5K09A

Crystal structure of comt in complex with a thiazole ligand
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
217
structure length
217
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Design of Potent and Druglike Nonphenolic Inhibitors for Catechol O-Methyltransferase Derived from a Fragment Screening Approach Targeting the S-Adenosyl-l-methionine Pocket.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 73
structure length 217
sequence length 217
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k09A00
3DUWA 3MCZA 5EHIA 3MB5A 5DLYA 4F86A 2QY6A 3KQQA 1RJDA 4C04A 4RTMA 3GDHA 3V97A 3B89A 5ERGB 4FR0A 9MHTA 3PS9A 2LD4A 5EPEA 1NW8A 5P8WA 4UOEA 2E5WA 4GOMD 3T7RA 1KP9A 4OBXA 1X1BA 1R6AA 1SUIA 3BGDA 4RVGA 3ELDA 4RX1A 4M7RA 2C7RA 2EX4A 2HWKA 5FA5A 1X1CA 1IY9A 3KPUA 2N47A 1NW7A 2AS0A 4RV9A 3BWBA 4OBWA 4KIFA 1KYZA 1VLMA 4LECA 5GM2A 3FPGA 3AXSA 1RJEA 2WA2A 3HCFA 3UJBA 1YFJA 1VQ1A 1WY7A 1WXXA 1F38A 2PWPA 3AY0A 3JWJA 4YV2A 2G1PA 2BM8A 1SVUA 3HA5A 5CVDA 4BY9E 4BP1A 3MCTA 3KQMA 3ME5A 3P2EA 5CVUA 2K4MA 2IH2A 1G8AA 3LECA 3WSTA 3UJ7A 4C03A 3EMDA 3NMUF 5IH3A 4P7KA 4R05A 2I7CA 2AOUB 2JH8A 5MHTA 4FT2A 3DXYA 3E05A 3H2BA 4PYJA 1ZG3A 5BP7A 4MTLA 3LBYA 3LSTA 4PGGA 3ER8A 4M36A 5K0EA 1ZQ9A 5T67A 5EIWA 1SG9A 5EQJB 1YUBA 2UYQA 2PGXA 5GIPE 1KPGA 2I6GA 5KQSA 3DOUA 3NTVA 1KXZA 1FPQA 3M33A 3LCCA 4X63A 2YQZA 8MHTA 3FPEA 2FHPA 2ORED 2PT6A 3DMFA 5K0JA 5EKXA 4GBED 2QE6A 1RI4A 2ZZNA 3TLJA 2OO3A 3KPVA 4E2WA 4OX9Y 3IEIA 4OQEA 1FP2A 2EJUA 1UIRA 2H11A 4U7TB 3AXTA 1UFKA 3CJQA 3GJYA 5T64A 5E2AA 5CVJA 3PT9A 3DULA 3TPZA 4RVDA 1JQDA 4CKCA 5FTWA 5GINE 1VPTA 3A7DA 3LCVB 3EVBA 3NW9A 5FQNA 3SM3A 4YV0A 1ZKDA 3EMBA 3CJTA 3C3PA 3KQVA 3TM5A 2P3LA 1PRYA 5DM0A 5LQKA 2CL5A 2A14A 2AR0A 3NDJA 4HTFA 3PX2A 5C0OE 3TQSA 4GOOD 4QVKA 1QZZA 4MQ4A 3A26A 2Z6QA 3HA7A 3I58A 3LPMA 3E23A 4FZVA 2O05A 5E1MA 5EIFA 4KRGA 2Y1WA 2IGTA 5EOVA 2XYQA 3HVHA 1WZNA 5HEKA 5ICFA 3PB3A 2PX8A 2G72A 3GU3A 5HIIA 2AOXA 1KHHA 1P39A 3HNRA 1VE3A 2ZFUA 2AN4A 4RTRA 3MQ2A 4GEKA 2NYUA 1KIAA 3ELUA 5E8RA 1JTEA 5KYGA 1MHTA 2DPMA 2EFJA 3HVJA 2AOVA 3O7WA 4IV0A 4XUEA 5EVJA 3QOXA 5CD1A 2O06A 4ER0A 2O07A 3L8DA 4PCLA 4OA5A 3BUSA 4ZTBA 4HSGA 2B25A 3P71T 2IPXA 3C6KA 4PYKA 3HP7A 3F4KA 3RODA 3CC8A 5HIMA 4AUKA 3NDIA 4QTTB 3R24A 1L3CA 3T7TA 4L7VA 2AVDA 2O0LA 4QPPA 4E2ZA 1IXKA 2V7EA 1BC5A 3P9KA 5DXJA 1FJXA 4YV1A 1B42A 2ZBQA 1BOOA 4HGZA 2B3TA 2YVLA 4YUXA 3CBGA 2ZBPA 1G38A 4K6MA 5K05A 3FPJA 5K8VA 4PWYA 1ORHA 2PX5A 3ELWA 5DM1A 1X1AA 3FUVA 3LBFA 3GRZA 4RTNA 1EJ0A 1D2HA 2BR4A 1NKVA 3KQWA 2DULA 2NXEA 4FS8A 4QDJA 3O4FA 3JWIA 4M37A 3NWBA 3EEOA 3HEMA 3KR2A 2OXTA 1TPYA 3EEYA 3TOSA 5M5BA 5CIYA 5FQOA 1R8XA 2VDWA 2QRVA 4Y2HA 2HNKA 1M6YA 1NE2A 3CCFA 3LHDA 3VYWA 3MAGA 4YUYA 2I9KA 1JSZA 1NW3A 1JQ3A 3G7UA 3OZTA 4FT4A 3M6WA 4FGZA 2R3SA 3I5UA 4RVFA 5LQJA 4WVLA 2IH5A 1R74A 3B3JA 3K0BA 5FCDA 1R00A 4BP3A 4YUWA 3GIWA 1EAMA 3SVZA 1NW6A 3HCBA 2ZZMA 3BWMA 5EG5A 3PVCA 3VC2A 5DTQA 4POOA 3GGDA 4WXHA 4RYLA 1O9HA 3UJCA 3GO4A 5DX8A 1RJGA 4PYNA 1R18A 1KR5A 3PFHA 4HG2A 4HTFB 5HIJA 5K0LA 3SSMA 3NJRA 1XTPA 4AZWA 3BXOA 2ZIEA 2GH1A 2PLWA 5KS2A 1JTFA 3TMAA 2BZGA 2PWYA 2P35A 2ZZKA 3FYCA 3HA3A 2H1RA 3TR6A 3LKDA 1XCLA 1RJFA 4ER7A 3CGGA 2FPOA 5EMLA 5JR3A 4YUVA 1RI3A 2HTEA 2XVAA 5D1NA 3CJRA 5CUQA 4EVIA 3GRRA 5DXAA 1X1DA 2AVNA 5DX0A 5F2NA 2KW5A 4RSRA 4R8SA 1QYRA 2AOWA 3BZBA 4F84A 4PINA 3SSOA 5DTMA 3KR9A 5LQNA 5ICEA 4RWZA 3U81A 3LDUA 4DCGA 1L3IA 1AF7A 3ID6C 4GF5A 5E8JA 3EGEA 3T7SA 2IFTA 1XXLA 1YB2A 10MHA 2VZ9A 5GIOE 1Y8CA 3OE5A 2OB2A 3G8BA 4X60A 5EC8A 2CKDA 5CVEA 3CKKA 3GRYA 4QPNA 2P1DA 4Y30A 4DCMA 3S68A 4EK9A 5K09A 5K0NA 4YMHA 1UWVA 2P8JA 3KPJA 3LDFA 2FRXA 3GXOA 3LCUA 3ERCA 3BT7A 1NBHA 3UBTA 3KQOA 3B3FA 5K0BA 4OQDA 4RTPA 1G6Q1 4GC9A 3M4XA 4QTUB 3SR4A 5B1SA 1EJ6A 4QQKA 2JHAA 2HV9A 4FSXA 1VP9A 4RTLA 4EKGA 1OR8A 3B5IA 1JG2A 1BHJA 3EVGA 1O54A 1YZ3A 2ZW9A 4HGYA 4KWCA 3UWPA 2BR5A 1RI1A 2GS9A 2P7HA 2PXCA 3EPPA 3HCEA 1TW3A 1NV8A 5EZSA 3FTCA 5DT2A 1FBNA 3OU6A 1VIDA 2PY6A 5T6BA 1NT2A 3DMHA 3MTIA 2QRVB 1IM8A 1R8YA 2IIPA 4GC5A 4E31A 2VDVE 3OPNA 2Z6UA 2XYVA 4JXJA 5EMMA 3UJ6A 3NVKI 1SQFA 4KDRA 5HIKA 5E1OA 3QOWA 4GOLD 2ZVJA 2AN5A 1DCTA 4F85A 4P7FA 3P9NA 3QV2A 3TFWA 3R9XB 2OBFA 1PJZA 2ZWVA 2GA9A 4V0RA 3UFBA 4RTQA 3G5LA 1JQEA 4DQ0A 2R6ZA 1XDZA 4MIKA 2P3OA 2IDKA 4CWAA 4KIGA 1V39A 3G88A 3RIEA 3A27A 3M6UA 2NP7A 2OY0A 3P2KA 4Z2YA 5ICGA 3G2MA 1VP3A 1VL5A 4GUAA 1XDUA 3OZSA 2YXLA 4IKPA 1SUSA 1NV9A 5U4XA 1KYWA 3G2PA 3M6VA 4GQBA 5FWAA 2PJDA 1NW5A 4ATNA 3AJDA 2IBSA 5JUWA 5K0CA 1RI2A 2Z6AA 1QAMA 2PXAA 4U7PB 2VDUE 5K01A 2IH4A 5GOZA 3PFGA 3P8ZA 4C06A 5CCBA 5DPMA 4E70A 3EVZA 2CMGA 2ESRA 1Q0SA 2GLUA 1Z3CA 2NNWB 3EVDA 3JWGA 4PIPA 2ZIFA 3BWYA 1FP1D 3TKAA 3LX6A 1EIZA 3MGGA 1AQIA 4KVZA 5LR6A 2ZCJA 1P91A 3HCDA 3UJ9A 4CTJA 4X41A 5H02A 3REOA 4HRAA 3DH0A 2Y1XA 4DF3A 2YTZA 5FADA 3A4TA 3HM2A 3K6RA 2IBTA 2ZBRA 4HH4A 2PX2A 3GCZA 3LGAA 5EZQA 3LDGA 1HMYA 2JHPA 3BGVA 4E30A 5EEGA 2O57A 2ERCA 2BH2A 2YUIA 1G60A 2PV0A 3GRVA 4CKEA 3DR5A 4DMGA 2YXDA 5GM1A 4LWOA 3SSNA 5LQCA 1AQJA 3EVEA 4DZRA 3FUXA 3OCJA 4XCXA 4R8RA 