2HMUA

Diamond-shaped octameric ring structure of an rck domain with atp bound
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
139
Chain Sequence
b'NKQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YuaA protein
molecule tags Transport protein
source organism Bacillus subtilis
publication title The RCK Domain of the KtrAB K(+) Transporter: Multiple Conformations of an Octameric Ring.
pubmed doi rcsb
total genus 39
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hmuA00
1MV8A 1PX0A 2NSDA 3BMOB 4CQMA 3OEWA 4CQLA 3WG9A 2JFGA 3GG2A 5B12A 1DFIA 3QRWA 4CPDA 3K73O 1PR3A 5IG2A 4WLUA 1KVTA 4CM4B 3SVTA 2DTEA 3GVCA 1HETA 1HLPA 3ETEA 4JN6B 1I0ZA 2B4RO 3MEQA 5A9SB 3ASUA 4PG7A 5KNLA 4BNKA 1DBVO 4OMUA 2UVDA 1A5ZA 3LSYA 4G81A 4JQCA 3P2OA 1R16A 4CLRB 5DCWA 3VOSA 4IS3A 1J6UA 1HEUA 2DTDA 4CMJA 2O7QA 3HSKA 1GEGA 3MJSA 3ZU4A 2HO5A 2Y1OA 2ZTLA 4ALMA 3PWSA 5IZCC 2IRWA 4HFJA 5K6AA 4L4XA 1T25A 3K2BA 3OBBA 4BB5A 4BNYA 1EBFA 3FPCA 3OETA 1B0AA 5DOVA 4CQLB 4FJ2A 4CUJA 5GZ6A 7MDHA 2DLDA 2C2XA 1BHSA 2DT5A 4AJ2A 3KM0A 3OQBA 2Q50A 4DC1A 3GAZA 2IZ1A 4CLRA 2CSUA 4RPLA 5ER9A 3HADA 2VRBA 5ITVA 3KEQA 1JQBA 3VVCA 3QWIA 3GZNA 3KYCB 2Q2QA 5JC8A 1GUZA 3WJ7A 1CIVA 1MG5A 3RBZA 3GZ4A 3PQFA 3F5QA 4RORA 4YAEA 3UHAA 2UYYA 2H6EA 2YYYA 3FRJA 1SZJG 4ZA2A 4QTZA 4WLVA 4ZVVA 1LLCA 1MLDA 3D5TA 1XYGA 2X4GA 1V9LA 2HDHA 3D3EA 1OAAA 4R5MA 1UJMA 2GUGA 3F1KA 4I08A 1HXHA 1LLUA 3GVIA 3ZHZA 4RVUA 4O5OA 2V6FA 5BSHA 5TIIA 3KYDB 2Y1DA 4YAIA 1E0DA 1ZXLA 3UVEA 5L7YA 1H6AA 3ZWAA 1EVIA 4LCEA 4YPOA 4G65A 1SC6A 2FOIA 4EBFA 1GQYA 1YBVA 4D0SA 1GQQA 5JDCA 1K2WA 2WD8A 1EE9A 1I8TA 3STHA 1VSVA 5K9ZA 4L8VA 1VL8A 4OSPA 2VYNA 4RLSA 4MKZA 5ADHA 3JQAA 3K2EA 3DFUA 4IXWA 4RQTA 3M1LA 3GVPA 1E1MA 1ISGA 2VT3A 4YVFA 5A05A 2Q46A 4PGFA 5HS6A 1O6ZA 1PJ4A 4O63O 4J7CA 4OIMA 1PU2A 4M87A 4RLHA 4QFCA 1IULA 4M54A 3S2EA 2W8ZA 2NVUA 4P38A 1OC4A 4FFOA 1I3NA 2XAAA 3G17A 4CL3A 2BFOA 3OEYA 1LNQA 5LC1A 1PIWA 1L7EA 2I9PA 2OBYA 2V6MA 3CZRA 2DBQA 4N5MA 2AQ8A 5AXAA 3EYWA 3I9NA 1KBZA 2B5VA 4PLHA 5K0ZA 4ZHSA 3GFGA 1GZ3A 5IF3A 3DEYX 2PKQP 4RZIA 1HYEA 3ZWYA 4FIZA 8LDHA 3W6ZA 5I8WA 1I36A 1ENYA 3F46A 3DBVO 3D0OA 1SOWA 2X5OA 4HUJA 3TZQA 4EYEA 1U1IA 1E7RA 2RIRA 1ISHA 3N74A 3IKVA 1YOVA 1Q7GA 4DTIA 4DXHA 3ROKA 1CQJA 5L3ZA 2DPHA 1BVUA 2O3TA 4D0RA 4JJIA 1N9GA 1MXHA 3U09A 1JWAB 2X6TA 4ZU3A 1NX6A 1FDVA 2BELA 3ZWMA 3MJ4A 2J8ZA 1GYPA 4YXFA 1B8VA 3AFNA 1TT7A 2XOXA 5TLSA 2PZMA 1M66A 1R66A 4RCVA 1H6BA 3AOEA 1HLDA 3C7AA 5EPOA 1C1DA 3ZW9A 3EMKA 3RQSA 4AICA 4BO3A 2VHWA 2VUUA 1MXFA 2Y99A 3H9JA 1NAHA 3U5TA 4PG8A 1U7TA 2H5LA 3DO5A 2QZZA 3WXBA 1TXGA 3I52A 4BNZA 4E13A 3JD3A 4LVCA 4DWVA 1P74A 3MWDB 4MKXA 5C5IA 1Q7CA 1DOHA 1UXGA 5KWEA 4PRKA 1MB4A 1P3DA 5AOVA 3ZV5A 2PKQO 1YONA 5A3JA 1ENPA 1R4MB 1NFRA 3B1JA 1SCUA 2JD2A 2W4QA 5F5LA 4L75A 2A9FA 3HHPA 4NK4A 4PLTA 3AOGA 4UEJA 4HP8A 3IUSA 3JQDA 4GLLA 1HDXA 5HS4A 3RUDA 5H82A 1PJQA 3EW7A 1CWUA 1SMKA 2PGJA 2X0IA 3KOUA 3IIEA 1AXEA 4CV1A 2O3UA 1DDOA 2WE7A 2RH4A 3ZWBA 4C4OA 1X15A 1SNYA 2VHYA 4WKGA 4HFMA 2H9IA 2Y1GA 4UVIA 2B69A 3AWDA 1N2SA 5TT0A 5DT9A 3UAGA 5EIOA 3ANMA 4BNXA 3MJEA 4CR6A 3FR7A 5JY1A 1DIAA 3GLQA 4ALNA 4JBHA 5TC4A 1HE2A 3H5NA 4J43A 4J1SA 1LU9A 3W6UA 4B7UA 1ULUA 1RPNA 1R6DA 2AHRA 2FZWA 3TN7A 2Q49A 1H94A 1R4NB 2W98A 3L6DA 5C7IO 3RJ9A 1LSJA 2GNAA 4I9NA 3VPHA 4BNGA 1PJSA 3FPLA 4CM6A 5C3MA 2NUAA 1OOEA 2O3JA 2VOEA 5G4LA 1PGPA 3AI1A 4ZQGA 1NHWA 5TX7A 3RUFA 3H3JA 2WM3A 4YJFA 3VPFA 1ADGA 2WYWA 2ZATA 1PGQA 5A04A 4RDHA 5A5FA 4PZDA 4CR7A 1QRRA 4YT4A 4Z0HO 3UCFA 1N1GA 2DPGA 4NFYA 3BIOA 5IXSA 1KC3A 4NNJA 2NTJA 1KVSA 4KDFA 3NJ4A 1NTOA 4RL6A 1LSOA 4CM9D 3HFSA 1E3WA 1L7DA 3OQ6A 1D4FA 1A72A 2ZYGA 3VH4A 1XIVA 3Q3CA 3Q6IA 3HE3A 2NADA 1QORA 3DOJA 4MPDA 4UUNA 1V35A 3KSDO 2VYVA 3L4BC 4NZ9A 1H5QA 4NDNE 3WX0A 5L9AA 4GX1A 3E48A 3BMCB 1SB9A 2XPCA 3H5RA 4XR4A 5JS6A 1TB4A 1E7YA 2EERA 3DFZA 1ID1A 3C1AA 5EQDA 4XCVA 1ZKMA 3CIFA 5KJ6A 5G0WA 2EWMA 4TSKA 4H15A 3FBTA 4II3A 4YJGB 1E1LA 3H2SA 1K5HA 2IXBA 3B6ZA 1GEEA 3ADPA 3A06A 5EJ2A 2HAEA 1L1FA 4MVJP 3AUAA 2C54A 5CEFA 4BGEA 3RUHA 3D5QA 4OYRA 3ZHXA 5DZSA 4QUKA 1WDMA 2O4UX 5TT1A 2EXXA 4LRSB 4D3DA 4S1VA 5G0UA 4HV4A 2PK3A 3RSHA 3WS7A 3JQBC 4QQRA 3TL2A 1OZAA 3W4KA 2PD6A 2YHIA 1ZMTA 3HDHA 4IJWA 2FN7A 5CDGA 1QG6A 2JCYA 2GF2A 3KXDA 4MP3A 4IBOA 4W7IA 2EKPA 4CMKA 2WD7B 1R15A 2W2LD 3EUWA 4PFJA 2DFVA 2NTNA 3EVTA 1VKOA 1XEAA 2AQHA 1ORRA 2B4TO 1G6KA 2JHGA 3V2UA 4BNHA 1NQ5A 4YAJA 4CUZA 4BO8A 4UEOA 4RF4A 4PRLA 5ES3A 2OXIA 1HE5A 1BW9A 5JO9A 4FOSA 1BSVA 2B37A 1AUPA 2X5JO 4RF5A 4BNIA 3TFOA 3UGKA 2CD9A 3O03A 5GY7A 3WFIA 2ZQZA 4XYEA 3TOZA 3T7EA 1R0KA 2F00A 4INAA 3WJAA 2BH9A 1P45A 3Q9NA 1QKIA 2PTGA 4CODB 2ZJ0A 2BD0A 1U2GA 3HB4X 1YB1A 1PSDA 3SLGA 1A71A 4NBRA 2V6GA 1ONOA 1IB6A 3ULKA 3MOIA 3WQSB 4A0SA 1JTVA 1MGOA 3DHNA 5I8ZA 1GV1A 1GD1O 2WE8A 3LYLA 4I9HA 3HQ4O 1DRUA 4KZPA 4GH5A 3PHJA 2EGGA 1I3KA 1U8FO 2DBZA 3KYCA 5THKA 5F21A 3VC7A 1FMCA 5L7TA 3S2GA 4ESOA 4PG6A 1YL7A 1QYXA 4HFRA 1B8UA 3EHEA 5B4VA 1W73A 2X86A 3QVSA 1U3VA 4HADA 2GN9A 3PFWO 5CDUA 2EW8A 2JKVA 3ZV4A 3ZZNA 5C37A 1DB3A 4FFRA 3AY6A 5KJCA 1XG5A 