1DCMA

Structure of unphosphorylated fixj-n with an atypical conformer (monomer a)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
b'DYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
publication title Structural transitions in the FixJ receiver domain.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Transcription
total genus 22
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dcmA00
1JFTA 5DLEA 4MS1B 1VRVA 2H3HA 3IDOA 1YMVA 3OM1A 3DLHA 3O74A 3QX8A 1ABEA 1D2AA 1J56A 3KJXA 4YR7A 2QSJA 4ETNA 3KYIB 2FMHA 1Z15A 4RWEA 4D6YA 1FSPA 3LUHA 5PNTA 4LZLA 4KQCA 2F8SA 2A9RA 3OO1A 4OATA 1Z18A 3OM0A 3HV2A 4RKRA 4MS1A 4F11A 1B00A 4NCAA 4IGAA 2FQXA 1OXKB 1ZVVA 1ZESA 2A9PA 4KK4A 3CU5A 4OBBA 1GLGA 2WRZA 2YHBA 5E3JA 3W9SA 3GA5A 1RXIA 2PJUA 3JVIA 1DP4A 2QXYA 3C3WA 3QK7A 1NXPA 2MYPA 4JB2A 1ZAYA 3GYBA 3TX6A 4Z99A 3GBPA 1XHFA 3NBMA 4ETIA 4MR7B 5HM6A 1Z12A 3L6UA 2JB9A 3VNBA 5FWXB 3RQIA 4QYWA 3QLVA 3C6QA 4N03A 1BDHA 2N9UA 5IUJC 1KRXA 1JFVA 4KK3A 1YS7A 2E4YA 4UHKA 3HZHA 1L5ZA 2P9HA 4MR7A 4Z9BA 3OQMA 5FWXA 3E61A 5IUNC 4TLLB 1A0OA 1P2FA 2IPAB 3F7NA 1CHNA 4NQRA 5TPZD 2IPMA 3DGFC 4MRMA 3G1WA 4MS4B 4ZPJA 3HO1A 1FFGA 2IPNA 3OMXA 4IMJB 4RU1A 3EODA 3OQOA 3HUUA 4YWHA 3F6PA 4XLTA 3I42A 3H5WA 4UHJA 3NNSA 2RGYA 3SNKA 1D1PA 4RS3A 3FFXA 5TPWA 4PYRA 2HQBA 5JNRA 4MS4A 1QP4A 3A0RB 4G0OA 3O2SB 2IYNA 3M9WA 3HK2A 4CBVA 3KSMA 3C3MA 4S04A 4W5TA 5JNSA 1QNLA 3I09A 3QLUC 1QO0D 4N47A 1F4VA 1RPJA 3Q7SA 1YK0A 1CYEA 3NHMA 4RK7A 4F12A 6CHYA 4S05A 4ETMA 1ABFA 5C5EA 4MR8A 1MB3A 5FBHA 1JH9A 1Y1LA 1E6MA 3LUJA 2CHEA 3KYJB 3RVNA 3GT7A 2FEPA 2H0AA 1DCFA 3IP6A 4XXHA 3ILHA 3B2NA 3C3KA 1DRJA 2E4VA 1YS6A 5KI6A 1DC8A 3N0RA 2NZUG 5DKFA 2PUCA 2W42A 2MYTA 1DCKA 1A2OA 5KQMA 2PE5A 1TLFA 5BRJA 4Y9TA 3K4HA 3QEMB 3JPYA 4MLCA 1SXGA 2E4XA 3OLVA 3HCWA 4PE5B 4KREA 4Z4GA 5BRAA 4WZZA 3E3MA 4W5NA 3KS9A 1LBIA 1TM2A 4E7PA 3O21A 2TMYA 2FMKA 1PHRA 4RSMA 3HS3A 5F64A 1OXBB 3LUCA 2PUDA 1DBWA 1NXVA 3JS5A 4RK0A 2LP4Y 5T7BA 1EAYA 3H5IA 1MB0A 3C97A 2IDMA 4ZYLA 2GX6A 3RVPA 3HJFA 2IPLA 2AYZA 1PEAA 3IP7A 3CZCA 3DGEC 1PEYA 2PLNA 1DBQA 3MYYA 1ZITA 4RXMA 1NY5A 5CNKA 4MR9B 5HSGA 1S8NA 1QP0A 1SXIA 5D2CA 3O1HB 5JNVA 3D02A 4WXEA 4M88A 1NXWA 4KV7A 1D4ZA 2WJAA 2XDYA 3GWGA 4KFCA 4RK6A 2O20A 1SXHA 4MR9A 3MF4A 3H5LA 1U0SY 3LUGA 3P9YA 4MS3B 4NCBA 4NV3A 4LE0A 1VLZA 2RJOA 3H75A 2FW0A 1MIHA 1AB5A 4G97A 4TMYA 4YS6A 3T8YA 5TQ2B 3DBIA 5IULC 2FTKE 4LRQA 3MA0A 4O1HA 5KC9A 1TVMA 1E6KA 4MLDA 2R47A 3QELB 