1DCMA

Structure of unphosphorylated fixj-n with an atypical conformer (monomer a)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
DYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
publication title Structural transitions in the FixJ receiver domain.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Transcription
total genus 22
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dcmA00
3VNAA 4JA2A 1JBEA 5HM6A 3ILYA 3MF4A 9ABPA 2L18A 3HK2A 2NT3A 2PJUA 4ETNA 1A04A 3QX9A 2YHBA 4JB2A 4MLCA 3LTEA 4MS1A 4RKRA 4XAQA 5CNIA 4FB4A 3H1GA 3Q41A 3GL9A 4O5AA 2ID7A 1QPZA 2FVYA 3FDFA 5HQJA 3KLNA 1A0OA 4RXMA 4Z4EA 3RH0A 1U2QA 3R0JA 3QX8A 4NICA 4ETIA 6ABPA 5ED4A 1BA2A 1CHNA 3KYJB 2NUBA 1Z2DA 3OLXA 5TPWA 1DCMA 1ZH4A 3CKMA 2R25B 5T3YA 5TQ2A 4M88A 4EYOA 4IILA 1CEYA 2VYCA 4MS3A 3QLVA 1FFGA 1JH9A 1RXIA 3RVJA 5T7BA 2M1ZA 1PNTA 3H5OA 4RK4A 3CZ5A 3NHZA 4RWEA 3TMYA 4RU1A 4F06A 2FMIA 5D2CA 4W5OA 3H5IA 3HCWA 1M5UA 1Z16A 2CWDA 4N47A 5BRJA 2HQOA 1VRVA 3H6GA 2MYNA 4RDCA 2JBAB 2QW1A 3FFXA 3OLWA 1RZRD 1F4VA 3N75A 1TM2A 2L17A 2MYTA 1JDPA 3H5LA 4KK3A 5C5EA 1W25A 1SXIA 5IULC 3BILA 4QYWA 3K9CA 3GT7A 5GQSA 1QKKA 3DZDA 3KLOA 4G0YA 3RVNA 1C4WA 4OLAA 4EVQA 3M6MD 5KC9A 3OQMA 3MMNA 3O2QB 3C6QA 1FFWA 2RDMA 3F7NA 1ABEA 4Q7EA 4B09A 3OQOA 3L6UA 1S8NA 3C97A 4XARA 3N0RA 5IUJC 4Q6BA 1BAPA 4G0ZA 2FKAA 3JTEA 4MQFB 4MR7A 4YGXB 2B1JA 3DLBA 5TPZA 3GBPA 4F11A 2AYZA 1FQWA 1URPA 2IPNA 3QLUA 1U0SY 4ZYLA 4MAAA 1JDNA 4N0QA 2LP4Y 5F64A 4E7OA 1NATA 2LIVA 3LUCA 5TPZD 2ZWMA 5IBQA 1H9CA 3Q7SA 2FEPA 3CS3A 2H3HA 4S04A 5EWJA 3IP9A 3NHMA 4MS1B 3IP6A 1JFTA 3B2NA 2GI4A 4XFKA 5KQLA 2V0NA 4RS3A 1QQAA 1QO0A 3I5AA 5FWYA 1USIA 4W5TA 5JNSA 4H3HB 1USGA 3GYBA 3O21A 3HDGA 5ABPA 1EWKA 2F8TA 1YK0A 3F73A 1FFSA 5TPWB 1NXPA 2LUOA 2PUFA 1XHFA 2FLKA 2LBPA 3OQNA 4NV3A 5TQ2B 4MS3B 2R48A 5TQJA 1JWLA 3G1WA 3CLKA 4MS4A 6CHYA 4KNYA 1EAYA 1OXBB 3GA5A 3OO0A 1DBWA 4Q6WA 3NNNA 4G97A 4P98A 3OMXA 2RJNA 2IPLA 1NY5A 2CD7A 1YS6A 2IYNA 1XHEA 2OENG 2Q5CA 5B3JC 5IUNC 2QSJA 3GV0A 2HQRA 3OM1A 3EGCA 5KWSA 3HUTA 3MM4A 3SQNA 1K66A 2NT4A 2IKSA 2R47A 3JY6A 1I3CA 1NXTA 4FE4A 4F3TA 3IP7A 5CNJA 4JOQA 1DRJA 4OG2A 3A10A 2W42A 1C0EA 2JK1A 2JVIA 3LFTA 4RY8A 5IEJA 1QNLA 2X7XA 3T38A 1TLFA 4ZPJA 3EODA 3N53A 3C3MA 3OO1A 1MAVA 3JPYA 3O1IC 1U04A 4JAVC 1QP4A 3SY8A 1Y1LA 1Z15A 2WJWA 4YCSA 5DKFA 4MR7B 4H3KB 4Z99A 3MYYA 2JVKA 2JB9A 4MQEA 4S05A 4QPJC 1JF8A 4W5NA 1L5YA 1JLKA 3T95A 4Z4FA 2GKGA 3OLZA 3OLYA 3JVIA 3KYIB 3IP5A 3TO5A 4HYEA 4YR7A 1A2OA 3SM9A 1U8TA 3I09A 1JX6A 5EWJB 3OM0A 2PUDA 4KRFA 1YK1A 4IGAA 1D2AA 4WWHA 3CFYA 1BVHA 5DGCA 3KTOA 3HDVA 5JS1A 5FWYB 4IMIB 2P4UA 4WXEA 3A0RB 4NCBA 5JNWA 1Z2EA 1ZDMA 1RZRA 1L5ZA 2B4AA 4W5RA 4NCAA 1OXKB 4H60A 3LMKA 2QVCA 1EWVA 1BDJA 3HXMA 2WB4A 2E4YA 2PL1A 2R4QA 4LE2A 1USKA 2IPMA 3RQIA 2E4XA 4MS4B 1ZGZA 4KQCA 2VUHB 1ZHHA 5TQ0A 3LUGA 3KCNA 3H1FA 5IUKC 3CRNA 1M5TA 3Q15C 5BR1A 1JFSA 1DCFA 3O2JA 4O1HA 1R8JA 1PNRA 3RVRA 4ZMSA 3A3KA 3CHYA 4N03A 2PUCA 1JYFA 1MB3A 1P6UA 3CU5A 1ZN2A 1AB6A 2PAFA 3EAFA 3F6CA 4GPAA 4JB0A 4LX8A 4Z9BA 1DCKA 5IEBA 2IDMA 2MYUA 5CNMA 5HKOA 1GCAA 4RY0A 2MSKA 2H0AA 3IDOA 4EVSA 3NNSA 4RKQA 4TLMB 4RXTA 3JPWA 1ISSA 4ZMRA 2DRIA 2ZAYA 3H5TA 1PUXA 4QYMA 4ETMA 4G0QA 1VPWA 1PEAA 4MR8B 4RK6A 4IRXA 4DN6A 1AB5A 4MGEA 5JS2A 3HV2A 1JL3A 2JRLA 2AYXA 3N6VA 2CHEA 3CG0A 4DADA 1Z18A 1ZH2A 2NZVG 4YLEA 2WY2D 1QQBA 3H5VA 2QXYA 3C3WA 2WMYA 3KG2A 3SAJA 3RVMA 1UDRA 2WRZA 4MQEB 4RK5A 1VKRA 3S99A 1NXVA 4YO7A 1Z12A 3QLTA 3E61A 4RZSA 3URMA 4LE0A 1LBHA 1NXXA 1NXWA 1E6LA 2IOYA 1E6KA 2PUEA 3G85A 2MSWA 3HS3A 4G0MA 3KHTA 2WJAA 3D02A 4HNRA 4WXMA 4LDAA 1BDHA 4MYRA 1M2EA 4CBVA 3DGFC 1SXGA 1D5WA 1ZY2A 2VK2A 1SXHA 1VLZA 1EHCA 1ABFA 3BBLA 3T8YA 5BRAA 3EDCA 2FLWA 3O1JC 4F8JA 3UUGA 2HSGA 2PKXA 4FE7A 1B00A 4Z9AA 1YS7A 3ROTA 1DC8A 2E4ZA 2QVGA 2A9OA 3EQZA 3MA0A 3BREA 3EULA 2J48A 3I42A 4JP1A 3H6HA 5KQMA 4JASB 3FFTA 1DRKA 3VNBA 3LUJA 1DBPA 2QR3A 4RV5A 1SRRA 3MQ4A 1DC7A 1PEYA 4Z4HA 1QMPA 3UK0A 1NTRA 2E4VA 4WZZA 3EJWA 3DGEC 5TQ0B 1YTUA 4L4UA 3NBMA 2I6FA 3RVPA 1LBIA 4RY9A 4Z4CA 2BGGA 3KKEA 3RVSA 1T34A 3GBVA 4LZLA 5DCLA 2FTKE 4QICA 3JS5A 1EWTA 4XXHA 4MR8A 3SNKA 5KI6A 8ABPA 2RJOA 4UHJA 3OLVA 4D6XA 4RK7A 4EVRA 2HPHA 3QEKA 3JVDA 1JYEA 1DZ3A 1CYEA 3QELA 5CNKA 4MR9B 4PEVA 4RSMA 3N0XA 3BRSA 4W5QA 5I4CA 3LUDA 3CG4A 5CHYA 2QZJA 1P8AA 3M9WA 1QP7A 1SD5A 1Z25A 2FMKA 1PHRA 3BRQA 3O1HB 4N76A 3QEMB 2QV0A 1ZGGA 4G0XA 4KQ9A 1E2BA 3RVQA 2OQRA 4EYKA 4KFCA 1GUDA 1MVOA 4RXUA 2F8SA 4YP9A 2A9RA 5JNRA 4EYGA 4YWHA 2QU7A 3T6KA 4OATA 2FEKA 4G0OA 4MRMB 4XLTA 3TD9A 4EYQA 1ZAYA 4HNQA 1RXEA 4LRQA 4PYRA 4TMYA 1QP0A 4OBBA 1GUBA 2PLNA 1P2FA 1DP4A 2L2QA 4HNSA 1HEYA 3EQ2A 1Z13A 5FWXA 2FXIA 4Z4IA 3LKBA 4OLBA 4KMRA 3L49A 3MIZA 4EGSA 2PUBA 2MSLA 3DBIA 3FMVA 1J56A 3Q9SA 4L85A 5EWLA 5FBHA 3N8IA 1LJUA 3HM9A 2M98A 4F12A 4LDZA 3LUFA 2JCGA 2PUAA 4LE1A 2FN8A 5JNUA 1D1QA 1RPJA 1Z17A 1GLGA 1F51E 4WT7A 4MPTA 4P1ZA 2GWRA 3ROFA 2E4UA 1KRWA 1APBA 2FQYA 3CZCA 3C3KA 4XASA 3O2SB 5FBKA 5KQPA 2MYPA 3N0WA 3HSYA 4EUKA 1KGSA 4Y9TA 5B3JA 3QK7A 4ZJPA 4MR9A 4GNRA 1JFVA 3M9XA 2N9UA 4YRZA 