1DCMA

Structure of unphosphorylated fixj-n with an atypical conformer (monomer a)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
DYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural transitions in the FixJ receiver domain.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
total genus 22
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dcmA00
1E2BA 3H5IA 2JBAA 3N53A 4P1ZA 3OQOA 1JF8A 1USIA 1XHEA 1BA2A 2OQRA 3H75A 2PL9A 5CNMA 3RVJA 3TD9A 1DJMA 5DKFA 4HNSA 1URPA 1F51E 2WWVD 4RS3A 3BILA 4RY9A 1SXHA 1KMIY 5IULC 4MR7B 1E6LA 3T95A 5HSGA 1DRKA 1D4ZA 3FMVA 3DGEC 2WJAA 1EWKA 5KI6A 4LRQA 4WUTA 2A9QA 3F7NA 2RGYA 2R47A 1UDRA 3A0UA 3VNBA 1NXPA 2W42A 2JVJA 1BAPA 3I45A 3LKVA 5IX8A 1MVOA 2GBPA 1DCKA 4PEVA 5FWXA 3JVDA 3O2SB 1U0SY 1VLZA 5EWLB 3H5VA 7ABPA 2QR3A 4Q6WA 2IKSA 4MS4A 3NNSA 1EWVA 2HQOA 2HSGA 3LUHA 1OXKB 4EYGA 5EWMB 1Z2EA 1ABFA 2Q5CA 2YHBA 2WJWA 4KVFA 4PYRA 3C3WA 3H1GA 3N6VA 3HJFA 2PUDA 5T7BA 2CWDA 2A9OA 5KC8A 2E4WA 4W5TA 4O1IA 4D6XA 4F06A 4RK0A 5CHYA 3Q7RA 5GOTA 4TN5A 4NCBA 3H5OA 3MM4A 3QLUC 3HS3A 4MR8A 4G0OA 3OQNA 2PUFA 3EJWA 3OLZA 4HYEA 3GT7A 4EY3A 1Z13A 4ZJPA 4HNRA 3CFYA 1RNLA 3IP7A 5KQMA 5DTEA 1VRVA 2FKAA 2JB9A 1QQAA 4WT7A 4ETIA 2FMIA 3E3MA 4Z4CA 4PE5B 5KQPA 1JFSA 2V0NA 4G0MA 2O20A 4L85A 4G0PA 4KPYA 3MF4A 4KQCA 3OO0A 3LUKA 1B00A 3QK7A 4YR7A 3CG4A 4UHKA 1W9HA 1ZITA 1YVUA 2FN8A 1JYEA 5TQ2A 1TM2A 1ZHHA 1YMUA 4NQRA 3A0RB 4Z4EA 4LE1A 1PNRA 1L5ZA 2PUAA 4MPTA 4Z9BA 2FLWA 2FTKE 3KHTA 1GUBA 2FN9A 4NICA 4ZMSA 1VPWA 5ED4A 1DRJA 3GYBA 4MGEA 1U2QA 4MS1A 2N9UA 1NTRA 1BDJA 3QEMB 3BRSA 3GBPA 4RWEA 4G97A 2LP4Y 4EYOA 3GWGA 2FEKA 5JNTA 5IEJA 2E4YA 3DLHA 3JY6A 3IPCA 4QYWA 4NCAA 4RY8A 5TPWA 3IP6A 2R4QA 1RZRA 4F11A 2WMYA 1XHFA 3O21A 3CNBA 4RK5A 3LFTA 2ID7A 2BGGA 1PUXA 1YS6A 3KLOA 1ZDMA 3HK2A 4YV7A 4TLMB 3KTOA 2FMKA 3KYJB 3G1WA 3ILHA 3T8YA 4N47A 2F8TA 5E3JA 2ZWMA 2MSLA 1RPJA 2GX6A 2NT4A 4S05A 1GCAA 1CEYA 3O2QB 4IF4A 4WXMA 4OLAA 3M9XA 4XLTA 2JVKA 3HUUA 4OG2A 2A9RA 2R25B 1NXTA 4JP1A 1LBHA 3JPYA 2E4UA 3MMNA 1Z16A 3L49A 3OM0A 3CLKA 4S04A 1ISSA 5FBKA 4KV7A 1YK1A 2B1JA 3QLVA 3TB6A 3MQ4A 2IPNA 1DC8A 4MS4B 1DZ3A 1Z12A 3O74A 3FFWA 3IP5A 4JA2A 2IDMA 4E7OA 1CYEA 1D5WA 1PEAA 4LDAA 1USGA 3NNNA 4YCSA 4W5RA 3GA5A 1DP4A 5TQJA 3F6PA 3CRNA 1DCFA 4KRFA 1LK0A 2ZAYA 3Q7SA 3CS3A 2NUBA 3QX9A 4ETMA 1TJYA 2FQXA 3IPAA 2WB4A 5JS1A 1JYFA 4WXEA 4ETNA 1NY5A 3B2NA 5HQJA 4P98A 4Z4IA 5FBHA 2QVCA 3KSMA 4MRMA 2FW0A 4H60A 4ZPJA 1BDIA 4XFKA 4KK4A 5KQGA 2XDYA 3FGZA 3HVRA 5D2CA 4YO7A 2PE5A 3DBIA 1Z15A 1PHRA 4N0QA 3HUTA 3RVNA 5C5CA 1ZESA 5TE9A 1JL3A 2FEWB 1QP0A 3TO5A 4KQ9A 4Z9AA 2NZUG 2VK2A 3EQZA 2GWRA 3IP9A 4O5AA 1NXVA 4G0QA 4O1HA 3T38A 4YRZA 3H5WA 4LE0A 4ML3A 4RU1A 3P9YA 5KWSA 5FWYA 1SD5A 3CZ5A 3FDFA 2PL1A 4LE2A 3D02A 2M98A 3F6CA 3KLNA 4TLLB 4DN6A 4G0ZA 4MLDA 5EWJB 4N41A 2OENG 3N75A 1XWWA 1Z25A 2L18A 3FFXA 3LUFA 3HEBA 1GCGA 1KGSA 3QEMA 4IMIB 4N0PA 4XARA 1RZRD 2E4XA 3L6UA 3EQ2A 2H3HA 3HDGA 1GUDA 2VUIB 2VUHB 3SAJA 4MS3A 1FFWA 3LUJA 1P6QA 1RXEA 2P9HA 4M88A 3W9SA 4IILA 4TMYA 3OM1A 1SXIA 3K4HA 3RVQA 4IMJB 2LIVA 1U8TA 4MR7A 1D2AA 3KS9A 3LUAA 3SY8A 2JRLA 1DBPA 3EODA 5IUJC 1JH9A 3A10A 4YLEA 3LUDA 4PZ0A 3RVLA 3H1EA 2QV0A 3EGCA 3RVPA 5ABPA 1ABEA 4Z99A 3VNAA 1PNTA 4XAQA 3IDOA 1GLGA 3KG2A 3O1IC 2JK1A 5EWMA 4MQFB 2QVGA 5TPZA 3QEKA 4YP9A 1FFSA 3TX6A 4QPJC 3T6KA 5BR1A 3H6GA 1EWTA 4RXUA 3HM9A 2FXIA 3A3KA 3O75A 6CHYA 2CHEA 4MS3B 4MQEB 2E4ZA 4PICA 4EGSA 1MIHA 1S8NA 4EUKA 3E61A 4F8JA 2PUBA 2AYXA 4MR8B 1C4WA 4MAAA 4D74A 4B09A 1P2FA 3LUGA 4KFCA 1OXBB 1D1PA 2A9PA 2IPMA 3HV2A 1BVHA 2FEPA 1U2PA 3H6HA 4MR9B 4XXHA 1DBWA 4L4UA 1CHNA 3KYIB 5PNTA 4QICA 4RKQA 2E4VA 3CHYA 3GRCA 2GI4A 2L19A 2IOYA 4EVQA 5KQLA 1K66A 1DC7A 5F64A 1MB0A 4XASA 1J56A 2IPAB 3CU5A 4F12A 5JNUA 4KNYA 1AB6A 1Z17A 2MYUA 2M1ZA 5HM6A 3G85A 3OQMA 4RSMA 2WRZA 2RJOA 1USKA 4GNRA 2NZVG 1JWLA 1QNLA 1JFTA 3NBMA 2HJ9A 4MQEA 4YWHA 4ZYLA 4MRMB 1H9CA 3QELB 4Z0NA 4EYKA 5BQ3A 4E7PA 3RVRA 1YIOA 1R8JA 3H1FA 1PEYA 2WY2D 2FSPA 2PKXA 1NXWA 4Q7EA 5GQSA 2FLKA 3RVSA 2IYNA 1ZH4A 1D1QA 2PLNA 5CNIA 3UUGA 3H5TA 2R48A 1T34A 1K68A 2MYNA 4Y9TA 1LBIA 3EDCA 4Q6BA 2KYRA 3JTEA 3HDVA 3RVOA 1EFAA 3SM9A 1NXOA 4RDCA 1W25A 2YHAA 4D6YA 1WETA 4LX8A 2PUCA 1JDNA 2QSJA 4EVRA 2ID9A 5CNKA 4N03A 1QMPA 1M2EA 1U04A 4OATA 3NHMA 1ZGGA 4RKRA 2AYZA 4KK3A 5EWJA 3SQNA 4FB4A 3URMA 1Z26A 2B4AA 4KZKA 3QLTA 4W5OA 4ZMRA 5JS2A 1M5TA 3OMWA 4UHJA 4WWHA 2FMHA 3Q7TA 2L17A 1ISRA 4G86A 3CG0A 4Z4FA 1C0EA 3M9WA 4JOQA 1QKKA 4RXMA 2IPLA 1JBEA 3RVKA 2X7XA 5DCLA 3QELA 4RK4A 1E6MA 2LUOA 3OLVA 1VKRA 3F73A 5TPZD 3QLVC 3UK0A 5C5EA 4JASB 1ZN2A 4FE7A 3RVMA 1Z2DA 1DG9A 3SG0A 2RDMA 2HQRA 5TQ0A 3D8UA 4W5QA 3LOPA 3HZHA 1EAYA 3SNKA 1TLFA 3C6QA 2CHFA 3C97A 1L5YA 3H5LA 4RZSA 3HCWA 2DRIA 4MQFA 2FQYA 1F4VA 4JAVC 1P8AA 1SXGA 3O1HB 4LDZA 3NNDA 5DLEA 3O2JA 3RH0A 2PMCA 1NATA 3CTPA 4Z4HA 5JNVA 2LPMA 4KREA 2H0AA 2QXYA 3LUCA 5TQ2B 4HNQA 4MR9A 1JFVA 3LTEA 4YGXB 2PJUA 4EYQA 1NXXA 2J48A 3N0WA 3ILYA 1ZGZA 3LKBA 4QYMA 1DBQA 5KC9A 4MYRA 4DADA 4MLCA 2MYTA 1MB3A 3I42A 1YK0A 3FFTA 5T3YA 4OTZA 2F8SA 3O1JC 3GV0A 5TQ0B 