4MS3A 3CLKA 5BQ3A 2V0NA 5DCLA 3LKBA 3FDFA 5JS2A 3DLBA 2JVIA 4HNSA 3CZ5A 1JX6A 1A04A 3KG2A 5TQ2A 1E6LA 5IEJA 4ZMSA 1JWLA 2YHAA 2FQYA 2QW1A 4PICA 1GUDA 3OMWA 2B4AA 2L19A 4W5QA 4RV5A 3HUTA 3H1GA 1MAVA 1M5TA 3QELA 2Q5CA 4W5OA 3KLNA 4EYOA 2IOYA 4YV7A 2QR3A 1FQWA 3CHYA 1VPWA 3G85A 1GCAA 2FVYA 5BR1A 5JNUA 3M9XA 3HDVA 2L18A 1Z13A 4TLMB 2M98A 1M2EA 1APBA 4MPTA 1GCGA 2WJWA 5TPZA 3JVDA 2DRIA 9ABPA 2QVGA 1BDIA 1K68A 3KHTA 2CWDA 3QLVC 1YVUA 4ML3A 3OLWA 2L17A 4Z4FA 3QX9A 3LFTA 4DN6A 1EWVA 4MQEB 4NICA 2J48A 3UKJA 4OLAA 1UDRA 1JYEA 2F8TA 4PZ0A 1ZGZA 3RVMA 3CG4A 5HQJA 1BAPA 4Z4CA 2OENG 4LE1A 4XFKA 1FFWA 4KMRA 4JOQA 1DG9A 4XASA 2GI4A 2FQWA 2PKXA 1QMPA 4N41A 1DJMA 1DBPA 1JFSA 4N76A 2JCGA 1ZH4A 2FKAA 2HQOA 4MQEA 2PAFA 3UUGA 1QO0A 4IRXA 4KZKA 4Q6WA 2A9OA 1K66A 2JRLA 4MYRA 1FFSA 5FWYB 4F06A 1M2FA 4RDCA 1EWTA 2FMFA 2X7XA 2R48A 3FGZA 4Q7EA 1JYFA 1DZ3A 1JF8A 1ZHHA 2QU7A 2VUIB 4G0YA 3H5TA 4YO7A 4JB0A 3N0WA 1T34A 5FWYA 3QEKA 3QLUA 3ROFA 1U2PA 3OQNA 4EVQA 3T95A 2FEKA 4KNYA 1URPA 4Z4HA 1WETA 4F3TA 4EGSA 2PUBA 2LUOA 5EWJB 1RXEA 4Q6BA 1XWWA 1EFAA 2RJNA 4EVSA 3JY6A 3CG0A 3NNDA 5DTEA 5KWSA 3VNAA 1KGSA 4GNRA 3UK0A 1AB6A 3NHZA 5TQJA 4N0QA 3F73A 3O2QB 4P1ZA 5EWJA 3BILA 3FMVA 5I4CA 1D5WA 4XAQA 1USGA 1JBEA 3RVKA 5B3JC 1P6QA 2GKGA 3CRNA 5IC5A 1YIOA 3EGCA 7ABPA 1Z2EA 4MGEA 3MM4A 2CHFA 4G0QA 4FE4A 4D74A 2M1ZA 1H9CA 5IEBA 3BREA 5KQPA 3QEMA 2BGGA 5CHYA 2FN8A 2QVCA 1RZRD 3O1IC 1QQAA 4QICA 5DGCA 2WWVD 4IILA 3QLTA 1EWKA 3CTPA 4LDAA 2HJ9A 1C4WA 3OLYA 1M5UA 2ZWMA 1NXXA 2MSLA 2GBPA 1NATA 3A0UA 4PEVA 4EY3A 4EYKA 2LBPA 1BDJA 1QP7A 3D8UA 4WUTA 1TJYA 1Z26A 3LUFA 5TQ0B 2PMCA 4MAAA 5KQGA 1Z25A 4KRFA 1C0EA 5CNJA 3A3KA 2NT3A 3BRQA 3GV0A 3MIZA 3NNNA 4Z4EA 1U2QA 4WWHA 3IP5A 4EYQA 5EWLB 4YP9A 4OG2A 5JS1A 2HSGA 1L5YA 5TQ0A 3MQ4A 1LJLA 2IKSA 4QYMA 5TE9A 5GQSA 1USIA 3H5OA 3IPAA 3EAFA 1ZH2A 3N6VA 1XHEA 3FFTA 5FBKA 3A10A 3O75A 4LX8A 1JDNA 3TMYA 4Z9AA 1GUBA 3SQNA 2JK1A 3EQ2A 4OLBA 5EWLA 3Q15C 2WB4A 3LUDA 4F8JA 4EVRA 1BA2A 1Z2DA 4RK1A 4WT7A 2NZVG 3OO0A 5IUKC 1TMYA 2WY2D 3K9CA 4G0MA 3CS3A 2FEWB 6ABPA 1P6UA 1ZY2A 2JVJA 3HXMA 5KC8A 4B09A 1QQBA 5IBQA 5IX8A 4RY8A 4RXUA 2FMIA 2RDMA 4KPYA 1PUXA 3EDCA 4O5AA 5KQLA 2FLWA 2L2QA 3N0XA 1QKKA 1NXOA 3LKVA 2CD7A 1E2BA 5JNTA 1U8TA 1W9HA 3HDGA 2R25B 1NTRA 3TD9A 5CNIA 2AYXA 4EUKA 4Z4IA 3OLXA 2HQRA 3LMKA 4RY0A 1KMIY 3IP9A 2PUGA 1JL3A 3GBVA 3HEBA 4RK4A 3SM9A 3GL9A 1DCMA 1R8JA 1YTUA 2ID9A 1ISRA 3L49A 2LIVA 2FLKA 4ZMRA 3SY8A 1RNLA 2VUHB 3GRCA 