1ISRA 2TMYA 2FMFA 2PUGA 4Z4GA 5E3JA 4PZ0A 3LUAA 3UKJA 2GX6A 3QEMA 4IMJB 4YV7A 5C5CA 3TB6A 4EY3A 1TJYA 3LUKA 5EWMB 2NZUG 3QELB 1TVMA 3CNBA 3TX6A 2FEWB 1LK0A 4MRMA 4N0PA 3HUUA 1YMVA 5TE9A 3HO1A 2A9PA 2JVJA 2FSPA 3NNDA 3IPAA 4NQRA 3I45A 1ZVVA 4MLDA 2CHFA 3FFWA 3W9SA 3K4HA 1YVUA 3P9YA 1MIHA 1NXOA 3OMWA 3Q7RA 1BDIA 4PE5B 1D1PA 7ABPA 4D74A 1WETA 1TMYA 2FN9A 4KV7A 3DLHA 2XDYA 3CTPA 3GRCA 5PNTA 3QLVC 4ML3A 1GCGA 2P9HA 3RVKA 4RK1A 4DQDA 1D4ZA 1K68A 1MB0A 1DBQA 2FMHA 2FQXA 4WUTA 3KJXA 5GOTA 1KMIY 3RVLA 1YIOA 3KSMA 4N41A 4UHKA 3O74A 2LPMA 5JNVA 5FWXB 2A9QA 4KREA 2GBPA 1ZITA 2O20A 3LUHA 1LJLA 2PL9A 3O75A 3H5WA 3IPCA 4TN5A 5EWLB 1KRXA 2E4WA 1YMUA 1QO0D 2L19A 5IX8A 5KQGA 4G0PA 1DG9A 5KC8A 4OTZA 2JBAA 4KVFA 3D8UA 1P6QA 2HQBA 4IF4A 2YHAA 4KK4A 4G86A 1IIBA 4TLLB 2PMCA 5JNTA 1RNLA 4PICA 3H1EA 4KPYA 3LOPA 3E3MA 3H75A 1NXSA 2IPAB 1JHZA 4RK0A 5DTEA 3HZHA 4E7PA 3HVRA 2KYRA 1U2PA 2ID9A 3FGZA 5EWMA 4KZKA 1DJMA 1Z26A 3RVOA 1FSPA 1W9HA 1M2FA 3ILHA 4YS6A 5BQ3A 1ZESA 5DLEA 1EFAA 5HSGA 3Q7TA 4Z0NA 4MQFA 4O1IA 3GWGA 3A0UA 3F6PA 2FW0A 2FQWA 3QLUC 5IC5A 3SG0A 2WWVD 1E6MA 2HJ9A 2PE5A 3KS9A 2VUIB 3HJFA 1XWWA 2RGYA 4D6YA 3HEBA 3LKVA
chains in the Genus database with same CATH superfamily
1YXMA 3KKNA 2HSEA 2E5FA 2IYRA 4PC2A 2BGWA 4A6EA 1LLDA 3GLHB 3OQIA 3I01M 2PT9A 1Z8FA 2WSYB 3VPFA 2F90A 3QXGA 4ERNA 4JC5A 1ZM7A 5EA2A 5ITSA 1Q0SA 5I7FA 1AU9A 2CFRA 3KKLA 5L3ZA 2FVYA 2GOYA 4XB1A 2CL5A 4N6OA 3OUUA 4U00A 1MUUA 4M7OA 1QVZA 1ESEA 1WUYA 5AI4A 3AIMA 2MTBA 4YT8A 4DRYA 2Z2KA 2GN1A 3QYAA 1DO0A 5ICEA 1X15A 2FR0A 2ZYAA 4M1TA 1J70A 1H66A 3C3CA 4EDFA 3SBOA 3M1AA 1CR0A 2R7NA 3G5TA 4RZUA 2WUWE 1DKLA 2CK3A 4JFRA 1N8NA 3T7JA 1Z07A 3RVJA 2BP7A 5JROA 2O1EA 2O8FB 1WMAA 4NKRA 4Q9KA 2XDWA 4YJHB 1ZA1A 4GQBA 4K9KA 2XYPA 1YQUA 3H5IA 3U3KA 5K8JB 1HDRA 2FJ0A 4DXHA 1NMYA 3RIMA 3V7NA 3MJRA 1V4BA 1RYNA 2BR3A 4G5HA 3VSBA 3KJFA 1HDZA 1NC1A 1Z9BA 4OYLA 3SNHA 7REQA 4IEEA 1PGQA 3GAFA 1N6NA 1RJGA 4I81A 2ZJ4A 2AGVA 1GYQA 4HRAA 4YJFB 2LWIA 4FEEA 3I2GA 4TXNA 4NECA 5BV2P 1RR6A 3O84A 4XVUA 3WP0A 2C8LA 2FMTA 1SC6A 4QYWA 4DA8A 1RCUA 1HI9A 2O2JA 1Q16A 3PNVA 4HDMA 3FCEA 5AKHA 4DQLA 4ZI3A 1ESCA 3NDBB 1AK2A 4OLAA 3QEOA 3A70A 3SHOA 5A2GA 2X8AA 5G3ZA 1QAOA 1VPVA 1SB9A 1T0HB 1XDUA 2O2YA 3JYHA 3TGWA 3VV2A 3WVNA 3F4LA 3DH0A 3PD7A 2Q6LA 3JQBA 4B09A 4EFDA 3GLHA 1S8NA 1GRNA 2ZRAA 3JTEA 2W2MA 1JPVA 2O0KA 4GOMD 4MV3A 4R8MA 5JR3A 2FSUA 2HM7A 4LDNA 5FQNA 2FAXA 4JP8A 4EY5A 2ONZA 4JGIA 3P71T 5H82A 4ENWA 4R7GA 5DSTA 2QS9A 1QG2A 2ZSUA 4OM8A 5E95A 2LP4Y 3HWWA 5JASA 1PR2A 4KW7A 2LIVA 3HCDA 1H9CA 4QDXA 5GZ6A 1XZPA 2AX3A 3E4CA 2JF0A 3ZWBA 4EO9A 3CS3A 1Q74A 5L6LB 3H7IA 5EWJA 1XN4A 1H2RS 3AEQA 2G0NA 4DR6B 1XVAA 4MYUA 3IJEB 3QFCA 4M49A 2XWPA 3A6KA 5E2BA 1UBTS 1T13A 2HHHB 1VIMA 1X2EA 5JNSA 2ICAA 1QF6A 1MXHA 4BX9A 1A9TA 4S2UA 2OV6A 4YRFA 4DSOA 3SIRA 1AMOA 4BMNA 1ZNQO 4MK4A 4HF7A 1GPKA 2LIPA 3F73A 3K70C 2Y4OA 1OXVA 2R6AA 3MTAA 1CBUA 2Y2VA 4O8ZA 1Y5IA 2GTIA 2A94A 4E2YA 5M34A 1ENZA 1KNQA 4B31A 1UFKA 2ID4A 4HV4A 1HDEA 3VOAA 5KWEA 3EIEA 1DKMA 2X14A 4NY1A 3M9LA 1GGKA 1OU0A 2AOWA 1GPAA 2X13A 2BD0A 3F0TA 4LGVA 5CK5A 1P6XA 2X0NA 3RVBA 4OIFA 4RZIA 1N5LA 2QMEA 4JH0A 2YOHA 4ESHA 2FUEA 1X14A 3C3JA 3TD6A 1VSTA 2JGDB 7GPBA 4N3BA 4KKXB 1GQ2A 2IYNA 3ORRA 5CXSA 3RS9A 4BZQA 2ISCA 5IBCA 2R6JA 1Y1PA 1SBCA 1MW8X 1FQKA 4GP6A 5SZKB 3HVKA 3TLKA 1XZHA 2E3JA 1PQYA 4MVJI 5B64A 1I0IA 3COPA 3LFTA 1G21A 2XCQA 3EBPA 2OKCA 4JWKA 2G25A 1CZUA 2XNCA 4DG9A 4IOLA 1FTNA 3V7WA 3EODA 4D4GA 2Y3IA 5BNZA 1HT3A 1NVFA 5J2TF 2GFHA 5JDIA 5D1NA 3OPVA 2H2IA 1GDHA 2IZOA 2IXAA 4NG4A 3GZTB 1KORA 4Y18A 4B6FA 3MTGA 2JGEA 2D74A 2CXRA 2BONA 4N82A 4YI5A 2XKAA 5EQFA 1OAAA 1J9EA 1BO6A 1R6TA 3VOSA 2FU5C 4FN4A 4E22A 1N34B 2UXCB 4DG8A 1M8KA 1IN7A 2BISA 4B6GA 2V7GA 4U9UA 4K9LA 1DPGA 2V5UA 3MUOA 4X1KB 5I9NA 5JNLA 2CNOA 4TUYF 1UBCA 4OLFA 3SM9A 2PA0A 3OM0A 1CT9A 2XEDA 4GBGA 4N12A 3HADA 3RC9A 1M2GA 2KB0A 3F8TA 5SZJA 4U7GA 1ZUIA 3WDSA 3MCWA 2RHWA 2D7DA 2Z2JA 3T5GA 5B58T 2P2LA 4AD8A 3ZXUB 5DGCA 3TLMA 1L8OA 2YJGA 5K3OA 4CLXA 4JI8B 3MJEA 4J3FA 2P4UA 1V4VA 1OLUA 3DL7A 3ISVA 5B4UA 1IL0A 4MUFA 4U9IS 5J4KA 2JGDA 2PJZA 3O93A 2BVNA 4IJWA 4RMHA 3W2FA 1XZBA 1IZYA 3Q6NA 1W5FA 3C6MA 3WKDA 2ONJA 5K4HA 3PICA 3ZDAA 5DK6A 4UBMA 2IYQA 3HU5A 4HXEB 3KJIA 2A5GA 2ZITA 5E4JA 1A8UA 1EGAA 1FTYA 3TKLA 5F5NA 1TQ4A 4CQNA 1GAQA 3M6UA 5TS3A 3KCNA 1ULBA 3ND8A 4AS3A 3RI3A 4ZIRA 1OW3B 3QQPA 5HKBA 2R44A 2Q99A 2R5FA 1CNFA 3O2JA 1I7PA 2D62A 5EHQA 3AZOA 1XZMA 4Y1FA 1G42A 2Q2QA 5DNYB 1XKQA 4P4TA 2XMDA 1Q7CA 4MW9A 5KVCA 2WPNA 1P6UA 3IPRA 2B7LA 5ICGA 2ORWA 2C5FA 4P4LA 3D6NB 4OPMA 2H2GA 3D9QX 2WHEA 4N8SA 3S70A 3ZE2B 1A8HA 4RFVA 5UKDA 1DRUA 5CNMA 3P2JA 5I4IA 2NNLD 1PIWA 1L8LA 4I0WB 1I4LD 4ND5A 2AG5A 1NR7A 1LF5A 1Y4UA 3ZHTA 4F9TA 1C9MA 1JQDA 3UNXA 1IOLA 1KZYC 3AQ4A 3AI7A 4I4CA 3ZDXB 4HWKA 4FM9A 5DX0A 2GJ9A 4ALNA 4YIKA 4RYLA 4X1KA 2PS1A 5JE8A 5K3DA 3TXXA 4UMDA 3K5WA 4IX1A 4NU0A 4PTYA 1TTQB 4W9NC 4XIFA 3RADC 4PLZA 4DLNA 4CEIB 4LHSA 4ZI7A 4B48A 4RD6A 3H19A 1FSGA 3HJNA 3AR6A 4ND6A 3ROZA 4CMAA 1NXVA 3OECA 4EJSB 1Q84A 2VSQA 1M6HA 3K8OE 