5K09A

Crystal structure of comt in complex with a thiazole ligand
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
217
structure length
217
Chain Sequence
b'GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Design of Potent and Druglike Nonphenolic Inhibitors for Catechol O-Methyltransferase Derived from a Fragment Screening Approach Targeting the S-Adenosyl-l-methionine Pocket.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 73
structure length 217
sequence length 217
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k09A00
5GIPE 1WXWA 5P8WA 3LL7A 3EMDA 2OXTA 2UYCA 3FUTA 3GJYA 1X19A 1YUBA 1NW5A 2AVNA 2IFTA 4PWYA 4U7PB 4X41A 3UJCA 2ZW9A 4YUXA 4KDCA 3MAGA 5T64A 1R00A 3SGLA 1FBNA 5FWDA 4FT2A 2G70A 2G72A 2YXEA 3EVEA 4BLUA 1RJFA 3TMAA 3PTAA 1P39A 3PVCA 5EEHA 1I4WA 2OZVA 4U7TB 9MHTA 5EZQA 5DSTA 2R3SA 3OZRA 4GOMD 2JH9A 4EMSA 4R8RA 5FQOA 3NVMB 4C07A 1B42A 4K6MA 3R0QA 2CMGA 4RSRA 1NKVA 3M6UA 5CVJA 5EZSA 5LQCA 5GOZA 4E2YA 2UZ4A 4NECA 1NW6A 3FPJA 3LBFA 1L3CA 1P1BA 5G02A 5JR3A 2JHPA 2JH8A 5FA8A 4DKJA 5LQNA 2H1RA 2PX8A 3HCCA 3FTFA 2G8NA 1IXKA 1WZNA 2IDJA 3T7SA 1ZHFA 4RX1A 2ZBPA 4IV0A 3SSNA 3SM3A 3SX0A 5ICCA 4GBED 3P9NA 5GP1A 3P2KA 3HA3A 3K6RA 3DMHA 3UJ8A 2IIPA 3O31A 4RTOA 1N7IA 3G2OA 4M37A 4P7FA 4PINA 4P7JA 3MTIA 3EVCA 2EJUA 3EVGA 1XTPA 4RVGA 1TPYA 3A4TA 1O9GA 2AS0A 2FRXA 5EHIA 3GRRA 4A6EA 3ER9A 2BM9A 3BWBA 3KPJA 4FGZA 5FHRA 1XXLA 3DXXA 4PCAA 3HEMA 2OKCA 3MB5A 2EJTA 3NDJA 4Y30A 4G56A 1SUSA 4HTFB 3LCVB 5DM0A 5FULA 3DMFA 4PONA 3OFKA 2AOXA 5E9WA 3AWIA 4CKBA 2ZZKA 5EMKA 1L3IA 1T43A 4DZRA 4DM3A 3LGAA 2NXNA 2PY6A 2NXJA 2ZTHA 4V0RA 1JQEA 2PKWA 3DXYA 4ER7A 5BXYA 4EK9A 3DTNA 2JG3A 5M5BA 3QOXA 3CJQA 1IM8A 2HMYB 3KQTA 3I53A 4GF5A 3UWPA 3PX3A 1RJDA 5HEKA 5DLYA 5ICFA 1NV9A 5C1IA 1YZ3A 2AOTA 3GXOA 4FP9A 2KW5A 4PYQA 4DCMA 3M33A 5CVDA 5GIOE 1VBFA 2AN3A 3HTXA 5DRYA 4FSDA 5EEGA 1KPGA 4PYNA 2IBSA 4BP1A 5CVEA 1VP3A 5LQKA 2A14A 2AOUA 2P7HA 1KR5A 2XVAA 1NV8A 3PB3A 3SVZA 3KQVA 1V39A 2YQZA 5DX8A 3C3PA 5EIFA 5DM1A 1QZZA 5F2KA 3SXJA 3ORHA 1Q0SA 3NWEA 5FA5A 5C0OE 5K05A 3GGDA 4CXMA 2UYHA 1VLMA 4AZTA 4YV2A 4E32A 1M6EX 3G2MA 4QDKA 3KR9A 2C7RA 4QQKA 4KW7A 3DUWA 2AOVA 2P8JA 3FYDA 3G8BA 1D2CA 2FCAA 2JHAA 4CTKA 3F4KA 3R24A 3KR1A 3MHTA 1MJFA 1WS6A 5KS2A 4A6DA 5BW4A 2ESRA 4C4AA 3M6VA 4PYMA 4C05A 1L1EA 4B17A 2N47A 4AZWA 5EGSA 1FPQA 3KQYA 5KQSA 5CVUA 2OYRA 3HVIA 5K0FA 2XYRA 5EIWA 3LECA 4RTPA 3NWBA 3FTDA 4ISCA 3ERCA 1XCJA 3G89A 5E8JA 2PSSA 2UYOA 5FCDA 5LQJA 1ZQ9A 2QYOA 3HA7A 5E2AA 4P7KA 3GIWA 3M70A 5DTQA 2E5WA 2P3OA 2PT9A 4HG2A 1WY7A 3MCTA 4Y2HA 3P71T 5K0EA 2WA2A 4KVZA 3GCZA 4RTKA 3ELUA 3FUXA 4HGZA 3TLJA 3VC2A 5EQJB 2PJDA 4L7VA 5K0LA 2F8LA 2QE6A 4FR0A 1N7JA 4GOLD 2CL5A 5D1NA 3KQMA 5E9JA 1KHHA 3FTEA 3AY0A 2I6GA 2VDWA 3CJRA 3GDHA 4DMGA 1RI1A 4E30A 1NBIA 4PGGA 5BP7A 3BKWA 4HSGA 3FPFA 3BGDA 5EKUA 2PGXA 3B89A 2G1PA 2IH5A 2DULA 3LBYA 3HCBA 1QAQA 5LQAA 2PXCA 4AUKA 3LKDA 1O54A 1SQFA 1VQ1A 2GH1A 2VDVE 2VS1A 4R6WA 2GB4A 3A25A 3LX6A 2FHPA 3DH0A 1G8SA 3GRYA 4LWPA 4YUZA 1EQAA 1BHJA 3C3YA 3GO4A 2HTEA 3KQWA 3OPNA 3VYWA 2OPBA 2HV9A 4OBWA 2I9KA 1JQ3A 2V74B 4PCLA 1I1NA 1TW2A 3MCZA 4AZVA 2NP6A 1OR8A 1JSZA 3E05A 3BWMA 3IHTA 3NTVA 4RV9A 2C7OA 1NW3A 4QVKA 3SR4A 5E9QA 1SG9A 3R9XB 4EKGA 1O9HA 3Q87B 3QOWA 1EG2A 3BWCA 5HIIA 2Q41A 2H11A 5B1SA 1F38A 4C03A 3G88A 3P2EA 2NP7A 2O0LA 2WK1A 1XDZA 1EAMA 3C0KA 5HOQA 2QRVB 3M4XA 1INLA 1G60A 1G8AA 5DXAA 1H1DA 1YFJA 2PWPA 4OBXA 5DWQA 3E7PA 4MQ4A 4DCGA 4KDRA 3HA5A 4HTFA 2YR0A 3FUUA 3G8AA 2BM8A 2BH2A 3D2LA 1ZGJA 2JJQA 4EKIA 4Z2YA 2DPMA 2QY6A 1EIZA 2R6ZA 3REOA 4F84A 3LKZA 5D1HA 3B3JA 1XVAA 3DP7A 3EVZA 4YV0A 4RWZA 1G38A 5U4XA 3OE5A 3RODA 4E33A 1AF7A 1L9KA 2ZBRA 2QM3A 3E23A 3P8ZA 8MHTA 1JTEA 3ANXA 4M7RA 5LQUA 2EG5A 5BW5A 5IH3A 2ZWAA 1FP1D 2GA9A 3GNLA 4QDJA 4C06A 5EPEA 3TPZA 3MTEA 3R3HA 5HIJA 3EGEA 3O4FA 4YMGA 1AV6A 3IV6A 3X0DA 4BLVA 5E1OA 5HIMA 3EVBA 4RVHA 1VP9A 2AVDA 2B3TA 3M6WA 1BOOA 3FYCA 5KVAA 4OQDA 2NXEA 3T7RA 1RJGA 5EHGA 1AQIA 4PYJA 1R18A 2V7EA 4QTUB 4YUYA 3OZTA 2AN5A 2GS9A 1BC5A 1RI2A 2ZLBA 3A27A 3UZUA 5E1BA 3TQSA 2XYQA 3CVOA 3NDIA 5GM1A 3EVDA 2C7QA 2Y1WA 2PX2A 3TKAA 3HCAA 4GOOD 1EJ0A 3DR5A 5EMLA 4C08A 1SVUA 3L8DA 2YVLA 4RTQA 2ZBQA 1YZHA 2ONYA 1Q0TA 1Y8CA 2CWWA 5KYGA 1XDSA 3ELDA 3KR0A 3THRA 2H00A 5EKXA 1RI4A 4H0NA 4PIPA 2OO3A 2FK7A 3BKXA 3MQ2A 1JSXA 3I58A 3I9FA 3NJRA 5K0BA 5GINE 2IH2A 4OX9Y 1ZKDA 2YUIA 5CCBA 3BT7A 2FPOA 2G71A 5K8VA 4WVLA 3OFJA 5EVJA 4PIMA 1XDUA 3P2IA 2EX4A 3DULA 1FJXA 2PX5A 1UWVA 2PXAA 2ZSUA 3A26A 3A7DA 3GU3A 3HVHA 3JWHA 4GC9A 5GM2A 3TRKA 5JUWA 5DXJA 2ZIFA 2YXDA 4EVIA 5ERGB 5K0JA 1I9GA 4LECA 1XJ5A 1G55A 4HH4A 3KPWA 1PJZA 1WG8A 3TOSA 2ADMA 2B9EA 2P7IA 4ZTBA 3CC8A 3P97A 4HRAA 3CKKA 3BWYA 2VZ9A 3PFHA 2WA1A 4JXJA 3G2QA 3TR6A 3KR2A 3UJAA 4F85A 5HILA 3U81A 2B78A 1XCLA 3HVKA 3PX2A 4FS8A 2P40A 1X1DA 3GRUA 2ZIGA 2GLUA 4OQEA 2ZVJA 1PRYA 2ZIEA 3CJTA 4AX8A 4KRGA 2IH4A 3JWJA 4AZSA 3KPVA 2AOTB 4YMHA 3LDGA 4GC5A 7MHTA 5ICGA 1R8YA 3UJDA 3HP7A 3MERA 5E1MA 3C6MA 4IV8A 1JG1A 1NBHA 3FZGA 2B25A 5KQRA 1YFLA 3LCUA 3KHKA 2AZTA 1YF3A 3Q7EA 5T6BA 2C7PA 