3CKMA 5FWXB 2QW1A 5TPWB 2NT3A 3Q9SA 5BRJA 1QQBA 4FE4A 3ROFA 1QP4A 4OLBA 4LZLA 1TVMA 1EHCA 2LBPA 2RJNA 3I5AA 1AB5A 1JLKA 1RXIA 4YS6A 6ABPA 2JCGA 3DGFC 3QX8A 1A2OA 4JB2A 3JVIA 2FQWA 1QO0A 5IEBA 4NV3A 2PAFA 4H3KB 1KRWA 3JPWA 5BRAA 1M5UA 5IBQA 3ROTA 3N8IA 4G0YA 1SRRA 1ZH2A 2I6FA 3OLXA 5IC5A 1ZAYA 4Z4GA 1ZY2A 2L2QA 1JHZA 1YMVA 3JS5A 3Q41A 3MYYA 3QLUA 3K9CA 3OMXA 5JNWA 1QP7A 2MSWA 2MYPA 4IGAA 4RY0A 1QPZA 2FMFA 1MAVA 2QZJA 1P6UA 1NXSA 3R0JA 5B3JC 3GBVA 1JX6A 3HSYA 4OBBA 3C3KA 3S99A 4KMRA 3GL9A 2HQBA 4W5NA 2FVYA 1FFGA 3N0RA 1A04A 5DGCA 2QU7A 4N76A 5JNRA 3HXMA 4RXTA 1M2FA 4H3HB 1FSPA 5JNSA 2P4UA 4MS1B 1KRXA 4EVSA 4RV5A 9ABPA 2HPHA 4F3TA 1QO0D 3N0XA 3DLBA 1DCMA 4JB0A 4G0XA 2JBAB 4DQDA 2CD7A 3UKJA 3NHZA 3KKEA 4WZZA 4IRXA 5B3JA 4RK6A 4RK7A 3EULA 1APBA 5CNJA 1YTUA 3LMKA 1I3CA 1BDHA 2VYCA 3OLWA 2GKGA 3EAFA 2TMYA 1FQWA 3BBLA 5FWYB 4RK1A 1HEYA 1A0OA 1LJUA 8ABPA 5HKOA 3C3MA 1ZVVA 2PUEA 1Z18A 3Q15C 4CBVA 5EWLA 3BRQA 3MA0A 1TMYA 3MIZA 3KCNA 1LJLA 3DZDA 3KJXA 3CZCA 2JVIA 3BREA 1YS7A 5IUKC 3TMYA 4GPAA 2PUGA 3M6MD 3HO1A 1E6KA 3I09A 5IUNC 5I4CA 2MSKA 1Y1LA 1JDPA 3OLYA 3RQIA 3OO1A 1IIBA
chains in the Genus database with same CATH superfamily
3PE3A 5JSZB 3OD5A 1N0WA 1M54A 3GG2A 4EZBA 5CNMA 1PG2A 2A9FA 2RGDA 4RCZA 1K6EA 3K0KA 4IQGA 4KLZA 4OHFA 5BUQA 2O59A 3D6JA 3RS8A 5KYWA 2A58A 1ZNWA 2E0IA 3AGPA 3N2ZB 3ES9A 1VKJA 4IYRA 1KIMA 1M0WA 1NVKA 1A72A 1E77A 2DPMA 2Q3JA 3M3PA 3VBEA 2EF1A 3A0UA 4XM2A 1PYGA 1SPXA 1D0IA 3DV0B 3NETA 4XUEA 1NNSA 1OLXA 2N42A 3E84A 1PEDA 5HJ5A 5EIXA 4WBNF 1Y1TA 4P4UA 1JI0A 3OTQA 5EWLB 1W36B 3JYLA 4M55A 2Q50A 3LQYA 1EWVA 2VAXA 2DOKA 4UU8A 3BAZA 1V16A 4P83A 2AC4A 3GLRA 4FW9A 2WJWA 4LJ4A 1T5IA 3H1GA 1L7XA 3EXFA 4G23A 4TKLA 5KC8A 1Q0QA 3RI3A 2BGIA 3LLVA 2IHBA 3K0CC 4UBMA 1UBTS 3TM4A 4HVTA 3R7LA 4IYJA 1YQEA 1W34A 2BJWA 4G0OA 1NJ6A 4ZAGA 4BUCA 5KYWB 2RGNC 3KOYA 5AVJA 4AUMA 1YDMA 2D7JA 4F8EA 4YHBA 2F1JA 3K7EA 4BNDB 2J30A 3D2LA 2P2CA 5EPUA 4ZT4A 4E07A 5DHFA 1WPQA 1PQ4A 3BL5A 4ETIA 1D2HA 1G4AE 3BMXA 2WNHA 4RHUA 2OCKA 2I6QA 2XUAA 1KWKA 1Y63A 4QYIB 5MFZA 3NVMB 1YXMA 5COQA 4B4UA 1NNLA 2AXQA 4G0WA 5G4KA 3TW6A 1NI5A 3MRXA 1XQWA 5ALZA 5KDOA 3EZLA 4HV4A 4JLVA 5JQGF 4AX8A 2FN8A 3T15A 1Z4MA 3NEPX 2RB5A 1T2DA 3HUDA 4YV0A 4PBRA 4HMOA 1L5ZA 1QK3A 2WYHA 1E2KA 3LDGA 1GDTA 4KTVE 5DU2A 1E8NA 2FN9A 4JR1A 4HMQA 3F3YA 5ED4A 1CEQA 2AQIA 1XLTC 5FB3A 1DO0A 2PN1A 4MQ5A 1OW3B 3RO7A 1NVDA 3CIOA 4J6FA 1SEVA 1UJ5A 3PJFA 3V2GA 3ZWVA 2NNLD 4R1MA 5F78A 3FMGA 3MAGA 1E2MA 3QVUA 2P0AA 1J90A 3IUBA 4HFNA 4WK4B 2KI5A 1DX6A 2XWJI 4M2LA 2JIBA 1L4EA 1XMVA 3E8SA 4M60A 5FI0B 1NVVQ 1O7JA 3AETB 5IJWA 1CVRA 2R4QA 4QUHA 3LGAA 3WKDA 2W2VA 3PSHA 1RHKA 4QU0A 4UEJA 4UNPA 4F91B 2QVBA 3KXDA 3U4AA 5A4DA 2J7PA 2QG6A 4QWWA 3UGKA 5FUQA 4ANFA 1WUKS 2F7SA 4X20A 2Z5VA 2UKDA 3KZKA 3OQBA 3PFHA 1KH1A 4C06A 4MIEA 2XBMA 4RLQA 3ZQ4A 2PANA 2R8BA 1BE6A 3NXKA 1X1AA 4A7PA 1A5ZA 1Z5WA 3ILHA 1XN4A 2WKWA 3AR9A 3VU9B 2DECA 4H77A 4MAMA 2ZSHA 4AMZA 3I0MA 3I72A 1RQPA 1FDOA 2J3HA 3QXGA 1W2WB 1N1DA 3IRVA 1KDRA 4W9MC 2QYOA 1KY2A 1Q3TA 5IM4A 1FU4A 1ZI9A 1Z0SA 1TEVA 3E18A 3SZMA 4F3KA 1AJEA 3K9FC 4PZZA 5CMLA 2QOEA 1JIQA 3RE1A 4EJFA 2QZ9A 3L7DA 2A86A 1E1QA 3ZLBA 3ASZA 3IX7A 4S04A 3C70A 1ISSA 2YUIA 5A4MS 3HMKA 2HAEA 3MCUA 4TXNA 3TB6A 5EEHA 5SY4A 4BVLA 2AWOA 2PZGA 2PM8A 4B46A 1UDBA 4TVKA 2XB9A 5EHZA 4G25A 5C32A 4WH0A 1QTIA 3EF1A 3QVTA 3U9TA 1KJ9A 3IT0A 1J5PA 4C5AA 1HYHA 2DY0A 4C05A 1DP4A 3F6PA 4P32A 5JJCA 4GX0A 1IN1A 1HTTA 4YRRA 4FLEA 3NYIA 1XVAA 1P5JA 2C0CA 4TSFD 1CR1A 4HAXA 3EGWA 4HH3C 4AYXA 4BLQA 1UPUA 3I04M 1KAOA 3OOJA 3IV9A 4QGAA 3VRHA 1BX0A 4DCUA 1NQVA 2I2CA 4LJ6A 5ES3A 3SGLA 2P5SA 1U98A 2A6PA 1CS4C 2AN4A 2Z2JA 4M0FA 4NBRA 3W4IA 1SXQA 4O2AA 1J22A 3QUTA 4J0JA 4M7OA 4XJVA 5ARBA 2C3OA 2ZRFA 3FGZA 4PRYA 5F7ZA 2WK1A 3L0ZA 1EP1B 4BB5A 2O2XA 3GEIA 4EGQA 5CDGA 4YCCA 3D6TB 1WCYA 3IDSA 2G9ZA 4TL8A 4OQLA 4CDGA 5IJXA 1R6AA 1QP0A 3GRRA 3OQVA 1AXRA 1U31A 2VAWA 1V8BA 3G79A 3A06A 2OCDA 5KQSA 3RHZA 5GVSA 1ZU4A 2JA1A 2QENA 4KXXA 1M6NA 2ZIZA 4X66B 2FFRA 4LE0A 2I7CA 4JI7B 1PVOA 3AVOA 3CZ5A 1WDTA 4BGIA 3KSUA 4X62B 1CJCA 3TSCA 4U02A 2OUKA 4IV8A 3VTFA 2HJSA 3B1ZA 3BGVA 4DYDA 5B64A 3L40A 2GJAA 4D1YA 4G63A 1XB2A 4LMBA 1CR2A 2WR8A 3EXG1 4UBKA 3N75A 2ZBGA 4CG0A 4AI6A 3VPCA 2C5LA 3PUYA 3LUFA 4RMJA 3IIKA 5FOXA 1X7ZA 4AS3A 1ZL2A 1KOJA 2J08A 4K5QA 1OTHA 4B3JA 4DLBA 2FEAA 4XGKA 1XJQA 2ET6A 1WCIB 1N6KA 2OP1A 2VUIB 2VUHB 2G07A 2OHVA 1AQJA 3IALA 4P9NA 3VX4A 5KWVA 5A5FA 3N5CA 2GPJA 2FRXA 1DC6A 1LPBB 2ECPA 3ZEIA 1Q7CA 4F86A 1BHSA 5HQ3A 2JJ2A 2WD7A 2BN4A 4D8XA 3PRKE 3EODA 4I50B 3NEYA 3ODPA 2CHUA 1MR3F 1T2FA 1XNHA 4PNEA 1A4RA 1JVNA 1JHYA 4YQEA 1OI7A 3PXXA 4DZZA 4YRMA 4CLOA 2JFUA 3NVKI 3N8HA 5ISMA 1FLDA 4KC0A 1SD1A 1T3GA 1QH1B 4RIHA 3MMSA 3RVPA 1BQEA 1ENOA 3FZNA 1JR3E 4M98A 4UTXA 6REQA 1FDWA 4IJVA 2AFHE 2W6CX 1RXUA 1I4TD 3EZ9A 4QGHA 3JD3A 2BT4A 4QC2A 4RY2A 1RHUA 5BRNA 1KVQA 4KPUA 4BLPA 1GFWA 1O6CA 2BL4A 1NBEA 3VZDA 4FYIA 2GRAA 3RTEA 1M2OA 4JI2B 1W4ZA 2FSVC 2CHEA 4R05A 3U7JA 4HYQA 1GKIA 2FETA 3FDIA 3GNQA 3JD2A 4PICA 5ALUA 1VPDA 2GR9A 2QTGA 