA 1YGPA 3VPDA 1ILEA 1XUOA 5CXXA 4NBSA 1YE3A 1J49A 3K9NA 4TXLA 5FI3A 3SZOA 1Y98A 4MJXA 3L0PA 4U6QA 4C20A 2VZ8A 4XRGA 1LNQA 2XMZA 3AF0A 4JU8A 1PKXA 3SIRA 1XELA 1QV7A 5IT0A 2GR9A 4OLFA 4RHTA 1KC3A 1V1JA 1E5DA 1DC6A 5JVDF 1HWYA 4KPYA 1VLZA 2PL1A 1Q77A 1Z4QA 2X13A 1P4HA 3D3KA 3RUFA 5E6SA 3T34A 5IWAB 2J9GA 2NYAA 5TQVA 1CJMA 1DEKA 1XK6A 4PCVA 3PWZA 4YCNA 4ABTA 2FN4A 3E5RA 3EW9A 3HHPA 1TTHA 1KTIA 5DHAA 4LXHA 1N7JA 3OQ1A 5AJUA 5TVGA 1T8WA 1RXEA 2PZBA 1G64A 1GLNA 3FUCA 2PKQO 2C9BA 3EMKA 5KCMA 4CQJA 1Y7IA 4LOHA 5LKRA 2QG4A 2HU8A 2JI8A 2VH5R 1F14A 2B1IA 1JSZA 1PWXA 3BVPA 1UKBA 1MT3A 1HEIA 3JAKB 1M0EA 1LDEA 2YMQA 4QM7A 1YU6A 1P9OA 4JA2A 1RQGA 4NBUA 1LU9A 4QPNA 4WLNA 1NI5A 1XZDA 4KE6A 3I2FA 1T1EA 1Y9DA 3KQMA 4PINA 1E63A 4LHXA 1JBKA 1WMBA 4F21A 3ZEIA 4HXEB 2G5PA 2H9YA 4ZEWA 5LMNB 1UFOA 5FUYA 5F73A 2CLEB 2ZJFA 5EJ8A 2XKKA 2H5EA 3DZIA 3EEOA 3BMCB 2CD9A 5I7VA 4CQMA 3L43A 2OP1A 2JGMA 1OD6A 5CK4A 1V37A 2DC1A 2E87A 1H22A 2M2IA 3QFFA 1JN0A 4JLAA 3I8OA 4RXUA 2JJYA 2W6JA 4PN3A 1OB5A 4KQIA 4JI7B 5AM2A 1KPHA 1WD5A 5DX8A 1HDYA 4IYJA 1A0OA 1LK5A 2C8JA 3CFYA 4HL6A 2X6RA 4UAUA 1Z75A 2J3DA 3WGOA 2UZ3A 1GZVA 4ZI5A 4BNHA 1SQSA 3R3SA 4EARA 1WNFA 2AR9A 1BH2A 5JATA 3W6OA 2CXHA 3DDUA 3T06B 1J8FA 4DB2A 2VYFA 4Z51A 4TV8A 3OTQA 2CLLB 3NAQA 16PKA 3VC7A 2KM1A 1LW7A 3A9TA 5DULA 2I4TA 3EN0A 4HAUA 4MZXA 2VTBB 4DKJA 2YJ3A 1CB7A 4AAYA 4G4GA 5TIIA 1P31A 3OZBA 1ISGA 2RGYA 2GFQA 1HEUA 1H05A 1YS7A 5LL6P 4OL9A 1UJNA 1JQDA 1MIOA 1HC7A 1Z5WA 1W25A 1C3VA 1T29A 4FZJA 2PUFA 1VB3A 4Y9DA 2IXFA 1K63A 2UAGA 3WJAA 3W5IA 1KP2A 2DTDA 3PQ7A 3IS3A 2Q28A 2GWRA 5TJ9A 3OAAA 1UBLS 1UQUA 1NW5A 1ZAKA 3R3VA 3FBGA 3CVWA 1RWMA 3OE5A 5C1PA 1YCHA 4PC7A 4EKYA 4YI3A 2EGUA 2ZSHA 4ZZ1A 2IY8A 3SFZA 2ZYAA 1QE0A 1QLJA 4EKIA 2M1XA 3DOIA 2ECQA 1EVKA 2MWMA 3EA4A 1ZVKA 1TA0A 3H17A 3T7AA 3ED5A 1GDDA 2FPGA 4NU0A 2RFLA 2CNNA 5L3SA 1DRVA 1E3QA 3OTOB 4OLBA 2QRVA 3ETGA 3R9WA 1Q95A 1LD3A 2HT1A 2JLQA 4JUFA 3EAGA 2VYNA 3MWLA 5F76A 4DMFA 1WLSA 3W77A 5DNYB 2L2QA 4XSHA 1J1ZA 2NO5A 2G80A 1DAOA 1X7YB 2D0OB 3DMDA 3G79A 4HQNA 1HFJA 4IDEA 3U80A 4BB9A 1T5HX 3CZQA 2BISA 4BO3A 4FDLA 1WZUA 4FFRA 3FMGA 5JPIA 1E2IA 3UCEA 5KQMA 1CB0A 1CQPA 4A0RA 1N6LA 1ZVQA 3I34X 2PX2A 4N4AA 4A16A 4R3WA 5FTKA 1EFLA 3SMQA 3BREA 2YYSA 3NVMB 3UAWA 3KETA 4J0HA 1QO7A 3R9XB 3UAZA 1NXPA 2XUQA 2C88A 4GE3A 3ET5A 4MW1A 4EJMA 3I3SR 4WLEA 4TRRA 4DIDA 4GKJB 4RTMA 2FSHA 1O54A 1X80A 2ACKA 3IT0A 1YQTA 3OZGA 5ALEA 3HVRA 1I0LA 2R6HA 5K0LA 2HF8A 2E1PA 4I81A 3WLIA 3SS7X 3WOVA 3N0VA 4HYYA 5CLQA 3PC3A 4XM1A 2VNAA 5EL0A 3HYRA 3LX5A 3VJMA 1QC5A 3THXB 4WKCA 3VR5H 2F3UA 1UJMA 3I45A 3BFKA 3CLTC 4ZU3A 1IULA 1EWKA 3GPBA 1JDSA 4FOLA 3ZR4B 1P81A 4IJMA 2ABWA 2YUTA 5DHTA 4KN5A 2HEGA 2CBZA 3OSZA 4ONEA 3TTYA 1P5JA 3IOYA 4UNPA 3KVVA 3SVTA 5T6MA 5CYGA 3LFTA 2YVAA 2QSJA 4QJ5A 1H8EA 1UKZA 2R5NA 3IMFA 3AINA 3ZV3A 4HFNA 5ESWA 1YV9A 2X9NA 1Z73A 1ABEA 1DQSA 1ISJA 3LYLA 1B23P 2PKYX 3DL0A 4HNSA 4R05A 3WYBA 4QGGA 2UXDB 3V46A 2PGNA 2OGSA 1IUPA 1P2VA 2I2XB 3KVRA 3LXMA 3QMPA 4MUNA 1F1JA 3BTUA 2YC2C 3NG1A 4KXLA 2O0MA 4AJOA 4CDNA 4WZZA 4HRVA 5F7OA 2IEGA 2PRIA 1MIOB 3EWAA 4PLTA 1HNNA 4UC0A 4WBSA 2VUHB 3BHIA 5JISA 1XZAA 1U2PA 2V6MA 1S8OA 3FZQA 1SBQA 5CBPA 4AKIA 1FFXB 4UTZA 3S1SA 1DTEA 3LDHA 1GV0A 2O50A 1RABA 2P68A 4RL4A 4ZA2A 4EAAA 5BW8A 3LL4A 1TRKA 1CHNA 1FJ2A 1PFGA 2O5VA 3FZEA 4Y2YA 4D5GA 1PQWA 3VJRA 1TAHA 1BEUB 3I12A 3A3KA 4ZOEA 3CZPA 2CXQA 3RVNA 2QBYA 1BDJA 1OX4A 1FNCA 3E70C 3FPEA 1ULHA 1L5HA 1FU7A 4ZCMA 5LD2B 1KY2A 3FYTA 1SXJA 4IHJB 4W1QA 1N4AA 1IY1A 3R75A 1YFJA 3IQDB 3UJ3X 1W0JD 5F51A 2IYVA 4FVTA 1IVNA 4X00A 6NULA 5AVVA 5JI2E 1SKAA 1P3Y1 4R1PA 5T4HA 5JDIC 5K4HA 2O8NA 1XEWY 3PEFA 1GGMA 1MH1A 5CA1B 5IUJC 1Q83A 1LRKA 4IOKA 5CLFA 1C50A 4IVPA 5ARDA 4EBFA 5C2JB 1R74A 1X87A 4J03A 4E5VA 3KE8A 4IDAA 5UKDA 1B41A 4ESHA 4EFLA 4H0NA 4OMDA 1IZ9A 3KB2A 1T25A 1P1CA 3U4CA 4OSEA 2P0YA 4P5DA 5DE3A 3VX3A 4INOA 1E2MA 3TMAA 2EQBA 3W8RA 2XPCA 2VYVD 3E23A 5EUQB 4A2PA 5SZHB 1AS0A 3H2KA 1IRXA 1K86A 2A0FA 1CR6A 2ID4A 1Q7GA 2Y2UA 2P2SA 3L02A 2HDOA 2QZ4A 3P4XA 1ZGBA 2FZWA 4NAVA 5EPOA 2EF0A 4BMZA 3VNAA 4CV1A 4EQ6A 3LX8A 1Y33E 2O23A 2D1SA 3IAM6 1I0ZA 1MB9A 3K5WA 4BAGA 5HYVA 2G17A 1A5ZA 4G0NA 2RMKA 3SD7A 4EPTA 1U90A 3FSGA 3U7JA 5FR1A 3CBGA 