2ZCJA 2OY0A 2PV0A 4YUWA 2HR1A 4CWAA 3JWGA 3B3GA 4BLWA 4E2ZA 1R74A 1YB2A 2Y1XA 2YXLA 4FT4A 5FWAA 5K03A 3S68A 3SMQA 3EEYA 3B5IA 5DTMA 2O57A 5EMMA 3I64A 3HCFA 3PT9A 3UA4A 4PNEA 2Z6AA 4QVGA 2JHCA 5K01A 4RYLA 1KPHA 3FRIA 3DLIA 3NW9A 4PYIA 4QPPA 3UJ7A 1AQJA 1RJEA 1X1CA 1IY9A 2ONZA 1VL5A 3HVJA 2O05A 3FUVA 1ORHA 3LDFA 2YX1A 5LR6A 3IEIA 5EOVA 5F2NA 3SSMA 4EQZA 1KXZA 3IYLW 4RTSA 3BGIA 4XCXA 4M38A 4GOND 1VE3A 1M0EA 4KIFA 1JTFA 1MHTA 2EFJA 5DPMA 5CVVA 4ER3A 5FADA 1QANA 5EG5A 2I7CA 3GRVA 3JWIA 4HGYA 3G2PA 4GEKA 1JR4A 1D2HA 4QPNA 4ER0A 4BY9E 3V97A 5K0GA 3PFGA 4CKCA 3ME5A 1X1BA 3OU6A 3P9CA 4PYOA 4RTMA 2ORED 3HCDA 2ZWVA 4KIGA 3GRZA 4GUAA 2FYTA 2OB1A 1Z3CA 5DRTA 5CD1A 3RIEA 3M6XA 2CMHA 3OZSA 2YTZA 5HFJA 1VPTA 4LG1A 5DT2A 1KYWA 2IBTA 3KPYA 1QAOA 1RI3A 2XVMA 3HM2A 4YUVA 4QTTB 3DMGA 3CBGA 3H2BA 1KP9A 4MIKA 3UJ9A 3DXZA 3TM4A 2Z6QA 4XUCA 2BR3A 4E31A 2IGTA 4P58A 3TKYA 3B7PA 3ER8A 2VP3A 1JG3A 5DM2A 3R6TA 1U2ZA 4YV1A 1SQGA 1JG4A 2OB2A 4WXHA 1DL5A 1DUSA 3LPMA 3G5LA 10MHA 4GQBA 3NMUF 2LD4A 1L3BA 3B3FA 3NVKI 2AN4A 1SUIA 3KU1A 3KQSA 1TW3A 5EMJA 3CCFA 4PGHA 4PYKA 3AXSA 3OCJA 3TFWA 3CGGA 4MTLA 5K0CA 1G6Q1 3HNRA 2IDKA 2NNWB 5K0NA 4E2XA 3LHDA 2PX4A 3KKZA 5DSXA 3KPUA 3THSA 3BUSA 4OA8A 4DQ0A 4UOEA 2Z6UA 4PYLA 3UBTA 3EMBA 3T7TA 4C04A 3RW9A 4F86A 2HWKA 2P3QA 3I5UA 1UFKA 3LSTA 5FTWA 2P3LA 2GAFA 1BKYA 4ATNA 2I62A 4R05A 5CM2Z 4CKEA 1NW7A 3LDUA 2AOWA 2BR4A 4RTJA 2O06A 2ZULA 3SSOA 1NW8A 1JG2A 3OE4A 4X60A 3KQQA 2OBFA 3ELYA 1UIRA 4RVDA 5DTRA 2FK8A 2ZFUA 3VSEA 5LQRA 4HC4A 4E2WA 1ZG3A 4V0QA 3TM5A 5FUBA 4ER6A 3FPEA 4DA4A 5C9ZA 3K0BA 4IKPA 5HIKA 1P91A 2XBMA 4X63A 1VIDA 3O7WA 2P35A 5DX0A 4MWZA 4OA5A 3FRHA 2BR5A 3ELWA 5EC8A 1KYZA 4RTNA 2PXXA 3KQOA 5IKMA 4RTRA 4IWNA 3G5TA 5MHTA 5DX1A 3FPHA 3AXTA 3BXOA 2XYVA 5T67A 2PT6A 3G7UA 1EJ6A 3UJ6A 4XUEA 3QV2A 2VDUE 2P1DA 3EGVA 5H02A 3EVFA 4MHTA 1DCTA 3GWZA 3EGIA 3E8SA 5CUQA 1RI5A 5E2BA 3DOUA 5E1DA 3MGGA 2NYUA 5FHQA 3BGVA 2P41A 1HMYA 3EVAA 2IPXA 3P9IA 1P1CA 1X1AA 2NXCA 4R6XA 5CCXA 4E70A 1NE2A 2ERCA 3FPGA 1WXXA 2PWYA 1NT2A 5F2OA 5K09A 2PBFA 4O29A 2ZZNA 3KQPA 4LWOA 3C6KA 3DLCA 2IP2A 3EPPA 3EEOA 1QYRA 3AJDA 4P7GA 3V8VA 1ZGAA 4KWCA 2PVCA 4R8SA 4POOA 2AOUB 1QAMA 3UFBA 1HNNA 4CTJA 2UYQA 3UJBA 2B2CA 4X61A 1FP2A 5GWXA 2PLWA 5FQNA 4BP3A 4M36A 3VC1A 4FZVA 3OU7A 4X1OA 1KPIA 4RTLA 2GPYA 5DM4A 1SKMA 1R6AA 1ORIA 2K4MA 1R8XA 3FTCA 4DF3A 2QRVA 5LSAA 1N2XA 3PLAE 3LCCA 4ER5A 1KIAA 4QQNA 2CKDA 3ID6C 3BZBA 3WSTA 2O07A 5E8RA 1M6YA 4RVFA 3A7EA 3PS9A 2BZGA 1F3LA 2AR0A 5HZMA 3HCEA 3FUWA 4XUDA 2HNKA 5ICEA 2ZZMA 3P9KA 3UA3A 3OU2A 4FSXA 5CIYA 1JQDA 1D2GA 3T0IA
chains in the Genus database with same CATH superfamily
2I1LA 4K81B 4BVBA 3GV0A 2O8DB 1GGFA 2P1ZA 1B0ZA 2HRDA 3FUTA 3HLYA 4U7PB 3SHQA 3UJCA 4M1SA 4U3JA 4B6QA 3IVAA 3TXXA 3MAGA 2BTOA 3B6ZA 2W11A 1C3OA 1WZCA 3HFRA 3TRIA 3VKVA 3K8ZA 3BXEA 1PZFA 3B12A 5BURA 4N49A 3QWBA 1E2JA 3ANMA 5E4TA 4KRFA 1A1VA 5AW0A 4PGMA 1M5TA 4NKRA 1L1FA 1ZCFA 2XWQA 5JAMA 2FY8A 4H15A 4XM2A 2YW9A 1RLIA 3H4TA 2ZCVA 1DTWB 1VE5A 5BVHB 1JX6A 4Z8XA 3D8TA 1GT6A 3NVMB 1BAPA 2Y0PA 1XELA 5FQOA 5B3JA 1H2ZA 4OBBA 2Q2OA 1ZLXA 2PUJA 5AJXA 1YGYA 2HJRA 2Q5CA 4OI4A 5CAEB 4EGJA 5C51B 3E9RA 2WVAA 3F6BX 2BPOA 3LT2A 2FX3A 1KSFX 3KRTA 1YVRA 2RHRA 4OFBA 5DGIA 1N2CA 2PNJA 4BFZA 1ZR4A 5J4LA 4ETMA 4MVJI 4BO8A 3VNUA 4KK4A 4DWVA 3T1YB 1XD2A 1N6NA 3KYDA 1C80A 1L5YA 2DQ4A 2PL3A 4HYTA 5JSFA 1NR1A 3LLSA 2VNJA 2IZ1A 2P4QA 4Z6KA 2J0EA 4FNOA 5F33A 2OA0A 5CT9A 5EWJB 4U2KA 2JD1A 1FFYA 2B1RA 1CDZA 1S8NA 2J3IA 1GPLA 1BX3A 4XVHA 3EZXA 3PNVA 3ZNNA 1W0JA 1JIQA 1E3IA 3IKMB 1Y4DE 2NQ2C 2O2JA 3CNNA 3F9RA 3K9GA 1MGPA 1YDGA 2JZNA 4YGYA 5ALMA 4ZCMA 2BE7A 1NNI1 1QO0D 3CM0A 3OBBA 3CWZA 4HWGA 3AVQA 4PCAA 2B7LA 3OETA 5AK0A 4A15A 4JI5B 2MSEB 3K6KA 1V45E 4NZ9A 5ALKA 2O20A 1U1GA 3DMFA 5J1TB 5JLJA 5KEIA 4A0FA 4EMUA 1ZM4A 1HX7A 2D7JA 3UMFA 2ZZKA 1AK1A 2IHVA 2Z8XA 1E4VA 1KYTA 3KSMA 4KNWA 3AKDA 3TQOA 5A9SA 3CH5A 1YKSA 4B45A 1JQEA 2XMRA 2DR0A 3AEXA 4LISA 5SZJA 4AVYA 2ROQA 1PWHA 2RCYA 3LXXA 1GQFA 4IXWA 1PTJC 1UMBA 2VQ3A 1FSGA 1MV8A 2ADOA 5F77A 1XRPA 4P3XA 3ZOKA 5JI3E 3A4YA 2Q29A 3Q41A 3AL0C 3MOSA 3QEMA 2YIVX 4NE2A 2A94A 2O0JA 4HUQB 3DBVO 4KGXA 1DU4A 1XE3A 1BD4A 5TQ0A 2OYSA 2WIKA 3IV7A 2HUPA 1NRWA 1DT3A 2Q3LA 3E22A 4QO7A 5JFOA 5CVEA 5KOIA 1Z5ZA 1ZUWA 2ZTLA 2A14A 5FIUA 2YDYA 3R3VA 4IIJA 3TLYA 5DNEA 1PUJA 5D01A 2GPSA 3WMFA 1XPOA 1GZ7A 1HH4A 4EX7A 4BP8A 1XUOA 3UNXA 3I04A 2CZCA 5J2UF 4IIXA 3PEWA 4N18A 5K8UA 2FLKA 2EG9A 3L7NA 3OZCA 1SVWA 2JCXA 2YCLA 3HKEB 3QEJA 3IAS6 4H7KA 4QGAA 2IT1A 5BSGA 3NO4A 3D02A 1QHYA 1GU7A 3UHJA 1B2LA 3TPFA 2PMBA 3HEBA 1JDPA 1KU6A 4F7DA 4GR9A 3P52A 4B80A 4L75A 3FGZA 2OQVA 1YZFA 4G4GA 4AT1A 5KC8A 2XEDA 4C4AA 2Q6KA 2W9XA 2A9PA 4R7ZA 1VSBA 5AKGA 1QQ7A 4WBNB 4LKOA 4ARUA 2J4DA 3MXTA 1L4LA 2BOVA 1GCOA 4FFNA 1IFXA 1TFRA 4Y6QA 3G89A 4EHJA 3ROXA 2G9RA 4P33A 4JLPA 3TYXA 1JFFB 2X0IA 2ZUSA 2OQRA 3JATB 4JZYA 4WZZA 1SD2A 3MWLA 4AXXA 2R6DA 3FXAA 2GXSA 2Z8YM 3G02A 3NDPA 2B4YA 5LBUA 1M1ZA 1LU9A 3TNFA 3W4KA 3QW4B 3ADOA 2C98A 3P5SA 4WK2B 5BOSA 1RLMA 1RXVA 1GUZA 1NVMB 1IWPB 4PGGA 1I4DD 3CKMA 5FB3A 2G4LA 