5C35A

Constitutively active sin recombinase cataltyic domain - t77ii100t/q115r
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
124
structure length
124
Chain Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKQSGKSIENRPILQKALNFVEMGDRFIVESIDRLGRNYNEVIHIVNYLKDKEVQLMITSLPMMNEVTGNPLLDKFMKDLIIRILAMVSEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of a molecular swivel in action
doi rcsb
source organism Staphylococcus aureus
molecule tags Recombination
molecule keywords Recombinase Sin
total genus 40
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c35A00
3BVPA 2R0QC 3G13A 5C34B 1GDTA 5C32A 5C35A 2RSLA 4BQQA 3LHFA 2MHCA 5C31A 3ILXA 3PKZA 1ZR4A 1HX7A 3LHKA 2GM4A 2GM5A 3GUVA 3UJ3X 1GHTA 1ZR2A
chains in the Genus database with same CATH superfamily
1J2TA 1SELA 2XOKD 3DUFA 2YV3A 3RSLA 4EUEA 2G82A 1VFPA 1Q95A 5K3DA 4AJNA 5JFGA 1XLTC 2CCKA 1H66A 4A6XA 4BE9A 3VC7A 2XUOA 2P62A 5K2MA 5CA0B 3MB5A 3SMQA 3GP8A 1DC4A 4IXWA 3D0KA 1HQDA 4H3KB 3OA0A 5FCDA 2Z2YA 3IQIX 4MK4A 4YCLA 1PVOA 3ZE2B 5DEOA 8LDHA 2D1SA 2HSDA 3DHVA 4NMMA 3VR5D 5JNVA 5ECGC 1NYLA 3O7WA 4JR2A 1PLJA 4BV2A 2HCTA 3WC4A 3EOAI 1HT2E 2FRDC 4U0KA 2XV1A 2BGLA 1EHCA 3LMKA 4FSDA 1LPAB 5C8YF 3TPFA 5FBWB 4M0MA 3LK7A 4Z53A 3C6QA 2ZRKA 3MOIA 4R0MA 1P2BA 4HEHA 4AQYB 1CU1A 1CXZA 621PA 2PSSA 3QOXA 3AM3A 1KNQA 5CFNA 3CW8X 2QTTA 1UM9A 1T8UA 4EYKA 4DDVA 1EJ0A 1PR6A 2P2ZA 3UXHA 1E9VA 3P7MA 2XUPA 2Z9DA 1GT6A 3B51X 5A5VA 1YQUA 2BFFA 3SJCA 2YNMD 4TVBA 1XROA 2VKTA 3FJYA 1FA9A 3AYZB 3OVMA 5K6AC 2D1YA 3KQKA 3A1DA 4R1LA 3WKDA 4GP9A 1RI4A 5BSKA 5HQTA 1UK8A 3U3RA 1SQGA 1CUSA 2ZM6B 2QTAA 4KYIB 1K2WA 2BEWA 4JJ8A 1L5WA 1U2DA 3B2NA 1WB5A 1CP3A 1IONA 1QO9A 1ZGBA 2F9FA 2EFDB 2PG3A 4L2IA 4LK3A 4YONB 4L95C 2YX1A 4RPHA 2X5OA 3K0CC 4IJWA 5LMNB 1GNTA 3ZE8A 3TX6A 2PXCA 2DSTA 2C5GA 4IZIA 2BFFB 5HJEA 4TZ0A 3D3NA 3QEOA 3RUAA 3AF4A 1PRYA 2RK3A 2VHEA 4FJ1A 2K2WA 4D8VA 1SXJD 2VCHA 3OZTA 4OBXA 4YGYA 3AJRA 2OD2A 4RLFA 2Z8XA 3KXIA 5HFAA 2OZLB 1MB2A 4RY0A 4K2AA 1UPCA 1V71A 2JGRA 4Q4HA 4F5YA 1F12A 7MDHA 1AZWA 5L6MB 4LY9A 5I7AA 5BP7A 1YB4A 3PE4A 1SVNA 1HTTA 1Z34A 3WBKA 3AIMA 3QP9A 2YY7A 5FO0A 4GBJA 4P54A 3UT6A 4A4DA 3AG6A 3RASA 5I4KA 4RTQA 1OHHD 2NO9A 3H0EA 1AKEA 2V4MA 3L49A 1BE8A 3CR7A 4EGQA 4D79A 2Y1CA 2H18A 1GAJA 1L7VC 1QF9A 2OMEA 5F76A 5GV7A 2OXCA 3WICA 2I7DA 3AINA 1SCUB 2RONA 1K89A 1QGDA 4NU8X 1QAOA 4P82A 4ZKEA 2ZWVA 4Q3DA 1FFBA 2EW8A 5T3UA 1QCZA 3L46A 3UWSA 4P4SB 4AN4A 4GLOA 2JFNA 1GPKA 4EHAA 2VHZA 4HDCA 4G86A 3OFNA 1P1RA 1YFJA 1S1MA 3F47A 4FGKA 5CIWA 2C98A 1Y37A 2H57A 3I4CA 3PFFA 5TXGA 4QJ3A 5EIBD 4B87A 1MRSA 1V6AA 2HA4A 2BEVB 4X62B 4DR1B 1I4DD 3S2IA 2ORIA 3WMXA 4LPSA 4AMYA 2O8EB 3GAAA 1AS2A 1C80A 1YZKA 2YCLA 5KDOA 2DHRA 3ZWXA 1O94D 4FEAA 4MVCA 4HVAA 4MZXA 4KDEA 5CXSA 3D5QA 2BI8A 3Q11A 5FL7D 5SY4A 3DZIA 4CCYA 2QRMA 3WB0A 1JG4A 1GU1A 1HDEA 1Y82A 1VRVA 2C82A 2H4XA 1IPFA 2VDPB 2ZWOA 4MZDA 4ZJUA 4ZQEA 5TQVA 2C7VA 3KJGA 9LDTA 3WLLA 1M2KA 5HR5A 4B44A 2YJ3A 3FZQA 3VTFA 5JYCA 2VPXA 3TKLA 3EH1A 5KHAA 4B4WA 1SKAA 2F00A 1LRJA 1NW8A 4HRXA 5LLTA 1XCBA 4IUDS 2W48A 4EQZA 1JPUA 1ZIPA 2QZPA 2A9JA 3OJEA 3QVGB 2IXEA 3MVEA 1UADA 1UMDA 4GI1A 4B80A 2BFBA 3M6MD 5F9MA 2O20A 4AJ9A 2G25A 3ISJA 3KQOA 4CQMB 3A6PC 1FRNA 1IE3A 2Q1TA 3R7LA 3WWEA 2H2WA 1Z6ZA 4ARZB 4IY1A 4Y2TA 3PHCA 1ESNA 2ISQA 4UNQA 3RCBA 1I3NA 4MRRA 4RELA 3NHSA 5FTKA 3RS4A 5FEUA 4TT8A 4M0CA 1KGSA 3V8QA 4AMUA 4L8GA 4C20A 3TDMA 2JJ8A 3T5BA 1PS8A 4LHWA 3BQNB 5LKRA 4F45A 2Q6IA 3GFGA 4Z7QB 5JSZA 3OKFA 4WLFA 3ZCRA 2X0DA 5ERGB 5KYTA 1JR3A 5A4AA 3H84A 3HBMA 5HZGA 4GXQA 2EEPA 1V95A 3AB7A 5FA6A 3A6EA 3DEIA 2BFCA 2I99A 5H82A 2MMCA 4OXRA 4B46A 2X3UA 2PKYX 2JIZA 3PUVA 4XDZA 2QJOA 5AT1A 4BVAA 2FWPA 3EQZA 3T06B 3OF5A 3A7EA 2G40A 2GZ1A 4FYPA 2HLNA 4CIWA 2BLNA 4YJDA 3AETA 3ICVA 2FR1A 3G8CA 1A69A 3H1TA 3HWSA 3MMSA 4FEYA 3ED5A 2Q0XA 3GJ0A 5DT9A 3BFVA 2IA5A 3QBTA 3QPBA 3A6LA 2ZPAA 1MX5A 1PR0A 5EJ2A 5K6TA 1U0BB 1Z4IA 3CTMA 1EJBA 1TUGA 3BGSA 1W0JA 2VNKA 1I51A 1Z28A 4M4SA 4QL3A 5LQJA 3FHCB 3A1CA 4FNGA 4PCUA 5KUTA 2NU9A 1UFQA 1VGVA 4PG5A 3AUAA 5IK2A 3K9FC 3O3NB 4BZXA 1QMGA 2GERA 4FMBB 3SBXA 4YRKA 5IZ4A 4E12A 5ED4A 1RAAA 1XVUA 2BC9A 1AKQA 4R9SA 1NT4A 2AG8A 4DYVA 1IQUA 5ALJA 4QPDA 5HKKD 1ONSA 1MAAA 1B76A 2FTKE 5EP3A 4PYNA 3UM9A 4CFSA 3IUPA 3TZ6A 2SECE 1S3GA 3I5AA 1M6VB 2Q27A 2XPCA 2QNRA 2VYCA 3V2IA 3L8YA 3F9RA 1P8JA 1JIUA 2C31A 4M0PA 4ZI2A 4OLAA 3IDQA 4M0UA 4R8KA 1IPHA 2D4AA 4HI0E 5E1MA 5COAA 2MHCA 3ER9A 3PQDA 2YOGA 3BE4A 4OGGA 1XMXA 5ARDA 5IVHA 3IUJA 1D1TA 1NQUA 5C0OE 1U8AA 1V7QA 2Y1DA 3MSXA 4XKJA 3VKWA 4BMOB 5CEEA 1XDWA 4LV6A 2E21A 5IKMA 4IIFA 2JCGA 3IJRA 2HUNA 1SIBE 4YJ3A 5IMSA 1LRLA 2MOKA 2YQ5A 2YV4A 4QYSA 4FCWA 4B48A 1JSXA 3JALA 4B2IA 3I53A 1FS6A 2GZDA 1XRLA 2VCEA 2YIJA 2UXBB 1T8SA 2H1CA 3IUMA 5B1IA 2HTFA 4PO1A 1K3FA 4MPDA 3TSAA 1XDSA 1C7JA 3KXPA 1Z88A 5EWMB 1F48A 3LV8A 3SHFA 3EB9A 1NSYA 1W88A 2O2XA 2BISA 2FPIA 4X1KB 4KWIA 3EGXB 3AONB 1MQ8B 5E6RA 2NV6A 4FFRA 2ABWA 4IW3B 3N28A 3H1BA 2CBXA 4OKIA 3ZN2A 3ZUPA 1TM4E 5C4IA 5CT6A 3UMGA 2EXXA 3DC7A 4GPIB 4K87A 2PUTA 3RVDA 2GCIA 1XC7A 2AEJA 3T12A 3EGOA 2GM5A 