3HJBA 4KV9A 5FOXA 3ZI7A 4DLXA 5FEUA 2O1XA 3U1BA 2OBYA 1M0TA 4BNTA 3LP8A 2Y1DA 1FX1A 3VPBA 1IUOA 2LKCA 3G9QA 1J2UA 4H31A 3TJZA 4MUAA 4DDTA 1GL7A 1MNAA 3NYQA 4HNRA 5U4XA 2I4MA 3FGOA 2I9KA 4JOCA 2P0AA 1D2NA 1RM4A 4JVOA 1C0PA 2ZROA 5DASA 1IUKA 5GVRA 2FVXA 3AY3A 3BXFA 4PZCA 4WGGA 2FLVA 1U5BB 3UJAA 1PR3A 1D3AA 1XRPA 4RD4A 9GPBA 3ZNPA 2II6A 3RQSA 1I51A 3AHEA 1YJ5A 4KHPB 2FLWA 3SDBA 3O1JC 1H8ED 5CDGA 1U2EA 2GPYA 3FOEC 1XQWA 2B21A 2PKXA 1NUPA 1QH1B 1S4QA 1XWFA 1A9XA 1NLUA 4X8MA 4PGHA 1P5ZB 3HCRA 3MA0A 1G2OA 3MCVA 3TZEA 4RV9A 4BQOA 1U2GA 5BYAA 2HNKA 3OT1B 4MW2A 1NN3A 1C9NA 4P92A 5AM2A 3G49A 4N1AA 1PWHA 2YJ3A 3AEKB 4L08A 5L4SA 3MMXA 4QM7A 4JYAB 4ZCMA 1ADGA 3DEHA 4PXSA 1DARA 1QGOA 1NTRA 2QGFA 3FPFA 3G6KA 4EHLA 5A6SA 4HZUB 2GNAA 4CKZA 3IVAA 2DFTA 3AFOA 3MPUA 2ZVJA 1NX9A 4JKIA 3UENA 3AVVA 3AIOA 2LVBA 4DNQA 4IMRA 4JSTA 5J1TB 1J20A 3CZ4A 4CCAA 4OUKX 3PRJA 4Q3CA 1UQUA 1LTQA 4ZPXA 1QE3A 2I55A 4R5MA 1C30B 1M2VB 3SNKA 3AHGA 4R1OA 4D6XA 1P75A 4G41A 3EZ7A 3GI1A 1WKBA 1DZ3A 1XC7A 2BELA 4NK5A 1EUCB 1G55A 1GRQA 4K0KB 1MKYA 2ZIEA 4RSMA 1KERA 3N0XA 3TZLA 1YB5A 3CBGA 3FNGA 3LUDA 3NHSA 3WWCA 5F9FA 3CG4A 4OQLA 2WIKA 3IP8A 1QVRA 3NM5A 3LP5A 4LRYA 3FOWA 3C7CB 1ZGJA 4OGGA 4QGAA 5K99A 4DTCA 1T43A 1W5EA 3RUIA 4B1FA 3DKIA 2JHCA 4MV7A 1TU0A 2XMZA 5COAA 1QHHB 3C39A 4FSHA 1EWYA 1SUEA 2EFYA 2EGGA 3C7DB 1LC3A 5FBWB 3C43A 3D2CA 3UJ3X 2R1ZA 1FYDA 2NSJA 1G20E 4MRMB 2FCRA 3WLLA 2GRAA 2WOOA 3GEEA 1ZAYA 2YIMA 3L8HA 1T2FA 5EJ6A 3ODGA 4ZO6A 2WKQA 1YFLA 1TTPB 4FQ5A 4X66B 2YZ2A 1PL6A 1C4XA 4Z5XA 1PJBA 5JC1A 3UY4A 4W9RA 2QTVA 2ATVA 1ETHA 121PA 1WABA 3U0VA 5BQOA 1Z13A 4AYTA 4KXMA 3LYLA 1ORVA 1CEQA 2I80A 1CQWA 4OHXA 4KMRA 3CLUD 2GPWA 2HBYA 1Q57A 4RPKA 3OT1A 2PRYA 4CF5A 2WAXA 4EGSA 4L85A 4RF2A 4B3CA 1MFPA 1U9IA 3HEMA 3PC8C 4F21A 2EF0A 4U0JA 1TYDE 2CLEB 2CDAA 5JAPA 3CLRC 2WYOA 3DHYA 1QOQB 1S3IA 4PGMA 4B8WA 3IOBA 3NUGA 3GOHA 2YBEA 4I1RA 4AKTA 3Q7PA 2XNHA 2NXNA 4JVLA 4P1ZA 4CYMA 4LZZA 4BN5A 1TADA 1NY6A 1FUYB 1UBHS 1N6IA 2RHOA 2YCBA 4OAPA 1CUZA 1PGJA 4DLZA 1F3OA 5DM2A 1XMXA 1QK4A 2BDUA 3HLYA 4U2DA 4Z51A 2P3LA 5C4IA 4DR1B 2N42A 3SPXA 4M6WB 4X71A 3IUQA 3VDXA 4C7VA 5B3LA 1Z36A 1BJKA 1BTOA 4X20A 1W9MA 2BV3A 3HFSA 4LYJA 1DLIA 3T4UA 1EUCA 3CA8A 4QU8A 1AUQA 1ZXBA 2G0TA 3KD3A 1YBAA 4MQ5A 4U1RA 4UTXA 5IJAA 3OE5A 4DS3A 2GAOA 3EASA 4UUPA 4D3SA 3A9TA 2H51A 3AWDA 2V9PA 3PE6A 3AFIA 4F86A 1KO4A 2DHDA 2Y77A 3AHCA 1VHLA 1ISRA 2FWPA 2TMYA 2WU0A 1MEOA 1WAMA 5JTUA 5KHAA 2G28A 2VTBA 4TXLA 1FS6A 1K98A 1FTQA 3N7UA 1C3OB 2D0IA 3GCDA 4R1QA 5LBIA 5B1YA 5ITZA 1QGYA 1LLQA 2FSVA 4W1PA 4NMHA 5DZSA 5L45A 3RWBA 5FI3A 5IW8A 3RSQA 4PBSA 2RGWA 2ZSIA 4MI9A 4EY3A 1HNZB 4S3MA 3N59A 5CIWA 4R9SA 4YP7A 3V2HA 4F3KA 1E5LA 1V7PC 3W7BA 1KAOA 4TLEA 3DT8A 4ERXA 2IUYA 2IX9A 4MRMA 7AT1A 1KFKB 4EUHA 1YKSA 2BDEA 4B87A 1HPLA 2D59A 2LNDA 1JEAA 2BFEB 2GTHA 1XRSB 3AILA 5HIMA 2IIQA 4OHKA 4EMTA 4HD8A 3TVDA 1R2QA 3H11B 2CHFA 1XD2B 2PX6A 1OT3A 1BDIA 4MB0A 1HM5A 3GGDA 2Q9CA 2MSCB 3TS1A 3MWYW 1H8EA 3RKRA 2YDXA 1IHYA 3IAM1 3W5VA 2V7QA 3IRVA 3E9DA 3JAWA 2VHVA 2HMUA 5DBGA 4HWOA 5CVJA 3ULKA 3L05A 4C14A 1W1IA 3O0TA 1RACA 4W5HA 1B42A 3ZCUA 1C3LA 5FD8A 4JL5A 4MSUA 2ZRQA 1WCXA 4FINA 3R0IA 4AQ7A 3PC3A 2Z0MA 3ICVA 1Y6RA 3I9V1 4MVWA 1HL3A 5IVPA 2FG6C 2IEDA 1RVV1 4MTCA 4A0GA 1GOTA 1KEUA 2WJJA 2YVQA 3EY4A 4UDXX 4Y3UA 2ZSHA 4D8XA 1QO7A 4TWRA 4CTMA 1NYQA 1HYQA 2WVGA 3NUQA 4TN5A 5EWLB 1E5VA 1AKEA 3QI2A 3NRCA 3WLMA 3P9SA 5TJ9A 5IX8A 1U6IA 4FFSA 1RYYA 4QYSA 2O3TA 4D3XA 1DG9A 1YE3A 4DGSA 1WZIA 1IYZA 3B3FA 5EIEA 3U4QA 1FVOA 4KVFA 4ZC8A 1UKYA 1BE1A 1GN9A 5JSKA 1JU3A 1CUVA 2RKBA 5B7NA 1HRDA 2QX4A 3GDOA 1GPDG 1NMSA 2I29A 1C8VB 3UUEA 5DI3B 4F1JA 4OL9A 4TLLB 4TYPA 4ZHQF 3NTQA 3ZU5A 3O3CA 2RD2A 1HYGA 1Y3DE 2V9ZA 1FRFS 3KKOA 1K5DA 3LW8A 1Y3AA 1XX6A 2I62A 4KU4A 1U2PA 2ID9A 2BUCA 1N3LA 1EP9A 2ZI4A 2ZJYA 5AT1A 3RRMA 2PGIA 2XUDA 4QU9A 3TQQA 3A7DA 2XUZA 3N0TA 4LXGA 4Z0NA 1CPYA 1ECLA 3ET5A 1MGPA 1PU2A 1XDWA 3GWGA 3OG9A 2XVXA 3F7TA 1YGYA 3OI7A 1L8AA 4N18A 1Z4JA 1Z6YA 2WJHA 2F8LA 3H11A 3PTZA 2F6RA 2OBBA 2HW8A 2B20A 4K9QA 4LRSB 5HCIA 3AX6A 3B51X 2PV7A 1G7SA 1VRCA 1DWUA 3UKOA 1W44A 1P1FA 1F9EA 3BORA 1S2NA 1JNYA 5FADA 4FEYA 3VJMA 1TO2E 2DUNA 1WQ3A 1ZCFA 1N0HA 5CFNA 3IOYA 3EEOA 2OECA 2BBSA 4R9VA 2DKFA 4G37A 1KOLA 2CMFA 3V4ZA 4CT0A 1E18A 4Z4QA 3VR4H 3FFBA 4YASA 1HEUA 4PC3A 4EI2A 1QZ3A 2P69A 3HB5X 2PD4A 1XU4A 5ALUA 2XXJA 5JD3A 1KYVA 3T1OA 3UICA 2KW5A 1LQTA 3X2EA 4ETIA 1DC3A 4RCVA 5B37A 4DDUA 4WASA 1T8PA 4MLPA 4YRDA 1VHTA 2CCJA 3WBFA 5HZHA 3GDWA 5CBKA 3P52A 3PEFA 2Q0SA 3RC8A 2NU8A 1IHPA 4M88A 2SKEA 2C5EA 5C5DA 3SS7X 1KYIA 2RBGA 4DCGA 3ESXA 1XEWX 3BSSA 1RXIA 2ODTX 5HUJA 2WUVA 2OSBA 1BW9B 3HU3A 1XTVA 4I1VA 3NC1C 5EKXA 1V8PA 1U02A 1JIKA 2HA6A 4HGPA 3RREA 1Z16A 2YINC 3ZH2A 1Y9JA 3VHRA 1NZJA 1NBMD 2FMUA 2KE5A 1ISHA 1UMBB 5HF9A 1XDGA 1HQYE 4OUDB 3IUJA 4L5JA 4PR3A 5JWOA 2J5RA 1F4VA 1KIMA 3PNMA 3RG2A 3N2YA 3IULA 2EJUA 2DPXA 4OK5A 3EOAI 5A4AA 1U8YA 3FZQA 5AHRA 2BEKA 4J1TC 4M55A 1I2MA 4DCUA 1TKCA 1HZZA 4L02A 3TTUA 1VJTA 4AMGA 1N25A 4B73A 4YUXA 1JDSA 3Q40A 1VYTA 4HRVA 2R2AA 1C8LA 