5HKLA 3RUFA 3RVDA 4TMWA 2W6PA 4L4XA 4CTMA 1NQXA 2UVQA 4NV1A 2P3SA 1KVTA 4L3WA 4ACBA 4CEJB 5CA1F 2IYQA 4CMBA 4JBYA 4ENPA 3QXSA 1JXAA 4WD3A 1W8DA 4MHSA 3FOBA 1BNCA 5B7GA 5JNTA 3KAJA 3EXEA 1S7CA 3ES9A 4UAJA 3WHIA 4S05A 2W6CX 3HO8A 3L0OA 2JFUA 1SZPA 2VWQA 1MNAA 3H2IA 5TMPA 1HUQA 1IVYA 1WXHA 3ASYA 4MV5A 5H1YA 1L1QA 4E6PA 2Y0DA 1R6TA 3N2IA 1MJGA 5H4HA 3FFWA 4AMVA 5GJBA 2RK4A 2PGLA 2X4GA 4JJFA 4Z99A 4MX8A 5BSWA 1ZA1A 3VPFA 3DHNA 4BCCA 1S2DA 5FTMA 5BSRA 1LPMA 5K20A 1F0NA 2FFAA 3LUAA 3D54D 4H60A 3SR0A 4O1HA 4EUNA 4UHFA 4O4HB 3BAZA 3HU1A 3KYJB 4QJ4A 1X3LA 1XDZA 4WINA 4WNYA 1E3EA 1AK2A 4KMRA 5BQ5A 2FW8A 4IBOA 4KACA 3KSZO 2JF0A 3KD2A 4B1FA 3N53A 4KDRA 5TPWA 3GNQA 5CM8B 4CGYA 3OIUA 1JNXX 4DR5B 3E4DA 3K0HA 1MO4A 1ZGJA 2P68A 3A37A 4TMFA 3RKUA 4AF7A 3BQ9A 1OH6A 2NZ8A 3VTAA 5ITVA 4YV0A 2YJ6A 4NOKA 3HBLA 1PR1A 5G53C 2WOJA 3I8SA 4KL8S 3ONWA 3THWA 1UANA 1GKLA 1UJNA 2LE0A 3Q15C 5L7WA 4W8GA 3UUFA 5LQUA 4U3JB 3K72B 2EG5A 1Q11A 1NVVQ 3GA0A 3LW8A 3X1DA 2ZWAA 4TS1A 2DHDA 3IMGA 4CJXA 2PX0A 1C3OB 2GA9A 4YRZA 4MW5A 4RK4A 1ECLA 1DC6A 3Q5GA 4URFA 2OD2A 3AL3A 3A06A 2XE7A 5HFAA 4Z4EA 3B7GA 3O4FA 4JCOA 4YHBA 1P5FA 4F2PA 3PDHA 3W06A 4X8OA 3F1LA 2NVUB 3HUFA 4P3OA 3RVKA 4ZI7F 1DJOA 3FYCA 3NOXA 3D2AA 4GPAA 5BQ3A 1RJGA 4X65B 2I4IA 4URUR 1TF7A 4HWPA 1MP0A 1J1UA 2AN5A 3EIUA 5D5QA 3A27A 5CB8A 1H5NA 3D81A 1I2CA 3K09C 1JMYA 2TSYB 4IDNA 1LV8A 2J3EA 2ERXA 3LNCA 3EE6A 4IHJB 4D9IA 1K7EB 4FZRA 3BHNA 3BEOA 1RXSA 3H5TA 1NJ1A 3FAZA 3ROTA 8AT1A 1ZAKA 3RV4A 2HJGA 3NS7A 2VBFA 1Q0TA 1XDSA 1RWQA 1U4OA 2ZT8A 3E58A 4MCAA 4HF7A 3GQVA 2WJ4A 2OO3A 4YT2A 3I58A 3I9FA 3IAFA 3I28A 1Z73A 3OHPA 4RVOA 3G1TA 4YALA 1N34B 2JG3A 3ZXYA 3R9WA 5EE9A 4P38A 3A0UA 1LVGA 2UXDB 1GZSA 5SYMA 3HUUA 5AUOB 1N32B 1U3FA 1H2RS 1M5UA 5COBA 3KBOA 4LYYA 3ZLTA 4NCKA 1R4NA 4PSKA 2B2XA 4X85A 4XQ9A 3M6LA 4IDQA 3MQFA 2YVUA 7REQB 4GLBA 1ZOPA 4OUDB 4ZEWA 1H22A 1P19A 1GQQA 1BJTA 1YONA 2IYEA 3K2BA 4HH4A 2QG4A 4P6VF 4UM8B 3UMJA 4OUKX 3UK1A 4UM7A 2FI1A 3PFHA 4ZOAA 1DG1G 2PYDA 3K0CA 3OPQA 3TR0A 3NRCA 1SEVA 2QE7A 2IBMA 3VR3D 4EELA 3JVUA 1FP4A 5I5GA 5J43A 3SVTA 1KEUA 1CDOA 1KOJA 5MDHA 3JQBA 3N2NA 1DFGA 3FWHA 3LDGA 4YN3A 3VTKA 1H2BA 1FPMA 1GLVA 3L8HA 3MWDA 3O1HB 4O2RA 2ZT5A 1C2TA 3E22B 4ZJZA 1ABEA 1P0FA 2H6EA 1VE9A 1NL3A 3SG0A 2C4WA 4JENA 4UU1A 1ZITA 2WFAA 2ONCA 4IIJB 1EINA 2HCFA 3BSSA 5IHPA 1SVMA 1UEJA 1M7HA 1RRKA 1AX9A 3LZCA 4N0PA 1CUJA 3WBKA 2O1SA 1QE0A 2BKXA 3I64A 3HCFA 4ZPJA 1QB7A 3O3OB 1HY3A 1KY3A 3WRWA 1P77A 1Y5MA 4BP9A 3OLCX 3FCEA 4LXIA 4N0MA 5AUQA 5C1OA 1M1UA 5JC1A 3UOWA 3MD0A 4QX6A 5AKYA 2R86A 4F6RB 1A7KA 1E2PA 4CDNA 4U2DA 5DHAA 2O05A 3FW1A 3LDFA 4KCGA 4C3OB 5JYBA 4N76A 2X42A 4EHAA 4DJTA 2Q5LA 4N39A 3ECCA 5D00A 2CC2A 4MYUA 2I2WA 3D5TA 2AEEA 2AMLA 4PC3A 3ITEA 2FUG6 1KY5A 2IC5A 5DPMA 3NASA 4I3HA 2IXEA 1ZNYA 3N39C 4YYEA 1XIVA 3ADBA 1V5GA 4HGYA 3DNPA 1JR4A 4ER0A 3JYLA 3BRSA 4WXEA 3TEJA 4PBRA 1BHQ1 1K4YA 1WHTB 4EAAA 1V48A 2UZ1A 2Q6IA 3CKLA 3W7VA 3OU6A 4UAVA 2OV8A 2PJUA 2ZWVA 4KQIA 1DEKA 1XX6A 2VAWA 4QREA 5LMCA 5LXTB 1QYIA 2JZCA 4RFLA 1TCAA 1F0PA 4YXFA 1BS1A 3NM5A 5B7NA 4W9MC 1RLUA 4ZKEA 1VPTA 5SY4A 1E7WA 4AWAA 2IE0A 3EXHB 2GI4A 2JATA 1OFIA 2PVSA 4F1WA 3PK0A 2XNCA 4Y67A 3TM4A 4B3DA 4I36A 4EY4A 1AY0A 4OB6A 4XGKA 3VPSA 1E92A 1KH2A 3ZWBA 3PFCA 3LVBA 3LKVA 2VP3A 2X58A 2FN8A 4KE6A 3R6TA 1U2ZA 1NFRA 1ZN8A 4M3NA 4DOMA 2HPZA 4JJAA 4WXHA 3EXEB 2I87A 4IZ6A 4DLBA 2BZSA 1TEZA 1DHRA 2Q5OA 3LIPA 2LW7A 1BE0A 3K0KA 3WXBA 3DFIA 4Q9KA 2RGCA 1VPLA 3A4IA 3TQCA 1RKBA 1TT5A 4LFBB 5SYNA 5EWMB 3I72A 3E27A 1QGZA 4CQNA 4QU9A 5DLPA 4UTNA 4N7JA 3FPCA 1EH5A 4X6XA 4EBFA 5AHRA 4D9HA 2R79A 3DOIA 4FJ0A 1F8XA 3GLGA 1I0LA 2M98A 3UT6A 5JSZB 4H3HB 2GZ2A 2FX5A 3LSTA 2Z3ZA 1U4SA 1GGNA 1QHNA 1WPQA 1UQUA 1DWPA 2Q6VA 2ZULA 5TPWB 5C7YA 3DKKA 3F5DA 3ND7A 3LT0A 1CE8B 4LY6A 4YNBA 1Y8RB 1CRZA 4G84A 1HSOA 1HQYE 3OE7D 1GTSA 1TX4B 4Q01A 3ORQA 1FYEA 4ZT6A 3OCYA 3PDCA 2L69A 1Q15A 2IHUA 3ZE7A 5JSYA 2Z43A 4AY3A 3SQWA 5DO9A 4UPEA 3U3XA 2UUAB 3THWB 3SBDA 3NCHA 1V7PC 1SA0A 3D6NB 5BRAA 2FWPA 3HHPA 5K6TA 4IEFB 4ZZIA 1LBIA 1PK7A 1WLSA 1NXSA 4OA5A 5C8DA 3EF0A 4G24A 4DV3B 1U1DA 1XG5A 3BORA 2QVBA 4JJ8A 4MB0A 1YQDA 2X8BA 2ZRKA 3FYUC 4Q66C 3Q9NA 4V39A 3M5PA 1Z12A 1FXSA 3GPDG 3OD5A 4LRQA 1SCKA 1Y80A 5FL7D 1L5GB 3HI6A 1O0BA 2OOKA 1ZSNA 5CA0B 2ATXA 3IEXA 4AMUA 4JQCA 3GGJA 1DG3A 3NTUA 1CUYA 1LSUA 1T10A 2P41A 2ZE7A 3BTUA 4K7JA 2WHXA 4L3OA 3BD8A 4YJKA 4ID3A 4UTOA 1X1AA 4D3DA 2CJWB 1JZSA 2DUMA 4E70A 3QPWA 4IIBA 3DLTA 3V8RA 2FPGB 1M6NA 4UKDA 3U3JA 2MHCA 4PG5A 1FMLA 1TUBA 5DULA 3EPPA 1IOVA 4NOJA 2H52A 4P7GA 4YDRA 3IB3A 5CFPA 2HIAA 1QAMA 3CO0S 4QA9A 3ZDBA 1Y1QA 3QPCA 1EP2B 1WQ4A 5A9RA 4DPLA 5AKJA 3KALA 1VRVA 3B9QA 4BP3A 4HO1X 1DAEA 5HS4A 3T7CA 4B4DA 2OO5A 1CUBA 1TMGE 1N75A 2H2GA 1ZGBA 2ADFA 2PZMA 1CS0A 3FSEA 4DL9A 2PA0A 3VH3A 4F1KA 1G6KA 5B3LA 1CEEA 4K9OA 2F2TA 4O4LF 4ARSA 1YZYA 1C3XA 4NSNA 4BVHA 3K6SA 3VZBA 3TR5A 2FFRA 1PJAA 4HDRB 1YT5A 4X92A 1E58A 2Z2XA 2J41A 2Q1TA 1E6EA 4P4SB 1LQ2A 3MF4A 1RKVA 5CP8A 3TVDA 2X5OA 3U3RA 1U9IC 3PIDA 1RC8A 1A50B 1ODIA 1DEAA 4H0FA 5ADVA 4Q21A 2EX1A 5LJLA 5I7EA 2QZPA 