2X0KA 3AESA 5CHYA 4P4LA 1V47A 1ZC4A 3A2KA 2YFKA 1MJNA 3HO8A 4LN1A 1TA0A 2DY0A 4Q9HA 2X5KO 4KQXA 1GPLA 2P6NA 4J0EA 3PUYA 3AH8A 1JKXA 3TBFA 3UT0A 4C06A 1OZGA 1BGWA 1WO8A 1LLCA 3ZHTA 1XKQA 1BJTA 4FFDA 4HKTA 3H5RA 2FU5C 4GPD1 4HPWA 4MVJM 4TGLA 4TLDA 2FMHA 4RE6A 3SZGA 1W4CA 2B8WA 2Y4NA 4H3HB 2AQIA 3ILVA 3QVKA 4PN7A 2XADA 4DLTA 4CKCB 3IS3A 1KO7A 2FP4B 2RBEA 1YJQA 1SA0A 3P9NA 5CFLA 1F7UA 1BVHA 2HLPA 3DDUA 3UUGA 4AG3A 1L7XA 3KZ1E 4S05A 3QEKA 4CLEA 1UXHA 3IHWA 1KARA 4JUAA 2MSKA 4C4ZA 4I0WB 1X87A 1C7IA 2HQBA 4L57A 2F43B 3PEWA 4O4JB 4EKDA 2WM9B 4RTJA 1RWKA 3E81A 1Z68A 3BHJA 2ZEJA 1J0DA 2MSWA 2YMLA 3OOYA 1E3EA 3Q9LA 4XTCS 5FTNA 1U5BB 3L4KA 1KI7A 2QPTA 4M9CA 2C57A 1RAGA 4MO2A 5EIWA 5ICGA 5KU7A 3WLQA 3ME5A 1PYGA 5BV0A 1MB3A 1IZZA 4ITVA 4UBOA 1CS0A 4BN0A 4KQ2A 3NO4A 4BV8A 1SXGA 4JITA 2YNMA 4XYBA 1IPEA 2QUZA 3OCZA 1M0SA 1ZN2A 2RGDA 1ZUNB 3KM0A 1DWPA 5EINA 3W6NA 3NRJA 2GDZA 3RGWS 1E7QA 1GUAA 1PBTA 3KPYA 2B4YA 4IVNA 5EJ4A 4I5IA 2Q0QA 4LTNA 5FAXA 1FK8A 1S8AA 2X76A 4Y6QA 5IYZA 4R1TA 4C7BA 3GQBA 1A8QA 3VISA 3DE4X 4G4SO 1GAXA 1RFLA 4BVKA 4P6VF 2FN3A 4E22A 1E2IA 1M1YA 2OV3A 3LKVA 1K6IA 1F8XA 3DMTA 3WMWA 1J8MF 1QC5B 1R4NB 4JT8A 1KP3A 4PHHA 3TB4A 4Z4QA 2EERA 2QN6A 2O3SA 4OL0A 5B36A 3RTEA 1V9CA 2DULA 2IEIA 3D4BA 3KVNA 4QLOA 3S27A 3SKYA 3NBAA 4UTOA 3TPZA 3LWBA 3BB4A 4V1CA 4B6OA 1IOLA 1KK3A 2C2YA 3I8XA 2OZVA 1H9BA 1JE0A 1YIAA 5KJEA 3ZGNA 4BP9A 2HU7A 2ZBUA 3EBLA 2G1KA 1A4XA 1K68A 2LZ0A 3B70A 4IR7A 4JLMA 4MUAA 1WLSA 2RKBA 3AZPA 4PONA 3ANTA 3S68A 4JP8A 4JK3A 5D3ZA 2OEPA 2P9BA 1H0KA 1R6BX 4O4HA 3VNAA 3KUKA 4CJXA 2C7OA 3AYXB 1AK9A 2BFBB 3IJEB 3E0QA 3W4KA 6YASA 2YJ6A 1KIAA 1M0EA 2V6GA 3LO8A 3KUUA 5BNFA 1Z0JA 3O83A 3EQ9A 1GQSA 2OVFA 4MVJG 1VSTA 5T6MA 1Z18A 2Y1LA 4IEEA 1XZJA 5BV8A 4QUBA 1DJPA 4NSNA 4GEKA 2IY7A 2O2YA 3QKTA 4P80A 4ASUD 1QTRA 4QQFA 1LK7A 5AESA 1PVDA 1SQ0A 3S81A 3FGNA 1UK6A 3T3EA 1UXIA 2NN3C 1O0SA 4MA4A 3TM5A 4UXHA 3E8MA 3UK1A 4FGJA 1GTSA 1DZ3A 2W4MA 1Z37A 2QRKA 3KUXA 4M88A 5HFNA 1JIXA 3ACBA 3EDCA 4BE7B 1PG0A 1ZJJA 1VHJA 2AOTA 2GHIA 3GIWA 3N0RA 4H7JA 4K9DA 4KWTA 5JVDB 1OBFO 4M7OA 1OU0A 4FWTA 1R0KA 1LPMA 1RQ7A 1YD7A 3UYKA 3I04M 4RANA 4ATNA 4HH4A 4Z8YA 3HMKA 4A5OA 4E4YA 1AXGA 1MVNA 1US8B 2BM1A 3PVSA 3GRVA 3HA3A 3LY9A 4KQ6A 4NBSA 3LHSA 4OSOA 5KDLA 2MR6A 2J5XA 3USZA 4ETNA 5HIKA 6GPBA 3ZE7A 4ZREA 5K0LA 2R2GA 2WRZA 4WUVA 3F6PA 4DMKA 5F3RA 1LNQA 2JW5A 1GD1O 2XQKA 5CJPA 5A0TA 1XMPA 2ZS9A 4HYTA 4YREA 1BWRA 4GICA 1ZD1A 3K70B 4YX9A 4L6AA 1E32A 3EFHA 4JI4B 3ZE6A 1H1TA 1TQHA 4JFRA 2EYUA 3OOEA 1D4ZA 2UZ0A 5KZMB 3QIAA 1SUCA 1MT3A 3RE1A 4BFSA 3FBTA 1A8PA 2OPBA 4PR3A 4FKBA 4KVGA 5EVJA 4M22A 4PX2A 3TQIA 4EATA 3QPVA 5H81A 3OLYA 5IG2A 2C7QA 1S3IA 3T99A 1J06A 3OPMA 3HVJA 3AERA 1VZ3A 4I4CA 2WIDA 1T0UA 2QR3A 3MNFA 5E9JA 3GVCA 4LBYA 4LZOA 3WOHA 4Z1OA 5DGTA 4DQXA 1RD4A 3FFBA 4ZYLA 2WFLA 4R81A 5DNVA 3WWCA 3B3AA 4KKVA 5JQWA 2PUWA 1XKTA 2E49A 3C3YA 2L18A 5IH7A 4ICIA 1C3OA 1U0LA 1E7WA 2QUJA 3FF1A 5TVGA 2XBUA 3W5JA 3WLOA 3U5TA 3FSGA 3LQRA 2IV2X 3A36A 2ZJ1A 4FS8A 2ZBDA 3IAS1 3UH1A 2NVBA 4MVJI 5I9SA 4BIMA 5DHAA 2JCXA 3A1NA 3L4BA 3KTOA 1RTTA 3M83A 1JG7A 2D7JA 1T3LA 3BM5A 3FLBA 3IYLW 1J2JA 3QBVA 1EB9A 4MYHA 3B1JA 4IZHA 2C94A 2XGSA 4EJ2A 1L4EA 4CHTA 2PYDA 5C46F 4A8JC 4C6HA 2PGNA 1CUIA 2YFHA 1R5BA 4H3SA 1XHFA 4K6HA 4QBHA 4QFCA 3U7EB 5AVUA 2XZLA 5DXAA 5SZJA 3KQPA 2AE2A 3R0IA 1K7YA 1KYZA 2Q0HA 4EF4A 1SPXA 5JY1A 4R69A 2P0EA 2ETXA 3KOOA 2IYRA 3SIXA 3CZ4A 3DM5A 3RVLA 4BB6A 2HQSA 1Z15A 4A36A 2P3SA 3CX3A 4AFNA 4Y2UA 2C5SA 3JWIA 2L17A 5HKOA 1KYTA 4IPTA 4M8SA 4M7PA 1ULHA 1PGNA 2AOWA 4LJSA 3JTMA 2CYBA 1XQXA 3KOUA 4MEJA 3VKFA 1SKYE 1I94B 3T9CA 2QGFA 4MQLA 4P3OA 3L7OA 3C5EA 3TTUA 2RGUA 3TMAA 4US2R 4H0FA 5DJ5A 1IB0A 4DRYA 4L5AA 4UMFA 4D25A 3ON5A 2K87A 4FHGA 4R6XA 1DTSA 1HE2A 2G9VA 3CH5A 4J1TC 4X1YA 5K0TA 2A0WA 4KI0A 2ZJBA 2I3BA 4O8ZA 4OI0A 2XYRA 5BSMA 3B1FA 3AM1A 3R9XA 2RB4A 421PA 4ZHSA 1VJ0A 4YV1A 4KXYA 1TZBA 1UBGA 4JQSA 4FBLA 3V4LA 2CK3A 3FMFA 4NEQA 4L5JA 4FW8A 3R7WB 3SF8A 3IO5A 4C4RA 1EX6A 4J0GA 4RS4A 1T2DA 3R20A 1JKMA 2CLMB 3ZXSA 1YULA 1A8SA 1TGYA 1PIWA 5C2JB 2BTQB 4EIWA 3WLJA 1FVOA 3I62A 1WCIA 5DYGA 3OEED 1WW3A 2NTVA 5JXWA 3OJLA 1WF6A 1EDEA 2YW2A 3HB0A 1QYVA 4DBLE 1IVSA 2QRNA 2YQZA 5KYXB 1KY5A 1N2IA 1TCCA 2VQEB 3ZKWB 2BGTA 3NM6B 3EMVA 4UM9D 3ZVNA 4ZO9A 5LLSA 4BZZA 5ALDA 4KDFA 2JGNA 1QH8B 5E1OA 1B73A 3TQQA 4YXFA 1RKBA 4JI3B 1HETA 1YS1X 3ASVA 1TCAA 2GBLA 2AC7A 5ALUA 3RSSA 1ONBA 2G5GX 3E5HA 4B17A 2PUAA 2IZZA 3WGQA 5IT0A 4HAXA 1JDTA 4TV9F 3L41A 3JX9A 1JHDA 1TJYA 1YASA 3DDOA 4YV0A 1G55A 3QFCA 2CDBA 3EOBI 2YZ2A 3NHZA 4KOAA 4QRIA 5CGQB 2H51A 5JBIA 2AZXA 4MDFA 1A5TA 4ZOEA 5IWCA 3ZY5A 1I4TD 1KDZA 1SXJC 5EZSA 1XVAA 1ESEA 1CZKA 1KVTA 3BYZA 4P81A 3CCFA 4GVXA 1U7XA 1HDOA 3PJGA 4PGGA 4PQEA 2WSYB 1EYZA 3NV7A 3OQIA 1RIFA 1KH1A 2ES4A 3C0KA 3DAGA 4JX8A 3C7CB 3HXOA 3TZBA 1X42A 5JALA 2PD3A 2ZUVA 2CVZA 4D2IA 2Z0MA 4D8XA 4LF6B 4HAUA 1Q1QA 1IN1A 3V5NA 1M8GA 2OFOA 3PRHA 1EFCA 1GRNA 2LIPA 3O38A 3RW9A 1ZCBA 1BCRB 1OA1A 2F3PA 4O59O 4Q82A 5FI5A 1TRKA 4BAGA 2A86A 4YP0A 4JXZA 1PR5A 2ECOA 3MWJA 2FWMX 3K6SA 3TFOA 1GGNA 2QSZA 3CRVA 3G9UA 