5K09A

Crystal structure of comt in complex with a thiazole ligand
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
217
structure length
217
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Design of Potent and Druglike Nonphenolic Inhibitors for Catechol O-Methyltransferase Derived from a Fragment Screening Approach Targeting the S-Adenosyl-l-methionine Pocket.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 73
structure length 217
sequence length 217
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k09A00
2O05A 1BC5A 4Z2YA 1RJFA 3TR6A 1TPYA 5EPEA 3OU6A 4CTJA 4DMGA 3P97A 1R8XA 2ESRA 4MTLA 4QPNA 5E1DA 3RIEA 2EFJA 4EQZA 2B25A 2PXCA 5EGSA 3UJBA 3VC2A 4C04A 5K0BA 2BM8A 2QM3A 5EMLA 4QDKA 3FPJA 3QV2A 5EC8A 5LQNA 2ZIFA 2UZ4A 2PSSA 3BZBA 3R0QA 5CUQA 2IIPA 5D1HA 5CIYA 1JG1A 3AXTA 3FUVA 2IPXA 3OCJA 4PGGA 1IXKA 5DX0A 4R8RA 5DT2A 3UJ8A 5MHTA 2CWWA 3NMUF 2ZVJA 2NXNA 3MHTA 4ER7A 9MHTA 1B42A 4FT4A 3P2EA 3SSMA 3PVCA 4CWAA 3O4FA 3HVJA 5DXJA 1N7JA 3EEOA 4PGHA 1ORIA 3KQVA 3EVBA 3KR9A 3M6WA 3U81A 3NWEA 2GAFA 3FUXA 2YXDA 3G89A 4OQEA 2KW5A 3GU3A 2PXAA 4K6MA 4P7JA 2YR0A 3FZGA 3JWIA 4R8SA 3H2BA 4RX1A 2G70A 3MCZA 5CVJA 2OY0A 4PIPA 3DMGA 4BLUA 3GDHA 4V0QA 1NW3A 2V7EA 2P35A 3EMBA 3G5LA 3HNRA 4PINA 5DM1A 5FQOA 1JR4A 7MHTA 3FTFA 3KPWA 3LDFA 3FRIA 2AOXA 5FWAA 3ERCA 1EG2A 4MWZA 3EEYA 1N2XA 1WG8A 2B3TA 1ZGJA 5FHRA 4BLVA 8MHTA 2UYHA 3PLAE 4HTFB 2QYOA 3HCEA 3LX6A 3MB5A 1R6AA 2XYQA 4X63A 5CVDA 5E2BA 2OB1A 4LECA 1YZ3A 2H1RA 1R18A 3DH0A 3A7DA 5ICFA 3LDUA 5M5BA 4EKIA 2VDVE 3E8SA 2XVMA 3GRZA 4KDCA 5T67A 3G5TA 3CJRA 4AUKA 1X1CA 3EGIA 1KPHA 3PX2A 5EQJB 4YUZA 4ZTBA 4RTKA 1G55A 3CJTA 1BOOA 3BKWA 5EHIA 2R6ZA 2AS0A 5DTMA 4BP1A 4POOA 4EMSA 3OFJA 3NJRA 3HCAA 3HVIA 1NW8A 3P9KA 3TM4A 3P2KA 4EVIA 3A27A 3I53A 1N7IA 1X1DA 5K0JA 4KRGA 1SG9A 5LQUA 1FBNA 4OA8A 3EVEA 5EIWA 2AN3A 2YXLA 3M70A 5EZQA 5LQKA 3T7TA 1QAOA 2OBFA 3GIWA 2YX1A 4GF5A 5LQJA 5KS2A 2PT9A 4XUCA 1WXXA 3BT7A 1BKYA 5BXYA 1XDUA 1P1BA 3TPZA 1Q0TA 3HP7A 4PYIA 1FPQA 2HV9A 3BXOA 2GB4A 4QVGA 2C7PA 3M6XA 2XYRA 4HH4A 4CKEA 4YUXA 5HIKA 1O9GA 3ANXA 4CKBA 4QTTB 2AOUA 3DOUA 4IV8A 2CL5A 4QDJA 4V0RA 2V74B 3LGAA 5EHGA 1XTPA 3DULA 2GS9A 2NXCA 2YQZA 2ZSUA 4MQ4A 5EZSA 2Z6AA 2P8JA 3KKZA 2ZW9A 4JXJA 2C7QA 3OU7A 3KU1A 5EEGA 3NWBA 4FSDA 4PYKA 1L3CA 2FK7A 4ISCA 5FULA 1ZQ9A 2DPMA 1G38A 2IP2A 1KYZA 4GC9A 1XVAA 3E23A 3C6MA 1UFKA 2QE6A 1QANA 3HA5A 1I9GA 1R74A 3EVAA 3FPGA 3KQWA 3P9IA 4OQDA 3UBTA 5E9WA 5KYGA 3GO4A 4WVLA 5JUWA 5GWXA 2PY6A 2VDWA 2IDJA 3VYWA 4KIGA 4M36A 5EKUA 4GBED 4F86A 5EMMA 3MQ2A 3B5IA 3VSEA 2OKCA 1TW3A 4KW7A 1NW7A 1JQEA 3THRA 2Z6UA 1XDZA 4PWYA 4PYOA 1D2GA 5BW5A 5LQCA 3ELYA 2ORED 1XJ5A 4XUEA 5H02A 2HNKA 4E2ZA 3CC8A 1JQDA 4BY9E 5ICEA 1INLA 4YV2A 2P7HA 2BR4A 3UZUA 3G8BA 3KPJA 1DCTA 4RVFA 2O06A 1SUIA 1JSXA 2NXEA 5FA8A 2PBFA 4PONA 1KHHA 3FYDA 5EOVA 3CCFA 2P3OA 3FTDA 4DM3A 1F38A 2P3LA 2XYVA 3DXXA 4H0NA 5GIPE 4DA4A 3AWIA 2PV0A 3M6VA 3PX3A 4RTOA 4DKJA 3EVFA 3A26A 3R24A 1ORHA 3EGVA 3F4KA 1KR5A 2AVDA 2ZBPA 2ZBRA 1JTFA 4AZTA 5LR6A 3CVOA 3KQQA 5BW4A 4C06A 3UJDA 3KR0A 1DL5A 4GQBA 4EKGA 4F85A 3DTNA 1VQ1A 3T7SA 3PFGA 5DRTA 3VC1A 1JG4A 1TW2A 5GP1A 2B78A 2Z6QA 2G8NA 1G8AA 5LQRA 2B2CA 2OO3A 1X1AA 4RYLA 3MTEA 3I5UA 3LKDA 5DLYA 2E5WA 3KR2A 3P8ZA 5G02A 3TFWA 2FHPA 1YF3A 1RI2A 3WSTA 1EIZA 2YUIA 4ER5A 4RTQA 1P39A 5HFJA 2I6GA 5U4XA 4HTFA 3OPNA 2ZZKA 2VP3A 3Q7EA 1NW5A 4E2WA 3ER9A 5E2AA 3OE5A 2P7IA 1YB2A 2Y1XA 2PWPA 3HVKA 3GCZA 3EVZA 3HA3A 3MCTA 3PT9A 3R6TA 5DM4A 5IKMA 5K0FA 4PYQA 5K0EA 1I4WA 2GPYA 5C1IA 3KQOA 5K05A 10MHA 2XBMA 2EX4A 2JHAA 5K01A 4E2XA 3V8VA 3SM3A 5E1OA 5FADA 3B3FA 1JTEA 2PWYA 3ELWA 2AOVA 2O0LA 3DUWA 1AF7A 3EVCA 1MJFA 3GRUA 3MGGA 5P8WA 3SSNA 4ER6A 3HM2A 4BLWA 1QYRA 5KQSA 3LL7A 4KIFA 4RTNA 1VP9A 1YUBA 3LPMA 3UJ7A 4LWOA 5ICCA 5DX1A 3UA3A 2IH2A 2OB2A 3AXSA 4YMGA 2GH1A 2ZBQA 3O7WA 5JR3A 2H00A 3SSOA 2ZTHA 3FUTA 2PX5A 2YXEA 3NVMB 3OFKA 4RVGA 1NV9A 1O54A 3FTCA 2QRVB 2OZVA 3KPUA 3S68A 3DR5A 2OPBA 4B17A 1P91A 1P1CA 3OE4A 3BWYA 3K0BA 4FT2A 4HRAA 3B3GA 3FYCA 1O9HA 2VZ9A 1R00A 5F2OA 4DZRA 4ER3A 3LHDA 4RTSA 1NBIA 4RTLA 2HR1A 3THSA 4C05A 3M33A 5CVVA 4PIMA 5DTRA 4E2YA 2NP7A 5E8RA 1ZKDA 4L7VA 3CGGA 4AZSA 5DX8A 3FTEA 3M4XA 3MERA 4YUVA 1F3LA 4CKCA 4HSGA 1RI3A 2NXJA 1U2ZA 4P7GA 3UFBA 1JG3A 2YVLA 3PTAA 4F84A 2CKDA 2ONZA 4RTMA 1QAMA 1L3BA 2AN5A 2PVCA 4U7TB 5FTWA 2EJTA 5HOQA 1NE2A 4ER0A 4G56A 3C6KA 1WS6A 2UYQA 3DP7A 2PKWA 1M0EA 4FS8A 4C4AA 5K03A 3B89A 3O31A 2ZZNA 2JH8A 3A25A 2QY6A 3BWCA 3OZRA 5T6BA 5LQAA 5CCBA 4OX9Y 3KQYA 3QOXA 5FA5A 4RTJA 5KQRA 3JWJA 2P1DA 3I58A 4RVHA 1T43A 2PX2A 4NECA 5GM1A 2P3QA 5BP7A 1XCJA 3IHTA 2PXXA 3X0DA 3TKAA 3BGDA 3NDJA 4RSRA 3PFHA 3P2IA 3JWHA 1R8YA 2ZWAA 1WZNA 3HCCA 3RODA 1NW6A 4CTKA 4UOEA 2ZFUA 3OZSA 1G6Q1 3G8AA 2CMGA 4IV0A 4HG2A 1L1EA 4QVKA 1JG2A 2I62A 1EJ6A 3FPEA 3KQTA 4U7PB 3KQPA 2O07A 3KPYA 5EKXA 2UYOA 3M6UA 1VPTA 5EMKA 5K0LA 3ELUA 3LKZA 3TQSA 2EJUA 1RJGA 1H1DA 3HEMA 4R05A 4AZVA 1G8SA 5DSXA 2DULA 5B1SA 2FPOA 4DCMA 5GINE 4X60A 2Y1WA 4YV1A 1KXZA 3L8DA 3ELDA 1I1NA 4KDRA 3EMDA 4PCAA 1AQIA 2GLUA 2WA1A 4E32A 4OBWA 