1DCMA

Structure of unphosphorylated fixj-n with an atypical conformer (monomer a)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
DYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
publication title Structural transitions in the FixJ receiver domain.
pubmed doi rcsb
source organism Sinorhizobium meliloti
total genus 22
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dcmA00
3SNKA 2QR3A 4KQ9A 3QLVC 3KCNA 3HSYA 4H3HB 1D1PA 1FFWA 1QO0A 5IULC 4F06A 3OM1A 3KYJB 2L19A 3O1JC 4L4UA 3A0UA 3UK0A 1P6QA 1GCGA 1DRKA 3SQNA 1ZY2A 4LZLA 4OG2A 5IEJA 4KK4A 3MA0A 5FWYA 5JNVA 1J56A 3GV0A 3RVKA 3HVRA 1Z26A 2F8TA 1MAVA 3CU5A 4KVFA 1ZESA 2CHFA 4RDCA 2FKAA 1FSPA 4H60A 1VLZA 2Q5CA 1RXEA 3C3KA 5TQ0A 1JH9A 3QLUC 2MYPA 1USIA 1CHNA 3HK2A 5EWLA 4KPYA 4XFKA 4F12A 1DBQA 1F4VA 2KYRA 4MPTA 5JS2A 2VK2A 4FE7A 4WZZA 4E7OA 1LBHA 3DGEC 4LDAA 4RK6A 5D2CA 3MQ4A 5T7BA 3JVIA 5ED4A 2V0NA 4RXTA 2JCGA 2PL1A 1USKA 2RDMA 1GCAA 1RPJA 3JTEA 3QELB 3R0JA 4N0PA 4D6XA 5KWSA 3DLHA 4GNRA 1EHCA 2W42A 5EWMA 3H5IA 1QPZA 1E6LA 3S99A 3QLVA 6ABPA 2VYCA 3FGZA 3TD9A 1YMUA 2MSLA 4QICA 5CNJA 1DJMA 2WJWA 3C3WA 3HUUA 1ABFA 2HQBA 3OLWA 5HM6A 3HZHA 4D74A 5CNIA 2QSJA 1EFAA 2IYNA 3UKJA 3EODA 2FMIA 5CNMA 3N8IA 2QW1A 4WUTA 4XARA 1PNRA 1U2PA 2WRZA 4MLCA 2QVGA 4JOQA 3ROTA 3GBVA 3RQIA 3GT7A 4HNQA 5FWXB 5IUJC 4PE5B 3RVQA 3NNNA 3OO1A 3LUFA 4RZSA 3A3KA 1GUDA 3QLTA 4UHJA 3TO5A 3L6UA 2L2QA 3MM4A 1C4WA 5JNTA 3H5LA 2PUAA 5EWJB 3H5OA 4W5TA 3EDCA 3T6KA 3JPYA 2B1JA 3JPWA 1QKKA 5IEBA 2OENG 4W5OA 2PAFA 5F64A 1PNTA 3O2QB 4DQDA 2F8SA 2WJAA 3HO1A 1Z18A 1CYEA 3M9WA 3HDVA 4ZPJA 2JBAA 4KFCA 2E4XA 2ZAYA 4HNSA 4IF4A 3OMWA 4N0QA 2PUEA 1PEAA 2DRIA 3B2NA 5BRJA 3FFTA 3K4HA 4G0MA 1GUBA 4M88A 4RY8A 3RVLA 4Z4CA 3F73A 4Z0NA 4MRMB 4WXEA 5DLEA 4MQFB 3H5WA 1DRJA 3URMA 4YCSA 3DBIA 3M6MD 3M9XA 4MS1B 3L49A 3RVRA 3F6PA 2WB4A 3JY6A 4NICA 2WWVD 1NATA 4MR9A 2VUIB 4Z4FA 5HQJA 4MS3B 3HM9A 4RKQA 2QZJA 4KZKA 4Z4GA 4YLEA 5PNTA 3KSMA 2IPAB 4XASA 5TPWA 2PUFA 1U2QA 4YV7A 2WY2D 1DP4A 1SXGA 3EULA 3IPCA 3MYYA 4MR7B 5JS1A 2QV0A 3VNBA 2CD7A 5C5EA 2M98A 3SY8A 3OQOA 5JNWA 3HV2A 3LKBA 2MYNA 3N0XA 1JFTA 2PL9A 4RK4A 4YRZA 2I6FA 3LUDA 4Z4EA 1NXOA 3IPAA 1D4ZA 4W5RA 3C6QA 3QX9A 3EGCA 1CEYA 4G86A 3KLOA 1DCMA 1JF8A 2GWRA 1AB5A 3O1IC 2JVIA 1PUXA 1QNLA 1R8JA 1EWTA 1XHEA 2L17A 9ABPA 2E4ZA 3C97A 1ZGGA 6CHYA 1S8NA 3RVMA 4PICA 3IDOA 3KG2A 1JYFA 3O2JA 2ID9A 3H5VA 3Q7RA 1NXSA 4OLBA 1D2AA 1BDHA 4H3KB 2ZWMA 3RVOA 1M2FA 2GBPA 2MYTA 8ABPA 3FDFA 1YIOA 3NHMA 5IBQA 4RV5A 1NXVA 2A9PA 1Z12A 5CHYA 5IUNC 3GWGA 4RU1A 3OLVA 4MLDA 5DKFA 5B3JC 2FN8A 4Y9TA 4OTZA 2HJ9A 2AYZA 4Z9BA 4ZMRA 1ZGZA 5JNSA 3LMKA 4E7PA 1W25A 1DG9A 5FBKA 1EAYA 4TN5A 5TQJA 2PLNA 4IGAA 1K68A 4Z99A 3HXMA 1USGA 3N0WA 4JASB 2FN9A 2GX6A 2HQOA 1FQWA 1QO0D 3H1FA 3HS3A 3O74A 1BVHA 4KNYA 4PEVA 2J48A 2LIVA 3GRCA 1VKRA 4RXUA 1JHZA 2TMYA 2PJUA 1E2BA 2FVYA 4MAAA 5BQ3A 3OM0A 2JB9A 2JVJA 1TJYA 2PE5A 1JBEA 2PUGA 4KREA 4RWEA 3QEMA 3FFWA 4LRQA 1FFGA 2MSWA 4JAVC 1SXIA 3H5TA 3BRSA 2FW0A 1D1QA 1ZH2A 2A9QA 1LJUA 3QLUA 4F8JA 4NCAA 2H0AA 3FFXA 3Q41A 1BA2A 4W5QA 5BRAA 1JFVA 1ABEA 2FQXA 5B3JA 2GI4A 1BDJA 4MR8B 4FE4A 1K66A 3IP5A 1ISSA 1DC8A 1YVUA 2CHEA 3A10A 1YTUA 3E61A 2FMKA 4YO7A 3RVSA 3NNDA 2WMYA 3FMVA 4IILA 3OQMA 1MB3A 4EYKA 1KGSA 4MQEB 4CBVA 5KC9A 2PUDA 1M5TA 1JX6A 1L5YA 1U8TA 3QELA 2FLWA 3TB6A 2L18A 2IOYA 3LUCA 5TQ2B 1Z16A 3TMYA 5E3JA 3CNBA 4KQCA 4DADA 3ILHA 2FEPA 3CKMA 1Z17A 3G85A 3KTOA 1E6MA 4MS4B 4O5AA 4O1IA 4JP1A 3VNAA 4EGSA 3QX8A 5ABPA 2IDMA 3N75A 1ZH4A 3EAFA 3LUAA 1TMYA 4EYGA 1NXPA 2IPNA 2IPMA 2PKXA 3GA5A 3NBMA 3P9YA 2JRLA 3D02A 1JWLA 1W9HA 4JB0A 4ML3A 1MVOA 5T3YA 4FB4A 4HYEA 3JVDA 5KQMA 3TX6A 2FSPA 3O75A 4L85A 4KV7A 1RZRA 4OLAA 2R25B 5FWXA 2H3HA 4JB2A 5FWYB 5CNKA 2LBPA 1T34A 1QQBA 3BREA 4O1HA 1M5UA 3CRNA 1GLGA 4YWHA 3T38A 1YS7A 1QMPA 2IKSA 2QXYA 5EWJA 5TQ0B 4YGXB 2O20A 4QPJC 1U0SY 1KRXA 3DGFC 2YHAA 5KC8A 5EWLB 2FXIA 3I09A 4B09A 3UUGA 1L5ZA 4RK7A 1TVMA 2PMCA 2LP4Y 1A0OA 2FEWB 3N0RA 4UHKA 1BDIA 3N53A 1KMIY 1NXXA 4XLTA 3I42A 1DCFA 4ZMSA 3H75A 5EWMB 1ZAYA 1SRRA 3SG0A 1QP0A 4OATA 1VRVA 1Z25A 4MRMA 1SD5A 1JLKA 3MIZA 5KQGA 2NT4A 4QYWA 3HJFA 4MQFA 4NQRA 4HNRA 5DCLA 3LUGA 4G0ZA 1RXIA 3A0RB 3DZDA 5DTEA 4MS4A 4MS1A 2MYUA 1PEYA 1QP7A 1NXWA 2E4VA 2FTKE 4G0QA 3H6GA 4MS3A 5TE9A 3C3MA 4P1ZA 4EVQA 4ZJPA 3D8UA 1Z13A 5TPZD 4D6YA 3HDGA 4XXHA 3BILA 4EUKA 3H1GA 1YK1A 4WWHA 4EYQA 4F3TA 4MYRA 5JNUA 4MR7A 1Y1LA 4LE1A 5I4CA 4RK0A 1EWVA 3SM9A 1SXHA 1B00A 4G0OA 4KMRA 4N03A 3OO0A 2A9RA 4LX8A 4Q6WA 1H9CA 1JDPA 3LOPA 1Z2DA 1Z15A 5JNRA 3SAJA 4ZYLA 3OQNA 2MSKA 4LDZA 4PYRA 3EQ2A 1D5WA 4YS6A 4OBBA 4G97A 1VPWA 3F7NA 1ZDMA 4RY0A 4EY3A 1IIBA 4N47A 1U04A 2P4UA 2JBAB 3ROFA 3Q7SA 4IMIB 3H1EA 3CZ5A 4IMJB 1OXBB 1QQAA 3I45A 2ID7A 3KLNA 5GOTA 4RK1A 3HEBA 3QEKA 1DCKA 1NXTA 2E4YA 2QVCA 3OLYA 1ZITA 3NNSA 2R4QA 1DBPA 1LBIA 2XDYA 2GKGA 1JYEA 4TLLB 2FLKA 4RSMA 3W9SA 4IRXA 2JK1A 1LJLA 2FQYA 1DBWA 1EWKA 1PHRA 2LUOA 2A9OA 4MR9B 5KI6A 5C5CA 5HSGA 2R47A 3H6HA 4NCBA 4RXMA 4ETNA 4MGEA 3Q7TA 1E6KA 5TPWB 3LUKA 4DN6A 1F51E 5IC5A 1Z2EA 4S05A 2NUBA 3CG4A 2LPMA 