3QSGA 3ICCA 3E8XA 4BVAA 3PQDA 4CV2A 1CERA 1X14A 4NBTA 2WSBA 4U6QA 3UCXA 4XIJA 3VTZA 4R3NA 3Q9UA 4OL9A 1XQ6A 1QYCA 3ANNA 2CZCA 5T5QA 1B26A 4IQ0A 4DGSA 1A9YA 2D2IA 4Y8VA 5FEUA 1KVRA 4MINA 2FPPA 4KQXA 5LDGA 2IYPA 1P9LA 1T1RA 5FF9A 1GUYA 3S2FA 4XQ9A 3H7AA 4IZHA 2ZK7A 2Q2WA 2HMVA 4CM3A 2FPIA 2FY8A 4CLXA 4I5DA 2EEZA 2X9GA 5AQ1A 1KEPA 5B37A 3JYPA 4A7PA 5A02A 2Y93A 1GTMA 1KVUA 1YQGA 3WICA 5L45A 5CG2A 3D7LA 3EC7A 3ZWVA 1YKFA 4YJDA 1PQUA 3BTSA 4XRRA 2AXQA 3OF2A 4BGIA 3OA2A 4GX5A 2BFPA 4UVEA 1ZFNA 2QX7A 4NU5A 5DP2A 1E77A 1HYGA 3LVFO 4AL4A 3FNEA 2VZ8A 4OSOA 1M75A 2ZB8A 3I9JA 3RUIA 3E5RA 1Y81A 2GN8A 2CMDA 3W4JA 3GOHA 4CM8A 2FZEA 2VT2A 4XJSA 2PD3A 2C20A 3ENKA 3D4PA 4WOKA 2WYUA 1DFGA 4NFSA 3KBOA 2Q4EA 4YT2A 4LGVA 1HDOA 4TZTA 4MVJD 3PDUA 1JVSA 4IY1A 4BNTA 5BNIA 1GYQA 4ALIA 4RDIA 1MG0A 2O7SA 2Y67A 3QVXA 3FI9A 4R9RA 4R69A 4AJHA 4RF3A 1HT0A 4B3IA 3GDFA 2YUTA 2I76A 2O3SA 4OQZA 1N7HA 3CMCO 3IDSA 4E2XA 3KYBA 2O48X 3ONFA 4NH4A 4YYZA 4Z6KA 1GADO 4J7XA 4NR0A 4R1TA 2YDYA 1LTHR 1T2EA 3T7CA 4IIUA 3OSUA 5L40A 4MOWA 1M76A 1K6JA 3AOEC 4ND1A 1I24A 4MVJI 5JC1A 2OORA 4J0EA 3PFFA 3VZQA 4B79A 2OL4A 4IPTA 2QRKA 4FGWA 1KVQA 3U3XA 3E9QA 2IEBA 1EK6A 1O0SA 1ZJZA 4IDCA 4QSMA 3VZRA 3X2FA 1Y8QB 2HMUA 4CMAA 1DIHA 3H9EO 1JLLA 3ZWNA 4O1MA 3PJFA 3F47A 1V6AA 4F6LA 3IJPA 2EJVA 1H6DA 3GRPA 3M6IA 2JFHA 4B3HA 2E37A 5T57A 2YQ5A 1H6CA 3DONA 1ISMA 1W6UA 5JNLA 1E3EA 4MVJG 4OO3A 4D45A 6ADHA 3KHUA 3VVBA 4R1NA 2Q1SA 1Q1NA 1BXGB 4ZQFA 1WMBA 2JCVA 5DNAA 4ND4A 1UXKA 3GDGA 4XJTA 3K31A 5CHEA 3VPGA 4Z3KA 3JSAA 2RHCA 4MIEA 3ZU3A 1QMGA 2GASA 3O9ZA 4UULA 4RVFA 4BNVA 2VYVD 4AJEA 3VZSA 1EUCA 3OM9A 6LDHA 3Q2IA 2G0TA 1LLQA 3IL2A 2HLPA 2G5CA 3KUXA 1XKQA 4YRAA 1KS9A 1ZCJA 5JCXA 1DJQA 4B4WA 2QHXA 2GYYA 2HMWA 3KETA 3HJAA 3ZU5A 4WNCA 5ITWA 3LC7O 2C0CA 3IAHA 3PDJA 4GMGA 4IDBA 3UUWA 1WXDA 1XELA 1Z45A 2W2KA 3KTDA 4DBZA 2YHUA 2NU8A 2CDBA 2YDXA 3KSZO 1U9JA 4DC0A 1UH5A 3EDMA 2I3AA 4F46A 1LDEA 3U9LA 1HDYA 4JK3A 1GZ6A 1QV7A 3U49A 1E5LA 1T2AA 3K8ZA 3DHEA 2VYND 2AMFA 5C7OO 4OKIA 3V1UA 4J2OA 4NJMB 3ZWXA 3KV3O 3ZWCA 1YVEI 3U4IA 3BMQB 1NVGA 2C5EA 3WGTA 1LQUA 3MJCA 4P4NA 2V6BA 3KYDA 2DAPA 3GMDA 1DSSG 1E7QA 1VRWA 2HSDA 1G0NA 3BHMA 4CV3A 2HMTA 2QQ5A 5ENVA 4BNNA 2RCYA 2FRDA 4WLEA 3DBHB 5KVQA 3PLRA 4ZQHA 3VZPA 1PQPA 1T2DA 4FN4A 4W4TA 2PH3A 1OC2A 2PD4A 5KJ1A 3ANLA 4G2NA 4GMFA 5TS3A 3I9LA 4TZKA 4Z0TA 3PLNA 3HN2A 3B70A 2JAPA 2OP0A 4XQGA 5KJEA 5THQA 3VAZA 5G4KA 4RVGA 4PLGA 2YW9A 4PLZA 4B7XA 2JD0A 4LSMA 4Z9FA 1NHGA 2VNAA 5BQFA 1E7WA 5BSFA 3DZIA 3VH1A 2QG4A 3V2HA 4UUMA 1HZJA 2HU2A 3UH1A 4YJHA 3EGOA 3C1TA 3OFSA 4H16A 4NPCA 3PQEA 1Q7BA 5AYVA 3KB6A 3MWEB 4Z0PA 1F12A 5L95A 4GWKA 3PZBA 5ILOA 4YQZA 1KC1A 1LXCA 2GD1O 3VH2A 4IDGA 2NM0A 4YJFB 2PA3A 3INRA 4MVJE 1NM5A 5FWNA 4FGSA 4LK3A 1LDBA 3BTOA 1UDBA 5G0VA 1E6EA 5CFZA 3JQ9C 3LDHA 1YJQA 5L53A 1ARZA 4Q3AA 4PG5A 1LLDA 3N58A 2BGLA 5EN4A 1WDKA 1HWYA 1PTJA 2EV9A 2Y1FA 4XWYA 1V8BA 4Y98A 4ILKA 5A3VA 5TSDA 3R3JA 4DLLA 1RYDA 4CM9A 2J3KA 1Y5RA 3LT0A 5F1OA 1ONNA 2FPGA 1X7DA 2C7GA 1BW9B 4R5HA 4WOJA 1EVZA 3CSDA 4DQVA 3LC1O 4GSKA 2PY6A 4O6VA 4PZEA 2BF7A 2C7VA 3TFQA 1HDCA 3PGXA 3E9MA 1R0LA 4J9UE 1YB4A 1Y1PA 4CQMD 3JD1A 3QV1A 2CFCA 4EI2A 3PHHA 1N5DA 2HKIA 4WLFA 3ZV3A 1XU9A 3R1IA 1H9AA 3L77A 4E3ZA 1I33A 3OIFA 4IQ8A 1F17A 1PL7A 3HFGA 3LC2O 2W90A 1ONPA 2VHXA 4OOEA 1RM0A 3G3EA 1XDWA 4OH1A 3WIEA 4R51A 2GPTA 1MUUA 3ON5A 4QO8A 3EY4A 3K92A 1UUFA 2B4QA 4IJVA 4C7JA 1E3SA 3M2TA 1UP7A 2CNBA 1UZLA 4CLEA 3L9XA 4WEQA 2GSDA 4KTVE 5TQVA 4WECA 1ISJA 1UP6A 4E5KA 4DPMA 3IP1A 4NK5A 4R41A 2PGLA 5LDHA 1S6YA 3WTBA 1C0IA 3GGPA 4R9SA 4E2ZA 1I3MA 3I5MA 3PWZA 1P31A 2EG9A 3ZW8A 1A4UA 4PLPA 2FMUA 3WWYA 2I5PO 4KWIA 3S55A 1DHRA 5I7SA 4J16A 3DAPA 4WNIA 4K6CA 1PS8A 5EQFA 4GQAA 2VWGA 5CEEA 1V0JA 3NKLA 5HA5A 3QWFA 3ROPA 1U5CA 1X0VA 3W8DA 3JQGA 1SEVA 4L73A 1DIGA 4IIVA 5HTOA 4LISA 3WBBA 1EMDA 1U5AA 1ZK1A 3DHYA 3AUSA 1ZK4A 1RWBA 3QHAA 5LCXA 4YB8A 4LMRA 4AJIA 1IZ9A 1E7SA 4WK6A 4RZHA 5JAMA 2GDZA 5H81A 3BTUA 2GN4A 1NFFA 3D1LA 3JQ7B 2Q1TA 4WUVA 3A1NA 3JD0A 1AGNA 3L0DA 3ASVA 3WYCA 4TWRA 1MFZA 1UZMA 1TLTA 3EZLA 1Q2XA 3WGZA 5COBA 3LK7A 3PYLA 4BO7A 5EL0A 2B36A 2GZ2A 2D0IA 2GGSA 1UP4A 2QIOA 1WZEA 1Z6ZA 2BGKA 2JHFA 5CDSA 2P4HX 4TKMA 4I1IA 5IZ4A 1PZHA 1G1AA 1WZIA 3Q0EA 4WEOA 1UXIA 3IQDB 2Z1NA 2DKNA 2RHRA 1GPJA 4TQGA 4WGGA 3DAFA 4KWHA 3JQAB 1E3LA 4DA9A 4XQEA 2NLOA 1IYZA 1PQWA 3JD4A 1ZJYA 4WJZA 2EHDA 1Z74A 2BMAA 5JDIC 5KKCA 3GRKA 5HRUA 3ONEA 4XB2A 3RC9A 5HWSA 2AG5A 4ID9A 4QO7A 5TGDA 4UVDA 3GHHA 1M67A 1XWFA 2J6IA 5IN5A 3BMOA 1HTBA 3D64A 4CQMB 4QX6A 1VM6A 4DPKA 1HKUA 1U8XX 1BRMA 3NT5A 4XA8A 4XB1A 2EKLA 5COAA 3DQPA 1DLIA 1DC3A 1ADCA 2AEMA 3GPDG 5TJHA 2IODA 4D42A 3OQ1A 1YO6A 2DUWA 1J4AA 3RKRA 4JGBA 4MO2A 5JO0A 1YS4A 5CPFA 3I1JA 3I3OA 3GGOA 3ROQA 1K6IA 1YBAA 1PGOA 1UXJA 3WR5A 4MIYA 3I83A 1HE4A 4J9VA 3JQ8A 3R0IA 3SX2A 2AE1A 3UF0A 2YQ4A 4BNMA 4NBVA 2JL1A 3RUEA 4GLOA 3IOYA 5JE8A 3G79A 3MJTA 4JJFA 3A9WA 1MFPA 1AN9A 1FK8A 1YDEA 3VDQA 1ENOA 2C07A 3TWOA 3ZHBA 3PZRA 4KTTE 3SBOA 4JX8A 3JQFA 1NVMB 2Q45A 4M8SA 2AA3A 4MP8A 4RVDA 2Q1WA 1B15A 3E1KA 4TRMA 1K0UA 3V8BA 