3W7BA 2JLBA 1RKXA 3MQFA 2FWAA 4OQFA 2JJQA 1L5RA 4A0QA 1MXFA 1PEKE 1T15A 3V42A 5JQGF 1XNQB 1SU6A 1F8UA 2DAPA 3D31A 4U8GA 5JZSA 5CA0B 2EWMA 4HF7A 3RF7A 1XNGA 2QP3A 3M83A 1EAYA 1RZRD 1APBA 4Q02A 4HAVA 5JRJA 1K8QA 4C0WA 3D3WB 4XJVA 4R0MA 4YV0A 3D5QA 3VVBA 3BGWA 4CXMA 1XYVA 3W9SA 1IB0A 1G2QA 2IIQA 1XPOA 4G6ZA 2OYSA 5L40A 4HC4A 1FMLA 1WXHA 2I55A 2R7AA 1VLVA 2EEZA 3JVVA 5I7FA 5KX5F 2EKDA 3ZJYA 1J9GA 1DJNA 1ECPA 3M6WA 2FRXA 3ODPA 3QUAA 4G5XA 4GM4A 1C9MA 4LYFA 4CFZA 3SAJA 2H9IA 1WB9A 1YULA 1X39A 1EVJA 4ZHQB 3ZHBA 2WU1A 1QIHA 3AEQA 3WMFA 1OLUA 2F90A 2ZU6A 3KJFA 1L0BA 3H1GA 3RS3A 3DWEX 4L8GA 1T91A 2OLJA 4JBYA 2I7TA 2HCTA 3ICOA 1MC5A 1IVYA 1NVWQ 1SNYA 1TF7A 2BHSA 3OF2A 3UM9A 4D8WA 5EIBC 4YPVA 4CKEB 1I5RA 5JMTA 2CNWD 2G4VA 3ND5A 1QK4A 4B33A 3D59A 1H4QA 3VMMA 1TDJA 1Z0ZA 2C7RA 1B3RA 1YBAA 3FNRA 3N3BC 1VMDA 3HMKA 3PXUA 3IV6A 4L74A 2ENWA 4NOKA 4EKDA 1P6QA 4KPUB 5KEIA 1GO2A 2QY6A 3N2IA 4YJDA 2BHLA 1N6RA 2GBCA 2QWXA 1UXOA 4FYHA 3RVRA 3EGVA 13PKA 3F49S 4TL6A 1ZG3A 4WZAB 3SJCA 3UMRA 3W5UA 4YR9A 5MFPA 3AVVA 4UKDA 5ALUA 2YJNA 1WCXA 3GL9A 4PZ0A 4DMCA 1ONPA 5A4KA 1DEAA 2FW7A 3PGVA 2HRQA 4ND2A 4Q5IA 4X8LA 4AZ3A 1D9ZA 3V4VB 5IUNC 5FWXB 5A9SA 4PNPA 2W6MA 3AX6A 1P5RA 2ZUUA 2JZCA 3F3SA 1NFQA 2Z1MA 1GN8A 4IH4A 2GVNA 3COWA 3ROPA 1AQIA 4PLFA 3CZAA 5EJAA 3OQMA 3BDIA 4ZKEA 2OYCA 1IRIA 2YMMA 3SK0A 3R0IA 2QRGA 3A6KA 1OZFA 1JECA 4YMWA 5C8YF 2J5QA 1FUEA 4IDOA 4WGFA 1IOZA 3DO5A 5T4FA 3M6VA 3MWJA 2PH1A 3Q9SA 3DPSA 4JP5A 1IN7A 1RWNA 2CVOA 2W00A 1LDGA 1E59A 4FWTA 3MGKA 4IEIA 3PE3A 4KR9A 3VHQA 2ODAA 3NWBA 5JT1A 4WZAE 5CIYA 4LFAB 4EYGA 4D74A 4S1NA 1FW8A 3WDMA 2NVUA 2QTWB 2JG3A 1L4LA 1SK9A 1KZ4A 1RPTA 3L4JA 1PW7A 3TBHA 2ZR9A 3MQ2A 3NM6B 5DGTA 3RC9A 1N8SA 3P2IA 2PY6A 1FFSA 4V0SA 1FXWF 3ZY6A 4DNPA 4EW1A 3QPBA 3MTAA 5LZ8A 1E3WA 4OYYA 1KHTA 2EF1A 3WMXA 1G6Q1 1LV8A 2VDVE 2QUKA 5KOJB 3N7TA 1RMYA 1SKYE 1SIUA 5AI9A 2ZIZA 4GO1A 4MYTA 5DN6A 2ZQZA 2MSDB 4DSUA 5I7OA 2ZKIA 1JH8A 3KSRA 1Z6XA 4J0JA 1U0OC 2G72A 2GZRA 1F0PA 1W4AA 5I9MA 6ABPA 3FPBA 4X65B 1FA9A 3KLOA 5ER9A 1R0ZA 2SKCA 2GUGA 3BXGA 1FS5A 1Z4IA 1C0EA 2YXPX 3AMVA 3KKLA 1AKVA 2BFOA 3HLYA 4W5HA 1C1XB 1Z5ZA 2ET6A 3TR5A 1QJ4A 3R5HA 5BNIA 3AL0C 1XMVA 3LWZA 3MAJA 2XF8A 1VYUA 1FFYA 1X8LA 2OFPA 4OQDA 5AVZA 1YTUA 1DKRA 3QRWA 4FBGA 3C3KA 4JGGA 1CERA 4N6OA 2JLWA 4GD3Q 3HV0A 2IHUA 3RHZA 3M49A 1I2BA 3QE2A 4RVDA 1Q1GA 3FGZA 2CZCA 5HRUA 3UJNA 3NFYA 4N48A 1DKUA 2QORA 3R5XA 3K30A 1C30B 1SCAA 3DW1X 4J1NA 5LBTA 1YFLA 3EWNA 3LC2O 3MTIA 3MTQA 2PMKA 2QVBA 3D4OA 2HL6A 2XECA 3M1YA 5BSFA 4QYXA 4IFEA 4IS3A 3ZDCA 4MQUA 1FVXA 2MCFA 1RPZA 4IRXA 1K8RA 4LNUA 5C35A 3U7QB 4O0MA 2DFDA 2C1ZA 4WOPA 1C9NA 2YXLA 2QMYA 4LXQA 3Q15C 2ZI9A 3CS3A 4QJBA 2V55B 5G0UA 4JVSB 5JFOA 3E81A 4WECA 1T13A 3EH1A 4O5AA 1OCEA 1POXA 1W0JA 1L4FA 1H1LA 1SCQA 1S3IA 3GIDA 1KQPA 1V8OA 1J5EB 4ZQCB 3GD5A 1C0PA 3RG8A 1TM3E 2LW7A 1C7ZA 2GEDA 5A4AA 2QI9C 1ZOIA 3HB1A 3BD7A 2K7FA 4CEHB 4G41A 5LP6B 2KS6A 2PX8A 4XDGA 1KE1A 1PNTA 1Y42X 3LTNC 1JZSA 2FEPA 1AN0A 2BLNA 2H48A 2ZSBA 4CM8A 1MA3A 1WUHS 2VDWA 3L82B 1JW9B 5J2TA 2BD0A 4RU1A 2CLSA 4WKBA 4F5YA 5CIQA 5EY5B 1Y6ZA 4FSHA 5COBA 5CITA 3AR2A 3M6FA 2R48A 3DT6A 1K88A 3QELB 2R4TA 1CJSA 3NTRA 4XPZA 4FXOA 1VBKA 3VC2A 4CIWA 3N0XA 3CLKA 4JODA 5IJZA 2W2MA 4LZJA 5K05A 1COWD 2X0IA 1XOIA 2Q1SA 5BSEA 7YASA 3E1GA 1MO2A 3VKUA 3ZCUA 4A8JC 4RC9A 1E98A 5T41A 1Q1QA 4B46A 3CE6A 4A1FA 4PFQA 1F1BA 1KDPA 1VGQA 4DRXA 1FCJA 3T0FA 2WUEA 2HZ7A 2ECKA 2WVGA 1GL3A 5AQ1A 2AWOA 1ZU4A 2V0CA 1AZSC 3LP6A 3OZCA 3Q7SA 4L0QA 4YQYA 2RG1A 2W4QA 1M67A 5FWYA 1EIZA 4M7WA 1G8GA 1XE3A 2ZBPA 3FSRA 5A4JA 1RZ3A 3D81A 2H4YA 4M83A 2X8JB 1H0HA 1PV1A 1Q0PA 1UMCA 2H0QA 3V8BA 3EYAA 4AXBA 4HAXA 3BXEA 1W47A 5G41A 4D9GA 4GEGA 3SXPA 4UDYX 3L9WA 2V0NA 2AOVA 4US2R 2R47A 3TS1A 1YOVB 5MFZA 1ZY2A 4DR1B 1FL9A 1MEEA 2HM7A 3C3AA 4TKVB 2I8LA 4QFDA 3TB4A 1FXSA 1KL7A 2GVDC 3O1LA 2WPDA 4B3CA 3L5OA 1XDZA 2C5SA 3D3EA 1KC1A 2AW3A 1QH8A 4QDZA 4YTEA 3GFRA 1WMEA 3K2IA 2B0CA 3LKVA 4QIHA 5ECYA 3C8HA 5PNTA 3LXXA 3WHIA 1R5NA 1BHO1 2R65A 4QX6A 1EFTA 1CUEA 3K8ZA 2UZ1B 4MW9A 2O2HA 2X0NA 4AIRA 1TK2A 2C78A 3TZCA 1TJNA 4BZPA 5BW5A 1R9MA 3C7AA 4M76B 1NLMA 2IYNA 5IM5A 3RU2A 1MDBA 2OCIA 2WYVA 5JAQA 1YR3A 2REBA 4W5QA 4ID9A 3I6MA 1YKFA 4NFYA 3FKQA 