3I53A 4WECA 4WD3A 4DV6B 1EEHA 1JQKA 2BEJA 4DDWA 5C46F 1FFWA 5BO5A 2GM4A 3HN6A 1W4ZA 2I7TA 2F3RA 1G8FA 3GJ7A 3L7DA 1S2IA 4AKGA 4AVYA 4G1EB 3DM5A 4E12A 2X76A 3GJSA 3ZHRA 4R2MA 1VM6A 3W5BA 1N6LA 1OAKA 1ZWLA 3LX4A 2XRZA 5TPZA 4E5NA 3D3KA 1PJ3A 1IK4A 1ZH0A 3BQ9A 1PZNA 3DS8A 4LOHA 4PNEA 1DAGA 3UWOA 3K96A 4KDEA 4PCUA 3M8KA 4ZAWA 4EHFA 4ZYLA 4D25A 2ZPAA 1Z2AA 1UQRA 3W5JA 1NATA 1ZK0A 4JIMA 4UFPA 1Y9EA 4KWTA 4DB2A 4H6PA 2PLAA 1XA3A 3RO7A 3W79A 4KSYA 3VRHA 1CULC 4G85A 4WKBA 1T6BY 2E18A 2F2TA 4DMFA 2CLCX 5YASA 3U60B 3UB3A 1SHKA 1XCJA 4NOKA 3UMBA 5J5AA 3SSNA 4JJZA 5HFAA 2A5FA 3TBFA 4HX9A 5KBYA 2AZTA 1N2JA 1ZEMA 3PE3A 4H3HB 4IO1A 4AZ3B 2D3WA 3OKFA 4ZGGA 5IXJA 1ADYA 1JG1A 1FW6A 1WY5A 3B2EA 3QE2A 4HYTA 4YACA 5CW2A 1HTWA 3ESZA 5ENZA 2O6LA 4JGBA 5DHPA 2GD0A 1BXRB 2ZGVA 1UMBA 3ZH9B 1U0EA 4YHHB 1SOAA 1UANA 2GXUA 3AOEA 4OUDA 5CLJA 2W6QA 4EA8A 5T67A 2H1VA 3NCHA 3L43A 3BWYA 3PQCA 1YF3A 3IPLA 1H5NA 5EC8A 3GA5A 1LPMA 2QYOA 1IULA 1JT2A 3LUPA 4NIMA 5A3SA 1RWKA 5HX7A 1CUBA 1T10A 2CLMB 4NSNA 1Y5LA 4R84A 5JD5A 3CKKA 2Y0PA 3QVUA 4LPKA 2A0YA 4JHXA 5B3JC 5K0GA 1DKOA 2PX3A 4RTKA 1LDNA 1YL6A 2IEAA 3B5JA 1SHUX 3T7TA 1OFVA 1XLUA 1Q6YA 4D0LB 1IJBA 3SC2B 3AF2A 1QYRA 1M2OB 5ALZA 4YP6A 1P8JA 4NE9A 2FFHA 4TT8A 3IP7A 2ZJBA 2TECE 5AVOA 4J0QA 4HAOA 1IE3A 4FXPA 1T5IA 2F67A 5D1HA 3GEHA 2NVWA 2X4GA 4YJKA 4CODB 5IAEA 5ERXA 5IEJA 1XNRB 1LRLA 1S7GA 3EG5A 2JLAA 5E7JA 1XP5A 1QP4A 4HB2A 1FDWA 3OZTA 5TX7A 1X92A 3I04M 4ND1A 4C2AA 3A4TA 1TAGA 1SXJD 1EVLA 3KZMA 2QQFA 3AO0B 1UPTA 2MDTA 3ND6A 3P45A 5JDIC 3ZV4A 5AXDA 3M81A 2D1TA 5ITWA 2O8EB 4P54A 4RGBA 3RUEA 4DIKA 1UEXC 3MJTA 2CV0A 4JJEA 1MMFB 4GWGA 1NJSA 1M9NA 1XXHB 2O1WA 3CMCO 1NF3A 2JKVA 2YJ5A 2Q7DA 5A6VA 1GD1O 1CRQA 4FCCA 2G04A 2BKAA 3QWAA 2VP2A 3PQ3A 7ADHA 4KRFA 4HDKB 1KOJA 2EARA 4ITVA 2IZ6A 3RIGA 4KG7A 2HH9A 3W6PA 2FUG6 3T9DA 3SQDA 1M8GA 4EHNA 4AAYA 5ALVA 4ZO8A 3DFUA 3Q8WA 2DPHA 3GVXA 1NBMA 1KQ3A 2PYDA 1ULTA 2EU8A 4F3NA 4EJ6A 4ZTZB 1QCCA 3BHJA 4JY7A 1U0FA 3DTNA 2XOXA 3CJQA 2F3PA 4COOA 4EUEA 1QS0A 2HHLA 4XWAA 2GZAA 1A2BA 3SIPA 4B84A 4QAQA 2QVCA 5G0TA 3A4MA 3KR0A 2NXJA 4HFJA 4QGBA 4UC0A 2UUBB 3WNDA 3OF3A 1H85A 5E7QA 1KJNA 2FFAA 3Q5DA 3A3OA 3RAFC 3WQRA 4MS4B 2VF5X 4AUEA 3D6AA 5DDIP 4OI1A 1E8MA 1OLXA 2BFCA 1CE8A 3LUGA 4GT1A 1DQYA 1U3VA 4X84A 5B53A 2F59A 3B1XA 1AS2A 3K6KA 4AO6A 4BNGA 4C0AC 1E4EB 3HDQA 5AW0A 2PSJA 1TK3A 3EGDB 1RRMA 4DBZA 5I7OA 3V8BA 3P0EA 5BV8A 1VSQA 1D6JA 5DBIA 2P41A 2VDUE 3UGKA 1UODA 3QTLA 1WM1A 1V7QA 4D5GA 1TXGA 1TQ8A 4AM8A 3PZBA 1MG5A 1AB6A 1ZMRA 2PAFA 1ONPA 2PZKA 3BM5A 3DAGA 4MRAA 4P7JA 4Z9BA 5DXJA 5F73A 2IDMA 1V8OA 3ND5A 3PSAA 2F3QA 1OPRA 1H5UA 2CB0A 2QRKA 5C7LO 3S2UA 1P4HA 2QGZA 4RKQA 4YYEA 3CEJA 4MROA 4PR0A 4RXTA 3KSAC 2O8EA 3GLIB 1QFXA 2DWCA 4WK6A 2DSTA 2IYSA 4L0QA 3UK6A 4C7KA 4AQYB 3EPPA 1KO1A 3DLIA 4MVJF 3L7AA 4PXAA 1IVYA 1E9EA 1U0LA 1H94A 1Z18A 3JD2A 2WU8A 3C5HA 2GF9A 1KQPA 4YLEA 5AKKA 3AR9A 4ZCLA 2WY2D 4TMWA 2I3BA 3OIGA 2JIRA 1N2ZA 4IFIA 5B5SA 2EDAA 1UFRA 5L4NA 1ZM3A 4Q4AA 5DM0A 3TRFA 3DA8A 4F3YA 1PT7A 1E9VA 2GEFA 4DGQA 5BSWA 4FJ0A 3JW8A 3AVTA 4YDSA 1LBHA 1Z0KA 4QEZA 4JLAA 5LBUA 3KTAA 4MDYA 3LM8A 1SHLA 1K0UA 2JCYA 2P77A 1R50A 1EG2A 3PLNA 1PFWA 4GOLD 4XGNA 4RTMA 1Z4KA 1I80A 4OHWA 3FMOB 4CFSA 1U0TA 4H3VA 2FJPA 3DCJA 4HNGA 3U4AA 2ZPUA 4IQGA 1DJLA 3A1CA 3U61B 3EAQA 3HPRA 4KDCA 2Y6UA 3G6WA 2V6IA 3EMKA 2HJSA 1TM7E 4RF4A 1E9DA 3ODPA 5CTAA 2CNDA 1M1YB 3ZIAD 2WHXA 1KA9H 3D6FA 1N7JA 2R5NA 1YS7A 2DT5A 2R9VA 3V4SA 2QVGA 2E4ZA 5FX2A 1EK5A 1SKYB 4PLHA 1XTIA 3IUYA 1Y9DA 5JLJA 1TCBA 3EWSA 4ARVA 1PNOA 1H2EA 5AQEA 1VIVA 1WW3A 1A71A 2E0IA 3TVYA 3ZQKA 1DKQA 1RWBA 4DIMA 1CYDA 5JI3E 3I73A 3DMTA 1QMPA 4QODA 2V7BA 3EB9A 2NTNA 4WKOA 1VJCA 1J6UA 1EQUA 1UOOA 3EJWA 3IE2A 1ISJA 3JR7A 3OF2A 4GDMA 1YTUA 3QVLA 4QG3A 3U3ZA 3KKEA 2I78A 2OLJA 2FRXA 2I7DA 4R54A 4BYGA 1SXJA 3CLTD 3FWNA 3GARA 2K2QB 3GLIA 3BRWD 5BN5B 1VCHA 2GBCA 2DOKA 5CLLA 2FCAA 1QQ7A 1SEVA 4WA8A 4BJHB 1BOOA 3T9EA 2XNSA 2QU8A 4AJIA 4DQXA 2QMOA 3PJFA 2H1LA 1PG2A 3QELA 4I8IA 1O77A 3GRRA 2OUKA 1SAYA 4FWIB 2AN3A 4MR9B 4PC7A 4ALKA 5MFZA 1CJCA 1OE0A 1VSBA 2QN1A 2VPZA 4I14A 2GYYA 3OSUA 1XZIA 4J0GA 2CNBA 4J76A 3ZE1B 4B7ZA 4J16A 1G8MA 3E3NA 1QP7A 1P4AA 2VF8A 2G17A 5KSWB 2XUFA 4DA7A 2FXVA 4Q3LA 4QOIA 2FA9A 1YQXA 5BN3B 4Q3EA 3Q9UA 1YDHA 4YDHB 4JC4A 1ZGGA 1RSZA 1ACJA 3TIXB 2EW8A 4GRAA 4BL5A 4G0VA 1STOA 4YROA 4EUFA 4K40A 2VA9A 4MRPA 3IAHA 5SYAA 3HKCB 1HLGA 1KZGB 2C2MA 1PR9A 1AKQA 5HF6A 4G0OA 3WGNA 4BLUA 1BHSA 2GYUA 3V8QA 4M1EA 1NF8A 5G0WA 5LA6B 1PRYA 1L2TA 5TVGA 3TTSA 3FHJA 5B4VA 3AL3A 5BP7A 1H9AA 1YQDA 1KEPA 3EOBI 3IURA 1UZMA 3V4PB 4JI2B 1VBKA 2QM7A 2KPOA 1J1UA 2BM8A 1P61B 2VPXA 4MTLA 4ZT7A 3W2HA 1RBMA 4I1YA 4B9AA 2BTQB 5FR2A 3UWPA 1GEEA 3WLHA 4C01A 1IH8A 1W581 1T8RA 2I4IA 3KSZO 3B5IA 3NGXA 1VHQA 3PUHA 3FVTA 2IUTA 3MJVA 3M5WA 2X0EA 4LDZA 1ENPA 1YNOA 4C7XA 3A6JA 4JJAA 1V37A 3LQ2A 1U3FA 2H4WA 4OIMA 3VPAA 4KITB 5DLPA 1SCDA 3QBTA 1P73A 1QCDA 1VLHA 2JIZD 2H4XA 3AEXA 4KIUA 4ZJUA 3LXRA 1XYVA 3AJ8A 2OBFA 1XRQA 2FQYA 3IJPA 2Q5LA 2DR0A 2X40A 3GEMA 1SU8A 1O96B 1Z4IA 4CM9D 3H3XA 2MYPA 