4GOLD 2GFHA 4BFYA 2WMDA 2Y93A 1XO1A 1JMKC 3NHWA 5CA1B 3SZ3A 4D9CA 1U2DC 1H23A 1EPUA 4IO1A 1JQ5A 3BDAA 4BX2A 1VFPA 5B1HA 4Q7QA 3CUVA 1K63A 2IPMA 1E3TA 1IRXA 3W8FA 1SU6A 1TNDA 2QTMA 2OCGA 3EQ7A 2YJ4A 3BICA 3OUUA 1NVFA 4LZJA 1X92A 4L4UA 4ZAFA 1MA3A 1Z6TA 5BOVA 2CXSA 3TAHA 1EESA 2RGRA 3GFOA 4H18A 2NXEA 1XR3A 2GI4A 3BMCB 4GEKA 4ZRMA 2QM0A 4TMKA 1Y3IA 3GQVA 1EU1A 3QHQA 3Q3VA 4C7VA 2OOSA 5EJ8A 2ZZMA 4L72A 1E62A 5GAJA 3LBNA 3OZAA 1H94A 4RPLA 5JOQA 1J33A 3G85A 3NIBA 5SZJA 3U19A 4K26A 3EYAA 1WY7A 5K3SA 1VHLA 1C4XA 3PLNA 3ZHXA 1I32A 4B75A 4YLYA 3B5IA 3WNDA 1X8XA 3RU2A 3QWBA 4FFNA 4WEOA 2DFKB 2OC9A 4Q82A 2O8FB 5K0BA 2H06A 4IBOA 1KY5A 1FX1A 2P6UA 3WMWA 2V5UA 2A5GA 4FWIB 4J7XA 4PC6A 4UTRA 2G3YA 4RETA 3C24A 1UT8A 2ZI6A 1VM6A 3HHEA 5TXGA 4UTZA 3GJ0A 5G0TA 2HIMA 1ML4A 1L7BA 4IG9A 4OHUA 1KXJA 2HRZA 3OCZA 1U90A 1JTFA 4MQUA 3REFA 2XTZA 2O4UX 3STUA 5JU6A 2FLKA 1PI3A 4Z3DA 2HQ1A 1U4OA 3AUUA 4M9UA 5CK4A 3KZXA 3N1UA 4Q9DA 4IKEA 1EKXA 1TZ2A 1ID1A 2QZZA 4HGPA 3RUHA 2GHIA 5IJ0B 1RYMA 4B3HA 5F7OA 1AS2A 1F6BA 2C2WA 1JGTA 1X1QA 3QYFA 4MRAA 4UPDA 4REMA 5FH9A 4DREA 4JSYA 3PYLA 3KDPA 3D5TA 5F3RA 2CMFA 4L08A 2CLKB 3O91A 3V4PB 3VC7A 3L8MA 5TGZA 4DL9A 1TXGA 5HCNA 1U04A 4CLHA 1FDUA 3T4XA 4Q9LA 1NN5A 4LZZA 5AXDA 2V0CA 4HDAA 3RADC 1MOSA 1P1FA 1NIPA 2J5XA 4KZKA 3DHWC 3JCZA 4RIEA 4GVXA 4OJMX 3ESQA 3HCCA 3GJ7A 4JZKA 1FPQA 5DWDA 3UV6A 3DPIA 4C87A 1NF9A 1UFRA 3BXPA 3KQQA 3VFDA 1PZFA 3P0RA 4L4YA 4BKQA 3T9EA 3B7WA 1ONSA 1IBCA 5A3JA 5JY6A 1QDLB 2QX8A 4Y2QA 4D7AA 2XCIA 2A8YA 3CLVA 3OT1A 5BNWA 2X4LA 3SYMA 4NKRA 3VYTB 2XA2A 2IOQA 1VKRA 2FWIA 3WLPA 1ZUD1 2H2DA 4F4IA 1O9BA 1AQNA 1AKQA 1WSWA 4LS3A 3TIFA 3S2IA 5HF5A 3OZXA 3SYTA 4PHHA 2GEKA 5JSZA 3RANA 3GJQA 3W5BA 4RULA 1GV0A 2DAPA 3IVGA 1G3MA 1C7QA 3T99A 5FV7A 3SNKA 4V02A 4HQFA 4CXMA 3FDZA 2BDUA 4IJ5A 2CXUA 1J8YF 1U9IC 1F4VA 1XD9A 3QKUA 1P45A 1OASA 5E4JA 3ZWDA 3E3NA 1KOLA 3ET4A 5JMOA 4PZCA 1NATA 3KYCB 1U9IA 2XKBA 1RWKA 2B30A 2QAGA 2J33A 1FS4A 4NFLA 5JDCA 1RFGE 2HXYA 5AKKA 3SI7A 4CTJA 4ZOLB 4UUOA 5IAKA 3HZOA 3KIPA 4Q4HB 2OYSA 2XSZA 4MDYA 3WK9A 3VKHA 3GEBA 4C4AA 3MNFA 4R1QA 1V37A 5H80A 3FM9A 3KZMA 3ONFA 4JROA 1DBQA 5ALWA 1N0IA 5CFQA 5K0TA 1GKYA 1RHRA 1T6XA 4MLCA 5EJGA 5LWHA 1XPUA 4ZN6A 1JAHA 2OV2A 4BTLA 1L3BA 1MRNA 1FS5A 2GO7A 1WD5A 5TQ0B 1L5SA 3RRZA 5KNBA 2QW1A 2Z2YA 3SDZA 2GM3A 3HB7A 1U63A 3IS3A 3MINB 1WPRA 3IXMA 4J0CA 4R0NA 3EH1A 5MDHA 1LPPA 2RHMA 3P0HA 3QX8A 4IOJA 1XXHB 1PR0A 2P2SA 4UVGA 1WOMA 1PZGA 2WU4A 2YWGA 1EX1A 1CS0B 2XITA 2VF7A 4H3KB 5E4FA 1ZD2P 3VPBA 5IBQA 2PG3A 2FV8A 4JLNA 3ROTA 2CFRA 1UDAA 3WGLA 2HU2A 5FA5A 1FDVA 1G8PA 2ECOA 1A8HA 5KSPA 1ZAYA 1XRNA 1SVNA 3A58B 5C3UA 3GLSA 5BN5B 1BS2A 1RVDA 1NW3A 2YVQA 3FFBA 3K9CA 1QP7A 1H8HD 1NW8A 1G0OA 2BHTA 3PEEA 3M4ZA 4BP1A 1FB5A 5EIFA 1S2OA 2QQ5A 1KOFA 4XWWA 4UAGA 4RPKA 4NH4A 1K89A 1XTVA 4O4JF 2W2MA 5LYJB 4HDCA 4RLFA 1F17A 4AMUA 3CT4A 4HG2A 3B38A 5LZ5A 4ZYUA 3ZWPA 3FBWA 5A03A 3AQIA 5DCUA 1A9SA 4D3FA 4OD0A 4M3NA 2C9OA 3G88A 4JYMA 4QHTA 2AJLI 5GINE 4X9XA 4Y1FA 2UZ1A 2VJDA 4NTZA 2P4UA 3QVWA 5JDIC 4YPFA 4OHYA 1OKKA 3ZE9A 1PSWA 5IT4A 3S1SA 2EP8A 5JR3A 4Q4LA 1R74A 1E1QD 2Y0PA 2CVOA 2GN0A 4KKXB 1PD0A 4U7WA 2C8LA 1S2IA 3FNEA 4ZDIA 3IIJA 5HZMA 1QQTA 1R8YA 4PWZA 3EVZA 4EQ6A 3GVPA 4IH4A 4CGYA 2GPSA 1U1IA 3O03A 1NAIA 4C0BA 2VBGA 3TW0A 4LTMA 3OLWA 4FSXA 3PHGA 3SF8B 5KVQA 4W1RA 3RASA 5JEDA 1U0EA 5BV1A 3RSHA 1Z5OA 5CVVA 3EDRA 2ZPAA 3EARA 1VLVA 4MP6A 4WY8A 1Z18A 1OB5A 2WD8A 2XB4A 4G65A 1DADA 4J76A 2LVBA 3VUEA 3DLTA 1ZA1A 3KZNA 4PZAA 4D96A 1DJNA 3BL8A 3GDOA 2VT7A 3T7DA 3O31A 3T0IA 5HZGA 2NQ2C 2WWIA 4QXOA 2FR8A 4RV4A 4BE4A 3QE0A 4NH0A 5PGMA 3C16C 1QFSA 3W78A 3MTBA 4F4HA 5HF8A 1FMLA 5SY9A 3U09A 3I05A 1KOGA 4UW9A 3WA6A 3V32A 4CM4B 5INTA 3RK4A 1BA2A 4PO3X 1Y1KE 4KR2A 3BIFA 1YDFA 3INNA 3KQPA 3ROQA 4FD2A 5FAXA 2EKBA 1JDVA 4HATA 1IN7A 4RS3A 5BT9A 2A3NA 4YRDA 1JDBB 4FE3A 2AVDA 2ZUTA 2ODPA 2OUIA 3D8BA 3FMVA 1RC0A 3GFBA 5AQEA 1QOQB 4PZYA 4ZVLA 1JYSA 1W5AA 5ICGA 1JEAA 2ZITA 3MBOA 2NSLA 4J2TA 4YJFA 2VPIA 2GYVA 1P5ZB 4HRVA 2AK3A 4P53A 4F1JA 4I4LA 3GBSA 5FFMA 4NR0A 3ETCA 4TWBA 2IXAA 3HFJA 3M1IA 3ZS8A 4JXZA 1N7HA 1C7EA 2PYIA 4R7TA 4O0LA 4I4CA 2CBZA 2XZOA 3OHMA 1H6AA 3I9OA 4F3CA 2NPOA 4M8LA 3WRWA 1AKVA 4PSKA 5IN4A 1FS6A 1TMKA 5LXTA 3SIRA 4MHSA 4DLLA 4CQNA 1LV8A 1ISIA 3MTIA 1J07A 5LCXA 4EUFA 3DEJA 1X0VA 2JLSA 4RLSA 4TYQA 5LWQA 5IDQA 5M5BA 2QJRA 4KX3A 4LPSA 1JQBA 2PV0A 3PUZA 3ZE2B 3F97A 5KMGA 4IVQA 1DBVO 4WLFA 2Q8QA 1QLJA 4ND8B 1VDMA 4TLDA 1R5NA 2B99A 2RAVA 3UMSA 4MX8A 1P9OA 3RIEA 4A0GA 4MW6A 5DIFA 2W6NA 5BSHA 2P7HA 2Q9BA 3C6ZA 3DS8A 4YT2A 4HNRA 3CFYA 3GVXA 4NL4H 5FT9A 2Z5GA 2FKAA 1VL2A 1YGPA 2WWRA 1PJ2A 3SS9X 2HR1A 1YR1A 2FMIA 3ETJA 2I87A 3IJ5A 3U4HA 1IN4A 4EDFA 2YN2A 3M89A 3CB4A 3UMMA 2BSXA 2Q9UA 2X8AA 2AH5A 3MF4A 3SNHA 1XZDA 1CIJA 2Z1MA 3HBFA 3HJAA 4LJ5A 3U49A 2H54A 1N6OA 3HG7A 1CJTC 2IXBA 1QB8A 4TV9A 4XFJA 5IBPA 5JXWA 1E5VA 2XT9A 4FXPA 1CZOA 2F8MA 4NQRA 5DISB 1KL7A 5FFFA 4JQYA 3SMQA 2Z1DA 1I4LD 4JMLA 1EUDB 1TYAE 3JU3A 4TRRA 5A9SB 5CIWA 3A4TA 3LDHA 3M5DA 1DRJA 3T7JA 4LJ8A 3WXBA 3JQAA 1V16B 