2AOWA 5FUBA 2IFTA 4O29A 5CVUA 4M37A 1FP1D 1X1BA 2ZZMA 2PX8A 3HA7A 3T7RA 3PS9A 2ONYA 4AX8A 3A4TA 2IH4A 3EGEA 4PYLA 4Y2HA 1ZG3A 3BGVA 2CMHA 3GRRA 3LBFA 4WXHA 5GIOE 1AQJA 4RWZA 1RI1A 2A14A 1V39A 3ME5A 3NTVA 5E8JA 2FYTA 1JSZA 3LCVB 5F2KA 5HILA 5EVJA 1EQAA 2AOUB 4GOND 3FPFA 4RVDA 4E70A 2I7CA 2LD4A 3GRVA 5HZMA 1QAQA 3IV6A 2P40A 4GOMD 2BR5A 1HMYA 3FRHA 5EG5A 3TKYA 4AZWA 1G60A 1VL5A 2C7OA 1KPIA 2AZTA 2BH2A 4XCXA 3UA4A 3BGIA 4RTRA 5D1NA 1KYWA 2AN4A 1M6YA 1QZZA 3FPHA 3LCUA 3GXOA 4X61A 3UJ6A 5LSAA 4HGYA 4E30A 2FRXA 3HVHA 5T64A 2QRVA 1KPGA 2XVAA 5K0NA 3ORHA 4GUAA 3UJCA 4DCGA 3FUWA 5C9ZA 2NYUA 5C0OE 1Q0SA 2ZIGA 3REOA 4PCLA 3LECA 3G2MA 1AV6A 2AVNA 3LCCA 4QPPA 2PJDA 2K4MA 3LDGA 1JQ3A 2F8LA 2EG5A 1BHJA 4PYNA 2IGTA 2HMYB 2JG3A 2AOTB 2ZLBA 5GOZA 2GA9A 3EVDA 1RI4A 3KHKA 4P58A 1XCLA 3DXZA 4Y30A 5CCXA 2NNWB 5E1MA 2AR0A 1WXWA 1VLMA 1YFLA 1M6EX 3TLJA 2PX4A 2IBTA 1WY7A 4HGZA 4IKPA 5DSTA 2R3SA 5ERGB 2N47A 5EMJA 4C03A 4CXMA 1VE3A 3DMHA 2JHPA 3KPVA 5HIIA 4MIKA 4FZVA 2WK1A 5DWQA 4FP9A 3BUSA 2IBSA 3OZTA 3D2LA 3NW9A 4XUDA 3EPPA 3KQSA 3LSTA 4QQNA 5EIFA 4IWNA 4QQKA 1ZGAA 3UWPA 4C08A 3QOWA 4YMHA 1MHTA 5FWDA 5EEHA 3SR4A 3DXYA 2C7RA 5DXAA 2FK8A 3CJQA 1EJ0A 3NDIA 1SUSA 2I9KA 1FJXA 5DTQA 3CBGA 3UJ9A 1NBHA 1SVUA 5CD1A 3B3JA 5DM2A 3CKKA 4KWCA 1Z3CA 2G72A 3BKXA 5E1BA 3C3PA 5CM2Z 3SVZA 3KR1A 3NVKI 2ZULA 4M38A 5DM0A 2HTEA 3B7PA 1IM8A 4E31A 2G71A 3GRYA 4DF3A 2PLWA 3BWBA 4YUWA 4GC5A 1FP2A 3HCBA 2NP6A 1VBFA 5FHQA 1VIDA 1NV8A 3G2QA 4GOOD 3GNLA 5E9QA 2H11A 4M7RA 1PJZA 4GEKA 2O57A 3Q87B 4LWPA 3MAGA 3GJYA 5DPMA 1RI5A 4OBXA 1SQFA 1HNNA 4FGZA 3ID6C 4HC4A 1NKVA 3DLIA 3UJAA 1L9KA 3MTIA 4FSXA 5K09A 2ZCJA 5FQNA 1L3IA 3E05A 3TOSA 3BWMA 3JWGA 1OR8A 1XDSA 4PYJA 2ADMA 4EK9A 2P41A 4P7FA 2VDUE 3IEIA 1D2HA 1DUSA 3LBYA 3KQMA 4X41A 3RW9A 2IDKA 5E9JA 1PRYA 2JJQA 1KP9A 2B9EA 2JHCA 3R9XB 3GGDA 1SKMA 4YV0A 5FCDA 1VP3A 2JH9A 2FCAA 1RJEA 1YZHA 3T0IA 1UWVA 1IY9A 3EVGA 3G2OA 4C07A 5K8VA 4LG1A 4X1OA 4RTPA 3A7EA 3HTXA 4QTUB 3TRKA 1NT2A 2BM9A 1Y8CA 4PYMA 3G88A 2OYRA 3TM5A 3IYLW 3AJDA 1SQGA 4OA5A 5HIMA 1EAMA 4E33A 2G1PA 1X19A 2ZIEA 2OXTA 2HWKA 2UYCA 2BR3A 2IH5A 4DQ0A 5HEKA 1RJDA 3DMFA 4FR0A 1YFJA 3AY0A 3G2PA 2WA2A 4RV9A 3SMQA 5K0CA 3P71T 5KVAA 3C0KA 3I64A 3SX0A 4KVZA 1XXLA 3PB3A 3SXJA 3HCDA 1ZHFA 3TMAA 4A6EA 4PNEA 4GOLD 5CVEA 2BZGA 5F2NA 3C3YA 3DLCA 3E7PA 4P7KA 2PGXA 1UIRA 1D2CA 2ERCA 3FUUA 1KIAA 3P9CA 4ATNA 4YUYA 4A6DA 2ZWVA 3G7UA 5ICGA 3SGLA 2YTZA 3V97A 5K0GA 2VS1A 3P9NA 4MHTA 2AOTA 5HIJA 5DRYA 2PT6A 3K6RA 5GM2A 2Q41A 5IH3A 3ER8A 4BP3A 3R3HA 3I9FA 4R6XA 3HCFA 3GWZA 3OU2A 4R6WA
chains in the Genus database with same CATH superfamily
1J90A 1X80B 1ZGZA 2BKUA 1RM5A 4UUNA 5IUJC 1MB9A 1N2CB 1TPYA 1ZN8A 3VR3D 4JEHA 4PBTA 2WILA 3U5TA 2Z08A 5DNYB 3FAZA 5LA6F 3O3CA 1U7TA 4QPNA 3KIPA 2YRFA 3UHPA 2QGNA 4OGWA 2ZXFA 4B4KA 1WUKS 3VC2A 4IILA 4KHZA 4IHAA 2YKGA 1B6GA 4Y2VA 3LYAA 4EF5A 3QLUC 5KC8A 5EA2A 2PSSA 4DQUA 4ARAA 2QEQA 3MWJA 4GKBA 2P78A 2F8SA 4E08A 4ND8A 1CETA 4J0FA 1WETA 2V6IA 2O1SA 2I54A 3PJGA 1KBZA 1NHGA 1Z5NA 3GJ5A 3GT0A 3NUZA 4LAFA 3LOQA 5BN5A 4BFUA 2H2GA 4RSGA 5EXSA 2QA5A 1N6RA 4HS9A 4MRMB 9LDBA 4A26A 4P84A 3PENA 3ZOZA 1G18A 2VJQA 3I05A 3RU3A 1QLWA 2O0HA 2KYRA 3O0TA 3ZDFA 4HX5A 1P5JA 1PEYA 4ACAA 1KSFX 1S3SA 2GFQA 4Z4GA 3WMXA 3G89A 1NF2A 1JQAA 1UBHS 1NLUA 1YI8A 3E8XA 1G6KA 3QVWA 3ZE0B 4IZ6A 1A82A 3FM9A 1Y6JA 2ID7A 5EZYA 4NH0A 1O96B 3NOXA 2W2OA 2VOJA 1Q7GA 2DKFA 2Q3HA 4G01B 1P6QA 1CZNA 1QHYA 2EEZA 3NP9A 4YAOA 4EEKA 2G67A 3HJHA 4TLEA 5B4VA 3ERCA 1EG2A 3I9JA 4MWZA 1E6EA 1GL9B 2B3TA 4MZXA 1FIUA 1R5BA 2QAGC 3CLRC 3GZNA 4MINA 2P2DA 3KFXA 3BILA 2PGLA 3PEUA 1JNXX 1NJFA 2WJJA 2XYQA 4CEJB 4PPFA 3JQGB 4QFCA 3R20A 5E2BA 4DY6A 2PAFA 4GOXA 5AK6A 1WIWA 1N3LA 1CZKA 4A3SA 1N32B 5ED0A 4O4IB 4QKQA 2W8ZA 2I03A 3AYZB 3FNFA 1T2EA 2WU4A 4FYMA 4NX2A 3ADBA 5KB3A 1RWWA 1TKBA 2PX3A 3DCYA 4LHSA 1J5XA 4R31A 1WXFA 4OHWA 2RD2A 5TQVA 1SB8A 2Y1DA 5AW6A 1Z6ZA 2R6ZA 3EXHA 4C5CA 2ZITA 3CR7A 1U4OA 3LT2A 1GZSA 1A1SA 3LLMA 1OT5A 3A27A 3AEQB 2CFOA 5BQ5A 3TJMA 4LDNA 2PANA 5ELLA 4ESEA 5K0JA 4E1AA 2PUCA 4GMFA 5DU2A 2W0MA 3UT5A 5D6NA 2VHYA 2BEVB 3QU2A 1TMKA 2B0JA 4DYHA 2C9BA 1SIWA 1KO7A 2PT9A 2ZAOA 3FDIA 1G3UA 1ADYA 5HKKA 2ASVA 3BWDD 3KZ1E 1QHGA 1LY1A 5IASA 2CZCA 4WH0A 4FYYA 5KNLA 1IUKA 2QE7D 3AIKA 3V4LA 2NVUA 2V0NA 1YZGA 2WPNA 4OG2A 2G4VA 3T3NA 1W5TA 1XF1A 4HY3A 3ZD9A 5AOAA 3I52A 3TPFA 1WL8A 4Y6RA 1QVZA 4HQLA 3FCOA 3SEZA 2QQGA 1NN5A 1BJKA 2OV1A 1FJHA 1O95A 1ZQ9A 3AF2A 3C7KA 3DO6A 2OOKA 1Z2NX 4C21A 3A2NA 4RZ2A 3HA5A 2NAFA 2ZS9A 3E15A 3ETGA 5CJPA 4F3NA 1MH1A 1EH5A 4JI1B 3CVJA 4IH9A 2ZSKA 1A5ZA 2ZANA 5EKUA 2DSTA 4DYDA 4ZFNA 2IU3A 2Y9PB 4XD7D 2GN0A 4TTJA 2BBWA 4WZBE 1KFJB 4TX1A 1E3EA 1PP4A 3TOCA 4ALNA 3DPIA 4L1KA 2Z6UA 4JIMA 4CV1A 1TKRA 3WKBA 4DVJA 3E58A 5I7RA 4UU1A 1LDBA 1XL1A 3DD5A 1LD3A 1VGVA 2UYCA 1LJ8A 1SWWA 3GG2A 1X15A 1GA6A 3KJQA 1MW8X 5AVJA 4GL2A 2WD8A 5G0SA 2DFPA 1V16A 1Y1KE 1Z2PX 2GEVA 2DLNA 3FYDA 1I1OA 1BH6A 5FOSA 5KWEA 2QNRA 4H0NA 5GIPE 1HOTA 4XGKA 3U4QB 4G2NA 1JILA 2OV8A 3JQ9C 1YQXA 1ZH0A 8OHMA 3V42A 4KFSA 3GUHA 3BRSA 4Q7LA 1FTWA 1NMYA 