4D26A 1A9RA 4F3TA 1OIWA 3NBYC 3H83A 4B6FA 2C3MA 4YJ3F 1HMPA 5G4LA 3KZKA 1Z5PA 2DJ5A 4OHMA 2ACVA 5LZ4A 3DDOA 4B3CA 4LZNA 2KHZA 4UVEA 5ECDA 1I51A 2X41A 3DKVA 4K3UA 1MMFB 4KE9A 4MARA 3WB1A 3KELA 5F73A 1J7KA 2JJYA 1UDXA 3BSFA 2DTDA 3AJRA 3C5VA 4RZHA 5LBIA 5FWDA 2EFCB 1Z0IA 2G70A 2G72A 4W6ZA 4UU0A 1T0HB 3K0EA 2H4ZA 3FJ1A 3QMVA 4P84A 3TMAA 3EN0A 4TS4A 3UAWA 3CX6A 3DFZA 2P65A 4XYMA 3V4PB 5EZQA 1VKRA 4UNRA 4ZQHA 5ER9A 4K46A 5JDCC 1QMGA 3EJ6A 1DAGA 4QXOA 3W4JA 5D5HA 1FL9A 1W4RA 3LUCA 1T5IA 1Y3FE 3GJZA 2E4ZA 4UNPA 3ISVA 2NSLA 3LO5A 1NW6A 3PKIA 4RJTA 5C8XA 3GJ5A 2W6QA 1BVUA 2WAOA 4UUAA 3L4KA 3V42A 1EA5A 5EKTA 3D3EA 2ON6A 1ZL0A 4UHBA 1O94C 3P9YA 4TTPA 1XEAA 1JFLA 2FA9A 3OP1A 3DT6A 5JQGF 1GUFA 1XF1A 3QJGA 4FU0A 2HRCA 1S3IA 5D7NA 1CZKA 2O8FB 1XRRA 4LYFA 4U6SA 3HSKA 4UVGA 3FVWA 4HK4A 1J1IA 5AVUA 4FFWA 3QYAA 1EFKA 3P9PA 4GKAA 3GFFA 3KPJA 4FGZA 1HC7A 3HKCA 5AT1A 5H81A 1LC0A 5KJCA 5FUYA 1FA9A 2NSJA 5F3DA 5FNVF 3RGGA 1AM4D 4TX1A 4P0QB 3KJQA 3O47A 1UOQA 2AXPA 4N3NA 3EBPA 1XVIA 4FZJA 1EX1A 3GUYA 4ME6A 5B12A 4ZXFA 3AX6A 4X84A 4BNMA 5ITZA 5IU6A 2O0MA 3DG9A 3LQ1A 4FMPA 4CODB 3DXYA 2OCPA 3IAUA 3IFSA 4HYQA 3LUDA 3ZZUA 3Q6MA 5AM4A 4LE1A 4RZ3A 3L6RA 2W37A 3QOXA 1GAQA 4OQYA 5CTJA 1D2AA 3SQDA 4QUJA 1YA4A 5CB4F 3VDRA 4GF5A 1A27A 3PX3A 1FDOA 4BKPA 4KYUA 5EHNA 1DGQA 3OM9A 4C0WA 2CLCX 1U04A 4IYRA 1W5SA 1Q16A 3R7WB 4MPTA 4ZV4A 3H1BA 2ZQYA 4NI5A 4X5OA 3RTBA 1WUTA 2XADA 1TT5B 2MR6A 2RAFA 1HDZA 4KE8A 5CYGA 3ZGNA 1QIGA 4LK3A 4OBEA 4M1MA 1KDTA 1NBEA 2REQB 1FRNA 3KKOA 4QFCA 6PFKA 4R5HA 1K98A 4EPWA 3QKSA 4CG1A 4K26A 3GLGB 3KHSA 3CZCA 3QX8A 3H5WA 4QT0A 1KEZA 1JFRA 3I9LA 2R44A 4WXYB 2WHRA 2QSZA 1ZCZA 4CXMA 4AZTA 3DFUA 1L4HA 2WP8J 3H2YA 4CIXA 4J49A 1S2MA 3L1HA 2FSPA 4LZAA 4LGYA 3B1ZA 2XSZA 2OOSA 4JC8A 2IK8A 3IODA 4CR7A 5IAEA 1BEZA 1MJFA 4D9BA 5KS2A 4MVJP 3LWBA 3WLAA 1X39A 3LUFA 5K5EA 1ZSYA 5D87A 4M99A 4EW6A 2QT1A 3RVJA 5HBRA 4ZHSA 2CLKB 1TM7E 1U98A 2ZAIA 4JI4B 4ISCA 3L7OA 1HDGO 1SK8A 1GA6A 3LG2A 2G36A 2COEA 3EQ6A 2CXRA 1L5MA 3F2IA 2CDBA 2VDNB 1R3UA 1GA4A 1V35A 3DL2A 3IAM6 4ZU6X 4DDTA 1GZUA 1WY7A 2YQ5A 4M1WA 5AJWA 4CCAA 1LI5A 2GQ0A 1FZQA 2JLWA 3B9PA 5PNTA 4UM5A 4LC1A 1BXRB 1OZAA 4INPA 3K9HA 5D1NA 2Y1KA 1N7JA 1KE2A 3I2JA 1IH8A 1D6JA 4MITA 1O96A 4U7JA 1DMRA 1M7BA 4OB7A 4NDAA 1ZBQA 5CHYA 3C6BA 2O2ZA 2P4SA 1U5BA 4HJXA 4WZAE 3K32A 4WERA 4FPXA 2PXCA 1N6HA 2BFAA 2KX7A 4RPLA 4Y7DA 4AUKA 1HEYA 1VQ1A 4DNOA 2Q8NA 4AJPA 5G0UA 1SVKA 1WW8A 2JGAA 3W1VA 1SQ0A 4HJRA 2QMEA 4Z1MD 1KFJB 4J1TC 2XW6A 1EQAA 3GO4A 4C7KA 1Y7HA 3SC4A 1S8OA 1W88A 1USUA 1LTKA 1ZK1A 3E05A 4BDSA 1E3WA 1GVNB 4CMAA 4QVKA 4BNFA 2IY7A 3GFGA 4LVOA 2X3YA 1KJIA 2QK4A 5K3OA 2I2AA 4ITVA 2A9RA 4O2BF 3WNVA 4D25A 3HSSA 4C03A 1TEXA 4QELA 2GHIA 2QSJA 1XEWX 4KXUA 2FRDA 1W2WB 2FKNA 3Q8XB 4DB2A 1QIMA 5DXAA 2VF7A 1GXSA 2FWNA 3CCCA 4XD7A 4BN4A 3EFHA 1EFHA 3AUFA 2UU9B 3L92A 2B6NA 4C43A 3KUDA 1EWTA 1CUEA 4WY8A 5EJMA 2WU1A 4OLAA 3REOA 2W7TA 3NP7A 3HDTA 1VOTA 3CO5A 1YQQA 4DMCA 2E6UX 4KQCA 5U4XA 4Z51A 5E6UB 4YREA 1T8UA 5A6SB 3WAKA 1Y0BA 2XZOA 3EX7C 3QE3A 4LZLA 2IGBA 3P0HA 1DIHA 3OZXA 3K31A 5L4LA 3TD2A 3A9UA 3RYFA 3JQ7A 4QQ8A 3V1LA 5BW5A 4XKJA 1GIAA 2PO5A 1GDTA 4J0CA 1JKJA 4YV7A 4CDRA 4PLZA 1MA0A 5HKKA 4FNAA 5F9HA 1AKVA 1IZ9A 5U1PA 2X6QA 1L7RA 1CUSA 3AHCA 3OKPA 4AIRA 3O8NA 4CV0A 4CF7A 4HL6A 1DT5A 1A8SA 1TZJA 1YRAA 1VRWA 3PEUA 5JE8A 1HR0B 2J5KA 1AQIA 2P2CA 3MOGA 4RD2A 1GG5A 2EJVA 4BEVA 4CV2A 4URXR 3Q9UA 1CJVC 1C8KA 1MG5A 1V3VA 3K0SA 3AIKA 4H27A 4D1YA 3NHWA 1P44A 4FYPA 5HM6A 1EJ0A 2YMMA 2HRRA 3H2HA 3E53A 1PX2A 2GEVA 4R81A 2XE4A 3PQCA 4V38A 4KTVE 1AKYA 1XXHE 1VJRA 4Q5IA 3VPDA 2AQKA 3A04A 3AMVA 4C14A 3EWIA 4M0KA 4B84A 3IRUA 3TVYA 3BKXA 1XI2A 4IF6A 5DTJA 2H7VA 4YQEA 4FGSA 3UWSA 1NN3A 5E6RA 4HLUC 3ZI4A 3DZKA 1FNNA 4B3IA 3CUWA 2ACEA 4Y3UA 1W7AA 3H4IA 1LI7A 1YE3A 3WLOA 4E12A 4V2UA 3S70A 5HJ2A 3VISA 1XYGA 4C22A 5LMUB 2HC9A 1R0BA 2QRUA 2NU9A 2Z9DA 2QAIA 4DLVA 5I7FA 5JOQA 4AKGA 2BFEB 2QI9F 2OXIA 2OHIA 1W76A 4IOJA 3L7DA 4X7PA 3PSAA 5AI8A 3MRXA 4WBSA 1T4BA 3EOAI 5I8ZA 5ITZB 3DOCA 1GD1O 3EXG1 1CJBA 3T5DA 4DCJA 1EFCA 1QIDA 3P97A 1EI9A 1UBCA 2R5FA 3LY5A 2VWPA 4OGKA 5KDOA 3P2YA 2GERA 3SZGA 4I8DA 4OXIA 5H8WA 3ZIUA 1TJ3A 4RKFA 5TB5A 2JIDA 4IDBA 3LHKA 1XVVA 4LXQA 2VEOA 3O7MA 4KRGA 4X8MA 5DMHA 4BRSA 4WFIA 3SFZA 2CFIA 1W44A 3UH0A 4ZRNA 1N25A 3LYLA 3U40A 1E2LA 4JL8A 3A6EA 5JCOC 1QSGA 2FSVC 5LQMA 3PD1A 1NXTA 5JS6A 1JG1A 1W52X 2E3JA 4DPMA 5JATA 1V5FA 3QXGA 4ZCSA 1ZI6A 2AKEA 4CWAA 2PMKA 4H1WA 5FWAA 2JEOA 1V4VA 3B20A 3COSA 1ECPA 2N3ZA 4BZQA 1NM5C 1A0OA 1HV8A 4J0GA 5BQXA 3WV4A 5A62A 5IJXA 2ISSD 1EVQA 1T6ZA 3L7AA 4MLPA 1VL0A 2PUAA 1KQFA 1C7JA 1E3SA 3ZE1B 3B5EA 1VA4A 5DOZA 3RVOA 4Z9BA 5T41A 2HTFA 3SJBA 5I8WA 3GJQA 4OSEA 4AICA 3FRIA 3HZZA 3OO1A 1EGVB 2R8YA 1AKWA 1VL5A 1K6XA 1U28C 2HWUA 3JZAA 1QFMA 4MCIA 1L5VA 1VCNA 3H9CA 2YC2C 3MK31 1PGQA 4P34A 3RUPA 2C58A 3TKLA 2XE8A 2R8EA 4EQZA 4GGMX 4Q48A 1H8HD 3BGIA 4XCXA 5ALPA 1ZM2A 4UUOA 3QMMA 2EFJA 1DAHA 3DZ8A 3PNPA 2Q5FA 2F1RA 2QA5A 5REQB 3K2EA 4BCBA 5J2TF 4UQPA 3UJ3X 2BKLA 3WLFA 3U16A 3D7MA 4OO3A 1EYZA 4BY9E 2OT3B 1GNVA 1UPXA 2ACKA 