3WTCA 4BQPA 5A03A 4FB5A 2J5RA 2P2SA 3O38A 3DZJA 4GVXA 3JYLA 5DDIP 3ZNNA 4BO1A 2TMGA 5JXWA 3W1VA 4NQZA 3RD5A 3PIDA 2C29D 4ZICA 4M49A 5DBFA 1P1RA 3DOOA 1ISIA 1ZMOA 2ILTA 4L4RA 4UUOA 2AQIA 2DU8A 4DREA 4IXTA 3TZKA 5KTKA 4J91A 3F5SA 3WQQA 4DUPA 1DC6A 1YRLA 4KUGA 4K1LA 2VUSA 2YJZA 2I6TA 5BR7A 3W4IA 2EGHA 2PKRA 4E32A 3DMTC 3JQAD 4O59O 1PJCA 1TI7A 3PHIA 2DC1A 3FN4A 2VRCD 3RFTA 1X7HA 2J5QA 3SC4A 5ICSA 1DRVA 4RPKA 4EZBA 1B8PA 4CMEC 1LSUA 3DR3A 1AHHA 3OJOA 2I66A 2IXAA 4MJLA 4YRBA 2OOSA 2OHXA 1PJLA 2X22A 5JDCC 4FBGA 3DB2A 3JYOA 1JVBA 4FCCA 4NBUA 1Q0QA 1QSGA 3HWRA 4CMGA 1DRWA 5IDQA 3GNSA 4PLFA 3CEAA 4YT8A 5KJFA 3NGLA 1R0SA 4TVOA 1KIFA 1GDHA 2ZCVA 4J4TA 3A28A 1LC0A 1PEDA 3LZ6A 4DQUA 4E33A 1W8DA 4DLBA 4QEDA 2GN6A 5FFFA 4PLWA 4BNJA 3CTMA 3AY3A 3ZWPA 1EQ2A 3AI3A 4IQGA 1YWGO 1DJNA 4NU6A 2NV6A 5EERA 4ALKA 1QYDA 4B4UA 1V3UA 1DC5A 1CF2O 2Q99A 1GQ2A 4J4BA 1YE3A 3BAZA 1TT5B 1DIRA 3TZHA 4CMHA 3M1AA 3OH8A 4HX5A 4TROA 3TZ6A 2SCUA 1N8KA 3JD2A 2BFMA 2VUTA 2GZ1A 2Y1EA 1ZSYA 1OI7A 2Y0CA 1O94A 2PNFA 4B4VA 2C82A 1R4MA 1D1TA 4CUKA 4ND2A 5TF4A 2AE2A 3HUDA 2Q2VA 4GPD1 4PN3A 3MTGA 2YFQA 4FR5A 4CL8A 4XX0A 3LLVA 3INTA 1GYRA 1FJHA 4RV9A 3LF2A 4CLOB 2BI7A 1QP8A 5COQA 4DVJA 1E3WB 3MTJA 4MVJA 4OQYA 4MP6A 3RU9A 2VCYA 1N9GB 4Y6RA 3NEPX 1PWZA 3DBLB 2W2KB 3NAQA 2WTBA 5TRTA 4YAGA 1O95A 2QW8A 3QWHA 4WCFC 3ZNPA 3S2IA 3GF4A 2HUNA 5B4TA 2HRZA 3BHJA 5I7EA 5A9RA 2DM6A 2WWRA 4LN1A 2D4AA 4CLDA 4R4JA 3ZHYA 4D7AA 1YL5A 1EEHA 4J3FA 4BNFA 1SAYA 3VTFA 3FD8A 2NVUB 4XEHA 1RJWA 3WYBA 3EVNA 1NR7A 3CMMA 3GN2A 1R4NA 4U6SA 1NQAO 2Q3EA 1U4SA 5IAAA 4CMIA 1T1SA 2I67A 3B1KA 4RVSA 1H2BA 4WCFA 2EW2A 3U4HA 2NU7A 4IZIA 1TEHA 1HL3A 4A73A 3U0BA 1B7GO 3U4CA 1NWCA 2JCXA 3PXXA 3TRIA 2P68A 2BHLA 4ITUA 4Y6PA 3UICA 1WAMA 4F6CA 1S7CA 3FF4A 4R54A 2UUOA 1PL8A 3ENNA 5F3RA 4IDEA 4NBWA 3WSVA 4AVYA 2ZTUA 2XF8A 3WIDA 3DTTA 2X23A 3BYZA 3ETDA 3QVOA 3GGGA 4GX0A 1P33A 4FC7A 4M86A 4CMEA 4XDZA 3OA0A 4QFDA 3GN1A 2VWPA 2P5YA 1NQOA 2NWQA 4E0BA 3QJ5A 3L4SO 4WCFB 1DPGA 2HK7A 2HMSA 5BSGA 1XLTA 2I3GA 4DPLA 2ZQYA 1NWHA 1JDJA 1GR0A 1GCUA 5B4UA 5BNFA 4Z3DA 4EGFA 1T4DA 1QLJA 3OIDA 2RAFA 2PZLA 4FC6A 5U4QA 3OJEA 5JYEA 4ROSA 1MA0A 1E3JA 2PGDA 2VWHA 1WPQA 2P4QA 3D3WA 3RC2A 5IFLA 4GKVA 4N7RA 1B2LA 1AE1A 2WMDA 1GU7A 4XYBA 4OAQA 3JQFC 1DLJA 2JFFA 3WNQA 3T4EA 3IS3A 2FSSA 4OOFA 4PLCA 3K96A 4BIIA 2BKAA 3L6OO 1XR3A 3PJDA 1YJ8A 1M2WA 1EFLA 2X8LA 3RFXA 2HK8A 2DTXA 3O8QA 1HSZA 4M89A 3WOHA 3I4FA 3FBGA 2YV1A 3PGJA 1VSUA 4WPGA 2X0RA 3NYWA 2Q4BA 2G76A 4DL9A 2RBEA 2HJRA 4CM5A 4D3SA 2D3TA 5I9LA 3NJ8A 1BDMA 3DBRB 3FTPA 4Y6SA 1Z82A 3RFVA 2AG8A 3OECA 3LQFA 4CR8A 1HZZA 1QV6A 1Z7EA 3OICA 1EVJA 4QT0A 5KVVA 2FHSA 2FWMX 1ZZEA 4OHUA 3KZVA 1F8GA 5A1TA 2ZIZA 3PJGA 4E2WA 2HK9A 2FSVA 2IEDA 3DDNA 4DLAA 5HM8A 1QYVA 4E12A 4YTEA 4W99A 2FR8A 3L07A 5A4DA 2AQKA 1P1HA 1GFSA 4JXKA 4B8WA 3GT0A 3VKUA 4YRDA 3FR8A 2OO5A 1IE3A 2JAHA 2CF6A 2D1YA 4E21A 5J23A 4GAEA 1E7MA 4J6FA 3AK4A 2VTDA 4GWGA 4E6PA 1HDRA 3OHSX 3S8MA 3GH3A 2ZYDA 2DQ4A 5B1YA 4LSWA 4HY3A 2P5UA 1ZK0A 4CM1A 3VH3A 4FD3A 1EVYA 5IDXA 1KY4A 3JQGB 1AHIA 1TVEA 4H7PA 3QP9A 3W8EA 2CDAA 3QA9A 1YB5A 3I9KA 1P0FA 3GNQA 3T4XA 1D3AA 1IPFA 1PJBA 3TSCA 3JTMA 4BB6A 3TL3A 2RH8A 4EJ0A 1BDBA 3ZCXA 5KIAA 2B83A 3KRTA 2DVMA 3ETGA 2B5WA 1XA0A 1J5PA 5A5EA 2ZB3A 1WP4A 1OMOA 1PR9A 4LCJA 4YDRA 3PYMA 5JAZA 1FXSA 2R00A 1ZIDA 1R37A 2GRAA 4IMPA 5A9TA 1D7OA 4L0QA 3F4LA 4WCDA 4I5GA 1CJCA 1HSOA 4BQRA 1B3RA 1ZNQO 3I23A 4KUHA 1E5QA 2PZKA 3NT4A 3WFJA 4BO6A 1EFKA 1MC5A 2B0JA 1ADFA 7ADHA 3N7UA 4AJKA 3HDYA 3H9GA 3RKUA 1JN0A 4NI5A 4IS2A 3RIHA 1ISFA 4IDAA 3AI2A 1HDZA 1NFQA 1YQXA 4CMBA 1M6WA 4XR9A 3CXRA 1YBMA 4XYGA 1U28A 2OP1A 1J49A 4KDEA 4RO0A 3U62A 3GA0A 1T4BA 4OXNA 2UDPA 3ZI0A 4N5LA 3UXYA 3WNVA 3ICPA 2C59A 1JW9B 2PH5A 4IUYA 1ULSA 2ZKLA 1HDGO 2HQ1A 5CAEA 3I6QA 2E49A 5CDTA 3BA1A 3F3SA 4YR9A 1C1DB 4N5NA 5JFOA 3ST7A 1K3TA 3IP3A 5EINA 2UAGA 1B16A 2VHZA 5JY6A 4ZRNA 1IUKA 1ZVMA 3F4BA 3H6KA 4FSHA 1JAXA 3L6EA 4ZRMA 4FDAA 2ZTMA 4BHTA 3I9MA 1UR5A 2WJPA 3QVTA 2A4KA 4IINA 2NU6A 3HG7A 4BO4A 3UCEA 1ZEMA 1Y5MA 3OP4A 3W8FA 1NXQA 5GZ1A 1I32A 4XD2A 3NDRA 4II2A 3QW2A 4IGEA 1YL6A 2VZ0A 3AU9A 4F45A 3LF1A 4P22A 1NBOA 3EAGA 4NG5A 1Z73A 4FJ1A 2NQ8A 3DTYA 4MKRA 4YAKA 3H9QA 4J1TA 5KVCA 1EUDA 2WYVA 1YDWA 1MC4A 1LBEA 2ZB7A 4XGNA 1WVGA 4XYMA 4DRYA 1Y8QA 1LRKA 3JYQA 3HB5X 3V2GA 4PG4A 4I5EA 1GAEO 4BV9A 1C0KA 3E9NA 2X58A 1BTOA 1KETA 1I3LA 3WMWA 2X7HA 4D44A 2X9NA 3FWZA 1NPYA 3DAGA 4IJUA 4R01A 4AJLA 3B1FA 3FSRA 4BKUA 1YH3A 5BT9A 2B35A 3VHRA 4UVGA 3LT4A 2P91A 1E3IA 3ABIA 3QQPA 3JYNA 1P1IA 5CG1A 3C8MA 3RASA 1LJ8A 4IJKA 1JAYA 3E5MA 3GEMA 4BKPA 1BXGA 1FDUA 2OUIA 3OMLA 1T26A 2V7PA 2BFAA 3QLJA 3VKVA 5FI5A 3KSUA 3RI3A 9LDBA 4BKOA 1C14A 4N54A 1O5IA 1ML3A 2A94A 4GGPA 3TPCA 1NNUA 3NTQA 4HXYA 1YGYA 2ZTVA 1JKJA 5KOIA 3PK0A 5DF1A 2Y05A 2O3QA 1Y6JA 1VL0A 4BGUA 3P5SA 4LRTB 2O23A 5T8KC 1J0XO 1JU9A 1KEWA 5DP1A 5A06A 5CEJA 1H2HA 1SO8A 2AEFA 3PTZA 2NTVA 1K6XA 4IDDA 4WLOA 4MIOA 2AEJA 4GVLA 4A5OA 3RC1A 5MDHA 2VWQA 1CQIA 1PZGA 2E4AA 1PJ3A 1VJTA 5T64A 2PZJA 3AFMA 1LQTA 1EDOA 4XDYA 4CLHA 4E30A 1F8FA 1Z75A 2IZZA 