3HSYA 3LUKA 4LE2A 2QV0A 4MRMB 3ROTA 3RH0A 2FN9A 2A9QA 3IPCA 2WMYA 3S99A 3KLOA 4DQDA 2R4QA 1JHZA 1PNRA 4DADA 2MSWA 4JASB 3M6MD 4XARA 3RVLA 2E4ZA 2P4UA 1SD5A 3ILYA 5TPWB 3JPWA 2FXIA 2I6FA 3Q7TA 3KCNA 4RK5A 4GPAA 3N8IA 2PL1A 4G0PA 3RVJA 3SAJA 4JA2A 5C5CA 2E4UA 4O1IA 3KKEA 4Z0NA 8ABPA 4H60A 4OTZA 3H6HA 4KVFA 4L4UA 3TO5A 2PUAA 2JVKA 3LTEA 3CKMA 3HVRA 2FSPA 3T6KA 2PUEA 4MR8B 1ISSA 2NUBA 1DRKA 3EULA 1EHCA 3Q9SA 3R0JA 5JNWA 4MQFB 4RXTA 4HNRA 3BBLA 1Z16A 3BRSA 3N53A 4JAVC 3RVQA 3JTEA 4L85A 4RKQA 4YRZA 4RY9A 3CNBA 4LDZA 4YGXB 1KRWA 1F51E 1NXTA 1W25A 4MQFA 3RVOA 2LPMA 3KTOA 3T38A 1LBHA 2ZAYA 4N0PA 3TB6A 1CEYA 4H3HB 2ID7A 5GOTA 1ZDMA 3RVSA 3Q41A 3OLZA 4WXMA 2PUFA 3LOPA 3RVRA 1D1QA 4H3KB 4QPJC 5CNMA 3CFYA 1RZRA 1HEYA 2HPHA 5T3YA 2OQRA 1Z17A 5B3JA 2MYUA 2MSKA 3FFWA 3H6GA 4E7OA 4EYGA 1JDPA 1NXSA 1USKA 1ZGGA 1SRRA 3MMNA 4FE7A 1MVOA 4G0XA 2KYRA 1I3CA 5HKOA 4YLEA 2GWRA 3I5AA 5EWMB 1BVHA 1LJUA 2B1JA 2PL9A 3LUAA 4IF4A 1QPZA 3O2JA 4JP1A 3N75A 2E4WA 4P98A 4G0ZA 4W5RA 3DZDA 4RZSA 1ZN2A 1YK1A 2NT4A 2VK2A 1VKRA 4HYEA 1DC7A 3H5VA 5EWMA 3Q7RA 2VYCA 2JBAB 2MYNA 3EJWA 1PNTA 1YMUA 4HNQA 3O1JC 4IMIB 4ZJPA 4KQ9A 4D6XA 5ABPA 4FB4A 3URMA 1P8AA 3EQZA 3F6CA 4TN5A 1IIBA 4G86A 1U04A 3HM9A 4YCSA 1LK0A 3H1FA 3H1EA 3I45A 5ED4A 2JBAA 3SG0A 2QZJA 1JLKA
chains in the Genus database with same CATH superfamily
3WDSA 3L02A 4RQBA 2OBLA 2V7GA 3W9UA 1XTQA 2OESA 1ABEA 3Q7PA 4NE2A 3JQ7B 5U4QA 3USES 1L7AA 4IV0A 1MC1A 1N1GA 4J9UE 1Z4MA 3NEPX 2GZRA 2YN0A 1BD3A 4BL5A 4D5EA 2B5VA 2DBRA 1VC2A 3ENZA 5AJZA 5J2TF 1JAZA 1JG3A 3ZZUA 3BIJA 3PEWA 2YOFA 1GZ4A 4GM4A 1GSIA 3DYBA 4P53A 1NLFA 3MK31 1F4PA 4C03A 4GXRA 1BMFA 1IHXA 2HKIA 3IT3A 3OKFA 1HWYA 4W9NC 4LV8B 1QK5A 3FF1A 2P62A 5FBZA 3U3JA 1OVGA 3M33A 1R12A 4BJ5A 3MMXA 3WYEA 1BCSA 4ZU6X 3VSBA 1ZM2A 4RETA 1G3UA 5G0VA 1N0VC 1E69A 1NULA 3DHVA 3F3YA 4LQLA 5KAMA 4EHBA 1YCGA 1C41A 5BUSA 1C7IA 1HT3A 4FCVA 4A8HA 4HLCA 1AURA 3LPDA 3PHJA 3PFGA 1N7GA 4Y2QA 1I4EB 2P11A 1FLDA 3KE9A 4HSEA 3LBAA 2VDUE 4MW4A 5AYVA 5DYYA 1YCFA 4KQXA 1JFVA 4IUYA 1N77A 4H3SA 3ADDA 3UAGA 1XXHB 5BQ5A 4XI9A 4Q3EA 3HZHA 4K0RA 4YJGA 4JR1A 5KYGA 1IWOA 2B99A 1S9HA 1ULBA 2ACKA 1E2NA 4OAPA 1GUZA 2Q46A 4CPDA 2CYAA 4RD0A 4DNQA 4L2IA 1XO1A 4J4TA 4Z4QA 2CDBA 2QVLA 5ESWA 4D4GA 5C81A 1HEIA 4YCSA 4Y7DA 5EE5B 5IVIA 2H4WA 3HJCA 1KDZA 1A4XA 4AZ0B 3DTYA 4O63O 4D4IA 3ITNA 2JJ2D 4FFRA 2Y6UA 4QU0A 1KP2A 5LUAA 3D6VA 1I8TA 4NLLA 3FWNA 4QPZA 4KB5A 4TQAA 4RS3A 4V0NA 3TGLA 4FGUA 