3WNQA 3L6BA 4DQKA 5AOCA 4EW6A 4YRIA 3AONB 4C4XA 1G5FA 3ZH9B 4BE7B 5BXYA 4WZBB 4IDQA 5L3SB 4URUR 2PU5A 3W34A 2Q7DA 4X1KA 1RAHA 1GQRA 1Z0KA 4WZAA 5AM0A 4PZDA 2ZYWX 3JXEA 4NK4A 3OD5A 3EIXA 5AJZA 5LLSA 2F3TA 4OD0A 2OV3A 4A6EA 3U31A 2ZE7A 4PS1A 5AW3A 1F17A 3I9V6 3D2AA 3NTLA 1GPKA 4BOYA 4MUBA 3CZMA 4CM3A 4H60A 1UBGA 3AP2A 3ZXYA 1MORA 3RHSA 3I2JA 1VKRA 4ZVPA 3U4QB 3SN6A 1OFIA 4NH0A 1JHPA 1KDRA 3DLIA 3IV7A 1BMFD 3SXUB 3L0IB 3GFTA 4OJNA 4FGWA 1H2FA 5CMLA 5KWJA 1DFHA 4JLPA 1Z3IX 3EC2A 4ZCSA 3OESA 3FYUB 1P0QA 1WG8A 2PUWA 2ZDGA 1V5FA 4U2CA 3F7TA 3GRRA 2H00A 2HC9A 3NV7A 3NAMA 3KJGA 3LPDA 1P2GA 1E2NA 1OIWA 1QG0A 2XCTB 3TL3A 2VOJA 1MIHA 2VQEB 3BTOA 1I80A 4J0DA 1R2QA 2XWJI 4WY8A 1J2JA 5F1YA 3BK7A 3FPGA 4FEGA 4ZO9A 1QHHB 2P9BA 3HMQA 5CEEA 3RHFA 1P8AA 4Q7KA 2XQIA 4JZYA 1B8VA 1WE2A 1KY3A 4QUKA 3VC1A 1LFAA 4E2XA 1JQ3A 2GBGA 3AY6A 1KOFA 1VG1A 1SXJE 2PZAA 3BXFA 1E0AA 5CVDA 5J1SB 3DWIA 2JCBA 2EQ5A 2JH3A 2BCJQ 3W05A 3DLBA 1YHNA 1E5QA 3KYCA 2BGNA 1W85B 2G63A 3HG7A 1V8DA 2OLKA 3GXBA 4IJ5A 2MYPA 2ATEA 3E9CA 4LHYA 4QDTA 5E9QA 3T6KA 4BJ6A 2D6FA 1NRWA 1FLNA 4N41A 3SSNA 3SVLA 4IR7A 5KAPA 1HDOA 2FVXA 4KWIA 1K5PA 2AOTB 2QRHA 4DNQA 1F3LA 2XQKA 4FGJA 4KR7A 2VQ6A 3I58A 3R3HA 3L0ZA 3O4IA 3PSHA 3GCWA 5CHYA 4NF2A 3S6JA 4AUKA 1UK9A 1CP3A 3JU3A 5J2UF 2QNBA 1X9GA 2HJSA 3HVHA 3L6UA 1Z0IA 4ID3A 4PR0A 4YX9A 1KEKA 2PO7A 1RMTA 2WJYA 621PA 5E3IA 4XWYA 1JJBA 2C2OA 5EMJA 1L7EA 1AN9A 1DJQA 2O14A 3PUKA 3MTBA 1T1SA 4V2UA 4B8YA 3UANA 1O0CA 1FOEB 2NZXA 4FFSA 2BV3A 1MTZA 3ISJA 3L4SO 1L5OA 3MT0A 4RPIA 5IC5A 1H0RA 3RG2A 1Q3TA 3AFOA 4X95A 5H68A 1W88A 2FKNA 4GS5A 1OAAA 1F8FA 1QVWA 1P0CA 3PCXA 4LRYA 3HCRA 3VTZA 4GMGA 2QN9A 2FGKA 4C43A 3I2GA 2H6EA 4JB2A 2O05A 4K87A 5DSXA 2I99A 3DT8A 2D2IA 3I01M 1NQUA 2YYZA 1UBUS 5AK4A 1XDUA 3R7AA 1YZYA 1JLSA 4KVZA 5JUWA 1TZCA 1E4EA 2XUJA 4K9SA 5ADUS 5AVUA 3RJ5A 2LIPA 1MJFA 1RHJA 3G5LA 1ADGA 1OYVA 3ZY3A 4BLUA 6REQA 2YRWA 5IJWA 4F84A 4O4LF 3EA0A 4LQLA 4WXRA 3CA8A 4DKXA 1YI8A 2C42A 5EIEA 3ER6A 4R5HA 3NASA 4HR7A 1V5IA 4M8NE 5IU6A 5H82A 3MJ4A 3O31A 1KYVA 3QKIA 5BT9A 4C0AC 2NW6A 3H9UA 4B6OA 2XIQA 3MMZA 3O95A 3AUUA 2CXUA 1FFCA 2WSSD 2BHNA 2XRFA 3K9QO 3KT6A 4R7ZA 4U7PB 1FC0A 2XKAA 3R40A 3W3AD 3MT8A 3ZHXA 3ZV7A 3AIKA 1XBTA 4W5JA 1NQVA 4C0JA 4O08A 4MW7A 2RH9B 4DR4B 3KKZA 1WCV1 4C14A 1K8ZB 2G04A 3BMNA 4EX7A 4AF7A 2B8TA 5C7OO 4MUIA 4YMHA 2ALJA 3QSGA 4C4RA 3OP1A 2GLXA 1DMSA 3HP7A 1FQWA 3C6XA 4JU9A 1JFLA 4OLHA 1A2KC 2PDAA 4JI6B 2G06A 5FAKA 3MOGA 2UZ4A 1S3FA 2YVQA 4MVJP 5IW8A 4PHTA 4CIYA 1XXHA 2CDRA 2NVBA 2YHAA 4YY3B 1U28A 5AJVB 2CB0A 3AGQA 1ORHA 4AB1A 4ZYTA 9LDBA 2BRUC 1D5WA 3AUFA 3IE0A 5IKMA 1Z4MA 4LNHA 4UQOA 2QHXA 1UKEA 3GJRA 2I6QA 3QELA 4J2OA 4PC6A 1FRVA 5CYPA 1YHYA 2DP4E 2ORYA 1P9LA 4WT7A 3H4VA 4NTZA 5E1BA 2GDJA 5JCJA 2IBSA 2V8BA 2AN9A 4B3HA 4RKWA 4JD5A 4CM6A 3F0TA 2WK1A 3QMMA 4DCGA 2ZWIA 1YBHA 3VJKA 3WSWA 3CJRA 1J8VA 3O1HB 3C4VA 4C7OB 4G8BA 3WL6A 4R40A 4KJXA 4OA5A 2Y1XA 4MW5A 4R54A 2JFQA 3RC7A 5JEDA 4W7IA 1S2DA 2VG8A 4RKYA 1XA0A 1WU7A 2HLDA 4RTKA 3ELDA 2QGFA 4MI3A 3WJ1A 1J09A 2NPIA 1X74A 1Z7YA 1N2CA 3DBVO 3BHJA 2XTMA 4OI2A 1L4KA 3I09A 5AI8A 1W4RA 3VTFA 1WXFA 1AK2A 4HFRA 2Q8QA 1DTWB 2W93A 5LBIA 1QHXA 3P19A 1M6NA 3D3QA 3S2SA 2R8YA 1W73A 4F6LA 3WYAA 3WIVA 4QRHA 3HJGA 1JAYA 3F6CA 4HWGA 2BEVA 5CT4A 5JJCA 5HCNA 3WA6A 2P6RA 4Z5XA 5F9FA 5FWAA 4ZCTA 5DW0A 1Z8NA 3DYBA 1QWSA 3S27A 1TCUA 1TLTA 1XTKA 2C0CA 1XZPA 1N8TA 1PBTA 2EKLA 3FTPA 2IYPA 4J49A 4JLKA 5A5GA 3T1OA 3TOCA 3TDNA 4YRAA 1CKEA 1EVIA 3KEFA 2O6LA 2ON6A 2XD4A 1PYDA 2Q2VA 2AMJA 4O4HF 2PKWA 3ZDAA 2FEOA 2IW3A 1E7SA 2JGJA 2O06A 2Q3BA 3MINA 3QG1A 1MQ9A 1AZWA 2YJ6A 2ZPAA 4K6KA 3V1YA 4Z4HA 4HWTA 4AJEA 2HUNA 3AJ8A 1N9GA 5C3UA 2IH5A 3GJ3A 4D3SA 5KTOA 3JZMA 1F38A 3GZ4A 4E13A 1I2CA 5FJJA 3HJBA 1C80A 3HKEB 1AC5A 1RIIA 2DR3A 2NYRA 2CUNA 1OPXA 2VT3A 1YFZA 3Q3HA 1Z5UA 1XN4A 1FB5A 4FX5A 1CUYA 2NSJA 3ORSA 3E2IA 3JQCA 4MWCA 1JG6A 4OHKA 4YO8A 5BSUA 4U7GA 2DMRA 3SZLA 3TIIA 3U3JA 3OZSA 2FSPA 4JSTA 1RTTA 2P41A 5E2AA 1Z08A 2QR3A 3JWPA 3RROA 1BVYF 2J3QA 2H52A 4OXKA 4Y2RA 1C0KA 4Q9LA 4Y6GB 5IVIA 1Y8ZA 1WZIA 4AW9A 1IBLB 1IU9A 2C04A 1S6YA 3UC9A 4GAEA 4MR9B 5DV9A 2I4IA 5B3AA 5NULA 4AU1A 2C31A 4ZEXA 4EG7A 4C0LA 4Y1GA 5JMWA 3RRYA 3OJCA 1NJ8A 2XYPA 