3UKOA 4CM8B 3AW9A 4DIBA 2Z5LA 3OJFA 2R6JA 1U4OA 3EZYA 4NJMA 4HBGA 1ZBQA 2P9GA 1BGVA 3P19A 1GUFA 3GDOA 3UW3A 1SPXA 3SJ7A 1I01A 1QLHA 3KVOA 4J4HA 3NTOA 4ZQBA 4QXMA 1E6WA 1PZEA 2LDXA 1C0LA 4Z9YA 4JP3A 3KLMX 3NV9A 1OFGA 3I4CA 1WNTA 3E82A 4R3WA 4DYVA 3GVXA 1VJ0A 4ZJUA 1T2FA 1VKNA 1SEPA 3GY0A 2DBRA 5DCYA 4FQ8A 1ZXBA 4B7CA 5JW6A 3RUAA 4M55A 4AFNA 1EZ4A 3CE6A 1P1KA 4NIMA 2POQX 2WDZA 2NQTA 3PI7A 3EK2A 4EUEA 1DAPA 4BMSA 1A7AA 1O9BA 1WWKA 2QRJA 4EJ6A 4BKRA 1NQTA 1HYHA 4W6ZA 2CVQA 2R2GA 2H63A 2IZ0A 4KOAA 5ER6A 3C24A 4XGKA 1H9BA 4HKTA 1EE2A 1O89A 3FHLA 3ZU2A 1ZK2A 4Q3BA 3ROMA 5U1PA 4TRNA 2GR9A 1LX6A 1RM3A 2ET6A 4ND3A 1O8CA 3WYEA 1DHTA 3WGIA 2X9VA 5DOZA 1KY5A 4R16A 1H0KA 4DMLA 4DBVO 2EKQA 1XQ1A 2GO1A 1I2CA 3KO8A 1NVTA 3C85A 2Y68A 4XRGA 2I65A 4CM4A 3DMYA 4BV8A 4FW8A 1EDZA 1ZW1A 1CRWG 5JDIA 3NTRA 4I9UA 5A9SA 1JWBB 4B4OA 4FFLA 4GGOA 1LDGA 2CDCA 4Q39A 4D41A 1N1EA 3DBRA 4BNUA 2PWZA 4I5FA 2Q1UA 2UUPA 5T67A 1M6HA 4J7UA 2CVOA 2DBVO 4A03A 3CINA 1DEHA 4PCVA 2IYOA 5F1PA 2GLXA 3E18A 4GSLA 3PHLA 3IUPA 1E1KA 3RROA 1EUZA 2OBNA 1V3VA 3ZNOA 3TF5A 2DUUA 2Z95A 3QWBA 2BRUA 4OKNA 4MVJH 4YA6A 3ZWOA 3S1LA 4GBJA 1FDTA 2YV2A 3RC7A 3COSA 1DXYA 1BMDA 2X1HA 4TKLA 1A7KA 4F3YA 2ZJ1A 1RM4A 5JMPA 1U3WA 2BI8A 2X0JA 3MOGA 4W82A 3BMNB 5FYDA 5ILGA 3P2YA 2C5AA 3F1LA 2EJWA 4UUPA 4RPGA 3GZNB 4OM8A 4ALLA 4BNWA 4E5NA 1D1SA 1Y8RB 4NJOA 3FWNA 2R00C 4B8ZA 1Q0HA 4OGWA 1CDOA 2CY0A 3E6AA 5AXBA 3WGQA 1NYTA 1VE9A 4K9DA 4YACA 3GUYA 3OIGA 3DBLA 2GZ3A 4XYLA 3RCBA 1KEVA 2H1SA 2C2YA 1UAYA 1XU7A 3CKYA 1UXHA 1Z7BA 2VN8A 4EITA 2JJYA 4L9RA 2A92A 1HE3A 1U3TA 3K9QO 3TOXA 1FDSA 3M2PA 4YCAA 2O3RA 1BXKA 3QE3A 4FFPA 3O4RA 4RPHA 4OJNA 2YHIB 3C7DB 1Y8RA 3K6JA 5DN9A 3KLPX 5L4SA 4Q9NA 3AM5A 1HRDA 3P7MA 3DL2A 5G4KB 4JJGA 5ICMA 1SOVA 1N7GA 2HRBA 4AG3A 5EMHA 2HCTA 5IDWA 1IHXA 1A27A 3FNGA 2TMDA 2DFDA 3FCOA 1Y7TA 3ITKA 1VJ1A 4MVJF 3NRCA 3BHIA 2EIHA 3H5AA 3JQCA 3WGYA 4A26A 5JCJD 4E4YA 2PV7A 4G5HA 1E92A 5AXCA 1LRLA 4CMIB 1P1JA 2HJSA 2YV3A 3CZMA 9LDTA 2D5AA 1VPDA 1OBFO 3PHGA 2NACA 4DMMA 3ADOA 3G1UA 1PL6A 4U8GA 1IZ0A 1KEUA 5KVSA 2CVZA 3GFBA 2IE0A 1DAOA 3H9UA 3JQ9A 3PYXA 1ZEJA 2FR1A 2A35A 5T6BA 4E2YA 1JKIA 1YXMA 4Q3CA 5JYDA 5FI3A 3Q11A 1E1NA 1LC3A 1I2BA 1VI2A 3H2ZA 2O50A 3VPXA 3WLFA 1XHLA 4Q3NA 3AU8A 3GPIA 1CYDA 1BWSA 1PGJA 4S3MA 3RAJA 3PP8A 5JBIA 1IY8A 3WQRA 4RPJA 1DC4A 3DC2A 5F5NA 2G17A 5BSEA 1PJ2A 4E31A 4W7HA 4GKBA 1B3BA 3JQEA 3QWAA 3VDRA 1R12A 2VTEA 2G1UA 4JBGA 2I99A 1X13A 1LRJA 2OFPA 3UOGA 3ZNQA 4JP2A 3LT2A 5IDYA 3D3WB 1EQUA 4TMFA 4CMCA 2VRCA 4Z9XA 1K89A 1RM5A 2J3HA 1UDAA 1BG6A 3DZKA 3RWBA 5CDYA 1E6UA 3AUTA 1G0OA 1WLYA 3JQ8B 3NDJA 5IXYA 4H3VA 4L76A 1C0PA 3TJRA 3VPSA 2E82A 5BNTA 3PRJA 3SLKA 5L4LA 3WGOA 4AJOA 4PVDA 1PS0A 4FFNA 4XKJA 5JPIA 3BTVA 1PS9A 4GI2A 3O8QB 1QYWA 1CEQA 4NFHA 1PWXA 2P9EA 1NPTO 1W4ZA 2Y1CA 4E5PA 1NPDA 2F1KA 2QZ9A 5TNXA 4B3JA 4W9NC 4WASA 3BXXA 2YY7A 1ZK3A 1GV0A 2PR2A 4BUCA 1GL3A 3HDJA 3QIVA 4KMSA 5IZCA 4ZGWA 3E03A 3MJVA 4U0JA 4Y67A 3A14A 4ONEA 3TDKA 2GCGA 2QYSA 5L51A 4XQCA 4RVHA 2E48A 3SEFA 1VC2A 3PVZA 1LDMA 4DQXA 3H3FA 3CPSA 3RUCA 4CM7A 2EF1A 3SC6A 3GVHA 3TZCA 2J3JA 2IDZA 4LVUA 5G2OA 3RJ5A 3JV7A 4IDFA 3UN1A 1B14A 2LDBA 3Q1LA 2O2YA 5HBRA 1FF9A 1GCOA 4OXKA 4AJ1A 1EK5A 5DULA 3WDSA 2OZPA 5I7FA 4EUFA 3ZH2A 1YQDA 2O2SA 2QRLA 1I5RA 1DIBA 4LW8A 3IMFA 2EP7A 3DBHA 1X7GA 2D5CA 3GEGA 3ONDA 3K30A 2Y0EA 1ZSVA 1SBYA 4PLVA 1V3TA 4GL4A 1C3VA 1WDLA 3I9OA 1LDYA 4PLYA 2VHVA 4YT5A 2NNLD 3GR6A 3SXPA 4AJNA 4E5MA 4RQUA 4D43A 3GEDA 1H93A 3H65A 1MX3A 4LMPA 4BKQA 3HZZA 3C7CB 1MP0A 4U5QA 4BMNA 3H4VA 4ZN6A 1NR1A 5MGBA 3RVDA 1AXGA 3ZN2A 3ZV6A 1BXZA 5F1KA 3SJUA 1X1TA 5L4NA 1U7HA 4KQWA 4BMVA 4BL5A 1VL6A 3F9IA 1A9ZA 5H83A 4D46A 3HN7A 4C7KA 5DBIA 2OGUA 4JROA 4URFA 3IJRA 3BMQA 1LSSA 1UZNA 1KYQA 4HFNA 1C1XA 4E5YA 4K6FA 2ZCUA 4ALJA 5JAIA 2D8AA 2NVWA 3NUGA 3HDQA 3JQ6A 1XSEA 3WSWA 3D4NA 4J1QA 2YFHA 4NMHA 4I8XA 4JIGA 4OXYA 4QECA 1GZ4A 1ZUD1 1ZSNA 3AM3A 3QVWA 1KERA 3GNTA 4J0FA 1DFHA 4N18A 4KUEA 4IGFA 1W0CA 3DWFA 5KCZA 3IC5A 2E6UX 4EJMA 4FOOA 1I10A 3NT2A 3AY7A 4J49A 1JA9A 1C1XB 1IL0A 4KP7A 1P77A 1YOVB 4R1UA 1WW8A 3X2EA 1TT5A 1LDNA 4W9NA 3H8VA 1P44A 2OMEA 3LLSA 3NGXA 1Y9EA 4DIFA 3C3XA 5G0TA 1F0YA 2X0NA 4YJHB 4R1SA 3WGHA 4AJPA 1IHYA 1GPDG 3ZDFA 4YBZA 2VNSA 5L7WA 4CV0A 2D59A 2P9CA 4UEKA 4RJTA 3DOCA 4UREA 4BO9A 5C7LO 1F14A 5DCUA 1LI4A 4P8RA 8ADHA 4CLOA 3V5NA 4ZD6A 2G82A 3UFXA 3A4VA 3L9WA 1QR6A 4JBIA 4AJJA 2O4CA 3GG9A 4JCOA 4Q3EA 4FFMA 3RBXA 3LT1A 2CF5A 2EP5A 4L4SA 3PEFA 2FP4A 3O26A 2JD1A 2QYTA 4DYDA 3ITDA 4PZCA 5JCJA 4UVHA 2PLAA 2W2LA 5I9MA 3FNHA 5CP8A 2PFGA 5GMOA 5JMWA 3AJRA 4BO2A 2Y0DA 1DO8A 4A2CA 2VZ9A 3DXFA 3HNPA 3G0OA 1U2DA 4FS3A 3QY9A 1EBUA 1CETA 3PIIA 3GQVA 2FR0A 4K26A 4A27A 1SB8A 3BZUA 1UDCA 3G49A 5K6AC 3INGA 2VOJA 2XXJA 3IKTA 3R6DA 4BO0A 4P4LA 4U7WA 3ORFA 4JNKA 3FNFA 2UV8A 3DZHA 3R3SA 4YQYA 4PIVA 1BVRA 3GUCA 1IPEA 3BMCA 1VLLA 3DZBA 4J1NA 2YZ7A 4ND5A 3JCZA 1ZO8A 4NHEA 5CPBA 4WE3A 3F6YA 4DIOA 2Z1MA 5JSFA 4D3FA 1P0CA 2BGMA 4BOYA 3RU7A 3NDIA 1X0XA 3I6IA 3B20A 3MZ0A 4YJGA 4BO5A 3JQBA 1P1FA 3GHYA 3OJ0A 4J90A 1XGKA 3GC6A 2WEKA 5TJ9A 