2HMUA

Diamond-shaped octameric ring structure of an rck domain with atp bound
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
139
Chain Sequence
NKQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The RCK Domain of the KtrAB K(+) Transporter: Multiple Conformations of an Octameric Ring.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
molecule keywords YuaA protein
total genus 39
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hmuA00
2JFFA 4J91A 1V8BA 4GGPA 4B7XA 1I2BA 3DFZA 2H6EA 4XD2A 1HL3A 5JY1A 1BVUA 3RUCA 1Y7TA 4E33A 4DLBA 3BXXA 3F5SA 4E2XA 2NTVA 2Y66A 3IIEA 3E18A 4GWGA 4XKJA 3ROQA 2CF5A 5KVSA 3ITKA 1U8FO 1HTBA 2P5YA 3A1NA 4RLHA 3GUYA 4YAEA 2WWRA 1GYPA 3WGTA 1JW9B 4JLWA 1RKXA 3JYPA 2DUWA 3AM4A 5HM8A 1C0PA 3CINA 2ZTUA 4NJMA 3L9XA 4EUHA 4YEDA 3SX2A 2JCVA 2TMDA 3H2ZA 4RVDA 5DCYA 5TRTA 2DTXA 1YBVA 1B8VA 4NH4A 3QP9A 1NPTO 4GI2A 4HBGA 2EP5A 4BNIA 1CQJA 1KOLA 4R3NA 4A10A 5B4TA 2YHIA 4M49A 2VYNA 4UUNA 2JKVA 2RHRA 3D4NA 5CAEA 4L75A 3DOOA 3JQCA 2P2SA 3ST7A 5CDUA 5HRUA 1R0KA 4AICA 4BB6A 3DWFA 4MDHA 1EE9A 3WNQA 5A9SB 1HT0A 5JC8A 4F6LA 3LT4A 4OKNA 3TRIA 3IL2A 1PR9A 1NHWA 5TIIA 1SB8A 5B37A 3DBLA 3AOGA 5AXBA 1HETA 3PPIA 1I3MA 1ZO8A 1Q1NA 3INTA 1A4IA 2HK7A 4BNYA 2PKQO 1O89A 4RV9A 4XYEA 2DPGA 2OUIA 3OH8A 1B8PA 4DYVA 4WGGA 4Q3EA 4A73A 4OL9A 3GAZA 2RHCA 3COSA 4WOJA 4N5NA 2OORA 1Q2XA 4CMCA 1JVSA 1Z6ZA 3I5MA 4BIIA 1H2HA 1W73A 2VN8A 4WEQA 2JD2A 3T7EA 1E1KA 1DIGA 5LC1A 1ZK3A 1D3AA 1Y81A 3DC2A 2Q3EA 3LT1A 2VUUA 1GDHA 1LU9A 3O03A 2HQ1A 1EEHA 3KYDA 5A02A 3LDHA 3JTMA 1UXHA 1PGOA 4TMFA 2C07A 4CQLA 2DFDA 5KNLA 4GQAA 1LJ8A 1MP0A 1KVUA 2FY8A 1Z82A 2FPPA 2IEBA 3MJEA 3MJCA 5FI5A 1HZJA 1ONNA 4CR6A 4J49A 1QR6A 4PRKA 5JDCA 1U4OA 4XEHA 4RPJA 1DRUA 3JQFC 4RVFA 1DFGA 3KYDB 4OSPA 1MFPA 4BQRA 2P9EA 3TSCA 4E5MA 4NBUA 4NK4A 4DYDA 4QX6A 1FDWA 1XDWA 2WSBA 2XF8A 2JAPA 3DDNA 1F8FA 2B0JA 3PHJA 3ZDFA 1HDCA 2VWQA 3GN2A 4RPHA 1HDYA 1GEGA 5KJFA 4HKTA 5HBRA 1SMKA 3UF0A 3BAZA 3TDKA 3BMNB 3AI3A 4I9UA 5C7OO 4L9RA 2VWHA 3QJ5A 2GN8A 1R37A 1HYEA 3GVHA 4D79A 1DC4A 1LX6A 4B7UA 3UUWA 4QTZA 3H9GA 2VRBA 4I9HA 1P44A 1DAOA 3I83A 2O2YA 3JQDA 2WMDA 1ISMA 2BGKA 1DIHA 3O8QB 1XCBA 4BMNA 2PZKA 3AK4A 5EPOA 5T5QA 1R66A 2HMTA 2P9CA 4YQZA 2NU8A 4D45A 4YRBA 4B4VA 1XHLA 2Q49A 3ZWCA 4YAJA 3IP1A 4U6QA 1QYDA 3K30A 2AHRA 3SJUA 5COBA 2DUUA 3KYBA 4HXYA 2GZ1A 3U62A 4CM7A 1DLJA 2YV2A 1JTVA 3RC2A 2PZJA 1AN9A 1SOVA 2NM0A 3RU9A 4J1NA 3ANNA 4BUCA 3TL2A 2VWPA 2J5QA 1U3VA 1WDKA 5JDCC 3PYMA 1L7EA 4CMIA 1GPJA 4ROSA 5ENDA 3UW3A 3PDUA 1E3EA 3HN2A 4OXNA 3JYQA 1DIAA 5GMOA 2GF2A 5TNXA 3RASA 3SLKA 3TQHA 2EHDA 3VPFA 1V3VA 3VC7A 1ZUD1 4QECA 1MLDA 2BH9A 3V2HA 1H6DA 5L4NA 3B70A 3F9IA 1O9BA 5T6BA 4E5PA 1ZK0A 2O3RA 5EIOA 1I33A 4BV8A 1AXGA 4JJFA 3VPSA 4A03A 5L53A 4ONEA 1KBZA 2POQX 4FFLA 5ITVA 1CJCA 4E0BA 4WLUA 4BKPA 3LC2O 1I2CA 3O9ZA 3HDQA 4FFRA 4O59O 3RC9A 3CZRA 3ZHYA 2GASA 3OQ1A 2QX7A 1OI7A 2RBEA 4FR5A 2VYND 4XJTA 1G0OA 1ADBA 3G1TA 2E6UX 1P0FA 2VUSA 4EJ6A 4XGKA 4NPCA 4YVFA 4MKXA 3V1YA 1OBFO 1FDTA 1U9JA 4ZHSA 2EG9A 2ZIZA 4IPTA 2EKLA 4BO7A 4OQYA 4B4WA 3LQFA 3KETA 1KC1A 3M1AA 3OECA 2P91A 3AW9A 3HDYA 2WJPA 3IC5A 2J6IA 1Z7BA 1YRLA 4FS3A 4ESOA 5L45A 1KY5A 2PKRA 2X58A 2PKQP 4BMSA 4CLRB 3U5TA 1GY8A 2BI8A 3GEMA 2RAFA 3AFMA 2IDZA 3LZ6A 1N9GA 4R1SA 5JSFA 1PGPA 1PWZA 4Y6RA 4IGFA 3WGGA 3I9JA 5F1PA 3VKUA 1F17A 1DLIA 4BGUA 3JQ7A 3UAGA 4UEKA 4B3JA 1N9GB 2VNSA 4W9NC 5ILGA 4LSMA 3ZWPA 1E7RA 1P74A 4ZJUA 3K92A 5JLAA 1AXEA 5IN5A 2CUKA 4G2NA 2GN9A 2VTEA 3DAPA 2BFAA 4C4OA 3RWBA 3NT2A 1E5QA 5EL0A 3ULKA 1Z7EA 1EVZA 2GSDA 5DP2A 1DC6A 1FF9A 1Y8QA 3L4BA 3TZHA 5KJCA 2X4GA 3HJAA 4D43A 3L77A 3UCEA 1KVTA 5I7EA 5BSHA 4YQYA 2QQ5A 4MP8A 4AJKA 3MJTA 3R0IA 1DFHA 1D4FA 1NFFA 2YJZA 4QUKA 3VDQA 4YJFA 1MC4A 2Q50A 4I5DA 2B35A 4FDAA 3TNLA 2VT3A 1F8GA 1B14A 3AOEA 5DOVA 3C85A 5ENVA 3SXPA 5A3JA 5HS4A 4ZD6A 3QVXA 4J1QA 5THKA 4DBVO 1E77A 3B20A 3DEYX 3INGA 3KSZO 3C1TA 4CLHA 4FOOA 1Z74A 2HK8A 2HO5A 2A35A 3UVEA 1NBOA 4IZIA 3H3JA 2DM6A 1GEEA 1C1XA 4IDGA 5JCJD 4Z0PA 3GDOA 5JDIA 5K6AA 1OOEA 3TL3A 4GGOA 4CMIB 4PFJA 4UREA 1QSGA 1DSSG 3I6QA 4J16A 1BXKA 3UXYA 1IZ0A 2Y93A 4BO9A 1A9YA 1YDWA 1PS8A 1Y9EA 1X1EA 4UUOA 4M8SA 4LMRA 5ILOA 1KEWA 4AFNA 2NVBA 3PYXA 4EW6A 1DPGA 1N5DA 1JWBB 4MO2A 1ZMTA 3KV3O 2GZ2A 5GZ1A 2EEZA 2I67A 4KDFA 4Q3AA 4H15A 3DAGA 2PGJA 2J5KA 3FI9A 2PNFA 4JP2A 3VVBA 1PJSA 3JD4A 3OJ0A 1LA2A 2OHXA 1LDBA 4KWIA 5COQA 4BO4A 4XA8A 4BNXA 2RH8A 2DT5A 3C3XA 4UULA 1IHYA 1NAIA 1M67A 2VHWA 2B5VA 1M6WA 4CM6A 3KYCB 1YJ8A 4UAGA 2HRBA 5H83A 2GN4A 2FN7A 4ND2A 1S7CA 4GVXA 3QQPA 2OXIA 1T2FA 3KLPX 1EUCA 1U2DA 1PQUA 2X9VA 4ALLA 1I3NA 4BNNA 1I32A 4NFYA 1XEAA 2IYPA 1ENYA 3NEPX 4ZQHA 4U8GA 4PZEA 3ZNPA 1LLUA 2J3HA 4BO6A 3JQ7B 2AE1A 2PH3A 4K26A 1VKOA 4CL3A 3PWSA 4MVJI 1FDSA 1HDGO 3RJ5A 4DL9A 5FYDA 7MDHA 4NFSA 1S6YA 1SOWA 4TRMA 4EGFA 3GVCA 4UVGA 4ITUA 2HMUA 4CMBA 5L4SA 1IYZA 1M75A 4DMMA 1VC2A 4S1VA 1GZ4A 3Q2IA 1PQWA 4YJHB 4CM4A 4KTVE 4R4JA 2YV3A 1QYCA 2DBRA 1C0KA 1LRKA 2OO5A 3EVNA 2EJWA 3E5MA 3PP8A 4JK3A 5JNLA 2PGLA 1TA4A 1EVIA 3JYOA 1M6HA 1WVGA 2JL1A 1IULA 3WBBA 1BG6A 