4Q4LA 1K86A 3ZCXA 1C7IA 4MICA 1R0YA 4AF8A 2VDPB 3RSSA 2G9UA 4EUKA 1KGSA 1RI2A 1D8AA 4L4ZA 3N2KB 3QK7A 1XOIA 4HB3A 2Q6IA 4MR9A 1ARZA 1CZHA 3PUYA 1E0DA 2YXBA 3LWBA 4CKYA 2XUJA 3ZS8A 3UUWA 2PXAA 1AQYA 4NBTA 1KFCB 4AN4A 5BV1A 3MRTA 4Q34A 1ZC4A 3QXHA 4FEAA 4OKNA 4Z4GA 3PA8A 1K27A 2GX6A 4DV1B 5BN3A 2OKGA 2UUPA 2JIOA 4Y1GA 5IANA 4OHYA 4D9IA 4CKEB 2IYZA 2PV0A 2JFOA 4GI2A 5H1YA 4K6MA 2A5LA 4A1FA 4BFZA 2PGLA 3GRUA 1IIRA 3TX6A 1CIPA 4LI0A 2X2OA 1D8TA 3DE2X 2PKWA 3PDHA 2O2IA 3A9RA 3PUVA 4M76B 1SA0B 3D2LA 3KP1A 1WW2A 2Q3LA 4MP6A 2YXNA 4MWEA 4PYKA 4WAUA 3JXEA 3K0CA 3KZOA 2AZ4A 2A5DA 1XEAA 4HWTA 1FFBA 3RTDA 5INTA 4Q9HA 2OYRA 2Y71A 3TDMA 1EE2A 2AR0A 2OHHA 4LDQA 3WNBA 3IBGA 5HRUA 1EZZA 5CVUA 1WETA 1R6DA 1THMA 1PZEA 2AFHA 2FN9A 3IKJA 4RD3A 1RRGA 1ODJA 2WU4A 3ZIAA 1O03A 4EG3A 1CZOA 2HC9A 4HDSB 3C7TA 4E2WA 4WXMA 4QJ5A 4R0MA 3Q87B 1E2NA 1JE0A 3WDKA 1UFVA 3O7MA 3HY6A 4C89A 4DQDA 4EZIA 5DNCA 1G5HA 2FQXA 1IPFA 1GFSA 13PKA 5TMBA 1DCTA 3ZCPA 4C4SA 2XD4A 3IDZA 3O73A 4YRQA 1QRUA 2P27A 3WZMA 3HCEA 3JD0A 4OK6A 1F8YA 2HLDD 4FLEA 1O97C 3HNPA 4CR8A 2VWGA 4U6QA 1GTJ1 2LCFA 1X2BA 4PBTA 4YRIA 1U1FA 1A76A 5CB4A 3VVCA 3N2KA 2BKLA 1UK6A 3BRWA 4LNHA 3E81A 3C4VA 5F7XA 3EX7C 1EGHA 1JXOA 1NVKA 2FB9A 4ZYTA 1J1IA 4YWJA 4AJKA 4KPYA 3AKDA 1GPH1 2HJHA 2GZ1A 1B8VA 1CP2A 3H75A 3F3MA 2BPOA 5LB2A 3VYUB 2GB4A 3HZHA 4AJHA 3L1HA 5KQRA 1J33A 3NBXX 3B12A 1F48A 3D43A 1BHQ1 2IIVA 1KEVA 1E2MA 2D5CA 2QRHA 3O8OB 4FXOA 8MHTA 5T3UA 2JS7A 4WX2B 3UFBA 1KIAA 4ISBA 1II0A 3HDJA 3GEIA 4TS3A 4NJEA 1PR4A 2O48X 3ZWWA 1ZMBA 2W2PA 3JYQA 5EMNA 5EHNA 3O47A 1UC9A 3KV1A 2N0SA 4CLOB 1NHGA 3UOGA 3GJ3A 4TTTS 2ZWOA 2DP4E 1ZKMA 3C70A 1LPNA 1MO5A 1YS2X 1ORWA 2JL1A 2VHTA 3KYDB 4L0DA 3NHFA 3ZI4A 4CMBA 3U16A 4KR7A 3DBLB 1MQ8B 1M1UA 4MVJP 2DQZA 3TD2A 5JCOC 1IQPA 4K28A 4MLCA 3KAJA 2D54A 3A7EA 4KYUA 3SC4A 1WHSA 1YZFA 2XQVA 3J7AC 2UUAB 4QQRA 4I19A 2YIVX 1C8BA 4J90A 4S0XA 4HX5A 4R3UC 4D98A 2JIQA 2QM8A 2V96A 3D54D 1J0CA 2C29D 1J4AA 1E1DA 2C4KA 4KIWA 4OU5A 1QMGA 1E2QA 1XJWA 3GGCA 3HSSA 1J9ZA 3UM9A 3WHIA 3P96A 5H3CA 4GSYA 1FJ2A 2JIZA 1TGVA 4LYDA 3S7ZA 2QVXX 5JSYA 1BA2A 2OAGA 4Y2VA 1ZMOA 3EDMA 1R37A 3K16A 4DQ0A 1SBHA 2NSDA 4MCJA 3O94A 5KTOA 4K81B 5E2IA 1CFJA 4CM9A 1JXAA 5BYKA 4A5OA 1C7JA 1U90A 3NYIA 3VZRA 1KWGA 1E77A 2PY6A 2PTHA 1F2TA 1C3EA 1DC4A 1GG8A 4I9HA 3RUHA 1O4VA 1IXYA 4WZBA 2W93A 4YK7A 1S0UA 3CN7A 1O8BA 3MTJA 1DDGA 3QUBA 1Z2NX 4B40A 4GXTA 1IM2A 2QLMA 2CF5A 2W2KA 1JJAA 3JSAA 3O8OA 4OXIA 4PM4A 1PR1A 5T41A 1HQCA 3VGPA 2Z5VA 3GRPA 5IF3A 1T2UA 1X8LA 2PCLA 3TZ6A 3FPKA 1Z06A 4BUJA 4XRGA 1RZRD 3PDWA 4ONEA 2DB3A 4HXFB 4AS1A 2MYTA 3GLFA 3Q85A 1NMZA 4HDNA 3ETHA 3KJHA 4R4JA 5FEMA 3WGZA 1ML3A 3KOUA 3UOAB 4D43A 3PCRB 5IULC 1MR3F 2ENWA 1E5QA 3IKLA 3K9CA 4OGKA 3D5EA 2IU3A 3UYKA 1SC3A 1SUSA 2NOAA 2W0MA 1VXRA 2ZJZA 3HB0A 3LX6A 1FYWA 3KYDA 4LHXA 5JAQA 2RC5A 1LWNA 2GPJA 4E1AA 3G2OA 2WB2A 1JFFB 3H9UA 2AC4A 1JAYA 4UM8B 2XODA 4YUYA 3CONA 3MT8A 4YGXB 2OCPA 1SCUA 3B52X 4AMYA 2EX0A 1X9IA 2DY0A 3D4PA 3FRHA 2C2HA 3C3EA 1ULHA 3T3MB 5JRJA 1IXRC 4DLKA 4D8UA 3OEHD 4AFNA 3A36A 2NYRA 3C0KA 3QUSA 4E7OA 4HZGA 1EZ4A 2MCFA 2G67A 1QU3A 3P9QA 2H3HA 4W82A 3ZHZA 3H3FA 1ID1A 2XMGA 3GVCA 3OPYI 1YI1A 2HLDA 4ZODA 5E4TA 3ORHA 5AR1A 3S44A 1QYIA 1Y7HA 4XFKA 3DPSA 2V0NA 1V1RB 5T4FA 1IQUA 3LPDA 4Q02A 4MDFA 1PK9A 3DM9B 3U31A 3CZMA 1IBKB 4J0IA 3IALA 3O21A 2GNOA 2GZDA 1C9EA 2F8MA 2I0FA 3A25A 5GADl 3ET4A 3MJCA 4RCZA 2BMJA 5KNCH 3OJEA 1BEUB 5HILA 5TY0A 5KOIA 3ZY6A 5IDYA 1QIGA 2BUAA 3GY0A 3UCXA 3KLBA 3VZSA 4WN9B 1A5SB 4US0R 1MOZA 1D04A 1N1MA 2VFAA 5K09A 3RYHA 2B3TA 2DQYA 4GPEA 3CGWA 4BEVA 1E7MA 1HO3A 2R6R1 2OV2A 1FVHA 1M1NB 1H2HA 1PZFA 1SU7A 1ZSVA 3V48A 2DG2A 3TL3A 3ELBA 3THWB 5AQ1A 3PFIA 2YMPA 2INGX 1E8DA 4HYQA 3U3DA 4QXAA 1PWZA 2ATCA 1E58A 1NYTA 1X7XA 2ZTMA 3S28A 4DIDA 1J22A 3WTBA 3E03A 4JLWA 3V1LA 1JR3D 1QLHA 3TCXB 3DDUA 1NLMA 2G5GX 2R47A 3K2QA 2X0RA 3R6LA 2ZANA 4M1YA 4A15A 1U5CA 2BMAA 1YJXA 2JC3A 3QVKA 2VAWA 2B69A 2QL6A 4OG2A 5CNJA 5KNCD 1KK3A 4PCVA 4LZAA 3P2OA 2A0WA 4RA9A 4DBVO 1TAQA 2ASVA 4H3SA 4OYHA 1GXSA 1PFQA 1Q21A 4RETA 1G38A 1U1CA 2Z98A 1CUEA 1JZSA 3IIMA 3FCUB 1Z15A 1MO3A 2EL7A 2VBGA 4WJKB 1W30A 3DR3A 3EGIA 4ZZ2A 5JMOA 3F2VA 2VDNB 3PXGA 1V6AA 4ZI5A 1Q0RA 3U26A 4BFVA 3SF8B 5MGNA 1R16A 3FVRA 1UKVY 5BWCA 3VAAA 2P4QA 2J9FB 3GPCA 3H5RA 4YCDA 1BGVA 1E1KA 1Z8HA 3CZPA 4L4XA 4WEOA 1W88A 3QZUA 2PKCA 3AFNA 3UBMA 3AVYA 4JLMA 2GM3A 1EA7A 2N47A 2B83A 1NBIA 4G1BA 4TQAA 5E3IA 1NWHA 1S96A 3AP3A 1PFGA 3ZV7A 3KDAA 4P6VF 1IY9A 2BE9A 5FO1A 4DL9A 3WISA 1OXSC 1QYVA 1TRKA 2PA3A 1FF9A 1IONA 5JWHA 3KZXA 5TMDA 1N6PA 4IMIB 1R0SA 3T5PA 1DBIA 1W6RA 2ADOA 2OBMA 4L8YA 2C78A 4YMWA 3F7MA 1M1NA 1M34A 1XKXA 3A1WA 3NHUA 1RZRA 2H6EA 1DAKA 1PTJC 2WJ6A 3T99A 3FUWA 2W48A 1C8KA 3R1IA 3GLHE 1I7DA 3MLEA 3OOSA 3E8MA 3HXMA 1JQ5A 5CDSA 1BG6A 2WHPB 2XW6A 3DL0A 1HDGO 1R6VA 2NU7B 4HUTA 5K20A 4FGWA 3Q3CA 2OUIA 5F9MA 1AS3A 1MX5A 4KQCA 2P79A 3AK4A 3BE5A 1G3UA 1Z6PA 2JBHA 3D1JA 2OHXA 3O92A 2H1OA 3C4JA 5IUKC 2XF8A 3LCRA 2XZDA 5H0IA 4DIBA 1RPZA 1BVYF 2AEJA 1WBJB 2P30A 3LVBA 1Z0AA 4CZ2A 4YP0A 5AUPB 