1ZH8A 2NUPB 1WL8A 3A6EA 3IRVA 2YH2A 3I04M 4KWEA 4C6TB 2YHUA 4AO8A 2F4VB 2AH5A 1AU9A 2R8RA 4DLYA 1UL1X 4PZYA 3BFPA 2J9FA 2EZUA 1LPOA 2QMHA 3LK7A 1WD7A 1LPNA 1Y1KE 1OVMA 2X8AA 1WQ3A 2DH6A 4DMHA 2PGXA 1YAHA 4GQAA 1VI6A 5AKYA 5ICCA 3AUYA 2YBDA 4J6FA 3RW9A 6YASA 2D0IA 2NTEA 2XT0A 4BTVA 5JNUA 3G1TA 2F48A 1GVHA 1YCGA 4HTFB 4IIXA 5DF1A 3T95A 1UFKA 2F4NA 3WQHA 1DB3A 1ZLXA 3PEUA 3IQWA 5AW5A 3B48A 1MQAA 3GRCA 3W5VA 1N75A 2ERYA 2PFSA 2X4IA 4GP7A 4EHAA 2JATA 2BFPA 2P9QA 3PL5A 2NM0A 1QKJA 1K0UA 5E4TA 3DQZA 4ED9A 1SU4A 4TSRA 5EMMA 1P73A 3WBBA 4FC6A 4X24A 2MR6A 4KIFA 4ZU6X 1YRWA 3QG5A 5J2TF 2C4NA 5CGZA 2FW0A 3PFBA 4TWBA 3WGTA 1G59A 4PGHA 1B3BA 2WYIA 1UFVA 4NXMB 1U8TA 1J8DA 1V8PA 1FXUA 3MCWA 3RABA 1Q14A 2WWWA 3A8TA 1IJEA 4J7XA 1HDXA 1T0UA 4G5HA 2GTPA 4P34A 1HE5A 3M4ZA 4YCDA 4DIKA 4PHHA 4DWWA 4HNGA 1PK9A 2OMKA 2FSVA 2WHRA 1JAZA 3E82A 2FW1A 2YBEA 4H35A 4RV4A 1WUKS 3LY5A 1CQZA 4MUKA 4TQ9A 4II2A 4FZVA 3M6LA 4DCVA 2F67A 4CV0A 1K27A 4MARA 4YUZA 1WIWA 3E3OA 3F5QA 1CS0A 5CFZA 5DOVA 1XRNA 1L7DA 1PJBA 2Y3IA 2FJ0A 4P1ZA 4Z0HO 3DAFA 1AZLA 4X8OA 4Q4HB 5LDGA 1UXIA 1NDUA 2HRCA 4BQOA 3HZOA 1NONA 1YGYA 1YTLA 1CCWA 1EMDA 3M4NA 4YREA 5KNBD 2AV6A 4I4TF 2REXB 5C8ZA 1YQEA 3CWCA 4KBFA 1WPQA 3GJ5A 3L4BC 4N7BA 1QH0A 2VDMB 3AEXA 4F4UA 4G5OA 4L7QA 2FNAA 1U11A 2FQXA 4LE1A 2I7CA 3KKQA 3G2NA 4MMYB 4TLMB 4PTLA 1GADO 1XRLA 4EA8A 3T7RA 2V4MA 1A3CA 4YP9A 1ZR2A 1SXIA 1FLAA 3GRVA 4XX1A 3PLAE 4DJDC 1K92A 3LZCA 3EGIA 4WZ6A 4J8PA 1B2LA 4G0QA 3C8ZA 1ADCA 1MDFA 4J07A 2I71A 4D8YA 2CVHA 4RD1A 2VZ9A 3OD1A 3L8DA 3UEOA 3T61A 10MHA 3ETEA 3BKWA 4CKBA 2C59A 1Q7EA 1VHDA 3C6BA 3JARA 3MJVA 2GJKA 1UDCA 3B9BA 3E15A 4HGPA 1R8JA 4HPXB 3ST7A 1A9ZA 5CNKA 4XTCS 1Q17A 1T5IA 1Y1PA 5LA6F 3QPWA 5CLJA 3IP6A 3KQHA 2FB9A 5AKGA 4Q1AA 4I50A 1G6OA 1U2TA 3O4HA 1RJ9A 1YR1A 1YZFA 1VSUA 3DDHA 3Q41A 4PGMA 2BJVA 5THQA 3TNFA 1XHFA 3VU3A 5LSAA 2XXBA 4M22A 4ZODA 1DIGA 1ORIA 2P2ZA 2N1MA 1WXIA 3GT0A 2NZ8A 3BBPA 3CW8X 1IUNA 1RM5A 3LSYA 3OF5A 4FBLA 4LWQA 1NIPA 2PUDA 2J6CA 2N3ZA 2WIAA 2DE0X 4MRPA 3OOJA 2ZBRA 3EXFA 2YHIB 3CIFA 4JL6A 4Q4AB 1EESA 2A0KA 4IIBA 1N92A 2DY0A 1K5GA 2R86A 3CN9A 3DMTA 4BO2A 4D25A 4XJXA 2HMTA 2QT9A 3BCSA 5ICMA 3AJEA 4FLEA 3CC8A 2B6NA 4GXRA 1OTXA 3ENWA 1MGOA 3NHSA 4GZ5A 4K81B 4KLAA 4TLEA 3WGGA 2Z6AA 1FXWA 2QTCA 2R6DA 1IZ0A 3I5AA 2JVKA 4UREA 4GI5A 2F1OA 4KACA 1ELOA 5HA5A 3G13A 1PX2A 3GH3A 1N5KA 1A7JA 2QA5A 1X0XA 1N7IA 2OHOA 4G1MB 3WRXC 4NG4A 4W1PA 4H08A 4M1WA 4PX5A 1U9IC 1IVSA 1U6JA 4FMBB 4XTRA 4B2YA 1K06A 4A8JA 2JIZA 2X0RA 4OHPA 4F97A 1CR0A 2QV7A 3BBLA 3CUKA 1NDHA 3A1SA 2QTLA 4HB0A 3TVYA 3ZJTA 1CRWG 3PUHA 4XSGA 3T3GA 3ZY4A 5IZCC 5EKDA 1UPCA 3H13A 1RLMA 3T3MB 2PJRA 4LECA 4IDNA 2QD4A 1OASA 4B3RB 1SBNE 3TJRA 3ZVNA 2RGXA 2NO1A 2X58A 2BMWA 3JQPA 2GYWA 1FBTA 3UGQA 4YYEA 2WHXA 4UPEA 2ZM6B 4P2BA 1L5YA 1UAYA 4LY9A 2WSSA 1DBWA 3R0QA 3C6YA 2CV1A 1CX9B 2R2GA 3TQQA 3ULKA 5IG2A 1ZBQA 3UMJA 1T5LA 4YB8A 5JAHA 2HMYB 2QVLA 4MMZB 2H5LA 2AHOA 3EARA 2EIHA 4Q4JB 1M1ZA 4I5EA 5A5VA 3AHJA 3DG9A 1PR3A 2AD5A 2F6RA 4UOZA 4N5HX 3EFOB 3UK6A 4R68A 4EB3A 1KMHA 3WO1A 2OMEA 4A8TA 3TZBA 3KBBA 2BFFB 4UPDA 4GX1A 1W8DA 3M4JA 5BWLA 3ZDBA 1EP1B 1DKQA 1QH1B 1P4RA 3A6PC 5CM8B 1Y3HA 1D6JA 1QHIA 3W1WA 3ESCA 2A94A 4KQHA 5IZ4A 2AOXA 2QVZX 1OXSC 4IY1A 5FA8A 4MS1A 4UCQA 2IELA 4E22A 4LVOA 5CHEA 4Y1EA 1XG5A 5E1DA 1VI5A 3SEZA 2ZT6A 1NBHA 4CLOB 5JJ5A 1V2GA 4MDEA 4ZAVA 1BXRA 2GJAA 5K3AA 2DBVO 7MDHA 1H94A 4JBNA 3B1ZA 4UU7A 4BFLA 5L45A 2XB6A 2CWWA 1HTTA 1DQZA 3ZQJA 4RHFA 3QSYA 3X44A 1RLIA 3A1CA 3KD2A 3KZMA 8ABPA 3ETHA 4TMVA 3IX7A 3VR2A 4R9NA 4IOLA 2GN8A 2FPIB 3WRVA 5T7BA 2UUOA 3GQBB 3K4QA 4M9CA 1JAHA 4MIOA 3P32A 1E6MA 1IN4A 2A5LA 3GJYA 4MO2A 1U7OA 1XVUA 2HLPA 1BE8A 3CE9A 6LDHA 3VISA 3TSOA 5B3JC 3HRHA 2JHCA 4RFVA 2J7KA 3L0DA 5KU7A 5FBLB 3AYXB 2FFQA 2AKAB 4QC2A 3SFTA 3V4SA 4RCYA 3OC0A 3R3YA 1CRPA 3DHYA 1K7YA 3H4MA 4O4IA 2Q3HA 4P7BA 4LDRA 2YOHA 1T0BA 3TWOA 2E4WA 1JSRA 1LLFA 4PQGA 4Q7QA 2AFIB 2DQSA 2AZTA 5IEBA 1Z6GA 2JD1A 5JQGA 2H65A 5DYYA 3W5HA 3GCGA 3IO3A 1U2GA 3EJ6A 4B6QA 3DEFA 1FUKA 1BRMA 1LY1A 4MA0A 2H2FA 5H7XA 2IWRA 4LQCA 4UW9A 2D1RA 2O57A 5BWOA 1J9ZA 1TQDA 2FFRA 2PYIA 4YJ3F 4MROA 1E18A 4TVOA 1ZOPA 3C5EA 1IQRA 1DCFA 1L5QA 2A59A 1DUSA 2AFVA 2L19A 3KU1A 3THWA 3WGJA 