3NYWA 1P1RA 4DUPA 2ZQZA 1T24A 2GO1A 5JO0A 2NSDA 3GFGA 4WOKA 3ZW8A 4ZQGA 3PJGA 1NR7A 5G0WA 4IZHA 3CPSA 1NPYA 3BTSA 2ZQYA 4PLHA 1O6ZA 3VH3A 4MVJH 2B4TO 1QYVA 3UH1A 4E5KA 1JAXA 3S2IA 1QP8A 3HQ4O 1AE1A 3OM9A 4IJVA 4R5MA 2HJSA 4TRJA 3K6JA 1YE3A 3ZHZA 3I9MA 3SLGA 1U3TA 2EV9A 1EUDA 4A27A 5F3RA 4YCAA 1EZ4A 3W4IA 1M76A 3M2PA 4G81A 4XQEA 2RIRA 1LBEA 3WG9A 1NQAO 3DZBA 3GMDA 3VH2A 3VPXA 4KDEA 3VZSA 1B7GO 1K89A 2VTDA 2IZ0A 2Y67A 3JQAB 3PHHA 4NFHA 1P1HA 5G2OA 4YT4A 2H9IA 2NVUA 2WM3A 1C1DB 1PGQA 2GD1O 1O94A 2ZCUA 2OGUA 1QLJA 3QLJA 4LCEA 1U3UA 2NUAA 2DBZA 1CF2O 1DHRA 3LC7O 4DREA 4BKRA 3ASUA 3D64A 5JE8A 1HXHA 1XGKA 1ZVMA 3KLMX 3BIOA 4CR8A 1C1DA 4BGEA 5BNTA 4FJ1A 1WP4A 3N58A 3EW7A 4JJIA 4IXWA 2WE8A 3NGLA 3WTCA 1P1IA 2WDZA 4H7PA 4AVYA 4ND5A 4OXYA 3ZV3A 4EUFA 2GCGA 2J5RA 2C5AA 4OIMA 5T57A 2GERA 4J0FA 2X7HA 1WDLA 3UKOA 1LRJA 3ASVA 3JQGB 1NNUA 1UP7A 1NP3A 3DZIA 1W6UA 2I99A 3E5RA 3HG7A 1QKIA 2DFVA 3BMNA 3BTVA 3H3FA 4EI2A 1FMCA 4C7KA 4D0SA 4DQXA 1YBMA 2A92A 1IZ9A 1JAYA 2AG5A 5F5NA 5A5EA 5IZCC 1VL6A 1KC3A 3M1LA 1E7YA 4A5OA 4XYGA 5BSGA 3EZYA 4TVBA 4CUJA 5G4KA 5JAQA 4CQMB 3JD2A 4EBFA 4HY3A 5CEFA 1WPQA 4JJGA 1TT5B 1UAYA 5KJ6A 2C7GA 3WQRA 4RZIA 1BW9B 4P38A 2BD0A 4WK6A 1EFLA 3H65A 3NKLA 3M2TA 4XJSA 3RFTA 4CM1A 1U7HA 5KKAA 1FJHA 4YRAA 5ICSA 4XGIA 1RM3A 2FR0A 1A71A 4D3SA 2QRKA 4BQPA 4CV0A 3KO8A 4U5QA 5H81A 1RYEA 5TJHA 5C7LO 4CMEC 3DMTC 4D46A 2V6FA 4BB5A 1PJ4A 2O2SA 3MJVA 3V2GA 3QIVA 3PLRA 5DZSA 1E3JA 4R54A 1YKFA 2ZYAA 1NYTA 1DDOA 4EYEA 3IKVA 2NNLD 5THQA 4RPKA 1GTMA 2PH5A 2OBYA 4KMSA 4UVIA 4BKOA 1HRDA 3P7MA 4YJGA 2O23A 3MTGA 5JAZA 3EMKA 3TOXA 3OETA 3KYCA 3LYLA 2WYWA 1NAHA 4ALIA 1UJMA 2PFGA 2X1HA 3DTYA 2R00A 2VYVA 1IPEA 1D8AA 1ZK4A 2UV8A 4WEOA 4XWYA 5U1PA 5ITWA 1ADFA 1QXSA 1VJTA 3BA1A 3MWEB 3H9JA 1PZFA 5IZCA 3D3EA 4NU5A 1LDNA 1FK8A 2F1KA 1ONPA 4K28A 5DN9A 1B0AA 1DJQA 5HTOA 2CFCA 2D5CA 4IJKA 4E5NA 4L74A 2GN6A 1EFKA 5KVVA 1ZJZA 5TS3A 1SEPA 2C7VA 1ZMOA 3FHLA 3JQ8B 2P68A 3NTQA 1SO8A 1MC5A 1GCOA 2YFHA 3OEYA 3AI1A 3LU1A 4O5OA 5F1KA 2AG8A 3DR3A 3V8BA 4FSHA 4II3A 3K96A 1N1GA 4GAEA 4YAGA 4PG6A 3FPLA 3I1JA 1R16A 4Y8VA 3ZWYA 2JCXA 4YPOA 1NVTA 1C1XB 4KZPA 4AJ1A 3Q0EA 2YY7A 3WYCA 1D1SA 1K2WA 5C7IO 1IY8A 3AUUA 3PHLA 4W9NA 1Q7GA 5JYEA 3L6EA 1GQYA 1UDBA 4PZCA 4PN3A 3GPIA 2YQ4A 2QZZA 4J2HA 3OIDA 4WE3A 1M66A 5MGBA 4D44A 3WFJA 5K0ZA 4JN6B 3B1FA 5JYDA 2WYUA 3PLNA 4TKLA 4L73A 4U0KA 3G17A 1HSOA 3RSHA 1ISGA 5FWNA 2JFGA 4O1MA 4M87A 3ITDA 4IIUA 1IL0A 4XDYA 2O48X 3IQDB 1Y8RA 4PLFA 3DHEA 3ORFA 2GLXA 1YL6A 4GPD1 3JV7A 3WMXA 3KSDO 3ZU2A 3ON5A 6ADHA 1DRWA 3I6IA 4TKMA 1V3TA 1Q0LA 2VZ9A 4TQGA 4AJEA 4GSLA 4LISA 4BO8A 3FR8A 1TEHA 1ISHA 4RPGA 2QW8A 4BMVA 3D4PA 4XRRA 2NACA 3KM0A 3MJSA 1ML3A 4RJTA 1P0CA 3GR6A 2Q2VA 3EYWA 3OICA 4CMKA 1QLHA 3ZWMA 4IDDA 4WASA 3AU9A 2VNAA 2R6JA 3NRCA 2OL4A 1DBVO 2FRDA 3QRWA 3LF1A 5EN4A 4BVAA 1WDMA 2BGMA 3E9NA 4QT0A 2X6TA 3WR5A 1M2WA 1QYXA 2GPTA 1A72A 4FC7A 1SNYA 5BT9A 2HMWA 1KS9A 4RORA 1NTOA 3ZHXA 3HB4X 3HWRA 1GL3A 1NHGA 1ZEMA 2FHSA 1NVGA 2VYVD 2HK9A 4HNHA 1YONA 2G76A 2B83A 4W6ZA 4ND4A 3LLSA 4CM9A 1E7WA 2JAHA 2NQTA 1WMAA 1XG5A 5JCJA 4PVCA 3X2FA 3JQFA 1LLQA 4GX1A 5JAMA 1GUFA 1AHIA 1I8TA 1YB4A 4E2WA 5A9RA 3ZZNA 1H5QA 2E48A 4BNFA 1IOLA 3RROA 1ZH8A 4PG8A 1WLYA 1ZNQO 3IDSA 1ISJA 3AUTA 3A28A 1CDOA 3D7LA 4AL4A 5B1YA 4OM8A 1H94A 2ILTA 3FRJA 5DBGA 3W4JA 4OMUA 2FMUA 3ROPA 5KOIA 1K5HA 4K1LA 8ADHA 1T2EA 2I9PA 3PXXA 3Q11A 3KB6A 3GEDA 3U3XA 1X13A 4MVJE 5B12A 3UHAA 1N7GA 4QEDA 5DCUA 5I8ZA 4ZN6A 1BDBA 4P4LA 1F0YA 1E1NA 1OAAA 5LDGA 4CR7A 1B26A 1UDAA 2ZATA 3QSGA 2LDXA 4CM3A 2EGHA 1KEVA 4CM8A 3BMOA 3VH1A 1TVEA 4J43A 4NZ9A 3ZNNA 4E2YA 1YL7A 4MINA 4GLLA 1NM5A 1UR5A 4JGBA 1YB5A 4BNGA 2XOXA 4ND3A 4RQTA 2YYYA 2FSVA 4XYMA 4D7AA 4BL5A 3HFGA 1Q7CA 1BXGA 3PFWO 4ZGWA 3WXBA 1YGYA 3QW2A 1LI4A 3GDGA 1O8CA 2Y1EA 4TWRA 3O26A 3RUDA 1E0DA 1B3BA 2E4AA 3C7DB 4BS9A 1LSJA 3E82A 4CLOB 3ZU4A 3U49A 3G3EA 2DU8A 3ZWAA 4I5GA 4E12A 5CDYA 5JXWA 1R6DA 3OF2A 1O0SA 3NTRA 1VLLA 4BNWA 3BHIA 3GK3A 4TRRA 2BLLA 4BNLA 2Z1NA 1V35A 1KEUA 3CUKA 1NQTA 3EZLA 3ICCA 2Y1DA 4IQ8A 1UXIA 1ADCA 3NT5A 3MEQA 2Q4EA 4E5YA 4YAKA 1E7QA 4PIVA 3PYLA 4U7WA 4LRTB 4L4RA 3GRPA 4E31A 1XU9A 4OOEA 2HLPA 3JSAA 1BDMA 3ANLA 5TF4A 3KEQA 5I8WA 4PLCA 3BZUA 3TZQA 4NQZA 5AOVA 1Y5MA 5IDWA 2VUTA 3PI7A 5L7YA 1DRVA 5DNAA 2I65A 1K6IA 4HFNA 5K9ZA 1H6CA 2P9GA 3TJRA 5I9NA 1X15A 5CG1A 2JHGA 1K0UA 4DBZA 5T8KC 4MVJA 1MV8A 2QRLA 2AXQA 5GY7A 1J6UA 2DAPA 2AW5A 4AJ4A 3SVTA 5IJZA 4TZKA 1JKJA 2Y1CA 2ZTLA 4KUEA 4IQGA 4PLVA 4ZRNA 1EQUA 1SB9A 2X0RA 3D3WA 4E2ZA 1SEVA 2WTBA 3Q9UA 5JMWA 1OZAA 1AGNA 2Q1WA 2AE2A 3H9EO 2C54A 3H2SA 2D2IA 3GEGA 1E3IA 1D1TA 3H9UA 3KRTA 2FR8A 4JBIA 3NUGA 4J9VA 4DIFA 3TZCA 2PD4A 3FNFA 3STHA 1B16A 4E32A 1KVRA 1ORRA 3BTUA 2V65A 4LCJA 4TZTA 1MXHA 4IJUA 1IB6A 5BQFA 2JCYA 4BV9A 1ADGA 3L4BC 4QFCA 3H7AA 4AJJA 2C0CA 3JQBC 3I9NA 1GUYA 2BFOA 4TROA 3DBRB 2D5AA 3QVOA 4FQ8A 4CV2A 2FPIA 4JX8A 3U0BA 1LDGA 4MIOA 3DBLB 1DB3A 5KKCA 2YFQA 4Q3CA 1KYQA 2R2GA 2FSSA 2O3JA 3BYZA 1ENPA 4YDRA 3AY6A 2C82A 4PLZA 5CEJA 3H6KA 4HWKA 3L07A 4J4BA 1RWBA 4QO7A 5JMPA 2VHZA 4B4UA 