2XBUA 1YJ5A 3D7LA 3WIVA 3EK2A 3VU1A 4YDQA 5KZMB 4OHWA 1CHNA 2OB1A 2JAOA 3RVMA 2FN9A 4HWKA 4OQZA 4IUCS 2FEOA 1BFDA 5CDFE 1NLYA 4ZMRA 1YCDA 2IBTA 2XVMA 3Q7TA 2VT7A 1RBMA 1YASA 2QV7A 3H75A 3DMGA 4TLEA 3UW1A 1KP9A 3GF4A 1T4GA 1U5BB 4NOMA 4RH0A 3SHOA 4DUPA 4E31A 3RC1A 3ZKWB 9ABPA 3G9UA 4CM9D 1K6IA 1L5OA 4ZTUB 3IBCA 1Q6YA 3TS1A 5HRUA 3NXKA 4UEQA 4YRCA 5IC6A 3B2NA 4Q6BA 4JI1B 3ZUGA 1VXRA 2VHVA 1U9CA 1XSEA 4OP1A 1L7OA 2C4VA 2F67A 4RBNA 1SVLA 5CNJA 5IYZA 1JJAA 1TD1A 1WZEA 4I4TB 5F7ZA 2QORA 3TW0A 3DD5A 3N6VA 1NDUA 4HNGA 3FLAA 3HEAA 5A0FA 3L07A 4PPGA 4K88A 4E08A 4DV2B 4FEEA 2YKGA 3CNHA 4AY6A 3I04M 3U9LA 1NPTO 5JZSA 1TVKB 2B82A 3HYLA 4MKGA 1EZ4A 2SICE 2JRCA 1KORA 1KI9A 2Z2KA 4MVJD 4OA8A 4WZ6A 5KIAA 2JIMA 3KFVA 5I7WA 2Q8QA 2FXIA 3R40A 4F86A 1NNLA 4S1PA 1PHRA 4Y18A 1N2IA 2TS1A 4OFZA 4R2LA 5FTWA 1S9DA 4KQ6A 3NT5A 2WJPA 3EC7A 2AMVA 4R9RA 4AP6A 5KMGB 5EXTA 1KJWA 2V55B 4DJJA 3HC7A 3SSOA 2YIDA 1E6LA 3B9BA 3DEYX 4HQRA 3T41A 4R54A 1UIRA 7AT1A 2QYSA 1C8VB 1XFDA 2I22A 3KBBA 4XX0A 5A5GA 4BX2A 1W9MA 1UBHS 5IVDA 2QU7A 1E79A 4F2WA 4NATA 5EJ2A 5GADl 2QLNA 4K05A 5C3MA 1NWCA 1E1QD 1BXGB 2X76A 2GJ9A 1IY1A 2BFDB 2ZBVA 1MX3A 3CZ9A 3UJHA 3ZVMA 3V5NA 2OFPA 3KJGA 2QUBA 3E70C 2ZYDA 3FNHA 4Z4QA 2JK1A 3IVCA 1RAEA 4PC7A 2W6MA 4DQVA 2HWWA 1RHKA 1HT1E 3LY9A 4Q3CA 2Q3JA 4DA0A 1LJLA 2ONJA 4FW8A 4MVJF 3WKCA 3LT4A 5IDYA 2B7BA 4G0ZA 2EWMA 3K8QA 5AKLA 1IBCA 2E55A 5DWDA 4YAIA 4HNTA 2DE0X 1DCTA 1N6IA 3P9SA 3E8SA 2SECE 4BMZA 1J24A 3LW7A 4MGYR 4DM7A 1TZBA 3FMFA 1A5BB 3EVAA 1TK2A 2IPXA 3HRIA 4RPKA 4IHAA 5CR9A 5KYVA 4DMLA 4BKOA 1QPGA 2WZQA 1Q12A 3RLFA 5U4QA 5KYTA 4EARA 2BUBA 1U0NA 3ZD8A 1MJGM 4QODA 4CT4B 3KKQA 1A5SB 4ZYTA 4DDHA 1RQ7A 3QHQA 4HTAA 3KQPA 5DGXA 4RE5A 2O2IA 3GZ4A 4KWCA 1Y3DE 1P4SA 4K8RB 4NYIQ 4O4JA 4B09A 3LF2A 1MQ8B 5IVPA 2BM1A 3MUOA 1O0SA 1QWSA 1W85A 4ZZ1A 2GR9A 3PI6A 4AJJA 2O2SA 1D09A 3HYRA 4MUHA 3TBHA 4OI0A 1SB9A 4KDEA 4TLAA 2QRNA 3I1FA 1U0SY 2WWIA 3ZLJA 3NKLA 1B6SA 5CEJA 2W2KB 4NZMA 2XQJA 4YB8A 3T7JA 1SKMA 4ZO6A 2CDCA 4QU5A 1P7VA 2A67A 5DDIP 4DRZA 1G7RA 1L8LA 4Q3KA 1HYBA 4HMOA 3HV2A 2QMHA 3ABZA 4BQSA 4BAGA 4EG7A 1KP3A 2WIJA 2CK3A 2X8AA 4RVFA 1G2OA 4TPKA 4K03A 5AKXA 4RHEA 1YK0A 3C7KA 2W6IA 5LQSA 4MWSA 4DADA 3U26A 1NXWA 4BYMA 1B1AA 1SO8A 2NT4A 1G5HA 3GG9A 4QGHA 4I5FA 5HK9A 1I7SB 1U0TA 2B8NA 2GBLA 5LD2B 3H86A 3IKLA 3LM8A 3IVGA 1FRZA 1T2FA 4BEWA 4HDCA 3IOYA 4WT7A 4DTIA 3WB9A 3SGLA 5TEWA 3S27A 5EINA 3J80A 3MJRA 1UT5A 1ICIA 2C57A 1I4OA 2O7RA 4Q15A 4R4JA 4G2TA 1L5WA 2GM3A 2OZVA 2YZ2A 3OM0A 4IUDS 3RRJA 2P9FA 2VHCA 1N6KA 3HJCA 4GOMD 5JO0A 1G64A 1Z15A 3KT8A 5EY5B 4X3PA 6YASA 3F5FA 3HRHA 2ZR9A 4G85A 3B60A 2QMOA 4HEJA 3W5JA 1E2EA 1T5BA 4CMJA 4FS3A 1S8FA 2XVYA 3CONA 3LXRA 4FWBA 4LTDA 4W9NA 2WFLA 2YV4A 1PGJA 4P8RA 2JH8A 3F3SA 1C4XA 1MN6A 5FR2A 2QLMA 5E9AA 3SYRA 1Z0KA 3DZIA 4D98A 3IRVA 1GFZA 1E4YA 1RXCA 1WZNA 2ERYA 2ZU0C 1P3DA 3OKCA 3DLBA 1JDVA 4JZKA 1JDTA 2PSDA 4ZRMA 2XVXA 3KVNA 4MRPA 5G0TA 1OXSC 1DRWA 4LDAA 2E21A 4PINA 3PC8C 4ZI5A 2AD5A 3MTIA 3EULA 5DN9A 4XTRA 1RM0A 2CBGA 4BKQA 4KFUA 2AK2A 1Z2AA 2H0AA 4UZFA 3V8EA 4U5XA 2BGIA 2OKCA 2GRJA 1DS6A 4ZDWA 4HTFB 2HBZA 4XIFA 2V6FA 2DFTA 4JJEA 1FFEA 4KIWA 2Z1MA 1TE2A 3TX6A 1ONOA 2RB5A 2H5JA 4DZRA 5KREA 2QR5A 2QW1A 3HR8A 3Q2KA 2JBAA 3LGAA 4Z4FA 4GLLA 4YRJA 4PU0A 2DQKA 2KMLA 1R8SA 5K8LA 4JJIA 4A2CA 1N2HA 5EERA 4EW3A 1OKKD 2I2XB 1GNQA 2WB4A 3GRFA 1VB5A 2K87A 3DTNA 2EKDA 4N4AA 4MYDA 3SEAA 5B4VA 5BY2A 1S01A 2C2KA 2TYSB 4J2OA 2YJ4A 2V4MA 3IURA 3JVDA 1QVRA 2AA3A 5ARBA 1YZ3A 1KK2A 2AOTA 3OZIA 2KW5A 2OQIA 5IWAB 2YV3A 3BYZA 2RAVA 3A11A 4TMXA 1JE1A 5IYZB 1K68A 2BM0A 2ZIWB 4M9RA 3CNQS 1V11A 1FYFA 2JGDB 4B8YA 1B8PA 3N70A 4IMJB 5JWHA 1VJTA 3IUNA 3VVMA 5IWCA 4E4RA 1IZ0A 1VG1A 1OHHD 5JASA 4KQXA 2XF2A 3GRKA 2GXQA 5AUPB 5HP4A 2NU7B 3ESXA 1R5OA 4HADA 3P5BA 3P9RA 2HFJA 5C0OE 4AG6A 5JAOA 3MTAA 1VLQA 5HJ5A 1Z6AA 1RM5A 1SKQA 1VL2A 4X7RA 5JD4A 1E0AA 1RQNA 1PZHA 3JZMA 4KUHA 2EKQA 1ONBA 1YB5A 3FOWA 1FUUA 3GH1A 4QQKA 5F35A 5LZ5A 4BVKA 3SHTA 1D2CA 4EOGA 4OY3A 4S0XA 3T5AA 1UIMA 2EFYA 3HACA 4HVTA 2IPLA 3R24A 4C6SA 2IPNA 1CZUA 3MHTA 4XX0B 1NJSA 5LKAA 2JJ1A 3ZVRA 5GPBA 1EWYA 3LWNA 4ZT7A 3W9BA 4RUKA 1SNYA 4U2BA 1YZGA 1GPWB 1OZGA 4QYWA 3VPGA 1RU3A 1E9FA 4IRUB 1XCPA 1G3RA 1EA7A 1JJBA 1LPSA 2BUAA 1C7ZA 2IVZA 4IW3B 4TGLA 3FTDA 4V0NA 3HNOA 1KQGA 1AGPA 1PGPA 2PSSA 3TB4A 4A0HA 4EEZA 1Y9JA 3F46A 3TLBA 1FNBA 2A9QA 2CWDA 2VF2A 4PFSA 4BECA 5KJEA 3J81A 3PUYA 4B76A 4ID9A 3ZH2A 4WFKA 3AI3A 1CKEA 1OSNA 5EQJB 3H9BA 3JASA 3MTQA 1THGA 2QXTA 3NWPA 3ZR4B 5KB3A 3U4QA 4KREA 4B73A 2A9KA 1UINA 1T4DA 2GLTA 1I7DA 3EZ9A 3PCRB 3IDZA 1JL3A 2Q2QA 3BGDA 3KOZA 1C0KA 4GICA 2ORIA 2FEXA 1CUUA 1XCGB 2IYYA 1K1EA 4FE4A 4AN0A 2UXCB 3KWLA 3NBQA 4G4SP 1UOPA 5EWLA 3U1TA 2VJMA 4WVFA 1DO8A 3KUCA 3RTAA 4L0CA 4YCMA 2R4UA 4GYYA 2I3ZA 2CLHB 3C3YA 3ECAA 1ZGHA 3KQWA 4XWGA 1NJ2A 3OPNA 5FTJA 3HHEA 1WMFA 3EOZA 4MUKA 4O4JB 4PCLA 4Q9DA 4YCDA 1V96A 1W85B 5CX4A 4G65A 1ZRHA 3NHLA 4D9FA 1E6KA 1SKBA 1C3JA 1YDHA 2XMGA 5HIIA 3QWHA 2PWBA 2OK7A 4MV0A 5B1SA 1YQGA 4KXMA 3IPXA 4Y2QA 4EY6A 4YWHA 4LJ9A 2GASA 3RUHA 1EAMA 3F4BA 1E1YA 1UXKA 