5T8KA 1I2ZA 1FDWA 1Q0LA 2NU9A 3GK3A 1JKFA 2VQ3A 3CUKA 4HWKA 1NASA 5I7VA 4YWJA 1UAGA 3KEOA 5AVOA 4EEZA 4XIYA 1NP3A 4BGVA 4FPXA 3RBVA 4HNHA 1Y9AA 3U4DA 4EUHA 3BMNA 5JLAA 4MVJM 2V65A 3V1TC 3LU1A 1LUAA 4Q3DA 3WMXA 3D4OA 1XCBA 3ZGYA 3WB9A 1D8AA 1F06A 1ENZA 3FTNA 5JAQA 2X5KO 1WMAA 5GZ3A 4D79A 4R68A 4YEDA 4Y9DA 4L74A 2XXBA 4XGIA 4XZ3A 2WD7A 3WGGA 4ZQEA 4BNLA 1LA2A 2NVBA 1U3UA 1ZH8A 3AUUA 3WBFA 2ZB4A 3MCVA 1GY8A 1PJTA 4A10A 4BS9A 1PZFA 4TVBA 1PGNA 3PJEA 2Y66A 2BLLA 3JQ7A 3L4BA 5AXDA 4IM7A 5EESA 4EEXA 3NX4A 5G0SA 5I9NA 2ZYAA 3ZWWA 4EDFA 4AJ4A 2J3IA 3WWZA 1I30A 4WLNA 4O0LA 1QXSA 3DMTA 2AW5A 4M1QA 3V1YA 3DZFA 3GAFA 3WLEA 5KKAA 1RYEA 3PPIA 4EW6A 4FJ0A 2GERA 4J2HA 3DZGA 1N92A 2J5KA 3C1OA 4IMRA 4JLWA 4K28A 4TRJA 5DBGA 4X54A 3TNLA 2CUKA 3K5PA 4RF2A 5IJZA 5IN4A 3AM4A 1T2CA 1NAIA 4U0KA 3Q2KA 1IOLA 1RKXA 3G1TA 1HF3A 1T24A 4UAGA 4CJXA 1X1EA 4P4GA 4PVCA 5U9CA 1LEHA 4TRRA 3CH6A 4MDHA 1A4IA 3GMSA 3OJLA 1KOLA 1TA4A 1ADBA 3TQHA 4RGBA 3PWKA 4HNGA 4GX2A 5ENDA
chains in the Genus database with same CATH superfamily
1N1MA 1MV8A 2FUKA 3M1YA 5K3SA 1V95A 2QX9A 1FVHA 1FFDA 4CQLA 2PWBA 3WG9A 5B30A 3Q8LA 2ZBUA 4WWHA 5JMTA 3C7TA 3P0FA 3VAYA 4WLUA 3ZKWA 3CRZA 1X38A 1M0TA 3N2ZB 4QJIA 2DH5A 3T4PA 3KZXA 8OHMA 1YS7A 3ZK7A 2W93A 3GVCA 5BNWA 3HGTA 1Y5IA 4PFSA 1V41E 5FPKA 3W77A 2D62A 3IJEB 4I3GA 1O6GA 4MS4B 1GNRA 2FGJA 4JQCA 3P2OA 1ZI6A 3W78A 3ZK9A 2C61A 2Q5CA 3G9XA 5DCWA 521PA 4TXJA 4OFBA 4BJ6A 3FYUA 1L8LA 1VIMA 4CF3A 3K6SA 5DEOA 2D2EA 3VDNB 1HT1E 1Z5NA 4CMJA 2ZDHA 2HO5A 4ARZB 4EW2A 4Q3LA 2B92A 1UKEA 3CJQA 5IZCC 2IRWA 3E5NA 1NV9A 1Y6GA 2GHRA 5ALYA 2HA7A 3E3MA 1SXJA 3K2BA 2CC2A 4YREA 2HWWA 4BNYA 1EBFA 2W6IA 3ML1A 3OETA 4G23A 1PVDA 1KO5A 2ZJAA 2B99A 2SHKA 1L7VC 2WPDA 1JYSA 4W5NA 3IOBA 5C80A 5T4HA 1VOTA 3EGXA 1ZNWA 4QQKA 4X71A 4FE4A 4PSKA 4R6WA 2I1LA 4O4LB 3OQBA 3ESAA 3PHBE 2IXDA 2Q50A 4KKVA 4RFSA 4X1IA 1VBMA 3GAZA 1O57A 3S44A 4BKMA 4CLRA 2FWRA 3UTDA 4YCMA 3GPLA 1T4GA 1KKMA 3FZGA 3KT8A 4PYIA 2VRBA 1P0MA 3KEQA 3G6KA 1JQBA 3V32A 3UMYA 4H6PA 4Y30A 1OIVA 1SZCA 4NRDA 2XMDA 2WFZA 3O92A 5LQRA 5SY4A 2I4LA 2V4MA 3RANA 3ZDEA 2XWJI 4MMZB 3WXMA 3AL2A 3BD6A 1AMOA 4YAEA 1SKUA 3UHAA 1UMBA 5JXGA 1TTHA 1RHMA 4W5QA 1JLRA 2QTGA 3FRJA 3Q5GA 4ZA2A 3D5TA 1L7NA 5TARA 2ZBEA 2X4GA 4BWYA 3GLHE 1WBBA 1OAAA 3DGFC 5CJPA 5AVUA 4GMHA 4A36A 5JEEA 3GJQA 3EYAA 3EMVA 3ZHZA 1KXZA 2GCIA 4P93A 5AICA 4DJDC 1NRJB 2EZUA 5KPDA 4JL5A 2QVBA 1ZXLA 4ETWA 4AO6A 2FA9A 2BT4A 5K2OA 4PGAA 4RDCA 3DE5X 1YMUA 4LCEA 4P7BA 4G65A 1FX0A 2FOIA 1TVKA 4DG5A 1YBVA 3DTVB 4IIBA 1GQQA 2B1QA 3HRHA 3G0IA 4NF2A 5TY0A 4L5CA 2OHVA 3I2IA 1MOPA 3R7BA 4CFZA 3F9CA 4OSPA 1WRBA 2VYNA 5CH5A 4QKQA 3ROXA 1WHTB 4CU5A 3DFUA 3NS7A 4IXWA 1HT2E 2V1XA 3ZE0B 1U2GC 3M1LA 1XFAA 1THTA 3QK7A 3WKAA 2MT9A 4QRHA 2VT3A 4DEYA 3W9BA 2OA0A 1W5FA 5A05A 2Q46A 3D8RA 2JPDA 5HS6A 1PJ4A 1GDDA 1MRNA 4OIMA 5ALNA 2PUVA 1PU2A 4M87A 4W7SA 3ADCA 4Q7LA 1GU1A 2MSCB 4QFCA 4DNXA 4ABYA 4YV2A 3V4LA 4OFXA 3B7WA 3MGAA 5E6SA 3TLCA 4JMPA 4KK4A 1DQYA 4QASA 1D03A 2BFOA 2CB9A 2DYKA 2JLUA 3OOYA 1F2UB 3TZEA 1L3BA 5LC1A 3V8PA 1L7EA 3PQ3A 4DCJA 2IHKA 2V6MA 2R8OA 2DBQA 4N5MA 1KI7A 2EFEB 1V5EA 2AQ8A 3KG2A 5SYMA 1UKYA 5K8IA 4J94A 5CFOA 1KBZA 5LNK6 2JG3A 2HIGA 3RSOA 4B3GA 4Q9KA 3U3MA 3H87A 3MWGA 3ZZTA 1N2XA 4GZ5A 1QH0A 2VTBA 1RADA 4FIZA 4CCYB 2Z5GA 3QMWA 4WINA 4DDHA 4UDNA 1GGFA 1I36A 2M32A 2Z98A 4FFDA 4HGZA 4LF4B 2BDTA 2VSNA 2ZIXB 3TZQA 5GV8A 4EYEA 2RIRA 4JITA 4N5HX 3WBKA 1U2QA 4NOLA 2XSZD 4QZVA 2FPXA 1TJ4A 2A1UA 3E3OA 2BBWA 2Z83A 3GW8A 4HGPA 4DIDA 5AW4A 2V9ZA 4N03A 1IY1A 3RAJA 5I5EA 3THXB 1BVUA 2O3TA 2HT6A 2D1QA 2J87A 1N9GA 2M9MA 2ST1A 3FLEA 3OQIB 4FBMA 2P30A 4YLYA 1NX6A 1FDVA 2C83A 2IP2A 3MJ4A 3ZWMA 5P21A 1AB6A 2E2WA 5AJXA 1JPVA 3FNIA 4LX8A 4XARA 4ERNA 2C58A 2Q5FA 4MV8A 4XJVA 1H6BA 2QRPA 4XM0A 1PUIA 2QQEA 5FB3A 5M04A 3C7AA 5EJMA 1LB1B 2Y6VA 1CRZA 4EUNA 2IPMA 2PTHA 1CC1S 3EMKA 1N4AA 4DCNA 2QAJA 2BFBA 2A7QA 3DYBA 1H2AS 5JZ9A 4R2HA 1SG0A 2QENA 1RQNA 3U5TA 3CX7A 5I47A 5I7UA 1CS4C 4ZVMA 1AXRA 2WTNA 1I0IA 4MUGA 1T4MA 1U7TA 2VP4A 3BQNB 5KYXB 3ZHCA 4AKGA 4LVCA 4DWVA 4LJ9A 4MKXA 5C5IA 1Q7CA 4PRKA 1P3DA 1KR5A 3ZV5A 1VCOA 3QPDA 4OQLA 5A2QA 4UQLA 2XDYA 1L4HA 2IPOA 3UJAA 1G59A 4KIFA 1NFRA 4LSGA 4CKWA 1SCUA 2SKDA 2IHNA 2NU7B 4QOEA 4TTQA 5JZOA 2QRVB 2HHAA 1ID8A 3EGVA 1V2GA 3BN3A 1DCTA 1I14A 3I28A 1JAZA 4MR7A 1K0FA 2JIPA 3TLKA 1HDXA 5AOBA 1ECGA 3A1FA 2WYOA 3RBAA 2ISSD 1CWUA 4BXOB 3GFSA 3O2JA 1IC6A 1D4AA 2FPOA 1GFWA 1RAEA 2O3UA 1YCGA 2V6IA 3LYHA 4H6WA 2QLMA 4LDAA 1QFXA 3WRVA 3MB8A 4YDHB 4OJYA 1YTUA 1SCQA 3KUKA 1J24A 3W06A 1QO7A 2IFTA 4WKGA 4LDZA 2Y1GA 1TZCA 2B69A 1AUVA 1M2JA 2OHGA 3MJDA 5A3RA 2P4UA 2Y92A 1N2SA 3T9AA 3UAGA 3RKSA 4HVAA 1NDQA 4HK4A 3VNVA 2VK1A 4CR6A 3FR7A 4DV2B 4MI3A 4D98A 1XZDA 3I0ZA 2MR6A 3AFIA 5D87A 2F9LA 4CT5A 3JAKA 3O8BA 1JFFB 1P0IA 4O2RA 1XNQB 1GAWA 3AG5A 3LQ4A 3F8TA 1PV1A 1ULUA 3NETA 3RAPR 1T3HA 5IWAB 1BE8A 2AHRA 3EXEB 2Q49A 1H94A 3SNKA 4RKRA 5F73A 3BH6A 5FQNA 3TAHA 3DWGA 4BP8A 1IM5A 3OEED 3CUSA 2C7PA 2JAWA 1RPZA 2WWTA 2X0KA 2O3JA 2J9RA 2WKPA 3CKKA 2A8YA 2IZOA 5G4LA 1RYFA 3CRMA 4D4IA 2YS7A 