2CY0A 3EE6A 1TIPA 4YGXB 3DQQA 1QB7A 1XZCA 1W2WB 1H23A 1XLWA 1ZINA 2XB9A 4N3AA 5KSPA 1S5PA 2XLCA 1Y3AA 4NPHA 1FVHA 3PQ7A 4XPIB 3W2GA 1X1AA 1YASA 3MTEA 3PNKA 1L5NA 3ZLUA 4RPJA 5E4JA 5SY4A 1LK5A 1V47A 1ZGHA 3T9BA 4NZOA 3Q4GA 1KJ9A 2CLMB 1QBKC 1QCDA 2JC3A 4R1MA 3OPNA 4IGKA 1MP0A 2WQZA 1GUAA 1ESEA 3NASA 2XCUA 4LWQA 2PWPA 4X3PA 4ZAFA 2ZBFA 2KBFA 3AKYA 2XMRA 2PU7A 5EHNA 4DARA 1XJQA 1D6SA 2EZ4A 4U6QA 3HJUA 5IW8A 2GX6A 1UDBA 2OBYA 4B33A 4XFJA 2DY1A 1N5LA 3FB1A 2Q9CA 1TTPB 3FGOA 5BQOA 3V8VA 3HU1A 2BFPA 3NH9A 3EZ6A 2XWPA 1JTEA 1A95A 1L4NA 3QX7A 4C7JA 5CX1B 4N7BA 5H83A 3LPCA 1ZQ1A 2TECE 1M2JA 2VPPA 3RYTC 1F0YA 2Z4RA 2QV0A 1NW9B 2G09A 1H94A 1OJLA 3N2KA 2X22A 4HEHA 1QBGA 1OWPA 3BL8A 1JGTA 3UJ7A 4OQPA 4CM6A 2WG0A 1Z15A 3KAJA 1E2DA 4EG6A 4IIJF 4M88A 3ZHUA 4PR0A 3QELA 5DI3A 2WSYB 4J4HA 3KLBA 5DBOA 1I2MA 1VSUA 2LCIA 2FR8C 1XA4A 1REQA 2RFLA 1O54A 3WWEA 4DREA 2B8JA 3P52A 3U3JA 2VT2A 1LB1B 1P1CA 4BMSA 3K6SA 1QO0D 4Y9TA 5EWLB 3W5IA 3ZWOA 3WDLA 5GZ6A 3R2JA 4HRYA 4Q01A 4E3ZA 1TU4A 2B21A 2BM1A 4MV3A 4JMLA 4ZU6X 3VU0A 2XMCA 3PWZA 1UBFA 1XCOA 3I6YA 3ZV3A 4G0OA 4E2YA 1P7WA 1Z26A 5JZBA 3ZIUA 2NV0A 2IHTA 5FWXA 4R01A 2H1FA 4LWZA 3PC3A 2O7SA 4F6RB 3ADDA 1LH0A 2GJAA 3C70A 4NPCA 1CIVA 3CT6A 3RYFA 4DVGA 1QRRA 2XUHA 1J56A 4CMJA 3IOBA 4BNTA 4EUFA 4F84A 3OEYA 1WCWA 1SXJC 5IFLA 5LKAA 3OIGA 4G0WA 3E9MA 4TMXA 1JHMA 4BBPA 2EJTA 1XCPA 2ODEA 5JSKA 4ER0A 4DBVO 1WS6A 3ANSA 3DEHA 5EKSA 5K0TA 2J8ZA 3C7CB 4UAGA 2D2FA 4N40A 4O2RA 5HS4A 1J70A 1EEHA 4EGSA 2WKWA 1QQ7A 3AFMA 3NJ4A 1V2HE 4LNUA 4Y9RA 5EPOA 3AF5A 3JVVA 4AF7A 4CM3A 5AVQA 1QHNA 3DAYA 1KGDA 4W9NA 2WD7A 4CGZA 1PLKA 4LE0A 1NMZA 2CHQA 2HGZA 2A67A 1T43A 2CYAA 3GCWA 3NS7A 5AVKA 4D79A 4WK0B 3IHTA 3OOWA 1J24A 2D1QA 1X7ZB 5KEIA 1D9ZA 1TYEB 3F71A 5F35A 4BMXA 2RMKA 3N8NA 2ONKA 2YWDA 5GY7A 2ZM6B 2NO4A 4HAXA 2JCBA 2EFCB 2QQEA 3ANMA 3DFUA 4JSRA 4PICA 4W8HA 5TS3A 3LYHA 2ZFUA 5C2JB 4S2UA 5DNUA 1QRUA 2IE0A 3G13A 4N9WA 5JMWA 5LOVF 1FTQA 1L1EA 2RGWA 1HURA 3TTYA 1IWBB 4BVAA 2BI4A 2FG5A 1Z73A 2IIQA 2NO7A 4NOLA 4A9AA 5CT9A 2XBMA 4EVRA 1H8EA 1RQNA 1QHEA 3JRNA 4O4HA 3AR7A 2H9YA 1G9TA 4DCMA 4D43A 1PJSA 1YZVA 4S1VA 2VF2A 3EIXA 2DPHA 3GPBA 1FNBA 4LHWA 4DXDA 1RHQA 2IYLD 5C81A 2CZQA 1SCNE 3QNMA 4OH7A 5FPSA 1F3OA 1G20A 1NTRA 1U0HC 2EZ9A 3QX9A 2AOWA 3IAEA 1QIHA 4FYKA 4OBWA 3HKCA 2DTDA 2HWXA 5FUBA 2O1XA 2O7QA 4M0FA 2OKGA 1E2LA 4WSOA 5DGHA 2WKRA 4MRRA 1LPAB 1BCRA 2V8BA 1TJPB 5E2IA 1AVTA 3CVYA 5DMHA 4ERNA 4GR5A 4YA6A 5H81A 2YCLA 5HE8A 3G0HA 1RI1A 2H3HA 3IKJA 1KC3A 5DBHX 4DJJA 2BGIA 3EZNA 4IGAA 4B45A 4NOMA 4XIYA 1PR5A 2JKVA 3AUYA 2XB8A 2FYTA 4H7IA 2HQSA 3UICA 1YK0A 3LVRE 4JNCA 1II0A 1GDDA 1UAGA 2AOUB 3ASYA 4E70A 3MWEA 3P20A 3AERB 4IP0A 2OYCA 1TLFA 4MYCA 2W6IA 1P9NA 3CHYA 4X97A 3BA6A 1WZCA 5ULLA 4WEQA 4BV9A 3X1ZA 3NBZC 1HTBA 1QGUA 1KIMA 2H18A 2AW3A 4S12A 4D3FA 4A0GA 3OECA 3RTAA 4DMUB 1HPLA 1UKZA 4P82A 1THTA 3ZH2A 5LIRA 3EEBA 4FFLA 3RBAA 1KI8A 2P1ZA 3NCTA 3B5JA 1KDTA 3HACA 4GMKA 1KQGA 4MH0R 2GCGA 4CIBA 2WRZA 5I7WA 1RXCA 1UDCA 3OPMA 4G9EA 1Y6RA 4UHCA 4WJLA 1IOZA 1T9CA 1X8LA 4AX4A 3WBKA 3G8DA 4XD2A 1P3DA 1TEHA 4NQZA 3VO9A 5TEWA 5JD5A 1E2QA 3LFUA 5K1ZA 4WOCA 3G2MA 2WHEA 4QPPA 1BDMA 4I50A 2HMWA 4PIVA 2NT4A 1HLGA 1HLFA 2FB9A 2C42A 2C2GA 2A4KA 4D25A 2FF7A 4I55A 3DBHB 2WC1A 1WLYA 4IW3B 4DQKA 5LU9A 3JYPA 3OURA 1QF6A 2MYNA 1ARZA 2RGNA 1HKHA 3RF6A 4EI9A 1CJTC 1LZLA 1ZI8A 4I4TF 2Z58A 4IDPA 1JA9A 3L0BA 4MVJI 3T1OA 3NNDA 2N75A 3ZJ4A 5BSGA 5JFTA 1W1UA 4Y1RB 2IBTA 2IHBA 1JQKA 4EA9A 1QFXA 4MRNA 2A33A 3D6HA 3QPUA 1QQ5A 1DQNA 1JEJA 4KXLA 4FZVA 1N5OX 1FP7A 5BYBA 4AI6A 3LT4A 1ISHA 1R0BA 2GBGA 1C3VA 2Y1GA 3HXTA 2GK7A 1ZITA 3GDGA 2P9BA 3IB6A 1H65A 2XNJA 7GPBA 2PPVA 5IDYA 4OJNA 1WCYA 4ZARA 5B57C 5EJGA 4X62B 2IS2A 4QOGA 3LQQA 3AGPA 3PVSA 4CG2A 1VECA 3N6XA 3HRIA 1NNSA 3PDUA 4GSKA 3ZKAA 1JDVA 3CEHA 4YFYA 4AURA 4HAIA 1R10A 3NDIA 1XMJA 4MJXA 5AESA 2I9KA 1YE3A 2QIOA 3CBGA 1ICEA 4IZOA 4L73A 4JEUA 1KJYA 4MR9B 4ODIA 4HQOA 1F2VA 3QEMB 2BFAA 1M1XB 4NZNA 5T4BA 1L5QA 1RPAA 3ZJYA 1JJFA 2QY9A 4M7WA 4BS9A 1ZD5A 5CFOA 4I4NA 2V1XA 1H4QA 3QVJA 2PKYX 1G3IA 1T8PA 1J1ZA 1PJTA 2QSJA 1YAHA 3S27A 3VR4D 3PQ5A 4H3HB 2C04A 1Z5ZA 2G1AA 2I3GA 3Q1KA 4RDIA 1RYHA 3R8XA 1AMNA 1GZVA 3KB2A 3BWBA 3BQMB 4GR9A 4F8JA 1UBKS 2ZJ7A 3I1FA 1Z2AA 3NV9A 1NVVR 1A72A 5E7QA 1EP9A 5DMXA 4OHOA 3ZU4A 2VUIB 4YQYA 1VLLA 2VUUA 5DNCA 3H17A 3EDRA 4C4PA 4P80A 1WNTA 2DBQA 3A06A 1OR8A 2O54A 2O2GA 1LCIA 1N2EA 1Q1GA 2WBLC 4Y6SA 1BCSB 3PIIA 3X2SA 4XA8A 3RAEC 5JE8A 5AKHA 3GOHA 2WIGA 1S96A 2J5QA 1NI5A 2IIBA 2JFPA 5SYMA 3TRIA 4BATA 4BZXA 2W6CX 1CNEA 1JKIA 3T9DA 1Y82A 4JP1A 4KE6A 1TZMA 2B9EA 1ZS9A 2ZJ2A 4OTZA 1H5UA 3DV0B 3LD9A 3H5AA 3TL6A 1TC2A 1AUXA 3KYCA 4HDRA 4MVCA 1IHDA 2R84A 3S0JA 1JEEA 4JYMA 2WY2D 4YAIA 1TE2A 4M1TA 4RA6B 2Y68A 4MQ5A 2PS9A 3EVGA 3DOIA 3UATA 5J4YA 2V7BA 2G7MC 3BTSA 3Q10A 1UJMA 4ID3A 5FH9A 4OJYA 2BMFA 3F78A 3HL4A 3TL3A 3HTXA 4NATA 1BGWA 2OD7A 4YLYA 1VL1A 2ZETA 1OXMA 1RWVA 3F6SA 5FKJA 1JEAA 5J5AA 4KO1S 1OXSC 2JI9A 4UAVA 3I30X 3KV3O 2V6JA 1FFAA 3VGPA 2UUOA 2IH5A 4D5EA 2EJCA 2HBRA 5HEKA 1TM7E 3IIMA 1QTIA 2FH5B 5DP1A 5K8TA 