2BMEA 2HK8A 3CMMA 3KZVA 3ECSA 4EB6A 2WSSA 2B92A 1W73A 1PSDA 3FDXA 1LXCA 2GJKA 1F1BA 4XPZA 1N6LA 2NX2A 3RIMA 4EKIA 2J59A 5H80A 3I2GA 2VRBA 2NV2B 3IJEB 4E5SA 1M1NA 3KTDA 4DYVA 4X95A 4E33A 1RWVA 3JD1A 3U4DA 1Z6ZA 1EDOA 3HWWA 5ESXA 4BYGA 2WJGA 3KZXA 2F3UA 3VJLA 2Y92A 3E35A 1N5JA 2PU7A 5ESWA 5KTKA 3UJPA 3DZDA 3OWOA 1YD7A 1KBOA 4F04A 5KTYA 3BDAA 1VYVA 5B3JC 4UQLA 3AR4A 2I80A 2GFIA 2G7ZA 3KSUA 4H6PA 4BBJA 4QAQA 5FTKA 4OVKA 1XJ0A 3FOEC 2PMDA 4GNRA 4HH3C 1QCZA 1C9JA 3T7RA 4EHBA 5FJIA 1U8CB 2IYNA 1NN1A 2WMOB 4LS3A 1ND6A 3BMCA 3L02A 1ZCAA 1J0CA 1MH1A 3DWIA 5B1DA 5C1PA 2GJ8A 2OCYC 4YR9A 4RH1A 1IJEA 3M4YA 4MW4A 2WFLB 3LHIA 1V9LA 3Q3IA 3MUEA 4JELA 1ETHA 3ABIA 4DTCA 1TUGA 4BIMA 1PHPA 3E1GA 5L40A 3P0IA 4RWEA 1DBIA 3TZBA 2E82A 1S0UA 2O2HA 3TRFA 4HVCA 3N6RA 2PEZA 4KQEA 2WE8A 3EEFA 5K9ZA 1E0KA 1W5FA 2I65A 5LLDA 3BWVA 4GHWA 5HF8A 4MJ3A 3GJTA 4O4IA 4EFDA 3JAKA 4MPDA 4L22A 4LGVA 2EFHB 4QJIA 3O95A 4QRIA 4DIEA 2BGGA 1R5JA 1UP4A 4DDKA 3RGWS 2ALJA 3RRZA 2PX5A 2PXAA 3ESBA 4U2GA 4DNXA 3THYA 1Q6ZA 4C4OA 2FSFA 3TAUA 2YXDA 3LVFO 3AQ4A 4NBSA 1I9GA 4CM5A 4Y2TA 4B44A 5T7BA 2YYAA 3VOTA 4BU1A 1PJZA 2B9EA 2GAOA 5BNZA 2P7IA 2FPPA 2PBLA 2EEPA 3JQRA 4ZYZA 4OHCA 1ORRA 3ESZA 4YPVA 3KOUA 4RIFA 4ND7A 4ND6A 4X6UA 3E0XA 4G0UA 2OUKA 3JQGB 5KNBH 4KFTA 2OC4A 3BJIC 2JRLA 4AUEA 2GSDA 3PX2A 3CVXA 1B0AA 2WUFA 1CW2B 1T8SA 4RZXA 1E8DA 3I39X 4F3NA 1VL8A 1A9PA 3AIOA 3VSCA 3N1UA 1WB5A 2AOTB 1M33A 5ILQA 3WRYC 2ZIZA 4YJ2A 4HDKB 2H18A 3CRVA 3WWYA 4IG9A 1IEVA 2BJVA 3MAJA 5HNKA 8GPBA 2PX3A 1DFIA 4I81A 4MEAA 3IQZA 2C54A 4P31A 4WECA 4QM7A 3FJYA 2IV3A 1IZZA 2PZGA 4LVCA 1M2VB 1E5TA 2OGWA 3Q7EA 2QW8A 3DR3A 3QUSA 2C7PA 3JWGA 4JA0A 2Y1XA 5K03A 3LIIA 3OQHA 3P4UA 1E1CA 1P4JA 2MT9A 3OLYA 1FU4A 4LVUA 2C83A 1H4SA 1EIWA 1L1RA 3QLVA 1GLNA 5J4HA 1Q7EA 1RYNA 3UCFA 1W87A 1UXJA 3LFHA 1K5PA 1XKQA 2XHEA 5HZHA 4PQFA 4PTYA 5AVRA 1NUHA 1XQ6A 2QAJA 3JYQA 2ODAA 1MRNA 3VR4D 2XQGA 3I62A 3EXG2 1KF0A 3A6ZA 4Q4LA 3OQ1A 1G7TA 1UM8A 4GSLA 4XJVA 2V7XA 2YX1A 3C8DA 1GPH1 3ZHCA 1EM8A 1VJ5A 4MUYA 3SXPA 3W90A 4J2TA 5KSOA 1NI5A 4HS9A 1TVCA 3N8HA 2IZ0A 4LZZA 5IEJA 1BHSA 1QDLB 1JA0A 1UBLS 2HEIA 3D6MA 4GD3Q 5EKSA 3TXAA 5IRCD 2RKOA 3K15A 4H2DA 3J7AC 3ZDFA 3KSDO 2I7CA 4UMEA 3I6ZA 4F5DA 5JRZA 4RD0A 3VZDA 1IMJA 3V8NA 5AFSA 4TSKA 1QPZA 1UFVA 3QU5A 1Z2DA 1LLUA 3IKVA 3OQBA 3IMFA 3NJ4A 5IS2A 4CT0A 3BSWA 2OR3A 3QITA 4G5RA 1Q84A 2VZ8A 3WMXA 4GUAA 2V54A 3BCSA 4PVDA 1SCAA 4FDTA 3IOEA 2DZDA 3HJGA 3OZSA 4DWOA 2YXPX 3LZDA 2OSBA 4PWZA 1WDLA 4QPJC 3NAMA 2CNWA 4NONA 3W5IA 3BB1A 1SWWA 2VHZA 2XGGA 2WAYA 4D81A 2WTAA 5DE3A 4DHWA 1TK9A 4ML3A 3SCZA 3AU9A 1DJMA 4FYMA 4GRAA 5AXDA 1JU4A 1TJYA 3LXUX 4BLTA 3WLEA 4Y98A 4X91A 1RNLA 4W5OA 2FOIA 4TN1A 4CCWA 2OB2A 2H48A 1R0WA 5JJLA 1DL5A 1YJBA 2HXSA 2GILA 4GPD1 3QBDA 4BVLA 2R97A 3L7MA 5M04A 1TM4E 1TA0A 2GO7A 2C29D 3FFXA 5G1NA 3WJ1A 4PYKA 1Q21A 1E9SA 2WG1A 2OLJA 1GKYA 4RF4A 4C89A 4PQEA 4AW9A 4EG6A 2NUBA 3LHDA 3CCBA 1UXOA 2IU3A 3HBFA 4IZOA 3P9ZA 4BO2A 3LUGA 2XWJI 1NKSA 3RDPA 4UVIA 1JIIA 2W0SA 5L9AA 4PAOA 3H6GA 1ILEA 4BZXA 4OMDA 2IHZA 4GO1A 4RK0A 1J23A 2G5PA 4R05A 4ZYYA 3WHLA 1EX9A 1JHMA 1U2TA 4BN5A 3H9UA 1SBCA 3TQFA 1L4GA 3M1YA 4OI2A 4UDOA 1JXQA 3NT2A 2FGJA 5DTRA 4OHFA 3HABA 4D4MA 4F6CA 5DNUA 5CNIA 3UMVA 2VOEA 1IBSA 2DR3A 2CJPA 1LZLA 4ER6A 3QSYA 1CETA 3UK6A 2JAUA 1B14A 5BSEA 1CJKC 1G17A 2X2PA 4RESA 2A1TS 1BX0A 3EPKA 1Z3IX 4S12A 2QAGA 2WWTA 1ULHA 4BWVA 1DQNA 1ODKA 3MTDA 3O7WA 4HZIA 1W2GA 4LDNA 3Q85A 3QVKA 4OP2A 4PGAA 4M1TA 4TWBA 4U02A 3SJCA 4YCCA 5KYUB 2OHVA 4NXNB 1JI0A 3ZWNA 1CQZA 3A9WA 3H0CA 2MR5A 3IUJA 4H1HA 5IKMA 3WA7A 2XTMA 3CPSA 5GJCA 3C8MA 2YHIA 1C3VA 4E3WA 3AXTA 2EGGA 1PL0A 2XYVA 2NU6A 2AMJA 1LPOA 3ZHVA 2RHWA 5LJIA 3D9QX 2G1JA 4FYXA 5A5EA 3LLUA 3SOZA 1HURA 3T3NA 1DQZA 1E4OA 3EGXA 3OT4A 5KDLA 2WB2A 3BMCB 1R88A 1MT3A 3PHHA 3KDAA 3QPVA 1VLZA 5AKZA 1FDSA 1KZGB 1WL8A 1Z5VA 4ERNA 4ZCIA 5CDTA 1XNRB 4COOA 2O14A 1A2OA 1T36A 4OB8A 3NH9A 4BVJA 4ETWA 8OHMA 2DWQA 4J3NA 2WJAA 2PMEA 4CLXA 2JA2A 3GCGA 3W2EA 4PZEA 4B4OA 3ABQB 1M3SA 1SCBA 1KNQA 4EGQA 4N6GA 5BR1A 1IOLA 2ZB2A 1VHTA 1E61A 2PVCA 4JJ4A 5TS2A 3TLKA 3RAGA 1YKGA 2FMXA 4H59A 4B3FX 4Z3DA 2IP4A 5KU1A 1DKMA 1O5IA 3LX5A 5T4HA 1RRFA 4O4IB 1V2GA 4Z7JA 3VC1A 1YB6A 2YJNA 3M49A 3ORYA 5FPHA 1O97D 3OOEA 5BSUA 1IZYA 4EPTA 3GLFE 1S3GA 2G0TA 3W8NA 1R6AA 3JSAA 4KSYA 4M9UA 1T9GS 3R7FA 1R8XA 4R1LA 3QY9A 2QRVA 3IAXA 2CJYA 2AZXA 4OGLA 2CFOA 3H9GA 4ETIA 3TNLA 3EXIA 1VIAA 2O9JA 1V1JA 1A3CA 3DVLA 5ENZA 1JKMA 3L5OA 2O07A 1UMDA 4NCXA 5K8IA 1SK9A 2G1AA 3PS9A 1HLPA 2G04A 1MQSA 3K0CC 3IQIX 1LNQA 4G6ZA 3Q1KA 4MVCA 5B2ZA 5J2UA 1YE5A 2P69A 1QO0A 1AG9A 3ICVA 4R1QA 2D4AA 1C9DB 5C7LO 3NLLA 1EB9A 3A2MA 3FTQA 3JQBC 1PLLA 3QVJA 5LCXA 4MLDA 4L4SA 4D9NA 1ZO8A 3M5DA 2HMSA 2UYCA 3TNYA 3R3JA 2IYWA 4MO9A 2Z2IA 1T9HA 4J90A 1PYOA 1D1SA 521PA 2ZW9A 5FRDA 2OBXA 4KDCA 4OAOA 1MOZA 2HDNB 1B6RA 2VHTA 1DX6A 3BB3A 1ID8A 1XV5A 2J5BA 2MSCB 4XQGA 2YJ5A 2JI6A 3QJYA 3L8YA 5ALXA 2A5JA 3SEZA 3W3ZB 4D45A 3PVCA 5CBKA 3W0LB 1ZGGA 1NVXQ 4XW2A 2OMEA 4JX9A 2NSDA 4ZD6A 2Y4OA 1BO6A 1X14A 4JQZA 3SQNA 2R3SA 1PWYE 4UHKA 3ZTYA 4CM8A 5BMVB 