4ETMA 2X7XA 1MIHA 2FQWA 3LKVA 5KQLA 3NHZA 4RKRA 1LK0A 5IX8A 4PZ0A 2NZUG 2RJOA 3O2SB 5BR1A 4KK3A 3KKEA 3K9CA 3CLKA 3MF4A 3LUHA 1C0EA 2FEKA 1I3CA 4RS3A 3RH0A 1M2EA 3OLXA 4KRFA 1KRWA 3OLZA 3Q15C 1YMVA 1ZHHA 3CTPA 3Q9SA 1RNLA 3GYBA 3I5AA 1TLFA 3RVPA 3RVJA 1AB6A 1P8AA 2IPLA 3BBLA 2CWDA 4QYMA 3DLBA 3CHYA 4S04A 3O1HB 4Z9AA 3T95A 1DC7A 1ZVVA 4Z4IA 3LFTA 4LE0A 4WXMA 1UDRA 2HSGA 1QP4A 3CZCA 3HCWA 3RVNA 2RJNA 2JVKA 1P2FA 5IUKC 3GBPA 4YP9A 1BAPA 2YHBA 2NZVG 2PUCA 3LUJA 3KJXA 4EYOA 5HKOA 1NY5A 5FBHA 3JS5A 4P98A 2RGYA 2R48A 1APBA 4N41A 1OXKB 4TMYA 4ETIA 3F6CA 4RY9A 4EVSA 3GL9A 3CS3A 3KHTA 4W5NA 3CG0A 1YK0A 1XHFA 4XAQA 1TM2A 2P9HA 1JFSA 1URPA 2PUBA 2M1ZA 1NTRA 3E3MA 4RK5A 2HPHA 2E4UA 4YR7A 4N76A 3IP9A 3KS9A 3N6VA 4MR8A 4GPAA 3T8YA 2AYXA 3G1WA 4G0XA 2B4AA 1DZ3A 1XWWA 1P6UA 1JDNA 1ZN2A 2FMFA 2VUHB 3KYIB 1ISRA 1FFSA 1WETA 4NV3A 3IP7A 4Q7EA 2FMHA 4F11A 1A04A 4G0YA 2BGGA 4EVRA 4MQEA 7ABPA 3ILYA 2E4WA 2N9UA 3EJWA 1RZRD 2QU7A 2OQRA 2HQRA 3HUTA 5TQ2A 1A2OA 3MMNA 4JA2A 1JL3A 3LTEA 4Q6BA 3BRQA 3EQZA 2NT3A 4LE2A 5GQSA 5TPZA 4WT7A 1HEYA 1MB0A 3QEMB 4G0PA 4Z4HA 5DGCA 3QK7A 3OMXA 4TLMB 3CFYA 3O21A 3IP6A 1YS6A 5KQPA
chains in the Genus database with same CATH superfamily
4M1SA 5FTWA 4M1TA 2GN8A 3KJQA 4ZCLA 2GPTA 3FWZA 2OT3B 4OV6B 3RROA 4GIBA 2A9VA 3KOUA 4JJ6A 1XFDA 1JI0A 1DUVG 1P5FA 3FYHA 1GR1A 3H97A 2Y0DA 2YRWA 3KHUA 3FZGA 4FILA 4LTMA 4NU0A 5CFOA 5FWYA 4TTPA 1C8BA 1DIOB 4HQNA 1AXGA 5AJXA 4AWAA 4BX2A 1RLOA 2WM8A 3ND6A 4E22A 3EEIA 2H51A 2C3OA 3WKAA 2FK7A 1Z63A 3TW8A 1FXSA 1NT4A 2XD9A 3KKNA 2Q5CA 2WFLA 4U9IS 4YJGB 5C1BA 3GUZA 3QWIA 4PAQA 4XIJA 1CUEA 5EQDA 3LBNA 3TAXA 4MW4A 3HK2A 2XUFA 4FS8A 1GVNB 1JEOA 3G13A 2H8GA 4GECA 1WU8A 3K09A 2B0JA 3I1FA 1ZCBA 2HT6A 4RF2A 1YKSA 3NZEA 3HL0A 5T7BA 3L8MA 4RD0A 1YVPA 2I7TA 1JAZA 2J08A 2R84A 2PL1A 1USKA 4X0EA 4EHIA 1SXJE 1JSRA 3U5ZB 1G1MA 1QHIA 3ITKA 3SE7A 2YMPA 3OP4A 2ZSAA 3K5HA 1A50B 4GNRA 1CYDA 3BJEA 3QI7A 3GB9A 5G0TA 1M2GA 2QUJA 2R4UA 2VHEA 2VP4A 1M1ZA 3KPUA 4NBVA 5HJEA 3ZTWA 3NRCA 4KCGA 4WFJA 4OSPA 4NIMA 5ILOA 1A8SA 3KTDA 4JYBA 1KJIA 3OLWA 4FOSA 4CU2A 1Q3TA 1YMQA 1NX6A 3IT3A 3H11A 4FGWA 5CH3A 3SGLA 2X14A 3BK7A 3G9QA 3VBCA 4L3WA 4DRXA 5JALA 2P69A 4Q7KA 1WXQA 4RTJA 2G4CA 1JS1X 2QIOA 1H6AA 3TZHA 4BCBA 4MLCA 4DNQA 4HEA6 2FZWA 3COPA 2H11A 5K0LA 3IQXA 1P4RA 1XZLA 3R7BA 1AIPA 4WXHA 1GEGA 3R5TA 1ONBA 1HE5A 4O2AA 1O96B 3OPYI 3HU1A 3STTA 1RWBA 4EW1A 1XZJA 1G17A 4DR2B 3FTPA 3FPBA 1AX9A 1W96A 2XMQA 4N9WA 3WNZA 1MAAA 3Q85A 4CPDA 1M6VB 3ZNPA 1QKKA 2JHCA 3WLHA 3TZCA 3P9PA 3O2QB 4NH4A 1ZS9A 3G0OA 3L0DA 1M6NA 3PHIA 4BNMA 2OFFA 3WISA 2O59A 2NPIA 5F98A 1D4AA 1KH1A 1I51A 4FGSA 1UOQA 3DWFA 3QXSA 4FDLA 2GMWA 4OI4A 5DLDA 5L3ZA 3ZBTA 4C6SA 4HNUA 3HJUA 4MRNA 5KKNB 4PRLA 3K4HA 2FJPA 1SUDA 5F3RA 1E7RA 2ZRNA 5CYFA 4FDAA 2O54A 2FKNA 4R1SA 1T0BA 1XK6A 1YQGA 5A6SB 4CNQA 3X1MA 4J6FA 4E5SA 4YT4A 3T5CA 1DRJA 3INNA 4N6OA 3RRBA 4XD7D 3RG8A 4KE6A 3FMOB 4MS1B 3UGKA 1XDDA 3AQIA 1Z7YA 3MS7A 4MVJE 3Q3CA 3V8BA 4RTKA 4FQ8A 2CDCA 4EHDA 2JAHA 3AEQA 2K4MA 3VTFA 3QSYA 3KSMA 3T3EA 4NCKA 4BWFB 1XCJA 3NHJA 5CLGA 4DZTA 1R0YA 1U2QA 1CEQA 4CYMA 4LNHA 3RRNA 4EG4A 4AMGA 2XOKA 1JDJA 1PL7A 5BMVA 2FSFA 4C0HA 3WNDA 1PKEA 1Y6JA 4RABA 5BSVA 4X66B 3CLSD 3BXOA 5ER9A 2CNBA 2GK6A 4U3JA 2HWUA 4OCZA 4A23A 2P27A 3WK6A 3PC6A 2V8OA 2W6CX 4IFTA 2MYNA 3A9VA 3OQOA 5JSZB 4JSTA 1AXRA 1JZSA 2YICA 4I4NA 3ICCA 2WA1A 5LDDC 2AKEA 2YIVX 4B31A 1KQGA 5SY4A 1IY2A 1ECGA 1RWOA 4H4CA 3A9CA 4V3CA 3HJGA 4BUCA 1CJCA 3PXAA 1C80A 1EM8B 1OAAA 1VJ5A 1A5TA 3WB1A 1S2DA 4W5RA 5FLEX 4BNHA 5DP1A 2HA2A 2N3ZA 3OPMA 3LBAA 5EE1A 2OAEA 3BCSA 2YYSA 3LCRA 4Q4LA 4BO9A 3V4OA 1UZLA 1WMFA 3ZU5A 3T4PA 4KWHA 1EWTA 3HR4A 3GFBA 1X1TA 1VJRA 3SQMA 4YFYA 3KLMX 4GZ3A 1DADA 1FRVA 1P19A 1GG8A 3WSVA 3HEMA 1JGTA 3IDOA 1ULHA 2B0CA 2YWGA 4BRZA 1KMHB 1XIVA 2JAPA 3B78A 2ID9A 421PA 3KQMA 3ZDZB 2BEVA 1N9GA 2W2XA 3RT7A 5I9NA 1M2FA 4WV3A 3HXQA 3CZQA 3GLVA 1VMDA 4BFSA 4D8VA 5ELLA 4BMOB 1EP9A 1G291 4QA9A 2CCJA 5F2OA 2CFSA 2IP1A 1D07A 2C07A 2R8BA 4BNDB 4ZTBA 3LHDA 1Z37A 3MJFA 1RADA 3W06A 3PD1A 4DCNA 1A7UA 4LRTB 2RGGA 1UP6A 3MN1A 4Y2PA 4AECA 4AKIA 1PJQA 4H4DA 5J2UA 2JCBA 1QIDA 4UEJA 2H17A 4YRFA 2PVPA 1DB3A 1Q3KA 4LXUA 4EHNA 2QRKA 2BEWA 5JU6A 1IRXA 1UK9A 1HMPA 1RVDA 2QXUA 1M5RA 5KWVA 2XKBA 4MW1A 5FTMA 2FPPB 1V47A 3M4NA 4YRCA 4RY2A 3R5JA 1N34B 3GZ4A 1QCCA 2IYSA 1VKRA 2ZREA 1J2RA 4FPXA 4OH7A 4P7FA 4C4OA 3BZWA 1I94B 5KYKA 1LWNA 2PKQO 2FVYA 3W90A 1J8YF 3N5CA 2JFOA 1JEEA 5AJYA 1G66A 3TTSA 3WC4A 3WLEA 5AHRA 3O73A 3OE5A 1JBEA 1WXIA 1ODIA 2R9VA 2PZAA 5GADl 1TK9A 4EPWA 4BP9A 1ZJJA 1FFGA 1D8AA 5TQVA 2AD5A 3GELA 2XSZD 2Q5EA 4YRQA 4UXJA 3NTLA 2F62A 4GOLD 4R8KA 3P9IA 1QDLB 1N6IA 2A9QA 2XVMA 4HLDA 1YDEA 3GROA 1T9KA 4R3WA 5EJ2A 4OJQA 5BQOA 3W5AA 4G0VA 4QXAA 2E82A 3T3HA 4I5GA 3WTBA 4A7PA 2WPDD 1KBOA 1E8DA 4HYYA 3PV0A 1KVQA 2H0AA 4K2HA 1CIVA 2HMAA 3G1UA 1CY6A 4H6PA 1K2VN 1Y5NA 1K0FA 2CLIB 4OQZA 1GTJ1 4CLRB 3E9RA 5U4QA 2FQ1A 1GQOA 2OGTA 3R6TA 5IF9A 2I2BA 3QLEA 4XPIA 1NG9A 3T1HB 3PL5A 2DSTA 3AF1A 3VYRB 2EBHX 2PKEA 1VJDA 1KP3A 1MGPA 4MV7A 1ISSA 3R0XA 