2HRCA 4QT4A 4DUGA 3CNOA 1BGWA 4WK6A 3FKSD 1IPEA 3AR2A 3GZ4A 2VRCD 1ULZA 4JP3A 2QRNA 1NTOA 3L7BA 1OT3A 1C7QA 2X0JA 1QO0D 5ENZA 1H05A 2O2CA 4ENVA 1U4OA 1YK0A 3SCZA 2REBA 1BQEA 4R16A 4YJDA 4L8LA 4G1CA 4IIBA 5I5EA 5LQKA 2R4TA 5BNIA 4XTCS 5FCDA 4G1MB 1AKVA 5F2EA 1E6MA 4EKEA 2B69A 5ELMA 2FGJA 2EX4A 2H5EA 2XECA 1LX6A 1W87A 1X8LA 2YNMD 3CURA 3LP6A 3PE6A 4YAOA 5CRIA 2EJVA 5LD2B 4G41A 4NK4A 2ZTLA 4EI2A 1N34B 1XQXA 3AF2A 3MOIA 3TSAA 4Y1RB 5EVCA 2UUOA 4IYRA 2R7MA 3TLGA 4G37A 4NESA 3QE9Y 2O8BA 1C9JA 2G9ZA 4M6WA 4UREA 2GQ0A 4E4RA 1YGYA 1AV7A 1FFCA 2RGWA 3FDIA 5L3RA 1FYEA 3LHFA 4FD3A 4AICA 2FOIA 4TWZA 3ZJUA 2H1SA 3TSOA 4MUIA 2P3LA 1Z33A 2XUKA 3FUXA 3I5XA 3V1YA 2AOXA 2F1RA 4O4LB 4MWEA 4OOFA 2Q7OE 5AOVA 5BRAA 1KO5A 3A04A 1GGJA 2ZBFA 3HXTA 3O21A 2EKDA 2OYRA 3ZWMA 2H57A 2BUCA 1UBLS 3HS3A 1J9ZA 4NEHB 3R8CA 3B78A 5KNBA 2PUDA 4YYZA 1ZJZA 3W5BA 5B6PA 1MB0A 1ZD1A 4D6PA 4JWTA 4R69A 3K16A 2Y8EA 3ABSB 1XROA 4F04A 4LC9A 2CXPA 1FRNA 2W93A 1ELOA 1WMAA 3IP7A 2BEVA 4GMDA 4RUKA 4BVKA 3T7AA 2FFRA 4C1NA 4BXOB 3AV3A 2QORA 4DA9A 3GRUA 4RXMA 4RA9A 5ECWA 4F3KA 3M4NA 2A4KA 1S96A 5BXYA 4F4CA 4OHPA 3ESQA 2Y68A 4GM1A 1DQZA 1PLJA 2QTVB 3QVKA 5D2CA 3D02A 5B3AA 3UO8B 2O2JA 1JG4A 3T1HB 4CM8B 1AZTA 2VVTA 4ENWA 1DVRA 1R6XA 2AKAB 1BDBA 2WA1A 4NJEA 1ENOA 3JTMA 1U8EA 4LCJA 4HI0E 3RC7A 4HV4A 1XZDA 2DTXA 4HYTA 1P4SA 5E9WA 4BO3A 5HQ3B 1U6JA 1AUVA 3KOOA 1USVA 1CNEA 1AB5A 2PLWA 4II3A 4XM0A 4LKRA 5HF5A 1A5TA 4GUAA 1UJNA 2IHKA 1G8JA 4IXWA 1VLQA 1SB9A 4FDLA 2Y1KA 1L4BA 1MOPA 2ZIWB 3DHWC 3E1GA 1E6KA 3SLKA 2PVPA 3S40A 3QELB 1SWWA 1K7FB 1XDSA 3AEKA 3M6UA 5KO2A 1CVRA 4IH9A 5FO0A 3RBAA 4JYCA 5KX5A 1UBMS 1L1RA 2NUPA 1CUEA 4DYVA 1CQIA 1TRHA 4YRNA 1I6WA 4RKEA 3QF4B 1I2AA 1PK9A 1W5EA 3JQ8B 3Q2KA 1J0XO 1E3WB 1E2UA 2DR3A 2OHGA 4CJXA 3JWPA 1QGAA 1FDRA 2I55A 4AAYA 1GG5A 4PYIA 3IEUA 4QQFA 3DL2A 2VAPA 2ZUDA 1F8XA 4MUJA 4NBKA 4QBTA 4W99A 3RFXA 1RWPA 1S02A 3PEUA 4CHGA 4DEVA 4II7A 3UHJA 2JAPA 2NUTA 1KEUA 2C5AA 4P2GA 1DJNA 3S68A 1DEKA 1LW6E 3I5YA 1MEJA 2JLQA 1L8AA 2XOKA 5JSKA 2FHPA 3IQGX 2OA0A 3VH1A 3C6YA 4BVLA 1TMKA 1K68A 1K6JA 1LRKA 3GD5A 3KNZA 2B6NA 3Q40A 1W96A 4JA0A 5DHRA 3R8XA 3LLUA 4FGKA 2E49A 5AESA 1H23A 3HVUA 4LK2A 1YJXA 4IDAA 5GZ6A 1S7CA 3LKZA 1B8VA 4TZTA 4OPMA 3IQIX 2IPOA 2ZSEA 3BHMA 4RF2A 3VH2A 4GZ6A 4MKGA 1V1JA 5C8VA 3PUZA 3CG4A 4TRNA 4CLEA 1IXYA 3HTXA 2Z98A 4YQYA 4P58A 5K0TA 3F74A 1CFJA 3AMVA 3IO3A 4RF5A 4JOQA 1G8MA 3IBTA 4RDHA 5ESRA 2PKXA 5LLDA 2QRLA 4N41A 1Z9BA 1JFSA 