2QG4A 2D0IA 5AXAA 3EHEA 1U1IA 4ZICA 3WMWA 1E3WA 4YBZA 5IF3A 1XA0A 4R3WA 1YWGO 2VCYA 1RM4A 1R4MA 1N8KA 2VRCA 4DLLA 5BR7A 2CY0A 4JP3A 4CM9D 5L7WA 5IXSA 1LC3A 2CNBA 2YHIB 3JQ9C 4OH1A 3GVIA 4IY1A 5JPIA 5COAA 2D8AA 4O6VA 5C5IA 3E48A 1ISIA 1LSSA 5F21A 1D7OA 1ENZA 3RUHA 2Q46A 4RVUA 3BMCA 1SPXA 3ZNQA 3K2BA 1I30A 1I2ZA 4NJMB 3TZ6A 5LDHA 3PJFA 3WGYA 1NQ5A 1LNQA 1ZXLA 3WGOA 1HYGA 5TLSA 2A9FA 3KHUA 1I3KA 4KUHA 2D1YA 4CUKA 1DAPA 5C3MA 4EZBA 2O50A 3I3OA 3CXRA 1CRWG 3DQPA 4YA6A 4NBVA 1I24A 1PL8A 1LSUA 4WCDA 1F06A 1UP6A 1YO6A 3AU8A 1PJTA 2VWGA 1EE2A 1R0LA 3GG2A 5ER6A 3ZWXA 3N7UA 1U2GA 1LDYA 1YJQA 5DULA 2X5KO 3PJEA 3AM5A 2H63A 4DTIA 2C20A 1ZJYA 2HDHA 3L9WA 3HNPA 3DHYA 3DTTA 1EBFA 3QVTA 1HE2A 1SZJG 2C5EA 3D4OA 1N7HA 4NG5A 4J1TA 2Y0CA 3F1KA 1J49A 2HAEA 4NMHA 1UZLA 2I66A 2AQKA 2AEJA 4UVEA 4BHTA 3GGPA 4OSOA 4FB5A 3CSDA 3DO5A 2DC1A 1PTJA 1I0ZA 1TLTA 3EDMA 3OJEA 1O5IA 2UDPA 4OKIA 3ADPA 1TXGA 1H6AA 5TX7A 1CWUA 2EJVA 4DC0A 1L7DA 3TFOA 3IS3A 1H93A 2V7PA 4L4SA 1LQTA 5G4LA 4N5MA 1IUKA 2ZJ0A 4PGFA 3FWZA 3P19A 1PQPA 1RPNA 2B37A 1EBUA 2QYSA 4R1NA 4EJ0A 3G79A 2Q2QA 3PWZA 1DEHA 4XQ9A 1P1KA 4FIZA 1A7AA 3RC1A 4YJGB 3GNQA 1ZCJA 3DHNA 1U5CA 4DWVA 4EUEA 4I08A 1E6UA 1FDVA 1P9LA 1PU2A 3HDJA 2P4HX 3E1KA 3B6ZA 3OJLA 4CUZA 4F45A 1MA0A 2PGDA 1J4AA 4Z3KA 1G6KA 1YS4A 3PGXA 1NR1A 1UH5A 4PLWA 1BVRA 3R3SA 5KJEA 3R1IA 5HA5A 3VTFA 2CDCA 2F00A 2CD9A 5A1TA 4GMFA 3LT0A 4DQVA 5CFZA 3H9QA 3D0OA 4B3IA 3JQ9A 3L0DA 3R3JA 3IOYA 2NTNA 1T2DA 2X9GA 5F1OA 1MG5A 3IJPA 4ZVVA 3WJAA 4R9SA 4ZQEA 1XU7A 1BSVA 4WECA 4CV1A 5FEUA 2X22A 4GH5A 1EUZA 3GH3A 4UVHA 1HE5A 1RYDA 4CMHA 3S2EA 3VVCA 5A4DA 2P4QA 2YDXA 5AYVA 4DPLA 3VAZA 2GDZA 1O95A 2WD7B 4IJWA 1K3TA 1RJWA 4A0SA 2BELA 5AVOA 2VZ8A 3SBOA 4KTTE 2OBNA 3U4HA 4DLAA 4F3YA 1I36A 2B4QA 4B4OA 4CQMA 4GBJA 4MVJG 3A14A 4WPGA 1ZFNA 3TPCA 5CDTA 3DZKA 4UEJA 1KEPA 1R4NA 4HUJA 1U28A 1CYDA 2J3IA 2NLOA 3P5SA 3S2GA 4BNVA 4FFMA 4FC6A 4R41A 2J8ZA 4XB2A 3EAGA 3OQ6A 1GPDG 2VHYA 1E3SA 2O3TA 4ALJA 1DOHA 3MCVA 4WLOA 1HDZA 4MKRA 5C37A 3DMYA 4W7IA 4IBOA 1AHHA 2JJYA 1ARZA 1X14A 3VZPA 2W2KB 1R4NB 3MJ4A 1KERA 3I9OA 5T64A 4BNMA 2G0TA 3W6UA 5AXCA 2Y1FA 5L9AA 4GSKA 4ID9A 2Z1MA 4BNUA 2Y0DA 3PQDA 2CVQA 4XGNA 4UUMA 2ZYDA 4FGWA 3WICA 3FTNA 5ES3A 5CDGA 9LDTA 1UUFA 4FFPA 5EINA 3ADOA 1MFZA 3ICPA 5CG2A 3K8ZA 1XR3A 3E03A 4MJLA 3WYBA 5CEEA 3NDIA 4U0JA 3W8EA 1X7DA 3QE3A 4MPDA 3WB9A 1KVSA 3KEOA 3DMTA 4BNKA 3QY9A 1HLPA 4TRNA 2Q45A 1XQ1A 1WAMA 1Y5RA 3GAFA 4MOWA 3U09A 2OZPA 3SJ7A 1SAYA 4JNKA 3P2OA 3W8FA 2VZ0A 4BNJA 3RVDA 4N54A 4IMPA 4H3VA 4E30A 4Q3DA 1E5LA 5JCXA 3VTZA 3F6YA 2B5WA 4I8XA 3KTDA 3U4CA 3ZWWA 3AUAA 3FBGA 1GYQA 4LN1A 1B2LA 4WKGA 3KVOA 4WCFB 4BGVA 1T1SA 3W6ZA 1T2AA 3PK0A 3S2FA 1BRMA 1EK5A 1NQOA 3ZCXA 3GC6A 1PL7A 1PSDA 2JHFA 2EWMA 3ZWOA 5KVCA 4KWHA 2HMVA 2NVWA 1IE3A 3K2EA 4OJNA 3OIFA 4NBRA 4TSKA 3GN1A 4IMRA 2ET6A 4CLXA 4PRLA 3OA0A 4CMEA 1Z73A 2ZB7A 3DBVO 4E13A 2BFPA 4RF2A 2B36A 3PQFA 3ZI0A 4Y6SA 4WUVA 2HCTA 5EJ2A 4X54A 1DXYA 3JD0A 4B8ZA 4OXKA 2BRUA 2UVDA 3E8XA 3EY4A 4WLEA 2SCUA 1E6EA 3B1KA 3LSYA 4QO8A 5A9TA 3QVWA 1LTHR 1PJBA 2YW9A 5IN4A 3D3WB 1BGVA 1GZ6A 1BHSA 1LRLA 4MVJF 2HMSA 2PR2A 4FFOA 4CM4B 4EJMA 2BHLA 2X0JA 3HADA 1XWFA 3PHGA 1DJNA 4N5LA 5L4LA 3CIFA 3GF4A 4HP8A 3FNEA 5I7SA 1WW8A 4FFNA 5EERA 4PG7A 3G0OA 1XIVA 4PZDA 2PD3A 1GCUA 3ROMA 1P33A 5TT1A 1LXCA 1PL6A 4YYZA 2OMEA 2FZEA 1ZSYA 4QXMA 1TB4A 3NDRA 5A05A 5T8KA 2CDAA 2PZLA 1QG6A 3G49A 2AA3A 4BO3A 4I9NA 1QMGA 2X0IA 4W82A 4FOSA 1P1FA 3RFXA 3AM3A 1KIFA 3NTOA 3BMCB 1EVJA 4NNJA 1TT7A 1V6AA 1KETA 3GDFA 1K6JA 2CDBA 5A3VA 3VPHA 2IRWA 4BNHA 3WQQA 2DTEA 1NASA 1EDZA 4Z9YA 1HSZA 3PDJA 1OC2A 4S3MA 2DKNA 2WE7A 5IZ4A 2DVMA 3LC1O 1R4MB 2D3TA 1XELA 4RF4A 1A9ZA 1VSVA 2ZB3A 1OC4A 1LQUA 2EW2A 1HYHA 2W2KA 2I76A 3A06A 2O7SA 1X7HA 1H2BA 1Y1PA 3QWHA 2GNAA 4AJIA 1NWCA 1PEDA 1X0VA 2EIHA 3ZU3A 4HFJA 1YQGA 5JO9A 3GGGA 4RLSA 5G0SA 1I5RA 1EQ2A 3GQVA 4QSMA 5A04A 3RU7A 1QV6A 4TVOA 1BXZA 3U9LA 2I5PO 2YHUA 4M55A 3ENNA 3ONDA 4OO3A 3GVXA 4B7CA 2X9NA 3HN7A 1YOVA 4MVJM 4RZHA 5EQFA 3OEWA 1CETA 1MXFA 4CLDA 1PS0A 1DHTA 3WQSB 4CM8B 1IPFA 4UVDA 4XIYA 1B15A 2AEFA 3JCZA 3BTOA 4RO0A 2WD7A 1P31A 4FPXA 4MVJP 2VT2A 2VHXA 4Q3NA 5DBFA 4J9UE 5MDHA 1Q0HA 5DF1A 4B79A 1FXSA 1ZKMA 4IUYA 3DFUA 3GZ4A 3AWDA 3V5NA 2UAGA 1X1TA 1PZHA 4A26A 3GUCA 4Y98A 3ENKA 4C7JA 3FD8A 2C29D 4R9RA 4PG5A 5ER9A 2DQ4A 4XR9A 2X0NA 3IKTA 2ZKLA 4HFRA 4B8WA 4LVCA 4Z0HO 4AJHA 3AFNA 5FF9A 3RKUA 3LLVA 2UUPA 1WZEA 1X7GA 4RVHA 3ZWNA 1W4ZA 4BOYA 4D3DA 1PZGA 2EP7A 3C1OA 4EITA 3NGXA 4MKZA 4NIMA 1KY4A 4Y9DA 5GZ6A 3W1VA 3PTZA 3GGOA 3BHMA 3ZW9A 3OBBA 3HB5X 1GR0A 4PG4A 4ZQBA 1YOVB 4YT5A 4Z6KA 2JD1A 4WNCA 1J5PA 3FF4A 1LC0A 5BSEA 3GT0A 1ZXBA 2UYYA 3DZHA 2RH4A 2O7QA 5I7VA 4LVUA 4RF5A 4M89A 1HWYA 3F4BA 3NV9A 4AJLA 3FBTA 4YR9A 7ADHA 1W8DA 4J4HA 4CMGA 1XYGA 4GX2A 1QYWA 3FN4A 3GHYA 1SCUA 3AOEC 3QA9A 1GADO 4NR0A 5ADHA 4Q39A 2G17A 3PWKA 2A4KA 1BW9A 1GYRA 3MWDB 5TGDA 4CODB 2Y1OA 3L4SO 2YQ5A 3WIEA 3Q1LA 4BNTA 4OAQA 1Y9AA 1E7SA 2A94A 2B4RO 3OIGA 3UICA 2NU6A 4ND1A 1V9LA 3ZNOA 5KWEA 3WGIA 1V0JA 2PD6A 2G1UA 1E1MA 4J4TA 3HHPA 1A7KA 3CE6A 1YQDA 