2Q29A 4Q00A 1QC5B 2ESRA 3TFOA 4GMHA 3STYA 3X1YA 4RWEA 2J31A 3P4YA 1UP4A 4P4NA 4BV9A 3TCXB 1Q92A 2HWWA 3RI3A 1Y7HA 2WHPA 2PYZA 2KE5A 3IAHA 5EIWA 3VC3A 1RHQA 4LF6B 3EVGA 2V3CC 3K1JA 4ZXPA 4V39A 1HTWA 3DMHA 2OFWA 3INTA 3UMGA 2P9YA 1NY5A 2BDTA 4ENPA 3WGQA 3KYIB 3A0RB 2Q5IA 4JCCA 3V34A 3OIGA 1XO1A 4CM7A 1O95A 3SKYA 2HRDA 3D2LA 4QOHA 3N2KA 1M5TA 5J40A 1R37A 4PLZA 3WK8A 1YHZA 4PG5A 2F64A 3KEOA 1T1RA 2YHBA 4LGMA 3I3OA 3F5FA 4V0OA 4XCQA 5DEOA 1U3UA 5CG2A 2E4UA 3GLIE 2FPUA 4NY1A 3QHQA 1CQJA 1QYVA 4PLWA 3ZS8A 4EB0A 4BZWA 1IAQA 1RYYA 2IPLA 1TD9A 5GM1A 2RKBA 1ULBA 3KL4A 3FPSA 4FINA 2X1MA 1ZGZA 4ZYUA 2GPYA 1NYRA 1YL6A 3PRKE 3VSBA 1TE2A 4JJGA 2H0RA 4ZVVA 2J9YB 3ON5A 1I33A 1AQJA 4MIKA 2D13A 3Q8WA 4R1TA 3P8ZA 1KVUA 2C03A 5FBQB 3MHTA 5EA2A 4OKIA 4I50F 5JCXA 4L4YA 3MXTA 3S81A 5KMGA 3IEXA 1Z28A 5BW4A 1PT7A 4EHNA 2CMHA 1NR5A 2JI6A 3B60A 3H5NA 4R6XA 3TAUA 4MUFA 3PNBA 4N39A 1EFHA 5HBRA 4D2IA 5LXTB 2MSEB 2JEZA 4F3NA 5G1NA 4ISBA 1DBRA 2JLUA 4Q9DA 1NW4A 1FK8A 5I4KA 1SVKA 4PE5B 1B2RA 1NVDA 3IEMA 2XMBA 4RV9A 1V3UA 1NXOA 4ICIA 5TGTA 4YWHA 2HRRA 3PXGA 1X3SA 3G23A 3RGGA 2ZBDA 2PZEA 1IEWA 4GLOA 4TVBA 3X1DA 3EVNA 1I13A 5FUBA 3KQYA 2D1FA 2NTYC 3H2YA 3LA6A 4NC9A 3JYHA 3K73O 2ORVA 4IUYA 4J9VA 5JRZA 3KR9A 4IVRA 4X5OA 4UASA 4D99A 1OFUX 2CUTA 4C0KA 3EF0A 3O26A 1BOFA 3SI7A 1C9JA 3QWFA 5HJ5A 4IBOA 4TS4A 3R7BA 2WV9A 5IHPA 5DMHA 1B93A 2OCAA 1NU6A 2VSQA 2WVJA 4LMPA 1K75A 4KQ6A 1SHJA 4NMMA 3RTEA 4EA9A 1KNXA 1E1MA 2BI7A 2DLCX 2BM8A 4K6FA 3UV7A 3VDXA 1II0A 2Y0CA 1AQUA 3E5MA 3H2HA 1CJUC 3THWB 2ZYIA 3DE4X 3CVUA 1OUMA 5U9CA 4OY3A 2FWIA 2VNKA 3K0FA 4RY9A 4UUPA 1WWKA 4TYMA 1E1CA 2G5TA 1TLFA 3NVDA 2ACEA 4OQYA 4QHSA 4ZAFA 1GDHA 1G20A 1VLHA 9LDTA 5HZKA 1II9A 2C96A 4IIYA 3IL2A 4IFIA 4G36A 1IQ0A 4MAMA 5BUQA 1X7WB 5EP3A 2C07A 5DTQA 2Q1WA 2VK8A 3OIDA 4PBTA 1A8HA 4F8JA 5B1IA 2ASVA 4F5EA 3T1NA 1NURA 1E6KA 4DV7B 1RD4A 2CV2A 3EQ7A 3RB8A 5G53C 2XUHA 4IV5A 5G4LA 5EXSA 2QR5A 1Y3BE 2WJ6A 1D8AA 4JT9A 4JJAA 2Z5VA 4C7BA 3QUCA 1P4SA 2SKEA 3V48A 2FTKE 4R8KA 1X19A 2D5IA 2BZSA 2F7SA 4LDJA 3BKXA 2Z57A 4ZVQA 4D6XA 1N77A 5F2OA 5K3FB 1XCPA 2GXQA 3DR3A 3NRJA 3OCZA 4G26A 4GR4A 4H3SA 2J4CA 3M6IA 1Y7TA 3PQDA 1HYBA 1CFJA 4ZKDA 5EPEA 5I9NA 3H16A 3ESAA 1VRCA 5CVTA 2HV9A 2HQ1A 3IP8A 2FVYA 4EGSA 4C7MA 3B6EA 2HSZA 4PS0A 1JJ7A 3A9CA 3CCCA 4ZC1A 3HCAA 1E3JA 3AXTA 2OY0A 1ONNA 2WDZA 1KARA 3KUCA 4YCAA 5EP1A 4B4UA 4KCGA 1JJIA 3NNDA 5CP8A 4EGFA 3CU5A 3JSAA 3OZUA 2GOYA 3ZU6A 2YZMA 4JLWA 2CZQA 3JQ6A 1N32B 5EQDA 5HBGA 4Z7OB 4B3SB 3UGKA 2X8WA 1MA0A 4OB6A 5I48A 1ZM4A 2EWWA 5A9RA 3MS2A 3NP7A 2R8XA 1KU0A 2EHJA 1TD1A 4DUGA 1U3WA 1R4NA 3DMFA 3IUPA 4NP6A 4KHPB 1WDWB 4HNQA 4RF5A 1R6DA 5KVQA 4AFNA 2BMDA 3EZYA 3MPUA 5JQGB 2RCNA 2IZ1A 2O9JA 1HA3A 3IHWA 3OQBA 4OH7A 3V1TC 4AF8A 4OXQA 3WDLA 4R2HA 4B4KA 5EYPA 1FVHA 3UB4A 1JHYA 1VFPA 4N03A 1R8QA 2GN4A 3AVTA 3U09A 4XE5A 4RA9B 3C1TA 5F1OA 3W5SA 3TXAA 1EB8A 1GGKA 3WL3A 1PJ8A 2JIMA 4PG7A 2MOKA 3AB8A 3U4HA 3TTSA 3EBLA 1E9SA 3IQZA 2YWRA 4YJHA 4QUAA 4BO7A 4QXAA 2A30A 1B43A 2ZRMA 1X1DA 4QBFA 4XCXA 3X3HA 3DOOA 3K1AB 3SVZA 4ZJPA 2F1KA 5HGXA 4C03A 3O8CA 5KNBA 4OYLA 2XQGA 4X60A 1G7RA 3OJWA 2VH2A 3FGNA 4HJRA 4DLKA 4BMCA 1D03A 5FV4A 3ASYA 4PG6A 5D85A 4CMIB 5BR7A 4FCVA 4GBJA 5K51A 1JPJA 3ABIA 4D02A 1HYHA 2BFBA 2OUIA 2WJZB 5HMMA 2YJ4A 2ZULA 1NUUA 3HDQA 4OVKA 5DOZA 1T2NA 4X1YA 1H8HD 4E4RA 2O7RA 5DSZA 3V6MA 3ZPXA 1Q1ZA 5B4UA 3WFZA 2G9QA 4CYMA 1A7AA 1TM7E 1XHEA 2CCGA 4L57A 2R7KA 4LCBA 2BP7B 4X6UA 2MYUA 1F9EA 1WJGA 5DP1A 2W70A 1YB1A 1YRHA 4QU8A 4PX3A 3CUSA 1QK5A 5DWDA 4DOMA 4DLTA 4DPKA 4OK6A 1QGUA 5JVDA 4LF8B 1Q12A 1R0XA 1EFCA 1Z15A 4XSVA 3UXEA 1G3MA 4OXIA 1OLUB 4H15A 1XA3A 4J2HA 5AMXA 5EN4A 4RF3A 3VH1A 4L51A 1DC7A 1IK6A 3A4VA 1QF6A 1B8NA 3GJZA 5CLGA 1ISSA 2Z83A 5LMZA 3AOGA 2PQMA 2WHPB 1FJGB 1T9AA 4CQMD 4F1WA 2Q7XA 2O07A 4RA6B 1Q84A 1W4LA 4LBZA 5LFAA 5E8JA 1YL5A 3O3NB 4KSBA 4BNGA 3PQ6A 4OX9B 5D3KA 2B7LA 3ORHA 3JQBC 1J5PA 1G6HA 2R1UA 2OFXA 4PU0A 3QOYA 4KEAA 4X64B 1SBYA 3P0JA 1CULC 5IUKC 3PK0A 1HG0A 3LVQE 2QRNA 3SEAA 1Z12A 2NTJA 1KI1A 3O3CA 3CB2A 1W1UA 5D00A 3GNLA 4B31A 3AUJB 5GONF 2D62A 2O48X 4O02B 1BGVA 1QTIA 3KZCA 4YRKA 2CFOA 4GZMA 1M2VB 4M0EA 5K6AA 5KNCH 3A05A 4X6XA 4IQFA 2ID7A 1F60A 2XNJA 1H6AA 1MCZA 1XTPA 2XGMA 