1NHWA 1WA5A 2HYDA 3PITA 1XK6A 5TX7A 3RUFA 4TN5A 2DULA 2VSQA 3EVBA 5KAMA 3VPFA 4JUIA 3L79A 1I4WA 4I4LA 2YHAA 4DOMA 4EKNB 3G0DA 5A04A 5EPUA 1QRRA 2ZETA 3LGXA 4BX2A 4YT4A 3UZUA 1QH8A 2DPGA 4NULA 4Q4CA 3PR1A 3T7DA 2RKBA 2FDCA 1KC3A 4NNJA 3KBBA 3GRYA 1EB9A 1VG1A 2B8JA 3D6UA 1NTOA 3WJ2A 3L2OB 4CM9D 2ZUEA 3OZCA 3QLVC 2PSHA 1I4OA 5CURA 1A72A 2ZYGA 4QUJA 2JLRA 3VH4A 3L1KA 2E5WA 1CDDA 1IBCA 2G4VA 1Q20A 3GOQA 3HSYA 2NADA 3HYRA 3D8BA 3LPCA 3Q6IA 4P0TA 4R8LA 4EG7A 3CV3A 7AT1A 2OZEA 1B1AA 3HZOA 1Z0ZA 2D1FA 2RAUA 2VYVA 5LXTB 3WX0A 3BSFA 4OQPA 4OMFG 1XL0A 3E48A 1W2GA 3A32A 4GP7A 4CIVA 4OUDB 1BFKA 5EUCA 2G09A 2Z9CA 1E7YA 4H0CA 5AK6A 2BHRA 2DHEA 3DEIA 3DMHA 3G2PA 3LA6A 5FL3A 3RSSA 5CFLA 5LA6A 4KRYA 3P0IA 3CT4A 5BP7A 1YUNA 4LQ4A 3T3PB 1H4QA 4ENPA 1FYWA 2FGKA 3QKUA 5B5SA 1REQB 2MIIA 1EI9A 1E9CA 1MVNA 5SICE 1YR3A 1PFGA 3L0PA 3D3NA 5IFKA 5JROA 1VJCA 4EJSA 4MCIA 4MV0A 2FCRA 2HAEA 3T0IA 2PKYX 1NX9A 4EWLA 2WSLA 2C54A 5DNEA 4ETMA 5F98A 1FP4A 2Y1WA 3CW9A 4Z1MA 3ZHXA 1GPBA 4U2DA 2IYXA 4XYEA 5EE0A 3LIPA 2R86A 2HA2A 1QH1A 3TD9A 3C6YA 4XWGA 1R4ZA 2BKLA 4LRSB 4D3DA 1MC8A 5G0UA 2R96A 2PK3A 4YRNA 5EVCA 4C0QC 4G41A 4A0RA 2J48A 4TLCA 1IZ8A 4UNRA 2DWQA 2BISA 4PS0A 2HRCA 2PD6A 2QN8A 1XMJA 1CUHA 3FCEA 4KPUA 1QG6A 2JCYA 4W7IA 2G8LA 1WKVA 1PT5A 4K5QA 4AUNA 4RVOA 3FBWA 2W2LD 4PFJA 3I09A 4N0PA 1KQ3A 2AUNA 2HB6A 2B4TO 5L4SA 4QTTB 5CYOA 3PXEA 1JZSA 3GZJA 3VKHA 2W6ZA 5ES3A 1E96A 1RVV1 1TYEB 1HE5A 1GITA 1XVUA 2NXCA 2NUPA 3MUEA 5JO9A 2MSLA 2C2HA 2FHPA 3WHKA 1EDDA 1BSVA 2VXYA 2Q21A 2OYCA 3T41A 3TFOA 4PR3A 2CD9A 3O03A 1KH1A 1PUJA 5FWYB 1ZVVA 4Q4AA 5ADVA 2C8VA 3EG9A 2YZ2A 3HBAA 3M9XA 4OXRA 1JBQA 3C3KA 1YRBA 1OBVA 5JQWA 2YXBA 2BD0A 5LBUA 1U2GA 1UBNA 1YB1A 2G6BA 3BH0A 4FGKA 4BLTA 3L7KA 1IB6A 1SKYE 1AV7A 4QU0A 3MOIA 3QXSA 3WQSB 1JTVA 3MTIA 1JEDA 5I8ZA 2QZJA 2HBQA 4MQLA 3TIGA 1XWWA 1QUEA 3LYLA 5DTIA 3TPFA 1SBHA 1E1QD 1YTLA 3HQ4O 5AI8A 3ZXUB 4C05A 4KZPA 4RTSA 4N6GA 2ZUWA 2R62A 3ZDQA 1W4RA 1E61A 2EGGA 1I3KA 1X7ZA 2AFHB 3LT5A 5L7TA 4G0OA 4ESOA 3QMPA 4PG6A 4A82A 1JXOA 1S96A 4EATA 2VL7A 3EHEA 3CLTD 3FTQA 1W73A 4RZSA 2YBEA 3QVSA 4L51A 4W6QA 1VE3A 4AG6A 3PLAE 1WMDA 2EFDB 4HADA 1M6VB 5B1IA 3TUJC 5CDUA 1R3UA 4I66A 2I1WA 4TVSA 1H9CA 2WT9A 2EW8A 1L7RA 2JKVA 4PC3A 3ZV4A 2HC9A 3ZZNA 3VAAA 1GGVA 2YXEA 3NHBA 4X7PA 4YP7A 5C37A 2C7OA 3T0GA 3QSGA 5T7BA 3TW0A 3O7MA 3ICCA 1DELA 4BVAA 4CV2A 3DR5A 1M10A 3PUWA 1A97A 3HKBB 3THSA 4TWZA 2FFRA 2JLAA 3INYA 2K5UA 4R3NA 3VYSB 5ERYA 3AF6A 4TZ6A 5T5QA 3ELYA 4AD8A 3K6SB 5F52A 4BFCA 3TLGA 1A9YA 4B75A 3STWA 1U11A 1UBHS 2G25A 3VR6D 5FEUA 3URMA 4Z7OB 3VV2A 4MS3A 3ZJUA 4K87A 3T52A 3FROA 5LDGA 1P9WA 1D2GA 1P9LA 4KQ9A 1JEQB 2Q2OA 1Y0BA 1N2ZA 2ZLBA 3C14C 2CKMA 2AI2A 3RJMA 3IUMA 4CEHB 3AR9A 3D8SA 3Q12A 2W22A 2J7KA 1G8JA 3I05A 3WMEA 2C1ZA 3ESRA 4CM3A 5KYKA 5M7EA 5GJVC 4G5SA 5SY9A 2CNOA 1KZGB 3VMMA 3A2NA 1CUFA 1GPWB 5A02A 4QODA 4EG8A 3G89A 1KBOA 5L45A 4WACA 1SY7A 1A8QA 2IIQA 4HG2A 2IBMA 4YJDA 1UBCA 1PQUA 2FWBA 1CFZA 2XF2A 2XB8A 3ODPA 2E4YA 2H0QA 2V58A 2UZ0A 2OHJA 1J22A 3AEYA 1Q6YA 4H4CA 4WSOA 4BLWA 5CLGA 4KO3S 3DKKA 2VG8A 2QTCA 1Z0KA 3UMCA 3WSTA 1IVYA 1ZFNA 4NU5A 1WEKA 2ZSIA 3SX4A 1YJ5A 3FNEA 3O1LA 4OUKX 2R1TB 4C0JA 1AURA 2OUKA 2ZYHA 4C4TA 2G9QA 1M75A 1U1CA 4GLJA 3E5RA 2QUZA 2GN8A 1V5WA 1YNSA 1TZKA 2AOTB 4O4HF 4BBJA 5CNJA 1LPPA 5B2EA 1A88A 2PD3A 3D0QA 1QTRA 4WKBA 1A95A 1EXVA 4D92A 1TVMA 3RIGA 3VHQA 1VSBA 2FFQA 2Q4EA 1G9XA 3PD7A 4P5PA 2JJMA 5FL7D 1RZRD 4TZTA 4MVJD 3PDUA 2M6SA 2I8LA 4AKHA 4KXLA 4XUCA 5ALRA 4D5EA 3ND7A 1PRYA 3L0CA 3NASA 1AKTA 2WQ7A 3UMVA 4X1YB 3DT8A 3NHYA 1EP3B 4RF3A 4UBJA 3BF8A 5GPBA 3RSCA 3GFFA 1VKJA 2AD1A 2WWIA 3CF2A 4KLRA 1SKMA 2FKNA 2A6PA 5JH7A 4YC7A 3KYBA 3U61B 2HCBA 2O48X 3ONFA 2O0KA 3EGIA 3G6WA 4YYZA 1GADO 5JHGB 1OYVA 2Z8YM 2P9FA 1IEVA 4R1TA 4BB0A 1K7YA 3T7CA 1RU3A 3CE9A 1G3MA 2HA3A 1P2BA 1GKUB 1TC1A 1M76A 2AJTA 4WADA 3AOEC 3ET4A 2PX0A 4KYIB 2YYZA 5AI0A 5TGZA 4GXNA 2G71A 4J0EA 3PFFA 1L9KA 1CQPA 2LCIA 2WJGA 3LBYA 4WOPA 1T5IA 2QRKA 2H2AA 2VDPB 5HZGA 3E9QA 1C4XA 4U7TB 3REOA 2IYRA 1FMLA 4OTZA 2E4VA 2IKSA 3RT1A 4Z3OA 2ADFA 1QK3A 2NUTB 1AS2A 1MX9A 3VZRA 1SUPA 1NNI1 1Y8QB 1YZQA 4CMAA 1ML4A 5E2AA 2HU7A 3AHDA 3A3PA 4GXQA 4NENB 1V6AA 1DXHA 1NUQA 3SXUB 1DBSA 1QE0A 3M6IA 3GRPA 3RFUA 1DPFA 4QPNA 5DM60 3K9WA 4DV1B 3ENQA 2OAP1 1XCJA 1CHNA 2I54A 2YQ5A 5LN1A 1SBNE 4AO8A 1PV4A 3RB8A 4LTMA 1JMKC 5LM3A 1E3EA 4OO3A 2H2DA 3KHUA 5DYGA 1QB8A 2IXTA 2ZUVA 4F72A 1A5TA 1DJLA 1UKVY 2Q1SA 3EQ2A 3KZOA 3PU6A 3ZS8A 1TAUA 2RG7A 2CJPA 4ZQFA 2QGZA 3G5TA 3HY3A 3QELB 1UXKA 3OAAA 4KIJA 4O4LF 1AKUA 4LC9A 1EZ1A 3PDHA 4G5XA 4HB3A 4DNQA 3K31A 1UADA 2YNMC 5CHEA 1XNJA 1EFDN 3JSAA 1QKKA 3KQVA 3F3KA 3ZU3A 1VIYA 3TMYA 2BFCB 2GASA 1SXJC 5ELLA 3VOAA 2NO0A 2JJ1A 1L7OA 2HJHA 1H2ZA 2VYVD 3V9AA 1JTEA 2GQ0A 3DPSA 2XUGA 1U6IA 1ZONA 2QMHA 4HL6A 4RM2A 2G0TA 1LLQA 1YDHA 4CWAA 1M1YE 3IL2A 3EUAA 2JBHA 2C95A 3HZHA 5A6SB 4CXMA 2VF4X 1ZCJA 1GNTA 2L17A 1HQKA 2F43B 3BORA 3HS3A 4FDTA 4HI0E 3FNQA 3KETA 4DSZA 5LXTF 4ZYYA 4EK9A 3ENZA 3LC7O 4G37A 3FZYA 5F78A 4M1OA 3U3JA 4BMCA 3A27A 1KO7A 4DRZA 3RRZA 1TUBA 1RAAA 3L7JA 