2XUFA 2YVAA 3QJ5A 2NVWA 4EYSA 5EJ7A 3QGMA 4CODB 5HQ3B 4MUJA 4KR0A 2ZJFA 3AL3A 121PA 2BM0A 1CYEA 1THTA 2I62A 2OQVA 2DFNA 5E1DA 3DAPA 2ZWIA 1D4AA 1QMPA 2Y1KA 3LUGA 3OCCA 3WYDA 5MN6A 3EFBA 1WEKA 4QOIA 5HE8A 3HDTA 3HDVA 4TMFA 3ZZ1A 2J0EA 3DBRA 3LQKA 4L78A 4WXEA 1DBVO 2ZRAA 3KT0A 1DDOA 3THOA 5D01A 3W6PA 5AK6A 3UJCA 1VCOA 4JODA 3ZHZA 5DN6D 5E6RB 2Y0BA 4MOWA 4Z9AA 3ROQA 1KBOA 4S12A 5FPYA 2FN9A 4Z4IA 2Y4OA 2EYQA 1O4VA 2R751 1X86B 3K1AA 3TXYA 3UV3A 4E5MA 5DNCA 4A16A 3LE8A 2JLUA 2WICA 1X77A 3TD9A 1E62A 1M1NB 1PJLA 2NYUA 3QFRA 4K9PA 1YOBA 3KQUA 1ICIA 2NUBA 1RADA 2P9FA 4LC0A 4ZOBA 1WU8A 2IEZA 4ZT5A 2X0NA 3CVYA 4MGHA 2YRXA 2XA9A 4ZQFA 2PRYA 4CQLA 1P5RA 3MGKA 2FPMA 2VRCD 1Z35A 3NIWA 3ORYA 3RC7A 4Q05A 1B4DA 3B6JA 1FXUA 4AKTA 3X1XA 2JL1A 1NQVA 4LTDA 1BS1A 4BUJA 5CM9C 3D8UA 3LM8A 1ZH2A 3THWB 5HCNA 3WZMA 4CEJB 2D4HA 4LXQA 4B32A 4HEJA 3KSDO 4NJMA 3V4RA 5PGMA 2GCNA 4KNVA 4NDZA 2GT1A 4LISA 1U4SA 1IG0A 3PEEA 5EP1A 4C43A 1DXQA 1T2CA 2YFQA 2VP2A 4J7CA 4XOIA 4QD3A 4RSHA 5TSDA 4NXNB 2GTIA 3U4DA 5ABPA 3RIHA 2QV0A 1P19A 1Z4PX 3PUZA 3RYIB 5LUAA 4KO8A 3SBOA 2EFCB 4HC4A 4CT5A 1QTNA 4HPJB 1AOXA 3QU7A 4R4JA 3NJRA 2B98A 4P35A 2I29A 2QL6A 2VBGA 4S3MA 4HUTA 4ZI7B 2XB2A 1XLVA 3Q7QA 1J0AA 2DZDA 3WXMA 4NE9A 4IJ6A 5G2OA 1L7QA 1BKSB 3LY7A 3PUHA 4LF9B 3UKJA 4AL4A 3VO2A 2OXTA 4FUTA 2JDIA 4R1PA 1YE5A 5IARA 3UK7A 4ALIA 4P2BA 1T36A 4HH1A 4ZT4A 5I7HA 3AX6A 3OI7A 1OIWA 1B0PA 1ZIXA 4KW7A 4EG0A 1YCDA 3EXFA 1Z0DA 3BF7A 3V3KA 3C15C 2V3CC 3FFTA 4I6JA 2A8YA 1NYQA 4F3YA 1WHTB 3P52A 4HGQA 4JEMA 4F9EA 5LD2C 4GOMD 2XUHA 4CTOA 5C32A 3Q3IA 4AQ7A 1EFTA 1NC3A 4MW6A 3VO9A 3JD1A 3MLBA 2IYYA 3VPAA 1T3GA 1HORA 1X8LA 1LU9A 3NHAA 1L7PA 3HP1A 4K9LA 4Z8XA 5JCXA 1WDTA 2VO1A 2V3VA 3K0EA 3M33A 1X1EA 2PGLA 4IEFB 5FAKA 5F73A 5K51A 1E63A 4KXQA 5KYKA 1QIFA 2VWPA 2XGOA 3HFRA 4HL6A 4LSZA 5CTJA 1KQPA 4EJ6A 4LF4B 1WUIS 1MCZA 2HCJB 3MWFA 4X93A 1DHTA 3GUVA 3E27A 3SYTA 4W9RA 1WD5A 2II6A 1BHQ1 1ZWKA 3Q9SA 5FT9A 1DCTA 3NWPA 2RGRA 821PA 3R7AA 2TS1A 3DZCA 2E4VA 1RHKA 4IL5A 2MTBA 1TIBA 4LZAA 2YHBA 4PU0A 5GY7A 3N2NA 2W93A 4F85A 4P22A 3W5VA 1EM8A 4WXMA 1CBUA 5GM2A 2V1UA 3ENZA 1XCOA 2O7NA 2QRLA 1P17A 3ODPA 4NWIA 1P9LA 2Q5IA 4DV6B 1APBA 2NOAA 2C7BA 4G8DA 1N5JA 1R5OA 2XMZA 3CF0A 4UHFA 4Q3CA 4PNEA 4YRMA 5I7FA 3BILA 2O48X 3Q87B 1XEWY 1VL0A 4JWTA 5HUHA 4EHBA 1KI6A 4FCTA 4DEYA 4GSYA 4EAQA 2J87A 2OCIA 4AS3A 1MW8X 1UKYA 3CLKA 5HYVA 4XQ0A 3Q3GE 4YAEA 13PKA 2E4WA 1PK9A 4A2WA 3F5SA 3FJ1A 2W2XA 3KKNA 4GZ3A 4DHWA 3HYTA 4LYHA 5DCUA 2ZAIA 4D4JA 2B7BA 1GPDG 5D7NA 1QE0A 1LF5A 1LDBA 1MO6A 3Q7PA 1T4BA 3M2TA 4Q3EA 4XLZA 2XVMA 4D44A 5ADHA 3PENA 1C3VA 1FE8A 2PZAA 3BWVA 3EZ6A 3Q3HA 4LGVA 5AVOA 2FF7A 3FW1A 3JQ7A 4ZZ2A 1YAJA 3SHOA 4A03A 4EJFA 3AHGA 4MUHA 3KDSE 4CNQA 1O87A 3OQVA 1KYQA 4MV5A 4UHKA 4J29A 1TEXA 2IOFA 3NP9A 4RS3A 4U63A 3SI7A 1XALA 4HMPA 2PGAA 4E1BA 3FCXA 2LDXA 1I5RA 2ZK7A 3AHHA 1E3WB 3NTXA 4YC7A 1V1MB 2H2FA 4WXRA 5DT2A 5AFSA 2EQ5A 4IQ8A 2D7DA 1ZMOA 3CY6A 3INRA 2C8VA 5JO0A 1JI0A 1YVEI 2ZB2A 2V96A 1S9DA 3OJ0A 1DQZA 3A58B 2QSYA 4QYTA 4WI1A 1L4LA 1JWAB 2R6R1 4BZQA 1HDYA 3IVMA 4FINA 4LDAA 4TKVA 5LVAA 2A4MA 2C3OA 4DLXA 1N0UA 1IH8A 2HMVA 3N2KB 1BKYA 4J94A 1RDFA 1Z7WA 1XN4A 4N5HX 4O33A 4RD6A 4GECA 1NP6A 1XELA 2VK1A 1KFKB 4UHDA 3UNXA 1QFYA 4C4TA 3I2IA 4XQCA 1ZKDA 4UNSA 1AN0A 3AKDA 4UAVA 2WVHA 1VRCA 3KEOA 4RXUA 4Y6SA 5FBKA 1IQPA 3ZJUA 2JLBA 3F5FA 4AS2A 1SUEA 3PQ6A 1PG5A 5ICSA 2ZUFA 2AFIB 2P9CA 1MAVA 3KL4A 3ND9A 4HTFA 5FUXA 4XIFA 3CRRA 3QMWA 2CLCX 1UDXA 5ALVA 1JBQA 2A1TS 3OJWA 2OV8A 3BG5A 2DBVO 1CRQA 2FUCA 3QKWA 3RAJA 3PJRA 2H8GA 5ER9A 3MBKA 3W8RA 1D2GA 1JYSA 3OT1B 3I64A 3LX8A 2OQIA 1SXHA 3T61A 3COPA 5IT9A 3UICA 2QT1A 1GOTA 3ZGOA 3VR3D 1GA4A 4F5WA 2HREA 4L8WB 2OT3B 3UOAB 4HNVA 4M2LA 4CTMA 3QJGA 3D4LA 3WLIA 1JSLA 4RMHA 5ECYA 2AE1A 1H9CA 2VN8A 2A0FA 2FG5A 2CFIA 5T7BA 3NPMA 2E48A 1UBEA 2VJQA 2BEUA 4RIGA 1KZ9A 1JEOA 1HDCA 2RIRA 2YV1A 4GLBA 4QVKA 2P3OA 4EHKA 4MQ5A 5AVKA 3RK4A 1DQPA 4N1AA 1F6WA 4J1SA 4DLYA 3D7KA 2W6NA 3L7YA 4DA7A 4EGCB 3SC4A 5G0SA 3KR0A 5ES3A 3DULA 1X19A 1E20A 2QP9X 2QMZA 3K2IA 3RK0A 3L4EA 5BNTA 1ACLA 4EW2A 5C7LO 1SWWA 1V3VA 4A27A 2CXRA 5FOQA 3SSAA 1KZ7B 5AHOA 2L2QA 2VC2B 2EIHA 2FNAA 5KU1A 1GZUA 1ZRNA 3PF9A 4YCDA 3JARB 3E3NA 3PD1A 5JJCA 2YWJA 3CZCA 1QJ4A 4JKIA 3QVLA 4EYQA 4YJGB 2IC5A 1VYHA 2FWRA 5KAMA 4Q12A 3NT5A 4FFVA 4FLFA 3MCZA 4G0XA 1M75A 1EVEA 4TTQA 4ZDIA 4QULA 4BFVA 1ZHOA 5F2OA 1HTBA 2JJ1D 3GROA 3I8SA 3I1YA 2REQA 4KO3S 5FXMA 4DM3A 2GBCA 1XD2A 5KYVA 5B6JA 2RMKA 3H5LA 2IXFA 1F4PA 3I5MA 3IRVA 3LF1A 1J97A 4I1OA 4PF1A 1KSHA 3DW3X 4LX8A 1FNCA 4U9UA 1KI6B 2FKNA 2Q8PA 5SYAA 2QGZA 5FIUA 2I9PA 1N2SA 3WLRA 3SYRA 2REOA 1EHYA 3NDIA 4BN4A 4JJEA 4I50F 3FDJA 2BEKA 1P6QA 2GGSA 3G0DA 4C0AC 1QHEA 1Y9JA 1HLDA 4MVJA 2BF4A 4IKEA 4YP5A 2Q2NA 5CCDA 3Q8KA 2CD9A 1DLIA 5DBEX 4E32A 2Q7OE 3OZEA 2PAFA 3H5TA 5IT4A 1EIWA 4W7IA 2CFTA 1YRQA 3IVRA 4IWYA 1Y5RA 2P79A 3M6WA 1PV1A 3GZ4A 2RCNA 5HKKA 3OY7A 2XNDD 4GH5A 1GG9A 3EBPA 3QSYA 1Z17A 2DHQA 1QZ3A 2PIAA 2F17A 1LD3A 1DQSA 1FNMA 1UKAA 2ZIAA 3BWYA 3JAWB 2EL9A 4N03A 1NSTA 2PR2A 2YZNA 4XXHA 2YUTA 2CV0A 4GI7A 1OFVA 1GUFA 