3O94A 2TYSB 2XZTA 2OCKA 2FWIA 5I4BA 3MUEA 2W71A 4EZBA 1CR1A 1P3JA 5ITWA 3A4YA 4Q9AA 1U6KA 2PX3A 3ZV6A 2CFTA 1O9GA 4KFTA 1RM4A 1U8TA 1N0WA 1JYSA 3IR7A 4XD7A 3FTCA 4G1MB 2L18A 3UWSA 1U5BA 4TROA 4PGMA 5CXSA 4J0IA 3MCWA 5IPFA 4P3OA 2O3SA 2JH8A 3KTOA 4IYJA 2P9QA 1X77A 3IUQA 4UARA 3VNAA 4CMHA 1C7EA 1FFAA 1FW8A 3HDTA 1P39A 1D9ZA 1XAHA 2PM8A 5ALPA 1FJHA 1RRMA 2F9LA 3C41J 5DU2A 1CS0A 1ST3A 3GI1A 3B60A 4H35A 2VRBA 4KLRA 2CXQA 4MWZA 1TMYA 3T0IA 3HY4A 5HX7A 2NV6A 4ZV9A 1XMQB 1GAEO 2E87A 3BIFA 3DZCA 2NVUB 3OWXA 4CM5A 3NM6B 2L82A 2VDMB 3EGXB 3NJRA 3WE7A 1QTQA 1XMVA 2R751 4ML3A 1WUTA 3TNFA 5KCMA 3GGSA 3U9LA 4ES6A 3DL4A 4QOJA 4G8BA 1I3NA 3CLRD 3B20A 5JATA 2F59A 3UG6A 3VXKA 4JB2A 4N0MA 4OHRA 1TQHA 1LSSA 1F1BA 1CUYA 1JZTA 3RHTA 4DA4A 1QIFA 1GTVA 2OYCA 5EKSA 3ZY4A 5L95A 5BWOA 1OH6A 3VU3A 2XMRA 4F1WA 4Q82A 1GV1A 2RHLA 3MCUA 1E59A 1I7DA 1G6KA 2O20A 5BWCA 3N8HA 1XMPA 4V0ME 3O0TA 1O5OA 3GLSA 3OJXA 5D5HA 1TB4A 4EB8A 4B09A 2QLJA 4HQOA 1TPYA 5A3SA 3RKRA 1R6BX 4KR6A 4LTNA 4FIDA 4US1R 4OL9A 4FONA 1U9ZA 2JLQA 4EB0A 1JG1A 2UKDA 2ZYUX 5EIEA 2P79A 2I66A 1Z8FA 4QDUA 1NNI1 4A92A 1O5IA 5BSFA 3T5PA 3DP7A 4O4IF 1N2CB 3CJQA 2AWOA 2P2YA 4YP0A 2JD0A 4B43A 4HVAA 3NLLA 2YFKA 4OATA 1JU9A 1ZIOA 4HDNB 4BB6A 2F4VB 1FNCA 1CULC 4GEKA 4ZAYA 5HNKA 3CN7A 3K09C 4NQRA 4Z4QA 1JLMA 5HJ2A 5F1YA 1L3BA 4DA9A 2O2DA 13PKA 1WCIB 3MRVA 4KIUA 4N39A 5BV7A 2UYCA 5BWMA 2ZBPA 2Z3WA 2WIBA 3R9XB 2O52A 3SC4A 3AINA 3C3MA 2JRCA 3E4CA 4Q4HA 4HEJA 1M2VA 1S8OA 3AWIA 3EIXA 4P4UA 4Q7JB 4QRDA 1MCZA 5E0OA 2X8JA 5EZYF 3PITA 2OBMA 3QOYA 3EA4A 3S68A 1NE2A 4KIGA 5I4CA 4B3TB 1XJWA 3VHXB 4BLOA 3FSEA 2JW5A 3Q1LA 1KY5A 4KMRA 1XPOA 1LNSA 3N2NA 5CXXA 3PEFA 2DPGA 4U2DA 4QULA 3W0LB 2P5YA 4QT4A 5JJLA 2BONA 3KAQA 2ICAA 4S3MA 1SUAA 5GMOA 5SZJA 2JF0A 1JW9B 4WOJA 2OLJA 4MKFA 4YC7A 5I45A 1I4TD 4TZ0A 1JFRA 1YL5A 3AG5A 3WIBA 1A5AB 3S7TA 3UT5B 5K3FA 1UKYA 4FCCA 1MO6A 1XQ6A 4WKBA 3CLVA 2XY4A 4TKUB 3C5HA 4OM8A 4NFSA 2B98A 2XSZA 4GGPA 5AWFC 4YRNA 5ARBA 3PNOA 4GOMD 4N54A 3ZCVA 4OYHA 3OTOB 4OFBA 3VR5D 3ORYA 3FR7A 3KEOA 4HFRA 3ED1A 5CT8A 3RWOA 1KJWA 2HJGA 2ID7A 1I8TA 2XCLA 3LQKA 3N3AC 4UCFA 1ONOA 3SHOA 1NQVA 1KH3A 1B4DA 2WPDA 4DHWA 2AHRA 3DH0A 1S7CA 5C8XA 2AC7A 5HZKA 1VYHA 3MUNA 1VCHA 2FY8A 3KR2A 1AGNA 1RYNA 3IOCA 4KBYA 1DO2A 4GHWA 3SVTA 2R1ZA 5C8YA 4JI5B 3CLUD 3TS1A 4BTEA 5FTJA 2ERCA 4HOYA 1KIFA 2WU3A 1OW3B 3Q7TA 2IZ7A 1YZVA 5AVOA 3V7FA 4RZHA 2R6FA 3VR4D 1GRNA 2JGMA 4Q3NA 3VV3A 2GH1A 4HK4A 1P8JA 3BXGA 3K8ZA 1Z2EA 4MQ5A 3ROFA 2IIBA 4C7OA 3CG4A 1ZJ4A 3ADOA 3CISA 3EG9A 3KPVA 2XCOA 2NO1A 2YYAA 1W36C 1R3UA 4FYXA 2XE6A 2I3ZA 1KDTA 2Q1WA 4MKIA 1Z0IA 2AB0A 3QTBA 5FL3A 4NFLA 1MO4A 4MVJI 5KPJA 3CW9A 1XVUA 1NBME 3K2EA 1HNXB 4QVKA 4CUJA 1M34A 1SWVA 1VSBA 2P2NA 2HXYA 3K0SA 3I5AA 1XGKA 3FZQA 3GNSA 4WHMA 5J40A 3V8PA 3VU1A 4IJVA 1FPMA 5IJ0B 4H15A 1Y81A 3BXFA 3CX7A 3Q8WA 1MW9X 1N2ZA 2AMVA 1JHPA 4LNUA 2XTZA 4Z4IA 1E96A 4B4DA 3QW4B 5EZ6B 3U09A 1KAGA 2C8JA 3IUSA 1D0SA 1DARA 3D8RA 3ONDA 3RNLA 3ZW7A 4WESA 4TYWA 2VI5A 3FDIA 4M83A 4FC6A 2OA0A 3FX2A 4EF6A 4LF5B 1B41A 4BLTA 3H9QA 4NSNA 4RFSB 2CLMB 4TM8A 1DIGA 1RI2A 1Y3DE 3RPEA 3WKEA 1HT0A 2RGYA 3GLUA 3UAGA 1ZUNB 4M76B 3TXYA 3VYTB 5B64A 3OCJA 1PIWA 3R3XA 1ZNYA 5D84A 1YRLA 1L7RA 3AI3A 1P1KA 3LPDA 1JLHA 4IDPA 4UOQA 4ON9A 3W3ZB 2C2KA 1SVSA 3FKJA 2CBXA 1QYVA 2NQ2C 2PK3A 3CZ9A 3BIWA 3ITDA 3KZOA 3NOXA 4B7CA 4YJ2A 2VQEB 4YO8A 2AQ8A 1X7GA 2Z6QA 3LQ4A 4RK5A 3AF6A 2HPHA 3KWLA 4MR8A 1TZ2A 3JR3A 3R6WA 4URHA 3RLIA 3R5KA 4YI3A 2D0IA 3ZD9A 4D0SA 1XWWA 1JDNA 3WHIA 3FTQA 4R5HA 3PU6A 1IBLB 2WABA 1OI3A 1SXJD 1V9CA 2QQEA 3CE9A 3OBBA 5BSHA 5JFOA 1NW9B 1BMQA 1IJBA 2ATVA 5H82A 2AMFA 5CIYA 1TA0A 1YHYA 2JHPA 7ABPA 3EJWA 1BRTA 721PA 2GXSA 3UCXA 3FVTA 2ZBRA 1A9ZA 4MW2A 3MTEA 4MEAA 1V7PC 4EFLA 2EBFX 4RKFA 4QGAA 4P38A 3LQYA 3ZCPA 1CEXA 2OB2A 5CIQA 2DX7A 4QBIA 3U7QA 4BWGA 4F2DA 5MN5A 1ZQ1A 1A4RA 1PZFA 4JS0A 5HUQA 2XMPA 4QEKA 1ZMXA 4PO8A 3HYNA 4A10A 3P4YA 1F2VA 2ID4A 1QC5B 1XU4A 3BMQB 4FD3A 2DLCX 1MTZA 5CD1A 3QWAA 3DL7A 3OX2A 3QU2A 5B58T 1ATIA 3GR6A 2NU8B 1LSUA 1NKVA 1TMKA 3HGMA 3UK0A 2Q7DA 5BNTA 3S1AB 9ATCA 5CA1B 5IKPA 2X1HA 3CVJA 1TM5E 4YGYA 3KUDA 4R2MA 1GTMA 3NIFB 2BW0A 3PHBE 5IM4A 1C1DA 3U81A 1PFYA 1T6BY 4GW3A 3E9MA 1C7RA 3PD0A 4UZEA 1C1XB 2D5IA 4NYJR 1IQ0A 2Q3EA 3WR5A 3UPTA 1WIWA 3VR5A 4KE7A 1T2EA 3KM0A 5CFNA 4Y9RA 4LJSA 2O07A 4C30A 2PWBA 1KXJA 3MQ2A 4EFMA 3IT0A 4HI0E 4IM7A 1NBEA 1LBHA 3IJPA 4LDAA 1QR6A 2LD4A 3TVDA 1J8QA 3V97A 3SK0A 4WFQA 2ZCUA 2OK7A 4RHUA 1YJXA 1V5WA 1FP4B 3WRYA 3O26A 4QQNA 1SD2A 3FJ1A 1W5FA 2YZGA 3L7NA 2H00A 4QHSA 1PV4A 1IXYA 3RUPA 1NVGA 2TMDA 2XDAA 3UJ6A 2VHTA 4MVJD 5SYMA 5HHTA 4FFSA 4C78A 1XYGA 1AK1A 1WW2A 3VR4A 4QICA 5FAXA 3WLQA 4JC8A 2IEYA 3DYVA 5DDIP 4LCBA 4U6NA 1GXSA 5CAEA 3MPOA 5F76A 3ROGA 3N8IA 4E4TA 3PHLA 1N1DA 3G6KA 5K3DA 1PLJA 4YVFA 1N4AA 4BKQA 1IHYA 1VECA 3MTQA 1MO2A 3K8QA 4HQLA 2F55A 4ZEMA 4PPGA 3GLFA 3N6XA 5ARDA 2QUHA 2ZK7A 5CFLA 2XDQB 4OHMA 1ORIA 1F0NA 3DLPX 1S3IA 4H3VA 1VIVA 2V9ZA 5DTJA 4B46A 4I1IA 2YJ4A 5JLJA 2C99A 4GYKA 1G38A 3OM8A 3CWZA 4TS1A 2QEQA 2R6ZA 3OKPA 3EEQA 1C4WA 4P58A 