3WBFA 1VM6A 1VL8A 5AQ1A 1NWHA 2GYYA 5BNIA 3RBXA 1PJ2A 1NFRA 2PTGA 2YDYA 5BNFA 3E9MA 1Y8RB 1MUUA 4K9DA 3OFSA 4N18A 4J3FA 5U4QA 4CLEA 4JBGA 3DXFA 2QIOA 4AJOA 3OHSX 4J90A 5IDQA 4LMPA 4Z9XA 1J0XO 4WCFC 3EC7A 5EQDA 1OFGA 4BGIA 3FWNA 4URFA 5ICMA 1DIBA 3S55A 4CQMD 3WGZA 4IIVA 1B3RA 1HDRA 4P22A 4R68A 1UDCA 3T4EA 1E7MA 4OOFA 2W2LD 3IUPA 4N7RA 3E9QA 2HKIA 4J0EA 3RD5A 4YB8A 2XXBA 5CDSA 1YQXA 5L95A 1A5ZA 3TN7A 5JY6A 2ZK7A 3RIHA 1E6WA 1DC3A 1HF3A 2C59A 2PWZA 4OYRA 3GMSA 2BF7A 3U4DA 3IJRA 4K6FA 1EVYA 3GNTA 3HUDA 2Z5LA 3WNVA 4BO1A 2PA3A 4QFDA 1R12A 4EEZA 4Q9NA 3DBHB 1QV7A 1N92A 1VSUA 5IDYA 4D42A 1Y6JA 2UUOA 1CQIA 4R5HA 4FJ0A 1VL0A 2Q99A 5JAIA 1GZ3A 1XQ6A 3GZNB 4IS2A 4JBHA 2V6BA 4XYLA 4GL4A 1YL5A 2Q1SA 3O8QA 1CEQA 2AQIA 3DZGA 2QRJA 3PRJA 3VPGA 1JDJA 4IINA 3WGQA 2X5JO 4DIBA 1G1AA 2GR9A 1H9BA 1ZK1A 3OQBA 3GZNA 1DFIA 3KZVA 4I1IA 1P45A 4WCFA 3RI3A 3TWOA 3WWYA 2AMFA 3RBZA 2GRAA 3H4VA 4HFMA 1BTOA 4DVJA 3C24A 5L40A 4IM7A 3E6AA 4RGBA 3OJFA 2B69A 4DPMA 1Z75A 4J7CA 1XKQA 1ONOA 3DBHA 3H5NA 1WXDA 4J2OA 2X23A 4AG3A 3F3SA 4RQUA 5GZ3A 4FGSA 1UXKA 2BMAA 1VJ0A 4LGVA 1I01A 2ZTVA 4CL8A 3I9LA 3C8MA 4R16A 3UCFA 3D5TA 1PGNA 3ZN2A 3FNHA 3R6DA 2H1SA 1V3UA 4NBWA 4RF3A 1PJCA 2Y05A 4FN4A 4YTEA 1L1FA 1CERA 1WMBA 4MIEA 1UAGA 2VOJA 2R00C 4DPKA 4GKBA 2FR1A 3CTMA 4YACA 2CF6A 3TZKA 1TT5A 2WYVA 5G0VA 5TSDA 2IZ1A 1ZBQA 4YWJA 3M6IA 1GV1A 1PS9A 3SC4A 2O4CA 2DPHA 3IP3A 2PLAA 1BWSA 4GKVA 3ZWBA 1TI7A 4R69A 4DGSA 1DIRA 4GX5A 3WSWA 3JQ6A 1H0KA 3GG9A 3W4KA 4J7UA 2EXXA 5CP8A 1WZIA 3QHAA 4L8VA 5DCWA 4BKQA 3RCBA 1T25A 1K6XA 1GD1O 3RUEA 4ALNA 2D59A 4JIGA 1QORA 3K9QO 1U8XX 4XDZA 4I5FA 3PHIA 1C0IA 1H9AA 3PGJA 4DA9A 1UXJA 1E3WB 3AY7A 3D5QA 1LDEA 4BKUA 4RDHA 4F6CA 5IG2A 3CH6A 4HX5A 3JQ8A 2O3QA 4F46A 3JQAD 5JBIA 1P77A 2O3UA 1UXGA 2IXAA 5A9SA 1UZNA 1T26A 3V1UA 1ID1A 1ZEJA 4WLVA 5BSFA 5U9CA 1HZZA 4DIOA 4E21A 3WWZA 1C3VA 3GPDG 2FP4A 1QRRA 2OP1A 2VQ3A 5IXYA 4JROA 2V6GA 5IDXA 4XCVA 5I9MA 2GZ3A 1PGJA 4XRGA 1VI2A 4KQXA 4RCVA 2Q1TA 4XB1A 1W0CA 2OOSA 3DBRA 2NQ8A 1GAEO 3LK7A 1U7TA 3IUSA 4CM5A 4J6FA 3BMOB 4RPLA 3JQAA 1C14A 3NX4A 4PLYA 3VKVA 3O4RA 2Q1UA 2FPGA 5LCXA 3CMMA 4AJNA 3CEAA 4PVDA 4PLTA 3GHHA 1RM0A 3A9WA 4DXHA 4GLOA 3DL2A 4XZ3A 1ZIDA 1JKFA 4WLFA 4YXFA 4NU6A 5TQVA 5HWSA 1GUZA 3RAJA 3KUXA 4W4TA 2E37A 3ZU5A 2CVZA 3GFBA 1PR3A 3EUWA 1PX0A 3VDRA 3RC7A 1YVEI 3ONEA 2Q2WA 1JA9A 2RCYA 1MG0A 3P2YA 4Q3BA 3TFQA 3IMFA 2VHVA 3K5PA 9LDBA 2O3SA 4YT2A 2AEMA 5EESA 4R51A 4IDEA 2W90A 1T4BA 2G82A 3AY3A 3EVTA 3PZRA 3ZV4A 3DB2A 6LDHA 1VKNA 1U5AA 4HV4A 5DDIP 4M54A 3NAQA 4Z0TA 4ILKA 3T7CA 4II2A 3GVPA 4BO5A 3VZRA 5H82A 4UUPA 3KOUA 3V1TC 1JU9A 4YJHA 1PJLA 3CZMA 2CSUA 1BMDA 4D0RA 4MP3A 4NI5A 1MX3A 5A03A 2W4QA 3EGOA 4O0LA 3OMLA 4YJDA 3TOZA 2DBQA 2HSDA 5CPFA 3QWAA 1SBYA 1GU7A 4ZU3A 3HDHA 1E1LA 4I5EA 1NX6A 1GQQA 3I4CA 3RBVA 1LSOA 5DT9A 3WLEA 1P1JA 4RL6A 2HU2A 2WD8A 2X86A 3UOGA 3RUFA 4RVSA 4RVGA 3JYLA 1ULSA 4KOAA 3UFXA 2AQHA 4ALKA 3GRKA 2X8LA 5KTKA 2HJRA 1CIVA 3WFIA 3CMCO 1DC5A 2NADA 1HLDA 3CKYA 4UEOA 5JFOA 4IXTA 4WLNA 1MB4A 1T4DA 2VOEA 1U4SA 2FOIA 3ZHBA 5IAAA 3UGKA 1NPDA 4L0QA 3SC6A 1N2SA 4K6CA 4XIJA 5TT0A 3WX0A 2PV7A 4CLOA 2BKAA 4GX0A 3MOIA 5K6AC 5DBIA 1VPDA 3OSUA 2I3GA 4OGWA 1ZK2A 1R0SA 2ZCVA 3DOJA 3KSUA 1ZZEA 3HSKA 1BXGB 1PWXA 3L6DA 3QVSA 2WEKA 2GUGA 3GNSA 3K31A 3NJ8A 4B3HA 5AXDA 1PZEA 2IYOA 4OQZA 3N74A 2JD0A 4BO2A 3MZ0A 4R01A 3SEFA 4ALMA 3VH4A 2IODA 3GA0A 4CPDA 2PK3A 1ZSNA 3AJRA 3FPCA 3I52A 4NHEA 3HFSA 3OP4A 1T2CA 1NFQA 4NBTA 2ZB4A 3T4XA 3Q6IA 1ZW1A 2EF1A 2ZTMA 2V6MA 2EKPA 2J3JA 2Y68A 2Y99A 3FNGA 5T67A 1B8UA 5IFLA 3FCOA 3WIDA 1GFSA 3EK2A 4AJ2A 3L6OO 1F14A 3ZGYA 3Q9NA 4DQUA 4YT8A 2ZJ1A 4CMAA 2D4AA 3WYEA 1P3DA 5JDIC 5A06A 2CVOA 1E92A 4IDBA 3ROKA 1GQ2A 5L3ZA 4M1QA 4IGEA 2IZZA 5KJ1A 2FWMX 1PIWA 2HRZA 2IXBA 3TF5A 5B4VA 3INRA 2EKQA 2YUTA 3DZJA 2JFHA 2W2LA 3WOHA 4FBGA 3UN1A 3IAHA 2YV1A 3BMQA 1UP4A 3LF2A 1ISFA 3C7CB 3JD1A 3QWBA 5B4UA 4LW8A 4AJPA 1NXQA 1WNTA 1VE9A 2QHXA 1ENOA 3ZWVA 4IS3A 3WJ7A 4YJFB 3U4IA 3FTPA 3KXDA 3PFFA 3RJ9A 1VJ1A 2XXJA 1IHXA 3PIIA 1JWAB 1VRWA 2Z95A 5F5LA 5G0TA 3Q2KA 3VOSA 8LDHA 1I3LA 5L7TA 1PJQA 3ZV6A 2H5LA 3LT2A 2E49A 2J3KA 2NU9A 3JD3A 2OP0A 3JYNA 3PVZA 4E4YA 1JVBA 4P4NA 3ABIA 3WTBA 1Q0QA 4XX0A 3AI2A 4FD3A 3HZZA 3PZBA 4A2CA 1AUPA 1RM5A 4O63O 3LVFO 2VRCD 4GMGA 1GV0A 5I9LA 3ETDA 2QYTA 2IE0A 3V2UA 4Z9FA 4FCCA 3O38A 4XQGA 4J7XA 2Y0EA 3HE3A 1YXMA 3FSRA 1U3WA 1X0XA 4LSWA 4MP6A 4RDIA 4R1UA 2PZMA 3PQEA 3UCXA 1HDXA 2C2YA 1LLCA 2DLDA 3B1JA 1C0LA 5G0UA 3VZQA 3ZV5A 3ETEA 5JW6A 1LLDA 5FFFA 3I23A 3Q3CA 4QQRA 3ZH2A 3PIDA 5I7FA 4IQ0A 4HNGA 3C1AA 3F1LA 4CLRA 4NJOA 1XLTA 4G5HA 4JCOA 4CQLB 4IDCA 2C2XA 2EGGA 3JQEA 4ZQFA 4YAIA 2G5CA 2GGSA 4LRSB 4P8RA 5KCZA 5JS6A 3GOHA 1NVMB 1PJ3A 4U6SA 1MGOA 3WGHA 5G4KB 1HKUA 4GWKA 5HS6A 4DMLA 2ZB8A 3DAFA 2CMDA 3A4VA 5KVQA 2QZ9A 5DP1A 4M86A 1FDUA 3C7AA 3BMQB 4L76A 1HDOA 5L51A 2W8ZA 1WWKA 1JN0A 2EERA 3NJ4A 3H5AA 4GVLA 5EMHA 4E6PA 1EMDA 1E3LA 4ZRMA 3WSVA 4Y67A 3WS7A 2AQ8A 3D1LA 1G0NA 5KIAA 1YBAA 3K73O 3JQGA 3F46A 3QWFA 2IEDA 4IDAA 5DOZA 4WNIA 4A7PA 2ZYGA 5J23A 3X2EA 4E3ZA 1H6BA 3PEFA 2HUNA 