1WMSA 4Q24A 3TD6A 5H0IA 3ZHSA 1ADFA 1W0JD 2I6UA 2X9NA 4IG4A 3NDRA 1XZPA 3PNVA 4AJHA 3TNYA 4F56A 1A04A 3N6XA 5I7RA 3TZQA 4UREA 2KX7A 3GEBA 3LSTA 5IM4A 2DYKA 5AI4A 3Q98A 4YRLA 3B9RA 2D6FA 2FSIA 1YK1A 2HDWA 4F6RA 1QNLA 2GN6A 3ZDYB 1GRRA 2OHXA 3OZIA 3GGCA 1U1IA 2GZSA 1JI3A 3EXEB 1Z7EA 4F11A 2XMQA 5BMVF 1NI4B 2GF0A 4XEUA 4MUFA 1GL9B 4H18A 4KIJA 3DZDA 3QW2A 5ESRA 1X1QA 4NE2A 1H9AA 2I2BA 3D1LA 4OHPA 1BHO1 1SEPA 5EERA 1YBVA 2I8LA 1ISFA 3WGTA 1B23P 1CEEA 1VIAA 3RVMA 5DN6A 4QATA 3K6KA 1KQGA 1A9RA 1NXPA 3KQSA 2XEDA 4AO8A 2PWAA 2V7XA 3GLQA 3T7DA 3DQQA 5A02A 3UHAA 4MWDA 1HYGA 4LF7B 4F46A 4EA8A 4G24A 4H3VA 2V45A 2X5JO 3GOHA 4GVLA 1TF5A 2NXCA 1OI3A 1Z29A 3CMMA 3OBIA 2LBPA 4Q4DA 4YAGA 1RAHA 1T4CA 5KOJA 5D3KA 1Q20A 3LHDA 1FFGA 1RQNA 4FYJA 2O6LA 4N5NA 3USES 4RD1A 1VI5A 3VU3A 5TGDA 1H2ZA 2NZXA 2BR5A 5CPFA 3RRBA 3HRKA 2ID7A 1NVKA 1PNRA 1YO6A 3KRTA 3E18A 4KUGA 4F8JA 3QV2A 4BJHB 2WD7B 3AEXA 4QICA 4YRNA 5BNIA 1Q14A 1K6EA 1WCYA 4OK6A 4WBXC 4B83A 1KL7A 3FOEC 3U3ZA 1U0HC 5BWLA 1OZHA 2X2PA 3ZXUB 4EFMA 5KREA 1PAUA 2PVSA 5CT9A 4ZC8A 4AP5A 4MIEA 4QFDA 1HGXA 3OQ1A 3U9TA 2D7CA 3UQYS 2ODBA 4D8UA 5DLYA 1YU6A 4DE5A 3V2GA 2B4RO 1WSAA 2P30A 3GNQA 5HIAA 3U61B 1FNNA 4CL2A 5CH3A 3JQ6A 3RJ9A 3C5CA 2O1SA 1HT3A 2I6TA 3KFVA 2H5JA 4YUWA 1K7CA 2ZIGA 2JKYA 3MBOA 1X7XA 4NVRA 3JVDA 5ITWA 1XTUA 3MJRA 4K9QA 4TRMA 5J2TB 2PMKA 1GZDA 1Y3BE 2QN7A 2X8AA 3PU6A 4BO9A 3LW7A 3GZJA 2ZUTA 2XDWA 4XUEA 2ZPTX 3ZDBA 2EQBA 3VMMA 1ID1A 1AQLA 2WJVA 2CDNA 3KXKA 2H29A 3NB0A 3O6VA 3O4IA 4JYCA 1Z7BA 3UQZA 4ZZ0A 5JJLA 2YJNA 3UKDA 2XLBA 1PWYE 3CN7A 1Z0FA 3FGZA 3RVSA 3H97A 1H2WA 4P31A 4LVNA 2AN3A 3A6HA 2PT9A 1K06A 5J2TF 4HDRB 1KRHA 4JGGA 5CX1B 1SHKA 1XVVA 2NU8B 4B33A 4EB6B 2FY8A 1WU7A 3CRW1 2DOKA 4J1QA 4ZAXA 5B2ZA 3U62A 1U8FO 4IUYA 4Q1EA 5K01A 3CLSD 4CQMA 3QRWA 1FBTA 4U6SA 5CK4A 4DREA 5K0ZA 2QYTA 5K0JA 2O6HA 5T41A 4KRXA 1J9ZA 4M1MA 4JJIA 3ZD9A 4WKCA 3R5SA 3X0DA 2D3TA 4R8RA 2VIIA 2O1WA 4RGQA 4RU1A 4YRTA 2VHJA 1YUMA 4BEWA 3D3JA 4AURA 7REQB 3UENA 1DBWA 4HWPA 5LUBA 4EVQA 1N6KA 1OLOA 5JSZB 1L5GB 1EQUA 1NZJA 2WWIA 2J3QA 2VT6A 3OJCA 5JVDA 2ZPUA 1XVTA 4FBGA 2BM8A 5EXSA 3W4JA 3VJLA 1VMAA 1H6BA 1VP3A 5JCJD 6AT1A 3FPAA 3D6FA 4LRQA 1WMEA 1KNXA 3WDSA 1EK1A 1F60A 4R8SA 4MRVA 4Y2YA 2NYVA 1LJ8A 1MA3A 1QIJA 1S89A 2F8MA 3IP9A 3QOYA 4RD3A 3QH4A 3V8BA 2GEDA 2DVMA 4ZT7A 2XRZA 4EZIA 1AH2A 3DLTA 3RU7A 1RCFA 1EBUA 2NUAA 2Y93A 3C1UA 4QODA 2EBUA 1PKEA 1TIKA 3NJ4A 4BYGA 5ESDA 2ZB3A 4YCNA 5JLAA 5F5LA 1JAYA 5T4HA 1EXDA 4F3CA 1AMUA 2C2BA 3AV3A 1MBZA 1FNSA 1K98A 3EQ7A 2GF2A 3QUQA 4FE4A 3U09A 3NBYC 1N3LA 3BGWA 2O8BA 3KTFA 3AEKB 1W1UA 4K9OA 4E5UA 1XEXB 5KNCD 1D9ZA 3L8HA 4O2AB 3L7LA 4WNIA 1JL3A 3IPRA 4Y2QA 4DARA 1NHWA 2LD4A 1M34A 4KLAA 4LYJA 5DM70 1OYOA 5ADVA 3BL8A 5KNLA 4E5YA 4YJ3F 2XT0A 1Z16A 1DIBA 4Z9XA 3K1ZA 3Q0TA 4NCNA 4C0BA 1GGJA 1U2ZA 1W94A 3R0VA 4EPXA 5LR6A 4QYXA 3T7SA 5F2NA 4L9RA 4IIBA 1RP1A 1YGYA 3CE9A 1W6RA 3QUAA 3Q8MA 4MAAA 4IZOA 4MAFA 3TQSA 2V1XA 3EZ9A 3LQYA 4Q15A 5JQGF 3Q3EA 4HWKA 4URYR 4J0IA 2ZR9A 2JJMA 2GN8A 4EVSA 1NQWA 1SVMA 1U7HA 3MWLA 3D2AA 3GFPA 3K9HA 3LT1A 1B7GO 4TUYA 4F7DA 1OZ0A 2AK2A 2OZLA 4CXMA 1JSRA 5JRZA 1WP4A 1KGDA 3ILYA 3K5IA 2PMEA 5BRAA 3C6YA 2JS7A 3K1JA 5AI9A 3E3OA 1P7YA 2GLTA 3AP2A 2IWHA 3OZWA 3ADPA 3ZY4A 2QTGA 2EAUA 1UQUA 3F6RA 4Y0AA 4BO3A 2JC3A 3RNLA 4PZLA 1BS2A 4CW7A 2C54A 2CHFA 4M7RA 4UUNA 4X44A 3T3HA 3QMVA 1MQSA 2ZYHA 3WL5A 2HPZA 8GPBA 1TF7A 2VA8A 1JYFA 2AS0A 1LY1A 2GUGA 4M9XA 5BNZA 5HP4A 3VPFA 1F0YA 1ZCJA 3BWBA 2XTJA 4IGKA 2Y68A 1ZA1A 2XGGA 3O92A 1PVVA 1R27A 4CDMA 2ZBVA 3FETA 1HY3A 1TK9A 2HRZA 3KU1A 4DLLA 4EG4A 1P2SA 1KEVA 2GBIA 2O0HA 1GVHA 1EUZA 3C3CA 3MJSA 3T7AA 3P19A 4I50B 3D3WB 1L7DA 2WJHA 4QSMA 1NMSA 4I9GA 1O6CA 2QJFA 3QBDA 3WL7A 2VT3A 2QTRA 3BT7A 5AM4A 2UDPA 4DQKA 4JEHA 3RQSA 2Y1EA 3O1JC 3OQNA 3AERB 4KNWA 4KR7A 1OASA 1XTIA 4ONEA 2JK0A 1KJJA 4WOJA 5EMKA 3ZNPA 4OQEA 4IV0A 2G4LA 2HPAA 3RUCA 1CUDA 3DV0B 4KV9A 3WI7A 5IX8A 3K0HA 5KQMA 1KI9A 2FGKA 2C5BA 2DFDA 4ZAWA 1V1RB 1WVGA 5JNSA 3C16C 1DAGA 2WYIA 3AY3A 3BWEA 3QLUA 1HBJA 4FQ8A 3WJ7A 3O0DA 4HADA 3RSCA 3CH6A 5IZCA 3OCJA 3FZEA 4MGZR 5CR9A 3OZCA 1NWCA 2D54A 4Y6PA 4H7IA 4R68A 2CLHB 4X71A 4M87A 4JNKA 4HR7A 1G2PA 1Y9DA 4QFBA 2HXYA 4UBIA 1IN6A 4QOHA 4GU5A 3AVQA 4D42A 1N6NA 2XVXA 4ARZA 4B7AA 5ADWA 4Q9LA 4E13A 1PEAA 1HRDA 2BH9A 2XWQA 4ZVQA 3HCEA 3O8BA 3NCHA 2Z1DA 2H65A 4ZT6A 4PYIA 2QLFA 2GYUA 2WHYA 3KNZA 2QU8A 3E23A 1GNVA 1U8EA 2Z3ZA 3JPYA 4OFWA 5IYZF 3I5YA 4LDRA 4F8EA 2IIVA 5TS3A 3WIOA 1U31A 2XNCA 3M6FA 3OLVA 5L3ZA 3R6TA 5IKPA 2DFKB 4KP7A 3RYTC 1GNLA 4YJHA 2VSFA 2BI7A 1PWEA 1ZMBA 3OOJA 1Q7GA 3CNNA 3SKVA 3D6TB 5DP1A 2FEAA 1FL9A 1TJ5A 4AC9A 3TB6A 1NW6A 2WIKA 3MUFA 2YUIA 4PNPA 4E33A 1XV5A 3W1VA 1YACA 2Q9BA 4HWSA 4MICA 3GJXC 1MN6A 2GZ3A 1ECFA 1KDTA 3KSZO 3WK4A 4OQXA 1GTJ1 1Q1NA 2ZRHA 1PG2A 3L6UA 4EF5A 4LHXA 3GRYA 5HZHA 3DS8A 4RM2A 3HSYA 2Y2VA 3TR0A 1A9YA 3H8VA 1C3JA 4MJLA 4LJ6A 4YGXB 2WTUA 5ENDA 2BJHA 4ZVNA 1R5NA 1MFPA 1P9WA 2JVKA 3QPWA 4OGKA 3ICQB 2O5EA 3WGGA 2E6UX 1DP4A 1OFUX 1Z26A 3ND8A 5AOVA 5IXYA 4MUBA 2J1LA 2RHHA 5JCJA 5AJZA 3ZZUA 1X2BA 2HHLA 2ADOA 4OI4A 1MRNA 1YR8A 