4GE3A 2A5FA 3BE6A 3ZE6A 4YJ3B 3BRSA 4IRUB 3ZNOA 2I33A 3OEYA 4FYPA 3P4UA 1LRKA 2PCLA 5FQOA 1EE9A 1IXRC 5JWHA 1G2IA 1KKLA 1P2VA 3V8NA 1LQUA 1KHTA 3AUJB 4UEWA 4D4JA 3LFTA 4NZPA 1PUXA 3KLOA 1G8JA 3VGPA 3IKJA 2AMFA 1K3FA 4PY2A 2JEOA 3ZLTA 1CZRA 1WXGA 4YFVA 3N2NA 4MPDA 4WK0B 2QAGC 3FNGA 1WMEA 3OZCA 8MHTA 4U3JB 3ZLUA 4EKDA 2AFIE 2FWAA 4GRAA 5CW1A 1KVSA 3O8QB 4PANA 3ZLVA 5BSKA 3B9RA 4F04A 5G4KB 1PJLA 2R1VB 5T67A 2M9MA 1E9CA 2V4UA 3JW8A 4MLPA 3U7QB 4EFKA 1R9NA 1X77A 3JPYA 3UATA 2OHHA 3GLVA 3L49A 5A3QA 3JQ8B 2GZAA 3FKJA 1LB1B 4E5PA 4N1AA 3TGLA 4S1VA 2I0FA 4IKPA 1SQ5A 3AVYA 3F6EX 4QO8A 1TZKA 1S2NA 2V9PA 1V25A 3FWYA 4PBSA 1AMOA 1SHLA 2YVUA 4ECEA 1MD9A 4KX5A 4A1FA 3A4MA 3WG9A 4P08A 1E3DA 1VJ5A 3B1WA 4ITRC 1CNFA 1GZ5A 4JI4B 4HWPA 1LLCA 5SYAA 1DCFA 3OPYA 5A0TA 2BH2A 3ESZA 2GCOA 3GCXA 5JCXA 1PX0A 3PGMA 1T15A 3QX9A 3LU1A 5AESA 1KS9A 3ROGA 4B79A 5HQJA 5KS2A 1TPYA 1DARA 1PIWA 1AM4D 5CDHA 3P2JA 4ZIRA 4RTLA 3VOBA 3BX1A 2LIPA 2PSHA 4OFWA 3NDBB 3AUTA 4UOZA 3OZBA 2CBXA 2H4FA 2ZYIA 4KO3S 3HVRA 3DBIA 4EG5A 4XVUA 1KWGA 1JL3A 2E37A 4Y6OA 5EJ5A 4F6CA 3TO5A 2Q5OA 3ZWQA 4XYGA 3IP9A 2QG4A 3DJFA 5C0OE 2Y05A 3C43A 3KU4A 2C7VA 3LXUX 1EZ4A 1HURA 5FKJA 1E3EA 1M8PA 1MXFA 1O8CA 2ZB3A 3C3DA 4WLVA 1B93A 5DE3A 3TNLA 3WGUA 4ZGGA 1Q20A 4P8RA 4WOCA 1Q17A 3UOAB 3I61A 2ZT7A 4OBEA 1E1DA 3OJCA 4MTCA 1LBEA 1XXLA 4B8ZA 2J6CA 4UHFA 4BJHB 4DN6A 4ENRA 1HZZC 3OZEA 3PD7A 4FYJA 4G4JA 3RREA 3RT7A 2HW8A 4CZ2A 2B82A 2JF0A 2O7RA 4N54A 4AYWA 2QL7A 3KPUA 4EB0A 4IGFA 5K0CA 2WIGA 1TIKA 1VB3A 2H2FA 1KC3A 2E4XA 2Q2QA 1VCIA 5JQGB 1AGYA 1POXA 5T4FA 1C1HA 3LUJA 5BV2P 4HX5A 1N9ZA 5DTMA 3A3NA 4LIPD 1KDZA 3V1MA 4EB8A 2KPOA 5IZCC 3DE5X 3GOQA 4DT1B 3BL6A 2D5AA 3ICCA 4NONA 1KYTA 1N2CE 2YWHA 3HWRA 1XFAA 4TWZA 4V0ME 4X6XA 4JI1B 4PAGA 1N36B 3E22B 4KXMA 1UMDA 3L0SA 5AW1A 2FZEA 4U7JA 1VC2A 3ANYB 2P5UA 2OM2A 2VHVA 2YR0A 2RHJA 2EW8A 4JCOA 4RL4A 4TUYA 4BFZA 2QV0A 2X14A 4IUDS 2W11A 4YMHA 2W6JA 2ZRBA 1DPFA 1RADA 2CNLA 1EDZA 2H2AA 3P71T 4MEJA 1Y1QA 1GCIA 3O1IC 2PRJA 4QU8A 4EEXA 4W1QA 1SQGA 3STWA 2G72A 2OV4A 2QAIA 4R3WA 4B80A 5TPZA 5KTOA 1K5HA 2Y6UA 2VTEA 4LV6A 4X1KA 1GM5A 1U0BB 1EWTA 3RYIA 3W7BA 2A7XA 1Q1QA 4RE5A 3ZI4A 3ORQA 3D3JA 4MYDA 3AEKA 4IMRA 1MIHA 4UCXA 2SKCA 1S8NA 1UANA 2W6JD 1KYXA 1L5QA 4Y6RA 2UZ3A 3TFWA 1HPLA 2EX0A 1R9JA 4IOMA 3K2IA 4I66A 2NO0A 3PHBE 1YR3A 2WF5A 4JLBA 4YCAA 2HF8A 4F46A 1P2FA 2Z43A 3E2MA 5CXSA 2R8XA 4FFLA 2NU7B 1WS6A 3G13A 3PUJA 4OGFA 1YT5A 2ILVA 5FRDA 5IS2A 1HZZA 1YZGA 4TQUS 1XV5A 1W19A 1XZAA 3BF8A 4R6XA 5C5IA 1DBWA 2ANBA 1CHNA 1EJ2A 2I6UA 1KJWA 3GDFA 5DBGA 2D13A 5JISA 4NHEA 3P26A 4RVUA 1TA0A 2NIPA 4LMAA 1FFAA 1DC7A 3IIIA 1MC4A 3NTOA 4PQGA 5DBIA 5A71A 3L0IB 1ODKA 1L4HA 3V7WA 1FK8A 3PPIA 4F12A 1JG4A 3FHJA 3KB2A 5F7JA 3WZMA 3HFGA 1ECPA 1KI6A 4RSMA 3U56A 2OO3A 3K6JA 1IXYA 2FZ5A 1RKBA 3F4KA 1YA8A 4JP8A 1PRYA 1KJQA 1C5KA 3UB2A 4CMGA 4YWHA 5HG0A 2BP7B 4HEA1 3LOQA 3IT3A 2NWQA 3GT3A 4OK3A 3OH8A 4EYKA 4AZSA 1EFVB 4L0QA 4DOMA 4YBZA 2V3CC 1BEEA 3S81A 1G5HA 3UAYA 1GOTA 1R8JA 3S1AB 1KAMA 2XYGA 5K3FB 1JE1A 2VBCA 3CVOA 2GN9A 1C7JA 3DQZA 4W7SA 1D6NA 2ID8A 2VF5X 2H2WA 5LR6A 2IT1A 2J3IA 4I9FA 3D0KA 4LRWA 2GDJA 1CY7A 1U28A 3C3BA 4C3ZA 4CF4A 2DR3A 2ISQA 4NE2A 2UYYA 5GADl 3DBLB 1HRKA 3OCJA 3I3SR 3QVOA 2HFJA 3U39A 1KMNA 1N2EA 4KJZA 1H2ZA 5KBYA 5GVRA 3IT2A 4ER0A 4NZZA 2B5OA 4GM4A 4UEOA 2GN4A 3TSYA 3K9WA 4UOQA 3DEYX 3NH9A 5FOVA 4NAVA 1IK4A 4R9RA 3RSQA 1VI5A 2QMEA 1M74A 3DEKA 8OHMA 4P3NA 2Y2VA 1KO5A 2QU8A 4RKRA 2ZAMA 5ITZB 5AJZA 2CMGA 2ZZKA 1F6DA 2ESRA 3LF2A 2J9XB 5FLEX 2FMUA 4NLLA 2XVZA 1GLNA 4QSMA 1GUAA 3TRHA 4V03A 3I2FA 1T36A 1R4ZA 3CNHA 1PZNA 4BFUA 1QV6A 3RT9A 3CG0A 3E8MA 1QPGA 4LYYA 1QH8B 1YZVA 1EFUA 1K3TA 3FPSA 3GU3A 1T5OA 2IEBA 1YBMA 2NTJA 1H1LB 4MP8A 4PLTA 3VI3B 4AZVA 1V8OA 2PCJA 4FHDA 4HYTA 2H1FA 1THGA 2DWQA 3M1AA 5DCLA 3U13A 1EDDA 1ENPA 3SIXA 3WR5A 1ATIA 3F8SA 3DZHA 3I4CA 2R1ZA 4TQ9A 3PXEA 1MB9A 2O50A 3LLMA 2OZLB 3QLVC 4LXYA 3VHRA 1Z5ZA 2NQTA 3N8NA 3O2NA 5CB6A 5JVDB 3BCUA 5DX0A 4EMBA 1XEFA 1Z45A 3PP8A 4R9NA 2PS0A 5DT9A 1HT1E 3HCNA 3RT1A 4EFNA 3B12A 3EMKA 2BDEA 2G71A 4GUAA 4HB4A 5CJJA 3X0DA 3EZ2A 3OQJA 1A3CA 4E22A 2RGAA 3K0BA 1X8JA 2J85A 2WHQA 3CUYA 3PRHA 2CHFA 2QE7D 4UU0A 1ULSA 4GYYA 3VO1A 2WWHA 4ZOLF 2CNKA 2GHQA 2XVYA 3JARA 3NNDA 4CF3A 4KN9S 2O19A 5L6LB 1JECA 2GAJA 4YRIA 1G17A 5AMXA 4OHCA 3UFBA 4C1NA 4LTDA 2BEWB 1EAMA 3QW4B 4YGXB 1RI1A 2I2FA 3L77A 4YXWD 1F12A 4M1OA 2FB9A 3HKCA 2XRYA 3HXLA 1BYIA 1E3JA 3HXKA 1EFRD 4KBFA 5EKTA 2IS6A 1VPLA 1OZAA 2X1VA 1P17A 4DADA 4RZIA 5HRAA 2OT3B 1S0UA 1T4CB 2QTLA 2VXBA 3P5BA 4UHDA 4OTZA 5D85A 4ZKDA 1AY0A 3RJTA 4KQXA 3PNLA 2PUVA 4F7WA 4FVTA 4EAAA 2N3ZA 3ZPXA 3TSZA 3EW7A 1BU5A 1K6JA 2X7HA 2GN6A 4ROSA 1IBKB 1MW9X 2Y71A 4B87A 1GTG1 2R1UA 1LDNA 1DLJA 1UBSB 2N47A 3ODGA 4HBGA 3NQ41 3ZR4B 1G59A 3CF4G 4EFDA 2ZI3A 5AM2A 3W77A 3O5AA 5AJXA 2XUKA 1G60A 1FMCA 1LPSA 4B9EA 3UM9A 2JEYA 1SELA 1RW4A 3PQ5A 4WSOA 5BT8A 1GT91 3AEYA 4L9SA 1T8SA 2L2QA 3JS5A 3ZGNA 2WHXA 4X8HA 2G0AA 2A92A 3OMXA 2AEEA 5LLTA 2VJQA 3ER6A 3H2JA 5I9MA 1WBDA 4Y6GB 5IFLA 1CYDA 4ARUA 4JK3A 4O02B 