2D59A 2JCGA 4GPD1 1N1DA 2AB0A 1LVUA 3COJA 3BAFA 1HE2A 3SF8B 5AM3A 2O3UA 1EVEA 2ZT8A 1E5XA 4B7UA 5L3QB 4NXMB 3MT0A 1CQJA 4BP8A 3QMPA 1MN6A 2ZYWX 3E18A 3L06A 3R6GA 2A88A 5E3HA 3DHYA 5AXAA 1I4LD 5EZ6B 1RJEA 1CY6A 3CVOA 2J41A 4YMLA 1G17A 2AI2A 4P5DA 4EVQA 1TJ4A 2PQ6A 221PA 5I7VA 5KOJA 5DK4A 4BYGA 1U2DA 5MGBA 3ZDDA 1ZUNB 1T9DA 1C8VB 4K9MA 3QM1A 1CW2B 4BFVA 5ALPA 1H4SA 1TCCA 2B34A 3HZZA 1TT5B 3UYLA 4ZYUA 4KAXA 4ARIA 2XRZA 2RAVA 3TQHA 2HWKA 1TU3A 2ORYA 4WLFA 3TJMA 4DEXA 4X63A 1RQRA 3WYAA 4Q6BA 1N57A 4M21A 4AG3A 4EFMA 4M9XA 2YMPA 1OFHA 4OKNA 4X8HA 3VR6H 5E2AA 3OPQA 4E5NA 1IN7A 4MUKA 3LQFA 3OWXA 1XPJA 1X77A 1Z6XA 1ZUD1 1RWXA 1VMEA 4XGKA 4ZP1A 1NQUA 1JEEA 3JR3A 3QJ5A 4G81A 1RYMA 1UC8A 4TROA 1WZEA 2WUDA 1J2EA 1SBCA 2EKQA 3P2JA 2OZLA 3PCRB 3QTLA 4DMCA 6Q21A 1BMDA 1GZ5A 2OCDA 4RVUA 1JNYA 2O8CB 2BEKA 2IYQA 5IDYA 3DMDA 4MV4A 1ECFA 1Z2EA 2CBGA 3LIIA 1Z8FA 2F55A 1UZUA 3VI4B 5CBPB 1QCYA 5GADl 2J9XB 3K9NA 1R88A 4CRWB 2W2KB 3F5MA 4M0EA 4PR0A 1D07A 1NKTA 1GPH1 2HJRA 4D8XA 5DT2A 1NJ8A 3GLHA 3SC4A 3TGPA 3NX4A 1BWSA 1IG0A 2YVKA 4NX2A 4ARCA 2OORA 3AEUB 1L4MA 2C2BA 4FR5A 4GICA 1KVQA 1QF9A 3D8TA 3FCOA 3N7UA 5IYZB 2A9VA 4AF7A 3DBRB 3M4ZA 3CQ9A 2LBPA 4I50F 5AK5A 4F93B 2BM9A 1PWHA 4FHGA 3KVYA 2AOTA 3HU5A 4F21A 3AF1A 2A0UA 3WLSA 4KWIA 2P1RA 4DNFA 1DG1G 4YI3A 5KEIA 3CE9A 4ZI7A 4Z4EA 1V45E 2P9JA 2P9GA 5FTMA 4DQLA 2EZTA 2PX3A 3L6CA 4CM5A 3I6IA 2DG2A 3Q7EA 2OO5C 2QHXA 4PHCA 4RFSA 3VR4D 4MVJF 4MRAA 3Q98A 4JBIA 1U3DA 1UIMA 1X6VA 1Q3HA 4W7HA 3DULA 3AW8A 2IKSA 3CCBA 3HB0A 2W8BB 5FWAA 5GQSA 2X77A 3SC2A 3NYWA 1GRQA 2R44A 1GU1A 3H9GA 4ENTA 1J09A 2RAUA 2WWXA 1A5SB 2IEIA 3U13A 3U2QA 1YS1X 4ND3A 3LGAA 4JQOA 1U8ZA 3ZE0B 3ZWCA 1VHTA 2HJWA 4I8DA 4EFKA 4L0CA 4II2A 3OZ7A 4U7TB 3OC0A 2GZSA 4HWTA 3VU8A 1LTQA 4O0MA 2XUAA 3OZGA 4DC9A 2OLKA 1XL0A 1QZXA 4YP1A 4WMLA 2ZR9A 2H0QA 2YHSA 4RY8A 3TNJA 3GWZA 5KNDD 3OJXA 5K0CA 1OZHA 4RA6A 2OO3A 3IOMA 3UT6A 3E05A 2A33A 1U8TA 4JD5A 4BMVA 4EJSC 4WY5A 1PD0A 2JANA 1PQYA 3L5KA 4KBFA 4V1CI 2CCJA 4D3SA 1SC6A 3BSWA 3BPSA 3I28A 4OLJA 1ONOA 1TM1E 2MIIA 1KMIY 4F4HA 3UZUA 5FQNA 4WDQA 4YRRA 4K87A 4ER3A 1NVWQ 1PUJA 1TPZA 4H18A 3U5TA 2B83A 4ZQBA 2IOQA 4V39A 1PJ8A 4KBGA 3WIEA 3HGMA 1VHDA 4C0SA 5JPIA 2ONZA 1RAGA 1FS5A 3AIOA 4LE2A 3UUFA 3KALA 2OBFA 5ED0A 1A71A 1LFDB 1G4HA 3ZC3A 4DCTA 2FN9A 3DQPA 3NBUA 3R23A 5EJ7A 1YSCA 4WZBA 5JTUA 4O4JB 4C88A 2XB6A 1SEVA 4BE7B 3D7KA 4KX5A 4MI9A 2BJHA 4DV7B 3NWPA 2XTAA 3M6MD 2J3HA 4MWTA 4YUZA 1NJ1A 3HJUA 