1NG1A 4P22A 4JXKA 4WA8A 3U80A 3Q2IA 1DAMA 3S8MA 3DT9A 3ESYA 1JIIA 3ZW8A 3KDAA 4W5TA 1S5PA 4ZK6A 2XMBA 2G08A 2OENG 1VL1A 5F64A 5B7PA 4DQDA 3PDWA 3DFUA 1J25A 3QPAA 5FBRB 2JD2A 3LNTA 2ZJOA 4M1YA 1CJUC 1P0PA 1AHPA 1MOSA 3IUJA 1U3CA 4TRRA 1PJZA 4N0QA 1GYPA 2DRIA 4LQ4A 3DLIA 2P4QA 4RY8A 1PQPA 1GUBA 4PHCA 1EG7A 3REOA 5GZ1A 4RYDA 3SYMA 521PA 3R24A 4XWKA 2E85A 5DSTA 4B34A 3N7AA 4M0CA 4L6IA 3EY4A 1UKCA 4CKCB 2FSHA 3NMUF 3H5WA 1HQCA 3RSGA 3EDQA 5K4AA 2QD2A 3ZGYA 4N7BA 3ZHQA 4BNFA 1EK0A 5MHTA 1KAOA 1J0EA 3ZDRA 4K9PA 2P5SA 1E2IA 4I8DA 2H31A 4MS3B 2QZJA 1N5MA 4Y2VA 1B3BA 2OGSA 1D0IA 2B94A 2QWXA 4KRYA 4XX0B 5CU7A 4FYYA 3CGGA 3KEFA 1KPGA 5D1NA 1ZYUA 5AJTA 1WZ2A 3AP2A 4DLRA 2F3SA 3OEED 1SXJA 1UFQA 4GOOD 1EK5A 2LKDA 1IG3A 5AK6A 1Q0QA 5ALQA 3TIFA 3E9CA 2V7UA 4JLAA 2YVAA 4BU1A 2N75A 3PK0A 1XYYA 4QU9A 4LCJA 7MDHA 1REQA 3EPRA 1ETHA 4BLQA 2X9GA 1ZR2A 3UWPA 1C3OB 4UUMA 4FWIB 5DYNA 3SR4A 1CZHA 5CCDA 1Y8AA 3SZ3A 2ZDGA 3IPAA 3ON5A 1P2SA 4EG8A 3D3WB 5I5GA 5AW1A 1VLVA 1WPQA 1X1DA 5ICGA 1XZPA 5KQRA 1VJGA 3NI2A 1F4PA 3UCEA 3HP7A 4A8HA 4RAQA 1PUXA 1MU0A 2NZ8A 3EC7A 3GJRA 3VFDA 3AL0C 4U2CA 4C5AA 2QRMA 2ECQA 4F3RA 1E0SA 2R6R1 3V2IA 1AURA 2E49A 2P8SA 2OV4A 3D6VA 1K5HA 4ZU6X 2M32A 3VKFA 2DWPA 4OYLA 3T54A 1B0ZA 2V7PA 3I2FA 3GLIA 4ZXFA 2MYTA 2HOQA 1K7YA 3NHMA 4QUJA 4ZHQF 5BURA 5KYYA 1FLVA 2RB4A 4CIYA 4WK4B 5ALXA 1YDFA 3CX8A 4A8JB 2VDNB 1HETA 4MLDA 3B5JA 1E9BA 4BFYA 1HA3A 4FC7A 1GFZA 5SZKB 4BFZA 3PPVA 4K6OA 3W8NA 4PAWA 3UWMA 4AM8A 2FFRA 3QGMA 4ZZ0A 5LN1A 2D5BA 1Q1QA 5FBKA 5AYVA 2RHBA 3LZCA 1FDIA 3MILA 5AKGA 3RQSA 4FYWA 5TQJA 5EJMA 3UM9A 3X1YA 1QX4A 1UKBA 3K7EA 3TPCA 2G3YA 3I9NA 3NKFA 1Y3HA 2FPGA 3ZWDA 5IBCA 1PVOA 3QM1A 3HFJA 3PZRA 4E70A 1MOQA 2B8JA 1QO0D 3DVAB 3H1FA 3O74A 4HN2A 2J3HA 4M1ZA 3M7IA 4MVJA 4Z9XA 4AULA 2WVJA 3OTQA 4EG5A 1CC1S 4M1MA 4EUHA 3O38A 2HPZA 3PT5A 2ODQA 1TADA 2A5LA 3BWXA 1HZZA 2ARKA 3L0BA 1RHQA 5IAOA 4RMNA 1W44A 4QDXA 5JZVA 1SCKA 5EIBD 2YN2A 1FJ2A 3IT2A 4HVTA 4TUYA 4IVNA 2EX0A 2QTZA 5JQGA 3TTUA 2BM1A 4X1KA 4DVGA 4N8DA 4R2XA 1WF3A 2HO4A 1C5KA 3UT6A 1QPBA 1FP6A 2H06A 5TSDA 1M2HA 2FU5C 2WE8A 4IIYA 2Q0XA 3MW8A 1VDZA 2PUTA 2NVWA 3BRSA 4FZ5A 4GXNA 3EZ7A 1DAGA 1PCXA 1HV8A 4K1LA 1MEJA 1SMKA 1XA0A 4PZZA 3TIIA 1CG6A 5C81A 3ZQUA 3SXUB 1DZIA 3C2QA 2B1QA 3FYDA 3GRRA 4TS4A 4W9RA 1H65A 4R1NA 5AKLA 4ITVA 4DCGA 1W29A 1M66A 3HMQA 2AK2A 3FFXA 1H4SA 3PE4A 4Y6GB 1NM5A 3LY9A 2M2IA 3P26A 2VF8A 2RHJA 2JPDA 5LBTA 1U8XX 4EITA 3CLRC 1KYQA 1A76A 3HQ4O 1HORA 3VH4A 4D80A 3WL4A 4YJGA 4M54A 2VDPB 3EFEA 3MT7A 4MULA 1Y6FA 1DHRA 3D6MA 4UCQA 1QYXA 3QVXA 2ZE5A 3BVPA 3F7TA 2D6FA 4P84A 4OGGA 4FOTA 1MJGM 4PX9A 4KRGA 4MQEB 1HFWA 4LY0A 4D56A 4KYTA 1PR3A 2B34A 5KC9A 4CQMB 1BCRB 5ITVA 5DBFA 2X8BA 2ILVA 3C3XA 3PQ3A 5E3JA 2WWWA 1Z5OA 4G1CA 4QUHA 5GTDA 1PFKA 1QK4A 1ZONA 1U1CA 2UYYA 3WG9A 1TL7C 4JLNA 3G85A 4BNUA 1JQBA 4EFKA 1Z2OX 2A0KA 3PGVA 3JZFA 2PZLA 4OF4A 1ACLA 3NHLA 1CP2A 2OG1A 3KSZO 3OKAA 3N75A 3OEEA 4PX2A 1ZLXA 4CG2A 2CVZA 5A0TA 2QJTA 3L18A 5GJWC 3SXJA 3WL5A 2VXYA 4EYGA 1NKTA 1RACA 2CC2A 1PK7A 4PLPA 5JYBA 3P71T 4WLOA 4CF7A 1SIUA 1SG6A 2ZBEA 4DLVA 1N6PA 5TEVA 1P1JA 1U98A 3RRFA 4N8EA 2ZSBA 3GP5A 2OCYC 4REOA 4BP8A 1BX3A 3JVDA 3O3OB 5CH5A 4DLPA 4ZTUB 8AT1A 2A1TR 3WGZA 2HJVA 3A1DA 2H1CA 1IY1A 2X2PA 3O4VA 4B6JA 1N6OA 1O96A 4P7JA 1QO9A 1A77A 1XKLA 5G40A 4RELA 2JHAA 5T6BA 1FMCA 1INLA 5AXCA 5FBZA 2EP5A 1WXGA 3DHVA 3MMSA 5CLHA 1NFQA 1YZFA 5TQ0B 3RIMA 5K01A 3ZJ5A 4QU0A 1M6VA 2Z2JA 1L1FA 1V2GA 1SK8A 4GBJA 5ALYA 2IDZA 3CUSA 1GU1A 1XDZA 3JD1A 2H57A 3BZUA 2EZUA 2Z2ZA 2ZYVX 1A0OA 4X90A 1OTXA 5FR1A 4KLAA 1N75A 3C8HA 3H5NA 2X76A 1PT7A 4K8RB 4NK4A 4QAJA 4WXRA 1U90A 4DMMA 1FTYA 3HR7A 1BDBA 2HLDA 3KVOA 4L0QA 1P7ZA 2Y66A 3I05A 3TR6A 4AC9A 1F14A 4O63O 2B78A 3HRKA 4PS1A 4DM3A 2QTRA 3SJUA 1K8YB 3BHMA 2QY9A 4XCVA 4AZWA 1N3IA 2EZ9A 4L6AA 5A6SA 5F1KA 1NLUA 4Y1FA 3UHOA 3FOEC 2GBLA 5AH0A 3BCRA 1LBTA 1RAHA 2ZRHA 3LG2A 2G28A 3G8DA 4HRVA 4MS1A 1H42A 1PEYA 2VOJA 4XGRA 3BGOS 4XI9A 3KQUA 4OU4A 1HDYA 5EHNA 3MCZA 4PTLA 3CLUC 3HDGA 2FN4A 2PZGA 1W8IA 3X1XA 4BDSA 4F3TA 7REQA 4DY4A 1X7HA 5MFZA 4P5DA 2GXAA 1NBMD 1BVYF 3K0KA 3KTFA 2EATA 4C87A 3SZRA 4RPGA 3H19A 2O8CB 3CRW1 4GKKB 4J94A 4LX8A 4I81A 1THGA 1L0BA 4B74A 5JSZA 4RD2A 4QU5A 1CY0A 1BEZA 5G3YA 3SAJA 1AZTA 3NHYA 3O8OA 3OQNA 5DRYA 2ZJ6A 1I9CA 2XMSA 1ZNZA 4YDHB 4B40A 1E92A 1EM8A 2QSZA 1RM3A 1RBYA 1RXSA 2VWGA 3EEYA 3P20A 3S2FA 1T5BA 3IIIA 4DCUA 4URWR 5CDYA 3OFJA 4U7FA 5K8IA 4BFTA 4K6KA 1XTTA 1UJ5A 5JDIA 4UZFA 4XH9B 5AOBA 1CRZA 5FADA 4WKOA 4A5SA 1GPWB 2B7BA 1QQAA 3I45A 4K40A 3TRJA 2I62A 1WUJS 2KQUA 3Q0IA 3KR0A 3QEKA 3ILVA 1XC7A 3EZ2A 1KMHA 4LVOA 2D1TA 2CZQA 4QARA 4LYYA 3O9ZA 3VI4B 3KXPA 2IOFA 3CNHA 5CVCA 4V0MA 5DK6A 5LWHA 3FUVA 4RIHA 1GDTA 1U1GA 2AXEA 3QOXA 4JP2A 5HDQA 1QHEA 5GGXA 1DWUA 1JJFA 4BNDA 2DWQA 2WNSA 3L82B 4PXSA 3IDZA 3JYOA 3KHSA 4QHYA 3H6KA 1CUAA 5FI3A 1ZK3A 1PBNA 3CUKA 4B5KA 2WM3A 2X40A 4IJKA 5KAPA 3SSMA 3M9LA 2I65A 3CONA 2NTVA 4Y2TA 1L7QA 4UVGA 4BFLA 1T2FA 3ANNA 2EU8A 2NZUG 3DZIA 3L6BA 4TLAA 1Y4UA 2P5TB 1GTL1 4FYJA 1T5TA 1BVRA 5H9VA 4JI7B 4CEHA 1KETA 