3H2ZA 1R9NA 1S2OA 1NV8A 2Z08A 4IP0A 4LGCA 3E3AA 1JQJC 3MMNA 4NMLA 2XT9A 4UNRA 1EA5A 3QLUC 4LDNA 5KVQA 4D4MA 3D8BA 4RX1A 3GFVA 1IBMB 1C41A 4GQIA 3UC5A 1QFJA 3PUWA 4HQRA 4C87A 1WHSA 1CJVC 1O96A 4WEOA 5KYYA 4RHFA 4FP9A 3U1VA 1DKQA 3ZWOA 3L6DA 3AC0A 3UMSA 2H17A 1EH5A 1OJLA 1K7FB 2Z56A 4GYYA 4M1KA 5DH9A 1UODA 2DBZA 1QO0D 1WS6A 1P2FA 1H8HD 2W2LA 4HUQA 1ADCA 2VI5A 1H8HA 2W2LD 5ALXA 1AU9A 1AKTA 4GRIA 3KYDB 2CN1A 3GD5A 3MCVA 1C2TA 3D0RA 4GX0A 4XYLA 1Z6YA 4ALLA 4MROA 1T1IA 3CURA 2GPAA 3FTDA 4D0SA 5BT8A 1K66A 2PKRA 2VP0A 4P3PA 2HBZA 3M82A 1DRVA 2D1TA 1IUNA 1F38A 1NBWB 2VRNA 4IX1A 3VNUA 2XYPA 5AVWA 1WCWA 1OCEA 1F2TA 2QTBA 4RK7A 1T91A 3DBIA 4I8XA 4BHTA 2F8TA 1Q0HA 3ZX4A 1SU4A 2EX1A 1H0HA 2IYQA 1JVSA 1M1XB 4TUYB 3RNOA 1O7JA 1LLUA 3MK31 3B20A 3GCXA 2QP4A 3DFKA 3IBYA 4AF7A 3D6MA 3O4VA 5EIAA 5FPPA 5FWYB 5EMHA 3ZDQA 2AX4A 3OTGA 1YFKA 3V80A 5A7GA 2F43A 2QTWB 1PDWA 1NMQA 3EG9A 4FIDA 3A3PA 3MINA 5BMVA 1P61B 1WNTA 3ORFA 1IHXA 4MVJP 3COYA 5HCIA 1TPYA 1L4FA 4I4TB 3RT9A 2GM9A 2B3DA 5JUWA 2OYSA 1IOZA 1VRWA 4G4JA 4D99A 2WWTA 2IKQA 2XCSB 1V4BA 4ND8A 2IHTA 4YNBA 1QC5A 5E95A 5LQMA 3TG2A 3KTDA 3NTUA 1U3WA 1Z6PA 1UP6A 1OI2A 2OKCA 5D3QA 1QIGA 5AVTA 2YOFA 2H5EA 2WU0A 3IOCA 4EOGA 3K7EA 1GUYA 1ZOPA 1QAMA 2VHQA 4M1YA 4QDOA 1GQQA 5F4ZA 5J3JA 3RYHA 2V6JA 3H1PA 2V6IA 4ZC1A 3F1KA 1OBHA 1BEEA 1YA8A 1FDRA 2QD3A 1TKBA 3EF1A 3VYVA 4F96A 5M04A 1OWLA 1T0BA 1SR8A 3EXFB 2F1OA 2REBA 4H1UA 4HYEA 5A62A 4FD3A 2I2WA 3TG8A 4FDLA 1K86A 3RVPA 4BN5A 4IRMA 3WHKA 3WLNA 2RI6A 5CDHA 4E5NA 1YI8A 1TI7A 2V5VA 4NK4A 4P58A 2W2PA 1B6SA 2A4KA 1ES9A 4B3JA 1AKMA 4UNNA 2FK8A 4YMVA 1JFFA 2HI0A 1F7VA 3JQGB 2TYSB 3GVIA 2GEVA 1CZOA 5LQDA 3WP0A 3NIDB 2QM8A 3AUTA 4YRJA 2FN8A 3O2JA 1U3TA 1C4XA 1GKIA 4DCTA 4DG9A 4HB3A 4WQMA 1V5FA 2D8AA 2REXB 3D4PA 3F90A 4XCXA 3T9EA 3WNZA 1JHYA 2WPDD 2EVWX 3MYRA 1NNUA 4JEIA 5LA6A 3GRRA 3QENA 3TI7A 4D9MA 1E60A 1X3SA 2D5CA 1ADJA 1M2FA 3QEMB 5F12A 1J9GA 1UAGA 5ALOA 5F35A 1KAHA 3MGBA 3SDBA 2AL7A 1YNSA 5C7YA 4BRWA 1TLTA 3O94A 4HNQA 2GETA 3CG4A 3WIBA 5FH9A 5KJ1A 3AR7A 4V3BA 3DGEC 3CRZA 4LGMA 1GKUB 3SYMA 1J8YF 3G8YA 3GFRA 2DT8A 4PR0A 2P9YA 1AN9A 2WNSA 3L5KA 4CMIB 5D6OA 3EPKA 1XZFA 1XCLA 3GA0A 5HK9A 4I1PA 3KAKA 1JILA 1RM5A 1GP2A 2WM8A 1UZNA 2Q29A 2Z2ZA 4CRWB 3F7TA 2VP5A 4QDTA 3G6WA 4UXIA 1RMTA 3TYXA 2Q9UA 3O9VA 1K08A 3LSYA 3P0RA 4J3FA 4KMOA 4QXAA 4YCSA 1MQ9A 5ITVA 3F73A 3HCBA 4WK0B 5FPSA 2AUNA 3H04A 4JBXA 1YNOA 4JJZA 3VSCA 4CQJA 1JJ7A 3A6FA 1B2RA 5B1YA 1DEHA 1EK0A 1G19A 1Z3IX 4BO4A 5C7IO 5CFPA 4YCCA 3DP9A 1I2CA 5JADA 5KNBD 3QPAA 3EQ8A 3AXTA 1P1CA 1M6NA 1GUZA 2BTOA 2BFWA 3EEQA 4WVFA 1OFHA 2G0NA 3N2YA 3K96A 1YZUA 1FTQA 1U7PA 2BM9A 1WZNA 2M6KA 4RESA 2ONCA 3FGOA 3HSKA 1TZMA 1GEEA 3DBLA 4O2AA 4OHZA 2D3WA 4MA0A 3C39A 1H1LA 2F4VB 2GZMA 3D5EA 4I1IA 2W6PA 3DVSX 1JXAA 2A58A 2G1AA 2EJWA 2VOEA 3JW8A 4ON9A 4YRPA 3RC3A 4R83A 1VGQA 3PITA 5DOZA 4HQFA 5I8PA 5D8DA 2BPOA 1OLXA 2AKAB 2ZJ2A 4HGNA 4F3KA 1NAIA 2H4YA 3OCXA 4KMRA 1KBZA 4DNXA 4LC9A 3K30A 3PWTA 1HOXA 2P5TB 4NESA 1QGAA 3CR8A 5BN4B 1U6KA 3IUNA 2J6IA 4JP3A 4TTPA 1P7ZA 2EJUA 3PF8A 2HMTA 1T13A 2I4IA 1FXWA 4HZIA 4WKBA 2X9VA 3I04A 2HA0A 5DWQA 3K4HA 4LKRA 1E5QA 2Z2IA 2HHCA 5U9CA 1WF3A 1NPDA 2JCBA 4R16A 4ESVA 4QHSA 2KS6A 2RJNA 3NZEA 4MR7A 4WK6A 5D87A 3T8YA 1M5UA 4G5GA 4XWAA 4Y7CA 3AI1A 2PH3A 3EZFA 3GNSA 3MS2A 3WWOA 1RSZA 3AFNA 3IUBA 2OE2A 3A32A 3RLFA 4XFDA 4W1RA 5HQJA 1SBZA 3LF2A 3AU8A 1YS2X 3OPVA 5EN4A 5LP6A 4JI7B 1R4NA 2O4UX 4H7HA 3AR2A 3JQDA 2C61A 1P39A 1V5WA 2PWPA 3C24A 5CLQA 2ZRQA 2PU5A 4EW1A 4JR0A 3FMIA 1SXPA 1SXJA 4EX7A 2C3UA 3X1KA 1W29A 3ZIUA 3VHRA 5A4IS 1CRPA 1X7WA 1E96A 1DEAA 1UZLA 5EQDA 1T36B 2DUWA 4YI5A 4DCMA 1PJRA 4EI2A 4XI9A 1UJ5A 3W5AA 2GASA 4DR3B 3DEHA 1FMFA 3B9QA 3LDFA 3M9LA 4RDXA 1KJ8A 1WTAA 4DMFA 3R9WA 3GVPA 4UM8B 5E4FA 3WNDA 4MVXA 4NFLA 1ECJA 4QNMA 1VG0B 1NMZA 3TSYA 1QVZA 5DSXA 2XCTB 4MULA 3LUFA 4GI3A 1DAMA 5WRFA 2AXNA 1JLLB 3AJDA 4L76A 1TOAA 1J25A 1MJ5A 2EKBA 3TRFA 3U26A 2XDAA 1ZL2A 4I5DA 4AZVA 1ZOSA 4W7SA 3KE8A 1Z0AA 3B2QA 3DEYX 5BOSB 1II8A 1SZCA 5L51A 4E7OA 2JAUA 5HA5A 3B1VA 1KAMA 1OH8A 3F98A 4Z0HO 2R6AA 3T1TA 4NULA 2WUEA 1NRXA 3P9KA 4JI5B 5H4HA 4D3XA 1GM5A 5EOVA 4IV8A 1LPPA 3K5PA 2PVCA 4NECA 4Q1AA 3SSMA 2R11A 4CDNA 2MSEB 4ED9A 4ZVUA 4EPWA 3JAMA 2ZB8A 1H2BA 4KNYA 3OM8A 3Q41A 1UINA 4JCCA 1UBUS 4XAQA 1ODCA 1JG1A 2FRVA 3X1YA 1M2OB 2FV8A 1PR9A 5EJEA 1Q0QA 2XA2A 4QGAA 1T25A 2TMGA 4BMYA 1QBGA 1BMFD 1JHOA 4KL8S 3VV2A 1N8TA 4A91A 1GCAA 4CPDA 3MOSA 2E18A 2BF7A 1CK4A 3HCCA 1H5QA 2G1PA 1DEKA 1S3SA 1JKFA 2P9TA 1DT3A 1HE5A 3COWA 3ZY6A 2CKDA 3KEMA 4TMYA 4ENWA 3QKSB 5K5EA 1VPWA 4E03A 4FNOA 2FR0A 3K6RA 3LBYA 2ZAGA 4HGRA 2CXXA 3GAMA 5IF9A 3T0FA 1FDVA 2VDVE 1Y8AA 2H2DA 4IRXA 1PCXA 4CL8A 5EWLA 3WK8A 2OWDA 1T3TA 1KPGA 1M2OA 2RK6A 2WV7A 1S2DA 4OU5A 2AHRA 2V0CA 4AZ3A 3R24A 3Q12A 5CB4A 1E4YA 1TAQA 4JKYA 4YCBA 3UAGA 1ISJA 3WKCA 3IPAA 2GRJA 2B2NA 2PDAA 4XSGA 5EP2A 5CDFA 3VOSA 4ARSA 3ENKA 5KTNA 2CLEB 4LCJA 4C1NA 3IUEA 10MHA 4Y2XA 2V7EA 1UBCA 4GM4A 1PUJA 1VPDA 2BEVA 3EZ2A 3QE4A 4P4NA 1RI5A 5I8WA 4F1KA 4NL4H 2OPHA 5B4TA 2XZPA 2FXVA 1NMEA 3VVLA 2KYRA 1NPTO 4CF4A 4RJTA 