5KNCD 1GGVA 1JIKA 2G5GX 1PDOA 4UTNA 2AWNA 4MS4A 3T5AA 1XXLA 2ZAYA 1TO1E 3U3KA 5TQ2B 1T0JB 5IDWA 2I6XA 1MGOA 2QZ9A 3ZQ6A 1VPLA 1T3SA 1QH1B 1YMUA 3O2QB 1U0JA 2B7LA 4PZUA 4P7KA 1OLUB 2GZ2A 3A6GA 4ASUA 1UIRA 2C9CA 4GVXA 2D54A 5TLSA 2NU6B 1SGWA 2W7TA 2HBQA 5KBYA 4H7JA 4YALA 3BFKA 2XUKA 4CT4B 1ELOA 1GCIA 1FS5A 5CNIA 1FFXB 3AW9A 5ABPA 4DNXA 1MT3A 2BZ1A 1AV7A 5AHRA 3KE8A 5IH3A 4W82A 4Z7JA 4IHQA 3JAWB 1XQWA 4RNDB 1JBEA 5JQGB 4UM8B 1V41E 4DW8A 4RE5A 1IEWA 1OB2A 2H1LA 1I6KA 2JK0A 2PSFA 4BNMA 4MYUA 3OF5A 1QR2A 3F9CA 3PZRA 4O0MA 4CEIA 2IS6A 4XGNA 2ZJ5A 2WWFA 3SAJA 2POCA 3OOYA 2G0NA 3HBJA 2J46A 4AMYA 1DC3A 4L0DA 4X3CA 2IPLA 1WD7A 2HHJA 1ABFA 4DIFA 5IC4A 2SBTA 2WFZA 3CYFA 1G8PA 2ZBVA 3OX4A 2VQEB 4OSPA 2BGJA 3BZBA 5JYCA 3KKKA 4TV8F 4L7QA 2R7LA 3GVHA 1NC1A 1CS0B 3R09A 1BWPA 3OD1A 1S01A 2A5JA 4MI9A 4YAFA 4RW0A 3TXXA 5C7IO 1POWA 3IMKA 2J0EA 2CWWA 4AJ2A 2NW6A 4LF6B 2Y4OA 2K7ZA 1IQRA 1CV2A 1KVQA 2XMBA 4LKRA 5BR8B 4XEUA 3OTQA 2IV2X 9MHTA 1YGYA 2YW9A 4FWTA 2P79A 1STOA 3PVCA 4RD4A 4RZQA 1QZTA 3KXDA 1TTHA 1RIIA 5JDCA 4MRVA 5D3MB 4ZHQB 2QHXA 2HMSA 2Q8NA 3EEOA 3AJ8A 1HFWA 4NFLA 1KY4A 4W5NA 2YV2A 3W6NA 3TQCA 5C8ZA 3JZAA 2JAHA 4MR7A 4FK8A 5D85A 5IFKA 3FMIA 4ZI2A 5K0GA 3CIOA 4QASA 2NTJA 1ZRMA 4Q12A 3E48A 2JJ2A 2BMEA 2BJHA 6GPBA 1ESCA 4H77A 4FOPA 3FTFA 3IXMA 4JUAA 1COWD 3FDZA 3PGMA 2Z04A 4D74A 1WRBA 4GDFA 2OV4A 2UYHA 1OX6A 4H4CA 3HCEA 2CL0X 4FEEA 1W4BA 5CVDA 4RC9A 4KZKA 3FVVA 5BVGA 3DOFA 5A0VA 1P33A 1YZ3A 2ZI7A 2XMSA 2CN1A 3RUEA 3CEJA 2YWJA 4D4GA 1G4AE 1U3FA 5ICFA 2OZLB 5TJHA 3UHAA 5A0TA 3PWKA 2E4XA 2R1ZA 1U2DA 4GM4A 3ZHYA 1T1IA 2HT6A 2QUIA 4AMZA 4AUKA 2QD2A 2VTDA 3Q3GE 3QEBZ 4CQJA 2NO9A 3VR2D 3QU7A 1RBYA 3OJFA 2Q2OA 2BM0A 4NDZA 4QDXA 3O26A 1DPGA 4JCCA 2JFWA 2R1VB 3ICOA 4U3JA 3LC2O 1F0NA 3KDAA 1UKCA 1NMEA 3PXDA 5EZQA 5CAEB 3FVQA 3P9QA 2I4MA 4RQBA 3WRYA 1YIAA 3D3JA 3V7UA 3L18A 5B4TA 1APBA 2HBYA 3L6OO 1AXRA 4TS4A 5IXYA 1U2GA 3OM1A 5G3ZA 1G1MA 1LVHA 1UAYA 5SZHB 4N47A 3X1WA 4CYMA 2BRUA 2DWOA 1IN5A 4EA6A 2DR2A 1PR3A 4YRFA 3FNBA 1XKTA 4JLSA 1SOMA 3EH1A 5HF8A 3VZDA 2W37A 4KFUA 4E15A 4URZR 2BCJQ 5M29A 2ZUWA 1EP1B 2I2DA 3PLRA 1HLDA 5JZ9A 1H6AA 2CFSA 4ETWA 4OLAA 5AUNB 4PFKA 5B3AA 4FSDA 1UKBA 2RAVA 2E6UX 1KYZA 5A6SB 1XVAA 3V9PA 2I6QA 4KSYA 3KVRA 1R74A 2XUZA 1DIHA 1M34A 2YOHA 2XEXA 3JYOA 3OJXA 2WV9A 3PE3A 3ST7A 5KTTA 3H11B 3M5PA 4X95A 1Q20A 2QB5A 2ZB3A 3BCHA 4HKTA 3THWA 5G2OA 2OGUA 1H1TA 1T6BY 3WGQA 4KGXA 4ALKA 5BWCA 2WWVD 3LUBA 5AR1A 3VSEA 3BXEA 1YIDA 2M1XA 1SXIA 2SICE 4AT1A 3AVWA 1DAHA 4FBLA 1Q14A 2EBFX 1SC4A 2P62A 5EL0A 5BW5A 4PN7A 2RHGB 2GPSA 1VTKA 2DERA 3IXLA 1U65A 2B2XA 5B6IA 3B3QA 1OH8A 4RELA 4RH1A 4CMIB 1A2KC 1HT0A 3G0OA 4Y2RA 3GNSA 4K46A 5KYWB 5D01A 4H7PA 4MYRA 1VGRA 1YB7A 2ZM5A 2C5GA 1NURA 1GXSA 2PBFA 3GZJA 1VKHA 3KD2A 2PZMA 3R3XA 5TVKA 1UXIA 2PKQP 3D5QA 2PV0A 3U61B 4IO0A 1BWRA 3B9BA 1XEXB 2X3FA 3CN7A 3PX3A 1Y3CE 1FX0A 1WP9A 2HSGA 1E1RA 5FF9A 2DPLA 3LQRA 2BBOA 4DGQA 2QUKA 5EIAA 2XNHA 1DNPA 1QOPB 3NRCA 3QKTA 4MCAA 5REQA 3B9PA 3UJDA 3KR0A 4QRHA 2JJ1A 3SDBA 2I1VB 2I6UA 1H5QA 3CXRA 3L7BA 5AKLA 2VTVA 4HYQA 4NMXB 3MWFA 1ZK4A 3AKZA 4RYLA 1I7QB 3P8ZA 1YF3A 4QDTA 4RCYA 4DCOA 1RZ3A 3M4JA 1JMYA 4GSYA 1L7BA 1BKDR 4YJ3A 1M2VA 4KN9S 4TWZA 4ZU1X 2EWWA 4LHZA 3D8UA 2XOKD 3OE5A 2GPNA 1I2ZA 4QU0A 3AM1A 2IQIA 1VKOA 3JQFC 5DM4A 2J31A 1R9JA 1SCJA 3RVDA 1HR0B 4GM0A 4AN1A 1ZX1A 4EZEA 1U80A 1BS2A 2R86A 3B1FA 3W90A 4LF9B 3H8JA 4I9GA 4BGDA 1V26A 2GPWA 4ISBA 3ASUA 2Q49A 3TI9A 3MXOA 1L5HB 1UM9A 1DG1G 3K2EA 3I2FA 1FQKA 3B3FA 3PRHA 2O20A 2K7FA 3W5SA 1AH2A 1DO0A 2JCXA 3M34A 2WZBA 1R5OA 1IL0A 3QPAA 3DLHA 1L1RA 4TM8A 2JGKA 3T9CA 4MUKA 1KORA 2JLUA 3UA3A 1YKFA 4ENSA 4RAOA 2R25B 3AESA 2PBRA 3FH0A 2FSPA 2QN8A 1PO7A 4ND3A 4NBSA 2DEUA 3H87A 2B61A 3VX4A 3VM6A 3NHRA 3K0CC 1QGZA 4K81B 3WMGA 5I8PA 4MVJF 2B5VA 4LZZA 3FR8A 1EA7A 4WGFA 2IYYA 3TCKA 4ZRDA 5BV2P 4N3CA 3A9CA 2VYND 5I5GA 2NP7A 4GQAA 1HDYA 4BDTA 3SHQA 4AY6A 3QVLA 2BJWA 1NWHA 2A5GA 4PTLA 2GM5A 2JL1A 1XA0A 2LKCA 2JGDA 5FI5A 1QC5A 2ES4A 3LQ1A 2BFFA 1ICIA 3CZ4A 3KJGA 4X8MA 5JYEA 1HF3A 2IOYA 1R6VA 2XUDA 4WZAA 3TAUA 4DWOA 3K1JA 2XXAA 1QUEA 3K20A 2V3VA 1OAAA 4XRRA 4A8JB 2ZSHA 4M89A 1YBAA 4I1UA 3EMVA 4FZ3A 4RVCA 2DXIA 1UJ5A 3DP7A 2FDRA 2BV3A 3H2GA 1SZPA 3IQGX 4EGCB 2B6HA 4F3CA 4BLRA 4C4AA 5E6RA 2IWHA 3ZHBA 4M6WA 3OZRA 3OWOA 4DLWA 1KSJA 4LE2A 1R0YA 2ST1A 3MBOA 2WICA 4HLNA 1YJBA 3BULA 3K9QO 4IHJF 4IZIA 1GFIA 4V0ME 3SXUB 1S8AA 5ARCA 3W1WA 2PX2A 4ML3A 4P36A 3OZCA 3BK1A 4MITA 5EWMB 2PXXA 1BQ3A 2DF8A 3QU5A 4OJKA 5JCOC 1KNXA 3PE4A 2V55B 5LA6B 5EWJB 4PQYA 4D4HA 3VSDA 2BFMA 1IXSB 4OHVA 5AM5A 4JJKA 2J5BA 3V3TA 4EM6A 4ALLA 3L0YA 1JEYA 5HBGA 3FPEA 5HQJA 5A3QA 5DN6A 3WGNA 4V24A 4Y0AA 4MHSA 4URFA 5HTKA 4B84A 4DR3B 4HWGA 2ZWPA 1C3JA 4PLPA 4K9RA 1Q7RA 4AZVA 2EIXA 2CDBA 2V7TA 2GVNA 3T3HA 2W8BA 1BVHA 2VHCA 3ZVKA 3K30A 4W5JA 1SIOA 4PNZA 4Q18A 3L8DA 3EXHB 3OPYB 3L2OB 2NSJA 4MVXA 1K7XB 5EHQA 4PCAA 3I0ZA 1IH8A 3FETA 1N5RA 1WZEA 5HJ2A 2IFTA 4PLCA 4X1IA 1JZSA 4YWHA 4XQ9A 2QL9A 1FP1D 1X1BA 1A7AA 1KEUA 2PX8A 3VNAA 1WF6A 1YCGA 2ETXA 2P30A 1KOLA 1YOBA 1JU9A 4GE0A 4JGIA 1RJ9B 