4UVDA 4OI2A 3Q9NA 2XTZA 3A14A 1ZEJA 1K63A 4QBKA 4FZRA 3SJUA 2RBEA 1ECJA 3VBCA 3CONA 3UMVA 4JUFA 4BV8A 3NJRA 3U1BA 1TX4B 4TUYB 1DV1A 4Q7JB 5AVQA 3P26A 4OM8A 5LOVA 4RULA 3FPCA 4HLQB 1YHNA 2NYVA 2EJBA 3ZOKA 3EULA 5AM2A 1IM8A 1FXWA 2PM8A 2I66A 3O82A 3QHQA 3R7WA 3SVZA 1WPXA 4DG9A 2DH5A 1JEDA 4MDFA 1Z68A 2V3VA 2P9YA 3GEMA 2VK8A 3OA0A 3V6MA 2DSNA 5GZ1A 1GL7A 1VJ1A 4G1FA 2VJNA 5FF9A 3Q12A 2W11A 1PR3A 2QYHA 4EBBA 3WAJA 3TTWA 4YRZA 1NI3A 4MAMA 4LWQA 3CLTC 3RU3A 3BH7A 3T9BA 1C1XB 2QQ5A 5F98A 2B4QA 3UQYS 1PL8A 2EXXA 4QDTA 1IEXA 3LY7A 2VP5A 1PO7A 1JA0A 3VH4A 1F2VA 4DA8A 1TVKB 3CEHA 3KKQA 5EJ9A 4QM7A 2R751 2H85A 2OYSA 2VDWB 1VE9A 2DB3A 3M2TA 4Y9DA 1JAYA 4A0FA 3FCXA 1MV8A 4ZI2A 3U37A 1RZRA 1AXEA 2GERA 3CFYA 4RVHA 1QMGA 1EGQA 1YFZA 1B15A 2HPAA 2W6MA 3MD9A 4QOJA 3WYFA 3G02A 2X9VA 2YC2C 3HKBB 4Q39A 5JO9A 4RF3A 4A0QA 4TKUA 5AVWA 1N25A 4MHOA 2FW1A 2RG1A 4QECA 5HKOA 3F3MA 3LHIA 2BFCB 5HILA 1XCJA 2A1IA 3H4TA 3G2NA 4QBIA 2X1HA 4UNQA 3UMRA 1EDEA 4YIKA 2ZBVA 1LJUA 4C22A 2D1YA 3KELA 3LUAA 4D9CA 2DEUA 4UDYX 4AJIA 5ALXA 1COWD 4E09A 1YGPA 2HAEA 1XNJA 4BV9A 5DRTA 4F4UA 5A1JA 1N6PA 3V6LA 3CUEF 2C8JA 1GFZA 1ZN2A 1NPTO 1JFFA 2SICE 3W2TA 1N5IA 1QR6A 2JZCA 4PQFA 4PCLA 2IYOA 2RJ3A 5EWMA 4ZVNA 4CW7A 4EGQA 5CB4A 2MYNA 3HY6A 4JL6A 1E2LA 4G26A 5T67A 3EC7A 3BXFA 4MRVA 1EFKA 3GHYA 3CVUA 2QVZX 2QYOA 1M34A 3L8DA 1QHSA 1Y42X 3CKLA 5ABPA 1NVXQ 1SXJB 1FJHA 2AFHB 3UB3A 3SJ7A 1LI7A 1M0TA 1G6HA 1XG5A 2O23A 1XFDA 2JDID 2FPRA 3ZQUA 3NUGA 2G82A 4JYPA 2VF8A 3ODPA 1LK0A 1GQOA 2UXDB 2HSEA 4Q7MB 3KXIA 2FPOA 2I80A 1V7CA 4HWKA 3EBPA 4JBHA 4OUDB 3UQZA 2RAFA 2C99A 1SHZA 3G2JA 1YMVA 1E1LA 5CR9A 5LP6A 3MIIA 4RV4A 5DHTA 1RJGA 1QORA 3K1YA 4KVGA 2C98A 3Q11A 2R6R1 5KWEA 1IHOA 3TCKA 2ADFA 5B58C 4PO3X 2AQHA 4M7WA 4QARA 4Z0TA 4IQ4A 3IAAA 5THQA 1D2MA 1LDGA 3HKCB 3D4LA 3FNFA 3MNFA 2XF8A 3NRJA 5HM8A 3AWIA 4KK4A 5ADWA 1JIXA 3I2IA 4UUBA 1SBTA 2YHBA 4NMWA 4ACAA 1GD1O 1JNXX 3A8TA 4KIUA 2PJUA 4ED9A 3PBKA 4DLVA 4HLUA 1RQ7A 2AXNA 4S2UA 2VZ8A 3O8QA 4IR7A 5EJGA 4D9FA 2XMDA 2PH5A 4B47A 1ZVJA 5DBGA 5A6SA 1TT7A 4KOEC 1FYXA 2RK3A 1GILA 3M89A 3IELA 2AN4A 4QYWA 2IH2A 1SXPA 2NACA 4ZT4A 1NUPA 4R1OA 2EL7A 4YUWA 2XXJA 4CKBB 4KJXA 1WABA 3W5DA 3RRJA 1AIPA 3RUIA 2FPLA 4P7KA 3I1JA 1I36A 3VC1A 2OVFA 1Q2UA 2YHIA 4EEXA 4YLGA 1VG8A 1S1CA 2QN2A 4XGQA 4QGHA 5JWOA 4AIRA 5A9SA 3G2MA 3WXMA 4CLRA 1JBKA 2ZVQX 5FKJA 1KI6B 4A03A 1Z8NA 2NSJA 3AHIA 4TLLB 3IGFA 4K9PA 4MWZA 4F5ZA 1KI4A 1KQ3A 1NVFA 3E48A 2JS7A 