5LPNA 5A4FS 5CJ2A 2QMEA 3NM5A 4I7EA 2ZYIA 4WFKA 3RS9A 5JISA 1BJKA 1HPLA 2JASA 2JIPA 1PJTA 3UAVA 4FFOA 4LRTB 1JE1A 4L3VA 1M1YB 4M86A 3RBAA 3TK1A 5F9FA 4P4TA 3RRFA 3WJ1A 4QWWA 2LP4Y 2WVAA 2SBTA 4YAIA 2XZOA 1E0SA 1WRBA 1IG3A 3CZQA 3E9NA 3GLUA 3QEMA 1U7TA 1VECA 2VBCA 5FNVB 5IJAA 3JQ8B 4GC9A 1DJLA 2H1LA 1OT3A 1QK5A 3CM0A 2IYXA 1NVBA 1YUBA 4IMIB 1PQWA 1GO2A 2VZ0A 2YWHA 4DWOA 2QAGC 1EGQA 3FXAA 4LSWA 3DYIA 1KZHA 1C1XB 2IYWA 2ODQA 2JZOA 3MN1A 5AOAA 1T0IA 5B6IA 2I7VA 4BJ6A 3KPJA 2A57A 2FJ0A 2NUTB 4NJMB 5DM60 5I4IA 5K0BA 1KZ1A 1J09A 3JAWA 2WIAA 3KZXA 4XJSA 5A6SB 1N25A 3PC2A 3G2MA 1NN1A 2VPTA 4M0FA 3T3PB 3ZNOA 5KIAA 4GGOA 3PGLA 4HNUA 3VUEA 4WUTA 1M34E 3EGCA 4JAVC 3JQ9C 4YS6A 1YT5A 3WYNA 4FWBA 1AS3A 1JJAA 2I6SA 1C9DB 1N9ZA 2CB9A 1JAZA 4NH4A 2ZTHA 3ZLJA 3OM9A 4CM1A 2AJ8A 4G37A 2CW5A 2IPXA 3VH1A 3W5HA 3K15A 4ZEVA 3MRVA 3FM9A 1GZVA 3SQMA 1NP3A 3GV0A 5F4BA 2V9ZA 1FU7A 2K6GA 1XTZA 4OBEA 5DISB 5BWCA 2MCFA 2AYXA 2PX8A 4BNNA 4B2YA 1BEZA 5IEBA 2XMDA 2NXJA 4LMRA 3JR3A 5JHHB 1Z6QA 4A6EA 3CVXA 4ABTA 1POWA 3R5TA 5IMBA 2BZGA 1Y8ZA 2GXAA 3A9WA 2PGIA 1YB6A 2VHYA 5F1PA 4GOXA 1WCIB 2A9RA 2HUPA 2V4UA 2ECKA 4EI7A 1OSNA 1SC3A 4YRFA 3GEHA 4C0XA 4DPKA 4Y18A 1VSVA 1MO2A 3QQPA 4JL5A 3FD8A 3ZS8A 3EZNA 3N0WA 2PM8A 3TW6A 4A92A 4AJ2A 1HQKA 4K6MA 3OTOB 5AKGA 2VRCA 3BRWD 4CM9A 3IE0A 5AK3A 2XECA 3MD9A 2AOXA 4L15A 4WCFA 5CLLA 1ZZEA 2MSDB 4RVNA 4F21A 2HL6A 2GHTA 1Z83A 3K73O 4UHJA 3WQBA 2P4SA 5IDVA 4NPHA 1VKNA 4NR0A 1ABFA 4WADA 1CNFA 1FRVA 1QBKC 3UAXA 2X42A 2IVZA 2CNOA 3SFVA 1PSDA 1TZCA 3HO6A 2D1QA 3SIPA 4YT8A 2QE6A 2LXNA 2JF0A 4MKHA 4RZXA 5FUWA 1SBHA 1XDGA 3ANXA 4FPXA 4UU8A 3G7NA 3GFSA 1I5OA 3IV6A 4HVTA 2Q2QA 1B8VA 4L7QA 4MGIR 3G8DA 4OATA 4OXXA 4DC0A 4ND6A 5IN5A 4II3A 4KUHA 4Q4AA 5AVZA 5BSFA 2IBSA 1A71A 1YVDA 4WGFA 2EP5A 2XMRA 2V54A 2ZM5A 2R65A 1HZZC 5B3LA 2MYNA 3I1JA 2I6GA 4IH1A 1Z8DA 3RPEA 4R1UA 3C8MA 5EFZA 3GRCA 1E3TA 3B1WA 1DPGA 5DMHA 2HJ9A 3LUJA 2UYYA 3QX7A 4N9WA 1G20B 1AF4A 1N2ZA 2JGDA 1EBBA 1ZO8A 1Q0SA 2PY6A 2Q6OA 3HHEA 2R1UA 3WGZA 4B5LA 4P86A 4PLGA 3V1NA 3V7FA 1AMNA 3V42A 1NJGA 4ZZIA 3AVTA 4B9AA 3PEVA 4PRLA 4UVEA 3T0GA 4EZEA 3CX4A 4PX9A 5KOHB 2Y9MB 1XQVA 4MPTA 1IU9A 2FWAA 1QH1A 3AKZA 1S02A 3R7BA 3PNPA 4RYLA 3STYA 1Z08A 3LA6A 1Y0BA 2A0KA 1E79D 2ZE5A 2XB8A 1XL1A 3THYA 2WIFA 2VQ6A 2WA2A 4TLLB 1FYEA 2E5LB 2XDQA 4M3NA 4ZEXA 3L40A 3U7QB 1E3JA 1PT6A 2CHQA 3O73A 5JECA 4R31A 3N39C 1B8OA 2NU8A 3O9MA 4YMIA 4AECA 1CT9A 2QQ5A 3F1LA 3OTWA 3YASA 5GADl 4MP6A 4P7BA 3QSGA 4FGLA 4A0HA 5H59A 1P7VA 1ZRHA 2B6NA 2NYRA 2XD9A 1G7CA 2QVLA 4DTIA 5J1SB 4U2FA 2I4MA 3BFJA 1JA1A 5JQGA 5DZSA 7AT1A 4BRUA 1JQAA 2JFWA 4CTKA 1V26A 5EWJB 4DW8A 1EDZA 1OXMA 4PWZA 5EJ9A 1DI0A 5CIQA 1X80A 1E6UA 2FETA 2R6HA 3VTZA 3WRYC 3LUDA 1LPSA 4CR7A 4GZLA 3PQ8A 1V16A 4ERXA 1B1CA 4DJAA 1OR8A 1PK7A 4JLDA 1ACMA 2NVUA 1U6JA 2GBGA 3JRXA 3HDJA 4CQMD 5GVSA 3ZGLA 1A27A 2M6LA 4EY5A 3DEAA 4DR7B 2QTLA 2WYWA 3ABZA 2QRQA 1SBQA 4HAWA 2X0FA 4BNKA 4RZ2A 2Q3FA 1VHTA 1Z0IA 1Y6RA 4FEGA 4JLJA 4RF4A 3NONA 2ONYA 1W96A 2ASEA 2HF8A 3L0SA 1GDTA 4XRRA 4TKZA 4OVKA 2JFXA 1Q57A 1YZNA 2WBLC 1X6VA 2ZJ8A 3MAAC 3NEYA 2GILA 5JO9A 2PLWA 2NAFA 3HFJA 5I3CA 1KAGA 4J43A 4OXYA 1J56A 1GSAA 2FSVA 4B6EA 1OAKA 1E5LA 2UYQA 4FHZA 1C1DA 1V4VA 1W5SA 1C30B 1I7LA 5JD5A 3I6QA 1JHVA 2VP6A 2XF2A 4RZIA 5CCBA 4J9VA 2CLIB 4FHFA 1XNHA 3KWLA 4M9ZA 1E1QA 5L53A 1HDIA 1CULC 3QVJA 4QBTA 3VDMA 2DWPA 3DFZA 4M9UA 4QOEA 3TQRA 4HQ6A 1Q44A 1CY2A 1J5XA 1IVYA 3BH0A 2AKEA 3QVSA 1QR2A 2FFQA 2GX6A 2RIPA 4Z5XA 3A3NA 3VUFA 3I42A 1BQEA 2WLSA 2CVPA 5JC8A 2X5NA 5IM5A 5JS7A 3GCGA 3PYXA 3EUFA 1M54A 3O95A 1MLDA 4LRXA 4GNKA 1I2BA 4X41A 4ROTA 1IHYA 4KPYA 2B5OA 2EHDA 1W5FA 1RJWA 2ETVA 1F4VA 1P5JA 5GOTA 3GOQA 1QRDA 2D59A 1T5SA 1L4GA 2GM4A 1KOGA 1GLNA 1SCAA 3C3BA 1ZGZA 3E8SA 3DCJA 2BGGA 1P5FA 5AHKA 1NNI1 1FMTA 3PPYA 4RV4A 4EB3A 2DHCA 2ENWA 4LXUA 3WAKA 4C3ZA 4CU2A 2YIMA 3Q3CA 5LJIA 1U8TA 4G8BA 1WJGA 2YHSA 3S99A 4AY4A 3R75A 1PZMA 1J0XO 5KMGA 3L7AA 4JR1A 3PQCA 2ERXA 4KN6A 4QHYA 4X7MA 1J22A 1JA0A 4RHXA 5K0NA 5HWSA 3QF4A 3ZBQA 3HCAA 3UF0A 4MMXB 3RADC 1AIPA 1UK9A 1P4HA 5HK8A 1CV2A 3ZTYA 3F78A 4LVOA 4YRGA 3H5VA 2HF2A 5A1JA 4AF6A 3QXCA 4AROA 2LVBA 3A9SA 2BSAA 4NDNE 2WUDA 5JNRA 2Q5FA 1P31A 1DC8A 1T1SA 2P6UA 4UOEA 2DG2A 1Y1PA 2HSJA 2IHBA 1R2QA 2IQIA 2NSJA 5TY0A 1EXMA 2DH6A 1XMOB 2FLWA 3AEUB 3AJAA 4BBAA 1V25A 2OFPA 3R9KA 3S2EA 4ZIRA 1N7IA 1RQLA 3GRPA 3UJ6A 2WYVA 4TMTA 2TMDA 2WUGA 2O3JA 2ZWMA 4R8LA 4DC1A 3B52X 4UC0A 5F7ZA 4ZOAA 3HDYA 1O95D 4TS4A 1K7EB 1TCUA 2ASVA 1NZFA 2R8YA 4HRAA 2GB4A 1W44A 2VXBA 4R84A 2JFQA 2Y0DA 3EJ6A 3FAKA 4B73A 4C29A 2VQFB 4MX8A 2O5RA 3OX1A 3CZPA 3HVIA 2O8FA 1USUA 5GP1A 3DOCA 5EI5A 3AFHA 3L43A 3CB4A 4BKOA 1LI7A 3E5RA 2OCAA 1XQ1A 4EARA 4TTTS 1LI5A 1N2GA 4CMEC 2VYFA 2UUAB 5DV9A 1JFVA 3A1WA 4G0OA 2VPYA 1ECCA 3T4XA 4H4DA 1N4AA 3NIFB 4D9CA 5MDHA 1PEYA 3RJTA 5DI9A 3PV0A 4DMLA 1GV1A 1Y4UA 1JKIA 4UBKA 5FUMA 5JZSA 2PJRA 1DADA 1XYGA 1V9LA 4PPYA 2JZNA 5EMLA 4EL5A 2JBHA 4ASUA 1S6YA 1G66A 1WW2A 3RU9A 1KKMA 5DP2A 5LXTF 3W5CA 5T4BA 3VFDA 2JA1A 2X0EA 3FHJA 2BOVA 4CU5A 1TZ2A 1IIBA 3NYWA 3ET4A 2X9QA 1E6LA 3KOZA 2J07A 