4YRPA 1U81A 1MC4A 2FPPA 5KO2A 4DWWA 3T9CA 5IT9A 1ZJZA 1B3RA 1E3JA 3OLZA 1DX9A 5EMKA 3TYXA 1RFLA 5A9RA 2XRFA 1UXHA 3C3BA 3ZXXA 4ER3A 2QZZA 3ORFA 2R5FA 1VKOA 3EXG2 2UYGA 2JIBA 3DDWA 4I66A 3AW8A 3KYCA 2HEIA 2OXCA 1VL6A 4WY2A 3LFTA 4WXMA 3PXGA 1WMAA 1Y9AA 5HMLA 4GXRA 4J1TA 4NQZA 3QWFA 3RVNA 3BFKA 3WYAA 2ZBQA 2ZI7A 1QVVA 2YRFA 2FFHA 4M22A 1AQNA 4EYOA 5L6MB 1G4HA 1XT6A 1R0CA 2H29A 3JS5A 5L6LB 1T4BA 2IBSA 2XB2A 4MHTA 2I3DA 2ZP1A 3FE2A 3ZYCA 2X2EA 3VU0A 4IHJF 3GPDG 5E7QA 5GONF 5L8VA 1AZSC 3GLGB 4W5NA 2ISSD 2BI7A 4GL2A 2QTAA 4M0PA 4ZC8A 1VG1A 3RYIB 3TBKA 3WZ2A 4ZIRB 3G0GA 5A4DA 4CLRA 5DYYA 4CIDA 3L92A 2ZAIA 2B35A 4YR7A 1WY7A 2C2MA 3N6VA 4KXMA 4TWIA 1GTZA 3KQLA 1NV9A 5HGXA 1ZIYA 3QYPA 4DNFA 2CB9A 1KEZA 2HF7A 1I32A 1SQFA 2X3UA 4B3FX 1ISRA 1KHTA 1NJGA 2B4RO 3GMDA 4R68A 3RWBA 3ZLUA 3E05A 3IP7A 1J6UA 3GLFB 2O7RA 5E7JA 3RK1A 4TRMA 4LJ6A 4GSLA 5HIMA 4XB2A 5FHRA 1KOJA 4GX5A 4X54A 5E2IA 2CDRA 3UA4A 2J6BA 1JPUA 3Q8KA 2XV1A 2NM0A 1GQFA 4CI0B 3U3KA 1CDDA 2DLDA 4HMQA 4Q6BA 5BW4A 5JD5A 3L3BA 4IH9A 1OU4A 4PAGA 2Y0BA 2B8EA 4FHEA 1J2UA 1U2RA 2BM8A 5FL7D 4BMDA 5TLSA 5CURA 1W581 4Z8YA 1C4OA 1BMFD 3WBJA 2CZCA 2RSLA 1PE0A 4LK3A 2HU8A 4QFMA 1NBMA 2NVUA 4N12A 4PAOA 2QD5A 3SNKA 5A6VA 1HZZC 2LVBA 5ICCA 5JWOA 4H4EA 4MYTA 2Q0HA 3DOOA 3NHFA 3EGXA 4MV9A 4RVFA 2PJRA 1DEAA 2JFQA 3P5SA 1PI3A 3INTA 4G07A 2D7JA 4UBKA 5E38A 3SQNA 4HMPA 3EVTA 1A7JA 4KK4A 4LPSA 3GGGA 2Q1SA 1QYCA 1GPMA 4QEDA 1IN5A 2C3MA 2ZSJA 3OE1A 5DHFA 1WRBA 1O6ZA 3KWFA 3O31A 3W9YA 4C4TA 2HO5A 1GDHA 1SOMA 1OYOA 4JC5A 3C3KA 1MEEA 2GD0A 1ZGHA 2X8WA 4LV5B 4F2HA 4ZZ3A 3CVUA 3CPSA 5C8VA 3OBIA 4RIIA 2Z6AA 1IN6A 1NWCA 2OECA 4JFRA 1NM5C 2GFQA 5ANRB 1L4HA 4TN1A 2VHUA 2X0KA 3LLUA 2W2MA 1SN7A 4UNNA 2DR0A 3KL2A 4RXTA 3R3HA 5JQWA 3TGPA 1Z88A 1N3LA 4EB3A 4CMIB 1N2CA 2OZEA 4UDNA 5JCJA 1DFIA 4C06A 4KVZA 4XGQA 3HPQA 3FGZA 4HDNA 2GA9A 3ML1A 4EMTA 2MSLA 1CUHA 4KAAA 5DN9A 4UD6A 2LV8A 3RF7A 1GHTA 4MUFA 3ZVMA 1I36A 1I2CA 1EXMA 1WCIA 4WN9B 3W8DA 3MK31 4D74A 4E5PA 3DQQA 4FR2A 1Q2XA 4U7JA 5H81A 3HABA 3MTGA 2HTEA 3C7TA 2WTBA 3HADA 3HH8A 1TM4E 6PFKA 3O3CA 1FXWA 4PSUA 3I83A 1N7GA 1I80A 3PC4A 5F2EA 1L4EA 1XD2B 3HVKA 3VRHA 4BZPA 1J0CA 4RCVA 2PJDA 2JAXA 3VHXA 4OHZA 3FLMA 2UXCB 5FWXB 4KX5A 4BQEA 3TLMA 1ISFA 4WJKB 3ZDXB 2G70A 2FFJA 2JBWA 2AQKA 1XCOA 4JLPA 3ZBUA 4BV2A 1UWVA 5COAA 1F06A 2OGZA 3M5WA 4O2BB 5EWJB 2VDVE 2AXPA 2FR1A 4O08A 1XWFA 1DRWA 2QM7A 3ZV3A 4NESA 1ZMRA 3SC6A 3UT5A 1W7AA 2LCFA 3ETCA 2YZKA 4TKUA 5IJAA 2OV1A 2Z4TA 1L4NA 3H0CA 1WXXA 3LZ6A 1OC2A 3V1LA 2O0LA 4BMPB 4Z6KA 2BELA 3WYFA 2E4XA 4R31A 1M3SA 3O9MA 3UAZA 3LLSA 3A28A 3TQCA 1A5BB 4J49A 3DT8A 2ZE6A 4OSEA 5C4IA 4B6QA 3LCVB 4QUIA 4P54A 3VHLB 2JLWA 3AB7A 4IPTA 3OFND 2F3QA 1K4MA 3QHAA 4JD5A 4RTLA 1DPFA 4M9SA 3K70B 4YWJA 2VYQA 4AY5A 1OI4A 3LP6A 3LXRA 1T1EA 2FG6C 4UJ3A 1KIMA 1HE8B 2QTLA 3TSWA 1E0JA 3V2HA 1DL5A 4Z4FA 4IDFA 3TOCA 2WB2A 1BEUB 4EAQA 3PQEA 3QX7A 3R0ZA 3FLBA 4TTJA 5PNTA 2OD7A 4I1SA 4XWYA 4B3DA 2OBLA 2R97A 3QJYA 5KDLA 5JMWA 2WUDA 4H7IA 4FQ5A 4ZVSA 3KU1A 2OG2A 1TEVA 2W48A 3MAGA 2WY2D 3ZI7A 1F7VA 5EZ5A 2GBLC 3KEMA 3W9BA 3WK8A 4FIZA 1ZUIA 1U2DA 4LG1A 1U0EA 1E3TA 2GPYA 3MTJA 1TVEA 4LA4A 4DJTA 4UBJA 4COOA 1JFTA 3CVOA 4IQ4A 3FH0A 3UXHA 4R1LA 4RK4A 2J0QA 4MYSA 3M49A 5FYQA 4LJ9A 4M7WA 3NQ41 3TGWA 5AESA 1H6CA 5AVWA 2VF2A 2UXBB 2QX9A 2Q4BA 1CJKC 5IJ0A 3M6FA 2QI9C 1D2GA 5EE9A 1BMFA 2LTAA 5JZSA 2X23A 5FFMA 1PS8A 3CF4A 4I2VA 4M7RA 3EF1A 2J9YB 1Q0LA 2YKGA 2H07A 2I3BA 3EY9A 4PV7A 1XMIA 4GE3A 1K92A 2C5AA 3RVMA 1ZJWA 4KV9A 3V6LA 1HF3A 2H85A 2HZ7A 2ZRFA 3K4QA 4IWNA 4R05A 3ZU4A 1UBTS 1XPUA 2A57A 3DE2X 1XL0A 2I6XA 1UH5A 4G8DA 3HRHA 3OT4A 3F9RA 4A82A 3CCCA 4NE2A 2BGTA 5JDIC 4E13A 4FCWA 1Z68A 2PGJA 1T1JA 4PHGA 4ENWA 2CHQA 4Y9TA 5AXBA 2Y1DA 4X60A 4EMBA 1RJ9A 5BN5B 1HQDA 1UBKS 1UKVY 5AM3A 2J3JA 1MJHA 3AZPA 5DBIA 2RJ3A 1ISIA 1XJQA 1W5TA 3RTBA 3VR6D 2KBEA 2FDXA 3GXBA 4WOCA 2X13A 5I7EA 4INJA 4W1QA 4Q1CA 3CLTD 1KO1A 3G8YA 5AJWA 1NWHA 1RLUA 1PSWA 3H13A 5EKTA 5B3AA 3U26A 1DC5A 2W2PA 4CU5A 3OQJA 2FN9A 4JROA 4M8LA 4ASUD 3I53A 1FQWA 3PUWA 4L50A 2NO5A 1SPXA 4PEVA 2ZWIA 1T9BA 2LIVA 2PX0A 1WP4A 3D0KA 1BD3A 1H1TA 2GLUA 3C8DA 4HGNA 4EG1A 1IXRC 3U19A 1CUWA 3A06A 2YMLA 4TVOA 1RDFA 5LYJF 2JFZA 4O4JF 3DMHA 4OGWA 5IU6A 3R74A 3ZVNA 3JYQA 3J81A 1DAFA 1E8MA 3ENKA 1YC2A 3K1JA 4C89A 1KAEA 3GPCA 3M1IA 1SQGA 3R6LA 2YQZA 3I6ZA 4AD8A 3ZV5A 1Z5PA 1XZBA 4MA4A 2A59A 3EYWA 3KNZA 1IN8A 4I9FA 3DBHB 2C5BA 4IAOA 1WCYA 4PBRA 1XRNA 5A5EA 1GSHA 1JQDA 2EG5A 4KN6A 5I9BA 1RIIA 5A1JA 1QC5A 3BMQA 2I03A 1KARA 1RWPA 3IT1A 3F2VA 3IVGA 2HU2A 3D4IA 4Q19A 5HZMA 1HI9A 3TZKA 5JJBA 3JAMA 2NU8A 1KZYC 3KELA 4CETA 4HFMA 1NNLA 2B82A 3AH8A 3CZRA 3HCFA 4N4AA 3V9AA 1VPTA 4Q47A 1LI5A 3S1AA 5LNK1 4N18A 1N5OX 2Y0PA 4QGBA 3R9KA 5CA1A 3H2BA 2OYSA 5D6OA 2H4XA 3BD7A 1EXWA 1JFVA 3D43A 4X6UA 2P7HA 2QW8A 3TIVA 3T0FA 2Q28A 4E88A 2FQQA 4L3OA 4HLUA 4ZALA 1AY0A 5CD9A 2YWEA 5GZ3A 4X61A 1A96A 2JGRA 2Z2KA 3FI9A 4PWYA 1C1XA 2QYOA 2ENWA 2AVDA 3CINA 1BVUA 3HB1A 1J5EB 2XBMA 1OF1A 2AR7A 4DR6B 4WUVA 3E61A 2FMKA 5I7RA 2P2GA 1IN7A 2VJPA 2GD1O 1UJ2A 1Y8RB 3NNDA 