1WXWA 3O31A 5FWDA 1VBFA 2P3QA 5EHGA 2ZTHA 2NXJA 2ONYA 1YF3A 5CVVA 1HNNA 4V0QA 2I62A 3THRA 2OZVA 1N2XA 3R3HA 3C0KA 3DP7A 2G8NA 2ZIGA 2ZSUA 3GRUA 3KKZA 3I64A 4H0NA 3UZUA 4RTKA 3IYLW 1D2GA 3EGIA 3OFJA 4MHTA 3JWHA 1YFLA 3UA3A 3X0DA 4IV8A 3DMGA 2GPYA 3FRIA 3D2LA 2G71A 3KQSA 3G8AA 4GOND 5DWQA 5EMJA 3VC1A 4RTSA 3KQTA 3OZRA 3FUTA 4YMGA 4BLWA 3UJDA 4ER5A 3SMQA 5LQRA 4PYLA 5HILA 2NXNA 5GP1A 3TRKA 3FTEA 3MHTA 3M6XA 2YXEA 3LKZA 5ICCA 1DUSA 2AZTA 2GB4A 4PYIA 2XBMA 5EKUA 2CWWA 1INLA 2V74B 3V8VA 3KR1A 5CCXA 4DKJA 5KVAA 2NXCA 2AN3A 3KHKA 3E8SA 3THSA 2PT9A 3B3GA 3HTXA 5CM2Z 4QDKA 2B2CA 1YZHA 3G2OA 5EMKA 1NBIA 3G2QA 4PCAA 1KPIA 5LQAA 3PLAE 5FULA 2ADMA 2PXXA 1M0EA 4E2YA 2HR1A 3UJ8A 4PIMA 4ER6A 1I9GA 4RVHA 3DXZA 3HCAA 4CTKA 3KPYA 3OU7A 3G89A 2UYOA 5E9QA 2P7IA 2PVCA 1ORIA 2QYOA 4P58A 2BR3A 3I53A 5DRYA 2QM3A 5E2BA 5E9JA 3ANXA 3SX0A 5GWXA 1XJ5A 3EVFA 3P9CA 3P97A 4BLVA 5HZMA 2FCAA 2NP6A 3GNLA 4LG1A 1JG3A 5EGSA 3OFKA 4ER3A 2AOTA 2PKWA 3FPHA 1U2ZA 1P1BA 2PSSA 3HCCA 2XVMA 3ELYA 3P9IA 3RW9A 3SGLA 5DM4A 1XVAA 2YR0A 4O29A 3BKXA 3FYDA 5DSXA 2IDJA 1N7JA 1EQAA 3GWZA 3A7EA 4P7GA 5F2OA 3DLIA 2UYHA 2JH9A 5K03A 2C7OA 5FA8A 3EVAA 1I4WA 2FK8A 4XUDA 3FPFA 4C05A 3BGIA 3DXXA 3DTNA 3EVCA 3HVKA 5E1DA 5FUBA 2FK7A 2JHCA 3M70A 4PYMA 3MERA 3OE4A 1SQGA 1L9KA 2P40A 3B7PA 3I9FA 2ZLBA 3UJAA 1SKMA 4CKBA 5KQRA 2B78A 4AX8A 5K0FA 1BKYA 3ORHA 3KQPA 4FSDA 4PYQA 4C4AA 1WG8A 1M6EX 3FRHA 4X1OA 5DSTA 4A6DA 3KQYA 4PONA 3Q7EA 7MHTA 5F2KA 5D1HA 4ISCA 1G8SA 2CMHA 2WK1A 5BW5A 1DL5A 3Q87B 3SXJA 1JG1A 1XCJA 3FTDA 3FUUA 4QQNA 3E7PA 5DM2A 4B17A 3TKYA 1ZGAA 4EQZA 2ONZA 1ZGJA 4A6EA 1D2CA 1QAOA 4C08A 1G55A 4E2XA 3ER9A 4BLUA 2UYCA 3OU2A 2IP2A 4NECA 2YX1A 3FZGA 4RTJA 2B9EA 3C6MA 4FP9A 4OA8A 2OYRA 2P41A 4R6WA 5LSAA 4LWPA 4CXMA 2C7QA 2VP3A 3BWCA 4DM3A 5BW4A 1Q0TA 4XUCA 5IKMA 2WA1A 5DX1A 5FHQA 1XDSA 2EG5A 2FYTA 4MWZA 1QANA 4YUZA 3C3YA 5LQUA 2EJTA 1MJFA 4KDCA 4QVGA 3R6TA 2H00A 1JR4A 2OKCA 4PYOA 2JG3A 5G02A 4E32A 1L1EA 2PX4A 3AWIA 2OPBA 1H1DA 3LL7A 1X19A 1WS6A 1ZHFA 2AOUA 5FHRA 2BM9A 4EMSA 4X61A 1F3LA 3DLCA 1P1CA 3A25A 3IHTA 1JSXA 3P2IA 5E9WA 4R6XA 5EEHA 4E33A 2Q41A 1EG2A 5DTRA 4M38A 5HFJA 3IV6A 5DRTA 2F8LA 2XYRA 2PBFA 4KW7A 4DA4A 3UA4A 3R0QA 1AV6A 2VS1A 2GAFA 3NWEA 4G56A 2OB1A 3EGVA 5HOQA 3G5TA 2UZ4A 5C9ZA 1KPHA 3BKWA 2AOTB 3CVOA 4AZSA 2HMYB 3VSEA 3KR0A 3FUWA 2JJQA 3NVMB 1O9GA 1TW2A 5BXYA 1T43A 1I1NA 5K0GA 1QAQA 3PX3A 2G70A 4IWNA 2ZWAA 5E1BA 3TM4A 4PGHA 1N7IA 4RTOA 4P7JA 3KPWA 3HVIA 4AZVA 4HC4A 2C7PA 3FTFA 4C07A 5C1IA 2ZULA 3T0IA 3KU1A 4PNEA 3PTAA 1L3BA 1RI5A 4AZTA 4EKIA 1JG4A 3MTEA
chains in the Genus database with same CATH superfamily
1IBCA 1RQGA 1S1MA 4OCZA 3VR3D 1W9MA 1PVOA 3ZVKA 1XJQA 1I0LA 5CLHA 5FLKA 4NCJA 4PHTA 4W9NA 1I14A 3AP1A 2DJIA 3B8HA 2AF3C 2Z8YA 1J8FA 2BZSA 3KCNA 3WGUA 2JEOA 1P7WA 1MPTA 3B1XA 2I2FA 3RRZA 1ZD5A 2IYYA 2Q29A 3OZGA 4BNKA 3T7RA 4JVOA 2P9BA 3DWIA 1KY4A 1EFKA 1RWVA 2CVHA 4ZQBA 1V95A 3RWMB 2R5FA 3BMNB 4D44A 3BMCA 4UU0A 3E9MA 3UB2A 1JR3E 1XKLA 3GDGA 3ODPA 1KO4A 1KQ3A 2ZT8A 5CR9A 4BVLA 3S2YA 3CZQA 3S1LA 1NW7A 4GI1A 1LJUA 2JCVA 4UEKA 3SQLA 1KEEB 1MJNA 4FC6A 5ALDA 5K3BA 3FWHA 1EWTA 3DXFA 4FYWA 4LECA 5AW9A 4DXDA 4DR3B 1XVLA 1PGJA 1SVWA 1XZDA 1I3MA 3G13A 3L7MA 4LISA 4TTVA 3V2IA 1C9DB 1UAGA 2GHQA 1P72A 4Z7NB 4HPJB 5EQFA 3EQ6A 4CNBA 1Y1TA 5CFMA 3KQMA 4X8LA 4FW9A 2PWBA 1LDNA 3ZTTA 5KDDA 1GU7A 3N53A 5KSPA 3WNVA 1JWAB 4FNAA 4ENPA 2FPUA 3ZHVA 2IITA 3OPXA 2FG5A 2GJ4A 4M60A 2YJ5A 1U7ZA 4YRDA 1IUOA 5E3HA 5JMWA 5CH5A 5K0EA 2H07A 2NSHA 3L6EA 3SG0A 4UQLA 5AKGA 3TR0A 3GY0A 5FLEX 3OX4A 1UANA 1O08A 3KTOA 3Q10A 4OAPA 2PTHA 1UT8A 3V8PA 1YQTA 4Y6PA 3WL7A 1CUFA 1J9GA 2C2HA 2RGUA 2PT6A 1US8A 4YMLA 3ZV3A 1SELA 4E6EA 4CM1A 4DQKA 3KPVA 2WUVA 4E2WA 4WASA 1OGJA 5D5QA 4BB6A 4Z4GA 3AXTA 3CUVA 3LJKA 3COZA 5L3QA 3CJQA 3A9TA 4M1WA 1WR8A 3DULA 1KI6B 1T2AA 3HFGA 3QX7A 1NQUA 4EG1A 2GGSA 1W0KD 1NVVR 3TSAA 1VPWA 3MUNA 1M2WA 1SXGA 2AK3A 1U8FO 1XZFA 3O4GA 3QPCA 4JBNA 3VKFA 2CL5A 3ZIAA 1Y6RA 3NDJA 3KLPX 4ETMA 2VHQA 4R0VA 2WWGA 4CVNA 1CXZA 2Y1GA 4LRQA 3A26A 3UKDA 3AF6A 2RGRA 2DZDA 4BQRA 5AK5A 1U0GA 4Z53A 2C4VA 3HYCA 3AOEA 3OIVA 1FS5A 2PANA 4Q9KA 2JFWA 4BWGA 1L7EA 2W2OA 3VPGA 2P9CA 5ICFA 4PRKA 4F92B 3U1VA 2LIPA 4PBTA 3P9SA 1HUQA 4E07A 4PPYA 1G64A 2LGJA 3CEMA 4IUYA 4J6FA 1PI3A 3GC6A 3HNOA 3IOBA 1OC4A 4IDOA 4U8HA 4RK6A 1XU4A 3AI3A 3FAZA 4PLWA 3GFFA 2DPMA 2PG3A 4QDUA 3BMCB 4D8UA 1SBZA 1J0DA 1DDOA 5LWHA 4GNKA 5CD1A 1A9QA 5CPFA 3SC3A 1JDVA 2GSDA 4B87A 4AUEA 4AAYA 3TGLA 1V96A 4FHGA 1DXYA 4FSHA 3UJ3X 1JR6A 2Y76A 4PPFA 5A4KA 1SVSA 1I7QB 4R5MA 2A1TR 3OA0A 3OEWA 1E2LA 4YAOA 1PFWA 2PUCA 2HF8A 4E2ZA 1JA9A 3NHRA 4IQFA 1XCMA 4JR2A 1N0WA 2CFSA 4JVLA 3LF2A 4G89A 2C4TA 2WMDA 4Q4JA 1YQGA 4KPUA 1DQSA 3R5TA 1YBMA 5FKJA 5IM4A 3N8DA 1DRWA 2WWRA 3G9ZA 4EPRA 2V4MA 3BL5A 4S1OA 5F9MA 1NWHA 5A02A 1QM5A 1VDMA 1IYZA 4EP1A 5E7QA 2YZGA 2ZI5A 3D1LA 4I4LA 2XUZA 3OETA 1ZMOA 1ZGZA 5F7XA 2A9QA 5ALLA 3RSLA 4OBEA 1X7XA 1CVIA 2UXDB 1RXWA 1KVQA 4YUYA 4QRDA 2WP0A 3B8EA 4TKVA 4QUJA 1P6QA 1PGNA 2V9PA 5HBRA 1YR8A 4RVFA 3I9JA 1JJFA 3QXCA 2JLWA 2B36A 1PFKA 5JATA 4BFCA 