5FI3A 4PLPA 2NTJA 4R1TA 5CHEA 3S8MA 4YRDA 3WLFA 2NWQA 4NK5A 4KQWA 3AUSA 1YDEA 3H5RA 4DC1A 2O4UX 1UZMA 3GY0A 4Y6PA 2XPCA 3MOGA 4BO0A 3RUIA 3OJOA 1HEUA 5A5FA 3NT4A 1A4UA 3PJDA 3VHRA 1JQBA 4FJ2A 1XSEA 2BI7A 4ZA2A 1LDMA 1HE3A 4WJZA 1ZSVA 1HE4A 2DTDA 2YZ7A 4MIYA 3I9KA 4XR4A 1R15A 3OA2A 5JC1A 3NDJA 3RUAA 2NVUB 1EDOA 4KUGA 4D3FA 4EDFA 3DOCA 2I6TA 4CMJA 2PY6A 1YB1A 2NU7A 1Y8QB 4W99A 1DO8A 4MVJD 3QV1A 1Q7BA 1SC6A 2Q4BA 2CZCA 4G65A 3H8VA 1LUAA 2NV6A 4P4GA 4L4XA 2TMGA 4W7HA 3RFVA 1JKIA 3RKRA 1F12A 4NDNE 2P5UA 4OHUA 3GLQA 4PLGA 2I3AA 5TJ9A 1N1EA 4BNZA 1KVQA 2Y1GA 3I4FA 2E82A 1Z45A 2EW8A 2BFMA 3F4LA 4EEXA 4LK3A 4D41A 3BHJA 2XAAA 3F5QA 2DBVO 4JXKA 4XYBA 4KP7A 3S1LA 5TC4A 1JLLA 2OFPA 1T1RA 4XQCA 4FW8A 4HADA 1EK6A 2BGLA 3ONFA 3FR7A 3DZFA 4IDFA 3RQSA 4Z3DA 3DONA 3W8DA 4DRYA 2X5OA 2W98A 1I10A 3ANMA 2LDBA 1YH3A 1ULUA 3KBOA 2FZWA 1OMOA 3WDSA 4J1SA 3JQBA 4CJXA 1LEHA 4JQCA 1A27A 3MTJA 4PCVA 3QWIA 4CV3A 4INAA 4H16A 5CPBA 3G1UA 3F47A 3ETGA
chains in the Genus database with same CATH superfamily
5LIRA 2JFFA 3LUFA 2GLUA 3HKEA 4KQHA 3LECA 5JY1A 1KOGA 2EKDA 1W35A 3LY8A 4E33A 4XXHA 1E20A 4A0GA 1WVMA 1W4RA 3FZGA 4GPTA 3DE1X 2R96A 3F5SA 2NTVA 1VXRA 4NENB 4E2XA 3LPNA 4X66B 5I5GA 4XKJA 1E3MA 1GNSA 3ROQA 3TR0A 2QM3A 4XWOA 3CLSD 3LQQA 1U8FO 3MAJA 2P5YA 4BX8A 2ZRDA 5JI3E 1GYPA 3BEDA 3IBYA 3KOWA 1JW9B 2BLNA 1CUZA 1XJWA 1BAPA 2BC9A 3FG9A 2WU8A 3AM4A 5J2TA 1C0PA 1B8OA 2ZTUA 4AZ3A 1F5NA 2FKAA 3M6XA 3QVJA 3WK9A 4EUHA 1ZICA 2TMDA 3H2ZA 1BS2A 5KMGA 1Q12A 2AFRA 5I3ZA 2N47A 4RCYA 3VO2A 5DCYA 3EX7C 5TRTA 3RDPA 1MPXA 3THWA 4FB4A 4B84A 1JHAA 4NAHA 1UPBA 1YBVA 3OT5A 4QDZA 4BFZA 3UPUA 4AMYA 3AFIA 2F9LA 4GI2A 1XTPA 2A9OA 4BNIA 1KDPA 3A1VA 4HWTA 1KU0A 2ATXA 2Y8EA 2PMEA 2C8JA 4DEVA 5AW1A 1KAQA 2VYNA 1JSZA 2PGOA 1H2AS 2XUPA 3CB4A 2JGNA 3D4NA 4Q1VA 2ZRPA 4UBKA 1RZRA 3F6PA 2CC2A 4QOEA 4XB6B 5DYGA 3GWGA 1KO8A 3DOOA 4L75A 4ZI5A 5CB4F 1JAIA 3V7WA 5FR1A 2V59A 1EWQA 4P5PA 4P4UA 4C3VA 4HF7A 1PTKA 5BVGA 1R0KA 4AICA 5KB3A 3DWFA 3H1TA 1EE9A 1JR2A 1ZNYA 3PQCA 4PX5A 3RTAA 3W5VA 3TD9A 1RMQA 1VLZA 1W6RA 2VDOB 4Y2UA 2ZB2A 3TRIA 1Y37A 2W48A 4C6TB 3BCRA 3U1BA 1NHWA 4D9MA 1OWPA 4KYTA 5TIIA 5HNKA 3T9CA 3WAJA 4CDRA 2Z8XA 2ZYVX 4FONA 4I6GA 4M6WA 4AZ0A 4Z4QA 3CBGA 5AW2A 2J0QA 2PX6A 2CXSA 3AOGA 3PPIA 2R5FA 3UT6A 1I3MA 1Q1NA 3INTA 4RVOA 4O3MA 1BNCA 3ZIAD 2OUIA 4HQKA 5D8DA 4D81A 2ODNA 4A6XA 3HU3A 2V9ZA 3ZHUA 3MWYW 4OL9A 1RCTE 3GAZA 4NESA 3A0RB 4EVIA 3P71T 4C7BA 1U0NA 4JI4B 3BBPA 4BN5A 1KQFA 3W04A 2Z8YM 4PAOA 2QENA 1DI0A 3I09A 4BIIA 1W73A 2VN8A 4EFNA 1Y3FE 2XB6A 3VPDA 1K97A 2QVYX 4Q4LA 2PQMA 4WSOA 5EJFA 3FKQA 1II0A 2Y9PB 2YZNA 1ZK3A 4JVNA 1DXHA 2BFWA 2Q5OA 1D3AA 2GPWA 3DC2A 2Q3EA 1IXZA 2VUUA 1U0OC 5DBOA 1LU9A 1SBQA 3KYDA 3PNKA 1WMEA 2BGWA 1EWRA 4TMFA 1AXRA 1UXHA 5KNLA 1TIPA 2C07A 4CQLA 1JWLA 2I7VA 3BJRA 4QULA 3L1IA 2DF8A 1KVUA 3MJEA 1FTQA 1HT1E 2FPPA 4DLNA 1W581 3JWPA 1SJ9A 3MJCA 4XIFA 2XQFA 5FHRA 4BQQA 2BR4A 4DM4A 1OXKB 3HC7A 4QBFA 1M2NA 1ONNA 4L95C 5HE9A 5JDCA 3N87A 1DRJA 3EIUA 4XEHA 3I39X 3ZY2A 4IWYA 1LBTA 4B9EA 3WBJA 1DRUA 3TMYA 1DFGA 2NO6A 3KYDB 5LQNA 4OSPA 4FEAA 2C5BA 1ZWLA 1VPVA 1OYWA 4G4GA 4QELA 4JI7B 4CF3A 1CJVC 1A8UA 4EDHA 2ZYRA 2BGTA 2W6OA 1R9GA 1V6CA 2AH5A 4JQZA 3ABRB 4DYDA 3TIVA 3CVYA 1R18A 3Q5GA 1YGPA 1Q7RA 3NAZA 3TUJC 2JFUA 3U48A 2F3SA 2GPSA 3B9PA 1DVRA 3ZD6A 4JYAB 4EB6B 4JB2A 3ZDFA 4AMZA 2QW1A 2GS9A 2FUKA 5KJFA 4KR6A 4CDNA 1UBJS 4HKTA 3DP7A 3UF0A 3WB1A 1DOZA 1I5EA 1TJYA 4AY3A 3BMNB 2ZVJA 1XEWX 3FI0A 3AI3A 5C7OO 2OV4A 4L9RA 3OCYA 1EFTA 3M6UA 2J7PA 5E95A 1QIJA 1TTHA 4EG5A 2ZDHA 1P9RA 3BL5A 5B55A 1V4VA 2VRBA 5AK0A 4UHEA 3DMRA 3I83A 4MPPA 4MUEA 3EG9A 3EQ2A 3SVZA 1T6ZA 2DJIA 2J87A 1DIHA 3HB1A 3O8QB 4MK4A 1TCVA 1JKXA 2QGNA 3X1ZA 2I9KA 2XXAB 1NR5A 2P9CA 1TVKA 2ZBGA 1KR2A 3G88A 4Z8YA 4YQZA 5E7IA 3DYVA 1PD0A 1XHLA 4L50A 4C6TA 2C00A 3C6ZA 2AHRA 1VP3A 3K30A 4X3OA 4QPNA 3SJUA 2P9JA 4DW8A 1T3LA 4HXYA 3SICE 2KSQA 4H1WA 5J40A 4JSTA 3U62A 1NJ5A 4CM7A 3R7LA 3BGIA 1C9NA 2YV2A 1XQYA 2BEUA 1SOVA 3RRXA 1A2OA 3V32A 3VI3B 1IXYA 2VPYA 4LYJA 1Q14A 1XA4A 3EGXA 3ANNA 4BUCA 4D5GA 4IVPA 4H4DA 1PN3A 2QI9F 5I5EA 3E9DA 5AR1A 1G55A 1L7EA 1IUPA 1S1MA 2GYVA 4MV6A 1S2OA 4RL4A 4ROSA 4AN1A 5KVSA 2XMCA 1E3EA 3SLKA 5C2JB 1DIAA 5GMOA 2GF2A 4M8LA 4F6RA 4FK8A 4CETA 4KPYA 4N5DA 4TTQA 1DJLA 3I6MA 4WN9B 3ADBA 3C45A 3HV0A 2J4CA 2E85A 1QGDA 2BH9A 3I04M 1H6DA 4TMZA 3PXDA 3B70A 1KARA 2G9QA 3F9IA 3LKBA 2VJCA 3TBFA 4H0NA 1GFZA 4RY8A 4RESA 2C31A 3TIGA 4UHBA 4YREA 2X8WA 3RVOA 2FJ0A 4JYBA 5CT9A 1L4FA 3EIFA 4G63A 1CJCA 4E0BA 5J2TB 5IBRA 3W6ZA 1SXJB 2XHEA 2ETXA 4EKYA 5KOHA 4XOIA 1R6XA 3L1UA 2CFOA 1I0IA 2X6QA 1NSYA 2B1RA 1QAQA 3LC2O 1MORA 2XF2A 4G8JA 3CZRA 1XYYA 3S2ZA 1FRNA 2C3MA 3T7RA 3BXGA 3OPMA 1JQKA 2VJQA 4IHJA 2IUFA 2GPYA 3SC3A 4FR5A 4JHXA 2VYND 4QU0A 4G07A 3FYUC 1G0OA 4S2EA 1AM4D 1TYEB 4OLBA 4RE6A 3FZEA 3WWDA 4EJ6A 3DA8A 4NPCA 1I51A 1G8MA 3AESB 1BVHA 1FDTA 1BEEA 5D3KA 4FT2A 4ZHSA 2QV7A 5EHIA 4BVJA 5LN1A 1QJCA 4K88A 1JDBC 1EGVB 2JCGA 4OQYA 2PBZA 4BO7A 1KC1A 3P1JA 4LQ4A 3OECA 5AKXA 2WJPA 2VKQA 1FBNA 1Z7BA 2J6IA 4NSNA 3VOTA 3ZBTA 5L45A 