1E3IA 1TCBA 1HL7A 3L8GA 1HDGO 1LBSA 2BD0A 4M8IA 4Z9XA 5EXTA 1A76A 1AQYA 2Q7XA 3CZQA 3QPDA 4PG7A 2GJKA 2XYRA 5DBFA 2YMPA 2OCLA 1DCTA 1A8PA 1U8EA 3KDAA 4JJIA 4QNRA 3ZX5A 4PLWA 3L7LA 1SVKA 3U7GA 1OI4A 4GOOD 2AK2A 3EOAI 5LOVB 4Z3OA 5EIBC 4IDHA 5IAJA 1OGIA 3IE1A 5E2AA 3L8YA 4ZRNA 1BH6A 3DOFA 2J67A 4MS1B 1XZKA 3KKLA 2JLQA 1ILWA 3V5NA 5BQFA 4H3VA 5K6AA 4LF9B 4CV3A 3KKEA 1FFEA 3N2KB 1E4EB 3PV0A 5AOAA 4IIXA 1L9KA 3V6LA 5B3JA 2QLMA 4G26A 4NDNE 4ZZ3A 3R3YA 3DDSA 4GX5A 4KXNA 5HUQA 3VSAA 1WSAA 1VPVA 2JLCA 1GY8A 2I4NA 2AN9A 1H2EA 3EULA 5LQSA 2EARA 2R8ZA 1UBCA 1SB9A 1GNTA 3R0VA 5FO0A 4AP9A 1ZCFA 4BFXA 1FQWA 3ZYCA 3OT5A 1PQYA 3MTGA 5EP2A 2I4TA 5CFOA 3V6MA 4YP0A 5HKAA 4PYOA 4P3KA 1LTHR 3VVBA 1ZISA 1LJLA 2FPXA 1KEZA 1N5LA 2UYGA 3CZCA 1RLJA 4H0NA 4U6QA 5ELMA 5AVXA 5CVEA 2YHIA 4DY6A 1ARZA 3VA7A 1TQ8A 2PEZA 4U8HA 3UXYA 4RTMA 1CR6A 3LXRA 1UMKA 1PT8A 2GN8A 1B6SA 3L7NA 1NDHA 4U63A 1D09A 2VT3A 3SP1A 3W5AA 3BQMB 4BBJA 4R5HA 2NAPA 4R5MA 1K0UA 1IM2A 3SK0A 3UAZA 4B76A 5DKFA 3WL6A 1NU6A 3BH0A 1QHNA 3DD5A 3HR4A 5EL0A 2FZ4A 2CWWA 2P9GA 4YX9A 4MR7B 1E6LA 1U3TA 4TZTA 4BQSA 3ONDA 5AWFC 5KI6A 3A2KA 1KU6A 4ZYYA 5I7SA 4FGJA 4UXJA 1KF0A 1Z68A 2HLDA 3K5PA 1R6XA 4HS4A 3PJRA 2I7TA 1O6ZA 1V8PA 4JUDX 1TD1A 2NXCA 3JYQA 3H5VA 1YQGA 1CQJB 1JE0A 2AXEA 4G41A 4KACA 4UXIA 5B1SA 3T7AA 1WSBA 1P8JA 2JARA 3GPCA 1RDFA 3AHFA 1OXKB 5EVCA 4HXYA 2R6ZA 4RQTA 1ZP6A 1QHSA 4KWIA 4NY1A 10MHA 2NV0A 3AC0A 3N6VA 4PRKA 3HJFA 5CYGA 1UZMA 2CWDA 3AGQA 3DBHB 4AC9A 2RD2A 3LZCA 4YP1A 2PGAA 3KEQA 1N6IA 4OHZA 1XJCA 1NRIA 4UFOA 2NV2B 2QGZA 2O2EA 1CJSA 3IQZA 1KQFA 3V1TC 4TYNA 1UPXA 4YGYA 3MCAA 3ML1A 2YS7A 1Z6YA 4JIGA 2ZRLA 4TQAA 5C4IA 5IFKA 1X1CA 1ZMBA 4Q12A 2RG1A 4F4DA 3M1YA 3JQPA 4AU1A 2HGZA 4B34A 5KQMA 4LHWA 5CFNA 2IQIA 4ZO6A 4ZZ1A 2PH5A 1QQAA 2IUTA 1E59A 5IT0A 5DN6A 5CEEA 2H17A 3GELA 2KBEA 4X0EA 4ESOA 1Q15A 1C8VB 3SBOA 4BATA 1A5SB 3ND9A 4KPYA 1WCWA 4EMSA 1I1NA 3OZSA 3BIJA 3TQSA 1U65A 3CVUA 3ZCRA 4G84A 2ZSUA 1V5EA 3CWQA 3IH5A 5KNCA 1M1XB 3PNQA 2DPGA 4J0IA 5TQ2A 1TQ6A 2AE2A 1HMPA 3QVVA 2A0UA 4ISBA 4UUMA 1G64A 1EMDA 1LX7A 3KC2A 4KNWA 4MPTA 4DB2A 2W2LA 4BNLA 1NQ5A 4D9NA 4L51A 1J21A 3BWMA 4PLGA 2UZ1B 4AKIA 2QBYA 4L3OA 3DE4X 1Q6ZA 4X1OA 4DSOA 1GG9A 1MA0A 3TTXA 1GTSA 1KA9H 5HF9A 2X3UA 4RMHA 4IIEA 3JY6A 1GAQA 1XRJA 1YSCA 2KQUA 4QTTB 4QYWA 4XLLA 2QN8A 4YV2A 5TPWA 4I3HA 4F45A 4TYPA 1KDPA 4MRVA 2IYWA 2C3YA 5DTIA 3WYGA 1RZVA 2FQ1A 2EJWA 1M2VA 1U3GA 3AEZA 3A11A 4IINA 5ALEA 2I3ZA 3IAXA 4RK5A 3ZIAA 4Q9NA 4TYYA 3BIXA 4MCJA 5LBUA 3HK2A 1GGHA 2QTHA 3RB8A 1BXRA 5CBPA 2MSEB 3SF8A 4BKPA 1CJMA 3H2IA 4F5EA 3I9V6 5CJPA 2CJPA 4N3NA 2JJQA 1V35A 2YC4C 3SIWA 2FG5A 1N5KA 1PNVA 4GUDA 2MSLA 3AKYA 1RBMA 1XZNA 2PSSA 1TAHA 1KJ8A 4DAEA 1CEYA 2YOHA 5AK5A 1XRMA 1YVEI 3DZBA 5C8YB 2JVKA 4PX3A 2WJYA 1M8FA 3PXGA 3WIUA 3C1UA 4QYTA 3HYTA 4EHLA 3AFNA 3Q4GA 3U3ZA 3C3JA 1OH7A 1K8XB 2Q3LA 2QV7A 1CERA 2GBFA 2H52A 2JFOA 4IIJA 4JFAA 3TLAA 3AWIA 5H83A 5FWDA 5BQ5A 4ZYTA 1QG0A 4CE6A 3JALB 3FD8A 3JZMA 2FFBA 3NGXA 4N3CA 1J0DA 2RBKA 2ZUDA 1JQKA 4AN1A 1OT3A 4WNAB 1D6MA 1KR2A 3O4JA 3AHDA 3RRYA 1LX6A 2VVTA 1IVSA 2IZ1A 4OQNA 2O06A 1GZSA 1M2HA 4YCSA 1CIPA 1PL7A 2D7DA 1RYYA 2Y1CA 2K2QB 4IDAA 4Q9JA 4DLAA 2DBVO 5FWNA 2N75A 1YRHA 1ESMA 1J2YA 3AI3A 2WDPA 2ODQA 4EPTA 3NT2A 4ZHSA 4CLRA 3KSZO 5HM8A 2C98A 2QVCA 4MTLA 4OXXA 4US1R 2X0KA 4WMLA 4ZOQI 3EA5A 3THOA 1R6TA 3OOSA 5BN3A 4C3UA 2K87A 3LC7O 1UKVY 5KVAA 4B35A 1BHO1 1D5CA 1U1CA 1UK6A 2UUOA 1KAGA 4RTJA 4L8FA 1IOWA 2RARA 1O97C 1U2SA 1N9GA 5C5CA 4DV7B 4NZNA 1ZESA 1FTGA 2LKCA 4AZ0A 4HDNA 1FFDA 1XRLA 3OCXA 2XCRB 1DAIA 2Q1SA 3EG9A 1E63A 1JVBA 1LV7A 1SKYE 3EVCA 5EN4A 2BZSA 3EQZA 5CIQA 4NK4A 3LCVB 4B40A 4OREX 5KCMA 5C7LO 4YRZA 1XTPA 4MLZA 1JZSA 5E95A 4EX7A 4JKOA 1TW2A 3G6KA 5FWYA 4M0CA 2JDID 1RYNA 3B3AA 3A14A 4BO5A 3AFMA 4FBGA 1E5TA 1YKFA 4YI3A 1QIHA 4JEMA 3TR6A 4OI0A 1NAHA 3HNPA 3NBZC 3S8MA 4E08A 5ENVA 2NZJA 4GYKA 3T7TA 5LP6B 2SKDA 3LNTA 1SIUA 421PA 4IQ4A 2F1RA 3A1UA 1RZRD 5D86A 3FSGD 3SCZA 4FGZA 4AJEA 4EA9A 1A9PA 1IEXA 3LK6A 3QVJA 3EQ2A 1GUDA 3CPHA 1T2VA 3OQIA 3MGBA 1P6QA 1RXEA 2J9ZB 2F3UA 1OHHA 1UUFA 2P9HA 3RF6A 5J63A 3IBCA 4RF4A 3G2KA 4TMYA 3T1NA 1REQB 5A4KA 4QSHA 3QOXA 5JALA 4MR7A 3LPAA 4N8DA 3RTDA 2CDCA 1PTJC 1MDBA 1S01A 721PA 1Z4KA 1B2RA 1W4AA 5LMZA 5EUCA 1JIIA 4DV4B 1E1LA 2ETVA 3G1UA 2ABWA 3EXHA 3GZNA 3R1IA 4TLCA 1DX4A 1T43A 2H63A 3MJEA 4ME6A 3W0LB 2VATA 3BERA 1G3QA 1DWUA 4G4SO 4LJSA 2IOFA 3JRWA 4FCTA 1D7AA 1WWKA 2X8LA 2R2GA 5H0IA 3C15C 4EA7A 2BYTA 5EZSA 1XJ5A 2JK1A 2WSIA 2MSCB 4M49A 4XGQA 4MUYA 3OICA 4DIOA 3OF2A 3T7EA 3T6KA 3NLLA 3C4QA 5BR1A 2AR0A 2VJNA 2XNDA 3ZWAA 5AW7A 3A3KA 2ATIA 3GD7A 4UPEA 2PX0A 3A3OA 2D1RA 4G8DA 4WXYB 3TFOA 3R0XA 1T4DA 3H83A 4I2VA 4YASA 4GZ3A 1HBJA 2AZMA 3Q72A 4B17A 1KMHB 4XB2A 1C4WA 4IVPA 4MO2A 1KI9A 1OBHA 1PSZA 2HU5A 2YRWA 1KQPA 1NQOA 4OGGA 4PLCA 3ZNQA 1IXSB 1IN8A 1XP8A 1M2JA 2A35A 2BM8A 3GCZA 4C9BA 1BD4A 3SJAA 4QAQA 4BX0A 2WC1A 4LQCA 3EE6A 1E5DA 1UQTA 3EPKA 5JPCA 2Q3DA 3ZCUA 2GNOA 2JJMA 3OOHA 2YBDA 1I2MA 1M6VA 3GZTB 3GNLA 2CDNA 4J29A 1EJ6A 2QJWA 4MW2A 3RGWS 4EVQA 5L7TA 5DMXA 