2AZ4A 5HRCA 3U9TA 1XK7A 3OOHA 3JY6A 4WXHA 2X8AA 2PR7A 3MJCA 4UDXX 4QGFA 4DLBA 1NSTA 5EJAA 4O2LA 1BXRA 4A7PA 2Z95A 4WK2B 1EQAA 1WJGA 1KJ8A 1NVVQ 3CUSA 3EOAI 1A9YA 1NVUQ 3IEUA 3H4TA 4QLBA 3E0QA 4RQTA 5C4MA 2DHQA 3GC6A 1M33A 4PLTA 3L8MA 4IIYA 2VWHA 4RDXA 1MQAA 2AFIE 1SXHA 2NUTB 1HH4A 1OLSA 1VL5A 2JIZA 4GU5A 3T4PA 2BE9A 1W1IA 1YS2X 2WIAA 2X0JA 3OPVA 1ENPA 3QBTA 3QFRA 4D41A 3DZIA 3L6RA 2CVPA 2O3JA 2QTAA 3ONWA 5HMMA 3OT1A 1M6YA 3ZCSA 3DC7A 3F73A 3SS7X 2WT9A 3BTUA 2BSQA 3RVBA 2P0EA 4TYNA 2AMFA 1MB0A 4BOYA 3GRAA 3PEFA 2GPBA 5JXIA 1JAXA 3HC7A 2IX9A 3UJCA 4D02A 1K8ZB 2O8BB 3B20A 1E60A 5AKKA 3LECA 3UGTA 3EGOA 2EWMA 1AV6A 1A8UA 1PR6A 1USUA 1W6UA 1Z74A 2EYUA 1KQOA 2I1QA 3LDGA 1J23A 4GXTA 4L9RA 3W1VA 4QTYA 4YXWD 2HHHB 1H9CA 1Y1QA 1BHJA 3ITKA 1A8SA 3A6EA 2B8EA 3CKLA 1LBEA 4KO8A 1QG0A 3LNCA 2WE8A 4TLBA 1RI4A 1AT1A 1UDAA 1ZJJA 3DXZA 4ZYVA 3VO8A 2X0FA 1V16B 2HQ1A 2KM1A 1RIFA 1S7GA 1EVIA 3TLJA 1VDZA 4HTAA 4DA7A 1QIJA 1L7EA 2IYVA 3WQBA 2BZSA 4PTYA 4QOJA 1MRNA 4WNAA 5HF5A 2BLNA 5YASA 2C99A 4C03A 2V3WA 5HQTA 4CXMA 4JJIA 4M1QA 4MIKA 4I14A 3HXPA 4W99A 2J3MA 2RJ3A 4IQ4A 3TLZA 3IEKA 1E9AA 1S8FA 1U9IA 1RU3A 5DIZA 5TPZD 4XUDA 3WBFA 4NZZA 5JAHA 3WAJA 1QZUA 4YRDA 2C2ZA 2R97A 3EIUA 4KMOA 1EM6A 2HTFA 3D31A 2EP8A 4Q0MA 4TKVB 2X5NA 2D3TA 4FC7A 4RCVA 1AZLA 3A1VA 1AN9A 3MC1A 3UMBA 3DWGA 3G49A 4GSLA 4RETA 3UXMA 2C7RA 1EGHA 5JBQA 1XK6A 2DAPA 3ZWDA 4KFTA 5KPJA 5DTQA 4JI0B 3NV7A 3BF8A 1QTRA 5DM2A 4J1SA 3TX6A 3RADC 4RK1A 3QEJA 3A1SA 3LZDA 3BB1A 5H3CA 1ZCJA 3UANA 3U1BA 4NU0A 2PUBA 2VUTA 1UMDB 3M3DA 2PZFA 5IULC 3HLYA 2QAJA 1FC0A 3KYIB 4G5GA 1ITZA 4ITUA 1VBFA 3WZMA 4ZZ2A 1U0RA 4E11A 2ZXUA 3HPRA 4MNTA 3Q15C 4GZ6A 1CUCA 2O57A 4Y0NA 3QI7A 4UPEA 1CJKC 3GD7A 1ZHOA 2DECA 5TGZA 3TSYA 3WZ2A 2JFNA 1SQ6A 3FGPA 1CVRA 4HC4A 5JAZA 1JHDA 4DNPA 4FSXA 3JD0A 1EFPA 1S3FA 1JSLA 1GT6A 1ORDA 4PYJA 3AM4A 4GL4A 2P41A 2HJGA 4Q3AA 3CRW1 3QELB 4QBKA 1MJ5A 3BREA 3RHTA 1QWSA 4BECA 2GLTA 3RW9A 3U7JA 4O08A 2HYIC 4E07A 1MC5A 3KYBA 1LQTA 1XD9A 3ZXYA 4KPEC 3EPJA 3DKIA 1N2OA 3C24A 2IV7A 3SEFA 3DV9A 2Q2WA 3BMNA 1J49A 1NJ8A 1Z07A 1Z2EA 3P2YA 4L8WB 5ALNA 2EFEB 3H9CA 1WUIS 3ROEA 3EPLA 4JQZA 3SQNA 3W34A 4DBLE 1XQ6A 1GN9A 4J16A 4PV7A 2BBSA 5HJEA 3CONA 2JIQA 3BRWA 5KYXA 4QM6A 3QFSA 5FWXB 1V7ZA 1NT2A 5KQGA 5DGTA 1U4NA 2XT9A 3GEHA 3RYFB 4B4WA 3IAM6 1KDVA 2BFNA 2NMVA 5AJTA 1SPBS 3OEEA 5LP6A 1ND6A 1UMBA 2FG6C 4MWEA 4Q9HA 2WI8A 1GILA 2CYBA 5AVTA 1QTNA 2WA2A 4RV9A 1U2EA 2X8JB 3QBDA 2QNIA 4TTPA 4AW9A 2C54A 1A7KA 3C0KA 3I64A 4IJVA 3WOHA 3AUFA 2FDXA 1DAGA 4BQPA 3NT2A 4K40A 3AYXB 2X2PA 4XLTA 5F2NA 2W22A 1ZC3A 2W83A 3PC2A 1SOWA 3O9ZA 1VI2A 4U8HA 2OT3B 3D4IA 4BFSA 3DWIA 4HEJA 4CKBB 4JT9A 2DKOA 1RRFA 5CLHA 3ULKA 2HZBA 2XMQA 1N78A 3PV0A 4YUYA 4UC0A 4W1QA 1X2EA 5LBIA 5EP3A 4F3TA 1FP4A 4OXYA 2Z8YM 4ZAZA 2POQX 2PMWB 2QLJA 4LMPA 2FLVA 2J85A 4BJ3A 2LP4Y 3O1IC 1SHZA 2BEUA 2PT6A 1UP4A 2ET6A 3AJAA 3KHSA 4FFWA 1QKKA 4B44A 1E1QD 2HA2A 1UKVY 4NHEA 1ZD2P 2O59A 5HG0A 1Z13A 2FRVA 1OA0A 2XBLA 2GN9A 2HIHA 3LWBA 3NR2A 2X9GA 1LSOA 3HN7A 1NYRA 2RGRA 4CKXA 4AULA 4CIXA 3DE5X 4V0KA 4UNSA 3QIAA 2R8YA 5JV5A 1BE6A 2GETA 1RP7A 2ANCA 2ESRA 2L0XA 5BNZA 3FZYA 5IAKA 4EARA 1DAKA 5CURA 2B83A 3RHFA 3ROZA 2OHXA 4IWYA 5IYZF 4IJ5A 1TU3A 2PE5A 4EI2A 1GU0A 4C01A 2GWRA 3DF7A 3O8NA 1C1HA 4MRPA 5DBIA 2WU1A 2B92A 4OHMA 1UMKA 2QR3A 1YS7A 1Z0JA 2BGKA 2A58A 2WVAA 1BCRB 2C2XA 2ZQZA 2NXNA 1YK1A 3GAZA 4P32A 5H1YA 4MGYR 1KE2A 2JIRA 4HDKA 4UVEA 4LNHA 3RVOA 2J0QA 2ZG6A 1V8OA 1FX1A 4TMFA 2FPUA 3H4VA 4OHFA 3ZGNA 2IHYA 2GXAA 1YDMA 3U81A 2Q4TA 1XVLA 2Y0EA 4ZMRA 3Q2OA 3WX0A 1RMQA 2KW5A 3NH6A 1DEKA 4OIMA 4DV6B 5FI3A 1C7EA 1QO9A 1E18A 1PJBA 4PIPA 5F52A 4BLUA 4UOEA 2F43A 3STWA 1QGUB 2C2MA 1IN7A 2WIDA 4MVYA 4QOFA 3R76A 4ZQFA 5LOVB 1KO8A 4GKAA 2X13A 5F9MA 2EJWA 4HUJA 4BRWA 4OMUA 4EG7A 1H2HA 3NKFA 2GDJA 2HEGA 5BSTA 3B7GA 5BR1A 3FHTA 3ZZTA 1ISSA 3AHFA 4X1YA 3WWOA 1R6AA 3PXXA 1P0QA 1A77A 4QEZA 1EFTA 5F1YA 2ZRPA 4FMDB 4LMAA 4B09A 3N7TA 2IP1A 3EY9A 3N2GA 1W94A 2ZUUA 5JSFA 2ZBUA 1KZGB 1IY0A 3E8SA 3AHGA 1QORA 4NENB 3U4AA 1G5FA 2SECE 4EHIA 1H6CA 1W9MA 3HYSA 4GLLA 1KY5A 4R2JA 4BB9A 4GWGA 5EQJB 4UD2A 1WSDA 3D8RA 3MGCA 3C1UA 1H0SA 4I55B 4PFJA 1JHOA 1FDWA 5J59A 4B7XA 5D86A 5IUKC 2QBYA 4YIKA 3GQVA 1HA3A 5SY6A 4QODA 3U3ZA 2OCLA 2RB4A 4B3DA 4EVIA 1TFUA 5DOVA 4HADA 3TSAA 2Z3VA 1FBNA 2EG9A 3WICA 2QROA 1ATIA 5FV7A 3SC2B 5AK4A 4R8LA 1XTIA 4C0AC 3IMGA 1PGNA 3Q11A 4TLLB 1JJBA 2DFKB 3TS1A 1NRJB 2ZSAA 2HCFA 3VX3A 2R9VA 3EUAA 4WJKB 2GBIA 4X7BA 4O02B 1R37A 4RL4A 3AL3A 3U49A 1ZNYA 2IU4A 2CL6X 2X8LA 1A8QA 5EQFA 3T12A 2OAP1 2Y1OA 3CH7A 4BMNA 4BNXA 5H8WA 2IDMA 1TK3A 1TUBB 2H7XA 5JARA 3ICEA 2CNLA 2NT3A 1GADO 2B30A 1XZ8A 3KU1A 2ZRLA 4CPDA 2C4MA 4GZLA 2XCRB 3FOWA 1NUTA 1PR0A 1A8IA 1JR3A 2X2OA 4AO8A 3DL7A 2F17A 5ALWA 1YQTA 3UMMA 3ZZNA 2IDZA 2XKBA 4N12A 2QE6A 3F8SA 3F1KA 4MI6A 4TXLA 3UW3A 1UMCB 1G8FA 4KDEA 1S2DA 4FHEA 4CF4A 2VF7A 2D8AA 4DCVA 2R7MA 2R6JA 3LS2A 2YZ2A 1MABB 4IVNA 4GBED 1B1AA 3ACBA 1ETUA 3ZI7A 4M60A 2DE0X 4LBZA 3AVVA 3WB2A 3TRHA 1X92A 2GXQA 1XYGA 4OYLA 1SRRA 1V1MA 3KT6A 3UO8B 5H82A 1E6CA 4QUGA 4U7WA 2O8FA 