3BGIA 1IQRA 1NMEA 4Q1CA 2YHUA 1F20A 4BUJA 1C9JA 1II8A 1T9BA 3I04A 1GSOA 1U9JA 3CRQA 2UXCB 1S89A 4ZV7A 5FUBA 1IQ0A 4WXPA 1V1JA 1LDEA 2P1DA 4ACBA 821PA 3T1HB 2GCPA 3OPNA 1E5LA 2ZAGA 4P84A 5IT4A 2XMSA 1WOMA 2N3ZA 4U63A 2VYND 1GN8A 2G9NA 3JZFA 5C7OO 1KQNA 4EFDA 4POOA 3V1UA 2CT8A 4HH4A 1EHIA 1OWMA 1YVEI 4WJKB 2IVFA 3BMQB 1NVGA 2RBGA 2XHEA 3M4XA 4LDQA 3ET5A 3ZBTA 3ZZ1A 3C3BA 3MJCA 1GGEA 2OQVA 5K2MA 2BGIA 1A69A 4ES6A 2ZWPA 3QHPA 4N48A 1XTVA 2BV3A 2HSDA 3AL3A 5TQ2A 1LBQA 3VV3A 2FSFA 3GLGE 1F6DA 1U9IA 2Q7XA 4PYOA 4UUAA 2DHQA 4K86A 2HCFA 2QB5A 4EMSA 4O0MA 4Y9SA 1EHCA 2HV8A 2MU1A 3NIGB 3QXGA 5BSWA 2AZTA 3N53A 4TPKA 5KVQA 4X1KB 1JG3A 5IC5A 3V8RA 1X80B 2PWYA 4ZQHA 3VZPA 4F9EA 5FNZA 4YCCA 2GVDC 3NJRA 1S4MA 3ZEAA 4W4TA 1OC2A 1NJFA 1ZWKA 3ANLA 4P32A 3WK4A 4GMFA 4DZZA 5JBQA 3UMMA 1KFBB 2XR1A 1DNPA 2D00A 3PLNA 2GAJA 4OQMA 4RD2A 5KSOA 5GIOE 3JAMA 2F3RA 1U99A 5KJEA 1DX6A 3ZY6A 1T5OA 4LGMA 4JVMA 4ER3A 3AY0A 2YW9A 3KIPA 2HSGA 3NIFB 4LSMA 3CWZA 4Z9FA 4A2PA 3NVDA 5BQFA 2LZ0A 3BJEA 1AH2A 1UOPA 5KHAA 3MWKA 1I0LA 1N7JA 4JEMA 3WWPA 1MO2A 1T3LA 1RRFA 3DO8A 3T7TA 5AUOB 5IKPA 1SQ0A 2Q4TA 3CN7A 3R6GA 3UH1A 2PUJA 3C1TA 3RG2A 1VZ3A 3W2EA 4O2AF 4X3PA 2AMVA 4IV5A 3DDSA 1SBCA 1F12A 3HU1A 3U4QA 3PZBA 1BYUA 2P11A 4IIJB 4WTOA 4ZQCB 2GD1O 3FGOA 1X19A 1JQJC 3UA3A 2NM0A 2IGTA 2PA3A 4GZ6A 4MVJE 1HM5A 4LK3A 1G98A 3BTOA 1UDBA 2XOKD 4A6EA 5AVKA 5CFZA 3LCJA 4YCSA 3WO1A 3RHTA 2DECA 3GEIA 4L5YA 1YJQA 3N8HA 1G2IA 3M6XA 1ARZA 1CB7A 3AERB 1TCVA 3LLCA 1J8YF 3EAFA 5G02A 3R6LA 4MUNA 1R00A 1XDSA 1XJ5A 2Q4RA 4Z4IA 3N58A 5TF0A 4YN3A 1T0JB 1OFHA 1V8FA 4Y98A 2CL0X 1GFIA 2E87A 4HC4A 3W9SA 4DLLA 1K3UB 1VHTA 2P4EA 2OWEA 2VAPA 2WYHA 4TS1A 1O3YA 1Z4LA 5A6VA 2BRUC 2A5LA 2B3TA 3DE3X 1X7DA 3MUNA 4H0NA 4JJ6A 1YR2A 2PU7A 4X44A 4YRPA 4LE2A 3EVEA 2I2DA 1F8UA 3UG7A 4AF6A 1FFAA 4PGHA 3LC1O 2W6MA 1KYWA 1MZVA 2XA2A 3ND9A 5AJTA 4PZEA 4OHKA 2QMUA 2O7NA 3IQXA 3KPYA 1ZOOA 3VU3A 1YB4A 4TM7A 2CNLA 4QTYA 5BOVA 4DQLA 1JWLA 1Z15A 1V9SA 3B51X 1ZJWA 4EI2A 1QIFA 4XPIA 4DF3A 4LBVA 3R7FA 5JAPA 1N5DA 4DB4A 4NICA 2XOEA 2MINA 5FNVA 2LCFA 1KYVA 5K3BA 1JKMA 2XEDA 1FFCA 1U9CA 4MIKA 5FUWA 3FHJA 1I33A 4HXEB 3MWDA 3R7WB 2NSYA 1NQXA 3KQYA 1PZXA 4I55B 1BQEA 3GRUA 1C9YA 1AVTA 1JHPA 2QT9A 4V1CI 3HCOA 2IS6A 1GPH1 4RMGA 3AKEA 1ZQ9A 1E4YA 3ZLUA 1MUUA 1YK1A 3NVAA 1RHUA 1RXYA 1VE5A 3OFNA 3ON5A 3PPXA 4QO8A 4TV8A 4M0MA 2YWFA 3V1LA 3IPLA 4C7JA 4FI3C 2Q2NA 2X5XA 1U0FA 3OCYA 4FYWA 4M53A 4JY7A 1D1QA 5FWXA 1T4CB 3USES 4UARA 3DOHA 5TQVA 4PNEA 5LOVB 3CVJA 4UHKA 2IYEA 4M60A 4J3JA 1NJSA 2RAVA 3FSEA 3JYHA 3AVWA 5D3ZA 3N76A 1E2BA 3HO1A 4URZR 4NK5A 3VKGA 2PGLA 3P9ZA 1S6YA 1E8MA 2FN3A 4NOKA 1ABEA 1C0IA 2ODEA 3GGPA 5AM1A 3WTBA 2DUJA 1C7IA 2MWMA 5AOAA 3FCSB 1AZWA 2CBZA 1QOPB 3EBPA 3I5MA 3IIJA 1UOOA 2EG9A 1WCWA 4IVQA 4KPGA 3ZW8A 2Q5IA 2FMUA 4KRGA 1Q16A 2I5PO 1X8LA 2XA9A 1S0UA 4G5OA 5EXDA 3S55A 4CKEA 3TLGB 2HD4A 1ZNYA 1U65A 1LI5A 1XVAA 3UPUA 2FV8A 3L84A 3GPCA 3NKLA 5HA5A 5TPZA 3LPAA 3UJCA 4DT1A 5C8YB 2O8FB 1G291 2Z3ZA 2X4LA 3W8DA 3JQGA 4BPRA 3WFZA 3WBBA 2CLSA 3EVCA 1Q17A 2IU3A 3DHYA 2XQFA 2Q8PA 1WUJS 3AUSA 4D0GA 2LXNA 4F9TA 1OFTA 1FFWA 2GRUA 4RD6A 4UDXX 3D6AA 3MGKA 1W46A 5AHOA 4ZEXA 1YKGA 4B5KA 1P4GA 1RYNA 1Z88A 3D9QX 4N0MA 2GS9A 5JAMA 2GDZA 1TL7C 1FFEA 2GN4A 2NXWA 1CUBA 2X4IA 4RHCA 4GQBA 3JD0A 4N12A 1Z6QA 2RHHA 2XUHA 3I1FA 4K8RB 1MFZA 1L5GB 4FILA 4IJ5A 2XCQA 3WGZA 2ATCA 3MLBA 2IDJA 1OFIA 3M0EA 4Q82A 2ZS7A 4YJ3F 5A5GA 4PN7A 4JOBA 4MVWA 1RWQA 1TAGA 1AKMA 2JAXA 1O2DA 3G2KA 3AC0A 3FE2A 3PGLA 5CDSA 2P4HX 4TKMA 2OXTA 1JSCA 2PBRA 4WERA 5EVJA 1YB2A 4K6KA 4BFUA 5DLDA 2JIZA 4D6PA 2DHRA 1PZHA 1WZIA 2R1TA 3Q0EA 2JLXA 2GCOB 3IQDB 3M7IA 2DKNA 1G5HA 1SGWA 4ZVOA 4A1OA 1NONA 1XMQB 2X1MA 3DAFA 1D6MA 1JNYA 3IMKA 1GCIA 1PQWA 1O95D 2BHTA 3PXDA 2EHDA 1Z74A 4WJZA 5HRAA 3CLTC 1KDOA 4QLAA 2FW1A 1DKLA 4Q1FA 4YH1A 1G8KA 4XB2A 3RC9A 4G9BA 1JH8A 1SK9A 3HNRA 3ODGA 4QO7A 4C1NA 3O9MA 3E9CA 2F67A 4NONA 2P6OA 3I76A 2E1RA 3M33A 4J16C 3PEEA 3HXLA 2I55A 5A7FA 4UC0A 5LQCA 5HE9A 1SXJD 1U8XX 2G63A 3HGMA 1Z68A 2BHSA 3H5IA 4TSFD 4XB1A 2PMCA 2YNMD 3OTIA 4IDQA 4URWR 1K92A 5DXJA 2CEAA 5JPDA 2GD0A 5TPWA 2AEMA 5JISA 2JI6A 1GUBA 3L5KA 1UBGA 3QUSA 1SHTX 4KMRA 4ML3A 2QJTA 1BHO1 4MUFA 2YN4A 2WHQA 3B36A 1YO6A 1L4GA 3A10A 3V6LA 2E0IA 2I4MA 3E7FA 3NAGA 5JO0A 1U0HC 5JFTA 1G8FA 5CB6A 2VNHA 3GGOA 2GN2A 5LKAA 3EPRA 4N39A 1AK9A 2VNIA 3E84A 3HTXA 2QPAA 5J4YA 5JNRA 4J9VA 4MWEA 3NBUA 1Q83A 1ODKA 3QLUA 1VRVA 4GLOA 1L4LA 3FFXA 4PICA 1AMUA 3R24A 2XTAA 2ZPUA 2D54A 4BMZA 1CRLA 3A9WA 1FVXA 4R1MA 3LP6A 5EE1A 3VDQA 3VU9B 3TWOA 1QX4A 4FYPA 3ZHBA 1Y98A 3PZRA 3QEBZ 1C30B 1SFRA 2JJ2D 3TXXA 5LOVF 1QIGA 1JMVA 4FU0A 4BCDA 3WWOA 4TRMA 3FVVA 4BQPA 4AZ0A 2OC4A 5A03A 5ALKA 4UMDA 4JT4A 3WA7A 2CWDA 1YD7A 2J5RA 4Y1RA 4GVXA 2FZCA 3JYLA 4AXXA 2Q5QA 3V00A 4MGHA 4GR4A 3W1VA 1KY2A 4B0PA 5I3CA 3SOZA 2GYWA 4ZICA 3BKXA 3HFJA 5I45A 2QM7A 2IYVA 1ZMOA 2VTVA 1D09A 4X94A 1Z39A 1DBPA 3N0VA 2I6GA 1THMA 5FL7A 2AQIA 2WZCA 1Q92A 1GU0A 1E8NA 2QTFA 3H75A 3TZKA 3MYRA 2CGEA 1G21B 1J5XA 2W2MA 3BXZA 3F5SA 3H8JA 2BFCA 3KTAB 3WQQA 1QTQA 2HIHA 4LNHA 2VUSA 