2WMYA 3IHTA 4UE2A 1L5RA 1QF7A 1VB5A 2OAGA 1F3LA 4JP8A 3RC9A 4A0FA 3U9SA 3B7GA 5J1SB 4A91A 1FP4A 3ONFA 1WUHS 1TTPB 3D7KA 2OLKA 5BMOA 1WUYA 5AKKA 2OCXA 2VQFB 5JC8A 4G9EA 3BL8A 4Q1FA 1YJ8A 5EUBA 1HEUA 3QU9A 4O5AA 2MOKA 2EKDA 2X7JA 2ZRCA 3OD1A 5BNWA 2ORED 1VBMA 2DR2A 3R8FA 2W6QA 4OQNA 4ZQBA 1P3DA 1GZVA 4FE3A 4I08A 4JNCA 2A84A 3LUAA 3ZGZA 4J07A 2CSUA 5H3LA 4YAKA 3I9JA 2AE2A 2VJLA 4HDMB 4FDVA 5FLYA 1A9PA 1UC8A 3TCXB 1BX0A 1OJ7A 3ZDQA 4RLFA 1E79D 2BBOA 4Y2UA 2EKLA 2DJ5A 4K0KB 1IU9A 1QH8B 4UM7A 4CMAA 3RTDA 2QM8A 2PV7A 3O75A 1YUBA 4F4HA 2XDQA 4BQNA 1SCIA 3RANA 4K05A 4DB4A 4FP9A 2RC6A 4EPYA 4RPIA 2D0DA 1FYWA 2CL0X 2ZIEA 5TMPA 3TDKA 4QTZA 3ZGVA 1TW2A 2HPAA 4YDSA 2KE5A 1LRKA 1OTYA 3DHEA 2EFEB 3ELYA 1O7JA 3SX4A 1CUFA 5F7ZA 1ODCA 5CDTA 4YPVA 3UUGA 1BFDA 3NP7A 4G5GA 4WKNA 3CVYA 2QJWA 4X41A 1BXKA 3PXUA 1XK7A 3N86A 1BO6A 4NMMA 1BDIA 3SQDA 2HWKA 1LBSA 1NJ1A 3HJNA 4J75A 1E3IA 4WGFA 1DI0A 4ZOLB 5AKZA 5GY7A 1G7TA 2O2GA 1SUSA 2QUKA 4JU9A 1JWBB 2ZR8A 2W0MA 4F97A 1C30B 1ODJA 2JIOA 2Y1CA 2I0FA 2WSLA 3VX4A 4MMYB 4D8WA 1W4ZA 4HNRA 4CHGA 1NULA 1F8FA 5DTEA 5IN5A 1GFSA 1NMEA 1JSCA 5LIRA 1T9CA 3FCEA 4ZO4A 4MS3A 3ELDA 3HGTA 2WMOB 4KNWA 5FPKA 3PEYA 4XX0A 4G0UA 4UOEA 1AGXA 3TQHA 4RIGA 4UM9D 4ASUA 4N5LA 1F20A 1X8JA 4E2WA 4WQMA 1DV2A 1Y1LA 2Z08A 4CM7A 2DBZA 2P75A 1V16A 1G1AA 4E03A 5A71A 1MNAA 2WMDA 1JDZA 3H7AA 4EKYA 4I55F 1FCJA 4MP8A 3W3AD 3MWKA 3DHYA 1RMQA 1Z2DA 1IULA 5AP9A 5DYWA 5F7OA 4JELA 5JNRA 1C3OA 1Z5NA 4QEZA 3I6QA 4PYKA 4Y2QA 1Z39A 3U1BA 3KQNA 1OZGA 3D3WA 2C2XA 1I0IA 1T15A 2FWAA 2H59A 3K16A 2ZYIA 4R8LA 5J59A 3NHSA 3T3GA 1E9EA 2J0UB 1U04A 2Q1YA 3DDHA 2F43B 2PWPA 3EIUA 3HCCA 3Q7SA 4IFBA 1T4MA 3GRYA 1PJLA 4JJFA 4NK5A 4YPFA 5LDGA 3R77A 3WLNA 1NVAA 3HYLA 3PIRA 3VOAA 2VNHA 3KETA 2D62A 4EJ2A 3FTEA 5BNFA 4Q4DA 2IXTA 4POOA 3EUAA 2X4DA 3C6KA 2ZPUA 1MPTA 3AKYA 1LSOA 3R0VA 4FW9A 4QDTA 1VG0B 3UVEA 2AJLI 5KDDA 4GL4A 4MGZR 3KJEA 4A8JA 1KVUA 3KEGA 3PF9A 4ABTA 4M8SA 1KYYA 4W99A 4QPPA 4X7MA 3KR9A 5HM8A 1XJCA 1QGYA 4KRXA 2QQ0A 3KKMA 4QO7A 2AE1A 4HWTA 5AVVA 2QMOA 2X0EA 3L4JA 1VDMA 2FQWA 2LKCA 1CUSA 3GQBB 3WOHA 2ZWAA 3WVNA 5KTYA 4R1UA 3UKOA 3H2GA 3T7DA 3WGNA 3O47A 4NATA 3CRVA 3O2SB 2I9PA 5BR1A 3WYDA 4UBNA 5FTLA 2Z57A 3K9CA 3ZLTA 1OGJA 3LUHA 5CA0A 3DVAA 2R60A 3BE8A 3AF3A 5DN6A 4CKBB 2OHHA 4KB5A 4YRAA 3U56A 1UC9A 3SM3A 4B80A 1L5KA 1TUEA 3C8MA 4UFNA 2IE8A 1AH2A 1E5DA 1EVIA 4BLRA 3T7EA 2WEKA 3UAOA 1CJMA 4J76A 1ZM9A 3KAKA 4JK3A 3V46A 5JANA 2IHNA 2FE4A 1PYGA 1I7PA 2OFWA 4JUAA 4C4RA 5ULLA 3F6EX 1TCAA 4J7AA 4A03A 4D2IA 1E79A 2IC5A 3ND8A 4BU0A 1A72A 3AR7A 1L7PA 2BMWA 3HCWA 1EP1B 4V03A 4NS1A 4XLZA 3EIHA 5AW4A 2G6BA 4Z0PA 3EXHB 1E6EA 1CIPA 1WNTA 1XPJA 3GPIA 4JLDA 1C7FA 1DELA 3QKIA 3WGQA 3DCIA 2CMGA 3SXUA 4P98A 1VZ2A 2I3GA 4PO1A 1NBHA 3F8TA 1TJ4A 1V8PA 5J4VA 1M0TA 3UPUA 3DOEA 4RY9A 3CRQA 3GRFA 4WZ6A 5KEIA 3FCUB 1CUUA 2IVFA 4LBWA 2Y4NA 1R5NA 4IJ5A 4YI5A 1AGYA 1ESMA 2O2CA 1NZJA 2ATXA 1NLYA 2ZRIA 3N87A 1W5AA 2CUNA 4ZU3A 3HNPA 1Z4PX 4KXWA 4EBBA 4D4GA 1GUYA 1JSXA 4Q21A 5IXYA 1JA1A 4WACA 3I6MA 1J70A 3OOYA 4NPHA 1M8JA 5EN4A 3AUYA 3KQWA 1A27A 1SH7A 5ILGA 2J0SA 1G5FA 1JPNA 4QBFA 4D9NA 4GMXA 3HZOA 4OBXA 4ZQHA 2A0UA 5HQTA 4ECAA 4RZXA 4MQEA 5KOJB 3A1WA 3EE6A 4CQMA 3UMMA 4N7RA 1ZMOA 2HQRA 3HUTA 3K9HA 1Q83A 2VYNA 1A2OA 3MMNA 1EVLA 4K1XA 4WK6A 4JA2A 2OO5A 4UUAA 3NJ8A 2PRJA 4DV7B 3NTXA 2WOOA 4CKCA 5CB4F 4MIYA 3QRWA 2P4EA 1IBSA 5ALSA 2X5OA 2D59A 1A8HA 4JOBA 4Q3DA 3OI7A 5EIAA 3GCDA 3ZIDA 1IIRA 2NZ2A 1E5LA 1HKHA 3CFYA 3E58A 3BGSA 5JUWA 3LWBA 1X9HA 4AYWA 2B1GA 4R81A 1D2MA 2GCOB 2HZBA 4KQ6A 5T67A 4XIFA 4C4ZA 4YRKA 1D1PA 2PBLA 2WA2A 2O8NA 3LYHA 3W3AA 5HKKD 1MABA 3A1VA 4NABA 6REQB 2QYTA 3AIMA 4S1PA 2EJBA 2CWWA 1WQ4A 2KLHA 2WMNB 3IPLA 1PEKE 1ZY2A 2I87A 2XLCA 3KR1A 1YZKA 2ZQYA 5IDVA 1JEYB 2G8LA 4DLKA 1TRKA 4YQZA 2G6TA 4TXHA 5B1EA 2C9OA 5GIPE 1EE2A 4GEGA 5K8JB 4ALNA 3QKRB 2VL7A 3GFQA 3QVMA 3OZUA 4U02A 2BKLA 2DUJA 3ETHA 1QAMA 1U4NA 3Q9NA 4FFMA 4GVXA 3PGKA 3WWYA 1MHTA 1ESZA 3CT6A 3PPWA 3PC7A 5TQ0A 2J9FA 3EH1A 4EF4A 3GHHA 4ARAA 2IF2A 1SFRA 4CV1A 1F4VA 2H92A 2OUKA 3N8DA 1DEHA 2VK2A 4Q00A 4I6JA 4D6PA 4YCNA 4KHZA 1JMYA 2YH2A 1Q6YA 2H4FA 3MQ4A 3O82A 4JX8A 2AR0A 4OHPA 4FD2A 5TXGA 1QZZA 5ED4A 2V0NA 2AUTA 4OHCA 5B2EA 2PRIA 5HPYB 4DQUA 1UXKA 4KVAA 4CNBA 1EHCA 1IPFA 2F3PA 3WGOA 1EUCB 1RAGA 1UT5A 3BA6A 5F3WB 5ALMA 2XYRA 3BBPA 1R8XA 4KPUA 4PIPA 1CF2O 3RS4A 3MPUA 3PWTA 4FKBA 5EEGA 3F4KA 3IEVA 2W22A 3R5HA 4FN5A 5LXTF 3HZHA 5CNIA 4OUDB 1VYUA 4CKWB 3PQ7A 4C3VA 3IXQA 4ZJUA 4U6SA 3AEXA 1WV0A 2QLFA 3GA7A 3MOIA 1JBQA 3LCJA 3W79A 3HE3A 4F5YA 1PNRA 1Z38A 2OCIA 2ZYTX 3HU3A 3VTAA 4D9EA 5B57C 1E4EB 2VT2A 1EQAA 4UAJA 1BE8A 4UMFA 1AJEA 2PIAA 4HQRA 1QG6A 2GESA 2M1XA 1TI7A 2NG1A 3GT0A 4KACA 4KKVA 4LYDA 3H87A 3KV3O 2ECKA 1MRZA 3NNNA 4GI7A 5JHHB 3OT1B 2I7XA 2O8CA 1IEVA 1KDOA 3IV6A 3JCZA 1LDEA 3KKQA 1LPSA 3OU6A 1JTVA 4E5KA 2VNIA 5CUQA 4IKPA 3KLBA 3Q3EA 2I2FA 2C2GA 2NYAA 4D46A 2AN9A 2NLOA 1E77A 3FHCB 1QS0B 2CYBA 2VS1A 2X86A 2XUAA 2Z04A 3I04M 3OWOA 4H1UA 4BYMA 1YS9A 1P4JA 1RKUA 2CF5A 3GH1A 3BK2A 3CO0S 4M8KA 1AKTA 4KFCA 2O2JA 3FCYA 