2ZRGA 4Z7NB 4TTRA 4E5DA 2CL5A 1H5UA 3DVQX 5AM1A 4FQ8A 2BZGA 3OQMA 5AKIA 1IUNA 1DKMA 2NUTA 1SXJC 3EH2A 4YPOA 1E96A 3EJ6A 4ZICA 4OIMA 4KITB 2G40A 2H1HA 4H1UA 1I6KA 2FWRA 3L7YA 4J03A 4MQEA 4EYSA 4YAUA 4FWTA 5TLSA 4GR9A 2HA4A 1WCV1 4NNJA 3SC6A 4KXFB 2MSNA 4IKOA 1UIRA 4FFDA 2PFSA 4ZRDA 4C3VA 3DKPA 3E7FA 1OYYA 3ZHTA 4E7PA 9ATCA 4I9HA 2FOIA 3WBBA 4F85A 3STXA 1QV9A 1KJNA 5DI3B 3S2UA 4TS1A 4FQ5A 1EZ1A 2CSUA 1N6LA 3LLSA 4A73A 4YRKA 2IYNA 4MOWA 4CDMA 1OFGA 1TFRA 2AT1A 2R4UA 1M2VB 2W2QA 1XDUA 4JJEA 4MW7A 2V7GA 3EVAA 3LS2A 3OU6A 4R2WA 4Y1GA 5KYKA 2WU0A 6AT1A 2V0GA 2RHLA 3ILSA 3JTEA 1CJBA 1AK9A 2DE0X 3RIHA 3PLAE 2B5WA 4RZXA 3UANA 4D6YA 1QYWA 3S0JA 1L5VA 3PFBA 1ISHA 3WSVA 5FPPA 4DCVA 3A9TA 1LBQA 3WK5A 3RAFC 3NHMA 3GCGA 3BGDA 1HFEL 2GXSA 3M6UA 5A9TA 2WTBA 3OIGA 4PONA 3WHPA 2WILA 2H4JA 5D3KA 1MZVA 2JI6A 3N6RA 1MGPA 3OY7A 1ZMTA 1YRLA 1E66A 4EF5A 4HT3B 1VHQA 4CM9D 2VI5A 3AUYA 1L5HB 2FP4A 4WCFB 4WLEA 5DM2A 4I1PA 5I7RA 3P0FA 1TX4B 4MWZA 2AKYA 3LE8A 3JR3A 3RC7A 4DILA 2Z9CA 4N8EA 1N5RA 2GH1A 3IRUA 4B82A 1GUFA 2ZVPX 1E0JA 3TQQA 1THTA 4FMBB 3NU1A 1EQ2A 1O9GA 3IEKA 4CMEC 1RXWA 1ANKA 4BMOB 5GGXA 5EXSA 3H16A 2GAOA 4UATA 4M4SA 4NPHA 3P0EA 2XRZA 5M3BA 3WZ2A 1N6NA 5TEVA 3WDLA 3LOPA 2WIDA 1V3UA 1AX9A 1ADGA 1KH2A 5BNIA 1L5YA 1R27A 4TYMA 4L5CA 3F49S 1V1MB 5CPBA 1JMYA 4IIUA 1ZQ1A 3A1VA 5EZYF 2VRCD 3O2JA 3E5HA 3BWCA 2G04A 3CTPA 1F8UA 1F20A 4JOBA 2FSIA 3VH4A 2VNKA 4PZ9A 2IQ5A 4WKOA 3L02A 3D1LA 1Q7BA 1KI1A 3R5TA 4WLNA 1VPEA 2IF2A 1VKOA 3QSYA 3K9LA 3GLFA 2Q0QA 4CQJA 5FLYA 3AINA 3X1DA 1CZLA 4B1FA 1UBGA 5KSOA 4E2WA 2RHBA 4NCAA 1MB3A 4LOJA 4TS3A 5FDFA 2Q45A 4EQZA 4XFDA 2P6PA 3F78A 2D5CA 6Q21A 3E15A 1FDRA 5EIAA 4YAGA 3R9WA 3PC8C 4PHFA 5LYJA 4GXRA 3Q9SA 3B6IA 1ZUWA 5TX7A 2OV6A 1TVMA 3PFCA 2OHJA 1N2XA 2OECA 5M29A 1DAMA 1TCVA 2P67A 4D8VA 3PVSA 4LRTB 4B6RA 3PENA 4X94A 4AJPA 2ZXUA 3W06A 3A1EA 1GNRA 4U9IS 1JAXA 3N2GA 4DLRA 5SZKB 2NSHA 4OJQA 2FPKA 5C8VA 5AUQA 1EFLA 4X3CA 2WUDA 3SDSA 2Y1XA 4JC4A 1JHZA 3RGGA 3HVHA 3J81k 3WQRA 4B3FX 1NVUQ 1O6FA 5EEGA 1I1HA 1QU3A 3GLQA 3ZU3A 1ZONA 1Z74A 1XMIA 4B3GA 3B60A 5B4UA 3WFIA 4IFEA 1LZLA 4HDOB 4BMYA 1J0CA 1NXSA 2H9AA 4XDHA 5EQTA 1FYXA 2CKDA 5JZOA 1P18A 2FUEA 2VSQA 3O90A 4P4NA 3ADPA 3IR7A 1PW5A 4OQEA 2WINI 3GL9A 2HQBA 2BRUC 2FVYA 3TOVA 5DRTA 6REQB 2W90A 3DZ8A 3AG5A 2X3FA 3UB3A 4RHFA 1FMJA 1G5FA 2HBRA 2IXFA 4NQZA 1T1GA 3SM3A 4X44A 4GZ6A 2C29D 1XTUA 2I29A 1HRDA 2AXNA 2PR7A 2M6KA 2JBAB 2J6IA 4ACAA 3IE2A 1NNI1 2IA5A 4AY4A 5FPQA 1JHRA 4LFBB 4FSHA 1NJ8A 3HCRA 4CMAA 2ZUWA 2ECFA 2RI1A 3NHYA 1KYIA 2X8BA 1NWHA 1RM4A 1ZW1A 2GUWA 2FN7A 2HHLA 5TEWA 3CNNA 4B3IA 4JV5B 3UHAA 5J4YA 2XOKA 4JT4A 3HXOA 2I9KA 1YTUA 5FWAA 3QG5A 4KZPA 1BW9B 4K46A 3BE5A 1X1DA 4RK1A 4BEWA 1E1RD 1X7XB 1EEHA 4IW3B 1HDZA 1K6XA 2EP7A 3W8NA 1RQLA 3D4PA 1X3SA 3E6AA 1PFYA 1DEXA 4K9NA 4AXXA 1K7SN 4ZEMA 1WY5A 1H9AA 5IUKC 3E4DA 3EBLA 2JRCA 2FSGA 3VSCA 3W6PA 4IHJB 1A8UA 4BRUA 2PUGA 4JS0A 4WVFA 1DKLA 1U0JA 5I4CA 5CUQA 1UZLA 2J9GA 4BE9A 4XX1A 2I8CA 4YT8A 4MHTA 4CTKA 4REOA 2D06A 2OQRA 4BGEA 2PL9A 2HD4A 1E1CB 4NIMA 1ZIPA 4MVJH 4YAKA 3RAEC 2CEKA 3E7DA 3F4LA 4A9AA 3R6WA 3S2YA 1A9RA 4R1OA 3K9HA 1UEJA 2JKYA 1L7VC 2TRSB 2VDPB 1G8SA 3F2VA 3T95A 1DJLA 5ALLA 3TSAA 1UJCA 1SVMA 2OZEA 2RC6A 2WJJA 1YJBA 1PWZA 2BLNA 5DWQA 4JC5A 1G66A 1RAAA 1VA5A 3Q5GA 4GP7A 3ZOZA 4AO8A 5CB4B 2JVJA 2BHNA 3GT4A 2NYUA 1MVOA 2QX7A 4HQRA 4G89A 1YMQA 4PEVA 3TRKA 3UMFA 2ZRJA 2ETXA 7ABPA 1R5BA 2BWJA 3I39X 2NG1A 3FPAA 3U0BA 4NBSA 1T2CA 1R0RE 2HSGA 4XWOA 1Z34A 1DL5A 3J7TA 1NYQA 1F2TA 3LOUA 1FCJA 1TCUA 1TW3A 5SYNA 4G9BA 5FBWB 5FR2A 2Q5CA 4KVFA 2V9ZA 3UCFA 1TYBE 1QQ5A 2I7XA 2W6PA 3UH0A 3K35A 2BTQB 3Q3EA 2QX9A 5H70A 3DTTA 3M6XA 3IMGA 1XTJA 5A3SA 1N33B 5A0FA 2QNBA 3DNMA 4Q47A 2ZYSA 2IOHA 2ODTX 4TN5A 1XZBA 2HWXA 1TGYA 2FZWA 3OZFA 3BH6A 4EH1A 1V7ZA 1Y5RA 2WNIA 1OAKA 2KJQA 3I83A 4LX0A 4RPIA 3ZJUA 3QE3A 4HYEA 3KUCA 1MC1A 3AZOA 1SA0B 1YZQA 1AKRA 3QXHA 4UZEA 5J2TA 1K6IA 2AUNA 3EIOA 1LWNA 4RANA 2I03A 5D3ZA 3I5UA 4TZ0A 1FRZA 1EEXB 4AK9A 2D6FA 1IVYA 4D6PA 1O3YA 2A1UB 1IHXA 1OV4A 3FUWA 3H7IA 1TT5A 1H1LA 2RMKA 2YJZA 2ZYAA 3KAQA 4EA6A 1ZI8A 2I54A 3RDPA 5CGZA 3OKFA 3LUKA 2V1UA 5IMBA 2P4SA 4ZCIA 1I10A 3L0DA 2EERA 3GLIB 4DLUA 3EVGA 2YQZA 4CIDA 3C8MA 4D8YA 2ZYDA 1WXIA 3L9XA 3NANA 2P9ZA 4HGYA 2JEZA 2ZE5A 2O8VA 1W1UA 3IV7A 2FPWA 3WGNA 3OEWA 4BN5A 3ZWXA 4KSCA 1VHJA 2EYUA 4Q3CA 3IKTA 1MX5A 4KE8A 4EG3A 1UP6A 4GGMX 5EE3A 1EDOA 4NICA 3C3XA 1DG3A 3ZY5A 2BUCA 2AA3A 3VMFA 1E0DA 5H9WA 4CQLB 1XK6A 1X3LA 4DVJA 4JKIA 3GZJA 5F52A 4K9RA 1EFKA 2CXHA 1BDJA 3GWZA 4ETWA 4EW3A 1U7TA 3U40A 5JZBA 4HTFB 3AR6A 4RADA 3QVLA 4BZQA 3QIVA 1PKEA 1GFZA 1I3OA 5L40A 3OT4A 4HWOA 2IUUA 4IL5A 2AC7A 1ZMXA 4HDSA 1YA6A 4RNDB 1RWMA 2RHGB 3CNBA 3EQ8A 1PE0A 4Q3NA 4YP5A 3UWDA 1VE6A 1PFWA 2HBYA 3W6ZA 2YRXA 1YE3A 5CDFE 4J3NA 1SA0A 2ISCA 1E92A 1EGMB 3SHWA 5KYTA 2IZ5A 1L4YA 1I9GA 1W5EA 4L9WA 2A88A 3SEFA 4MKHA 1LRJA 3MT0A 3IIEA 1LLFA 2XRMA 5JSQA 5DNYB 3QH4A 4JNCA 3KJFA 1JRLA 3GGJA 4M1QA 2UZ4A 5FTNA 1M6HA 1JHUA 1HETA 2VQSA 3JQFA 2VJPA 3IB3A 5HKOA 2JH3A 4JXXA 2Y76A 3B3QA 3QKTA 3AERA 