4FC7A 1OH5A 2GZHA 1CR6A 1PWZA 2QIPA 2WF7A 1VCHA 3P2OA 4ZRNA 4PCVA 3DKRA 3BHNA 1QYWA 3CUYA 4C7KA 3SS9X 1CUHA 2AJTA 5TJHA 1I36A 3DV0A 3OQMA 1EGHA 2I2CA 2RHGB 2IYSA 3PTZA 3T0IA 3TOXA 1NQTA 3F3MA 3K0FB 1PQUA 1R4MB 3WIUA 1P2TA 3CF4A 1HYHA 1NIJA 1U0JA 5ALNA 3D3KA 4GR5A 2HNKA 5JJIA 4UJ5A 2AR9A 4E15A 1QX3A 1ZESA 1ZU5A 1RBYA 3TZKA 4E07A 1TKAA 4UBLA 4TUYF 1ZR4A 3WV4A 1QUFA 1MTOA 2WMNB 1D8TA 3NTRA 1C9JA 1CKEA 1NQAO 3I32A 4OSPA 2D2IA 1ZGHA 3D7LA 4LZPA 3UVEA 3EVEA 3VTKA 5EJ6A 2I67A 4ND2A 2GUWA 4CV2A 1JIIA 3L6OO 2FG7C 1AG9A 1NG1A 4HZGA 3RQIA 2DKFA 3GRUA 1BXKA 2WG0A 1ZXLA 1Z2AA 3ITDA 4BBZA 1SIWA 2IU6A 1OMOA 1UJ2A 2BKXA 2C1EA 3E3MA 1B6TA 2VA9A 2V7VA 2VDUE 3DVAB 3BGVA 3MW8A 1NMYA 4KUEA 5KMGB 1WAMA 1XA4A 3R09A 1XZIA 2ZVDA 1Z8FA 4JJAA 1Q92A 3RIMA 2Q5QA 1IHUA 3VHLB 1YQQA 1NW3A 5IUKC 2P40A 2JI4A 4LXHA 5CLIA 2WTXA 2JLQA 1TQ8A 4B6PA 3FZYA 3B7PA 3OFVA 3RJMA 2FVYA 3OIWA 3PWSA 4M0DA 3KHSA 4AUEA 1TM7E 3IKMB 5EQFA 3RLIA 5AW8A 2ZRIA 5I5EA 2KMLA 2ZDQA 3IP3A 5EIHA 3S55A 5JT1A 4LQ4A 5LP6B 1BFDA 5C1DA 3BPSA 4CMJA 1YDFA 1Y5NA 5C53B 3JCZA 1ZIYA 5LXTA 2I1LA 2ZUWA 3OURA 3GLFB 4EG5A 4TT3A 3V1YA 2ZIVB 5C8YB 4QPNA 3LW8A 4H7KA 3GLTA 3I6YA 3L9WA 5DF1A 3RHFA 3H11B 1DBIA 4ZRMA 4D57A 3RSOA 2Q99A 4AYXA 1HZJA 4CG3A 2XXBA 3EC2A 2PRIA 2IEAA 2J5BA 3FPJA 1GTRA 1P18A 2WZDA 3EXHA 3KVYA 5CM8B 1CQJB 4HY3A 4WLVA 1H2XA 5AIBA 4MI1A 3PPVA 1A9XA 2EKQA 4W99A 5LOVB 3IB6A 2HR1A 1FX0A 2VJBA 4AMBA 4BNJA 3T9DA 3DO5A 3A06A 3N0TA 2BFMA 3FZGA 2QL7A 4G1EB 1UMDB 3V8VA 3H99A 3BGOS 3BB1A 4BNYA 4WN3A 4DJDC 3KVVA 3TI9A 1BZYA 3NOVA 4B84A 2R8EA 4O5AA 3O26A 1H22A 4TRRA 3KB8A 4D4IA 1IBRA 1E9CA 3PPWA 1XAJA 2WW8A 1SPBS 2JFPA 3CUUA 4UEOA 2BFNA 1JFRA 2HYIC 3OLZA 3G2LA 3GJRA 4HWTA 5KTTA 3HR4A 2Y66A 1MR3F 1L5NA 1D3AA 1DKNA 3NBZC 4PSDA 1QHYA 4UVIA 4PYOA 2GCOA 5AJTA 4OGLA 4HUQB 1EP9A 3S29A 3UJHA 4TROA 5FF9A 1MOQA 1PJQA 2RH8A 3F4BA 3LUBA 3FBGA 1X13A 4A15A 4OGFA 5JNTA 1J2YA 3K6SB 1MVOA 4A8PA 1VIVA 1PR1A 4POOA 1O9GA 3U39A 1G1MA 3ZU4A 1E2FA 4TTSA 3J7AC 1U0EA 2OXEA 2G77B 4TSFD 1WPRA 1EXVA 2ZIUB 2CFOA 4HXYA 3KQNA 4C2TA 4ESHA 4B6FA 3P32A 5JCPA 4X90A 1P4SA 1DPFA 1QE5A 2GKSA 2R85A 1F1BA 5AO9A 2IVFA 2B61A 3IGFA 4N47A 2YZMA 2VR1A 4K40A 4WW0A 1URPA 5FBQB 1OILA 2SNIE 4IVRA 2IXAA 3GX1A 2WTEA 3ZI4A 4EMUA 5B57C 5ALSA 2F9LA 3FDZB 3CUWA 2DM6A 5CPBA 2C84A 4Q3LA 1L4YA 4FXOA 1E7RA 2YWRA 5CX1A 3P0FA 4MQ4A 2IV3A 3CT6A 1UZMA 2I66A 5EJ8A 2HK6A 1VDMA 3F3SA 4K9MA 5JPIA 2FX3A 3S5JA 3V2UA 4BLQA 4GGPA 5J4LA 1TUEA 1PT9A 3IFSA 3JRNA 3MCAA 3U31A 2Q4RA 2ALJA 2YW9A 4BL5A 2IE0A 2X5XA 3FWNA 2B0CA 3LCMA 5FI1B 3HTXA 3THXB 2HK9A 1MO5A 3AR9A 2DPYA 4ZCRA 1Q0LA 4PINA 1FTNA 5AW7A 3GG9A 4BNWA 4Q4JA 5A9TA 3CVVA 1U5CA 1UMBA 4MHSA 4ECEA 1O6BA 4HDAA 4ER7A 1Y6ZA 4V3CA 1QCDA 3QTLA 3RHTA 1DBQA 3Q6IA 3IEIA 3LKBA 3NHFA 2VJOA 1BX0A 3R5XA 3MXOA 3O74A 1HE8B 2ZVQX 2PKCA 3EE6A 3FMOB 1CC1S 4KE7A 4Q4HB 2CJWA 1KY3A 5CVVA 2PEYA 3C8UA 2REQB 3CPEA 2QG4A 5K2OA 1QHIA 2NTYC 3VZPA 2GH1A 5AUNB 1FDUA 3A25A 3G79A 5F7OA 3I83A 4DRZA 2PZBA 1FU8A 2JIZD 5A3QA 3U5ZB 2V0NA 1JXOA 2QTVA 4HLDA 3U3MA 3WWYA 5FPTA 1LDYA 5JSKA 1T8PA 4A82A 1Z73A 1RWBA 5HGXA 3QE0A 3REOA 1PHRA 3NHBA 1ZZGA 5IVKA 3HQ4O 3JSAA 4JC5A 5JE8A 1NR5A 4R1MA 4GWLA 1ZXXA 5K05A 1XJ0A 4YLEA 5LBIA 1A97A 3V4PB 2AEMA 3CUTA 3SICE 2W6OA 2O8BB 1U8YA 2QNBA 4G0MA 5EXDA 5GMOA 4B1FA 4B9EA 4D3DA 4YIHA 4Q01A 4EELA 1R8JA 1T5TA 2IZ6A 3GA7A 2FPIB 3C7TA 4MUIA 3GWZA 2Y1GA 3QWHA 1YDWA 2E5FA 2O07A 4C2UA 4G1VA 4JJ6A 1SXJE 1AZLA 1ZH0A 3FVTA 4YP9A 1QKIA 5DO9A 1SBTA 4LJ9A 1J0EA 3G1UA 5DBIA 1R0YA 4L8FA 5JAIA 1HT0A 2WPNA 1NVGA 1QQ5A 5AHRA 1RYYA 1Y3FE 4F1JA 3Q3VA 2ZCJA 3ZWAA 1AQNA 4AJEA 1E0DA 4DGQA 3IOEA 4WDQA 4WA7A 2OZEA 1X74A 2QX8A 4ZXFA 1R18A 1ZN7A 5ELLA 3DVAA 4GX2A 2VDOB 3EC7A 3AF0A 3EFOA 5LMCA 2QZZA 3WGOA 2C88A 2XSZA 5FDFA 2FUKA 5G0VA 4RD4A 2OY0A 3UB2A 3ZWVA 3KL2A 5AI6A 3SX4A 5JPCA 3M7IA 1B15A 4RACA 1N3BA 2JPDA 3CF6R 2Q2OA 3NGLA 5F5XA 4XH9B 3R5HA 1DOHA 1F6DA 2CJFA 4RD0A 4I50A 2B4QA 1NLUA 4BS9A 5FL7A 2RI0A 4MH0R 2GAIA 5E2AA 4MVJF 3S1SA 4TYYA 3VAZA 3CZMA 1L5ZA 1U9IC 2GJ9A 1DX9A 1E9AA 2IP4A 4HQ0A 4O6VA 1SQSA 1MC8A 3TBHA 4BIIA 2VKQA 3GLGB 1FIUA 4ZANA 2QXUA 2AUTA 4V2IA 5JG7A 4JUCA 2GPNA 4WVLA 2IF0A 2OCPA 2R00C 1W8DA 2HA6A 2O2JA 3GN2A 2HQ1A 5AUQA 2QP3A 4E2ZA 3CUEF 3THWA 2C8JA 1QOPB 1Q0PA 1EIZA 3DLAA 2CVOA 4M1TA 4ZI3A 4NNPA 3SDZA 2WQZA 1H4QA 4Z54A 1SVUA 1I6WA 3AJEA 1TT7A 1YJAA 2UZ4A 1CUUA 2ZSAA 1FLAA 4J1NA 3KJZA 2HIMA 3RR2A 1I2AA 1F8GA 1VG8A 4F38A 5HIMA 2C95A 2W58A 3NWBA 4KXUA 1YQWA 3I2GA 1RQRA 1MPXA 4YDSA 5HDBB 2C7GA 3RRZA 5FD8A 4DLZA 2NZWA 4G1UC 2J9FB 3CSDA 3WYAA 4H27A 5FBHA 1HE3A 4RZ3A 2FHSA 3Q8XB 2KW5A 4K6CA 5EP4A 4BFCA 2W6JA 4TOIA 3NHUA 3R8FA 2D00A 4MXDA 3VOAA 2B7CA 2ODPA 3PNKA 4L0QA 4P34A 3JVIA 2Y2UA 1R8XA 1XEAA 4A0GA 1XB2A 3PEYA 2X19A 1W75A 3PC8A 5AJUA 5HRAA 4UEKA 5CW1A 4B3CA 2FZVA 4JDUA 3ICPA 4IDEA 2GOYA 3CH4B 1W8IA 4DZRA 2EOAA 5EPOA 4RDIA 2O8DA 1C29B 2WNIA 3BWMA 4G07A 4HEA1 3UUWA 5H1YA 3WWZA 3FTCA 4EG6A 3GRFA 1FQJA 5F3WB 3EMBA 4CV0A 4ND5A 3CZAA 2WJPA 3H3JA 4RIEA 1I1NA 3GH1A 4AZSA 4BGIA 4ZYZA 1XU4A 4D0RA 3DOJA 1WPXA 5AICA 1CPYA 4N5IX 1EM8B 4C89A 1AT1A 3HI4A 4CGYA 