5TSDA 3SLKA 5EJ9A 3KNZA 2WUGA 3UCXA 5F77A 2B7CA 4OBEA 3OQOA 1J4AA 3W5JA 1C3JA 1T3ZA 2HA5A 4A9AA 1RWWA 5TLSA 2HO5A 2YJ5A 4O29A 1NMEA 4OK5A 5TJHA 3WGHA 4BVAA 5FNVF 2BGGA 1TK9A 2IZOA 4RQBA 3ORFA 2J3HA 3D9QX 5EP2A 1VG8A 5LM3A 4BO9A 1CVLA 1J06A 3IAEA 3EIQA 5EZ6B 4IF4A 8MHTA 5COQA 4MAFA 1SKBA 2ZR7A 2H7VA 3LW8A 5JD4A 2HGSA 3OPVA 4B9AA 4Y8VA 3ZWYA 3V4PB 3RNLA 1E1LA 4KMMA 5K8VA 2GAAA 1U2RA 1KE2A 4DJAA 3PICA 1VPWA 1O0SA 4Y2HA 3DL2A 1SQ6A 4FOSA 2QL9A 3FPLA 4AZ0B 3NOVA 3ENZA 1T9GR 3AU9A 5BOVA 2A1TR 1XLVA 3KTAB 3VU8A 4BFZA 4EF4A 4YT8A 1FQJA 4ALMA 2O1EA 2DKNA 2FZEA 1KRWA 2XHEA 2R3SA 2Q0XA 1I94B 3CGGA 2VF8A 3PQ4A 1JLLA 3DAHA 1N36B 3W5AA 3K4PA 1PFWA 1UUFA 1WBDA 3QVUA 4I2VA 4I1OA 2AJDA 2OQ2A 2WJPA 2YCBA 5DGHA 2IXDA 2LDBA 5JU6A 2IS2A 1BX1A 1CY1A 2B8NA 2BZ0A 3BZUA 3OZTA 1UWVA 3Q8MA 4K8OA 3STWA 3VI4B 1N6HA 4TQUS 3GA5A 1KWGA 1HPLA 1QE3A 2ZUWA 1MJHA 2VTEA 1A9OA 2KWIA 3MJHA 4NEGA 4YAGA 1PS8A 4N7RA 3NDJA 4Q4JA 1P2SA 3M6AA 3DEAA 4FD3A 4OLAA 5AVJA 3B3AA 3UJAA 3IUSA 2VPPA 4QU0A 4Q9IA 2ZZNA 1BDMA 1SBHA 4MA5A 2LGJA 4LV8B 3S3TA 1X1BA 1RI5A 3B6JA 3GEBA 4DREA 1UBRS 1SMKA 3FLBA 4OHMA 1JYFA 3WNDA 4CQLB 4DG5A 5F5LA 5I9IA 3LLMA 4ARSA 1MRZA 3PTAA 1BTOA 2QIPA 3ZY2A 2XEDA 3MTEA 1U0NA 2AWNA 4E2FA 4M0KA 3FNEA 4NCAA 1MAVA 3M2TA 3OTIA 2YCLA 1ZNYA 4IF6A 2HK6A 4LA4A 4TTPA 4YFYA 5MN4A 2YV4A 2G09A 5CG1A 2BMFA 1GCAA 2AZ4A 5AKXA 2A84A 3I62A 4B79A 4GPAA 2Z4SA 2I1WA 2HF2A 1UOOA 4CKCB 1H8HA 3SF0A 4HEJA 1Z18A 1V47A 3SX2A 3V4OA 4D6PA 1VSTA 4QQFA 4Y2TA 5ECWA 4KGDA 4XYEA 1VL8A 1KMMA 2COKA 1BE6A 1U2SA 2AQKA 2IZ5A 3FTNA 5CT9A 4LGCA 4RSHA 2AFHE 1FP2A 3I9KA 4UUMA 5JS7A 1YZGA 5HK9A 4DA9A 3BIJA 3LT1A 2V96A 1M2OB 3HKEA 1GQ2A 1C81A 1RCUA 2XOEA 3PGLA 3N2LA 1JDZA 5KYTA 1H1LB 1TEXA 1DP4A 5HCIA 2XSZD 3MRSA 3PA8A 2NU6A 4PIVA 1HYEA 2YFHA 1ZZEA 2PANA 5EJGA 5CVJA 4X1KB 4LKRA 2GJ4A 3QBDA 3ICEA 2V7BA 2FEWB 5HDBB 5AVXA 2I33A 2LKDA 2J9ZB 3B9QA 4LWZA 4XB6B 3PGXA 5IAOA 3C8DA 3AEUB 2QX9A 4LXIA 1VHTA 3GV0A 1KZHA 3BMQB 2DCMA 4FYMA 4N0MA 3R0VA 3ZXSA 3KOUA 1FDSA 1UXHA 3RK1A 3RYCB 3ZVLA 2GQ0A 3E8MA 2JLAA 1RAEA 3JQ7A 1LBQA 1XMSA 2C00A 3SDSA 3VAYA 3DFZA 1SVMA 4MP3A 4NULA 4BUZA 1U04A 4RLSA 3LF2A 5EJFA 4KGVA 1N2JA 4QFCA 4WBXC 4DV2B 1HDGO 2BLLA 2ZE6A 3OE7D 1NQAO 1SHZA 2E37A 3NBKA 2QN3A 3JVUA 4G01B 3VPBA 4KMOA 3CYFA 5K09A 3JZAA 4TS1A 5BYBA 3M5DA 4JC5A 4C0BA 2GN0A 2DU8A 3ID6C 1L4EA 5BYAA 2P27A 1QHHA 4JJKA 1SVWA 4U3JB 1XTTA 1G7TA 1DO8A 5KJ1A 4U39A 4Z9BA 3PYXA 3R6TA 5A7FA 1RTKA 2JS7A 2HDHA 2EFCB 3DVRX 3GAFA 3KJZA 2BELA 4OKSA 3G3EA 3QKRB 5KYYB 1J1UA 2AI3A 1Q7CA 3PQ3A 1K5DA 4D81A 1GNTA 4ZVLA 2R1VB 4P35A 3W4JA 4OXRA 4REOA 1B74A 3IHKA 5BSHA 1QG4A 1AMNA 2L18A 4K9KA 1BW9A 1JSLA 4EX6A 2QTGA 1ZM3A 1O96A 3UXHA 1OXTA 3DPUA 4QU5A 3AM1A 1L4BA 1XHLA 2C9OA 5H1YA 2VA8A 3IKTA 4RSRA 1F0NA 3GOHA 1SUIA 1Z74A 2J0UB 2A1IA 1ODSA 5DNUA 3UPUA 2YY6A 1JF8A 1Q44A 3LLCA 3WIOA 3EVDA 4UBOA 3TD6A 2WD7B 4ZV7A 2EGGA 2IP4A 2XXAA 2N47A 3AESB 3DYVA 1FFXA 3GFGA 5CFRA 3FROA 4HMOA 1PN3A 3VR5D 2FG5A 2B25A 3SCZA 5TARA 1T2AA 4JJZA 2DUMA 3V8PA 2OBFA 3OPYI 1WTAA 3NXKA 1EE1A 3GZTB 2NP7A 5K8JB 1Y5NA 5C53B 1RYDA 4JP3A 5EZYB 1Y1SA 2F59A 2FEMA 1CF2O 2ERCA 5BY2A 1WHSB 4X90A 2W8BA 2F3PA 1NQ5A 4K9NA 4KODA 4ZHSA 3EZLA 2IFTA 4ZQBA 5KPDA 1F9AA 1XQ6A 2WP8J 4NV3A 4TX1A 4U5QA 1Z8FA 3ABQB 4YMIA 4OA8A 3KFVA 1F2VA 1U7XA 4KK4A 4QNNA 3TJZA 3ZTWA 5HF5A 5DBOA 3PIRA 3EG9A 3MJTA 2ETVA 5HIAA 1KO8A 5BUZA 2AFRA 3DDWA 5KQRA 3BWYA 4C2TA 2IUUA 4RJKA 4C6TA 2ANBA 1H2HA 2VBFA 4LI0A 1KAHA 1XVIA 4BFCA 4BKUA 1Z0AA 1ZVMA 1XU7A 1QAQA 1NGSA 1UPBA 3N05A 4OKNA 2V98A 3C85A 2CY0A 3TE7A 1F7VA 1EA5A 3RDPA 1XPRA 1QHEA 1P5FA 2C4MA 1Q5PA 1A5AB 2J07A 1PLLA 4EMBA 2FQ1A 3BGSA 3AKEA 2WB2A 4GMDA 3QFTA 4LFBB 2PKXA 3BH0A 3QH4A 2B4RO 4YRFA 4JX8A 3KFLA 3A4MA 2PKEA 4B3BA 2H1LA 3DLTA 4UXIA 1O3YA 1RWKA 2Q8NA 1UKAA 3GNSA 4EL0A 5AK0A 3GUVA 3HDJA 4NX2A 1RHUA 3OCXA 3O74A 3MUOA 3QA9A 2C5BA 5D3QA 5TT0A 4EZIA 3H97A 2HXGA 3HB9A 4H2DA 5KOIA 1PIWA 1ZJJA 2ZEJA 4CMHA 3K9GA 2OV2A 5KVAA 2HHHB 5FBZA 2PV0A 4YMSA 1AK1A 5L3QB 5DNAA 1YR7A 3O8DA 4JXXA 1J0XO 2CXTA 2PSSA 3DDCA 1GAJA 1SUFA 1ZJ6A 1FDVA 2VNJA 2WZDA 3UBTA 2OXRA 4MR8B 1U2GC 5DBIA 4H1TA 4ETMA 2XWBF 2PUBA 5FB3A 1RKUA 2JLVA 3AR7A 2Q4OA 3QU7A 3LKZA 2QU7A 1ZH2A 5ALSA 4URFA 5JE8A 1PR9A 1N9KA 