1RBZA 1EJ2A 4FFNA 5GINE 1KF0A 1Z7GA 1F1JA 1T29A 4PGHA 4N01A 3EWNA 2QLBA 2IE0A 1O94D 4BAZA 4H0NA 3ZWMA 3E4DA 3U4QB 3MGBA 4W8HA 3BJZA 4V24A 3HLYA 3NPAA 3EPLA 4YCSA 3K6RA 1ZICA 3NOOA 4C7MA 2BVNA 4FLEA 4KEAA 3NUGA 4LXTA 5DK4A 2VUIB 3BICA 3VVBA 2C0PA 1SHUX 1RKBA 4NX2A 4E08A 1JIQA 3P5BA 3QXXA 4YLEA 5CTJA 3H8JA 2MMCA 3ZLJA 4QC2A 2FW9A 2QENA 3UY4A 4YV7A 5BT8A 3JSAA 2QDKA 2VTEA 5DM1A 4ZYYA 3GN1A 3JQRA 4MHSA 4CM8B 3IPCA 1LB1B 3E5RA 1S02A 2RGEA 3LIIA 4PR0A 4WLFA 4ZAXA 2BH9A 5DNUA 1IBKB 4DCSA 1U7DA 1IQUA 3PQ4A 2QR2A 3S2ZA 1E2GA 3WP1B 1PSZA 1Q21A 3K94A 3LDAA 4JJIA 4BEJA 3TTXA 4BV9A 4NJOA 4RQTA 5CMLA 2V5UA 3U61B 4HDRA 2PR2A 2EV9A 3OJEA 1EDOA 1MZVA 1SC4A 2PANA 4GM4A 4XIGS 1X3LA 3LUDA 4IUDS 4YMLA 1T1RA 3OX4A 2V7WA 4U2BA 1CS4C 1FNBA 3DV9A 4YAGA 4YXWD 2X4IA 2XWPA 3KLOA 3LF2A 1ETUA 4M9ZA 3W6PA 3JQAB 4L8VA 3KXKA 1LQ2A 1CZRA 5BPFA 5JBNA 1MAWA 4BTLA 2DSNA 3CR3C 4H7KA 5FNVB 5HKKA 4LVNA 3DR3A 5IT4A 3LPNA 1S8NA 3M3PA 3WNVA 2G07A 5DRTA 3UOGA 2WF7A 5BR7A 5CB8A 1H23A 3IO5A 4F04A 3K0AB 3A6HA 4F4CA 1JAXA 4KUHA 4GPD1 4PLVA 5HG0A 4CT5A 3BWVA 3QBVA 3D1LA 2WUGA 3PNMA 1U0GA 1R2QA 2AC2A 4FZVA 5CG1A 4FFPA 1YBVA 1R7RA 3F3KA 3SNHA 1T2DA 2YWXA 4Q1VA 5I3ZA 2YJGA 3C6MA 1ECPA 3GLGA 2DULA 2Q27A 3K70D 1LRLA 3RYIA 2JD1A 3FZNA 4X3PA 4ZIRA 5E6SB 2BY4A 2RGWA 4IJQA 1PAUA 3RHFA 4ZGGA 4JC4A 2JI9A 1DG9A 3HA2A 4LWZA 4D0LB 3KOZA 1OAKA 1EA5A 3S2IA 4CODB 1WD5A 4M9QA 2GOYA 2YV3A 3HACA 4P9NA 5DM60 4I4CA 4ME6A 4X92A 3RV4A 4A8JC 2HQOA 2AG6A 4RJLA 1DGQA 4N7JA 1DAHA 2WTEA 3FWYA 2VLBA 1SCQA 4FYVA 3KZKA 1BFKA 4FI3F 2XDWA 1F0PA 5JYCA 1ZAKA 2TMYA 2PUHA 2P9EA 2DERA 3U7IA 5C3UA 2Y05A 2R1TB 3FCAA 3MEQA 3QA9A 2EHDA 3ESZA 5DW0A 5IH3A 5LDHA 2O5EA 1BRMA 1M0WA 4C7KA 4GX2A 1XTSA 4O0MA 3CUWA 4RD4A 3RCBA 3VC1A 1NRXA 1ENZA 1LNZA 1U8CB 4I6GA 4AP9A 4HLQB 4ARIA 3KQPA 2NPOA 2WTMA 3DFMA 4HWPA 3SFVA 3ORQA 3OJOA 3UMBA 2Z9CA 4P93A 3R23A 2V6BA 2C84A 3NM5A 5TF4A 3WYNA 3JWPA 4DUPA 3GGPA 5HOEA 1Q5PA 1LJUA 3COSA 3QLUA 2A92A 3FMPB 3IX7A 1EQ2A 3L1KA 3RSSA 3GO4A 4IKEA 4LAFA 3DDUA 2QX6A 5DBGA 2JAOA 4PPQA 3B12A 4NG5A 2HY7A 5FEUA 3LNCA 3IC5A 2WF8A 5SV2A 3VDQA 4BAGA 3B2EA 4YHHB 3OJFA 5CA0B 4PQFA 3L1HA 2Y27A 1NMSA 2AFIB 1D03A 5F3DA 2XGJA 2FZ5A 2O6HA 3L0OA 2CY0A 2Q45A 2CHEA 2CK3D 2TRSB 4GUAA 3PPYA 3LO8A 1YTUA 1COWD 4UTRA 3O4JA 1N77A 2VRCD 3EISA 3JRNA 4AKSA 1TK3A 2ZR9A 4LC1A 1ADGA 1B26A 1QJ4A 1Z6TA 3KYDB 5LOVF 1Y0BA 1P1RA 1QYDA 3N2GB 2FFQA 4LXGA 1ZD4A 1G6OA 4RKWA 2X0DA 2FLWA 2HA5A 3QI2A 1IEQA 1Z6XA 1Z16A 1P1CA 2ADFA 4RLSA 4CMIA 5FUMA 1JT2A 1UKZA 4KN5A 4YBRA 1GGVA 4Q37A 5IARA 1NDUA 3U3RA 3CKMA 1YHZA 2EF1A 4G36A 1NQ5A 1XNJA 2OCPA 1J8DA 3B5EA 3JRXA 1IM2A 4FHCA 4LXHA 4WN9A 2ONCA 1N7JA 2O9JA 3AMVA 4MQLA 2Q4DA 4PTYA 3WKBA 2UUBB 1K3FA 3GJ5A 4JI0B 3WGGA 1AC5A 1QIMA 4YDQA 2IPNA 4BRUA 2F3TA 2JLCA 3QENA 5A5GA 2AOTB 3B9QA 3KKKA 1FQOA 2G5PA 2J33A 4A16A 2PJZA 2FW7A 1KE1A 1JWLA 3OTWA 2VJCA 1GQRA 3CH5A 3CBQA 2WD7B 1XD2A 3ASZA 3Q0TA 4FB4A 3N76A 4KV7A 5AM5A 1F5SA 3D2AA 2IW3A 1N6RA 5FWXA 2JIZD 4E2YA 5CNKA 3AJ9A 4AWXA 4EEZA 5F9HA 2JEOA 3I2HA 2WM2A 2YDYA 4YXWA 5F23A 4M98A 3T1OA 1GLGA 2CLFB 4O2BA 2GZ3A 4G25A 5EWJA 5HKLA 4QFBA 1QV9A 5EWLB 2PDAA 4NYMR 1ISGA 2FF7A 5D87A 4CF3A 2TS1A 1CUXA 1WU7A 4MWOA 4W1SA 4X44A 2YN4A 3NYWA 5EP1A 3TI7A 4UCXA 4M0LA 1JHQA 4M89A 1O0SA 1ZJ5A 1RJDA 3FVVA 4DPLA 3NTRA 3WGYA 1YRAA 3VVLA 5JWHA 4ZMSA 4JR2A 3H75A 5IFKA 4JR0A 4W5JA 5AO9A 3L6RA 3TSCA 3G2IA 3E7FA 4DG5A 2NT4A 1M6EX 1Z4JA 3RU2A 1XD8A 4UOZA 1RXIA 1H4TA 1O57A 1OX5A 3FOBA 4C4SA 5D86A 3TXAA 3IPYA 3VO8A 1BSVA 4BNXA 3VNRA 4UFOA 2RH4A 2O3JA 3AVOA 4Y6PA 3I6IA 1P2UA 3AYXB 5B36A 2COKA 1O9HA 3MLAA 4JIMA 1A9QA 3EJ6A 3RUFA 1GAQA 2XZPA 3PLRA 1ZH6A 2HDNB 4V3BA 4KMMA 2HHCA 1WB5A 2OQIA 3MHTA 1UWLA 4H7EA 2PZKA 1ZK4A 3O1LA 4QFCA 4AMVA 4LF7B 1EBFA 1ZGCA 1ISPA 1EE9A 1Q20A 1QIJA 2ORWA 3C8UA 3H83A 3HR8A 3N0TA 2EQ5A 4CVNA 3GBSA 3LH5A 5L45A 1P62B 1KMMA 2VC2B 3QNUA 1NVBA 5HZHA 2G1AA 2IHBA 2IYTA 3CEAA 4Q15A 1JVNA 4E5YA 1JHOA 2PS3A 2YW2A 3EASA 4ZT3A 2BFOA 5JXJA 5EQTA 4HAUA 5E6UB 2XT6A 4PYJA 4MZDA 2Q2VA 4XQ0A 3QMWA 2OWEA 3IAM6 3JAKB 5IMSA 4Q9LA 1G3QA 2HRQA 4KDCA 4BB9A 3DL2A 4LZNA 5JZMA 1T2UA 2AFIE 4H7HA 1GSOA 4QZVA 4BO2A 3E81A 4IRUB 2FUCA 4HJXA 4FFRA 3ZBPA 3DLCA 1TT5B 2BGWA 1HTBA 3ILXA 1LGYA 3Q1KA 4NU8X 4RSMA 5I47A 1EESA 4BNKA 1KEUA 1XVLA 4OAQA 1NC3A 2RH8A 1IHUA 3G3EA 5G4KB 2BSQA 1CUGA 5C5CA 3EW7A 3EPPA 3H6HA 3EA5A 3IAFA 5FUWA 5K4HA 3BF8A 4LSWA 1WB4A 2JGEA 1FRNA 4YAOA 5HFNA 1TCUA 3IPXA 4ZVVA 5I9IA 4BE9A 2CK3A 3N9IA 5BN5A 2ZRMA 3A6LA 1K7CA 3ERCA 2YCBA 5DNWA 2FWBA 1IAVA 1MKYA 1NN5A 3DF9A 5E1BA 1J0DA 1XP8A 2PKWA 2VRCA 3DE4X 4MIKA 5TR9A 1OHHD 1TTTA 2BEKA 3WB0A 3VPAA 2RJOA 3KZVA 3L6CA 1SCDA 3EUFA 5IKXA 1QK5A 3SI7A 2Y93A 5CGZA 5C0OE 4CXMA 1KI6A 3SBXA 1O0BA 4OJKA 1I3CA 3KPJA 2NXEA 3LHFA 3Q15C 3VISA 4B75A 4QSMA 3AY3A 1TD9A 1AF4A 3GYBA 2ZUWA 4I8IA 5D7BA 1ZPDA 3ND9A 5JAMA 3GCWA 3L7CA 2W2KB 3KWMA 4B83A 3WGUA 1EYZA 2A6PA 2GPJA 3FYUA 3ZK9A 2UZIR 1WDLA 2QG6A 2BOVA 3FTNA 1AGRA 3ZS9A 3CCBA 3N70A 5I7OA 3NEYA 4FN4A 4KFSA 4RJTA 1TM7E 2EQAA 3LGXA 3DBHA 2DAPA 3JWHA 1NJ8A 4BZWA 5TC4A 4DIDA 4F9FA 1AF7A 