2P8SA 3KQSA 3O3CA 1VL8A 4LDNA 3WDLA 5KYUB 2AD1A 5D1NA 1WMDA 3D0QA 2PQ0A 4BB9A 4M0KA 3WSVA 4HNUA 4ZQGA 2OV3A 2AKYA 2W9XA 1PDVA 1ATIA 2OCYC 3H5WA 1M2GA 3M6WA 2IPXA 4J8PA 3GEDA 1B0UA 2IW1A 4K3UA 5DTIA 3RRXA 3U17A 2UVQA 3KEQA 2I6GA 1MRNA 1GTVA 2WK1A 4JHLA 3HCRA 4Y98A 5ALGA 3UATA 1QP4A 3LBYA 4G0OA 4LPKA 5COQA 3ZVRA 3F6RA 3Q10A 3UT5B 2WUVA 2XTMA 4UE3S 1NJGA 5CK5A 3W8RA 1N2OA 2OXFA 4ENSA 1F4VA 5FH9A 4YPOA 3Q7SA 3Q5GA 3VX4A 1G8KA 4BLQA 2P5TB 4ZO8A 1PX0A 1UT6A 1PL6A 4BVJA 4Y6GB 4ZCTA 1LH0A 4IFEA 3ZDFA 3I04A 5DLYA 2ZJFA 1R0WA 4X1IB 4DIKA 5JJLA 2BFDA 5L53A 4AFNA 3KYJB 4NU6A 4A1FA 4JI7B 1HF3A 3VYVA 1BXRA 1MO3A 4YUAA 5HHTA 1JH8A 1Q0UA 3L7LA 2BF7A 3FPGA 5F77A 1SZCA 3T54A 3WFZA 1FNSA 3GY0A 1P0QA 1MX3A 4TTPA 4DM4A 1EUCB 1P77A 2HPZA 4BJ6A 3FTFA 2RG7A 3GHHA 4RIGA 2VO1A 6REQB 3QPVA 1YB1A 1R8XA 4YAGA 1AK2A 1KFBB 3L93A 2W42A 3IAS1 3P0RA 4BZQA 4DCNA 1RFLA 3IO5A 3U3MA 1ORDA 1W5BA 2PX4A 3ZVLA 1YIAA 2GLTA 4RSRA 1AF4A 4N4AA 4TSFD 3X1MA 5FYQA 3ZNPA 1NQTA 1RBYA 1SHJA 2EX0A 1EYZA 3E7DA 3E9MA 3EDOA 3ND8A 4PO8A 5AK4A 3LYHA 3SE0A 3ZD8A 4EQ6A 2HA4A 4KXLA 5C8YF 2BGNA 2R6CA 3E3MA 5K0GA 1GPKA 4XCQA 2GCGA 4JUIA 2WF6A 1LKZA 2UVPB 1G1MA 1UKVY 1JQEA 2BGLA 3VKFA 3LT4A 2W00A 1LSUA 2XVXA 3KZOA 1IONA 2FSIA 4NECA 3CF6R 5EE9A 2J3DA 3CZ9A 1TA4A 4XJTA 3RSZA 1E1QD 2ZOSA 2C4VA 3Q2OA 4JJ4A 1M76A 2FN3A 3PGLA 2ZJOA 4GMFA 1E2FA 3GGGA 4RJKA 1ODSA 5EMMA 1QJ4A 4P6VF 2HSJA 3MINB 3PJEA 4PWYA 4M1EA 3UAOA 2BGWA 4HDKB 2KWIA 2ZE8A 2EYQA 3C8MA 4LOIA 5CDUA 2OC4A 1NUHA 1M1YE 1UM9A 2ICAA 2WJAA 4CKEB 4Q1FA 3MWEA 5GWXA 1U02A 4JQSA 1J21A 5JAUA 2ATVA 4NAUA 4QLBA 3GRVA 5MGNA 1WG8A 4DCMA 3GP8A 1BQ3A 2BC9A 3A9RA 4MR9A 2XE8A 3TIFA 5COBA 1D2CA 4WN9B 4ZCMA 4MUYA 3IUPA 1ZK3A 1E3SA 2UV8A 3EVGA 3LIPA 1LNSA 2WYIA 3OWOA 1LV7A 3QLEA 3ZQKA 3NYIA 1V5EA 4MCHA 3L0IB 4LYHA 1W88B 2JFUA 3DV2A 4B1FA 4F2GA 3CLUC 2LIPA 1Z7BA 3H87A 1TVMA 3RHTA 3T06B 2EJCA 1RLOA 3V1TC 3DP9A 5DCLA 3IPRA 9ATCA 2D3TA 3FDFA 1T9AA 4EHFA 5A0VA 4HNSA 4LXIA 3CZ5A 5TQ2A 4DMRA 3HWRA 1DJPA 2BGKA 1HYHA 4IJ5A 4N12A 4BQEA 4L8WB 1G7TA 1G55A 2C2XA 1MO2A 2AJTA 2QD4A 3PKJA 3ND7A 4RFLA 1Y8AA 3ZCPA 3I1IA 1XCOA 1XJCA 2OC9A 3AJDA 3C85A 3CF2A 1ZISA 3L0PA 3EF3A 2GLXA 3TRJA 3JQBA 4GSYA 4B5KA 1PDWA 1QWOA 2R68A 1I7QB 4IPTA 1PYOA 1S2MA 3B36A 3CZRA 5EJ5A 3P9RA 1IUKA 3U4MA 2XCOA 2FVYA 1UBUS 1MH1A 4JU8A 4B6FA 3RYFB 2C9MA 2UZAA 4JITA 1NVVQ 4C7MA 1SXQA 2FXVA 4P7BA 1JPJA 2WYHA 3IUJA 5TPZA 1GFSA 4Q1VA 1Y1TA 1YA4A 1YULA 2FX2A 3IODA 1BDIA 2QNBA 1YU9A 