4INOA 3IO5A 5FD8A 4JYZA 3DLAA 3DVSX 4LHEA 2IS6A 5A0TA 1YO6A 3NNNA 1YDEA 2OAGA 1FVOA 1XA4A 3WDKA 1OH7A 1P60A 5EZSA 4LZPA 2O4CA 4LF8B 3OWXA 5J40A 3SS9X 4PX3A 5AR1A 3R1IA 1HQDA 4YUAA 1M34E 2AV6A 2H1RA 3GQBB 2R68A 3STYA 4RLQA 4WIAA 4WZAB 2WQ6A 4HRXA 2QBYB 4WV3A 2GZMA 2IYXA 2OD7A 1JHPA 5CA1A 1IM2A 3R5FA 3P2KA 1F20A 3O84A 3CEHA 2ZROA 3QKIA 3TVTA 3GUZA 5I3CA 5JZOA 3AP3A 4P7JA 3C3MA 1HTTA 3EVGA 4YCJA 4UEKA 5MGBA 3NOQA 3RNLA 1DRVA 4KLAA 1NMYA 2D0PB 1Y7IA 2HK9A 2JDID 3V4ZA 3TQTA 1V8ZA 2XT0A 3R3XA 5TMEA 3RVPA 3NRBA 1DIBA 3HEMA 5FLEX 2KS6A 2E85A 3IDAA 3H2JA 3W6UA 4B2LA 4PZZA 2AT1A 1R3DA 1WOMA 4P7BA 1JHUA 3HXTA 3R0IA 1X1QA 3V2UA 2JAWA 5K6RA 3AWIA 5GTDA 3C45A 3ZWAA 2IHJA 2ZTHA 4V0RA 2LIVA 4OJKA 1U2EA 1UJBA 2CFSA 2W0MA 1CCWA 4M0UA 3G5MA 4PLPA 3BERA 2GCGA 1K89A 2AN9A 4ER7A 4DLZA 2OHGA 1JUDA 4QC2A 1ST3A 2XUOA 2OP0A 4IQ8A 4KP7A 2EOAA 4MV8A 3SE7A 3TJMA 3ADDA 4WKCA 1MO5A 1ECFA 1HK7A 2Q1UA 4B87A 1AJEA 5I7VA 4LBVA 3CUSA 2ZSFA 2D00A 5J5CA 1W4ZA 2JCYA 3ZHOA 4HWSA 2OVBA 2P6MA 2GTIA 2R6JA 4PLTA 3OUTA 1XDWA 4YBZA 3GLVA 3MS2A 1NMSA 4JWTA 4TTVA 2Y6VA 3ZNPA 4N3GA 3LVRE 5JZBA 1JEYA 2JBHA 2ODTX 1WMBA 2BN4A 2V3VA 4NDNE 4O5AA 1MT0A 3PB3A 1OH8A 1GUAA 2WV9A 2YQZA 5TX7A 2GN2A 2E4XA 4M54A 2DCUA 4FB5A 3QTTA 1QU3A 2H29A 3N2YA 1IXZA 1X7WA 2I29A 2IUEA 1GU1A 1PG2A 1YBAA 4LXHA 3VAYA 5TDHA 1ZIYA 2QPAA 1ZXBA 3GLUA 2UYHA 1E2UA 4QDKA 2VC2B 1T34A 2PRIA 1P2FA 4ZI7A 2RKBA 2F43B 2V9PA 4EA7A 1Q92A 3ZTWA 3QFHA 4F6LA 2O6LA 2OEPA 3EODA 4NJEB 2IODA 3H4MA 1GNPA 1GGJA 1VJDA 2AJLI 4GXRA 4P54A 2TRSB 3QLUA 5LIRA 4YRQA 5JH7B 6ABPA 2FOLA 1QX3A 2VNKA 4NC9A 1C3EA 2N47A 4B17A 3GEBA 4L02A 2CNNA 2WM8A 1X15A 3HVIA 2DJIA 2GYYA 2AF4C 4IDCA 3PCXA 2QAGB 3KZMA 2BUCA 2WKSA 1RW4A 4PZCA 5EFOA 4AP9A 4EA9A 2EQBA 3B78A 1XXHB 3N05A 1ZQ9A 1BE1A 1TMYA 4P81A 5H3CA 1UT6A 3HFJA 4PQGA 5TE9A 4BZPA 1E3MA 1FFBA 1HYHA 3MPOA 3I9JA 4ZZ3A 1SN7A 2Y1GA 1QH9A 5ICMA 5JROA 4XVCA 2P0AA 1NSFA 2DMRA 1U3UA 1RXWA 1G291 5EXSA 1QQ5A 4A10A 3RFTA 1T2DA 4MEBA 4OKNA 3THXA 5CVCA 4WEOA 2PAAA 5JADA 1NBIA 3EGXB 3WLIA 1GN8A 2E4VA 2XB9A 3OTGA 4FONA 1TO2E 1E0SA 2C2WA 4R5MA 4WCFC 3JQAB 3W3AH 3MSCA 3OA0A 1FDRA 2PNFA 1T36B 1YQWA 2QVYX 2YWDA 3CLTD 3GMSA 4BATA 4ES6A 2O8BA 3HB9A 2ID4A 2JAQA 2XUKA 1HYEA 5DBOA 3SQOA 1JS1X 2FHPA 1X92A 3DH0A 3GVHA 3MT0A 4QXRA 3SLKA 1JDZA 1SM4A 4RS4A 2HLNA 2P9EA 2YJZA 1TFUA 1P31A 4OBWA 5FBZA 4ARZA 3QFCA 2GAAA 2OO5C 3C14C 4ILKA 4L4UA 3DOJA 4ZTZB 2ZJ5A 2VHEA 1K7SN 4X1YA 1EG2A 4IGKA 1BVHA 2OBBA 1WVMA 3NZEA 4PZPA 5TMBA 3D0OA 4D9JA 4UMDA 2JFPA 2Q2VA 1U8EA 3KWMA 5EKDA 1F06A 2Y0EA 2QRVB 2Q3EA 2A6PA 1G8AA 1JVNA 2C2BA 3WY9A 1LLQA 1PK8A 5ALLA 1E6MA 2OGZA 1E2KA 3COVA 3E7PA 1TPZA 4TLCA 5I47A 1UMDB 2RK6A 1WCWA 1CNFA 1YAJA 3CNEA 4P92A 3UMGA 5MF6A 3QPBA 4MNTA 2JCBA 5DIZA 2QY6A 5B1IA 2B0JA 2R6ZA 4TTAA 3HPQA 3F6CA 4F38A 4WXMA 3PGMA 3EC2A 2IVFA 4RWZA 1NGSA 2IPMA 1EWRA 3R3UA 4JT9A 3UKOA 2AUNA 2X0KA 4AYXA 2XMPA 3BK1A 3OM1A 4EGCB 3LCRA 3ZW8A 3BHIA 1DNPA 4ECEA 3BC1A 2GN0A 3LGXA 5KX5B 1OTYA 4RQBA 4G1BA 3KYCB 4FOPA 2JGLA 3AF4A 2GA8A 2GN8A 2FSIA 1WSAA 3GT0A 1IN6A 4X71A 4DV7B 4MV3A 2O19A 4HPJB 4HNSA 3R3HA 3QSGA 3X0DA 2BFFA 3PF9A 4KQ2A 4J8PA 3OBIA 4ZPXA 3SYMA 3TLMA 4K2AA 5CXQA 4MOWA 4EAQA 3ADCA 2VUIB 4CLRB 2A78A 4H08A 3FA2A 3OZWA 4I4LA 4L9RA 4PYJA 2V7EA 1Z4IA 1M2EA 2OHXA 2UVDA 1A9XB 4M0DA 3UAXA 3VBEA 2B36A 4LHYA 1DAOA 3CVOA 3UPUA 3IQFA 3AEYA 1Z2OX 1E9BA 3EISA 1P4GA 1KZ7B 3H5OA 3HCAA 5ED0A 4BFWA 1WSBA 2VAPA 3L1JA 5H9WA 1NQAO 1G2IA 1V47A 2H51A 3L8DA 4D9KA 2ZBQA 2Y1DA 1KO8A 1V71A 1U0RA 2I66A 2VJBA 1H0RA 4LXXA 3IAAA 2A4KA 1UPUA 3PXUA 1K5DA 1ZUNA 1DXOA 4KQFA 4B4VA 1F2TA 2ID7A 4G01B 1EE1A 3BICA 4WJLA 3BT7A 2HU8A 2FPOA 1FDIA 2VP2A 4GR4A 5IT5A 2YOGA 1PWXA 3RQSA 3RT7A 2OFWA 5FI5A 1OLSB 2DPLA 4ZHQB 3B6MA 4MP8A 2RDMA 4KLNA 4ZO7A 2PFKA 1TAGA 2AK3A 2XLBA 3GAMA 3ZU6A 1XPRA 3B53X 4LK2A 2OHJA 1SFRA 2IUTA 3JWHA 721PA 4DLKA 5EE5B 1L7QA 1PGOA 1GAEO 5AKIA 1KO5A 5IUKC 3OMLA 2TMGA 1E77A 1IHXA 2YMPA 3DHEA 4MW6A 3IUPA 1ZW6A 4QICA 2FCRA 4HRAA 5J9FA 1N92A 1G3UA 2VA9A 3K9FC 1W36D 1F2UA 1X70A 3FSGD 4H1UA 4KRYA 5A1TA 4Z1OA 4NU8X 1D4ZA 1ZYUA 4FFVA 5HM8A 1DZIA 4KNVA 3UATA 1YRHA 4M0PA 4M86A 4FYKA 3CJTA 1CTQA 2BZ1A 2R8PA 1D04A 1Y1PA 1Z7YA 4L51A 5T4EA 3GPCA 4REMA 3ZEAA 4D6YA 4PFQA 1WV0A 2P2SA 1Q0RA 3NYQA 3CZRA 3UJDA 3ASVA 1XBTA 3CRNA 3OQPA 4W7IA 2I3GA 1JEYB 3L93A 1IZ8A 1NBHA 1H2FA 4CLOA 2ZRJA 4P98A 2PQ6A 3PC3A 3AR2A 1CLEA 3L82B 1R74A 4FT4A 3W34A 4DLNA 2B4QA 2V6IA 2ZXUA 1X7WB 4ND3A 1TZCA 2O57A 3V8PA 1UZNA 5T57A 3RRBA 4PANA 2C9DA 1T8WA 3JAMA 3DVAA 1KJYA 4WBXC 4CIVA 1XYYA 2BFCB 3BAFA 4ZI7B 1KPHA 3ANNA 4QU0A 1ZR2A 3DLIA 1IY0A 3DB1A 2C2ZA 1IY9A 1M1YE 3HVJA 3D6TB 2CXTA 4BX9A 1R4MA 5BVGA 1H6AA 2XCOA 1Y1TA 4GFDA 2WE7A 3HBJA 4DMMA 2C99A 2GEKA 3L0ZA 4WESA 4LYEA 4QOSA 4RJIA 5FOQA 3KKEA 1HXHA 4U6QA 2CHQA 2XXAA 5AESA 1FSZA 3IHLA 3BFXA 7ABPA 3F90A 4YRDA 3Q4GA 1ZD5A 2A1UA 4OOFA 1W93A 4LZWA 1D4AA 3ME5A 1L5FA 1X1BA 4ZT3A 2IYTA 3RE1A 2EFEB 2WSMA 4FC7A 2HQSA 3M4NA 2ORED 1NYRA 1TVEA 2VATA 2HCJB 2WJ6A 1K8QA 4MS4A 4BFYA 5DRTA 5TSDA 1C1XA 2NO6A 4ZU3A 1QGDA 3QYFA 5EUMA 3C41J 3ZY2A 2E4YA 2VPZA 4M9CA 