4EY4A 2RAFA 5L3QB 1JDBC 3AUFA 4TS9A 3UENA 2C03A 2HBYA 2XDYA 2M1ZA 3T7DA 3G1TA 3L4SO 3PVCA 1P2BA 4WXHA 4BFLA 1O9HA 3OG9A 4OMFG 4TGLA 4WE3A 1MW8X 4XIIA 1IOWA 1XTPA 3ET4A 5I4IA 4X92A 5I9NA 1Y7HA 3EW9A 1M54A 1XTQA 1ENPA 2OAQ1 4RXMA 5TQ0A 3ZBPA 3IBFA 3AJ9A 4WNIA 1EXDA 3F7OA 4GOXA 3TDMA 1NUUA 1S7CA 2JBHA 1E9BA 1YDEA 1ZUNA 4IDPA 1MTOA 4RY2A 4X6UA 4K0KB 5AXCA 2IHYA 4R8SA 3IE1A 2GTIA 2AOWA 3F3KA 4L9SA 1UMBA 1DX4A 3E15A 4I1YA 1LX7A 5LLDA 1UEXC 2DQZA 1U0HC 2HMAA 3M83A 3QE4A 4P4UA 2GTPA 3L0PA 3R4VA 1HLDA 1X7GA 5ICEA 1OB5A 2ZEJA 4M49A 1GAWA 1WPGA 3QTLA 4L9RA 4ZAFA 4GRIA 5DLEA 2VZ9A 5F73A 5B7PA 1JILA 1JAHA 3COJA 4QE3A 2X9GA 2HSWA 4TSFA 3W2EA 5LZ9A 1N2SA 1EG7A 1M1YA 2XB6A 4BX3A 4ZREA 3S4YA 3U48A 2QJWA 4GP6A 2FRXA 2Q0SA 3QFSA 1EK2A 4AJIA 3ERCA 4G2TA 2JARA 1D6JA 1ZMTA 1Q1QA 1U28A 4TVKA 4Q4JB 2C2WA 4D9EA 4PRLA 4EKGA 3QY9A 3ORYA 1YZ3A 3JRWA 1BXGA 4EZIA 3V5NA 2GZAA 4MYRA 2P9ZA 3VC3A 1DIBA 3E2MA 1P1RA 3IUYA 3O73A 4U2GA 4PY2A 5DNDA 1T4CA 3MK31 4R69A 2D1SA 2QU7A 5CYGA 3O92A 3TSWA 1ECCA 1VIDA 4S0XA 1AHPA 3F4LA 2BMEA 2I2BA 5F5NA 3MTIA 4IMJB 4RCVA 3DPUA 2HKIA 4EIWA 4DXAA 3AVWA 2BFBA 5CU7A 3IC5A 1X7XB 1YVEI 1SQFA 1P1FA 5G3ZA 3OSUA 4E1VA 4LTNA 3WDKA 2GNOA 4TKVB 2ZVJA 1P4AA 3DOOA 2C00A 2E3JA 4AJJA 3BGSA 4GYYA 4A92A 3WRYA 3AF4A 1CUJA 5EZ5A 1MX9A 1ETHA 4J07A 4LC1A 1CP2A 3RQIA 3G5UA 5B58C 1EYZA 3OM9A 4KV9A 2ZR0A 1YNSA 5AI8A 2VHWA 5KNLA 2JAUA 4E13A 3PLRA 4N4AA 3X1ZA 2VJDA 5I3CA 5AKJA 5CRIA 5TQ0B 4ZDKA 5JNVA 4HB0A 2E37A 1ZOOA 4HLQB 4HLNA 4K46A 1V8DA 4IXWA 4DZZA 1RE1A 2DWPA 4G4JA 2V3CC 2VF5X 2G9ZA 2QTBA 3JWPA 1P0QA 3V4OA 2X4DA 4PGMA 1ZUNB 4NBRA 5DHQA 4O5OA 2AD1A 5KQMA 4XIFA 3QSGA 4LRSB 4C0AC 3VSBA 3K8QA 1UMBB 4C7VA 1Z2NX 1PK7A 1C1XA 3G8DA 4ZGWA 4K9LA 2WR8A 4HYQA 1LWNA 3MCWA 3WB0A 1TRHA 2GVZC 1CUXA 5JNTA 3UJ9A 4KNYA 5IM4F 1ZRNA 4XYBA 1QVWA 5CEFA 1QZXA 2ZBRA 4LDAA 1YRYE 2QVYX 5B2ZA 3BCSA 2QS9A 2RHJA 5HR5A 4E30A 1U80A 3VV2A 5A06A 1CY8A 1M1YB 4YPFA 3R7DA 4UBKA 3VR5A 1B8OA 3B13B 1W34A 4J0GA 3UYLA 4CKEA 4ROSA 1KY3A 4BO1A 4Z4QA 1W0JD 1WKVA 1KVRA 4FFDA 3L05A 1TUGA 3KVRA 5FJIA 1CULC 2JGLA 3LFUA 4KPEC 3FJOA 2P3QA 1WW2A 2H8KA 3ETHA 2NXJA 1YF3A 2B1QA 1BXGB 1GZUA 2P4EA 1V2HE 1NBMD 2WZQA 3VZDA 4BE7B 1BNCA 5HKBA 1XKXA 1VMIA 2V3VA 2LZ0A 1T4CB 3H9JA 4PC6A 2CJWA 2IF2A 2OXFA 3NYWA 4RELA 2D7CA 1R3DA 4RZSA 3VPHA 1JLLA 1P4RA 2C82A 5HDQA 3KSZO 1JDSA 1GNVA 4IS3A 4GOND 2OFXA 3DDSA 2NSJA 1KFBB 3HK2A 1CY6A 3ONVA 5IXSA 3UJDA 4ER5A 3TDNA 3V33A 4B09A 4EPTA 3OMLA 4ETIA 2LCQA 5E9AA 4LPSA 1J56A 2NXNA 4MHSA 1WNTA 2C4HA 2CE7A 5UKDA 3WA7A 2VLIA 3F8SA 5EE0A 4BMOB 2VI5A 1TDJA 2R8EA 4S1VA 1VIVA 1NOJA 421PA 4EG6A 3A0UA 2FW8A 2XWPA 3SEQA 3HVRA 1M6NA 4YP7A 4PLGA 3PFIA 2VQEB 1FUYB 3WYDA 1Z38A 1S2DA 3GEEA 4DGQA 2PUVA 3DNPA 4B34A 2GFQA 5J5AA 2GNAA 3EOZA 4W5OA 3LCMA 5EMKA 2Z5GA 3BFPA 4C0HA 1ZKMA 3DZJA 2W93A 2DPXA 3OPQA 4Y6GB 1NVTA 2HQRA 3FMOB 3IDFA 5KCMA 3VTKA 4CMEA 1IVNA 1Y33E 3P9XA 4G5QA 1KAEA 4HWTA 2A0WA 1SUFA 2V9ZA 3PVSA 2ZI4A 4I2VA 2B99A 1FVHA 1XL0A 1ULAA 2QN7A 3OX2A 5SYNA 3RS7A 1DRKA 1C1XB 2WKQA 3MLAA 1I1OA 3BA6A 5FUYA 3GNLA 1XZEA 4MW4A 4YACA 1MGPA 4WSOA 1S3IA 5BVHA 1FVFA 3S7ZA 1N2OA 2PSSA 1F17A 2N9UA 4IUBS 1CG6A 3B3QA 3SCZA 3AFIA 1GT6A 3B1VA 4P82A 5DWVA 5B1HA 5ALTA 5FYQA 5KNCA 1COWD 1XT6A 4L4RA 2OQVA 3DOJA 2P77A 4CKEB 1RBZA 1BA2A 4KR2A 1X77A 3T1YB 3N2EA 4X00A 1IE3A 5AIAA 2REBA 2X15A 5EUCA 1XHLA 3K1JA 2ZBFA 4M8KA 4W5RA 3IBTA 2DUNA 4Z54A 2M9MA 2G83A 1E5XA 4U7JA 3QXGA 4CKBA 1MQAA 3LY7A 3CSDA 4HGRA 4NWIA 3WC4A 1EP1B 5HQ3A 2LP4Y 5KTMA 1TX4B 3KRTA 2W2QA 3UYKA 3Q8XB 4R9NA 3H2HA 4WOPA 4NNPA 5EUBA 4IHKA 4BYMA 2Z6VA 1UCFA 1WP4A 1UADA 2CJWB 2NO1A 4KXVA 1WX1A 2PA3A 2WHEA 3ZCRA 1OLUA 1JLLB 1S7GA 3CYFA 3FTDA 3KK0A 4J2TA 4UMVA 4WDQA 5FNVA 3TKYA 5IHPA 5JCJA 5E4YA 1D2CA 4UUAA 4E5VA 3LUKA 2IP2A 1K9SA 2EFGA 2YX1A 3WJAA 1W87A 5HZKA 1Z5PA 3CPSA 2IKQA 2ZKLA 3GMDA 5FUQA 3SHOA 4CDNA 2EVWX 4P0QB 5CTAA 4XVQA 3HKBA 1W47A 3L92A 1X3SA 5DASA 2X77A 1Q0TA 2OBBA 1L5VA 6YASA 1HT3A 1TZ2A 3G2JA 3BH6A 3Q9NA 4RVSA 4RS3A 5CLIA 4CG0A 1UK9A 5CLJA 3PC2A 3C3YA 3IUMA 2CJPA 1MJFA 2YFHA 4QVGA 4V3BA 1L5MA 2H00A 1BGVA 2O5VA 2W83A 3QLTA 1KYVA 2OKCA 3F96A 4MMXB 1HYQA 3EY4A 3D6NB 5E95A 1OX5A 3G5AA 4FE4A 3V1LA 3JD0A 1U8ZA 4G4SO 4TLCA 1CUEA 1F3LA 2J4DA 4DLBA 4FCWA 3A25A 1YZFA 3P2IA 5F12A 2ZQ5A 2XT6A 2CV2A 3N1UA 4DXHA 3L7OA 1NU6A 2XE4A 5BPFA 1I4LD 4CMJA 1GGMA 2JA1A 3VVBA 2PBFA 2C07A 1PFQA 3GUZA 2VHUA 1K2WA 4X1YA 4LE2A 3QVTA 4UZFA 3NWEA 4EKEA 1E1DA 1QRDA 4H7KA 4OM7A 1IZ0A 1NHWA 1OKKA 2Q4TA 2VA9A 1U7WA 3BJEA 1WVMA 3AHJA 2GAJA 3DGFC 5BVHB 1PDOA 2ZYHA 1CTQA 1UBMS 3C70A 5BXQC 5DKFA 1PX0A 2JLRA 1XK6A 4U2EA 4M9ZA 4DA7A 1TQ4A 2DOKA 1N7IA 1QS0A 3HYTA 5IBQA 1TQ2A 3EEFA 1WUKS 3ZWQA 1OFVA 2PO5A 2W6MA 2XBUA 1NJSA 4BVFA 4OLAA 3KZMA 4QGAA 3SYMA 3W8DA 5I8WA 4XB2A 2RGBA 1MORA 2PRSA 3I76A 4EATA 2LKCA 1JG4A 1PWHA 4CKBB 1RLIA 3LYAA 5HQ3B 3B60A 3MOGA 3L43A 4LBYA 4ZDIA 1JDJA 4W5HA 1H0RA 3Q0TA 2HLDA 1YI8A 2GRJA 4EB0A 1EZ4A 4H6VA 1FU8A 1NMSA 4NZPA 2BONA 3RU2A 4RHTA 4YXWA 1OLUB 1O97D 4L3VA 5FNVB 2QTGA 1L6RA 2ZJ8A 3ZHYA 5EYPA 4INPA 4Y98A 3DLPX 2JGFA 5BSHA 2QD4A 1ANKA 2HWKA 