1K97A 1NJ2A 2I6TA 3CEJA 1M2NA 2PO7A 2V54A 2PKRA 5JH7B 4BE9A 5CUQA 1OXKB 1CR6A 3PHIA 3KP1A 4JVNA 5EHIA 2XEXA 4G25A 4FDLA 1GNQA 3WGVA 1KJNA 2VBGA 5DU2A 2A0FA 4MLPA 5E7IA 2J5QA 3FYUB 3IDAA 3N8GA 3C6QA 4OLJA 3RFTA 3SC4A 3UT0A 4S35A 2OAQ1 1B1CA 1LSUA 2RH9B 3VOBA 1XWIA 1KI6B 4D9CA 2XUJA 1ZH6A 4K9NA 2PRIA 1T0BA 2I66A 2L69A 4MJLA 4TYMA 3TCXB 3TX6A 1XEXB 3E5HA 1IUPA 2ZRKA 3BDIA 2ZRIA 4M9QA 4H2DA 4OK3A 2LCQA 5IVPA 5JQGA 4D26A 3M6AA 3DB2A 2C1EA 3FW1A 1QSGA 1MN6A 2FG5A 4NFLA 2F4VB 4NARA 1SHUX 3RYHA 5KYVA 3CEAA 4GECA 4ZOLB 4LI3X 3UXHA 2HWUA 2MYNA 4OX9Y 4C5CA 1R0SA 721PA 1KIFA 3HI4A 3ZY5A 2J3EA 1C4WA 4MW1A 2M6KA 5KOYA 1CJBA 2O2GA 2QTZA 1UQUA 4W8OA 2BI4A 1ABBA 5C3UA 1QTIA 4FKMA 3U7IA 4KO4S 4DUGA 4E33A 1W8DA 3KQLA 1PG2A 5A0VA 2B9VA 4DILA 3KOMA 3R0QA 1RPTA 4QEDA 2GN6A 3KLOA 3PCTA 1FNNA 5A0FA 7MHTA 1KWGA 1I9GA 1MAAA 5CLQA 1VXOA 3T9FA 4RTLA 2XWBF 4YCLA 4EUSA 2NV6A 2QTTA 1QYDA 4GP6A 4H08A 4KZKA 5C1BA 2RCNA 5EJ7A 3A7EA 1GQ2A 2B98A 3U7EB 4KWEA 2ZJ7A 2IYFA 2QN7A 4CMHA 5EZ6B 1QHNA 3M1AA 5E1OA 4CKYA 1MIHA 1TFUA 4HX5A 2CUNA 3TZ6A 1N8KA 1C7FA 1G9SA 3LPMA 2BFMA 3FWPA 3P4UA 3QIAA 1GL7A 2Y1EA 3EQ7A 1OI7A 1O94A 2Y0CA 3G2JA 1UPTA 5B1EA 5IU6A 4B4VA 3VNRA 4CUKA 2Q3FA 3JARB 5TF4A 2PMDA 1KY3A 3MG9A 4Z4CA 1YAHA 4FR5A 1BQ3A 4CL8A 5D84A 2XCLA 5AJYA 3LLVA 1GYRA 4R2KA 1FJHA 1XQ9A 4RA9A 1YR8A 3LF2A 1ZGGA 1NT4A 2XB4A 2XUAA 1YZUA 4EMUA 1J1UA 2AXPA 4G0ZA 1E3WB 4WZAB 3AEKA 1QHYA 3OY7A 2GEVA 1JL3A 3RU9A 4N0DA 2ORED 3PQ8A 1UJNA 2FDXA 3M6LA 2W2KB 1D4OA 3NEPX 4DQ0A 4ENQA 4FM9A 2OD2A 3ILVA 5TRTA 2WTBA 4KB5A 4UEWA 1A5AB 3QWHA 5JSYA 1JX6A 3IA7A 3FJYA 1N6OA 4PAQA 3NDBB 4FINA 1RQ7A 1ZLXA 1J8DA 1VLZA 1O94C 2B20A 3BGWA 3Q8WA 5CM8B 1JT9A 5B4TA 2WWGA 2WC1A 1GZUA 3FJOA 4RW0A 3ZLVA 5A9RA 4LHZA 4CLDA 2N46A 4D7AA 4ARAA 1BIFA 3B82A 1N6PA 3CO5A 4BNFA 2QL9A 3FD8A 4UMVA 2Y71A 4UMFA 1RYBA 3DJYA 4K9PA 4XEHA 1PLJA 3KSRA 3QNUA 4RKEA 1C80A 4F2DA 3WYBA 3GN2A 3KWJA 3DE6X 3CMMA 4L9SA 5D86A 5BVGA 3I45A 5C31A 4YUZA 1NQAO 4XIFA 3ZCRA 4RETA 4B4DA 1IY9A 2I7XA 5GWXA 3K5WA 2WFLA 3OCVA 3OM1A 5ESXA 4OBBA 3U4HA 2CLOB 3IT3A 1HL3A 3H05A 4TT3A 3U0BA 3U4CA 2JGFA 4WKNA 4CNBA 3FJ1A 4ITUA 3HCRA 1WAMA 8ATCA 1S7CA 1WP9A 1HTTA 2UUOA 4H1HA 4MMXB 3ZLBA 3WSVA 3ZZMA 4RIIA 1KOFA 3ESYA 3DTTA 3FMPB 3WB1A 3VR5H 1P8AA 3LC0A 4WFJA 3VVLA 4A8HA 1KPHA 5BORA 3HLYA 4MQUA 4PANA 4YV7A 3BXHA 1DMRA 1QIDA 4BDTA 4IMIB 1P33A 1SELA 3EFHA 2JJ8A 2RG1A 3CUVA 4KO8A 4L7QA 4M86A 4XDZA 1ATIA 3OA0A 3B8HA 3GN1A 1FFHA 4QFDA 4LF8B 4ND8A 2HBRA 4E0BA 1ZOSA 4WCFB 1OU4A 1DPGA 2HK7A 3TG8A 1OH6A 1V7QA 3E4DA 5FX2A 1X86B 1XXHE 5BSGA 2FWIA 2A9OA 1TTPB 1BDIA 4UM7A 2AJDA 3TOVA 5B7QA 1QZUA 3NOOA 4FEAA 4S2EA 1Y8CA 1NWHA 4IFTA 3TNYA 5FWXB 2TMYA 3HSSA 4XCQA 4QVIA 3EE6A 3ADDA 2GZMA 5KINB 5K0SA 2LPMA 3TTUA 4ASUD 1ORDA 5DIZA 2QOEA 3J81k 2W42A 1QOZA 1HNXB 4EFKA 5GJCA 2VIIA 2VPPA 3OJEA 5U4QA 3WE7A 4NBLA 1RDFA 2ZJ4A 2PGDA 4OF4A 3P2MA 1RFLA 4KFSA 3SC2A 5IFLA 3OZ7A 4YLEA 1BZYA 1GVNB 1AE1A 4WZAE 4O4IA 4PO8A 2BGGA 1GU7A 1CEXA 4R2JA 3Q3EA 4F71A 4U4AA 3L43A 2DJIA 1XYVA 1W88B 3L7NA 3H1PA 4XM2A 1QAOA 2ARKA 3FPEA 2JFFA 3VNQA 4D8YA 3T4EA 1MO5A 1EWQA 4JEHA 1U1GA 2BGJA 4FZJA 4QBIA 1ZNXA 5IC4A 3IO3A 4ZJZA 1V5IA 3H4TA 1QKJA 1M0SA 4DWOA 3KD3A 1VIVA 5FIUA 1FW8A 3RFXA 4CKBA 4IZOA 1ECBA 3DAHA 1DP4A 1CK4A 3ZDRA 4XOUA 4RFSB 1I4DD 4LHEA 2Q0HA 2X8JA 3I32A 1E9EA 2HJRA 5FKJA 4D3SA 1GPKA 2D3TA 5I9LA 4YUAA 4Y6SA 1Z29A 1XPRA 1Z82A 1QUFA 3NBZC 3RFVA 1KZYC 3QI7A 1TM2A 3NO4A 1X1QA 3USCS 3BSWA 2EEPA 4X7BA 1IRIA 4YRSA 3SQOA 3GCZA 1EVJA 2JHCA 2ZIVB 4OGFA 3T15A 4N3AA 2FWMX 1DADA 5DLPA 1ZM4A 1ZZEA 1CD5A 4OHUA 5AMXA 4KQHA 1SCJA 1YHYA 4KPEC 1F8GA 3HJTA 4MR9B 4C7VA 2G9VA 4KQGA 4RAOA 3PJGA 1MTZA 3M6VA 1OQAA 1ELOA 3VGPA 1G64A 4E2WA 4E4RA 1QYVA 3FOBA 1ZITA 2RSLA 2H2FA 4ZHQF 1D2MA 2NZUG 2FR8A 3L07A 4WOCA 1P1HA 4YMWA 3KT6A 4JXKA 1FC0A 3IP9A 3GT0A 1V9CA 3HPRA 3FR8A 4E21A 2PL3A 4GAEA 5BYKA 2ZT5A 3IRVA 4JC0A 2JGKA 4TLDA 4A91A 3HA2A 1O03A 3E1SA 4GWGA 4UBOA 1TW2A 1HDRA 3OHSX 4XE5A 3ZKAA 3ETCA 2DQ4A 3KKZA 1UIRA 1T6YA 2AXNA 3FTFA 1Y1RA 2P5UA 1QU2A 3VH3A 1VBFA 1E4OA 3QHQA 4B6FA 4MYDA 3BQ9A 3TSAA 1QP0A 3JQGB 1AHIA 1II0A 4H7PA 4EPXA 4ZKDA 2I87A 2PX8A 5BMVF 3KJQA 1YAJA 121PA 3UJPA 3SHOA 3G2MA 3QE2A 3U13A 3AZOA 4AJ9A 2IEYA 1JPUA 1UKZA 3JW8A 3JTMA 4DIMA 1JHZA 3OTWA 4MRRA 1BDBA 5J5AA 4ZYZA 1OI4A 3UUFA 1BKYA 1ZGZA 2OXFA 2PZFA 2GWRA 2Q9BA 3A1UA 1SBTA 4NC9A 1G8HA 5DWQA 5ECDA 2OGZA 1EVEA 2Q8NA 3SS9X 1BNCA 3S3TA 2AN1A 3VPDA 1P17A 4LJRA 1OLSB 3K0CA 4MYSA 1H2FA 1PR9A 3IB6A 4DUYB 2A0YA 4W5WA 3FMIA 3T3EA 4ROTA 2JLYA 4MLZA 1ZIDA 2HHHB 3KYJB 4G1FA 5A9TA 3RYTC 2Q7OE 4E51A 1QQBA 2WSSA 1D7OA 5GONF 3QVVA 5EIFA 5LMNB 1DUVG 1Z06A 1ZNQO 1OKKD 4EJFA 2R8PA 4V0LA 2O5VA 2RGRA 3NT4A 3WFJA 4IH4A 1K68A 1SVSA 4D97A 1ADFA 2Q3BA 2V7BA 3IDFA 1MB2A 4FDMA 7ADHA 4P0PB 5KDOA 1PFWA 1E5VA 5LUAA 3RKUA 3LJKA 3NHPA 5IASA 1JN0A 1I1NA 4NI5A 4EY4A 2JFYA 3STTA 4ZJPA 4RTOA 3RIHA 3AX6A 2AI1A 3HBFA 1HDZA 1NFQA 2QW1A 3W5JA 3BSYA 3F78A 1YBMA 4DV4B 2AF3C 1TEVA 4KDEA 2HFJA 1JFSA 1FTQA 2HLHA 3GA0A 3F67A 4OXNA 4F12A 5CD1A 3EOZA 3MILA 3W8RA 2AOVA 2CJFA 1SUSA 1FNMA 3P27A 3UXY