2II6A 4BVGA 2BH2A 2X58A 3NWJA 4MW9A 4WFIA 4Z7JA 2RB5A 3E9EA 4JQYA 4ML3A 4BMSA 1JEOA 1CS0A 1GY8A 2BI8A 2VSQA 3IYLW 4G01B 2IDZA 4R1SA 4TV8A 2DHDA 4RBNA 4BATA 5BV0A 5JSFA 4TKUB 4DR5B 3HRHA 4OEHA 1PWZA 2AR9A 5HBGA 4FS8A 3UXMA 5AW3A 1DBSA 1JBQA 2QUAA 4IGFA 3V4ZA 1OW3B 4UHDA 3RK0A 3AIIA 2BMVA 3WGGA 3I9JA 5FULA 2DWOA 5F1PA 1DO2A 4EB6A 4NNPA 1DLIA 2FCAA 3NQ41 2NP7A 3DDCA 3R77A 5JV5A 4O29A 3PX2A 1P1CA 2RKWA 3Q9LA 1DL5A 3DE0X 1L1EA 2HCBA 2KQUA 4MAMA 4D1YA 2QX6A 1M5UA 2HBQA 1GSIA 4G2NA 1ZIPA 3PX7A 1LBHA 3DAPA 1W5FA 4NYMQ 2C97A 4YO8A 1E79A 1E5QA 4WXYB 4DT1B 3KQQA 3ULKA 4DMKA 3E8SA 1RQ7A 4Q48A 1NNLA 3NBKA 2R8RA 1AG9A 4FN5A 3GPLA 1BCSB 4O1IA 1RQPA 1R3UA 2AJLI 4EHDA 3DTVB 3EF1A 3EVAA 3WK7A 3KJQA 3AHCA 1JJIA 3UCEA 3MGAA 4FWBA 4HUTA 4I2VA 5I7EA 4JI6B 1RACA 4MP8A 4RTPA 2R65A 3R0IA 5KPJA 3HP1A 5GONB 1ZR4A 4F91B 1AC5A 1NFFA 1HFKA 3PUKA 4LTNA 4D9GA 1QRSA 5E2IA 5LJIA 2XTJA 4QUKA 5CBPB 4RV5A 2FEMA 1NLUA 1W2WB 1DKMA 4YJFA 3CLUD 1Z56C 4I5DA 3TNLA 1L7MA 3DHWC 2HLDA 4FDAA 3R0QA 3QUTA 2C04A 1X8JA 3IPAA 3WGMA 2D2FA 4ZAYA 2YMQA 1Z5WA 3AOEA 5HS4A 1E9AA 2C2BA 4ZEXA 1U2QA 3H99A 2H2GA 5CIWA 3SXPA 4DBVO 4YV2A 1GDTA 3C6KA 4GZ6A 4ZT5A 2CBZA 3ISTA 1RRVA 3N59A 5B3LA 3PFNA 4QBGB 3II6X 2QJRA 4BE7B 2CXHA 2WJJA 5IJ9B 2I1QA 1JFTA 2VBFA 1JUDA 1Z74A 1L9XA 3OZWA 3U2QA 4UHKA 3X43A 2JFXA 1NBOA 3C3MA 4IZIA 1X1RA 2W11A 4UMEA 4DCUA 1VLQA 2NSJA 4YP1A 4EMBA 4EO7A 4R2XA 5DM1A 4D56A 4JJKA 1GCGA 3F6RA 3OPQA 4RXMA 5B2EA 2XTMA 4PTLA 5K6AA 3NBAA 1OOEA 3TL3A 3WL3A 3H5VA 3K9HA 4CMIB 5JZSA 4PFJA 5F3WB 4UREA 2BMEA 1QSGA 3A26A 1DDIA 4J16A 4UNSA 1BXKA 2IVFA 4W5RA 1IZ0A 3EGXB 4WXRA 1PAUA 3G0DA 5IT0A 5A3QA 1DQZA 3ZCSA 5IS2A 2V0CA 2GEJA 5K0FA 2EYUA 5J47A 2QZSA 3I6YA 2O2CA 1E6LA 1NP7A 4FBMA 1U0RA 1ZGCA 4L5IA 4ZVKA 1ZH0A 2BL4A 1NDQA 1DPGA 3A3YA 4YN3A 1IATA 4I4TB 4EW6A 1RQRA 4CRWB 1TVMA 5CNIA 1F0KA 1YSCA 1N5MA 4KDFA 4OCZA 2FFJA 1BROA 2QRGA 1H4SA 2R8EA 4INOA 1L4HA 2QGFA 4Q9LA 5DH9A 4DIUA 4DY4A 2AZDA 1LDBA 1YE8A 2W93A 2C1EA 2GCEA 2CEKA 2HSGA 3FMPB 3NTLA 4HZGA 1TZ2A 4QATA 4UDOA 4BNXA 3DFFA 2HB6A 3RANA 4KQFA 3U9SA 4ENRA 2VHWA 2B5VA 4ZVUA 4A16A 3RLFA 3KYCB 4TZ6A 3VOAA 1UBGA 3B82A 1ZAKA 4WKBA 5DM0A 3IB3A 1Q16A 2GN4A 2PLNA 1ULZA 4P08A 3PEEA 1A8SA 3LUKA 3QQPA 4WESA 3ZGZA 1E9FA 3A3OA 1Y3AA 3MUOA 4EF5A 1EUCA 1V5IA 3OT4A 3C1UA 4DR7B 4QOJA 3VYVA 2R9VA 2X9VA 2A0WA 1JDZA 1JHQA 1IBCA 4BNNA 3V7YA 1YT5A 2Q5FA 4B6JA 4EW2A 1ZNXA 1XEAA 3MILA 4KXNA 2IYPA 1W2HA 3Q5EA 4ERNA 3S29A 4YRNA 1ENYA 4FEEA 1RCFA 2J0SA 4PZEA 4CEIB 1LLUA 2DE0X 1OI3A 4HN2A 4JBXA 3JQ7B 4FLEA 4K26A 3RVPA 3PWSA 3WY9A 1RJEA 1WCIA 3K71B 2JAOA 3RJ5A 5BMVA 4DL9A 1BC5A 4HVCA 2IZ5A 4TRMA 2VFAA 3EE6A 1KEKA 1SXPA 3EF0A 3W9BA 4B45A 3IR5A 4CMBA 2JAWA 3QX3A 1M75A 4DMMA 4MUBA 5DYYA 3C3PA 1ZCAA 3DYBA 1GZ4A 1YNSA 4PQRA 4O4JF 4YJHB 4CM4A 1LNSA 2RHOA 3M4NA 3MW8A 4R4JA 3M4JA 1H8ED 4RGVA 1D9XA 4NL4H 4P81A 2OD2A 4YFYA 2NXWA 1JDNA 1QH0A 1VDMA 2AOTA 2F6RA 2FQXA 3PP8A 4GBED 3ZUGA 1JEAA 2V54A 3WAGA 3NIFB 2IS1A 1A3CA 3Q10A 5KQPA 2A33A 1M6HA 2CBXA 1RAFA 3WOVA 4ENQA 5I7UA 4DLUA 4EHHA 1P1RA 4P5DA 4S1NA 4ZHQF 1H4QA 2GO1A 2NSDA 2ZPUA 3K35A 5H59A 1MOQA 3ZW8A 4G0UA 5E7MA 4ZQGA 5FTKA 3TRKA 5BWLA 5CM8B 5KYYA 1NR7A 1I7LA 2D7CA 3EZ6A 3PNQA 3RO7A 3QEKA 2L17A 2NQ2C 1AHNA 2HA6A 3VH3A 4LY3A 4MVJH 1QYVA 3ADDA 4X20A 1U7UA 3ETNA 4E5KA 4MQEA 3GRUA 5EYPB 1QP8A 1S2GA 2JCBA 5ECWA 5JYBA 1AE1A 2FOLA 3OM9A 3I62A 1AOXA 4IJVA 4R5MA 2HJSA 2VLIA 5K8IA 1DAEA 1JA0A 3MVEA 1ULAA 3ELBA 3WWPA 2B78A 3MTDA 1U3TA 4G4JA 5CK5A 1YCFA 4TYWA 1B41A 1HV8A 3R6WA 4V0QA 1MHTA 1EZ4A 3WLJA 4PS0A 3HRKA 4ZI7A 3W4IA 2Q9BA 4G81A 3VQTA 4CIAA 2QVZX 1V5WA 5GGXA 2A14A 1XN4A 3VH2A 4KVFA 4KDEA 2EJCA 3FRHA 3O75A 3JQAB 2IZ0A 1NBIA 2Y67A 3TCNA 4ENUA 1P1HA 3QUSA 4N48A 2WUEA 1JSLA 2E55A 2IE8A 1D4ZA 1BE8A 3HLKA 1QANA 3R23A 1OBVA 4KQ2A 2OGUA 3H1PA 1UQUA 4QTXA 3AB8A 2B8WA 3B85A 4P7JA 1Y1KE 2IELA 4F2DA 5BNZA 2FZKA 3NATA 1ST2A 4BZWA 4PIPA 4D8YA 1QHIA 2FK7A 5E6UA 4CQJA 1J9GA 2E4ZA 2R6FA 4TTVA 1HYQA 2IU0A 3ZTWA 1CUVA 1NUHA 1XGKA 1Y4ZA 2FFQA 2J85A 3KLMX 4ER5A 2NIPA 3WLAA 2XMPA 3ZY6A 2C88A 5LL6P 2Z58A 3KB8A 4PYLA 4F11A 4EB3A 3UV6A 2RHBA 3KELA 4DJTA 3R8CA 4YNBA 2OAEA 4KYUA 5KDDA 2LWIA 2ZBEA 4YS6A 4IOMA 1UFKA 4N1AA 1NX9A 1VIAA 3IKJA 1SC4A 2IIVA 3T9DA 3WTCA 1V8PA 4OXYA 3EG5A 1Z62A 3ZV3A 4UM9B 2B2NA 5G3ZA 2J5RA 1AZTA 2ZBRA 2XBUA 2DX7A 3NHMA 4LY6A 3EIWA 2C57A 4D4KA 2X7HA 1WU7A 4C5CA 3UKOA 4AG6A 1HE8B 3ASVA 3B7GA 2FYTA 3A1EA 2AN1A 2VJKA 2WKSA 1M10A 4B75A 4F1KA 3KL4A 4G4IA 1LPOA 5HEKA 9GPBA 4KQIA 3T3DA 4M38A 2I99A 1SQGA 3BILA 2RGCA 4B40A 3SPXA 1JQ3A 3H3FA 4LJKA 4EI2A 3MF4A 2OEPA 4PXYA 5KYYB 2BHNA 5DGCA 4C7KA 4D0SA 3ZIDA 1JDSA 1YBMA 3AR8A 4D9NA 8ABPA 4IXMA 4YAFA 3KWMA 4XWTA 3IUYA 4D9BA 1IZ9A 4LOAA 1SY7A 4ZT7A 2YHAA 4A8TA 5IZCC 3MPOA 1Q0RA 3M1LA 1KC3A 3N8NA 2ODQA 3PPWA 1FYVA 4M3NA 1EXWA 1YJBA 5KDLA 1XT6A 5K4GA 2JGRA 4CQMB 3JD2A 3X0DA 3DFKA 4JJGA 5BYAA 4U7JA 3Q7IA 2CV0A 1UAYA 4YECA 5KJ6A 5T4FA 5ESXA 1E2EA 1BW9B 1S2IA 2ZJZA 4P38A 3VR5D 1SUSA 2BJWA 2V5VA 3CKMA 3H65A 3NBQA 3QU5A 2JDID 2PVCA 4K9LA 3EFOA 1QF7A 3LYUA 5KKAA 2BW0A 1G3RA 1RM3A 2GEKA 2F8TA 