1H69A 1UH5A 1SHJA 1XVIA 2OHGA 1TD9A 3IOCA 5DNYB 3FFXA 3K0HA 3HCRA 1GGVA 2QI9F 2VPWA 4C0QC 2OCYC 821PA 3HKBB 2IDMA 4F96A 4IJQA 5B3JC 4AU1A 4AD8A 3WVNA 4C4OA 1W1WA 1KI8A 3UK7A 1ZESA 3L8EA 1L5SA 4EFLA 4KO3S 1KF0A 4ZHSA 3T3OA 3BN3A 4Y3UA 2YQ4A 3H5NA 2YV5A 4B74A 3K2QA 3H5OA 1IN4A 3GJSA 1AXEA 3RFFA 2BSAA 5JXWA 2BAGA 2ZDHA 5KYWA 3O1HB 4OXXA 1ARZA 4R1LA 3QVUA 5JXJA 5MFPA 4G0ZA 1MVLA 2QW8A 3KKNA 3E05A 3RRYA 1J90A 5ITZB 3N7AA 4OGLA 4CGYA 2JFOA 3H05A 4D99A 3T6KA 2ZI9A 1O97C 1NOIA 3A1TA 4A1FA 4P4TA 2IPOA 2YRWA 4P32A 4TMYA 2WU1A 1WV1A 2X58A 1V4NA 4TMVA 3DOUA 5I9LA 1DC3A 3K72B 2OSBA 3IHKA 4HEQA 4NARA 2V6GA 4X1YB 3FPEA 1LDGA 1SUDA 4IVNA 4PG4A 1BSVA 4LYAA 1O2DA 3RGWS 1Z06A 2VJQA 3N39C 4HQLA 4ZANA 3ZNOA 5BNFA 3HACA 1NBAA 1P2TA 1TA9A 3QU5A 4YS6A 2BHSA 2GJAA 1NIJA 2QGFA 1R0SA 4BBPA 2PKCA 1QS0B 2WE8A 2ZVDA 3QLVC 1XU7A 1VPLA 3CT4A 4PICA 3STYA 3T4EA 5I7FA 4OHBA 3GRFA 1S9HA 3ESZA 4M7WA 3KYJB 1HDIA 1BH2A 4JBLA 4NL4H 4WLNA 5FNVF 1CDEA 3Q8LA 2B4QA 2ZK7A 3JVIA 3I58A 5C8VA 4X7MA 2ZTVA 2CNLA 1L7VC 2PEYA 4L08A 4WESA 4D8YA 1R4ZA 1Y4ZA 2GEKA 2VOEA 2DFTA 2PDAA 2VDOB 1P2UA 1C1DA 2EEZA 2J30A 2X2OA 3JD2A 4FGUA 4HGPA 3T5GA 3FSRA 4H7EA 3Q11A 1CSEE 4M9CA 1OV4A 3GR6A 1MVNA 3AR6A 4KSYA 4MYCA 3X1WA 4ALMA 5EYPB 1CUYA 3ONDA 3H0KA 4IF4A 4W4TA 1E7WA 1QDUA 3H42B 3QEKA 1P0MA 1CUZA 3QOYA 5DZSA 4QM6A 1PWZA 3TSYA 1DEOA 5TF0A 1C30A 2AJDA 1DUIA 1SBIA 1ND5A 3E4CA 4QSHA 4XWKA 4EI7A 3HJHA 2Q4EA 4RPCA 2JCXA 4L76A 2QT0A 4QU9A 1QGUB 2X7XA 2ATEA 1FF9A 4KE8A 4XEHA 3USCS 1D2MA 1DBQA 3KKKA 2MT9A 5CB0A 2IIQA 3CEAA 3Q6NA 4LEIA 3WIOA 5I7SA 1JHYA 1WLYA 1R27A 1EK6A 2W48A 3GOQA 3OZDA 5HK8A 3KLOA 1G21E 1Y98A 3OO0A 3THOA 3W9SA 4EY3A 3PQ5A 1RP7A 3SDZA 4V1CI 1E1RA 5DM1A 4EY5A 1FRFS 4C2TA 5FAKA 1EFUA 3KXLA 3MFQA 2NWQA 2NXEA 4QDJA 1ONPA 4TT3D 1N32B 3O4FA 4M37A 5M29A 1V8PA 4EGAA 1TLFA 2XCRB 1UFQA 1ADYA 4BB0A 3SD7A 2IXFA 3B6MA 2ZDGA 5TJ9A 1E2MA 1DP4A 3AVOA 3GT7A 4LJ5A 4JI1B 3TXXA 3LX8A 1XZPA 5JXIA 4M9XA 1J0BA 1EUYA 1GQFA 1MLDA 5JWRA 1IATA 1NW3A 1NVUQ 2CXRA 2OHFA 3G7UA 2QYTA 3ILVA 3OZTA 4PLCA 4O4HA 4H7HA 4MW9A 3NRJA 3K0BA 2CNDA 4Z4FA 3GNTA 1QHNA 2DB3A 1PHPA 5DK6A 1NJGA 1QUEA 5LQMA 1D5WA 1I2BA 1TM4E 2IIVA 1VC2A 3BWVA 4D9BA 2BV3A 5HS4A 1KJNA 1ONOA 3C7DB 4HWSA 4UDYX 4POOA 3M7IA 4RF2A 1TT5A 5LKAA 2AA3A 3G6KA 2A1UA 5AKXA 4TXNA 5L6LB 3KUCA 3RSQA 1NVFA 2GA8A 4DMFA 1TAQA 5JRDS 2E55A 1AS2A 5KQLA 3BTVA 5MDHA 1FQJA 3VKHA 4DUGD 1T9HA 4J0FA 1MBZA 2BZGA 2Q5LA 2JATA 4WESB 1WZEA 4KBGA 1Z13A 1IZZA 5C4IA 4LY0A 1PW7A 1GVNB 1CF2O 3HY4A 4CN9A 4I6JA 1Z7EA 2J46A 1C0EA 1Z6QA 4Q3OA 4TYMA 4ANFA 1C1DB 2X3UA 4TVBA 4JSTA 1SCBA 1SD5A 2XNDD 1ZRSA 3A1UA 3W5AA 2CN1A 1RAGA 1ZM9A 3GPCA 2KW5A 5A3JA 5EHNA 2ZIWB 1VLHA 2NU6A 4JWTA 1MMFB 1C14A 3ESXA 4F9EA 3A3YA 1DTWB 3CX7A 1M73E 4JUDX 4RO0A 1KP3A 3RC2A 3WAJA 3DLAA 1P1IA 3K30A 4ZWNA 1LXCA 4XOIA 1C30B 2NLOA 1PGQA 3U5ZB 1IM5A 1WQ4A 2YRFA 4YWJA 1RRFA 3PXDA 2ORWA 2ZU0C 1CJUC 3EZFA 2WPNA 4AECA 1J9ZA 3FGOA 4BVBA 4FZJA 3E35A 3LUPA 2PEZA 4KN6A 4M99A 5COBA 7YASA 1KDOA 2WWFA 3A3PA 3BXGA 2I1LA 4DJAA 3M4ZA 1C3JA 4RTPA 4UUNA 2PUEA 4RKWA 1GOTA 2ZRLA 2W42A 2GCGA 4GS5A 3PRKE 1AHIA 2MYUA 2JAHA 3QVVA 4KWCA 1MO2A 3D4LA 4OEHA 4QM7A 1K06A 2BCGY 3ROFA 1Z8DA 2MSDB 1SC3A 2GS9A 2Y0PA 4I81A 3G7NA 2GXAA 1RM3A 2ZWMA 4PFQA 1TAGA 5A62A 3C39A 1OYOA 4MX8A 2ENUA 3AF3A 1J4AA 3OE7A 1A1SA 3ZDXB 4E31A 3NVKI 3QBEA 5EMMA 3W5UA 2GK6A 1O95C 2ZYIA 2C5GA 1U2GC 3WGJA 5I7HA 4J4BA 4TQUS 3FCSB 3L4BA 4KPFC 5IYZA 3Q3GE 3JAMA 4YB8A 4O4HB 4QYSA 2IYAA 2O3QA 2NU8A 2VYQA 4FBMA 4JB0A 1QDLB 2OBFA 3AEQA 4L0DA 3T7EA 4C7JA 2RFLA 4S05A 2QL6A 1SG6A 2W6ID 3G5LA 1JQEA 3PNQA 3R9XB 4AL4A 4XWWA 3EJ6A 3KWJA 4CKYA 2GZMA 5PGMA 4MP8A 4KGZA 1XTTA 4Q7KA 5JT1A 4BPRA 3IA7A 1TT5B 4CM6A 5LJIA 1BRTA 2A1UB 3JQRA 1UMKA 2IYFA 3KAPA 1ISMA 3KKPA 1KMIY 3VO2A 3IHLA 1H8HA 4PQGA 3W5IA 1FA9A 3P9RA 3MZ0A 2KHZA 2XOEA 5C4MA 2GM9A 4GPEA 4IYRA 4B0PA 1M1XB 1Y42X 3GUHA 1F4VA 3DT9A 3MS4A 3G0BA 4BNZA 3WMEA 2PXAA 4Y1EA 1SRRA 2Y0DA 2VDUE 3PJGA 3VOSA 1ECJA 1Z29A 3VZPA 1G63A 5JW6A 3OEED 1EGHA 1MO4A 5F98A 4UNIA 5BUCA 5LQUA 1OIXA 2R8YA 1UMDA 2NU6B 2WHQA 2ZIFA 3FDFA 2A0KA 1PT8A 1V3TA 4YH1A 4DC0A 4A36A 5HIAA 3LX6A 2OGSA 2HN9A 5H3LA 3P9YA 1B14A 1FTWA 2ID9A 3LOPA 2W98A 3BIXA 1QYWA 4MWOA 2SCUA 2WYVA 4CTJA 2CEAA 3ZCTA 1NUAA 2P9YA 2YTZA 2I80A 4ZYVA 4G0VA 4C6HA 3GJZA 4UUOA 1WVIA 2NUTA 1SVOA 5I8ZA 2O57A 5ALGA 1R9JA 3ZI7A 4D3ZA 3A9CA 4H35A 1JBEA 2VHXA 1CNMA 5BSEA 5LXTA 4CF4A 5B1YA 3EY9A 3SSNA 2YRXA 4FYIA 5EQTA 3V8NA 5IANA 1QGAA 5HCUA 1YONA 1Z4PX 4LOKA 4EW3A 3S7TA 2G9UA 4MVJM 4TYQA 4JLVA 2PBLA 2WEKA 2VHZA 2YWXA 4I9HA 1SULA 4JP3A 5DP1A 3SNHA 4O4HF 4OAQA 3QOFA 3THRA 3Q5EA 2OWDA 5AM4A 3R3XA 3O3OB 3I64A 1VMDA 1F8XA 5BV2P 2N42A 1N3YA 1NVBA 4TZ0A 1WMBA 2JBAA 5DBOA 1SXJD 3CMMA 3O82A 4FBGA 2VUUA 3TLAA 3GRKA 5AIBA 1JVNA 2ILVA 2WVJA 4L3OA 4JA2A 2QRPA 3FRIA 2V3WA 4N03A 4Q6WA 2H2HA 1AU9A 3PXUA 4ZAWA 3TZLA 4DABA 1W30A 1IBLB 2NSYA 4A6XA 1GDTA 4R7ZA 4X6LA 5KZMB 4V2UA 3R0XA 3VX4A 4KQ1A 1REQA 4HB3A 5IYZB 2EIHA 4PYLA 3TJMA 4B2IA 3C87A 5GP1A 1V8BA 2NU8B 1M5TA 3PICA 3AEQB 4MMZB 1YA8A 2JFPA 1CNEA 4AMGA 3KFVA 2EQAA 3CVYA 