3TPFA 4F71A 4DBVO 2UXDB 2JG3A 1A7KA 2Z2KA 2E4UA 1YBHA 1Z16A 4JVNA 1NR7A 2JAPA 5SY6A 1OZFA 4S12A 4YJ3F 4FNAA 1QAMA 2FJUA 1WV0A 4KJXA 2IGTA 4YEDA 1P6XA 2F2TA 2ZSAA 5AJHA 2X4IA 1IXKA 1MQ8B 1ZJZA 5G1PA 4LDNA 3ED1A 1XU4A 1JSCA 4BJ5A 1SQ0A 4LV8B 3MMPA 4HDMA 4RFSB 4XPZA 4XPIA 5AT1A 2A78A 3RS9A 3FAKA 4FYKA 1XTSA 5FTWA 4B2LA 1D2MA 1C9MA 3KUKA 4E7OA 1TQ2A 4LDAA 4LNUA 2VDRB 4J90A 4J0HA 1QH9A 2FR8C 2XAAA 1FNBA 2ZYGA 4BEVA 1P0PA 5TF4A 3I0NA 3QGMA 1DWQA 2GESA 4JA0A 1QHHB 1J9ZA 3LO5A 2X5JO 4GM0A 4XWKA 4CIAA 4D26A 1ZNYA 4DUPA 4QUKA 3ZDFA 4P5DA 3B2NA 5CK5A 4Z4IA 4P98A 3DWIA 1QK4A 4JBWA 5HDBB 4MZDA 3FMPB 4XFKA 2VJMA 4R31A 1P2UA 5B3AA 5BPHA 3D4BA 3TMAA 5JS7A 3LI2A 5EMKA 4P34A 1NVBA 4M9ZA 2R7AA 3HVUA 2OCYC 5BR8B 2JDIA 3T3IA 1QS0A 4GP6A 2BFNA 2E7ZA 4P22A 1KNQA 3W4JA 1MU0A 4YMSA 4ZWNA 4QOEA 5BOSA 2CVPA 1OZGA 1GU7A 2W6QA 1HE3A 1AV7A 2ZQZA 4FDLA 3PQ7A 4FOSA 1N4AA 1SKQA 2IWRA 4ENQA 5ITSA 4ZKEA 2EHDA 2CFTA 2QHXA 4NWIA 4TVOA 2R6R1 3RK1A 3WRYA 2BUAA 4I1VA 2BMDA 4B0OA 2UUAB 1NKTA 3RF7A 4EDHA 1FYEA 4RU1A 5IJ9A 3T3NA 2NTNA 2J46A 3WQSB 2HMVA 4I36A 5I48A 3O4GA 3IVXA 4L8VA 3OCCA 4ZOLA 1UM8A 2O3JA 2WTMA 1MABA 4OAPA 1ZN9A 1P5HA 4OBWA 3WB0A 3RBZA 3EGXB 1O5IA 5FYDA 2VQFB 2I62A 2I6XA 1P75A 4MLDA 1Y9DA 4QBHA 3H97A 1NVVR 3DFUA 3ORSA 3HO6A 5IK2A 3RFFA 4B7XA 1UWCA 2ECQA 5KTRA 5LKRA 5ALQA 2HJWA 1ZGCA 1ICIA 4BAGA 1SXJB 3NR2A 3L7OA 4MS3A 3TXAA 3SQWA 4LQDA 3H2YA 1Z0FA 4I46A 1L6IA 2O1WA 3M7IA 2FUG6 3K4HA 1MPXA 1XLTA 4ATNA 4YUWA 4RAQA 4TXJA 5L3QA 4GMDA 3SY8A 2H11A 4IEIA 2RGXA 1TF2A 3VAZA 4AJ1A 3M6AA 3PQ3A 3BCHA 4QTXA 1FW8A 3SWWA 3TX2A 4HNGA 4BB0A 4PN7A 1S6YA 1XELA 2B8TA 4XSVA 1YULA 4FZ5A 2RJ3A 2KHZA 4LK2A 3INGA 4INZA 3P2OA 4OOFA 1VE1A 3VNAA 1UK8A 1WU7A 3NZEA 2HF7A 4YDSA 2DHRA 4G5QA 1JPUA 2JGIA 2PUHA 5CM9C 4TM7A 3DT9A 3HBMA 4FYVA 1OWPA 3DXFA 6NULA 3PQ6A 3VVLA 1UJ6A 1ZPDA 1PX2A 1ADCA 3ZBQA 1LI4A 1A9XA 4ZQIA 2FPPB 3IDQA 4HK4A 2WF7A 4ND7A 4AVYA 2GZHA 1F0YA 3PXCX 3ZK7A 3UJ8A 1M66A 1U2RA 1RHMA 2X8WA 4MW0A 3DP7A 1P1JA 5EHIA 5CCDA 3SOZA 3DAFA 4E13A 1KK3A 3BSYA 1Z75A 2XQFA 1FP4B 3FCXA 3OKAA 1TAQA 3CRRA 3FKSD 3LCCA 4KU4A 4I50A 1XNJA 2PS3A 3AF1A 1AKMA 3O93A 3UBMA 3VR4A 2BMWA 2GD6A 2C4NA 3C2QA 5DOZA 3IAS1 1AUOA 1V39A 1C81A 2DWCA 3ZKWB 3AYZB 4BLWA 4RD2A 1O94A 2H8KA 1YS4A 1ORWA 2L19A 1VL6A 1U8CB 2MIIA 2VXOA 4S1TA 2F1IA 5C4GB 4MXDA 1GTMA 4JYCA 1WZIA 1PO7A 4W1SA 4KCGA 5I8ZA 2ZPUA 1ZRNA 3AKDA 1ZK3A 5H16A 2G9NA 3WGKA 4K9SA 1IZ0A 3ABOB 2ZPTX 3JWEA 2QVZX 3NKFA 4TGLA 3V8EA 1HYEA 1B15A 1ZZEA 2E82A 4C76A 4TTTS 1YB5A 2ST1A 3G68A 1QNLA 1SKMA 1MV5A 1RWVA 5JAOA 3COJA 1MX9A 4RHTA 1H9CA 1ULAA 4MMYB 4JBNA 1IUKA 5G41A 1IFXA 1PR9A 4B6SA 4CEHA 2Y1KA 2EW2A 4R9VA 3MWKA 5LMUB 2ZB2A 4B31A 1GU1A 2YIJA 1UMBA 1JFFA 3PTZA 1C7FA 3ZY6A 4H6WA 4E14A 2QT0A 3HCPA 4HAWA 1EK1A 2F3SA 2Z57A 3GPDG 1NXWA 2PLRA 5EXDA 3IERA 2QKYA 2SCUB 5EKDA 1T9DA 2F64A 3G0DA 3RWMB 1D1QA 1FF9A 1DDIA 2KLHA 3EASA 4C7BA 3AR2A 3OIWA 5L4SA 5TS3A 1GGKA 1NUQA 1O4WA 1VMAA 4RMIA 2JL1A 1RPNA 3IMFA 1OPRA 3EAQA 1DBIA 4HEHA 2C82A 1L0BA 1QWSA 2P3LA 1MLDA 3ESDA 3B1XA 3R8FA 1DFGA 3IUYA 2O3RA 621PA 1AKTA 4PX9A 2P77A 1RLTA 4QJ5A 3VYWA 1HT3A 2HKIA 4PVDA 1VIMA 4FOLA 2JFWA 4OATA 5EZYB 2XUHA 1ZGGA 4K8RB 3VTKA 3ZD8A 3OTGA 5EWJA 3FOAA 4BP3A 3L43A 1FTYA 5GIPE 2BCGY 3L0CA 1AZTA 4FOPA 1M73E 4CM5A 5AOBA 3WFJA 3GNTA 4EO4A 4A82A 1NUPA 2RHHA 4PFKA 2YOGA 1E0SA 1X1TA 3BDIA 4X3PA 2ZIXA 3I2IA 5EGNA 3EXIA 3DYIA 4II3A 2BFCA 4FCWA 3T7IA 3AM4A 4AM8A 3N3AC 5CCEA 1QE3A 2IYZA 3EGOA 4J7AA 3WMRA 2CLLB 1WXEA 1U02A 2IU3A 1NBME 3H5NA 1E8MA 4HNTA 4WK2B 1GLVA 2IEIA 4Q39A 1P4GA 1KJYA 2J87A 4OXQA 3GRAA 5TMBA 3CO0S 5JROA 1E3LA 2GT1A 2X7JA 4RTSA 2DH6A 1N7IA 1R8QA 4UVIA 3I64A 4TLEA 4DG9A 2H8GA 2W98A 4ZDWA 2RDMA 2HQRA 1UP4A 2DYKA 5TQ0A 2C8VA 5EE5B 1DHRA 2QSZA 4CM3A 4DABA 5BW8A 4RTKA 1PWHA 1PV4A 3C6QA 4C4XA 4NBWA 1DAPA 2JFNA 3TK1A 3U9LA 3HU1A 3TCXB 1AKWA 1GA4A 1MO3A 1ZK4A 2HRRA 1P8AA 1J8MF 1XD8A 3BF7A 5FAKA 2DY1A 2Q99A 3LF1A 4U5QA 2H48A 2QMHA 4G4IA 4R1TA 4TKZA 1GVNB 3ZXYA 2QXYA 4DDMA 4JJGA 5KNBD 2YFQA 4Q7JB 1JFVA 1MBZA 3U7IA 2ZJYA 4GMKA 1M8KA 2RHTA 4GBGA 2ZIUB 5EE9A 3UWOA 3ZZMA 3TRDA 3B3JA 1MVNA 4Z7OB 1AZWA 1USWA 4G5FA 1J49A 1Z8HA 2AC2A 2XVXA 2DSTA 4GX2A 1WA5A 4U7PB 5DM60 4AN4A 3D8TA 3DMNA 1KQGA 2OFXA 5ESXA 3CTMA 4Q3EA 4XYBA 4KN8A 1WMFA 3T5GA 5F98A 3ABIA 2FUNB 2DUWA 2GZ3A 4Y67A 4IQ0A 5FPYA 5ARCA 2DFNA 1S1CA 4U2DA 5TPWB 2GCPA 4DLWA 3IJEB 1I7SB 1JALA 5C8XA 2C5GA 4HLDA 5CPFA 3F9IA 3ORRA 3ZU2A 3DGFC 4I9UA 3VVCA 1LVGA 1J7KA 5IRCD 1XG5A 4LQLA 1WAMA 2CFOA 1U5BB 4X63A 1KBOA 2P41A 4G56A 1KSJA 2EIXA 4NV3A 1RPAA 1SM4A 3HL4A 2C0PA 1Z35A 4PLHA 5K0GA 4JGIA 2ZBQA 4TRMA 2GYYA 1N2HA 3TEJA 4E30A 1WR8A 3K70D 1YRAA 5L45A 3WS7A 4OHVA 2NXWA 7GPBA 2QVLA 1QZTA 3G59A 1SMKA 4O29A 2BP7A 4DCGA 2QT9A 3H2SA 1V41E 2WFMA 1FJHA 2YV1A 4L6AA 5T8KC 4EGJA 5JAIA 4C6SA 3OG9A 5ENDA 1YB2A 1PSDA 3K9QO 2E1RA 2G4LA 1FSGA 2XMRA 1AMNA 1FFBA 1ZICA 5SV2A 4F6RA 3WQQA 4ZU3A 2BGMA 3MTQA 4D98A 1OX6A 4KH0A 4DQVA 3FSJX 3KR2A 4CT4B 2NO6A 4DLVA 2DGDA 3NBQA 4M9SA 4WKGA 4G1EB 3INRA 1XXHA 4RJ2A 1YR9A 3CLSC 3IULA 2Q2OA 1DHTA 4KQMA 4RXTA 