2J5XA 1I7SB 4QUGA 3USZA 3IP8A 3JALB 1MCZA 1S3FA 5B3KA 2QRKA 1M6VA 5SZJA 1GL7A 4RIGA 4U5QA 2R25B 5NULA 5A4MS 4KWEA 5TJHA 3AG6A 3L0YA 5BQ5A 1QKKA 3FSGD 1J2EA 5KQLA 2V6FA 4L0MA 3L7AA 2XLBA 4Q6WA 4BGUA 1CR4A 4FLMA 2IEGA 3V2GA 1R1DA 1NUUA 3QIVA 5DZSA 1P4SA 4EA6A 1YKFA 5KAMA 1NYTA 2HRQA 2N46A 4OU4A 4EWLA 1JFVA 1VL2A 3DVAA 2XVXA 3IKVA 1DE0A 3HKDA 2BBTA 5AI5A 1Z2PX 4IMIB 5IJAA 3W9UA 4XVCA 5GPBA 4UVIA 5JJLA 1KZYC 5DM4A 4BKOA 3P7MA 1A8PA 1L4BA 3LO5A 4YJGA 4R7ZA 4KAJA 4OI0A 2EJBA 4HMOA 3EMKA 5JVDA 3SIPA 3MPUA 3PC2A 3HP4A 2WYWA 1BN6A 4HWPA 3HA5A 4IQ4A 4Q02A 4EYGA 1KH1A 5BW8A 1EE1A 4HPJB 1QGYA 2G8LA 2YZGA 3HV2A 2IQIA 1MF7A 2PLRA 2IY9A 2R00A 3LDGA 1D8AA 2ZVDA 4WEOA 5F1YA 1WZNA 1QXSA 1U2GC 1HYBA 2CEAA 5BVGB 2X14A 1F2UA 1LDNA 1FK8A 4LOLA 1BQ3A 1ONPA 3PCXA 3TSOA 3A25A 3WO1A 1DJQA 2VPZA 5A6SA 2HL6A 2CFCA 2IX9A 5HTOA 3W6NA 3I92A 4D9IA 3GEIA 4Z0NA 1COWA 2FMHA 1R6VA 2HWWA 2PGAA 1SEPA 2W70A 2Q6KA 3JVIA 1M0WA 3I37X 1VGRA 2P68A 4COKA 1MC5A 1MOZA 1Z4PX 3OEYA 4KIWA 5ITZB 5B1DA 4QPJC 3V8BA 4FSHA 2ZSEA 1CEYA 1EAMA 4JLOA 4RH1A 2J08A 2PLFA 1N1GA 4MYRA 3LW8A 1RLIA 3UG6A 4BTEA 4GAEA 3NVKI 4UNPA 1OLSA 5TEVA 1EG2A 4RE5A 1UDXA 1SBIA 1VPLA 3AF2A 4L2IB 2JFWA 4WNAB 2BBSA 4K9KA 3S7ZA 3TVTA 2H3HA 4Y8VA 4KPFC 3ZWYA 4TYQA 5D1NA 3X1XA 1JSRA 2ANCA 1C1XB 2XDQB 4AY6A 2D7JA 4KZPA 2W2OA 4AJ1A 3OZSA 1KJIA 3R3UA 3CF4A 2W0MA 3GAMA 3PVSA 1FFXB 3VC3A 4LFBB 2BZ0A 2GETA 5JYEA 3E5NA 2QR3A 1I6WA 5FTWA 1AGRA 4FFVA 5CLGA 4BWVA 1G3MA 5I7WA 1SXQA 4CFSA 4OJKA 2HXYA 2SKEA 1QE0A 2QORA 2I7DA 3E27A 3RYIB 4DEXA 1HTWA 3JWEA 3U40A 5K0ZA 3ES9A 3SJAA 4DR1B 3CJQA 1VZ2A 1QGED 1Z6QA 4FKBA 1PV4A 4D6PA 2ZYHA 1QIHA 3ZS9A 2HQSA 3WHLA 1JH8A 1GTJ1 3RSHA 2JFGA 4ZYTA 2WVHA 3ITDA 1GSHA 2O48X 2XVYA 2H1OA 3ORQA 4FOPA 1QTRA 3N53A 2GZHA 4PLFA 3I5YA 3ORFA 3N2ZB 1K7CA 2IYRA 3ZU2A 5HOQA 1VE6A 3ON5A 3GCDA 3GLIB 4ZVQA 4G36A 4ND7A 5H16A 5E4FA 1R5JA 1FFGA 1E9VA 1V3TA 3W90A 4ZGGA 2UVPB 4AJEA 4M4SA 3FOEC 1AF7A 1HORA 1J9ZA 3KWJA 4RPGA 4DA7A 2FMTA 1K2VN 3EPPA 2JBAB 3D4PA 3PC8C 2NACA 3K1YA 4RSRA 4C0JA 1TLLA 2MU1A 2NZUG 1K6MA 1P0CA 2M2IA 2H1FA 4HYQA 2ZAMA 4OUDA 4CMKA 1XAHA 3CS3A 3GOQA 4Q1DA 1QLHA 4IDDA 3H17A 4PZZA 3UEOA 5BY2A 5JQGF 2RI1A 4INJA 1E2UA 2AVDA 2WF8A 5EN4A 4E5MA 4QT0A 3E9NA 3I0ZA 1LVGA 1KK1A 4XE5A 4TT8A 5F52A 1LZKA 4R81A 3OJCA 5ILQA 1KS9A 1NJ6A 1PR6A 4MUAA 4RORA 2ENUA 4AZTA 3NHYA 1JYEA 4BCCA 4XUGB 4PYRA 4BMCA 5E9WA 3G9TA 4EKNB 4NDZA 4A1FA 2HK9A 2IITA 2YWXA 4I55F 3N3BC 3THXA 1VLJA 3PUJA 1E7WA 1WMAA 3CYFA 4MYCA 5LU9A 3K9BA 5E2AA 3B36A 4DMRA 4GX1A 3Q8MA 1MEJA 1AHIA 1SUCA 1H5QA 2E48A 4BNFA 3CNHA 3EFHA 4JX9A 3TQQA 3OEHD 5BMOA 3RRYA 2XKJE 4PG8A 2WA1A 3AESA 1WLYA 1ZNQO 4UDNA 1C9MA 1CNEA 1VMEA 2ILTA 2A5GA 4M2LA 3T12A 4GPZA 4JUBA 2YVUA 3M6FA 1MO3A 3VU0A 5KOIA 4DXDA 5A62A 1X92A 3D6VA 4PCUA 3BRQA 2F1HA 3H0KA 2LIPA 1RZRD 2FWJA 2W2QA 5EIXA 1AUOA 1TC2A 3OOHA 2BP7A 3G5LA 3QFSA 2W6JA 2J3MA 1NUPA 3RW9A 5KAPA 1U6JA 5EJ9A 1N7GA 2X1VA 3OMWA 4QEDA 3QOFA 3QUCA 4QXRA 1BH6A 2Q8QA 5JANA 4P4LA 4NRDA 1U1GA 2QLLA 2GLTA 3QTBA 3T3PB 4EPXA 1OAAA 1PWHA 4JL8A 4CR7A 2O0MA 2ZIGA 3HB7A 3O74A 1GRRA 1RAAA 4L08A 4QRHA 5K2MA 3ZQKA 2AWOA 1QRAA 3PR3A 1MC1A 4MJ3A 4AMUA 3BMOA 2OAQ1 3TNFA 3U7FB 2JA1A 3ZNNA 2CE2X 2WB4A 2DQZA 1KEEA 5C8YB 2D3WA 5IKMA 3E22B 1OWOA 1NM5A 4GT1A 5D01A 4B3FX 2HWXA 1TZCA 3FNBA 3AXTA 4BCDA 4P82A 4RQTA 3JR3A 5GJCA 2HU8A 5KX5B 1FSGA 2ID7A 4QJ3A 4DNOA 3AEKB 1X1DA 4BL5A 3UAOA 3PFWO 1PD1A 3WXBA 1I5OA 1M2OB 3BQ9A 4L8GA 1WBDA 4IHKA 4Z54A 1LI4A 2C3PA 3GDGA 3LOQA 1A69A 3O26A 1ZINA 4OAOA 1E0DA 1SXJC 2ZT5A 4YP9A 4DLVA 4BS9A 1LSJA 2J33A 1QUFA 4PIMA 4C14A 1OU0A 1UKBA 4CNBA 1T35A 2QZ4A 3IESA 5LWQA 3LWNA 3G3EA 1Q3TA 3ZWAA 3FYTA 4HRYA 4I5GA 1Q1GA 1UM9A 1RAGA 2DYKA 3KJGA 4RYLA 4UZSA 1R6DA 3RC3A 2O8DA 1O0SA 4LKRA 1TU3A 1NE7A 5JHGB 5CU7A 2ACVA 2Z1NA 4QOHA 3KQUA 3QKIA 1KEUA 1W52X 3ZXSA 1NQTA 3D43A 3E05A 1D2CA 1ODSA 3I1FA 4NV0A 2Y1DA 1DCFA 4YH1A 3E2PA 1FZTA 1X80B 3G2PA 4MUHA 4BMPB 1PG0A 1T15A 3WP1B 4YAKA 1E7QA 2I4RA 3NKFA 3UWKA 3PYLA 3V80A 1MO4A 4LRTB 4YDSA 4L4RA 3FVRA 4QAQA 2XCOA 1S8NA 4X92A 4EUNA 1M2OA 3GRPA 4RETA 1JHVA 1Z63A 1JDTA 1NJ2A 3FPEA 4RH0A 5IJ0B 3NLLA 2ZE6A 2IW1A 1GN9A 3JSAA 1XTZA 5JXGA 3NPMA 2O2HA 3JAWA 1SBNE 1SQSA 1WW2A 3OU6A 1W4AA 4ZVOA 3CR3C 2NW6A 5IDWA 1XAGA 1WU8A 1RSZA 3C6MA 1UFVA 3O5AA 4PHGA 2I65A 1K6IA 1VIYA 2WM9B 4GYKA 3UHFA 1H6CA 4AG5A 1Y9DA 5K9ZA 1T9GS 4QBTA 5LQAA 2OBFA 3FTCA 3P4UA 2PUDA 2JHGA 1NNEA 3WKBA 4BZZA 3U6KA 1ECJA 2B8TA 2I4IA 1M2EA 5T8KC 2QNIA 1MV8A 1L5VA 2P2NA 3GT3A 1J6UA 2I2WA 2AW5A 2WJWA 1X1CA 2AFHB 2Z04A 3FNRA 4V0NA 2A67A 3X1WA 4HB2A 5L6MB 4IQGA 4PLVA 4H18A 3VU9B 2WU1A 2HLNA 2YZMA 1SQ0A 3P45A 3RRNA 3T41A 4FWIB 1QZ3A 5F4ZA 3H2IA 2QTCA 4E2ZA 3ZXIA 3KG2A 2C7PA 3P4YA 4H17A 1OZAA 4Q6BA 3THSA 4B3GA 1JAHA 3H9EO 3H2SA 1Z2NX 2BZ1A 4MRAA 2JIMA 1RP7A 3UAZA 4QQ8A 2HQOA 3EARA 2ZUEA 3FDJA 4C4XA 1D1TA 1EKXA 1YS2X 4EATA 1KZ7B 2VDVE 2WKRA 1C9EA 3LCUA 5FNZA 5A7FA 1KMHB 3I5XA 1IXRC 4XJXA 3T34A 1NG9A 3K2QA 3B51X 3BTUA 2V3CC 2FPGB 1BGWA 1IB6A 3AF6A 5H3CA 2BKXA 4DG9A 3E1GA 4M7WA 2I2FA 4MV1A 3SFTA 2VA9A 1T4MA 3E4CA 3H7AA 3L4BC 3N86A 4G85A 