3M9XA 2NO0A 4M9SA 1RRPA 1T9DA 1ZWLA 2XUIA 1DJPA 4UZEA 1EFTA 3EA5A 1LH0A 3OJCA 4HFRA 4MWCA 2VZEA 5DTIA 4NOJA 5TEVA 4QKQA 1M10A 1C29B 1M2EA 2IXGA 4PPQA 1I51A 2ETXA 3DS8A 4OHUA 3CW9A 3MGKA 1WB5A 4PCAA 2ADMA 4XFDA 3ZD8A 1ABBA 4XGKA 1T2FA 5DN6D 5EN4A 4R1NA 5LMZA 4OY3A 2VH1A 5B3AA 4LCBA 3VGJA 2M1XA 1GR1A 1RAHA 2H7CA 1ADBA 1UMDB 1HZZA 1ST2A 4AKGA 3W7AA 3VKVA 1C0KA 1ZVQA 2EGHA 4HMOA 1O8BA 5BMOA 4HB4A 4B47A 1A5BB 2NO6A 4Q1EA 3GYGA 1DXOA 2FQWA 1LQTA 2SCUB 4ML3A 5DLPA 3TDKA 3EIHA 4D45A 4F12A 2X14A 5DWDA 3KSUA 1NQWA 1W2HA 3QE0A 4BV9A 2Y9PB 3WAKA 2NUTB 3A1DA 1U3VA 3O2QB 1DBRA 1DO8A 4UXHA 3ST7A 3BQNB 1K5DA 4RAQA 1ZK3A 1CZNA 5LXTB 5A0TA 3RK4A 3WNBA 4Q9AA 2E4ZA 4A0FA 5THXA 3R5HA 1O5TA 5GAJA 3RWOA 4BGIA 1PR9A 2GOYA 4M87A 4HB2A 1ZOSA 4EHIA 3H0CA 3B7PA 3TQIA 5K7SA 2ZLBA 2QZSA 4B5LA 2WWTA 3D3EA 1D0SA 1O89A 2B6NA 5IYZF 3FFWA 1AKNA 1PEKE 1ZD8A 4M4SA 1PZNA 4MCJA 5EJ6A 5U9CA 1OAAA 1RYEA 2QHXA 3ZYZA 3C5EA 1M6EX 3RREA 4BAUA 1P1HA 5J47A 1W1IA 1SMKA 3KQYA 3BE8A 2DUJA 2JBAB 4WUTA 4BX2A 3RUCA 4X93A 1W36B 4XTRA 1GQOA 3A4IA 3IAXA 4B17A 4F8EA 4PHCA 1E2PA 4C08A 1LVGA 2EW1A 4BX9A 4G37A 2R62A 5C52B 3EBPA 1L9XA 3Q3JB 5BN3A 5GJWC 2C95A 2XGOA 3RD5A 3T1VA 5BRNA 2WT8A 1HX7A 4O4IA 1O77A 1BS2A 1R88A 1N6RA 1ZD3A 2DHRA 3CZ5A 3NAQA 3QUCA 2Q9CA 5KNBD 3RVDA 3NYIA 3QPAA 2O2YA 5JWHA 4JJFA 4A03A 3K4QA 2VSQA 4JKYA 4ND4A 2WA1A 4KEAA 4P2GA 4RCZA 2YXNA 5DX1A 4ASUA 3C3JA 1E2KA 1X1TA 2FE4A 3Q72A 5F7ZA 2QTLA 4EZBA 3ABOB 4YCMA 1QRUA 3IESA 2ST1A 4UXJA 2B8NA 4RJJA 2GHRA 2ONJA 4V39A 3N7UA 4Y1RA 5HKAA 2ZJ2A 4P5DA 1RQ7A 3DONA 1XP5A 5JANA 1ZX1A 2YJ4A 1R4AA 4EA9A 2J3MA 3I28A 1N6KA 3ISVA 4I1VA 4NPCA 2ZTSA 5HVNA 1ZHFA 3KZNA 2F8SA 5KYYA 1IBRA 5DOZA 4MUGA 3ZIUA 1EJ2A 3IUBA 4FFBA 1IN7A 1G8GA 1EWQA 2JIZA 1SA0A 4DWOA 1UFRA 3IVCA 3KEMA 5ED4A 1TVKA 3X44A 2O6LA 1DWPA 3AILA 5LXTF 1U1DA 3U6BA 1IG0A 2FF5A 3JQEA 3DMYA 1Q3KA 3WLQA 1R10A 2TMYA 3U2QA 1SGWA 2WD8A 2PN1A 2BI7A 2MYNA 5CHYA 1F4LA 3RJTA 3UAGA 3GPDG 2CXOA 4WAUA 2ATXA 1KPHA 1DFHA 3ZDEA 3WRVA 3HH8A 3AUAA 3MN1A 2QZPA 4M8NE 4N0DA 3UWMA 3PA8A 4P4LA 4EW6A 5FDFA 5JHGB 2FDCA 3K6SA 4EKDA 3F6SA 1NASA 3W6NA 4I4CA 2EKQA 3D1JA 1F6WA 4OJKA 4GUDA 3RS9A 3AGPA 4X7PA 3SEAA 3OKFA 5L45A 2HL6A 1BZYA 1JZTA 1QOZA 3EASA 4JFAA 2E5FA 4RPGA 4FNMA 3ZY3A 1W48A 1ZITA 3G0CA 1YJ5A 2J59A 2OQIA 4A10A 3MB5A 2OHIA 5BSRA 5TMEA 4KOAA 2ZBGA 4UQPA 2BTEA 2QT1A 3HCNA 1X0VA 2BP7A 4U5XA 3ZXUB 2BMVA 1XGKA 1W94A 2GZ1A 3FHLA 3QNWA 1BJTA 1JJIA 1OVGA 1T36B 1UAYA 4K6KA 2NU7A 5I9MA 1ZW1A 1M1YE 2VZLA 2XGGA 2DUWA 2OC4A 2ES4A 3EIFA 4FYPA 3K53A 4DR4B 4DLYA 4IIFA 2X4GA 3TCXB 5BN3B 3QWAA 4MR9A 3OLZA 2QNRA 2QRKA 4TROA 2X5JO 3IVXA 4O4IB 3DWFA 5DEIA 3ZHTA 4FDTA 4D82A 5T7BA 5EP4A 1I6LA 2G4LA 1G8JA 1WKBA 1Y4AE 1S9DA 2Z43A 2H63A 4B6GA 4EUKA 3C6BA 5F5XA 4D3XA 2G1PA 3K5WA 4MWTA 3DCYA 1XQXA 4FOOA 1R6UA 1BQEA 1OBHA 2V96A 5CIQA 4QUEA 4V38A 4Y1RB 4JFRA 1NE7A 5I5EA 4CEHA 4UUQA 2J5XA 3JTEA 3VNVA 4MAAA 1G42A 3BRCA 1OASA 2CMFA 4OYHA 4BTLA 2JH8A 5KYYB 3KQLA 1E1QA 4W7IA 4MTLA 4FFBB 4X3PA 1TA0A 3AUYA 6REQA 1SA0B 3I1JA 1GZ3A 1Q1ZA 5KWEA 1TVKB 2PPVA 4URVR 3P0IA 3KEFA 3UQYS 1I2DA 2XNJA 3I32A 4I5DA 5DDIP 3SHTA 3I3SR 2CHFA 1NG9A 1TCUA 2BFFA 4AULA 2XDWA 3I4CA 1J97A 2QVBA 4B3HA 4P6VF 1W0CA 5JMOA 3S0JA 3T5TA 2JEZA 1SM4A 2A7QA 2HGSA 4K5QA 4MJXA 3R5FA 1AKWA 4MR7A 4U7TB 5DO9A 3OTQA 2IZ1A 5DJ5A 2X9LA 4DNXA 3K6SB 3NT4A 1VPTA 1V7ZA 3WO1A 1PZGA 2HD4A 3CJTA 1O94A 2YMLA 4TXHA 1N2EA 4GL2A 4YMIA 1OJLA 1N5RA 4XQEA 4JKIA 1A96A 2IS2A 3LO8A 4AK9A 4QVKA 3GMTA 1JAIA 1JDPA 4Y2VA 1I7PA 2J6HA 1X7YB 2PGJA 3OTWA 4HAVA 4M6WA 1ULBA 3TRIA 1SEPA 5CK5A 1J7KA 3H7IA 1N6LA 3D0RA 1Z5NA 2FLKA 4ZCPA 3UGKA 5A3VA 2XIJA 5HE9A 4YQEA 4PRZA 4JLNA 3WO0A 2YS7A 3ZWOA 4O4IF 4CLEA 4OM8A 2BP7B 2IQIA 1IXYA 2JFYA 2E21A 4AKSA 1QIEA 4CGZA 2G72A 4Z9YA 2QMEA 2Y66A 1VL6A 4HUQA 4ZVKA 2JAOA 3WYBA 4D0NA 4LC0A 4LHZA 4DNQA 4YUAA 1KMNA 4BE9A 3H99A 3LYUA 4HNHA 2KI5A 5TT1A 4IRMA 5FUVA 2BMJA 1NSFA 1MHTA 1VHQA 3K9QO 1DRUA 4R2LA 4KVFA 3R9KA 5IC4A 1FFYA 3G79A 1KFKB 4MR9B 3Q0EA 2B82A 2PLAA 4WZZA 1H5UA 4ODIA 2XUFA 1SKYB 4MR8A 5JEEA 3TMYA 3EXEA 3GB9A 2UYGA 1YL7A 2A9JA 3CC8A 5CJ2A 2WVGA 3OQ6A 1U1GA 2WOOA 4XM1A 2AEFA 3SZUA 3ZY2A 2IS4A 2ZBQA 2ZXUA 5GMOA 4CEHB 5ALSA 4NVRA 2G07A 2HK9A 4WERA 3WQRA 5K8VA 4PWYA 2B7LA 4DLRA 1GKUB 2P91A 2QTVA 1JQLB 2Q8PA 3AI2A 1BW9A 1Y4DE 5L7TA 3QVSA 1Z12A 3CO0S 6REQB 4LQ4A 5K5EA 3CKMA 1R8QA 3HADA 1ADJA 4OXKA 4D9CA 5AJZA 2GPSA 1Q44A 1OW3B 1UP6A 4G0MA 4MA4A 2LTAA 4PN3A 1N78A 2QRHA 3OOYA 2BFFB 2R1ZA 2PS0A 2FSVA 4YJKA 4OQPA 2I9KA 3MWKA 1XLTC 1VSVA 2Z09A 1QYVA 4MVJP 4EVQA 1H94A 3T1QA 3ZWXA 1YTUA 1B2RA 1WCYA 2D8MA 3B12A 1HKHA 1OY1A 1NP6A 1U7HA 1ZSNA 3FWYA 3P52A 4QQRA 2W22A 3EHDA 3PWSA 2RGXA 3QHQA 4W1SA 3AV0B 4Q02A 1E6KA 4JUIA 3HYRA 4LY6A 5I8PA 3LYLA 3K0AA 1PYDA 2E4YA 2YOFA 3A9UA 3DZCA 4LXHA 4AVYA 3G59A 3I45A 1KARA 1T8PA 4KGXA 5LFAA 2X7JA 4JOQA 1PZXA 1KR5A 2QSJA 3PFHA 3F5QA 1W35A 3LQRA 1DWQA 1MB9A 4WCVA 3UC9A 2H85A 4OK5A 5AW7A 3AVVA 2HIGA 1GPWB 3LVFO 2OHOA 4M6WB 3HA3A 3SIPA 2ZUWA 3NJ8A 4AT1A 2H1RA 1KO7A 1OYVA 3AV3A 4BGUA 4HDRA 3KQHA 2I4RA 4URUR 1SNYA 3IAHA 4UU8A 3EF3A 2JI4A 5EMLA 