4XX0A 2E5LB 2CUZA 5FLXA 1W36C 1E4VA 2J32A 4Q39A 3F4LA 5AJHA 4AO7A 2FLKA 5DLDA 2IU4A 3FB1A 2FK7A 1NF2A 3CBQA 4PHFA 4WFJA 1EDZA 3UKOA 2E82A 3QTTA 3VR3A 1DBSA 2J59A 3GHYA 3ZN2A 4AJ1A 2OO5C 2D2XA 4MKRA 4A27A 3AM5A 3MELA 4WUTA 4JMLA 3E48A 4M0LA 4PRLA 1WDKA 2QTTA 2JCGA 1N0WA 2XCOA 3LZDA 3W0LB 1QGDA 3WK6A 4B7AA 4EVQA 1GKLA 5KTMA 3QFSA 2GPSA 1UADA 4EY7A 4HNAB 1JL3A 1MLDA 2J85A 4C30A 3FYCA 4BNVA 3ZJUA 4G09A 1BE0A 2EKQA 3OMXA 2NUAB 2Y1FA 3VDMA 3HI4A 5IAAA 2V7QA 4LC1A 1T4CA 5DK4A 5C8YB 3GFSA 4UTVA 4B74A 5FKJA 4L7VA 3GG9A 1FNSA 1U8YA 1X8KA 3NHZA 2Q8PA 4OUDA 3FWZA 4LKOA 4JV5B 4W9RA 4FX2A 1XFDA 1Z82A 4JXJA 5KKNB 1QO0A 2C99A 3VHLB 1MTOA 1G8PA 4TWZA 1NV8A 3A4TA 3IT2A 1N3LA 4QBGB 1PDOA 1PGPA 3ZWWA 3PI6A 3IPAA 2EW1A 4TT3D 3TBKA 4AECA 1JFFA 4GICA 5DJ5A 2CYAA 2GK6A 3T5MA 4O0LA 2QLBA 4PC1A 1I6LA 4L1KA 2ZDQA 3VQTA 2XIJA 5DM4A 3VUEA 4II7A 2LCQA 1NPYA 2A6PA 1P7PA 2ZR8A 1GCOA 2ORED 4XIYA 4KITB 1PFVA 3LPAA 3DLHA 1XKXA 3QBEA 4PLVA 4YRMA 3WLEA 1K7FB 2ZXFA 1ML3A 3L8GA 2Y76A 1BHQ1 1TIKA 2EW2A 2QL6A 3B3JA 3CWQA 3L18A 1ZSYA 3DJFA 3GJXC 1VOTA 3IJEB 1HURA 1YB6A 1Z13A 1K4YA 2RHDA 3D3JA 4HN4B 4I1SA 5CFNA 1E2QA 3DMGA 3KG2A 5AH0A 2QJWA 4B3XA 4QGHA 3EY9A 3HL0A 4TLLB 2JARA 4H7HA 1G21E 1Q0SA 3OJLA 1D3AA 4WHMA 3VR4A 2W83A 3OKCA 4LWOA 3KD3A 4RVCA 2C7VA 2PPVA 2YQZA 3GGSA 2WAAA 3L8FA 2V1XA 3PBKA 3ZBUA 5LDHA 2YX1A 3DXFA 4OGFA 2OKCA 5KB3A 3S2UA 3WDSA 3SYNA 4WX2B 4BY9E 4WLOA 1Q22A 2JFFA 4DPLA 4Q1CA 1NNEA 5DTIA 4IRUB 3AY3A 1P75A 4FE7A 2HU7A 1PT9A 4ANFA 3C5CA 1WOMA 4HY3A 2HSJA 3Q0EA 3LM8A 2C4VA 2ZROA 4RJTA 1QTQA 1NU8A 1TF5A 4O2RA 5DNWA 4YJFA 5KHLB 5DLEA 3CT4A 4HP8A 2VNIA 4QGAA 2MINB 1YB5A 1W0KA 2INGX 3L7IA 2HHJA 3GWGA 3DZKA 1ORVA 2H29A 3PR1A 1HXHA 1TU3A 2BKUA 2F3RA 2OCXA 2ZYSA 4P7JA 1MW8X 5THKA 4KRFA 2PMFA 4YJ2B 1G5TA 4D9CA 3O4VA 2IUYA 3H8WA 2F3QA 2IHTA 3JQAD 2FU5C 3GARA 4MWBA 4Y2PA 3BAFA 3P2KA 4MEBA 3ZZTA 5JLAA 1C7IA 5BV0A 3NMUF 1EVLA 1IQUA 4ASUA 1NWHA 2C5LA 4W5WA 1LI4A 2I62A 3E84A 4F2GA 3R6WA 3TX2A 1YZQA 4C3UA 4O2BF 1ZZGA 4ILKA 3X43A 3AU8A 3L9XA 4MXDA 3FJYA 1J2RA 3UBMA 4LEIA 3OCYA 3PVSA 4QASA 3CUYA 3TPCA 3KBOA 3RSCA 4M7RA 1QPGA 4DCMA 4IMRA 1VJ1A 3OEHA 2OWEA 3C1OA 2FW6A 3VBEA 2XE7A 3EG9B 4PV7A 3CY6A 3IKVA 3PDIA 3M1LA 1JKXA 2QZPA 2POQX 1SZDA 3QKUA 5D8DA 2H7XA 4KQWA 1XDGA 3SE0A 1HLPA 1OGYA 3CLSD 4MS4B 2OV8A 4DDTA 4DIMA 1G18A 3R7DA 2ZIUB 5KYXB 2PTHA 2BMAA 1KPGA 1LC3A 2GJ9A 3CPEA 4ZEVA 5ICSA 5K4GA 2IXBA 4JOQA 1G1MA 1INLA 5CD9A 1VG0B 3IO5A 5DB4A 4D46A 3V1KA 1PDWA 1Y8RA 1X70A 4CMBA 4JZKA 3UT5A 2SKDA 5F1PA 5AXBA 2C2YA 2VRBA 2VTDA 3FX2A 2Y93A 1WUJS 3IPCA 2QNRA 3HBAA 4R2JA 4YJGB 2XLBA 2GZAA 3DXZA 4IGAA 2M6LA 4YUYA 3FUXA 4RPHA 2N75A 2VKTA 3BDVA 4OEHA 3DJYA 3QHPA 3EOBI 3T41A 1JX6A 2C1XA 3VNBA 3LHIA 4X63A 3C4QA 4YRCA 4DIEA 4RQTA 1L5WA 2HYIC 1UK8A 4PO8A 5DLPA 3OWHA 3HN6A 2C20A 1R4ZA 2P1RA 3G2QA 4FEYA 2X5OA 3KWFA 3MUNA 4GGPA 4M8KA 4UMDA 5A3RA 1F8XA 2X14A 3G85A 4UTNA 4EJFA 2ZUBA 3FSEA 4KE7A 1IXKA 4DSZA 3NEYA 3VPAA 1H0KA 4CGZA 3FHTA 4AKSA 1W35A 1HV8A 1AGYA 2ODTX 4XCVA 4XUGB 5LQRA 2O2JA 3QEKA 4U00A 3OFKA 1USWA 4N40A 2DVMA 1KFBB 4C2BA 4IIUA 2HRBA 2ORWA 1RKVA 2OXCA 1TAUA 4I1PA 4V2IA 1X7GA 1CUJA 1AKQA 3JQ9C 3S5JA 2PCLA 1N2CE 4R7TA 5FYDA 4AWXA 1SUBA 3KV1A 3NYIA 2E4XA 4HDMA 4E09A 1EVEA 4F06A 4EG4A 1RFLA 3BUSA 4LXUA 4Q3KA 1JKFA 4H77A 2BTQB 2CW5A 1VTKA 4HDKB 3E1KA 3RUAA 4Z3OA 4RD0A 2A9RA 4ZYVA 1BXZA 4OJYA 3FY4A 4M9ZA 3PUZA 3ILVA 4TS3A 1KRHA 2I67A 5CM2Z 3CB4A 5AHRA 1ID1A 4V1CA 1T36A 1ZC3A 4IJ6A 4LJ6A 3BE5A 4K9LA 4O25A 2DR2A 3O2SB 3HJFA 3LCVB 5LYJA 3OOWA 3CF2A 3I2HA 4XJSA 3GDFA 5KWSA 1DAIA 3GEPA 2WAMA 2BFDB 2PRYA 2ZU0C 3EY4A 5AOBA 5J4YA 3CH5A 1EXDA 2A9OA 4ZO8A 1Y5MA 1RMQA 4EMUA 2UZAA 3REQA 3HS3A 2H31A 3LBIA 1P33A 3UMMA 4ZTZB 1QKIA 4WKGA 4FDUA 1GFSA 3K0EA 1U2ZA 2X1VA 2QXYA 1MMFB 1IDOA 3HR8A 1U1GA 1T5DX 4N6GA 4RTNA 2JA1A 1IJBA 2V3VA 3PPIA 1P1RA 1WUTA 3I4CA 1W30A 2V4UA 3KKOA 4NEHB 5EMNA 4F5DA 1CY8A 4FFOA 4RJ2A 2WIFA 3ZHZA 3ZCXA 2G0AA 1WUYA 2E3JA 5DP2A 4ALNA 4EVRA 4F3YA 2IZ0A 1FVOA 1OF1A 4WXMA 5FOTA 3UT5B 4TM8A 3ETDA 3ZNNA 1E66A 4QVIA 3H5RA 2H54A 1EK1A 3M81A 5D01A 1SA0B 4FU0A 2OBXA 1TXGA 2GZDA 3L0YA 4F72A 3TBFA 1A9XA 2HK8A 2HX1A 1XK7A 3ESQA 1T1GA 1EM8A 1L8AA 3H42B 3OCUA 3G5UA 4HAYA 3ER8A 5CT5A 4DGQA 1KI6B 2VP2A 