3PFFA 1QWSA 3ZE8A 1CDOA 2AXPA 3ZDDA 1A9OA 1JDUA 4ZMSA 1D4FA 1GQYA 2GN2A 1BX0A 4NENB 3T3NA 5C4MA 4QPDA 4MMZB 4XX0A 2ZRMA 1HNNA 5EEGA 1UIRA 3EAFA 3LVFO 2O59A 5DI9A 1P0IA 5K8UA 3OEHA 3L9XA 1QIFA 4R1LA 5LQSA 3NTOA 2VT6A 4Q7JB 4GLLA 4RY0A 1OH6A 3KCQA 1Z62A 4EVSA 1MNQA 1AKNA 3F3YA 4HGOA 4YNBA 5BVHB 3QBDA 4PNZA 1I0LA 1WMFA 3UG7A 3PFKA 2AI3A 1NZFA 4F4JA 4ETMA 2ZYIA 4F4UA 1N5DA 5C80A 1KH1A 3V34A 1C7ZA 2JEZA 3FPJA 5F5LA 1W49A 1WTCA 1IY8A 2VLIA 1NVBA 4O4LB 5THQA 2V0GA 1L4MA 4AXBA 1I0ZA 2JFGA 3PCXA 2ZXFA 2WMYA 3LXMA 1M0EA 4BLOA 1B7GO 5JBQA 3OJFA 3RVMA 3Q7IA 1XCPA 2AN9A 4WNAB 2UVDA 3ETJA 1S2OA 2ZJ8A 3N8DA 4QBIA 3D0OA 2OA0A 4KQIA 3C6KA 4RH1A 1A7KA 5FOQA 1WBDA 3RSOA 4I7EA 5HIIA 3DKPA 3WYCA 4OHMA 5KU7A 3UJBA 2B0CA 2DHEA 4Y6GB 3DQQA 3PXUA 4JELA 1BN7A 2XDQA 1QB8A 4O4JA 4HVCA 4MUGA 1LSUA 3L6RA 2P5SA 1G5PA 3DGFC 3LQKA 2NU7A 2XTNA 1KDTA 4NEHB 2JHFA 3B78A 4RE5A 4TTAA 5K0LA 3CN9A 4JI0B 1FMFA 1FLAA 2D5BA 4MHOA 3M1IA 3VR5H 4DMRA 2G07A 1G21E 2IQIA 2C2ZA 1H2FA 2LDXA 2QM3A 1A4UA 3O26A 3R74A 4EA6A 4YCCA 2ONYA 3ROTA 1DC8A 4DJ5X 4RTLA 1JR3A 3FLAA 4QUBA 5ARCA 2PD6A 4BQPA 3I42A 4HSEA 5C8VA 1OAOC 5KYUB 5KYWA 1D2CA 1TZKA 2PCJA 4JASB 3AG5A 3IDAA 3OPQA 3TGPA 5KNCA 4HDCA 3GJRA 4DPLA 1X7HA 1Y3HA 3G7SA 4GPBA 4F6RA 3Q8KA 3IUEA 5JVDB 1KJYA 2VHCA 2R3SA 3B1FA 4PXYA 5J40A 2HMSA 5JPCA 2BMVA 3LQ4A 1XKLA 3JQFC 4MZXA 2O07A 1YL5A 3FZNA 5T8KA 4B75A 2NU9B 5KKAA 5BVHA 2EP5A 1GGJA 2YIJA 2CV1A 1RAIA 2XB8A 2YV3A 4XUDA 2FTKE 1HLDA 4C07A 3HKEA 2KBEA 2GEDA 1EFRD 4WOKA 1HX7A 1MN6A 2QN2A 3IC5A 3NHPA 1L7EA 5TS2A 4IV5A 4O4LA 1NIPA 1SN7A 2C9DA 1KC1A 2VYQA 3TZBA 3K8QA 1I5RA 1DG1G 5LXTA 2C95A 3EVZA 3R09A 5IJ9A 1MX9A 2C9YA 2CLDX 3FB1A 2X2FA 2XUPA 2WHYA 3CSDA 3IPYA 4N5NA 3T94A 4CF4A 1B6RA 3KWFA 4MEJA 3CF4G 2VRNA 1AXRA 1MW9X 5D5HA 4RIIA 3FNEA 3LD9A 2I6GA 3LC2O 1P5RA 1T6NA 3D0RA 3LVRE 1ZU5A 2OY0A 3FZYA 1L6IA 4NBWA 3V8VA 1E2BA 3T3OA 1JH8A 1V0JA 3RVQA 1UXIA 5KNBD 1BXGB 1SZDA 1JHMA 1L7XA 3BSYA 3L7MA 1NUSA 2A9RA 1KC3A 1QKIA 1UBEA 4MWTA 2V74B 4BNUA 5KMGB 3P1JA 1UJ6A 4P34A 3WBBA 2ONKA 4BPRA 1F14A 3BZBA 4Q3DA 4CKBA 1HYHA 2GILA 2FFBA 2HO5A 3ZX5A 4YAFA 3MWEA 2IYAA 3BULA 4B8YA 2XXAB 5CFQA 1QH9A 1YRHA 2L2QA 2NM0A 4ZVQA 1UT6A 2D13A 3DVAA 3LK7A 1HFJA 2YICA 5I7AA 2G83A 3PKZA 5CM2Z 4M54A 1X8KA 4CMCA 1YZNA 4FBMA 1H42A 3B1KA 2OCKA 3OHPA 2QK4A 3MXOA 3NWOA 2ERXA 4Z2AA 3LDGA 3PR3A 3TXYA 1EBFA 3HBJA 5E1BA 2VZ0A 4AC9A 2YJTD 2ZI7A 1E9CA 4QASA 3AEZA 3OC0A 4DJEC 5FIUA 4QUEA 1QIHA 3O4RA 2Z8YM 1DO2A 2B30A 5KYYB 2ZXUA 1AY0A 2EZUA 3L79A 4BVBA 3G2NA 2P40A 3OX4A 1YTLA 6REQB 4MPJA 4I5DA 3T5MA 4PTLA 5FV4A 1KY5A 2QM0A 4U8HA 3UMFA 5JRDS 3HSYA 3ACBA 3EGOA 5E9AA 5E1MA 4CTOA 4CCYA 3P32A 4ZU6X 3O82A 4WA7A 2P67A 1EFVA 2QTNA 2WTMA 4RY2A 1E1YA 5GJVC 3VI4B 4OXQA 5IZCC 3DJYA 3Q2KA 1GFIA 1QLJA 2WP8J 4GQAA 1FXSA 4M36A 1DEAA 4PHFA 5AVQA 2ZSFA 1LY1A 3ORYA 2PUGA 1X42A 3EF1A 3OOWA 4KO3S 4UAVA 5AJVB 5SY6A 4X3PA 4Q9IA 5E3JA 4C5BA 3U44B 1I4EB 2QD2A 1JQEA 3I6BA 1V3TA 4PVDA 3WB9A 1MH9A 1PVDA 3KC2A 2Q3BA 4QUGA 2VK1A 1BGWA 5HCUA 4KLZA 4UULA 4YRPA 1TEXA 1XQ9A 2Y66A 2YS6A 4P84A 4XPZA 2QUZA 3CNBA 4BDTA 4M1WA 4BZPA 4ZOCA 1ODFA 2ON6A 4FMCB 3G5UA 4IV8A 1YMVA 3DBOB 5TE9A 3O3OB 3WBJA 1I3MA 4MHSA 2GUGA 2NU6A 2CN1A 4ICIA 4N54A 1CIJA 3F47A 5CLQA 3TSOA 4EFKA 5ENVA 3CLSD 3CR3C 4X1YB 3H1BA 4R41A 2R7AA 1MIHA 3INGA 1VGVA 1LLFA 2B61A 2O1SA 2PUTA 2ZBQA 3WGKA 1J5PA 1VHJA 1W75A 5JCJD 5JI2E 1XQYA 2YFHA 1B8NA 1GZHB 4MI1A 5HK9A 3W04A 2Y0CA 4XKJA 1SFRA 2FPPB 2JA1A 2QTLA 4RL6A 5AK0A 4QUDA 5DW3A 5FJIA 3M5DA 1B4DA 2Z83A 4EGFA 4JQCA 4FK8A 5C3UA 1ZKDA 1PZXA 1KDRA 1WQ1R 2PXHA 5HBRA 5A02A 4MJ7A 3L04A 3QENA 4DC1A 1I10A 4DWVA 1ZUD1 1ZK3A 4N5LA 4JN6B 5ALOA 2J87A 4C0BA 6REQA 5KO2A 2ZZNA 3KPVA 2E4WA 1L1QA 1P72A 2WE8A 4I3FA 4II2A 5GP1A 3L1IA 4LS3A 3HVHA 1RLTA 1M3SA 4UUOA 5GV7A 3RC3A 3QVXA 3EYWA 4ADSG 1EFRA 1L1FA 2HQBA 4H7FA 3LT2A 2BH9A 1UMDA 2HMYB 2WK1A 1RWMA 4JYPA 1IIBA 5F7JA 4R98A 2BFPA 2RJ3A 3GMTA 1JHUA 2O8VA 2GFIA 1NW4A 2JCBA 3QFFA 4JSRA 5IN5A 5CFLA 3U44A 3FIUA 1RJEA 3V8EA 4D8WA 2QTHA 4E7PA 4EKGA 3NTUA 4TQGA 2XECA 5BPHA 2KYRA 4WESB 1W2HA 5ALRA 4KNWA 3FMPB 4X8HA 2DTDA 2HA2A 3L01A 4Q24A 5CT5A 5JFGA 3LOUA 3L6EA 3QSYA 2J0UB 1NP3A 3NAQA 4JLSA 4DQVA 5KNBA 2HPZA 2HDOA 4ER3A 2FQWA 2DUJA 1BQ4A 3IAXA 4LQCA 1E6MA 2RH8A 2IHYA 4YEDA 5DWVA 2HJ9A 2G4VA 3WJAA 2YASA 4CF3A 1NNEA 3AJDA 4YT2A 1L7NA 3ILVA 4D6YA 1L7BA 1SCIA 2C8KA 3FSEA 4TL8A 1B3RA 3EGVA 1GAEO 3AUAA 1PHPA 3J81k 2YZ7A 2PBFA 3EQ8A 1GITA 4P86A 1N2BA 4PZYA 1W5TA 5CNIA 4ZRMA 1JSZA 5A9SB 2O0MA 4AMBA 2WSBA 2E6KA 3H83A 4LY3A 2J6BA 3CRW1 1UKZA 4GSLA 4O5AA 3TDNA 2GN0A 5LZ4A 3VSCA 1NJ5A 4FFDA 5H3HA 1DMSA 4EUNA 1D6NA 3VOTA 2KLHA 3MQ2A 2FEOA 4ZREA 5IASA 2XQKA 3HCPA 1VMAA 2W70A 5ALDA 3LTNC 4C6TB 3R0VA 2O2GA 3NDIA 3ZCSA 3O8LA 3VZQA 2ZIZA 4ZK2A 3CJTA 4OHCA 1P80A 3OLXA 5HEKA 3C5EA 2JH8A 2X4IA 2AFRA 3AF5A 4XWTA 1SPBS 4QQ8A 4R8KA 3UIEA 4RJKA 1L4NA 4KGDA 1JEQB 2O3QA 1LLCA 2OCDA 2A30A 1GZ3A 1UWCA 1JH9A 4B3JA 3WGVA 1Y34E 1X7GA 2M1ZA 3MXTA 2AI2A 4KRYA 3U3OA 5I48A 1U2GC 4WFIA 5DH9A 2V3CC 1JR2A 4L27A 1TKAA 2EWMA 1WZCA 2N1MA 1VMKA 1I32A 4HO1X 4MVJG 