3Q3VA 3H1EA 3THXB 2V7VA 1F4VA 4QPZA 1H2YA 2HDWA 3KO8A 4JFRA 4LIPD 4EPYA 1T4MA 2VAVA 4JEIA 4B3XA 1ZJ6A 5HR5A 3TECE 2PRYA 2HK6A 1DXQA 2G9ZA 3L6UA 4O4LA 1C9KA 1US8A 3LL4A 2PE5A 3O3CA 2OK8A 4A8TA 4C87A 2R5WA 5HBGA 3AEKB 5FL7A 4WBNF 2O8BB 4JC4A 4G4JA 3HJBA 2FHSA 3PBKA 1TJ4A 1SHZA 2DU8A 3GBSA 2BCJQ 2QTRA 4D4GA 1SY7A 4N7BA 2OPHA 5T3YA 4DIUA 1ARZA 1VL6A 1QYXA 2YRWA 2GPNA 1W30A 3QLTA 5SZHB 2XB8A 3HKDA 4YJ3A 3R7BA 1QWOA 2QEQA 3IELA 4S04A 2WHYA 4KQMA 3G7SA 3PXXA 5IULC 2C3PA 1OTXA 5K0NA 4C0SA 2PX4A 4LJYA 4X1YB 2P2LA 3BUSA 1VGQA 2FLVA 2FRDC 2R7MA 3ENVA 1VKJA 1BE6A 1C4KA 1JIUA 2BEUA 2V97A 3SKYA 3URKA 3WLRA 4EF6A 3WKEA 2XCUA 5J3JA 4HXGA 4AI6A 3FG9A 1DTEA 1SXJD 1KMCA 3K9QO 3M2PA 4QG7A 3RUEA 3NPMA 1FX0B 5TF0A 3K9LA 4NBLA 4Y6OA 4AMBA 4BC1A 3BA6A 2PZEA 3E2MA 3MB8A 3OJWA 4E09A 5FTLA 1W4AA 3IEUA 4X60A 3OE4A 1NVDA 1V1MB 2PZAA 3DF9A 1YFKA 4G23A 5B4TA 1ANKA 4AQYB 1DMSA 1VSQA 5C1DA 4EY5A 1EK2A 4L9SA 3V46A 3G79A 4TQGA 5EIEA 3O2JA 5I48A 4I9HA 3M5WA 4ND2A 2P4UA 2VWHA 4IKPA 1B76A 5B7PA 3ZNOA 2GAIA 3LP8A 5HIKA 3IAS1 3WS7A 4FUQA 1E2BA 3ELWA 3FCSB 1N9KA 2G3YA 3DBIA 3E2PA 4NMHA 2MDTA 1WCXA 2CXXA 2Q45A 2QLTA 2CF6A 1O7JA 1YC5A 3LLVA 4O4HF 3VHLB 5MHTA 4YRPA 3GFOA 2BFFB 2A5GA 2GVDC 1B4DA 2J0VA 1L7MA 2QRJA 4EMBA 4PAQA 4Q82A 2KM1A 4G5GA 3OOWA 3A1VA 5BN5A 1A5TA 1NF9A 2J31A 4U9UA 5EHXA 5HKBA 2OM6A 5I9NA 1I4TD 2DH5A 3OZAA 4EF5A 4LF7B 2PFSA 5FNVA 3P9IA 5DCLA 5E7QA 2O6HA 3FLMA 2HPAA 2P5TB 4OFXA 3FVTA 2BKEA 5IJ9B 1U2GA 1N2GA 2EP7A 2QZ9A 5D3MA 3GLRA 1BWQA 1U1CA 2ZZNA 5LU9A 2IQ5A 4RZUA 3AVWA 1FQOA 1QQ6A 4URYR 1BKDR 3E84A 4JWKA 4XD2A 3ZCXA 3HJFA 4X64B 3S29A 2YASA 4GOKA 4EUKA 5CB4A 4CTJA 4OEHA 5KWEA 2ECKA 2MIIA 2OCBA 1W2HA 4CR6A 3HCNA 4J76A 4ZJYA 4E15A 4A16A 3OT5A 2IXGA 4KO8A 2I5PO 3PPIA 3ZCVA 3ZHUA 5JI2E 1KZ6A 3LQRA 1UF9A 3AETA 2SHKA 2MSKA 1AGRA 2QTAA 3H17A 5AOCA 3VSAA 1AXEA 2XKJE 5DSXA 3U4MA 4G67A 1J4AA 1IAVA 2Y9PB 5ADWA 3LUHA 4Y1FA 2Q6TA 4HWTA 1IUOA 1TUIA 5JQGB 1YR9A 2Q28A 2D2EA 1T0BA 6REQA 5HCUA 4IHJF 4WCVA 4RIEA 2KPOA 3C85A 2LXNA 5LD2C 3GHHA 5AKHA 3SX4A 1UK7A 2ZYSA 5DJ5A 3KG2A 2V7TA 3OZGA 4DR2B 4DSTA 1XZPA 5K8JB 3ITDA 1QGED 2C84A 3ODGA 3A4VA 2XRFA 2AUMA 5P8WA 3QBVA 2E4AA 3Q0IA 4J29A 5AW8A 5KTPA 3WOVA 2YN4A 2R60A 5TJHA 2RBGA 2VPWA 3SKXA 2IYFA 1KEEB 1C9MA 2YXEA 1FVHA 1OI3A 1SUEA 4KI0A 3TI9A 3IKJA 3PTAA 4KSCA 4HV4A 3KSAC 4EBBA 4CLOB 4TTTS 5HX7A 5DVZA 2VWGA 4CV1A 3LUKA 2P8SA 4YAGA 4ARVA 4H7EA 2XEXA 1QZUA 2ZANA 1RRCA 1BW9A 1HE5A 2VH5R 2Z4TA 1CIPA 5ALVA 3DWEX 1LDGA 2QDXA 3K96A 3IR5A 1SU8A 2FEMA 1QONA 2I6UA 4L4RA 3F49S 2DPYA 3W6NA 3VAAA 2NSHA 4NDZA 2YY7A 4L5AA 1Z2PX 3TRDA 4G09A 2ZRCA 5AJHA 5J63A 4FBLA 3UHPA 4PF1A 1HOXA 1MIHA 3IUBA 4PN7A 2XUAA 5ALUA 3B1XA 1UBFA 3VV2A 1QIHA 4Y9UA 1I36A 1R4MB 1H1LA 4XQCA 1W8IA 2VYVD 2DETA 2ZBPA 3OCWA 3DBOB 1KI4A 3TGWA 4C0BA 1EZZA 3F9CA 3JU3A 1NN0A 1Q3TA 2FR0A 3AEZA 1H65A 3FNEA 4PSAA 1KKLA 2ZRAA 3G6KA 3ZU4A 1T9KA 2I1QA 3SF8A 2XXAB 1T3TA 2CE2X 3ZDYB 4OAPA 2C8VA 2EJUA 2JIPA 2ZYTX 3L43A 2PGOA 4FIZA 4MAFA 2A1UB 5AXBA 1TKAA 5EHIA 1SHKA 1YACA 3V9PA 2FZ5A 4LJ7A 3S1AA 1XMIA 3NTRA 3LA8A 2FQ1A 4MI9A 2IYOA 4WASA 2NVOA 3QH4A 1P5RA 1O0CA 4E5VA 1E7YA 1FTWA 3ZJ5A 3NIDB 2GO1A 3CVVA 1V8OA 3GUVA 4JLWA 5AW4A 2HT1A 3HXPA 4O2BA 2RAUA 1PFYA 1NE7A 1F6BA 3AERA 3I0MA 1TYEB 5ADUS 2N0SA 2UUCB 4JXZA 2PH5A 2C82A 2RHJA 2PMCA 2E2WA 3AY3A 2YZNA 2P6PA 4QSHA 1VKHA 1E6UA 4O3FA 5KQPA 2J87A 2QTHA 3JVVA 3NI2A 5INTA 2XQIA 2QVLA 2FKAA 4BEBA 5B57C 1KHTA 1M2FA 1TA9A 1NUPA 3BREA 3CYFA 2WHQA 4BO0A 5JV5A 3FSRA 3TIGA 4MQFA 5CXSA 1AQNA 5GIOE 3BMOA 3GJ6A 3MG9A 1WVIA 3VU3A 3FNIA 4C7MA 3T1VA 4N7RA 4EB3A 2C97A 4P4LA 4YJ3B 1PZNA 3KTFA 4AUMA 2P7HA 4MQEB 2QJTA 3NOVA 4EO7A 2ZUDA 4Z1MA 1Z7GA 5LXTF 4AKTA 4EP1A 1ZVVA 2XGJA 2GNOA 4O63O 2JKVA 5CPFA 3BE6A 4JBNA 1TYZA 1BTOA 1Q0SA 3ABRB 4OGFA 2H7CA 3STUA 1VLMA 4XRRA 4A8HA 3KUUA 3MFYA 2AOVA 1DOAA 3FYDA 4ZAFA 3NP9A 4TSFD 2C96A 4IFBA 4MEJA 3FWNA 3FCXA 2AJTA 3FMPB 3MA0A 1ISGA 4YP0A 2WJ3A 4X94A 3U4IA 3U4GA 4TM8A 2PUEA 1NX9A 4Q4AA 1G21A 4H4CA 1JECA 2VCYA 2FPIB 3B1VA 4NYMR 3UMCA 3WYGA 5L4SA 5AIAA 1EJ2A 5B53A 1Q1GA 2KLBA 3PYMA 5FOTA 2NTYC 3HCRA 1Z22A 4EFLA 4S3MA 1JV2B 4IR7A 3ORSA 2QL6A 3KFLA 4WLFA 4P7KA 3MMNA 5JLAA 2WTBA 1P6QA 3INGA 3Q40A 1WD5A 1Y89A 4RACA 5DBGA 2WA2A 4MS1A 4PZAA 1OPXA 1ULZA 3ELUA 2UDPA 4IF4A 4JD5A 4PW0A 3TLJA 4ITRC 4WK0B 1N2EA 4OQ4A 1G9TA 3T3OA 2EBUA 2XOXA 4FGUA 3G13A 2NO7A 1XAIA 3DOEA 3ET5A 3MAAC 3B8HA 5E9JA 3RU2A 2GPTA 5L7TA 5BN5B 2VDWA 2FUG1 1O8BA 3D2BA 3L77A 5EUCA 4R1TA 3BIFA 3H2SA 5B58T 4WZBE 2WIDA 3F6SA 3B89A 4MGKR 4MUFA 1MO6A 5FFNA 3SIRA 4D8WA 4DSAA 2V3CC 1Z07A 2D2XA 4RHYA 2CZGA 3QTBA 2BCGY 2ZYIA 1R6UA 1X86B 1IZ7A 4UEOA 2XAAA 1E89A 4RZQA 4DZTA 2VDVE 1QNLA 1Z4PX 3KZ1E 2CCGA 5HQ3A 1DQPA 2B8EA 1D2RA 2ZI6A 3LX6A 3NC0C 4H6WA 3IUSA 4RMJA 4C7BA 4D79A 2JGNA 4F9FA 3KNZA 3H5VA 2HV9A 3UAVA 3LBHA 5BSMA 3GFTA 4RQTA 1QP4A 1M6VB 3FKSA 3ZJYA 1H6BA 3FZEA 1G5TA 1Q44A 3P2OA 4L6AA 1OUMA 4ZT2A 1F3OA 2CL6X 1K75A 4D0RA 1A7UA 4PG7A 3A9VA 1WKVA 1AKRA 4FDVA 4GZ3A 3F67A 1OGIA 3N74A 4TMTA 5CA0F 4CEIA 1GKIA 2GEUA 3TUJC 2AKAB 2H1HA 3QKTA 1A9QA 1INLA 1J21A 1G60A 2J6HA 1H1DA <