2ZIEA 3BJRA 4DV1B 3QU9A 4L4RA 5BSVA 3ZNQA 1MOPA 4W5QA 1MJGA 3FYDA 3M6UA 5ALMA 1D2CA 3TR6A 2FPPB 5BV2P 4U2EA 1I13A 2C92A 3ILXA 1WMFA 3RT1A 4XQGA 3JS5A 3WGHA 4DSNA 4IIJA 4MKGA 5D1NA 5BQFA 4L22A 4N0EA 3LQ1A 1BMQA 1LLDA 3SXUA 2CL6X 1ZS9A 4KTTE 4P5PA 4UU7A 4D6XA 2R4QA 4BKRA 3BCRA 1EGAA 4R1NA 4L74A 5IJ9A 4HT3B 5H3HA 1AB6A 1GAQA 4HO1X 3LLCA 1WBDA 2DY1A 3MWEB 1IXYA 4NCJA 4PHFA 1CS0B 5I51A 4PC2A 1P5ZB 2QMUA 3G1WA 2HJSA 1C4KA 4HYQA 5TB5A 2ONJA 4KHPB 1C9YA 3PC4A 1JEEA 3QWFA 4NOMA 1F20A 3BXFA 3NHWA 3PQ4A 2XAUA 3DT8A 4OXKA 4AT1A 2XD4A 4KJXA 1A7JA 2WUFA 2ACVA 4HZUA 4EEZA 1P0QA 3GBPA 4KE8A 4P8RA 1XRQA 5LIRA 1PN3A 2WSLA 4B4UA 3ZXIA 2D5LA 3EPLA 3M6XA 1SY7A 5A3JA 4E88A 3R5JA 4UEJA 3T3NA 1QS0A 3SY8A 1II0A 5ALHA 1KMCA 4E09A 1PF7E 2A5JA 2CC2A 2X6QA 4H0NA 4MW4A 1NJ6A 2CVQA 2UVPB 4XWYA 1XWFA 4QJIA 5KNDH 4DKJA 1AKRA 3I3OA 1Q11A 1WDKA 1U1DA 2XOEA 1UJCA 1WHSB 3LL4A 2Q4OA 4TN5A 3VNQA 4S1NA 3R3XA 3PFBA 4UZEA 3ZE1B 3RV4A 4IDHA 5J5CA 3SJ7A 1T2EA 5F1KA 4PWYA 5EKDA 1W85B 4QKQA 4ENVA 1KEKA 1IULA 3GJTA 1BWSA 2VJMA 4GMDA 1RRCA 1A7UA 4BWFB 1P5HA 2JFYA 3MA0A 4RV9A 1UBFA 4OHVA 2OBBA 5IFKA 4X6YA 1SKMA 2Q5JA 2EL7A 2ZWAA 3CF2A 4K1XA 2GK7A 1NUSA 2JVIA 3QMMA 2ZJ6A 1DAPA 3WSTA 1Q6ZA 5JAUA 1N6IA 4WESA 2JH3A 2JCYA 5G1PA 4B09A 5A1TA 1JJBA 3GLIB 4UDXX 3GF4A 3AVXA 3RVNA 1HFEL 4NBTA 1YZQA 1Y5LA 2VPZA 1NYTA 4X64B 3MT8A 1PGQA 4CYMA 1ZR2A 3QLVA 3L8GA 2CE2X 3NHRA 3COJA 4J16C 2W0SA 3OHPA 4EHIA 5IK2D 1FFYA 1CUXA 4OM7A 4YAFA 2BFDB 1UKZA 4Z49A 4PTYA 3ANLA 1QONA 3UY4A 3R5FA 5E7JA 4KN9S 2R48A 3BMNB 3IA7A 3PWZA 4EPYA 4J1TA 4RH3A 5JH7B 1Z7GA 4M0LA 1JDNA 2HSZA 4HMOA 1C0LA 2GQ0A 4TWAA 5BYJA 4ENUA 3WA6A 2B8EA 3BX1A 3P2MA 3VU1A 3GMSA 3ANMA 5FP0A 3KB2A 4ZCSA 1KOFA 2YWGA 1SXIA 2P2CA 5H16A 2OM6A 4KXMA 4EG3A 1AUVA 2OHJA 4HXGA 4E30A 3VNVA 5ICEA 2Q3LA 2JLAA 3GUUA 2QB5A 3PTLA 3QY0A 4BC1A 5MN4A 4NAVA 2JFFA 4YRDA 1M73E 5U1PA 3TDNA 2GTHA 3P9PA 4W1SA 1UZAA 2WYUA 3H1FA 3CNLA 2A35A 5LBUA 1QIEA 2OZPA 3SC2A 3SR4A 5JNUA 2XE7A 3QIVA 2H06A 3PUXA 4RTOA 2G7ZA 4DSAA 3DG9A 1ULAA 2FLKA 1HQCA 1LQTA 3JQFC 2XKJE 4KYUA 2ARKA 1AHPA 2B7LA 1G3IA 1XRNA 6REQA 1CY6A 3FPEA 3KYCA 3CXUA 4NF2A 3NT2A 3RD5A 1BE0A 3HDQA 3KOYA 4DUZB 2JJQA 3B89A 2WG1A 3P4YA 1DXOA 3IBGA 2AZ4A 3E1GA 1BFKA 4WKNA 3B6ZA 4TLBA 2B4KA 4MQMA 4LI3X 4CM8B 3FWZA 3IIJA 3SNHA 1XNQB 4J3JA 5JW6A 1E2GA 4HX9A 4LA4A 5AKLA 5GOZA 2NPIA 2MSCB 3DO6A 1Q77A 4IHAA 4XD7A 1ZI6A 4HH3C 1CJMA 3PBKA 3WFIA 3BOSA 4KOEC 1KU6A 3O4HA 3ADCA 4NFSA 3TFQA 1A2BA 2HDOA 4Y2HA 3K09A 3ZV4A 4ZK6A 1ZRMA 3GLHE 3JQQA 4TWZA 3JYPA 3FUCA 3KEQA 1PJSA 1PUIA 4MVJD 3WLAA 1WULS 2IBMA 4PBRA 4KE6A 4N5DA 1Q91A 1R9GA 1C3EA 5J40A 1PW7A 3KWMA 1WVMA 5L45A 1Q5PA 2QZ9A 3FNRA 4NARA 1Y8QB 2IJGX 1KMMA 4QDXA 3S6JA 3KQLA 1IY9A 1FSGA 1U11A 2MJLA 4JJKA 4KGDA 4TV9A 4FFWA 4CLXA 1CUBA 5LL6P 3P0IA 5H70A 1R0SA 3DOEA 1SVOA 3QHAA 3A11A 3HN2A 5I7VA 3IA2A 2FEXA 4YMLA 4WZBB 4J0JA 3DQZA 3HGTA 3OPNA 3CLSC 5ED0A 1HT1E 3DOUA 1XG5A 1ZNYA 1O8CA 3T5MA 3IEVA 2XX3A 2QAJA 4JLNA 3MAJA 2R8BA 4FNAA 4KSBA 7GPBA 4US0R 1YUNA 3DPUA 1TE2A 4GL4A 3DVLA 5B58C 2OG2A 2CUNA 3Q0EA 2Y92A 3CEHA 3U4CA 3W8EA 3ICWA 1O3YA 2CZCA 2OO5C 2I3ZA 1R0XA 5BQ3A 1KS9A 4M53A 4NONA 5EE5B 1MOZA 3T7CA 4RMNA 1X8KA 4MYDA 5AKIA 2AUMA 4BASA 1E9SA 4B43A 1QGZA 1LTQA 1SMKA 3AQIA 4PM4A 3T4PA 2GCGA 3L4JA 2JFUA 1N33B 3OCVA 3QI2A 1EU1A 3FNGA 4P7FA 4ETIA 3TDKA 4W8HA 4B74A 1JHRA 1TPZA 2H92A 1FUUA 2D2VA 2XUQA 3IT0A 1PNOA 3SJBA 2XVZA 4M1ZA 3FB1A 4M8IA 1RBMA 1O95A 3LGAA 4MMYB 1C4OA 4J0QA 2W2QA 4HD8A 4M99A 5JY6A 2UV8A 4J0CA 1YQEA 2J5RA 2X0RA 4FZJA 3I09A 4P36A 4DLBA 3D6HA 2HKIA 1ULTA 2JGMA 3TCKA 3JV7A 4R2IA 5E8JA 4F2DA 5M29A 4NOJA 3NVKI 4IKOA 1W1IA 4Q7JB 3BA1A 3R76A 2R5FA 5AVJA 3B8HA 4G0QA 4MJ3A 4MP8A 5COBA 4AKGA 5AH0A 4LCBA 3LTNC 1E2JA 1T43A 1PI3A 3I8OA 3OHMA 3OUTA 5CGZA 2WTBA 3TD2A 3TLAA 2JD2A 3FLAA 1Z12A 4M36A 3KBOA 2NPOA 2W43A 3HVUA 3P27A 3AGQA 1YDGA 4RIHA 2NW6A 5BV7A 7REQA 5LLDA 2JZCA 1O89A 4LS3A 1W49A 3C6BA 3E35A 3HI6A 2A94A 4NK5A 3QQ5A 4JMLA 1TEZA 5AKHA 3F9CA 4RXTA 4ZO6A 2EEZA 1ODLA 1VB5A 2HX1A 3PIDA 3BD7A 1G5QA 1OPXA 4LY3A 2P8JA 5LA6F 3ZWNA 1T0PA 1DAOA 2CGEA 4XCVA 3IAAA 2B1JA 2FOXA 3KC2A 5A03A 2Z2JA 3DP7A 1M2HA 4DR2B 2CJPA 4ZRDA 3PYLA 1F5NA 3T15A 4GR9A 1X1AA 4XIGS 1N8KA 4B3DA 3RI3A 2PZLA 4CT4B 1G60A 1PT8A 4KGVA 4C2AA 3AF6A 2OFWA 4KN8A 4MR9A 5JXGA 4OU4A 4IGAA 4UMDA 3WTCA 2B8TA 2GVNA 1FJ2A 4LJ8A 1VHWA 2I0FA 2VYNA 2CEKA 3DAOA 3KLNA 3PQ7A 5DDIP 3WGYA 2NQ8A 1XRJA 4LECA 4EJMA 4WNAA 3LH5A 2FLVA 4DAEA 2LCFA 3DE7X 4W1QA 1FZQA 2QRVA 3PQ5A 2ZRJA 4OG2A 4XFJA 3PZBA 3EARA 4D3ZA 4PBTA 3BJZA 3GCDA 4UHHA 1SC4A 2XUKA 4KN5A 2CL0X 1Z6AA 2OUIA 4GOND 3SR0A 1SM4A 1XF9A 3AV0B 3OETA 4J2TA 5D86A 4BGVA 1J33A 1Z39A 1UUFA 3A3YA 3LP5A 3PT9A 4LRSB 3VV3A 5BQ5A 1Z4KA 1I10A 4Q7MB 4DDHA 3TECE 3IBFA 1TQ6A 1WIWA 1XEFA 2RSLA 1A7AA 3L6CA 4IFIA 4BDSA 1S1CA 5IJZA 1YDHA 1W36D 2A7XA 3VSBA 4MW9A 1QF6A 1RCTE 3GEDA 3ZKWA 2AZDA 5B3KA 4FYYA 4RPLA 1GN9A 4IM7A 3QF7A 4AZ0A 1EWYA 1MZVA 2DUJA 4B45A 4KPGA 1T4DA 5LYJA 1FX0B 1T6NA 2OENG 2HDNB 4QEKA 4V02A 2AN4A 3HJBA 3SIRA 4BKMA 2FMTA 3QX9A 1LSSA 1R6AA 2BKEA 1ZAKA 4FGUA 3BD9A 5FOXA 2R6FA 3G5UA 1VXOA 3