3AG6A 3GGPA 1FNMA 1V7QA 2HN9A 1B1AA 1RHQA 3CLRD 3FWHA 3WL7A 4EL0A 4ZGBA 1G1AA 4FXOA 4PYMA 2HPHA 1LSOA 1QO0D 1OD6A 3U2QA 1RBQA 9ABPA 3CVYA 3JATB 2C20A 3RUEA 1DRWA 4NOMA 3FHOA 4IRXA 1CC1S 4FNGA 4IFBA 2QUZA 5AW6A 3R7DA 1NI4A 4RK6A 3ADKA 5JJLA 1CE8A 1XTRA 2X77A 2PZAA 4W1PA 4GYJA 1Y7HA 1T5TA 4C0WA 2GBGA 2XZLA 5LMNB 1PR6A 3QWFA 2AZXA 4KQWA 3NONA 3CUSA 3PJEA 1J1ZA 4V0LA 2IIPA 4RD6A 1RPTA 3IUPA 5LD2C 1OI3A 4RV9A 4NFHA 1H6CA 4MA4A 4XIJA 3KOXA 1T3HA 2HV8A 4NF2A 4AZ0B 2YH2A 4XYLA 1RI4A 1L7AA 1Q2XA 1TMYA 2OWEA 4CKBA 4RKFA 4WZAB 1RKVA 3ZTWA 1MNQA 1R12A 1XX6A 3CCCA 4GPAA 4P2BA 4QL3A 4Y6PA 3FDXA 3BD7A 1ODLA 2WFAA 4NBTA 3QXCA 5H3LA 4AY5A 4OJYA 1JR4A 2PVSA 4JVLA 1QF9A 3HSKA 1SUCA 5J2TF 4CV0A 1WPXA 2C54A 3N53A 3QOWA 1JF8A 4BPRA 2NU6B 4HWRA 1M0EA 1XZCA 1ZSYA 2HLPA 1R5JA 1RJGA 4IXDA 4RF5A 3DMDA 2CXOA 4Y3UA 2XT0A 1CUFA 3B6ZA 3TQIA 4E5YA 2XV1A 2QMQA 2P9BA 5KIAA 3RLIA 2O23A 4LRQA 1YR6A 4UM9D 4KXYA 3IDZA 5EHGA 1E9VA 4JBHA 4GS5A 1FVOA 5I47A 1G8FA 4AKGA 3ECSA 3OOYA 4BNFA 3TGWA 4PR3A 3N70A 2DFTA 2HHHB 4EY7A 2F3RA 5LPNA 3AUSA 1IZYA 5BO5A 3ZNNA 4YJGB 4AX4A 1V8FA 3K9GA 3RKRA 4CHGA 3PX2A 1NUUA 2OTCA 1Y37A 1GADO 1T13A 1N25A 1ULTA 2VWHA 3IJPA 3T5BA 4D3XA 5TVKA 2VAVA 1LUAA 3CW8X 4W5TA 2JK0A 2AFRA 1QK5A 3U81A 5LMCA 3JD0A 3Q7RA 2VCYA 4E46A 4HGOA 1Q1NA 5ALGA 3HS3A 3KL4A 5E6SB 3HBAA 4BV8A 1UT5A 3DP9A 3ICPA 5ES4B 4TRNA 1NF3A 5L3VA 3OLZA 3ZUPA 5JH7B 5BMVF 4RKWA 1YZTA 1RMYA 2G6TA 2C5BA 2JB9A 4N4AA 5A7HA 4MUGA 3V97A 4ZDJA 3B1KA 2IBTA 4Z4CA 3HGTA 3SIPA 4DKXA 4L76A 4XD2A 2NADA 4H4EA 2J9YB 1NU8A 1OA0A 5ALVA 4RTOA 3TZLA 3VKFA 3BXEA 2WA1A 3RYFA 1GPYA 1AA6A 1UBLS 1FLAA 2PSEA 1MEJA 3G5AA 3DNFA 1XL0A 4NCJA 4O4HF 1KEKA 2CCGA 1DKNA 4RVFA 3SHFA 4YR7A 3VAAA 3MT8A 2VP0A 3CG4A 2Q4RA 2WJ3A 1PVDA 1Q84A 3KQVA 5DK6A 4AUKA 2RSLA 4DCTA 5K8UA 2NYAA 2HIGA 2BGRA 1P3JA 2I6TA 2QIPA 2PKEA 2JAHA 3RYCB 1FC0A 1HE2A 1EVYA 2PX4A 4JQZA 2MOKA 3MAJA 1JIKA 3ZWKA 2DUJA 2ZJ1A 1ZW6A 3KPYA 4IGIA 4OLJA 4TMVA 4UM5A 1WBBA 2GAIA 4PN3A 1F5NA 3PIIA 1SAYA 3C3CA 2OHXA 3UJ7A 4E88A 4MZXA 2QPLA 4ZANA 2VHYA 2HH9A 3EFHA 3PX7A 3Q87B 5GONF 4RGYA 1KAHA 5FOSA 1PFGA 1EX7A 3AI2A 4OHBA 4ITVA 4BU0A 1B16A 4S1NA 1Y4DE 3RS0A 4MI3A 4XB1A 3Q6NA 3Q3GE 4KOAA 3WMGA 3B48A 3W5IA 2BUBA 1KERA 4W7IA 1DTWA 2COUA 2XI4A 4TKUB 2DLNA 2ZYVX 4DNQA 3T52A 1XCLA 4HXEB 4M8KA 2WB2A 3PX3A 5CYOA 4P33A 1ZR2A 2FH5B 3FR8A 5I45A 3GJTA 3C5VA 3NYWA 1J9GA 3EXEB 1KP3A 5ENZA 1FY2A 1ONOA 3SEAA 2IDJA 3M9XA 4XLTA 4Q66C 3HUUA 4QREA 1A9XB 2CLFB 3C87A 1XJ0A 3IUJA 3NDPA 1EB8A 1DAHA 2EWMA 3BC1A 3GGSA 4LBVA 2UYQA 3B78A 3CRVA 1XT6A 3OM0A 5H9VA 5U1PA 3BJIC 4HUQB 4XGNA 1O0SA 3RM3A 5C5DA 3RJMA 1FZTA 5A9SA 3A6HA 1PUJA 4Z3KA 2P6MA 1T8RA 1AQIA 2IEAA 1PD1A 4HFMA 3CH6A 2IXGA 1NIJA 1MJHA 2IVFA 2V9CA 1UM9B 3KKMA 3QITA 4NU6A 4ZAXA 1N3LA 4H0CA 4D0LB 2VTBA 1PEAA 1XWIA 4CMJA 1CQIB 2IU4A 1DTEA 2IP2A 4XWAA 3VDXA 3FAZA 3WWZA 3FZYA 2WAYA 4ZVKA 2PZ8A 1E2UA 3VPGA 2V7WA 3AL2A 3BJRA 2C77A 3ZQKA 3FPLA 1NY5A 3HU5A 3OU7A 4RYDA 1VDZA 2LRHA 3D7KA 3Q2KA 4WY5A 4LMPA 4A0HA 1B8PA 1ZH0A 4BVGA 1I5OA 1R3UA 1ENZA 3R5FA 1XZPA 4WFJA 3Q1LA 1JDBC 4WLOA 2ZUBA 5L4NA 2CXRA 1H4SA 1YNOA 2II6A 2W2TA 3RHSA 4EB6A 3HUTA 1XIVA 1Z8FA 4L75A 5K3BA 3RVNA 2VP4A 4DZRA 3O8LA 4EITA 4Z9AA 3FETA 3C3PA 4HR7A 2H65A 2NZUG 2ZRQA 3FUCA 1RJEA 2HBQA 3U7QA 3WO1A 3FYHA 3OBIA 1JBKA 1T0IA 3M5CA 4FN5A 4MJ3A 5JSFA 3QE4A 5D5PA 3FYDA 2XCQA 1UC5B 4X1IA 4EJSA 1J6UA 1WP4A 4BMVA 5GM1A 1DQRA 1SD5A 3IAHA 4S0ZA 3FDFA 5JYEA 3U16A 2JLUA 3OHSX 4YCJA 2R97A 1KPGA 2C96A 3H0CA 4UEKA 3F6CA 4PG4A 4E15A 2Z08A 3GLFB 3FCOA 2RI6A 5C46F 5ADVA 3BWYA 4FR5A 3QV2A 2HWUA 1DI0A 1KYQA 1OFTA 4FC7A 4UMFA 3GJ4A 3I01M 4Q18A 2JD0A 2XR1A 1GCGA 2XUIA 3QEMA 3HBLA 2Q0XA 4PLVA 4YJFB 4BQQA 4CKXA 2WWGA 5B37A 3IEUA 1I36A 4ONEA 4ZT7A 4EHFA 1B42A 2J7KA 5IAAA 1YJAA 2R9VA 1KY4A 1VCHA 5IVHA 3AVVA 5C3MA 5HTKA 2P27A 4LVOA 4PO1A 2JGDB 2VPXA 2BMJA 2C2HA 2PT9A 1YQUA 2DQZA 2QAJA 5IN5A 3LA8A 3ZBPA 2BCJQ 3I30X 5BN4A 5BV8A 1IBLB 4EY4A 3OHPA 1TMOA 3PUIA 1HKHA 1RXSA 3C5WP 3E9RA 3MTAA 5DVZA 3IQXA 1BMFA 5IDYA 2WKRA 3WHKA 1FUYB 3ZE1B 2YASA 4CV1A 5IWCA 3O26A 2PKQP 5BURA 4GEGA 3TZCA 1RJ9B 1IJKA 1K5DA 1NOJA 5JSYA 1NW7A 2AFVA 3MGCA 4K7JA 3TDKA 2OBXA 2E2WA 4I55A 4KTTE 5ALJA 3WSWA 2Q1YA 1F8XA 1H42A 1QLWA 4B3TB 1I01A 2DPHA 2Z2ZA 2AW5A 1RACA 1Y42X 3I73A 5EKUA 5F5LA 2WJ6A 5H82A 3DAOA 5F1YA 3N8KA 2FW7A 1P19A 1QG6A 3KQLA 3MS2A 1D1TA 4N5MA 5CW2A 3X1YA 5DNCA 1UKEA 2D1FA 3VR6A 5KTSA 3MGGA 3RRMA 3CH4B 3MRTA 1BXGB 1I2DA 2C7BA 3W3AH 3ZBTA 2QYHA 4RKYA 4TXMA 5JYBA 2VH2A 1SVUA 1X7WA 1HQKA 4NV1A 1YDWA 2YUTA 3PD1A 2O7NA 2PKWA 5EINA 4EJSC 2YFYA 3DBRA 4JLPA 1FFHA 1WDLA 2JAQA 2Q5HA 3OQ1A 1G9SA 1JBQA 1QO9A 1XDZA 1NN3A 2VOJA 3OWXA 5CDFA 2JD2A 1T6ZA 5TGDA 3UMVA 1EP2B 3C7KA 2YWCA 3R0QA 4NZMA 1PHPA 2O8DA 3ORFA 3UMBA 1CF9A 4IFTA 1C3LA 4TUYB 1SG0A 4AP5A 3BD8A 1UZUA 1NURA 1RRMA 3OZWA 4PWYA 4F97A 3SE7A 2EYQA 4R98A 4YROA 1RQXA 1CP3A 1U7HA 3PI6A 4NARA 7MHTA 3AL3A 5F64A 1C1DA 4B43A 3E4CA 3CU5A 5EMLA 4D4LA 2IHNA 2MYUA 4QBGB 3UA4A 4DMKA 1OWNA 4B81A 1QJ4A 2J45A 4LBWA 1OU4A 3PDIB 4DIEA 4FHZA 1OXXK 2HDWA 3K09A 4QGGA 3PEVA 3VQTA