2BVNA 2C0CA 1OZHA 5PGMA 3I9NA 1L4NA 1GUYA 2Y9MB 3MBOA 2BFOA 4ZVTA 2K87A 2PS1A 4Z7OB 4PSVA 3DBRB 1IU9A 2D5AA 4FQ8A 4HDOB 2FPIA 3AILA 4JJZA 2QZJA 4TLAA 3R5SA 2OHOA 1KYZA 1LDGA 5CCBA 3CF4G 1FJGB 1DB3A 5GVRA 2C9CA 4Q3CA 5J5CA 1MJFA 2NYUA 4G2TA 5DLYA 4QOGA 4B4KA 4B81A 2C2HA 2R2GA 3T7JA 5F9HA 2O3JA 1B0ZA 3QUQA 2IZ6A 4FQ5A 1GJRA 1G8SA 4JA0A 1HMYA 3RHTA 3IPLA 5CEJA 2P79A 2WPDA 4J4BA 3OEEA 3P9PA 2JHAA 3KOMA 2ZWIA 1XTIA 2P65A 2H2AA 3F8SA 4GF5A 5J58A 2O8BB 1AKMA 2E2WA 3PFCA 1EIZA 5AW0A 2C99A 2OMKA 3A8TA 1XXLA 2ORYA 4BMOB 3BCHA 1G7SA 3GD7A 3LK6A 1QG0A 4KLCA 4OK3A 4WBXC 2FN9A 2QTTA 3CZCA 5BR7A 1YB2A 1XP8A 4PC1A 2CY0A 4TTPA 3DL0A 4MS3A 3G13A 4M9ZA 3K0CA 5BWBA 4EKDA 1LC3A 2CNBA 1N5IA 2QR2A 3AINA 3JQ9C 3D3NA 4OH1A 1EBBA 1RI3A 1WL8A 3GVIA 3KXKA 1WXIA 3V42A 2CJPA 4OLAA 1G9TA 3K0AB 1LSSA 1F4PA 1UJCA 2YWGA 3COWA 1U81A 2DWQA 3NEYA 4ZO9A 1JQDA 5IFKA 4RVUA 4MRMB 2O2XA 3SZLA 3FTEA 2I3BA 1E1CB 3FB1A 1E9SA 1ECLA 1EFCA 3ZNQA 2P11A 3K2BA 1I30A 2IPMA 1I2ZA 3EZ9A 4IXDA 4TSFA 3T6KA 3U60B 3TZ6A 1SVOA 3PJFA 1LNQA 3FUTA 3AVQA 3CONA 1BFDA 1YA8A 3BIXA 5EWLB 1IM5A 3GUZA 3VBCA 2H1RA 4UCQA 3EOZA 1RQNA 1EVLA 2D1YA 1L5ZA 2E5FA 5ERYA 2D00A 1BD4A 2NUTA 3AHIA 4FDMA 1TYZA 5DWQA 3V00A 2O50A 1IHPA 3I3OA 2FAXA 3CXRA 1CRWG 1TA0A 4A6PA 5DIFA 1M6YA 3VO8A 3UTDA 2JLXA 1G8KA 1F06A 1SUFA 2Z9DA 5ICFA 3ANYB 5IX8A 2RK6A 3UXEA 4D4LA 5LQCA 4HAVA 5KSWB 3L7OA 4JOBA 1TFUA 4CIBA 2A88A 3VYSB 1R0LA 3GG2A 4LWZA 5FPQA 1UBTS 1FSZA 2BUCA 3ZW7A 1LDYA 1IBLB 2QT9A 2WJ6A 4G0PA 2X5KO 1GRQA 1XV5A 2W00A 3PJEA 1MJGA 3AM5A 5P21A 4BCBA 4Z1MD 4KAFA 5CXXA 5D3MB 1A97A 2R4UA 1O0BA 3FFBA 3R5KA 4IGAA 1ZJYA 1JG4A 1J23A 4NPHA 5CGQB 1RRGA 3W34A 1EBFA 1SZJG 2C5EA 3LBFA 2IWRA 1FS5A 3FE2A 1F3OA 4J1TA 4UQPA 1T36A 4LMAA 4DIMA 2Y0CA 5IXJA 4GP7A 3KHSA 2IIQA 1GSOA 3IGFA 2I66A 4BHTA 2AEJA 4RKQA 1VZ3A 1JLLB 3GGPA 2CK3A 1CTQA 1Y8CA 3OM8A 3HJCA 2PU5A 5EIHA 4CF6A 1JSXA 4DF3A 2VBGA 5BWCA 3HU1A 1FU4A 1ZRMA 3ADPA 3QLTA 3MC1A 1CWUA 5HGXA 2W2MA 4O2RA 1D1QA 3TFOA 1GGKA 1H93A 4QBIA 1LQTA 2PMBA 2XT0A 3FWZA 2Q2OA 4BFXA 1PQPA 4R1NA 2A0XA 4J2TA 1UT8A 2HBZA 2ECPA 2Q2QA 4E08A 3I9V1 4U8HA 1OIXA 3FGNA 4HRVA 4M8NE 1A7AA 4WXEA 1FU7A 1SVMA 4DWVA 2XUOA 1H2ZA 2REXB 4EUEA 3AVVA 4DQKA 1AT1A 1P9LA 1PU2A 1UZAA 2POCA 3OJLA 5AKIA 4BUJA 3RU3A 4F45A 2FE4A 2FWBA 5FOWA 2VP3A 4AMGA 4AQ7A 4H31A 1XP5A 1DWUA 5A4AA 4X1YA 4EMTA 3NBUA 1BVRA 1PT6A 4EGSA 3DEJA 2CDCA 3T06B 2K7ZA 1MRNA 4RTOA 3R3JA 3F3YA 1KAEA 5F1OA 1MG5A 4ZVVA 3GP3A 3MXOA 4R9SA 3CW8X 3P2IA 4P9NA 2P8SA 4GH5A 1BH2A 4LK2A 1RMTA 4UAUA 5E4TA 1HE5A 5IVKA 1H23A 3JVDA 2GARA 3HYRA 2WMNB 4JOQA 4BYMA 4CMHA 2DERA 2YDXA 4K5QA 5JSZB 4DR6B 1QVVA 2A1TS 2GA8A 1Z25A 3ABQB 4V0LA 4OK5A 4KGDA 1CVIA 1G6HA 4O02B 3ZZMA 3NORA 1RJWA 4ZMBA 2FCRA 2IOHA 2BELA 4NDAA 1ODJA 4P92A 2OBNA 4EJ2A 3U4HA 5KU7A 1FFHA 4F3YA 1H5UA 3LKVA 2B4QA 5EY5B 4B4OA 3THRA 2EEPA 3A14A 3IEPA 4WPGA 3G23A 2OSVA 3R7AA 3AKCA 5CDTA 2X3FA 4UEJA 3IO3A 1UWKA 4WVLA 3PEYA 1V9CA 3ZDXB 1P73A 3CF6R 7GPBA 3GJRA 1U28A 3FHTA 1CYDA 3OZRA 1H8HD 4FFMA 3WADA 1FXUA 3C3AA 1KXJA 3PENA 4DB2A 4ALJA 3MCVA 2RC6A 2YL2A 4MCJA 2ZJOA 3NC1C 3DMYA 3OZEA 3TLMA 2JJYA 1X14A 1NVVQ 3ND8A 3ZZ1A 2WVGA 4L0DA 1DG9A 1E58A 2QLJA 1KERA 5FTNA 1SXJE 3A6PC 4NOKA 2ZCJA 2PZ8A 5FBWB 3L18A 1PKXA 2D1TA 4DKJA 4YRIA 6REQA 3HRIA 5AICA 5AXCA 2Y1FA 4Y6LA 3W6UA 2UYHA 3QKSB 4RYDA 2C9YA 2ZTHA 3QLVC 2V5UA 1E6MA 2CVQA 1WW3A 4I9GA 1E5DA 2R11A 4XGNA 4OJYA 1YZUA 4E3WA 1ZJ5A 3R0VA 2OG2A 1TKRA 4FGWA 3FTNA 4MWEA 1W1WA 1GGEA 4ZV7A 3S2UA 9LDTA 1N2CA 4PR3A 3DPIA 1O87A 1OCEA 3IXMA 2ZR9A 3EGVA 4Q1BA 1XR3A 4P0QB 1NKVA 3DF9A 3FFXA 1WTCA 3W8EA 1G18A 3CCBA 1CB7A 1T8TA 1X7DA 2BY4A 3QE3A 5F7ZA 3KEOA 4ITRC 3TD2A 1AA6A 3DMTA 4N4AA 1XPUA 1G20E 5G41A 4MS3B 4S2UA 1SA0A 4MOWA 3U09A 3D6NB 4LC1A 3OF3A 4IHJF 4OV6B 3SJ7A 2Z6UA 1EUYA 4XFJA 2P69A 2VZ0A 4M1ZA 2GFIA 1UWLA 2WTNA 2BSQA 1PFUA 4LXYA 4N54A 1J0BA 3MM4A 1OFVA 3E1SA 3O73A 5HQ3B 5E6RB 4GM4A 2QUKA 5IK2A 1KJNA 1NKSA 4A4DA 3F5DA 3FBGA 1GYQA 4LN1A 3UPDA 4KPGA 2PX0A 4QYTA 4ZMSA 2RG7A 1OFUA 2HCFA 2F43B 1G21E 2MSLA 3L7IA 4MQFB 2IV2X 3RV3A 1U0TA 1NOIA 1BRMA 1EK5A 3S2FA 5DSTA 3ZCXA 3GC6A 1RJFA 4ODIA 3L5KA 1R0CA 4KXUA 4OGLA 1JNYA 3C5VA 4HNSA 3ZWOA 4B3SB 2CFTA 1W0KA 4P32A 2HMVA 5DGTA 4LXGA 5FQOA 1L4KA 2B1IA 2Y27A 2V1XA 2MTBA 5B1IA 4MQEB 1LB1B 4NBRA 3X1MA 4KR3A 3GN1A 4IMRA 2ET6A 2AZMA 1FYDA 2B2XA 2SCUB 2BFPA 4OQPA 4RF2A 5I9TA 5F12A 3F67A 2B36A 5BW4A 1JR3E 2PMWB 4ZZ2A 3WLOA 4Z4CA 1O94D 5CFNA 4N6NA 1H0HA 4X54A 2F9FA 1DQYA 3R5JA 4B8ZA 2BRUA 3UJDA 2VF5X 3H6HA 1QIEA 2H2DA 4M9UA 1DQSA 1SK9A 3V34A 4K40A 3B1KA 2OUKA 3DLBA 5EIAA 5A9TA 3RVMA 2P75A 3QVWA 1PJBA 4QU9A 4RM3A 4F04A 4AO7A 3W78A 4D2IA 3GJSA 1GZ6A 5EP1A 1BHSA 4UBLA 1LRLA 4UXHA 4KDRA 4EJMA 3W2IA 4EY5A 3VSBA 2H2FA 3PI6A 5K2OA 2OHIA 5ISMA 1Z4IA 2ORVA 3BCSA 4N5LA 2NG1A 3P96A 4GC5A 4EOGA 3UYLA 3CIFA 1CJTC 5HDBB 3ZVLA 1BS1A 3BPSA 5JMOA 2BJHA 1HDEA 2PL9A 5EERA 1E69A 1FFCA 4RHEA 4DZRA 3CRRA 1XIVA 1ODIA 4CXMA 4Z51A 1P33A 1Q0SA 4MI3A 5BT8A 1LXCA 4AIRA 4EYSA 1PL6A 2XSZD 4JBNA 4JWTA 4H0FA 4OK6A 1PLKA 2YY6A 2XCQA 3LWBA 2V0GA 3QLUA 3OCJA 4C2TA 4JB0A 1W25A