4BL5A 2E85A 2JANA 4BY9E 2VJMB 5FL7A 4XM0A 2Z4SA 1N9KA 4JIGA 1M6HA 1JFVA 2P7HA 1FNDA 1TQ2A 5DF1A 3L7NA 2UZIR 2R7KA 3FBGA 3X44A 3ND8A 1YE8A 2VBIA 2BE7A 3DE7X 2GI4A 2XUFA 1RZVA 1EJBA 3U4CA 2E21A 1R3UA 2JVIA 4YRGA 1YRBA 3KYCB 2IEZA 4V3BA 3VZQA 1SEPA 1P2GA 3A26A 5F5LA 3DL4A 3WHPA 2C0CA 4MUYA 4PZEA 1EEXB 1PW5A 5ECYA 4K9NA 1A0OA 1BHQ1 1M6NA 2QVZX 3CLUD 2Z2KA 3ED1A 3Q41A 1DPFA 4CU2A 1XLVA 4AP6A 2HDOA 1JG4A 1NTOA 2Z3ZA 1VPDA 2JFFA 2JIPA 1NIJA 4K9PA 1H3NA 1WEHA 4KPGA 2XIQA 1G8AA 4CF5A 4DG9A 1RRKA 2Z6QA 4F04A 3WWYA 1N4DA 5HDQA 2XQVA 4N49A 5HKKD 1OW3B 1CLUA 2YYYA 3TTUA 1Z6PA 2CHUA 2IBMA 1DU4A 3QHAA 3VGJA 3G9XA 1T4BA 4O2BB 4DUYB 1VPWA 4L9SA 4YCSA 1D03A 5I9BA 4KKVA 1SIUA 1XZKA 4BWYA 1A5BB 1K08A 2HQOA 1NR1A 2BBTA 2OHHA 5I5EA 1SHUX 4RHFA 2ILTA 5K0EA 1SZJG 3IEXA 4IVRA 2NUBA 4PAMA 5ERYA 5C1IA 3ROQA 3V1MA 4BLSA 5K05A 1QP7A 4M87A 2E4ZA 1U31A 4ZOLA 3HFGA 1Q12A 2VNHA 3GLHA 3L04A 4EFLA 1O95D 1RE0A 3PGLA 5G0TA 4MGZR 1E3MA 1VKNA 4PC7A 3ML1A 1F2TA 2D1TA 2NU7A 3RKSA 5AVUA 5KDOA 3ADCA 4BVHA 3Q8XB 2I2XB 2B8WA 4XI9A 1TF7A 3NIFB 5H59A 4FNAA 4DXAA 2CLEB 4P34A 4XX1A 3VAAA 3AF0A 5FOUA 3AXSA 2MSDB 3OZ7A 4BVGA 1F5NA 3CO5A 2H00A 2X0KA 3KKOA 3E7DA 2Q1XA 4L5IA 3NVMB 2IK8A 1V48A 4Y2XA 5EE9A 3CWQA 2ZRQA 5BURA 1CR2A 3GMTA 2Y0PA 3WGKA 4Z4IA 5CH3A 3AR3A 4F6CA 4JVNA 3AHIA 3RS9A 1WB6A 3MTAA 3TQTA 5CXQA 3OLYA 3H13A 2GN4A 1GQQA 2MYTA 4I1YA 3NHLA 2WVHA 4TLAA 4B6OA 1QYWA 4NMWA 5CVVA 4OGLA 3SIWA 2HR1A 4UMDA 1M2HA 1VYUA 2J41A 4BPRA 6PFKA 5L4LA 3A6KA 3FTEA 1GUYA 4GX0A 3SQOA 1L5WA 2BTEA 2P65A 2XUPA 3D8HA 1MFPA 3I39X 4KV7A 5KSWB 1TIKA 1XIVA 4ANFA 1ZK0A 2ZTMA 1ILEA 1TLTA 2XVXA 3A9RA 3R4CA 3G23A 2WW8A 2MCFA 3ZX5A 5KKCA 1YZFA 1U7ZA 1KAMA 5EXXA 3CX3A 4MDYA 4U7TB 1RLUA 2J32A 2WTMA 3ISVA 1TZBA 5F7XA 1JWAB 1R4MA 1TRHA 4IGIA 4DBLC 1DMRA 1WA5A 2O52A 4XZ3A 5AP9A 2YMPA 1X7WB 4FU0A 1M66A 1XZIA 4JZYA 4CMHA 1M0EA 1L7NA 4KWIA 4M3NA 4B1FA 2ZIVB 5IKXA 4EJMA 1TA4A 1VE5A 2IUSA 4N8DA 4WXEA 3GF4A 4Q3DA 5F9HA 4FI3F 1E9EA 4ID9A 2FQWA 1PYDA 2UYYA 4I3GA 1CEYA 3OH8A 3ENWA 1E0JA 2GARA 3IOCA 3DCIA 1FL9A 2X5XA 1ADJA 1JDTA 1FYWA 3ZCTA 1NDUA 3DVSX 1KERA 3TKAA 3IOMA 6LDHA 2HLHA 5F7OA 3IIJA 3KU4A 3B1XA 3M4ZA 5CXSA 1Y7HA 4WADA 4EMUA 2XUIA 2ZPAA 2I9PA 5BVGB 1K8YB 2GJ4A 2OO5A 3KJIA 5JLJA 1ODIA 4CN9A 5K8IA 4M83A 5SZKB 4YHBA 4HG2A 2W6QA 3SICE 3IE1A 5FLYA 3D3WB 3GLRA 1QHXA 3ELUA 3C8HA 2WMNB 2W2MA 4V1CI 4UBNA 2X5OA 3O8OA 3R3SA 5LDGA 2MSKA 1D04A 4EMTA 3ZHZA 2D8MA 3U13A 2QTNA 2VK8A 5B1YA 1PUIA 4CKWA 5FOVA 3ELDA 5IMSA 3K70D 1S8OA 1TO2E 2V6FA 3CVUA 3FWZA 4U2CA 1BE8A 1BKSB 2WP8J 4E4YA 3IMCA 1DOAA 5LDDC 2HNBA 821PA 4CDGA 1YCFA 3QEOA 4W5WA 2AK3A 1R7RA 1D4FA 3WNZA 2GPAA 1VI5A 4U02A 4TZ0A 4GT1A 4LPSA 3PQ2A 5JAQA 3V6MA 1CRZA 4YMSA 4TYQA 4LE1A 1MO5A 3ABIA 2EQBA 4MPRA 4WACA 5AVZA 3WWDA 1GVNB 1CEQA 1VJ0A 1XTQA 1ZH2A 1PFQA 3OTOB 3SOZA 2IY9A 2CBZA 4RD3A 4ZGGA 2Q8QA 3MQ4A 2GRAA 1MOPA 2NUPB 4OF4A 2PM8A 2JAUA 3EUEA 2RE8A 3V2IA 3WL5A 3FRHA 5G3YA 1C7RA 3W8RA 3GP3A 4R4JA 3WGVA 3L8EA 4WBXC 1YR8A 2LBPA 5DBGA 1MQ9A 1DUVG 1WZUA 2LTAA 1NQ5A 2AZTA 5CX4A 3U40A 1MX5A 3W2TA 4WOBA 3TZKA 1A4IA 1ZL2A 3JR3A 1M34B 1T4DA 3S1LA 5JHGB 3ORQA 3LCUA 2ZIAA 2FU5C 2CNOA 4NCJA 2FEMA 3SIRA 4WX2B 1TCVA 4B2YA 4CNBA 3THWB 3E9ZA 5BWNA 1Q91A 1NI3A 3CRRA 1GHTA 1Q0SA 2FJPA 2ZIGA 3T8YA 3VC7A 3VJKA 3KTAA 3L8YA 4BNUA 2XJ9A 2NADA 4ESHA 1AS2A 3C43A 4ZI5A 4R3WA 4KR3A 1XPJA 5K3OA 3LF2A 1SQ5A 1P6UA 1ZOLA 2F8LA 2FMIA 1FMJA 2ZTLA 3G0IA 4ZEXA 2J5XA 2ZLBA 1JFTA 1ISRA 4RKQA 2QOEA 3QKSA 2XRFA 1JYFA 1KOJA 3R3VA 4E4TA 3AFNA 5IDXA 2AR0A 3O8LA 4EFKA 1YFLA 1GXSB 1R2QA 2I67A 4KQ1A 4CMGA 3L05A 4E7PA 1LNQA 1S2OA 4B7CA 1H8ED 4P5DA 3EPHA 1W59A 3W0LB 1M3SA 4PO8A 1ODCA 4NJMA 3ZV5A 5I4KA 1QZ3A 3W78A 1QIIA 1ZBDA 4YCDA 3ZI0A 5HKBA 3A70A 3KPVA 1OI4A 2MYUA 3MT9A 1N2CE 1JHRA 2Q1UA 2RHLA 2CBGA 4KBYA 2TMKA 5DGIA 4B3RB 1YRAA 4ZVTA 1LW7A 3PDHA 1CDZA 1BAPA 4DQDA 2N3ZA 2UZ0A 5F3RA 2O5RA 1JSCA 2JLRA 4P83A 4WNYA 4YMHA 4J8PA 1AKEA 2J48A 1K97A 3L0ZA 4ZAGA 4G0VA 4HSEA 2WV7A 1TVKA 3I6MA 5C7LO 1UPTA 4M8SA 3U09A 4YTEA 1V5WA 1U7DA 1B16A 3PFIA 4M8LA 1MB2A 3ICCA 3RB8A 1XDDA 4YJ3B 4Q3OA 3MS2A 4QUJA 4U2DA 1J5PA 3KP1A 1JE1A 4UEKA 5IBRA 3D54D 1GNPA 4GPZA 3SVZA 4X7RA 2RGXA 3CE9A 2H92A 2JB9A 4M38A 1R12A 4LF5B 4TLDA 3GEEA 3RFUA 2W6ID 2G71A 2JAXA 1KR2A 3FPLA 3VISA 4UM9B 4KH0A 1UKAA 1Y89A 1L5KA 3HPQA 1KE1A 3T41A 2O8VA 3GNLA 2HRQA 1UM9B 2ZOSA 1PJZA 3RS4A 1PWHA 1UADA 1UBUS 5DPMA 5F73A 4MP6A 5I6DA 3LLCA 3QMWA 1Y9AA 5KX5A 3QG5A 2GAAA 1A8HA 4ARZB 1DCMA 4BMDA 2E4VA 5BWBA 1CB0A 5JVDA 1E1LA 1P3Y1 5K09A 1I4DD 3W5JA 1WDMA 3TOSA 2ZI5A 4RCZA 3DO5A 3W79A 3I72A 4YT2A 4DSUA 3VRHA 5ADUS 4PZ0A 3VPCA 4R3NA 1JHXA 1NJ2A 1Q84A 2EJBA 2OCDA 3LBYA 1GPLA 2HMTA 3SS8A 3TTSA 4CQLA 2EVWX 3FD8A 3LW8A 4I1OA 4BMVA 4RMIA 2C8JA 2RGEA 4F4FA 4QUIA 4Z1OA 2MSWA 3FSEA 2IF0A 1CRLA 4QHYA 5AXBA 4QPDA 2HJWA 4MULA 4EYGA 4OQFA 3SG0A 3SYLA 2FWMX 5P21A 2HXGA 3G2OA 4IMJB 2AZXA 2FSVC 2GN1A 3AQIA 3L6CA 4M9CA 1K1EA 2GZRA 4RTPA 2O8EB 1UINA 1KDRA 2QL7A 4Z99A 2JGDB 2FZCA 4O2AF 1YB6A 4A8TA 3PDIA 4BV2A 2WYVA 5GADl 1B26A 4Q4JB 1G41A 5HIMA 5KDLA 2BFFB 1OA1A 4WFKA 5AXCA 2PZAA 3BORA 