1NYRA 2IEAA 4IIDA 4ZU1X 1EKXA 1BMDA 4OXRA 1MDBA 2X0NA 2ZJYA 5J47A 1BXZA 1O2DA 1TE2A 1MAHA 2JIZA 3P32A 1XXHB 1M6YA 2R48A 5F2NA 1OH8A 2BL4A 4AN1A 1APBA 1OXKB 5EIXA 1E3WB 2ETVA 2QU8A 1H2HA 1IBRA 2CYCA 7MHTA 5CDGA 2R87A 3UW3A 1PWHA 1D6NA 1IVYA 3P2OA 5ECYA 3I9MA 4WKPA 2FPMA 4WBNB 2UUPA 4RV4A 1YFJA 3FHJA 3UATA 4YR9A 1ONNA 2FCRA 3NWBA 1HDXA 1A2QA 3GZNB 3QYJA 1U7PA 4BLSA 2X2FA 2Z4SA 2BBSA 3P0JA 4ITRC 1O03A 4GNKA 5B58C 1F6WA 2OXTA 4BMNA 4NDAA 3D4BA 4S1OA 1Y8RA 2FSUA 3GP3A 3RC2A 2P2DA 1FTWA 4XDGA 4L1KA 3RB8A 2A94A 2I3AA 2H52A 3NYRA 1IQRA 2N9UA 4Q3KA 4Q02A 3URKA 5BXQC 5HF9A 3OESA 1HWYA 4GOXA 4IIXA 4J03A 3B7PA 4JI4B 2GCEA 3N2ZB 3LTEA 2PT5A 4GO1A 3QOWA 1WUIS 5DBOA 2PZFA 2ID8A 4ZVRA 5BOSB 4ZQEA 5LMCA 1ML4A 1AQIA 2BTEA 4BO6A 1HNWB 3VA7A 3HP1A 3P2KA 2KPOA 4BN5A 3BD6A 2XWSA 4CKXA 3NB0A 4QYIB 2IGBA 3PI6A 3TOVA 4HDMA 2QR3A 2ZGVA 4PYOA 2VJOA 1PT5A 1WZCA 3D8TA 2WD8A 1P5JA 3LL4A 2IYAA 3NTUA 4GP9A 1ODKA 3A0UA 1E1RA 1P6QA 4GU5A 2IJGX 3FPSA 2C4WA 1UMCB 2DHDA 3G2JA 4YRIA 1XZKA 1KFEB 3BXHA 4UU8A 2DWCA 4KH0A 2DJIA 4EWLA 1K6JA 3RVKA 4DLAA 3HVRA 1R3DA 4HG2A 4KVFA 1ZESA 2GVNA 2CHFA 2EJVA 2RIPA 3CVWA 1N36B 2YWJA 2ZTSA 4DR4B 1QVAA 4AJ4A 5EMMA 3QLUC 2ZI9A 5EVCA 2INGX 4A15A 3PEWA 4DUZB 1WMBA 1DBQA 2I4NA 3TWOA 4TYPA 2G76A 4KPEC 2ADOA 5SY6A 4BJ6A 2JIRA 3OU7A 1FS6A 1O1YA 1DXYA 1WULS 5J63A 2PNJA 4XVQA 4KX3A 3PE6A 4BMVA 1BWRA 4ZOLA 5DGHA 1Z4NA 2QUBA 1XZFA 4LKRA 5EP3A 1GGEA 3A4LA 1PX0A 2EKBA 3RUDA 3TZ6A 4B2LA 4GUDA 5JADA 5HP4A 3V00A 5KU7A 1Y1TA 3FRJA 3S99A 3VR2D 4A0GA 4WECA 1C30A 2OAQ1 1E9SA 4RA6B 2H7YA 4DJAA 2BFWA 4MI1A 3DW1X 2FW6A 3C3WA 3D5EA 1IOLA 4YACA 4B6EA 4RDIA 4YRLA 5DMHA 4AMZA 4LJ8A 1ZINA 2NVBA 1L7XA 2QW1A 4P3NA 4DAOA 2NU7B 2ZBUA 2ZTVA 1N5DA 1KJQA 2QGFA 2JA2A 4Y1GA 2WIGA 1A97A 4EHHA 1DEKA 4J9UE 4KAXA 3NH9A 2EW2A 2F1RA 4M99A 2H2IA 1S1CA 4S2EA 1JEDA 1SCBA 4LZPA 4DY6A 2BGJA 1UFOA 4Q1EA 2IP4A 3ZUPA 2Z09A 3R7AA 5FEMA 5DNCA 5GV7A 1Z5UA 5I9SA 4TSFD 3PNKA 2DTXA 2IHKA 5AVZA 1P44A 3UJPA 5IDXA 2O2YA 3QV1A 5K99A 3FPJA 1TU3A 5BSRA 5EHIA 1GYQA 5DASA 3ZTYA 1EVQA 2EOAA 2F8MA 2J0UA 2GBGA 2WHQA 2F43A 3LGSA 4LECA 3KUKA 1HT3A 2DPYA 1XP5A 5C34B 2DBRA 3TKLA 4C0QC 4CHTA 1IVSA 2BCGY 1D9XA 4G67A 1HNZB 3RVLA 2K87A 4Z4CA 4D3ZA 2O1SA 1NY6A 3A4VA 4HWGA 2R8EA 5AKJA 4EZEA 4ZVNA 2X5NA 3KRTA 1KS2A 1V5IA 2BGIA 1Z4IA 2C94A 3M1AA 4QJ5A 2CMHA 4Y7DA 4MQFB 2FWRA 2DUNA 1T9DA 4B6GA 1RC8A 3PDCA 4GWGA 3T5DA 2C2BA 1Z2AA 3OUUA 3M6AA 4KLNA 5SZHB 1UAGA 2Q29A 4MXDA 4MKXA 4PNZA 4B6PA 4X1OA 2LCIA 3SU8A 3U4IA 4Z7JA 2XITA 2ZR7A 2ZAMA 2QYSA 4I9UA 1RXCA 1T25A 3V8QA 1ZXBA 4A1OA 3ROMA 1QPGA 3ACDA 4OA5A 1Z8HA 4CRWB 3K70C 1ZH8A 3T35A 3PFIA 3WMWA 5JS1A 5FOWA 1ZEJA 3GQBA 2RI1A 3LPAA 3QY9A 4JJKA 4RPHA 5C5EA 1U7HA 3VYWA 4RDXA 4OAOA 4L7QA 2ZJ0A 4QNRA 4P34A 4FT2A 4EYSA 2XCTB 1V8FA 1SC6A 4QDKA 4UUOA 5E8JA 4BO4A 5K0TA 1CJTC 4CKBA 1H3EA 4WERA 3PX2A 3RSQA 2DHCA 2MR6A 5A7FA 3SF0A 1IY0A 1D4ZA 2NIPA 5JAPA 5JZ9A 5M7EA 1HDOA 2N46A 3HPRA 4HQ6A 4RM2A 2YJ5A 1ZXXA 3AXTA 4G86A 4U39A 4G01B 4DL9A 5M2QA 1N5IA 4XTRA 5FV4A 3RBVA 5AKIA 1H2XA 4DG9A 2I34A 1UXJA 1JHAA 4L5CA 4AJHA 5B1DA 2Z8XA 1AE1A 3CB2A 4PICA 2FGJA 1Y6ZA 3IURA 1VFNA 1G2PA 2JGKA 3EXHA 3KFVA 4Q4AB 3MTBA 5F5NA 3IEMA 2HK9A 1WOMA 2VHYA 3GA0A 3HY6A 2PS0A 3OOEA 4M1EA 4R3UC 4YYZA 5BVGB 4MYHA 1VG9B 3A2LA 1UK6A 4C43A 1SM4A 4H1TA 3VKHA 3FGOA 1PQUA 2ZBDA 1FSGA 2ENUA 1PG2A 3ABRB 3ETEA 4WASA 5JY6A 3DCJA 3A2MA 4CL3A 3U4CA 3PFFA 1SOAA 3B6JA 4GPIB 4PANA 4Q7LA 2XNHA 4KSYA 4U7GA 1KI1A 2DHQA 3G8CA 1THMA 3CRMA 4OHOA 4GX1A 4D4LA 5IYZB 5B6IA 4PQRA 1P18A 2G17A 2BKUA 1DXQA 4BRWA 3DB1A 5JWRA 3EOZA 4LOJA 1RHRA 4HWRA 4F5ZA 1UZAA 3T7CA 4FMCF 1L5NA 1LDNA 3GJ3A 2CBGA 3UWOA 1ILWA 4UHEA 3RO7A 1XJ5A 4GGMX 3FYCA 2PCLA 1BG6A 1ND6A 1P74A 4N5NA 3TRHA 5A0VA 3PNYA 1I10A 2J5XA 1Z4MA 3G17A 1SR8A 5KOJA 5ICSA 1M67A 1KEPA 2EX1A 4W5WA 5KSYA 5M34A 3EX7C 4C6RA 1FVOA 2OHOA 3NVAA 2QQFA 2WZDA 3OM0A 1KBZA 4RH1A 5HIKA 4QUKA 3VNSA 4Z5XA 1QFMA 2BGUA 2I29A 1DO0A 2P4SA 2C95A 1JSLA 2HA7A 5COQA 3U17A 1R88A 3PJEA 5IHPA 1I2BA 4LF4B 2GN4A 5C5IA 3JQAD 3TLCA 2PLAA 2AI1A 2BLLA 1MR3F 1Y5IA 3PBKA 4F3KA 2GCOA 2E5FA 1KBQA 3IOEA 1YZLA 4HDQB 4M53A 4UTZA 3TCKA 2B8NA 3ESAA 3IVCA 5FTNA 6REQA 2ZWPA 4RHYA 3ZDCA 4RDHA 4HATA 1A9YA 2H4ZA 1GY8A 3ZV7A 4H27A 3HB7A 3MB5A 4TSFA 4D8YA 2GF0A 3NDPA 4QGSA 1JEYA 3ESQA 1RHMA 3DO5A 3IPRA 3PKZA 5LJLA 2H1SA 4CCYB 1V1MB 1V26A 3QKRA 2JLZA 5H4HA 5CVTA 5JVDA 5KYXA 4FE4A 1EEHA 1EFVB 2W5UA 3U6BA 2WSIA 4X5OA 5ECDA 5ICEA 4BXOB 1X7ZB 3HJAA 4Q1DA 1T1GA 1U3VA 2QVBA 2ZW9A 2J3KA 2Q5JA 3DMDA 2BHSA 3NAGA 5G02A 3ZCTA 3GDHA 2GZHA 3TB4A 2VDRB 2C5GA 3A31A 5CXUA 2AN1A 3R8XA 1PGNA 3IEIA 5HZGA 1KGSA 1FU7A 3AU9A 4IQ0A 4BIMA 5JD4A 2OHFA 4KGVA 4O2LA 1L5YA 2JLVA 4PHFA 3SQXA 4C0SA 1P5RA 1QVWA 5CVDA 5F1OA 2AZTA 1CDEA 4D9KA 5HGJA 4JVNA 2FFBA 3OPXA 1EUCA 5EPEA 4ARCA 5IS2A 1EXNA 5CB0A 2GVDC 5AVTA 4TQAA 4MS4B 1JE1A 3RSOA 2FWJA 1OT3A 4ZXPA 2AZXA 4HAVA 5MGNA 1YE3A 1BJRE 2IDMA 4KGXA 4QXQA 1K1EA 1XF1A 4H17A 4JU8A 5LMNB 4GQAA 4RF5A 4CM3A 5JV5A 3CPHA 1HK7A 4OUDA 3OJWA 4AQYB 3H4VA 4WKGA 2EWVA 4I3HA 4JFAA 3L8HA 4YHBA 1JAHA 4NBWA 4ZDKA 3SYTA