5IVIA 4IWYA 5BR7A 2DM6A 5CITA 5I51A 2EW8A 1DE0A 3N0RA 4F3NA 8ABPA 4R9VA 2JJ2D 2BM0A 3PD7A 4EVIA 4HUQB 1N5JA 1W4RA 2O3SA 3ADBA 5ES3A 1F0YA 1LK0A 4F84A 5B7NA 3CO5A 4EMTA 3LXMA 2CLHB 2OMEA 4HVAA 3RK1A 4WD3A 1BXKA 3U81A 4B6JA 4KR6A 3OLCX 1B23P 5ELMA 1PGOA 1JPJA 5B55A 5H70A 1DAMA 4Q12A 5ALPA 4D80A 4MR8B 4R16A 4S1TA 4WL0A 3EXEB 3GJXC 3I6MA 4ITUA 2EDCA 2IEZA 4OMDA 5JC1A 3P2YA 3BHNA 1EUDA 3CKKA 5FXMA 3KE8A 2X0EA 3UKJA 2VUTA 2ZGVA 3KQNA 1U9JA 2UV8A 1R8JA 1MQ8B 1QE5A 2OAP1 1ZUWA 3QUQA 1VL1A 3MXOA 4MWDA 1FL9A 4TWRA 5GPBA 4AMUA 4F5YA 1GUDA 3KQOA 3OT1A 1IPFA 4V2IA 4F71A 3ZY4A 2QJOA 1VMEA 2GF0A 1XZNA 2RHMA 3ENKA 5B1SA 4R2IA 1SHTX 2HLHA 2PMWB 2C92A 1VP9A 3U6KA 3R7AA 8GPBA 4MWSA 2WG2A 2QTVB 1GAJA 3NUGA 1RWWA 4Q37A 4Q3EA 1BW9B 5TPZA 4F3KA 5FJJA 2OFOA 5JBNA 2LV8A 1GG5A 3JRXA 3OICA 3MJ4A 1VSQA 2H0AA 3K70C 2PKXA 2ODTX 4XDZA 5A71A 3BMOA 1U0BB 3WKAA 2QTMA 4KDRA 4FJ0A 1KK0A 2PD3A 3V00A 1PT6A 2W00A 3PP8A 4BEWA 1TPZA 4KXMA 3L46A 4DQLA 2C20A 4DC1A 2EU8A 1DIHA 4BBZA 4YR9A 2O2DA 3PDUA 1R0RE 4Z9XA 1SPXA 4N76A 3SBEA 4AQDA 4UCFA 2PQ2A 5EINA 2PK3A 3BFVA 1LBSA 3DCNA 1XZIA 4JB8A 2IDKA 1E3IA 4RE6A 1V39A 1PJAA 4EUHA 1J2TA 4HVCA 3BDAA 1ABEA 3DPIA 1JL3A 1KETA 2Q99A 3LYHA 3C4JA 1DS6A 2E87A 2O1XA 3DHWC 5D86A 4KOEC 3V8QA 3W8FA 4B7XA 1IUKA 3VGPA 4OHKA 4BGVA 5LYJB 2DPYA 5JBQA 1VM6A 4A8JA 5HJ5A 5KOIA 3Q2KA 4HDRB 3S2SA 1OOEA 1SOUA 3PRJA 4BO3A 4A4DA 3D5TA 5K01A 3C5VA 2JGRA 3HS3A 2GXSA 4JCCA 4RIIA 4Y2TA 1HZJA 3D7LA 4C0XA 5IKEA 5DPMA 1YD7A 1A82A 3EVZA 4JGBA 3WKDA 2FJUA 4DSNA 3DOIA 4E70A 4LYFA 4Y2QA 1PAUA 4Q4CA 1PQ4A 1H0HA 1FP1D 2QN6A 3K31A 4J9UE 5CLFA 5H5JA 1V0JA 4RMNA 3EQZA 4HCJA 1P91A 1GZ4A 5CJJA 4NU8X 2DWQA 4XWYA 3UOAB 4D96A 2NO9A 2YY5A 1QMPA 3N28A 3NOOA 4RDXA 1J2RA 3DTVA 3LKBA 4CCSA 2C1XA 3O9VA 1EUDB 2CFOA 3AFMA 3RBVA 3OLQA 1NDHA 3DDHA 1K89A 1AVTA 1WVGA 3F46A 3JAWA 3FYTA 4HXYA 3KFXA 3WK4A 1RR6A 2M6RA 5AI5A 2BHTA 5E7IA 5M34A 1SUBA 3QPBA 2Z58A 3EH1A 2CC2A 2XF8A 3OT1B 4A2WA 3LNTA 2I3BA 4R8MA 1F1JA 1EKXA 1WXWA 1X70A 2GD1O 4RKFA 4WJLA 1KBQA 2R85A 5KTTA 1LQUA 4F8JA 1FOEB 2EZ4A 1YB5A 3SBXA 4DAEA 3L1VA 2OZVA 4MPDA 5G40A 5AICA 1CJKC 5GQSA 3KKZA 1LS1A 4XASA 4ARCA 4TS3A 1NBEA 3DE5X 1NJ1A 2HNAA 2AZMA 3IYLW 3L7KA 4GP7A 3N9IA 4R2JA 3QENA 1Q14A 2RGEA 2PQMA 4P3KA 4RIGA 5JDCA 3OFSA 1PTJA 3TB6A 3TOXA 4AMYA 2QB5A 5BQFA 5CB4A 4TTIA 3BMOB 2CW5A 2IYWA 3CUKA 4N8SA 3QYFA 4LJ9A 5CYPA 1D9XA 1L5NA 2NZ8A 1CC1S 3D81A 1YVRA 1E18A 4L2IA 3ANYB 4MUYA 4DYDA 4BO0A 2EKPA 2EOAA 5LYJF 1KDTA 4RD2A 1Z0KA 5KVVA 1DXHA 2QRMA 4I36A 3TL3A 1J2JA 4S1WA 1G6HA 2I71A 3R75A 4AROA 1G7TA 3HBJA 3W8RA 3DWGA 3KEOA 3MHTA 4G01B 4UTZA 5H81A 1Z6TA 2NZJA 1E62A 2QM0A 2PS9A 5DP2A 1TYEB 4EGQA 1I0ZA 2BGJA 2CWWA 4NBSA 4H3SA 4S12A 1VE9A 2C2XA 2O8CA 1ZD9A 4B45A 3KHKA 4DCNA 3NONA 5JO9A 4OGGA 1ZIPA 2EFDB 3GA5A 2B2CA 4NATA 1E3JA 4WJKB 1NN1A 2MR6A 5FD8A 1E7SA 2ZIUB 4XFKA 3KZCA 3SLRA 4A8JB 1IY0A 4AY2A 2ECOA 5E4FA 1L4EA 2A5LA 2B98A 3I01M 4FDVA 4WECA 5AI9A 1VGRA 1DC8A 4A0RA 3UEOA 2AZXA 2ZXFA 3MF4A 4ZEVA 4IIDA 3BHIA 3BTUA 2P2DA 3UXHA 2YJ3A 3F6YA 1EVJA 5HRAA 5JDIC 4S3MA 3VI4B 4ESHA 3TTXA 2QM3A 3ANXA 3DE0X 3EVFA 3GG2A 3LG2A 3P97A 3T5AA 3U49A 3VDQA 4QUAA 1X7HA 2ZCUA 4LG1A 5BVGB 3OFKA 1ZVJA 1QYDA 2ZB4A 3OFND 5ED0A 2WINI 1U8YA 1O58A 2EZUA 3EVTA 5A4MS 1S2GA 3SGLA 2GKGA 3LQ1A 1KTIA 2JLAA 2JCGA 3KYCA 5DM4A 1X42A 1QP7A 2BMAA 4X94A 3IELA 3O47A 5TC4A 1GA4A 1V5FA 3GWZA 2F1JA 4PU0A 4XPIA 1PV1A 5C35A 1KZHA 1OLXA 1I4WA 2QV0A 3VU3A 4OYLA 4MB6A 2ZJYA 3BGIA 3IDSA 4KAAA 3GFSA 1V5GA 2MSLA 1IMJA 1YQXA 2BEUA 4WWHA 2IYXA 4D42A 2EL9A 5KOYA 3I9FA 1CQIA 3P19A 2Q3CA 1CUAA 2GCOA 4L0MA 4PX9A 5LBUA 3VA7A 3GYBA 4AX8A 4PV7A 5U4QA 4WBSA 4PYQA 2NVOA 1WG8A 2W2NA 1G5IA 1I2CA 3QLUC 2FOXA 1XTZA 4XM2A 1MAVA 1NXVA 1XNGA 2M6SA 1KMHA 1PYGA 2QL9A 1YU6A 1HOTA 5FL7A 2Z3ZA 3JVEA 4W9NC 5CB4B 1XCJA 3WRXA 1AF4A 1NULA 2PKQO 1HDXA 3GBSA 4LRYA 5KYNA 4L2IB 3PDHA 5BUZA 4RTJA 3T1OA 4FCVA 4GPIB 4LJ8A 2IQ5A 3DMNA 4QWWA 1UKBA 3HJGA 5J40A 1RMTA 4WLUA 4DANA 2IHZA 3KWFA 1OFUA 2ISQA 1L5QA 3D8HA 3MELA 2FOIA 4W7SA 4LKRA 3T3MB 1A4UA 2ZWPA 3IODA 3P5SA 3VHQA 4CBVA 1WPQA 5DEOA 4UOZA 2AMFA 1DU4A 2JD2A 2EG5A 3F5FA 4IDHA 2CD7A 4RJLA 2Q6OA 3WLSA 1U3CA 2O8CB 4Z0TA 1BH6A 3FF4A 4DV2B 3NHPA 1E94E 1FEZA 3ZWMA 3SJAA 3TL6A 2AKYA 2IPAB 4JHXA 3JQGA 2YWCA 1M0WA 2P11A 3UUWA 2I2AA 1X19A 1ZU4A 2F43A 4K3UA 5JYEA 3DPSA 3HMKA 5J2TA 2WZCA 4L5JA 2QPOA 2X6RA 3TUIC 1ZI6A 2IPMA 2HREA 4R6XA 5LOVA 4CF5A 1N1EA 1OWLA 2BGIA 1YS6A 3IP9A 3QMMA 2JVKA 4MKZA 2KBEA 4K2AA 2Y3IA 4HDSA 4Y9UA 3S55A 3QE9Y 1HNXB 2Z1MA 1JIJA 4FI3F 4F6RA 3LFTA 3KVOA 3C4VA 4GGMX 4AZSA 3M2TA 4BO5A 3PGVA 3DAGA 3KR0A 5F7OA 3M8KA 1QE0A 1QBGA 1VB5A 1I1NA 3SIRA 1QAQA 3PX3A 4UEWA 1RRKA 3WL6A 3KYCB 2XUKA 3QUTA 1E96A 1WB6A 4XFJA 3X1JA 1NDQA 1GLVA 2P6PA 4OREX 4P7JA 4KWEA 4RTOA 2WMYA 1A9RA 4XPIB 2BEKA 1Q91A 2I54A 2J85A 3BYZA 3FCYA 1KBZA 2OG1A 1ECLA 1OLXB 1QO0A 4XJXA 3SHVA 3WXBA 1VYHA 5CB4F 1QP0A 1JEQA 4J7AA 1HPLA 1RWXA 2IC5A 4KXXA 4JENA 4UUBA 4WZAA 1GN8A 1ZGGA 2R4QA 4WCFA 1CQIB 3VH4A 3H13A 3OHPA 3SICE 1MABA 4NE7A 2GCOB 3NBYC 5DLYA 1NLZA 1QCZA 1X1RA 1B8PA 2RK4A 3AJ8A 4Y9DA 1OLOA 