5FUVA 2N46A 1AXEA 2BR3A 2ID9A 2HSWA 4CF3A 3CA8A 1UKEA 1FNNA 2H85A 4D3YA 5A5VA 3D7NA 2QUAA 3SX0A 3SVLA 4HMQA 1I33A 4KREA 3DDSA 3OLCX 2ZAGA 1E8NA 5IN4A 5A9TA 3ZCUA 3PHIA 4OFWA 5E6RB 3ROGA 3M1LA 1OCEA 3N0RA 4M6WB 1OYOA 3WG9A 4AAYA 2DUJA 4BIMA 5J1SB 3FLAA 3IDZA 2XGOA 5EJ9A 3VTFA 4DMMA 4TXNA 5L6LB 5ICGA 1HQKA 5LZ7A 2YTZA 4EYOA 1TQDA 3I3SR 3WLPA 1UJBA 1MOQA 1X6VA 1N3IA 4FFOA 3F5FA 2IS4A 5GM2A 1FTGA 1K92A 3LUHA 4UU8A 3EFEA 2Z8XA 4WDQA 4BP3A 4ZT6A 3PXCX 4I9UA 3DVAB 3EBLA 3FNQA 3NVDA 4W7SA 4P4TA 5TV2A 5B3JC 2BD0A 1CJUC 4CTJA 5KKNB 1J99A 7MDHA 3WLIA 3KD3A 2Q2QA 4M49A 5DGCA 4BWVA 1QSGA 4DV2B 2I80A 4JX9A 1GEEA 3UUFA 1J0CA 1E7QA 1NPYA 2VK2A 3T3GA 1QGED 1K0FA 5KJ1A 3IAS6 3N2EA 1BOFA 3O94A 5AVWA 4QPJC 1BMDA 1FK8A 2H5EA 4RORA 5D1HA 3M3HA 5AICA 2WG1A 3NMUF 1VCNA 1U3UA 4HXFB 1NOJA 3HUDA 1XTRA 3GA7A 3LAWA 2CMFA 1A9QA 1GYPA 3NIWA 1NN0A 2NQ2C 1D8AA 4LYAA 4OREX 4NCIA 3GFBA 4XSHA 5FYQA 3HXQA 4RPKA 3MHTA 2Z6VA 3OSZA 4TQ9A 1EI9A 3QVGA 4IHJB 4CWAA 1X7YA 4YJ2B 4JUCA 3K09A 3RSLA 1DADA 4HGPA 2D5AA 5CLIA 2B3DA 2FZLA 3U1TA 4Q7JB 1L4KA 5KJ6A 3QXGA 4FFBB 3QRWA 2NN3C 3NU1A 4LOAA 4IVPA 4ZZIA 1I4EB 1IN6A 4MVJM 1NF9A 1OC4A 4G07A 4A2WA 1RRCA 3ICVA 3IKVA 3QKWA 3BWVA 5ADWA 5AW7A 1E96A 1ZM2A 3NOQA 1J9GA 4LRQA 3LCRA 1CR6A 3ZHCA 4UQPA 3MN1A 1U7PA 1U8XX 3KPWA 3TIIA 1NVXQ 2ZIWB 2LKDA 4AJHA 1YE5A 4Z9AA 1RS0A 1PW7A 4H7HA 4H16A 4K7JA 3E1GA 1UZUA 4O4HF 1H22A 1EHIA 2PH1A 3KBBA 3RWMB 4UEJA 4ASUD 1RXVA 5CEFA 2WUWE 3ND9A 4GUDA 3RNLA 1IBCA 3ZI4A 2YV3A 3FKJA 4EKIA 1EJ2A 3R5JA 4XKJA 3UG6A 3JASA 4KNWA 1RKXA 5LBTA 4WFIA 2BZ0A 3L82B 5JQWA 3RSQA 5KYNA 2C7GA 5AVVA 2AXPA 2JGNA 3EZ7A 2RBKA 2ZTVA 4MQEA 4YJHA 1TQ4A 1ZD9A 2GVDC 1PV4A 2A9OA 5DJ5A 1RXYA 2I6TA 5U1PA 5CA1F 5I8WA 5L3SB 3MRXA 3JQEA 1DEAA 3V4RA 4DDHA 2B8TA 1RC0A 4CG3A 4WNAB 4KSBA 3ZE6A 4G0QA 1QFYA 1U7OA 3ZGOA 1G2QA 1IPHA 4XUCA 4M9XA 5DYTA 1JPVA 3PSAA 1XDUA 1G2PA 3E9DA 4MVWA 1H4TA 4IFTA 4R84A 1UEXC 3NB0A 2OHIA 2X19A 3UPDA 4AG3A 3DO8A 2KB0A 4HDCA 3BTVA 3MS7A 4NICA 3T52A 4DCJA 4ICIA 4C14A 2VHZA 2F9LA 3HDHA 3STYA 5C1OA 4R1OA 2AUNA 3PTZA 1Y6QA 3GR6A 3WMWA 4U7DA 3UK1A 1XWIA 4FQ5A 3J7TA 4I6EA 4EW2A 4ENTA 2O5EA 3CB4A 5CNJA 3DHEA 1L3CA 3D43A 4ZIRA 1E4VA 4I1VA 5J9FA 1FVXA 3C6MA 1UFKA 2OQIA 1DTWB 3PNQA 4AF8A 1WO8A 1BD3A 1Y37A 5KYGA 4K2AA 5GWXA 5NLLA 1K3TA 3P2JA 4WE3A 1DKQA 1CUBA 1E64A 2VDWA 3PL5A 1AMOA 4I1SA 2P9ZA 3SZMA 1G4HA 5C31A 1NBWB 4MV7A 2JJ2D 2I4OA 2J4DA 3DQZA 3LKBA 4MUFA 4F1JA 5JZSA 2YXPX 5AW1A 3SMVA 5BWOA 1P5RA 4P3XA 4XWKA 5KINB 5DEOA 5CDSA 4LC0A 1RXIA 5BT8A 1AKTA 1GRQA 4GIBA 1QRTA 1ZN7A 1EFPB 4DPKA 4XCVA 3WRVA 1KZ7B 1NQWA 2C0PA 3IV9A 3PQ8A 4IGFA 3J81k 3Q8MA 4YDSA 2Q4EA 3DDHA 2Q5QA 4CMEA 5AIAA 2AZDA 2O06A 3PKJA 3B6ZA 4XLZA 4Z9BA 4HN9A 4HRXA 3B6IA 1FUYB 2RDMA 3GGOA 2I3BA 5IZ4A 3EPKA 3JQDA 2AJCA 4YV7A 2ICAA 1N6NA 4G4SP 4UOQA 1V45E 3BMNB 2O48X 3AB7A 1GV1A 1YR9A 3AY3A 4L9WA 4OHPA 1DO2A 1G7TA 2C4VA 3EISA 2H48A 1GIAA 1F4VA 4Y6PA 5FOXA 1SD5A 3TTWA 3GMIA 4YRKA 1GP2A 5FAXA 3T3MB 3EVTA 1VRVA 1Z83A 3TRDA 4N8SA 4F9EA 1KA9H 4B3HA 5HXAA 2QTFA 1ZM3A 2B78A 3MCAA 3I4CA 5EPUA 2O2XA 4HN4B 3MF4A 2UZ1B 2Z2YA 2F67A 2V45A 4QXPA 5ADHA 2H5JA 4CRWB 3NLLA 2CLCX 1WZ2A 2AB0A 3H9JA 4E2WA 2RAPA 1FDIA 4HDSA 4MSUA 1E77A 4RF5A 4TL7A 5CCBA 2J67A 3C3JA 3R6TA 4ECAA 3ZK7A 1QVAA 4WINA 2BIFA 3HFSA 4HLQB 3UQYS 1QGOA 13PKA 4AICA 1KARA 4BVFA 3HZHA 1Z68A 3X1JA 5BOVA 4Q4HA 2IEDA 1ORRA 1YJ5A 2JGRA 2P8SA 2QLNA 4G5FA 2IUFA 3ELWA 3C6BA 3BRCA 1IHYA 5CGQB 1PZEA 1AF7A 2HMVA 4Z3OA 2BEUB 3H6GA 4KRYA 1R0KA 3COVA 1EX9A 4H15A 2FJUA 3HKEA 2VDQB 2QR2A 4FB4A 1CR4A 3LY7A 3Q85A 3TEFA 2Y71A 4JI7B 3OFKA 3LWZA 1M10A 1UWCA 3CNHA 3I92A 3L4EA 3VOSA 1LTQA 5CDGA 1ZJ4A 4FFPA 3C39A 2MSNA 2HA0A 2RI6A 3ZCQA 1SEVA 3EXIA 4RSMA 1MKYA 4N8EA 2O2EA 1BJTA 1DTSA 1MAVA 1P19A 1P3JA 1RTKA 3MRTA 2HGSA 4MLDA 3MGAA 3C45A 4CR6A 3X43A 3AKDA 3C7AA 3ND6A 4M86A 3QYPA 3QXJA 4YWJA 3WHLA 3ZE7A 2GAIA 1QHSA 3ANYB 1P7VA 1XLTA 4Q7QA 4KUHA 1TLLA 5IKEA 3IKTA 1JIQA 3E70C 3O75A 3G8YA 5TX7A 1IWOA 3HLTA 2YVLA 3PTAA 1D2MA 1WBJB 2QPAA 4HDKB 2CKDA 1E1RD 2QTMA 3RVSA 3L7IA 2XDYA 1E7RA 4UUOA 5BORA 2G5CA 4UM9D 3RYIA 1XO1A 3VR5H 4LRXA 4J49A 4UNIA 1ZA1A 3VSBA 3QLJA 1WTCA 3PHJA 1EVEA 4PQEA 1CC1S 3CU5A 1KAQA 4PO3X 2WJVA 4B73A 4X93A 3WRXA 2F43B 4WCVA 2VJYA 3A4VA 4RTJA 2I2AA 1EWTA 3GEDA 3A4NA 2EXXA 1RADA 2WYHA 5GM1A 2SCUA 3WJ7A 1AHIA 4KAFA 4MJ7A 4Q03A 4QLAA 3N07A 3DLPX 1AUQA 1TJNA 3NDJA 3MTQA 4J29A 4KPUA 1X1QA 2MSEB 4ALIA 4YO7A 4K0RA 2PYZA 4FGSA 1YD7A 1F20A 3B51X 2I8AA 1FXSA 2FX3A 3CUYA 2PFKA 4Y6LA 1UFQA 2J59A 3L1UA 1DAMA 5ES3A 3VV2A 2FPIB 3N2GB 1MENA 2O2SA 5FWNA 3T7AA 1VPTA 4DLZA 3UPTA 3LKZA 4B46A 1WKCA 3FDFA 2B9VA 3L8HA 2EJUA 1JLHA 2CV2A 2QX6A 1KWKA 4KFCA 1ZEJA 3I32A 3LX4A 4ZQBA 2Y1WA 3EOBI 4YV1A 1B3BA 2QBYB 2Q6VA 4KDRA 1I1NA 2V59A 4HYTA 3SC4A 4O4LF 3EMDA 3HJBA 1OTYA 1IB6A 1L8AA 4OXRA 3NBQA 1MNAA 3BJRA 4JAVC 3Q7IA 1S2MA 1VIYA 4O29A 5KYYA 2Z2JA 3UHOA 4B6EA 1MA0A 1GCOA 3HB5X 4AX8A 4BU1A 2YY6A 3MFYA 3RYCA 2QP3A 1OX4A 3RWOA 1F8YA 1XZJA 2OFOA 2C61A 2V03A 5BY2A 3U0BA 5C37A 5ALDA 4BB5A 1D2AA 3K2QA 1S3GA 3NTVA 4K5QA 4A10A 3IERA 2AX4A 3AUKA 1V43A 1RWBA 