4RU1A 3KKPA 5EZ6B 1L5KA 4Q4JB 2GCEA 4ECAA 1GQQA 2OGTA 1KSHA 2Q3DA 3DTVD 4Q4HA 1FDUA 4XD2A 2AC2A 5THKA 5KTKA 5KDOA 2CVZA 1Z5ZA 1Y5RA 2ZT7A 1P31A 1JHYA 1TA9A 3WWPA 1ITZA 1X1BA 3LQFA 5EGNA 4Z7JA 5BN4A 2VUTA 4V1CI 1EP2B 1SVNA 4D2IA 2J3EA 4COKA 1X7YB 3D31A 4KE7A 1YR7A 4BGDA 2ERYA 2ZYVX 3SJBA 5LQCA 4G24A 1FDSA 3UMGA 1GRVA 2H48A 1T5HX 1W4AA 3ZWKA 4G0YA 4HFNA 4LYYA 4EVQA 5AW2A 1BN6A 3ZHQA 2PR2A 4X54A 3EXAA 3I8SA 4U3JA 2RDMA 4WBSA 4YRLA 3JZMA 4IFEA 5BUZA 3DFZA 3W34A 4O2LA 5A0TA 4G0ZA 3ZZ1A 3QSGA 4EJSC 2HSJA 2ZIVB 2VAXA 3HMQA 3K15A 3QUAA 4MKXA 5EZSA 5K8TA 3IO5A 2FR8A 1IBMB 3I4CA 1WUJS 2C00A 3GIWA 3R5TA 2PFGA 3I8OA 3C1OA 4ABYA 4HXYA 4KACA 4TTQA 3RFTA 2YN4A 4B2PA 3JD4A 2VC2B 2ZBVA 4Q1DA 4WOBA 2HADA 2ZWMA 2OG1A 1OGIA 1SXQA 3THOA 1S6YA 2DPGA 2UZAA 3JWJA 5FOSA 4JV5B 4DSZA 4WLOA 4N7BA 5JYDA 4F4HA 1ZJ5A 1E9FA 3B2NA 3DBRB 4W5WA 3R6TA 3MTEA 4HQ6A 3PJDA 3N58A 4L0CA 1SVSA 2OOKA 2R87A 2EZ4A 1JAXA 1XNJA 2JI6A 3GQVA 2V97A 4UCFA 4XPIB 2QG6A 1UAGA 2PT6A 4ZI2A 3DTYA 3N74A 1JG7A 1PT9A 5CK4A 3VHQA 4P8RA 2QN6A 2V8OA 3EXIB 2FJUA 3R3ZA 3HMKA 1O54A 4FI3F 1AKTA 3KQNA 2IK8A 4QQKA 4ZVSA 1BYIA 4PQEA 2FWIA 4D96A 1JHAA 2XNJA 1H2YA 1QVVA 5TV2A 3BRCA 1F4LA 2LBPA 1G8YA 3GZJA 4QRHA 4ER5A 3RNOA 5IMBA 4II3A 3ZJTA 3TVTA 4E4TA 3SICE 2WLTA 1T0UA 1IZ9A 1HE2A 4K88A 1RQNA 1C2TA 5HBGA 4LOAA 2A5YB 2V59A 2AQIA 2V7UA 1RBQA 2XF2A 3BIWA 3DZFA 1WR8A 4RWZA 5LFAA 5IXSA 3HYTA 5J3JA 4M1KA 2O3RA 1GUFA 3LX5A 4P98A 1NDHA 4BHTA 3OEED 3EEYA 5HYVA 1E0KA 3QE9Y 2UUCB 2GCOB 4KGXA 4QFBA 2R7MA 4EG8A 1BROA 5IUNC 3PPXA 3L8MA 1N2IA 4FW9A 1P0QA 1BDMA 3MM4A 1Q0HA 1PL7A 2Z9CA 3L0BA 2CL7X 3N2LA 1CSEE 1HTTA 4FOTA 3TUZC 3MILA 4EABA 1YBVA 2W22A 3A14A 3P5BA 5G4KA 1VKJA 3WWYA 4R8RA 1JU9A 4OQMA 3GMDA 4LWOA 3L6OO 5GINE 3T38A 1TLFA 1L1EA 2H08A 1EM8A 1MEJA 1PT6A 2VT7A 3N53A 3IAAA 3F74A 1HE4A 3L0CA 3QOXA 4HEA6 2A59A 3D3EA 5DWDA 1YZKA 1Z83A 2GSDA 4MO9A 3GAMA 4NBUA 4CEJA 1ZD8A 4Z99A 2ZBGA 2Q8NA 2DBVO 4XLLA 1F5SA 4G1MB 4LVUA 1M74A 1UDBA 3SEAA 4F5YA 3BL8A 3H0CA 4Z4FA 3E1GA 2X5JO 3CVXA 2HLNA 2HIHA 5KJ1A 3JRXA 4WBNA 2HDNB 5CUQA 1RWXA 5JXJA 1Y7LA 4AZ0A 1D0IA 2GAFA 3KV3O 4G2NA 3IODA 4Y2GA 4I36A 2VKQA 5EIFA 5JJKA 1KJ8A 1Q1ZA 3FGPA 3JQ9C 1N6KA 1NOKA 4IAOA 4QO8A 5AKYA 5AW3A 4ACAA 1XL0A 4BB6A 4KQXA 5JXIA 1SCQA 3DTVA 5FWYB 1AMUA 1R4MB 4BAUA 2ZTVA 2I4RA 3IXMA 2P9QA 1B1CA 1LBSA 2LD4A 4IYRA 1ZGBA 4H4CA 2P6MA 1RZUA 4IJMA 3HTXA 4M9CA 1MLDA 1RLJA 2C7QA 1CUIA 1EGVB 4LHZA 5IYZF 3TG2A 1Y8ZA 2XUIA 4G8DA 4P5PA 3ZCQA 3RLIA 2KS6A 2JFPA 4PZUA 4LVCA 1NVDA 3ZD7A 1AZSC 1RHJA 3OPYB 4CDNA 5IKXA 2OGZA 2VBFA 3NOXA 1OWOA 3GLTA 3K8ZA 3GT4A 3RWOA 2YC2C 2AWNA 2NP6A 3MC1A 5IYZB 2Y1LA 1QF7A 4GICA 4K86A 1X7ZB 4P3XA 2GAJA 3PUIA 4KVGA 4ALLA 4BKPA 4E5VA 4KIFA 2WFZA 2ZUVA 5EG5A 3A9VA 1FPQA 3AHDA 3AEUA 1IPEA 1ZCJA 3COVA 3LLSA 3PA6A 4XGQA 1O5TA 3FYCA 4RH0A 4U7HA 4XTCS 1JI0A 2Q5FA 5B1IA 2IU6A 1USWA 1WU7A 4KI0A 4PSUA 3U4DA 4E5DA 5DBHX 1OA0A 4JB0A 1YU9A 2DJIA 1ZBDA 3EHDA 1NJ2A 4LX8A 1ZU4A 3RAPR 2HUPA 16PKA 2VF4X 3WXBA 1NW9B 2VJYA 3F5DA 4J2OA 4TX1A 3AH8A 4URHA 1W48A 1IXKA 3BDVA 2D8AA 2PZLA 3CR8A 4FYXA 4GC5A 4IFBA 1OIXA 2ZXEA 2RI6A 5KHLB 4IG9A 1XQ1A 1M0SA 1DAHA 3VH4A 2DZDA 2O5RA 3CNOA 3D6UA 3ZGVA 2GN9A 1P60A 1E2DA 3PYLA 1HFWA 4B43A 2VNHA 2QRJA 3RC7A 3ZCTA 1MCZA 3PL5A 3ZTTA 2H17A 3MWDB 4G4IA 4C6HA 4E5KA 4HPXB 3SAJA 1UDRA 4MQEB 3IE1A 2JGIA 4U9HS 1ZX1A 5AKIA 3SK0A 3VAYA 3R5HA 2A0XA 2B8NA 4ID3A 4BVHA 3OD5A 4IRUB 4RZSA 3RYFA 1ATZA 2ZETA 5EKDA 3MGGA 3IV6A 1U0BB 1G3QA 1E6KA 2BSQA 1UJNA 3D4OA 1V35A 4G0MA 2C77A 4PAOA 3VHXB 1EB8A 2WJAA 3FDXA 4YAIA 5KYGA 1Z6TA 2G63A 3L3BA 3W8NA 4H7IA 3KSDO 3AF4A 3EZYA 4YAJA 4NFLA 1UM9A 3OJLA 4X45A 1OI2A 1IM5A 1DIOB 1QFJA 2W4QA 5K6AA 2O2SA 3SS9X 3OEEA 4IDDA 4E5PA 1UINA 1U0GA 2HTFA 2QLBA 3P4UA 2EYQA 1N3YA 2WOJA 3DDZX 3R6GA 1X7ZA 3L84A 3Q5GA 2ENUA 4ZQIA 1KPIA 2IBTA 1E99A 4L8WB 3HKBB 4C0QC 3KKKA 1MVLA 2BFDB 3S3TA 1A98A 4GVPA 4UTVA 5AFSA 4DAOA 1LZKA 2CVQA 2O5VA 5F4BA 3UXEA 3ERCA 1N32B 4NJMA 3MTQA 1Y8CA 2BEUB 3NHKA 4CKWB 2OM6A 2DPLA 2CJPA 3L02A 4DZTA 1E7SA 2D8MA 1P5FA 2IU4A 3E9EA 4FFBB 4ZTUB 3ZV5A 2YQ4A 2PUVA 3IVRA 4M98A 4C04A 3UK0A 4BCDA 1D03A 2J5QA 2I03A 2WJYA 1EQAA 3F9CA 3QX3A 1GGVA 1EK0A 1U6KA 3OZAA 4V0OA 4C0LA 1CXZA 4KLCA 3CGGA 1HZZC 1AKRA 1XJ0A 3IV9A 5BW6B 2C88A 3E0QA 3U09A 5LLDA 5HNKA 2EGHA 1L5QA 3U37A 1ZRMA 1M2HA 5BNIA 3KDPA 4RK7A 3KELA 3A3PA 3NATA 4HNAA 4BE4A 5T6MA 1PFUA 1CYEA 2GVDC 3EEIA 3RODA 1MGOA 1GZ5A 2DUUA 2XGJA 1JAZA 4TN1A 5FBLB 4GMDA 2GKOA 2R65A 3M4JA 3K73O 4RVSA 4RULA 3MMSA 2JFZA 1H69A 4IXTA 4ON9A 4LZOA 4JMLA 1D6SA 2X0IA 3TB4A 1PK8A 2DTXA 5KYXB 4OFZA 3QKSA 3ONDA 5KDDA 4N76A 3QEMB 3EH1A 1K0FA 3QWIA 4YCLA 5FLYA 5DX8A 2ABWA 3K5PA 4OFXA 4RXUA 4R01A 2AE1A 1K8XB 1XMJA 5IVDA 3ZWMA 4YCNA 2E4AA 1B0UA 1N5RA 2QU7A 4OHVA 3QVWA 4AYXA 4KPGA 3RS0A 3D3NA 5DFAA 1Q3TA 4TKUA 4TL9A 3UJNA 4HQNA 4QPCA 4MITA 1X1DA 4HLQB 1B0AA 1G0OA 4N49A 4BO4A 4G4GA 4UQPA 3F98A 4PF1A 3V32A 3EY9A 3K5HA 2ETVA 3MWFA 4LXHA 4RVFA 1JHPA 1G7CA 1KHHA 1V11A 1INLA 2R751 3FMFA 4GLFA 5WRFA 5FWXA 4BY9E 3NKFA 2RGNA 3OZUA 3TX2A 3BMCA 2MMCA 1DKPA 3ZZUA 4OLBA 2BEUA 1J56A 3I5UA 