2CBGA 1F51E 2GJ8A 4TQGA 2E6KA 5KYKA 1OBVA 3KOYA 3INRA 2HA2A 4LRXA 3KPVA 4CN9A 2P90A 3VDQA 2XRYA 2H16A 3R3XA 5TPZD 2CSUA 1SCUA 3K0CC 3ZYZA 3QEOA 1RIFA 2VZ0A 3BGIA 4CT4B 4BN0A 2FUKA 4Q21A 4MP6A 4R41A 3VO2A 3TSAA 1V1MA 2DFKB 1EQUA 5SY4A 3JAWA 1E0JA 3G0IA 1XMPA 3R0XA 1E1YA 4O2BB 3DOFA 3U48A 3VR0A 3UJHA 2VHZA 1YD7A 2P2NA 3IAXA 1B0AA 5CGQB 2OM6A 3AF3A 5G3YA 1GTRA 3TEMA 1WO8A 1OXXK 2IZ6A 4NBKA 3UQZA 4QQNA 1UAGA 3H86A 2AF3C 3NBUA 5DCLA 4BKRA 5FL7D 1TCVA 1H2ZA 3LK6A 1VL1A 2WFAA 3L1UA 3TZQA 2C4KA 4ARAA 5AOAA 1GTMA 4LF4B 4LF9B 4XLLA 3E5HA 3MLBA 1KJQA 3I6BA 3QYAA 3HN7A 1HL3A 2DERA 2WBLC 3L8CA 4D8XA 4DR3B 1YZLA 3EZ9A 1CVRA 1FMCA 2ATXA 3DZ8A 3JWHA 4LDZA 4P83A 4Y6SA 2EX4A 4YGYA 3VPXA 1XZBA 3MGCA 2GZSA 5TS2A 5CDTA 4NDAA 4CKWA 2PBZA 4RPJA 1FX1A 1DZ3A 3JQ9A 3RHTA 3VZSA 4GC5A 2I4MA 1ZN8A 1DIOB 3CVVA 3IA2A 2YJGA 2PXHA 4OUKX 3TKLA 5JO9A 3ZHCA 5JYDA 2ZYTX 3CGWA 4ENVA 2RAVA 1IY8A 1U8AA 2DSTA 2LP4Y 4JJFA 1BWQA 3B53X 3FETA 1UEXC 1FMJA 2CN1A 3ESRA 2MMGA 4YMVA 2PGDA 2VJKA 2W2OA 4HB3A 4X1YB 4JFRA 3TM5A 3F1KA 1W46A 4PR3A 5IN4A 1YBFA 1YCFA 2O7NA 1M10A 1RADA 1JUDA 2VI5A 3CLHA 5KNLA 4CF3A 1U3GA 3KAJA 5EQJB 2GCNA 2LDXA 3GGJA 2YMLA 2O2SA 4RK6A 4LK3A 4PQYA 1EJ2A 4TOIA 3LPLA 1IUOA 4X7PA 4D0RA 1O08A 1SKMA 3WLFA 1RYHA 1CUXA 3W4IA 3GDHA 5KUTA 4S1PA 1IY0A 2CGEA 2PX6A 5TX7A 3TG2A 1XRJA 1YVUA 4R1SA 1JHOA 1UOPA 4B3TB 3BJIC 3EUWA 1W5SA 2VDLB 2UZ0A 3BERA 1RLOA 1PQYA 2IQIA 2RBEA 3IDZA 4UFOA 1AT1A 3OAAD 3AM3A 1P60A 3A1WA 4GI7A 4B71A 4A2CA 3M0EA 4RK5A 3WAKA 3MCAA 3QOFA 2IITA 2JFYA 4BO0A 1UPXA 1T4MA 2VHVA 3VR6H 3E4CA 3V2UA 2WDPA 5JTUA 1PR5A 5FWXA 2FAXA 3BMOB 4Q7LA 1IXSB 3EW7A 1ULZA 1SO8A 2PCJA 2X0KA 1T5OA 1MNQA 3QENA 4CTMA 3K6SA 2O8EA 4A6DA 3N86A 2F1RA 3EF3A 3FOEC 1S1MA 3QBVA 4HB2A 5DHPA 1E1KA 1UXKA 5FOUA 3B7WA 1YZHA 1W52X 3WWZA 2MSNA 3ILSA 4RLHA 4LJRA 3C70A 1G42A 5T4BA 3VPFA 1RFGE 1PJ4A 5ELXA 3NDIA 1RI4A 1HBJA 1HFEL 5IFKA 1ZH0A 3L6CA 4U7DA 5ESRA 1LJLA 1NAHA 2A0YA 2P75A 4FD2A 4M1YA 3MCVA 3EDOA 2ATIA 4ZEOA 3JV7A 4HXFB 3GLUA 4FQ5A 5FTNA 4NYJQ 1TAGA 5T8KC 4V0LA 3BIWA 2I3AA 5ABPA 1NBEA 2P6PA 3GW8A 4TUYB 3BGDA 4UNIA 1ZD1A 4BO6A 3T52A 4BNLA 4UQPA 5DWVA 3RT1A 3S7ZA 3KQUA 4EGJA 2V45A 3LUPA 3Q0TA 1DZIA 2MU1A 3K0AB 1L1EA 3QA3E 2FPLA 4HDRA 4MJ7A 1R0RE 5CTAA 1CJBA 3A1EA 1Y4SA 5DXAA 5IXJA 1OTYA 2JDIA 1N1EA 4NG5A 4ZRDA 2AFIE 1RQRA 3TRJA 1UWCA 3I2IA 2JBWA 3NHWA 4ODIA 4U9IS 4DLRA 2VDQB 2ZIGA 3FH0A 1FVFA 1YR9A 4B6FA 3OQVA 3AP3A 3CV3A 5DNDA 2B3TA 1NUSA 2EFJA 2WZBA 2GPNA 1C1YA 3C3EA 1AKUA 3RASA 4PSAA 1WU8A 3D6VA 1LDBA 3VH2A 1EGMB 3RU3A 1KSFX 3MWDA 1QP4A 1SUSA 1HKHA 3O5AA 5BQFA 1KI9A 2ZQ5A 3PHGA 3HJUA 4DRZA 3KOXA 3OE4A 3EZ6A 4QDXA 4CR7A 2CCJA 1GQSA 3NTUA 3C1UA 5K6AC 3PF9A 1ZQ1A 2V7XA 4LV5B 1HOXA 3GBPA 3W4KA 3WTCA 3ZGNA 4Z4FA 5H4HA 3EGDA 3PNQA 3P0FA 2DWPA 1U63A 2BEUA 1NXTA 1Z63A 1A8SA 3IOMA 3QLEA 2IDMA 4LRUA 3H2IA 1XAHA 2H63A 2MSKA 3WB0A 3EXG1 3BORA 3FGOA 1ZK4A 2ZJ8A 5HKLA 2DSNA 3ZVRA 1S2OA 4ZP1A 1E79D 3QV2A 2OHHA 1OBFO 4DQUA 1N25A 5A4MS 2VAWA 2SCUB 3JY6A 1NC3A 1JR2A 1OB2A 3HB4X 2HRZA 4HWSA 2X0FA 1B16A 3X1JA 4B6PA 4JK3A 3IMEA 1X42A 2YHSA 1T3HA 2V5AA 1PHPA 1IONA 4EVSA 4DPMA 2W6CX 3EOAI 1MRSA 3NWPA 5FH9A 4QHYA 3LYUA 3FZYA 4I50B 3RU7A 1PZNA 4UCWA 1CP2A 1TKBA 3H3FA 1TEZA 4C07A 1TUEA 1E6LA 3CEJA 4O4HB 1H6DA 3PC8C 5JH7B 1YQDA 2COEA 1V16B 3T7CA 3RRJA 1YUMA 3UGJA 1HE1C 5IBQA 2HREA 1PL0A 3AQIA 3GVCA 2PWZA 1H9AA 3WJ7A 3WNVA 1H1TA 4P4SA 3BF7A 3E22A 4J4HA 5BVGA 4BGVA 4C0SA 3M5CA 2AUMA 4NCHA 4EYEA 1GNRA 3PXCX 4FMCF 3E2MA 4FWBA 5AXDA 4Q1VA 3UKJA 4DR2B 5CB4A 4KFRA 1V7ZA 2JI9A 3HY6A 4P3XA 4WIAA 2CKMA 1GU1A 2WICA 4OJTA 2QRVB 3N2EA 4P7GA 2RHGB 5E3HA 2GNOA 4NYMQ 1RWOA 4Z1MD 3AERB 3KKPA 3SGLA 4N3AA 5JDCA 3TLKA 1EJ6A 1SQGA 3E03A 3G88A 4Y1RA 1HSOA 4MHTA 1GGVA 2FMHA 4MKXA 2XYGA 3D6TB 3QPUA 1Y3AA 5A1JA 5F23A 5BNTA 3N58A 2AJBA 2OC4A 3VYRB 4OGLA 1RI3A 3C16C 4DNFA 4YFVA 3ROZA 3I6QA 3TTXA 2ZVDA 3T7JA 3RTGA 1E2EA 1ZD3A 4IIFA 1STOA 2VSNA 4ML3A 4CWAA 2D1QA 2YV3A 3GF4A 3OFSA 4GR5A 3JD0A 1L4GA 2P91A 1EXNA 3KOWA 3MRVA 3QITA 3FDZB 4EHIA 2DFNA 2ZJ7A 3H5WA 1Y5RA 1OLSB 2PWPA 4RD4A 4HT3B 1MBZA 4GYWA 4X45A 5DGDA 1I7PA 2NNLD 1KYIA 4HPWA 4NL4H 4YLEA 4D45A 5EIAA 2WT4A 5K1ZA 1KK2A 2QSZA 2WMNB 3OLCX 4UM9B 1NJFA 1XZKA 4KXQA 1WCIA 1HDCA 5KU1A 4WBNA 2