4NC9A 1Z37A 4HNQA 4KJZA 2JLXA 4BRSA 5DYWA 1CP3A 1HDEA 1FNMA 2ERXA 1BFUA 5B1DA 2UVPA 1KJWA 1XTUA 1GL3A 2KI5A 2R4UA 3VA7A 3ESYA 3MW8A 4G0NA 1O5OA 2XTJA 2QVBA 4D0NA 2H63A 1VSVA 2VQ3A 1D09A 1E7WA 3NTQA 3EC2A 4B8ZA 4EY7A 3PPVA 2UXBB 5KCMA 1KMQA 5FPTA 1H6DA 1JTVA 4PY2A 4KR2A 3NIGB 4PAWA 4DE5A 5IVIA 2RKWA 3MUNA 3KFVA 1VMDA 2B1GA 1MHPA 4PWZA 1UXHA 5HK8A 1NATA 2VK1A 2XUGA 5JG7A 3GQBA 2QRNA 5HIAA 4DCGA 3MD0A 5EXDA 2H7CA 2R5FA 3RWBA 2FNAA 1FS4A 3LH5A 3VR0A 1V9LA 4HNAB 1AX9A 4E5UA 3F5MA 3G8CA 4JD5A 4NF2A 4XQ0A 3RVJA 4JI2B 1JQ3A 4HQKA 1KAGA 4MUXA 4XJVA 2Z57A 4MS1B 1E2PA 4BO3A 4IJ6A 4MPTA 5ARDA 3KL4A 3IBGA 5B7QA 2JEOA 1GZHB 2F2TA 4UAUA 1YKSA 2XTZA 5DN6D 2IZ6A 3LKVA 4PZ9A 4NJOA 5D5QA 5BYAA 3FZQA 2G9NA 2JLWA 4YRMA 3DTVB 1YZLA 4QPZA 1FFBA 1C8VB 2FEOA 3H0KA 2GASA 4EJSC 1Z45A 4NABA 1CUXA 3LF1A 1ZXLA 2P90A 4IX9A 3PUYA 2UU9B 1G5PA 1ENYA 1KS9A 5DSZA 3FKSD 2YVUA 3W9YA 3MEQA 5JNTA 4MI1A 1L8OA 1DIGA 3P94A 4CHTA 2ZU0C 4IMRA 2QVXX 3FSRA 1Z47A 1EP2B 1OZAA 3L0IB 1RFGE 4RMNA 4XR4A 3QX3A 5I8ZA 2IPMA 5CB4A 4ZTUB 2NVOA 5IWAB 2BGLA 2YW2A 3LNTA 4K1LA 2ZB2A 3CKKA 2REXB 5H5JA 5LB2A 1RWQA 2G72A 4UFOA 3M9WA 5D00A 3HJFA 1JALA 1Q44A 1Z4OA 3ICQB 2VDKB 4NONA 1ENZA 1MFZA 2FPKA 4E31A 2Q6LA 2P6RA 2A1TS 1ZUD1 2PO5A 1FP2A 3BGOS 5JMOA 1ZH8A 3BDIA 4BX2A 1MC4A 4ZQHA 3W5CA 2JIZD 3GLHB 5FOTA 3PF8A 4Z3KA 4IG9A 4LWPA 5DNVA 2I4IA 1YJCA 1RI5A 3SZOA 2NU7B 4TKLA 5KOHA 1CZLA 4UEOA 1Y4ZA 3ID6C 4CG0A 1VXOA 2NPIA 4US1R 2RJNA 3E9CA 1UDWA 3SF8A 3PPYA 3UJAA 2ZRMA 1L3IA 3OC0A 4BLQA 3RBXA 4YREA 2CE2X 4KXMA 1JECA 4NDNE 4LJ4A 3UV6A 2VDUE 4LXHA 1D2HA 2RCYA 4EYKA 1QP0A 5CXUA 1Q15A 3KQMA 3MM4A 1CUFA 2R1UA 5BO5A 3ZWQA 3BVPA 4DSAA 1RLIA 1SD1A 2I4TA 4E46A 5BN4A 3S6JA 4JITA 2PKQO 1J42A 2ZSJA 4HMOA 1C9MA 1E8DA 1MCZA 1TM3E 3NORA 2PZBA 4N5IX 1M8PA 1S1MA 4DMCA 3ZLJA 3U6BA 2ECOA 2RI0A 4KYUA 4P7BA 4X64B 4BE9A 1A4XA 5THQA 1ACJA 4BASA 4N03A 3L4SO 1GUFA 1KDPA 3AC0A 1TT5B 1PKEA 1OI2A 2BTQB 2IYXA 2JLBA 3I12A 4HWKA 4PYMA 9ABPA 1M2FA 3IYLW 1SQGA 4AG6A 3EQ7A 1HQCA 4KMMA 5DHUA 4A1OA 3CUKA 5JBIA 4LN1A 3FIJA 1T36A 3WC4A 1A3CA 4AXBA 4QARA 4CLEA 1KRXA 1YA8A 3G2PA 5JDIC 4AL4A 3RVLA 3PRJA 1FXUA 1R4MB 4KXUA 1M6VA 3SOPA 3UGJA 1V5GA 5KTYA 3TVDA 1FZTA 3HCDA 1K6IA 4PNEA 4UUAA 4MV9A 4Q39A 1WB5A 5NULA 2C3PA 3OIFA 5LZ9A 4BMOB 1S4QA 3BHJA 3KUKA 5A71A 4CUZA 2J0SA 1E4EB 4JVLA 1D2CA 3LBIA 2YHAA 5T8KC 2QU7A 3DQPA 4RZXA 4BXOA 3AR4A 3FCAA 5THXA 1NASA 4HDNB 2RGYA 3SE0A 1E2IA 3HGMA 4G5QA 3AL2A 4X1KA 1D1TA 4EEXA 4BTVA 2BEWB 3PE6A 3UKOA 2PSJA 4JLMA 5JAMA 1RMTA 1XRLA 2QN9A 5KI6A 1K66A 4Q7EA 3WYNA 1ZBQA 1ZN2A 4EJ2A 1P18A 3I2HA 3GJ3A 3WGJA 1MJGM 5LMUB 2JK1A 4V2IA 1DV1A 3F9IA 1DBQA 3IBYA 4IIXA 4DR5B 2OLJA 5CA0A 1QCCA 1QVWA 2X15A 1S89A 3ISJA 4MTLA 1H2RS 5KKAA 1GUZA 3IUBA 3WADA 2B25A 5B55A 5CG1A 2UUPA 4C2UA 2CXUA 3F7MA 4R2LA 4M0DA 5DBFA 3WNDA 1NNUA 3WWCA 4A82A 5LQNA 2PDAA 4MJLA 4YMVA 5IWCA 1Q1NA 1W5SA 1Z7WA 3DFKA 4O33A 2ZJ8A 3SHOA 4ZOAA 2X0RA 1DKNA 4JJ4A 1LPSA 2EKQA 3PGA1 1KI2A 3TNFA 1C9DB 2Y6UA 3QTLA 4FT4A 1XU9A 3FF4A 4Q1BA 1NUAA 1I7LA 4CL2A 1SKUA 5A05A 1QG6A 2FQ1A 3UAOA 2NUAA 4OP2A 1XMXA 3BRWD 2G82A 1USKA 3DPSA 4MA0A 1AQNA 1EK0A 3JX9A 3ZDZB 4R5MA 3B60A 2PO7A 4TUYA 3AV0B 1KJJA 4UPVA 3L8FA 3JWIA 2BN4A 3GYGA 3PQDA 4DLXA 4HDAA 2DHRA 3OEED 2BGTA 3NM4A 3EMBA 1N5JA 3C16C 1SVKA 5SYNA 5DTEA 4ZT4A 1EK6A 3FOZA 1CUUA 1G21A 2X8WA 5EE0A 1GPJA 4JJAA 1T5BA 3HBLA 4I46A 3L7DA 4RJJA 4MX8A 1LTKA 2DFTA 1P0MA 2ZEJA 1GAEO 1NPDA 3I2JA 2GUGA 5EKTA 5KHLB 5KVVA 1XPOA 1DBPA 4U00A 5AO9A 3I9KA 4MAFA 2E55A 5FPPA 3HBMA 2J3QA 2OB1A 4LECA 4MIYA 4NZYA 4OSOA 2XI4A 2YZGA 1ISPA 3F4BA 1JWLA 2GM4A 4I4LA 1RABA 2VKTA 4K86A 2XVMA 3L5KA 2JCSA 5FXMA 2AW5A 3DDWA 3LPLA 3F6PA 5KNBH 1X1CA 1JU3A 7REQA 3PX2A 4LDPA 4WASA 4RTKA 1NZDA 1Z4QA 3G85A 2XNDA 5T3UA 5LXTB 2MMGA 4QC2A 1E2GA 1L4MA 4K87A 4N6GA 2OQVA 2H0RA 3QKSB 5AIBA 1HYHA 1MEJA 1JKXA 2Z2ZA 3AIOA 3BMCB 3NOVA 4PX3A 3TM4A 4B3XA 4BP9A 1XZGA 4Y2QA 2HKIA 2QJTA 4KE8A 4D82A 4KXFB 1HQYE 3TE6A 2WUFA 1L5FA 3CLSD 1RT9A 2YXLA 3K05A 2ZE7A 3H9QA 3HCPA 4RDCA 3TVYA 4EPRA 1NYTA 1TA0A 3EZFA 1YKGA 4KWTA 5E6UA 1VBMA 1WXXA 2WJ3A 4KQHA 4XJTA 1OKKA 1C1XA 1SRQA 4C0KA 4D9KA 4IDNA 5J58A 5C5EA 1M1YB 2WYOA 4I5GA 2WWGA 4LJLA 1YC2A 3TQQA 4ARVA 4DUGA 5JSZA 2HB6A 3AZOA 4HH4A 1GTG1 5AJUA 4XARA 4DJDC 4WTOA 3C2QA 1MW9X 4DJTA 4QTTB 3DDZX 1TVKB 2BONA 2PPLA 1LS6A 3DUFA 1IN4A 4FHZA 4KIWA 5ALFA 3HXOA 4CG1A 2P8JA 2ATXA 4C1NA 1C9KA 3BK2A 4H9GA 4CKCB 4I36A 4FE3A 1RRPA 1LDEA 5IJWA 1I1HA 4XQCA 3P9IA 1I9GA 3KYJB 2CB9A 5BQ3A 3L43A 4J0EA 4OV6B 2PY6A 1O6GA 2VK4A 4QGAA 1GZ7A 3MRVA 1I8TA 4L5AA 2R8OA 3NYRA 1WMEA 3VJLA 3FHLA 2VJLA 4NSNA 5A6VA 2PCJA 4HNRA 2G5TA 1IYZA 2JARA 1DAFA 4P5EA 3RREA 1IVYA 5KX5B 4OHCA 1G0OA 2C82A 1W49A 4D96A 3CC8A 1K9VF 3BE6A 5JVDB 2D4HA 4N5NA 1ORVA 3E1SA 5DISB 4P3PA 1O97C 1W25A 1M2KA 3SDSA 1ID8A 3CH4B 2K2QB 3GDFA 3PNLA 4U5XA 3B1YA 4CQLB 1UWLA 1P7YA 2Y6VA 2P3OA 1WULS 4ZWNA 4ABTA 2DPXA 2FG7C 3AWIA 5IJ9B 3OA0A 4M98A 1U6KA 3IBCA 4EF6A 1E79A 2Q0SA 3EVFA 3T6KA 3AF3A 1KMHA 1NA5A 3F4LA 3RFXA 4M0PA 5AW8A 1V4BA 3ITDA 1Z8FA 3PJFA 4C06A 3OWHA 3NWOA 1Z4LA 3VC1A 3IQHX 3VKWA 4HNGA 3ABQB