2RKBA 1HWYA 3LT5A 4KH0A 1I36A 2BBTA 3NEYA 4NPAA 5KWJA 3CLVA 4ARAA 3AOEC 1NWCA 1YZTA 4FR0A 3TLZA 2GK4A 1KMHB 2ZT6A 3U7RA 1HE8B 2VP0A 4JV5B 4AM8A 3LP8A 5JH7A 1PZHA 3Q2IA 4RHXA 1FNDA 2XAAA 1A8PA 3P9ZA 2OUIA 5C34B 3EPRA 4ALJA 4IH1A 1HF3A 3UMGA 1V71A 2EX4A 3OHMA 4B7ZA 4YCAA 2VP6A 3BIOA 1IJEA 3KPUA 4Z9FA 2HO5A 4BUZA 2R87A 1PFGA 2VUSA 3IBSA 4JQYA 4YWHA 3EISA 4P2BA 4QG3A 3NORA 1RM4A 1SHUX 4MICA 3FPGA 1IRIA 3RUDA 2WUGA 1HC7A 4ME6A 3L84A 5K8CA 1I4TD 1XNQB 4XE5A 1NVGA 3T3NA 3ENQA 3NH9A 4HJXA 2QNBA 1AX9A 3TNDA 1NXXA 1ZGHA 3G9TA 5HMLA 4BY9E 2REQA 2C99A 2ZBDA 3B6JA 4LRWA 5CVUA 1QE3A 2AT1A 2YWDA 4UPDA 4DUZB 2IH2A 3C3MA 3JQGB 4IIYA 1A76A 6GPBA 4K9RA 4QU5A 5ENZA 3UWDA 2F43B 1R0XA 3G6WA 4EBBA 5IAEA 5J2TB 1EEHA 1JPUA 3GLTA 4UAVA 1M8FA 4R41A 1JT9A 1KRXA 5LOVB 3FDXA 5GIPE 2PGXA 1EK1A 3QFRA 3KNZA 4PLFA 3TOZA 3UCXA 1FW8A 1A8HA 2QEQA 3F67A 4PX3A 2BFOA 4CF3A 4GMKA 4DJTA 4EYOA 4HDSB 4IKOA 1WWKA 4F6RB 3E27A 4BN0A 4DLVA 5EKXA 2ZM5A 1ZL0A 2DRIA 5K2OA 3HG7A 3IEIA 1UIRA 4GW3A 4JGGA 1MIHA 1P8JA 2AQHA 2IHBA 2HYIC 5E2AA 1K6JA 1RQPA 5ENVA 4B35A 2PX3A 3HB0A 1LSOA 4HNQA 1SXIA 4WFJA 4CT4B 3KQVA 4J16A 2GN2A 1KDRA 4P31A 3RRNA 1YBHA 3QQ5A 5DT9A 1GAQA 1VE1A 2A14A 3A1EA 1FS6A 3FJ1A 1LCIA 1JEQB 1HSZA 4MGKR 1T4MA 2Z6QA 3H3FA 4ZCQA 3UMSA 2G25A 2OCXA 3BC1A 1G5FA 4WZAB 1J21A 4WCFB 5EIFA 3UXMA 1MABB 4OK3A 1DEHA 2AJTA 2XYQA 3HL0A 5EUMA 1WSAA 1FNCA 1I5RA 1ODFA 1V45E 2Q9AA 3LE8A 4G0XA 1Y81A 4PCVA 5L9AA 1E8MA 4TWJA 3WIBA 4IGFA 4RETA 1PO7A 5TDHA 3L6BA 1WMSA 5DHAA 1Q0RA 4EG0A 3HNRA 2G77B 5JH7B 1GPNA 1Q1GA 3ASYA 3GHYA 4G0PA 5K8JB 4Q9HA 1Z22A 4KYVA 2A7XA 2B1IA 3K73O 5IAGA 3O1JC 4FMDB 2YCLA 2NZUG 5B2EA 3II6X 4QNNA 1GNQA 1SCDA 2GNPA 2P9JA 3DE3X 5JC8A 2J31A 4OB8A 2LUOA 1JEYA 1BS1A 1O96A 3TLGA 1XX6A 4ZAZA 4CM4A 2B25A 4MQLA 5J2TF 3E3LA 4J49A 3TQFA 3U62A 1VE6A 2ZBEA 3F4KA 5LOVF 1ND6A 2EFEB 4U0JA 2WTUA 4U7DA 1VIMA 1UXHA 2QM8A 1PD1A 5C7LO 1C9YA 1ZONA 5DU2A 4CEIA 4YV1A 3RC7A 3O3CA 1OXUA 3QM1A 2JCBA 4G2NA 4YUXA 1JHRA 2REQB 5ERYA 1OV6A 2EZ8A 5G1PA 1F8UA 5K3EA 1YR6A 3FPJA 4FYJA 3KB1A 5E6SA 4MARA 4EGJA 4QJ5A 3Q0IA 3DEJA 4OP3A 2BGUA 2GZ3A 3FUVA 3SE7A 3WYFA 1U28C 1EJ0A 3MMSA 4GYWA 5I9SA 4F5DA 4CM3A 2VH2A 5CGZA 1JR2A 4P5EA 1W93A 3FOBA 4Z7QB 2ZBVA 3JZIA 4YX9A 4IMPA 1CW2B 1V5WA 1IIRA 4ZCSA 2XKJE 4AN0A 3MD0A 5DLQC 2IWHA 5KDOA 2WV7A 1MVOA 3IKJA 1KRHA 3ZDFA 2KS6A 2V65A 4IQ8A 3WA6A 4DREA 1IIBA 2VSFA 2WFLA 1JLHA 1AUPA 1NQXA 2BGLA 3F2IA 5LQJA 3PJFA 1EI9A 1PJSA 3D6AA 4II7A 4QA9A 5FCDA 5AXAA 1T9AA 4KPYA 2B4TO 3GIWA 1OGIA 2BDUA 3O93A 1OI2A 3K0EA 3MAJA 2SHKA 5EG5A 1NKSA 1LC3A 3MTAA 1JE1A 3WRYC 2JZCA 1TVCA 2POCA 3C6ZA 3KZKA 1MNQA 5JH7F 1F7VA 4FR2A 3ED1A 5AJVB 3A4MA 4MRRA 3SSMA 2D1FA 5MGNA 2GH1A 3CRVA 4RGQA 5LDDC 4FMDF 4OH7A 3LK6A 4QFDA 2B8EA 1NKTA 2KMLA 5FTKA 2P35A 1GEGA 5TVGA 4H17A 2OHHA 4JIGA 5BYJA 4MINA 4WKCA 2RJNA 2X0DA 2Q3EA 1RI3A 4OYRA 1TCAA 5DXAA 5H9WA 5DULA 2CSUA 1TEXA 2B34A 3VOTA 1V6AA 2HDWA 6ABPA 1QRRA 1TXGA 3OCZA 4FFPA 2PUWA 4DG9A 2QVXX 1NRIA 4FNGA 1WSWA 3O6VA 4KMSA 4Z8YA 4YO7A 4BMCA 5E8JA 1G20A 4DILA 2I3GA 1O96B 1V26A 3NDRA 1HLPA 4LN1A 2OB2A 4QDOA 4CM4B 3OLWA 4GZLA 2FQYA 4NAUA 1H2HA 3TEFA 5FPSA 4C88A 1RCUA 1H85A 1U2DA 2DPLA 5EKDA 5C32A 4MHOA 2IS6A 2ZTUA 3MJVA 2J07A 1UIMA 4MUJA 1FUKA 4DIBA 4CEIB 5B37A 1NBHA 4F2WA 3QHAA 5K0BA 4ZZ0A 3IUNA 1R50A 4HBZA 1FUIA 1XRMA 2VT6A 2CK3A 1SIOA 2OLJA 3DEHA 1JI0A 3FWKA 4JS0A 3FCUB 4D5EA 5H0IA 5JYBA 4CDMA 4KQ6A 5CUQA 4KH1A 2ZW9A 4HGYA 1WDWB 3HJUA 3ZGOA 2XODA 2RHTA 3PZBA 5JSZA 2FPSA 2HBQA 4PYRA 5EPUA 1CEYA 1NV8A 2QY9A 2UZ0A 3QF7A 3L7NA 1RM5A 3C8DA 1N3BA 2FP3A 2JLCA 5J23A 1OFUX 3PJEA 2P0YA 2FEWB 3WNDA 4YQYA 1CHNA 2FSHA 4PZ0A 2XYVA 3FOWA 2F3TA 5DHRA 1H8ED 2ZRFA 3EIEA 4PGAA 1TTQB 4UZSA 2WFLB 2WKPA 4ZO6A 3VQTA 2BBWA 5DE3A 3VNAA 1STOA 4F85A 2EWMA 1KEZA 1U0LA 3EQ9A 5F1YA 1U5AA 2ZWVA 2O4CA 2ZAOA 5T4HA 4CQMD 3QEMA 4ID3A 1IAVA 3NBKA 3A6LA 3JYPA 4NTZA 4HAWA 5D3MB 4FBLA 4MUKA 5F21A 3WWZA 5A3RA 3H18A 5BQPA 4YRIA 4J03A 3ZLJA 4MEAA 1M2GA 1ZMXA 2BUAA 4K3VA 4X3OA 2GAAA 4KXLA 3TNJA 4ZAXA 1DBPA 3THXA 3AU8A 1TO6A 2HJSA 1ZEMA 5AJHA 4OHCA 2IRWA 5KNCD 1U4OA 4QXMA 2AG5A 3AJDA 4BNVA 3T54A 4OYYA 1TJ5A 1MQSA 1CWUA 3N8HA 5T3YA 1QAMA 4NC9A 1UC4B 2J8ZA 1GFSA 5IARA 4EGCB 2ZJ7A 4X54A 3PFGA 3V6LA 1I01A 2QI9C 3T5DA 1M2FA 2I4LA 3TE6A 4XYGA 4IDQA 4UTXA 4WKNA 3JWGA 4CMEC 1N1GA 3NASA 3BWYA 2MSEB 3HLKA 4PHFA 2W6OA 2G28A 1VXOA 3BXHA 2ZCJA 2IOHA 1HSOA 5TIIA 4PQYA 4YMWA 4ZP1A 1G20B 4D9HA 2FFHA 3HM2A 4FQ8A 3GCZA 3BSWA 3RGGA 2O48X 4B3BA 4C87A 4DIOA 2DFNA 5JSYA 2JGEA 2Q7XA 5EEGA 4ZJUA 2A94A 2EKLA 2J67A 3T9AA 4F2GA 3HUEA 5H68A 3FB1A 1CDZA 4XJVA 5H80A 3VVMA 2UXBB 2BISA 1EH5A 5JSKA 3ETCA 4MKRA 3LWZA 1ORDA 4OMCA 4PZUA 4TYNA 2ZR9A 4MQFA 3PFFA 1WCIA 4X0EA 1RXVA 4LCEA 3E84A 1QXSA 4ARIA 1FFSA 2CNWD 1W59A 3JPWA 2EP7A 4CODB 1LSSA 2FF7A 2I4MA 5FPYA 5JTUA 1ZXXA 3EDRA 4P86A 5JSZB 1SU8A 1A2OA 1QG6A 1SKYE 1CR4A 1A4IA 1D2GA 4D9JA 4UHFA 3MMXA 4DWWA 1LDBA 4Q21A 3H7AA 3I05A 1DIOB 4IV8A 3WL3A 3BFJA 4JSRA 2E6KA 4L4SA 1FFGA 2IPNA 1QNFA 2VJLA 4NULA 1GJRA 1T4DA 5EHXA 2UUAB 3ASVA 5CDTA 3LXUX 3OZCA 4L5YA 4FE3A 3KM0A 3ZDAA 5H4HA 1N33B 