1XNGA 3N8IA 1EKXA 2ZWPA 3EQ7A 3GFGA 2C4WA 3GLQA 1A8QA 2G0AA 2GLUA 4FFBA 4G25A 1OMOA 1RWPA 3J7TA 3U4GA 3CLHA 4ASUD 4TV8F 4TYNA 3AZPA 1RPJA 2DBZA 3HB9A 3TLBA 2XGMA 4D4HA 4DRXA 2QTFA 4MXDA 3G2KA 2WE7A 5JQWA 1JKIA 3TG8A 3BB1A 3V8PA 2C84A 1ZH8A 4LWZA 4F7DA 5CFMA 4DF3A 1VI6A 4EG7A 4MA4A 3BGWA 1DAEA 2WZCA 3R9XB 3MERA 3HP7A 4O02B 5KX5F 2WG0A 4Z9FA 3IPXA 5I7EA 1HY3A 5IBRA 4DFDA 4XQGA 2GUWA 1S5PA 2C2OA 1IWPB 3B9QA 1UAYA 4CM5A 4YIHA 3R24A 3ZK8A 5FDFA 2Z1NA 3AIKA 2MHCA 2PRKA 1FYXA 3L8ZA 5KX5B 1UKEA 1YS1X 1XZLA 3DR5A 3LSYA 3Q88A 3UHJA 1YCHA 1PFKA 2QPOA 1V1JA 3QEMA 3F5SA 1JHDA 4DJAA 4K8RB 2ZG6A 5C5CA 2FR1A 2RAVA 4JJGA 4YVFA 3IUNA 2AUNA 5FA5A 3VYRB 2VCHA 1NBHA 2BSXA 1NFRA 1LK0A 3KVYA 1MX3A 1V2HE 2V7TA 2R96A 2EWVA 1U2RA 4CL8A 2XUGA 5D3MB 2VPTA 4DSAA 1JR6A 4GLJA 5TT0A 2A9PA 2TMGA 1A72A 1RWQA 2E7ZA 2QN9A 2J45A 3IPAA 4KBFA 2XT6A 5BWOA 2P2ZA 1JFLA 2FOXA 3DYBA 1U9JA 2VDKB 4GLOA 1ICEA 1CETA 1DJPA 5H70A 3E2PA 7ABPA 2VVTA 1RLMA 3CVYA 1RQ2A 1EHYA 2UUOA 2IX3A 4P4GA 4TWZA 5LP6F 2WVAA 1NN5A 2GYWA 5DYTA 4PLPA 4ML3A 3PGXA 4PX3A 3PEWA 1P45A 3GJ0A 2P4EA 1AV6A 4AG6A 2XI4A 2HR1A 4M0EA 2G1JA 4GYJA 5GONF 1SHZA 9LDTA 3A4NA 4DLBA 4WJZA 4DQUA 4CPDA 3GLIE 2VDMB 4NATA 4GKKB 4EJFA 5B58C 2C4VA 1C14A 3KQMA 4RIFA 3DE7X 4R40A 1KYYA 1O6BA 4M7PA 1N57A 2FN7A 1CUXA 1N5OX 1YMUA 2L19A 1D1TA 2QSZA 3F97A 3L93A 4QELA 1SU4A 3LKZA 3OIYA 4DW8A 2C9BA 3FLBA 4ZHSA 2SBTA 4OTZA 2VCYA 4MVJE 1RYBA 5JAZA 5KJCA 4PFSA 1OFGA 2YWEA 4UHDA 5HE9A 4B7UA 4BLVA 1QV7A 1VJ1A 2HWXA 3H13A 1RLIA 3F4BA 4ZEWA 5K05A 4CMKA 5BSFA 3ADBA 2C07A 2A78A 3NWEA 1ZN8A 1R4NA 4ZCTA 2I2AA 4ODIA 1QZTA 4KZKA 4KMSA 4QOEA 5D86A 5EUQB 3U7QB 3CIOA 1SQ0A 2YYSA 2DMRA 3AJEA 3DC2A 2HI0A 4QD3A 5K3FB 5AVZA 3I1JA 4O1IA 4Q9DA 3RKSA 4LUCA 1M1YE 1I2ZA 3U3RA 2RHJA 5AICA 4H77A 1OX6A 2OD2A 3A6LA 1UXGA 5IC5A 4URVR 3N28A 1NW3A 1Y6QA 2OFXA 2GBIA 4E21A 2FEAA 1PYGA 1ND5A 2Q5EA 1GRCA 1K7EB 3GJTA 1AJEA 3SYRA 2QLLA 1JKFA 4IQ0A 5HM6A 2WD7A 3E7FA 3SVZA 2QGNA 2L18A 4WUVA 5AHWA 3FHTA 2Y27A 3PHHA 1C7RA 4C1NA 1Q6ZA 5M29A 5L3VA 4UTZA 4MAMA 3BFJA 5HQTA 1L6RA 1RZ3A 2VHYA 2ZRPA 4IHJF 4XGRA 4C4XA 4FOSA 4Z53A 1A0OA 1S9DA 2JGRA 2RBEA 3AB7A 4RE6A 3GJ8A 4ASUA 1U2QA 4QNNA 3R0JA 1LDBA 1Z4NA 5LD2C 4HI0E 1FFXB 2ZRKA 4BU1A 3MW8A 1CUHA 4XOUA 3WRXC 1CQIA 1MRSA 2OXFA 4CM7A 1YE5A 2N3ZA 3ENNA 3IQFA 3T1VA 5CDTA 2CYBA 4PRLA 4PIVA 2QL5A 1QG6A 3D8SA 5JANA 3X1KA 4IILA 1PSDA 2AOXA 2VYCA 1Y5MA 3DXXA 1WCV1 4KWIA 3EVTA 4ZYWA 4XQ9A 1SIBE 5F1KA 3ZHXA 3B38A 4AI6A 1PNTA 1A4XA 3JWEA 3K09C 4OB7A 4RDXA 1CUGA 3RYIB 3T7EA 4D26A 4KR6A 1NA5A 3TRKA 3QLJA 3VKVA 1L5RA 2DE0X 2GARA 3BF8A 1KDYA 2R7KA 5JZVA 3B36A 1LNZA 3Q3IA 4BIIA 2XVAA 4GZLA 3BICA 4I99A 1IZZA 3FTEA 1PZGA 2QW1A 2Q2NA 3IEPA 2JLWA 4R7ZA 4BXOA 2AF4C 3EPKA 4LFBB 5FV7A 3ID6C 4Y1RB 2YWBA 3OQBA 4F38A 2OCXA 1F2DA 2GDZA 4BLRA 1Q1GA 1OZAA 3CF6R 4B82A 4IDGA 3K70D 4XRRA 2ZVDA 3KQTA 3DZDA 3DAPA 4QVKA 1Q50A 3TZCA 3WXMA 2AZXA 1FL9A 3KJNA 2Q4EA 4RHTA 4CU5A 2SICE 2ZU0C 4FKMA 4KLNA 2WF6A 4B7XA 3HCCA 3D0KA 5J4YA 4D44A 1HE5A 2QJRA 4ROSA 3PEEA 3O8BA 4NNPA 5F2NA 2BEWA 5KAPA 4GI3A 3EVDA 3HBFA 3TH5A 1QQTA 4D4IA 1C9YA 1ODIA 2HY7A 3ENQA 3JARB 4JBHA 4PANA 4ZYYA 3DC7A 1AIPA 2ZYWX 2Z2YA 4KFUA 4PHGA 5F78A 3QNWA 2ZJ1A 3DEIA 5IBPA 1FQWA 4LMRA 4UM5A 1U7HA 5IJZA 4MAAA 2B35A 1N33B 1XZJA 4K6HA 1XQ6A 2VRWA 3C3AA 3HHPA 3LUCA 3QMVA 4WZAB 4PGGA 5CPFA 3RV3A 3TLAA 3ZDYB 1K9VF 2FEPA 4B76A 1Q11A 2M2IA 3NTLA 1VKOA 4QHSA 1KI6B 1JFTA 1AS0A 2VXCA 2CLOB 2FSHA 2OCYC 2YX1A 2PJDA 4OSOA 1B73A 3JYNA 2YWFA 4QLAA 3REGA 1D2RA 2O06A 5FL7D 2QP9X 4DCTA 4W5TA 4EK9A 3OQ1A 1QE0A 5L7TA 4K6OA 4CG1A 2XAUA 2HRCA 3DV9A 2WSSD 3AI1A 3HRIA 4U2CA 2FE1A 2VYND 3JQ8B 2W98A 2HRQA 4RGYA 4XWKA 4ENQA 5IF9A 5IC4A 1FTWA 3G82C 4PHHA 5M3BA 3K1ZA 4MB2A 3GGGA 4KNYA 1E3JA 3FAZA 3MD0A 1KQOA 5TSDA 2F9LA 3FH0A 4LBZA 3GVIA 3QW4B 1ENYA 1PN3A 2ZW9A 4OOFA 3UGJA 1XLWA 2RHBA 3CB2A 5C0OE 1W85B 3KQLA 1G1MA 3OFJA 3TIGA 3TPFA 4DY4A 4JUCA 2IZ1A 3TQHA 1KMQA 1XHEA 2OENG 1DTSA 2Q5CA 2WT8A 3D1LA 2X58A 4TM8A 1QPBA 1TQ2A 1SIUA 4QNMA 3K70B 1MJ5A 4NBRA 4R81A 3EG9B 2QZ9A 2ZSEA 2RGBA 4NMXB 1T0JB 4FJ1A 1UJ4A 2EOAA 1N2GA 2G06A 1V8DA 3KALA 1V5WA 2CB9A 1DRJA 4JODA 5F77A 3ROQA 3RVDA 4CNQA 1SH7A 2WM8A 2ZUDA 4NMWA 2I3GA 1E4OA 5I8ZA 2XBMA 3R77A 1R0RE 4LOIA 2I2FA 3KQUA 1JDJA 2WU3A 4HN4B 3ZE6A 4ZARA 2JAOA 3QPVA 4GSKA 4MV0A 1WCIA 2BMDA 4OQXA 3DOEA 4V1CB 1P2SA 2FW7A 1P0MA 1WL8A 2QX9A 5BVGB 1T0BA 2RK3A 4I5FA 5IP5A 2JVKA 3IERA 4KAJA 2ZOSA 5IARA 4FE3A 3P5SA 1O9GA 4WZBE 5BSKA 1XL1A 1JAHA 3MOGA 3OZDA 1ZINA 2REQB 4UU7A 3JVIA 3WJ7A 3IHWA 1XCBA 2J9YB 4B4VA 2IS6A 5LQDA 2D06A 4IP0A 4CN8A 4MKZA 5FHQA 3W90A 4JLBA 4V0ME 4CTJA 4CEHA 3OZ7A 1RHRA 4RKYA 3NIDB 3NHWA 1GSIA 4NE7A 1J8YF 1P0FA 1SVMA 5JFTA 2IE8A 5CXXA 1EFHA 2JGJA 3SDZA 4CTKA 3EQ6A 3MK31 3BDIA 2HHCA 1XZDA 3CWCA 1PNVA 1W85A 3NH9A 3NETA 3QF7A 4M1MA 4BQIA 3A2KA 4H60A 2BZGA 2JD2A 1HFEL 2IOFK 4IGEA 1QGUB 1ZJWA 5ALKA 4PLFA 2NPFA 1LS6A 2FPIB 4W99A 2ZATA 2AQHA 2FPRA 5DMHA 4BX3A 2E4XA 1VIDA 1NI4B 3FYUB 3NVAA 3V3TA 4QSMA 3A28A 1TIBA 4UXJA 1NKSA 4X1IB 4QXQA 3E7XA 4B44A 1WX1A 2GHQA 3KOMA 4X8OA 3TW6A 2OHOA