3LPNA 1J2YA 3EODA 2DHQA 2SKCA 5MGBA 1HL7A 4A0QA 1P0IA 2YXEA 1BEZA 5E4JA 3QEMB 2J7PA 1E0SA 3UPTA 5IP5A 2XQFA 9LDTA 2VG8A 1OKKD 1DAFA 1I24A 3H04A 4ZT6A 1W2GA 1UBHS 3AUSA 2QD3A 1R8SA 3RFTA 3AHDA 5EXDA 1EP9A 1EE1A 1NRJB 4NKRA 1Z08A 1NVXQ 2DKFA 3WGGA 2OCDA 2QQFA 1RQLA 1RLTA 3AB8A 3EYAA 3GGGA 3QVXA 4Q4LA 4JLWA 1U7OA 3CLSD 4IVQA 4EENA 1HA3A 2XKKA 1E0JA 1GIAA 4R2MA 4GRAA 4AO6A 1PJQA 1U8XX 5E9QA 2VQFB 5IMSA 1T3ZA 2JH3A 1K9VF 1N5DA 1QKIA 2QROA 2W8BA 4BJ6A 1TGVA 1BXRA 4MVJI 1X8XA 3IS3A 2XR1A 1WE2A 1TC1A 2NP6A 2QRNA 5FBKA 1E9AA 4ER3A 2BFNA 1DIGA 2AFHA 5KPDA 1ODJA 2B30A 2C94A 4HZIA 4ZMSA 5A5DA 2GESA 3U4QA 1M75A 2JVIA 3BSSA 4R9SA 3T3HA 4LYDA 3O8LA 2FI1A 4DCPA 4MRSA 3G8YA 4UNNA 3PC7A 3U7QA 3VPCA 4GMDA 3A7EA 3K8YA 1YR3A 1C7RA 3FI0A 1J23A 3OVMA 4UD2A 2GEVA 3MS2A 2PZBA 3UGQA 3S1AA 5LDGA 3AHGA 3DTNA 3EVCA 4A82A 5FUBA 4A7PA 4K88A 4KRYA 5DGXA 3TLXA 4MQFB 4B8ZA 5BRJA 1WCIB 2XBLA 5G0UA 1HR0B 4Z9AA 5LQDA 2C2MA 2YHBA 3GJ4A 1GDDA 2XGMA 1AGPA 1H22A 1JKXA 1DT3A 4PO8A 2PRKA 1DG9A 4WW0A 1AGRA 3PEFA 3B78A 1JR3D 4QFMA 4BC1A 3N7TA 3HR7A 4HYEA 3URKA 4YY3B 2VH5R 1ZH6A 2G7MC 1RLOA 2G63A 3T3EA 3CY6A 2WTNA 4GR4A 5DM2A 5FPQA 4EJSA 3T5CA 1ZGAA 1ZGJA 3M6LA 3LDHA 1QAOA 5AKEA 4AYTA 2UYCA 5CNIA 3UW3A 3OU2A 5F1OA 3OQMA 2GVNA 3ICWA 2WUEA 1L1QA 1JHZA 2AG0A 2G3YA 4JZKA 4Q7LA 2AF4C 4XARA 5M7EA 3OOEA 1R16A 4EQ6B 3C1OA 3NC4A 1WP9A 2WJ3A 1YZNA 4G97A 4TLEA 1V3UA 2H57A 3W7BA 1Y6ZA 1TOAA 1YOVA 2O20A 1BWQA 4MWZA 4TN1A 2PCLA 3TYXA 2C54A 5E7MA 1JR4A 3OTHA 5KTNA 1HYEA 5I5GA 1ZM3A 3AJRA 2HPAA 3AWIA 4REMA 1GRVA 3P0HA 4H9GA 1WS6A 2O7VA 2CLMB 1G5HA 2INGX 2VNHA 3KT6A 3PHHA 2YMMA 5A5FA 4CT0A 5DGCA 4HXGA 3WL5A 3TIIA 3R0VA 3U7HB 4LMPA 1OA0A 3FPAA 3OT5A 3VR3A 1AM4D 1M2VA 3HO6A 5IAJA 4XB6B 3ZLBA 3GJ6A 4NEHB 5CEEA 3GT4A 2W8BB 4C4XA 3PGMA 1BXRB 4XX1A 1LLFA 2W9XA 3VAYA 2OB1A 4O0LA 4OQXA 4LHVA 2AFHB 2C04A 2FMIA 2EATA 2I7VA 1A5AB 2OXEA 3KD2A 2Z2JA 1IC6A 3GZNA 5L40A 3OC6A 2JJQA 3U4QB 1E2FA 2Z04A 4BLSA 4YAUA 2F4NA 2ZWAA 1ULUA 1JZQA 1E2QA 3U7QB 2RBKA 4CI0B 5AM0A 4U6QA 1XFAA 5F23A 4GKAA 4NBVA 4PSCA 2DHEA 4YJHA 3GJTA 1QG0A 1T2UA 3PT5A 4LX8A 4ES6A 1U1IA 1XTVA 5C1IA 3O9ZA 3K2BA 3KU1A 3Q3IA 1T3SA 1U1CA 4OXRA 3K3PA 4XSHA 4JLAA 4MB0A 4C2BA 4CFZA 1HNWB 3PEWA 2VZ0A 2DBYA 2QJRA 4N18A 4XD2A 5JS2A 1TGYA 1Q7EA 3KSDO 2V7BA 3OMWA 4EAQA 1DWOA 1RJDA 3LT1A 2VXCA 4LJAA 5JS8A 4N7RA 1E2IA 1K0UA 2D0IA 2YC4C 1QCCA 3O0DA 1GUBA 1T9CA 3PDIA 4GYJA 4TLBA 3UHPA 1TF2A 1W5FA 4C20A 5FOTA 3RVMA 4D6XA 3AINA 9MHTA 3PS9A 1XC7A 3R74A 2HCTA 3U3RA 4RW0A 2BL4A 4EJSB 1E5VA 5ESWA 1JALA 3QUSA 3R7FA 2HT6A 1M3SA 1SUIA 2OBNA 2J6CA 1AKEA 3ELDA 4EY6A 3KOYA 4G63A 1Z5UA 2YZNA 1XELA 1SUAA 3IQZA 3JCZA 4JYCA 2ZRJA 2VF4X 5EFOA 4EUSA 4AJ2A 1LB1B 1PFUA 2NUBA 4PZAA 4DLSA 1E9CA 3VPBA 4KDEA 4EYKA 2P9HA 1IQ0A 2CLEB 3D3KA 4UDXX 4BZPA 2D5AA 5B7GA 4I1PA 4KWTA 3DKKA 3W78A 1EBUA 1VSTA 1YOVB 3PXCX 3Q7QA 4MEBA 5G0SA 3TLCA 3D2AA 1WNFA 4UM7A 3ZKWA 1PL6A 1H2FA 1RAIA 1W0KA 3KAQA 4KWHA 4URHA 2A9KA 2OXRA 5E2IA 4BP1A 1VRVA 5ARCA 4JC4A 4C03A 2VL7A 3LFHA 4HAYA 4X90A 4MS4A 2C58A 5CX4A 5ANRB 5G4LA 5IH3A 4K8OA 3V2GA 4EFNA 2O5EA 3TPFA 1KJWA 1I3OA 3H84A 1H1LA 1P33A 2W4MA 4NEQA 1CBUA 4XCVA 5ALHA 1CQWA 2HX1A 1DJOA 2BEWA 1YUBA 3N86A 2EHJA 1M2VB 1KXZA 1Q1BA 5ALKA 1A7UA 1KJ9A 1ADGA 1N9KA 1T0PA 3CN9A 3DF7A 4HNSA 4AP6A 2YQZA 1PX2A 4RVCA 1YBAA 1YZYA 3I72A 5HTKA 3DMFA 3W5BA 1X7DA 1Q3TA 1Z75A 4HP8A 5MN5A 3EC1A 1QB8A 1WPXA 2O5RA 5ECYA 3GZNB 4L5BA 3VTFA 4ZCTA 4YDQA 2NXWA 3K9FC 2BY4A 5K0SA 1RPTA 1N1DA 3GJYA 1P31A 1DLIA 4FEYA 4BZWA 4UMDA 1JQDA 3EIQA 3QBVA 2B4AA 4C2AA 2GVDC 3U16A 4IX9A 1X9GA 4C7XA 1GQSA 5JJLA 3JATA 3G2KA 4YJHB 1Y1LA 1H2ZA 1LTQA 2ZAIA 4L5CA 4YEDA 5THKA 1XTJA 2ZSBA 1IZ8A 3MPUA 1ZI9A 4GOOD 1VYVA 4IICA 1P9LA 4M7PA 4MUHA 4ZQIA 1C80A 3RASA 4DM4A 3I4LA 1G59A 2K2QB 4QPJC 4R4JA 5LB4A 2P2YA 5AW0A 4LDQA 1YQWA 1TL7C 4QU0A 2IS1A 2IXAA 5EOVA 1XCPA 4ARZA 3PDIB 2R6DA 3GU3A 1LPBB 2NPFA 5TGZA 2EBUA 5CDGA 1N2GA 1Q7CA 3ACCA 4P83A 1OYYA 1CNFA 4EFDA 5DGTA 4M86A 1AQLA 1C7EA 1D5CA 1OD6A 3A1FA 3NFRA 4YO8A 1N9ZA 2KE5A 4WK0B 3ER6A 3QUBA 3X43A 1WCXA 1TA4A 2FP4A 1FQKA 1DKLA 1AXGA 1Y9DA 2N0SA 3JQPA 3OZAA 2RCYA 4TRRA 4XLLA 5AVRA 2JJYA 2JDID 1CS4C 1L5YA 4HS9A 1CR0A 1OBOA 2EYQA 1DAHA 2PGAA 1E8DA 1K92A 5LL6P 2HW8A 1GPYA 4FOTA 3BB4A 1BC5A 4OHMA 3V32A 2HF9A 1RLMA 2WUDA 1ST3A 2BBOA 2YWJA 3C1TA 4FHFA 4I7EA 5EJ2A 4Z3DA 2ZSJA 1JT2A 4H3HB 5A6VA 1M76A 3NHYA 3A37A 4NH4A 4CW7A 1QRTA 1DEXA 1JDZA 4GZ3A 1V11A 2AYYA 1NFFA 2B2XA 4GVXA 4MS4B 1ONSA 1ZD1A 2ODWA 1FNBA 1X92A 4N5LA 4OXNA 2IXBA 5D7BA 1H1LB 1Z39A 5BQ5A 4CCAA 3UATA 2BEWB 2Z3WA 2CYCA 5AKKA 4AJHA 2WOJA 2CDRA 3PTZA 3WNCA 1VBNA 4D2IA 1IBMB 4UUMA 1ECBA 4G4SP 4ZO9A 3Q85A 4DV5B 1M2HA 3MT8A 1CLEA 1XEAA 1NE2A 5F1KA 3TZQA 3U4HA 3A32A 3W7VA 4JI4B 2D5LA 1T29A 1Y8RA 1CB0A 3L4KA 3DBRA 1ZIDA 1LNQA 2GSWA 2Q6VA 1I3NA 3MMZA 4W63A 7MDHA 1R74A 1DQYA 3LY5A 1R00A 4HYTA 1IXZA 4MVJE 1UBOS 3SYNA 4PN7A 3DDCA 3TQHA 4YP1A 4UVDA 3FZNA 3I9NA 3KSMA 3FYSA 4GPZA 3ZCSA 3JATB 2QN3A 2D2IA 2ADOA 2E1RA 2Y9MB 4WLFA 3CNQS 4B6OA 5FO1A 2DY1A 3IE0A 1S4QA 1R0ZA 4J43A 2FLVA 3HR4A 1RYYA 5IRCD 4OGWA 5LJLA 3VFDA 2PWYA