3I9KA 3KYBA 4PSKA 3FAZA 3G5AA 3WL3A 6GPBA 1SMKA 1EUQA 1NN1A 4IXDA 3ZHUA 2GCIA 3UJNA 3K9WA 1NMQA 4NICA 1PT5A 2IHYA 3KZCA 4C87A 1UJ6A 4L8GA 3H18A 4WA8A 4PLFA 2YRXA 4CF4A 1HKHA 4AIIA 1TC1A 2BDTA 4CMHA 4J75A 4D4HA 3VHQA 2O2XA 4I5FA 1OI4A 3I0MA 1Q1GA 2PG3A 2B8JA 1U0OC 3ENVA 2BEWA 3FBGA 4Q03A 4A8JC 3PDCA 3QSYA 3FLAA 4ISBA 1ECBA 2O2EA 3V4ZA 1FDIA 2PAFA 3ZGYA 1X8KA 3F6YA 5B4VA 2AKEA 2Z30A 1MO6A 2YZNA 1N36B 2A5GA 4RDCA 2GCOA 5FXMA 2FE1A 1WZCA 1MU0A 2J9GA 5DHSA 4DQVA 4YIHA 4NJMA 3U19A 4KDEA 2QMQA 4ER6A 4F91B 3N0TA 1DEOA 3ZV4A 5F1PA 3TVDA 1KU6A 4O2AF 4RV9A 3RE1A 1M1XB 4YWJA 1GXSB 2WU8A 5EA2A 3DYVA 4KNYA 3OZDA 3TQIA 4F3TA 1IY9A 4NYJQ 5HZKA 4BAZA 1OLSB 3CLSC 1EB9A 3S29A 13PKA 1NRIA 4Y2VA 5JQGA 3ETHA 4NOJA 1VLJA 5M3BA 4KXVA 2H51A 3WGZA 1IC6A 4HVTA 4LGVA 1SCBA 1QYIA 5JXWA 1PW5A 1SHKA 3MPUA 2XGJA 4P31A 5I8WA 2C0PA 2INGX 5IARA 4LFBB 1GA6A 2QW8A 3IJPA 1LBSA 4GP6A 4JL5A 1PSWA 4ZOAA 5CFLA 4LBWA 2X3FA 1USGA 4Q9DA 1WRBA 2ORIA 3B6EA 2IGTA 3NBKA 1RXUA 3KFVA 4HVAA 4TTQA 3RVKA 2HR1A 5CXUA 3VJMA 2O2SA 1P1BA 4KODA 3K70C 1JU9A 1J5XA 2NU7A 3BL6A 2REOA 3M83A 1HNWB 4YPFA 1VPLA 4H0NA 4QOSA 2H17A 4NKRA 2JGDA 4QXQA 1N3IA 1Q2XA 4PN3A 3SS8A 1BA3A 1OT5A 3JX9A 4Y2HA 1AV6A 4KEAA 1TIPA 1VTKA 1CZRA 3QLTA 4L5JA 1K5HA 2CGEA 2QNIA 1V71A 1YB6A 3S2ZA 3RAFC 3U62A 2Z5FA 3OCZA 3VO8A 3ZQJA 1M6VB 1OGJA 3F8WA 2JDIA 1MTZA 1XVAA 3DE5X 2CXRA 3EXG2 3H17A 3KAJA 4NOKA 3D8UA 4LDRA 1XU9A 5TV2A 1NBMD 2JEZA 4GWLA 4H7KA 5IKEA 4DV3B 1T3HA 1G8SA 3X1DA 3ST7A 4IHAA 3DLAA 5E9AA 4QE3A 5H82A 2JFWA 3RTDA 4IGEA 5FPHA 5SYMA 4EYQA 1E9AA 1XP8A 4I2VA 1QP8A 2GK7A 1WULS 1MOQA 1QSGA 4QFMA 4BPRA 5KSZA 1TEXA 2C88A 1H65A 3FYUC 4HN2A 4EKYA 2EKPA 4L4RA 2C78A 3IALA 1SEPA 2O3SA 5M04A 3FZNA 4DFDA 4G2TA 4XSVA 3RS3A 4LQCA 3CV3A 1MJFA 4NPCA 1WEHA 4PZEA 4IDHA 2GKOA 5C2JB 3WO1A 1ORWA 2PT5A 2QG4A 4JXXA 3DKPA 4FC7A 1PWZA 4F8JA 1T4CA 2PKCA 3FWPA 3MRXA 2P2YA 3LDFA 4P36A 5AOBA 4KLAA 8AT1A 2ZRCA 4XGNA 1XMIA 2VT3A 1CHDA 5CXSA 3A27A 4RH0A 5E7QA 4K9RA 3WYCA 1MIOB 1EFPB 3RAJA 3GAMA 2XT6A 3LDGA 3ANMA 1NOJA 2ASVA 1QYCA 4O5AA 2VT6A 1OJLA 4UFNA 1JLSA 4J0HA 1U1EA 5E1BA 3QWHA 5ALKA 4D0SA 3NI2A 2JIDA 2IDZA 1EXDA 2ODAA 1IAQA 3RABA 3DHEA 4Q12A 4JI2B 2NSYA 3N8GA 1OBVA 2P27A 2GTHA 4JBNA 2PZKA 3G5LA 1E0AA 4AMGA 2IOFK 3SXJA 2ZRLA 3ZXUB 4CTNA 4L02A 3THWA 4OHYA 3LCRA 1NI4A 2V58A 4CQMB 2EW2A 1QZZA 2CSUA 4MMZB 1SVLA 4EPVA 4P34A 4MGYR 2VQ3A 1LX7A 2PU7A 3CNQS 3NCTA 2I3AA 4LNAA 2VDVE 3D3WA 3R41A 1DTSA 2PX6A 2X0NA 2J3IA 1Y1SA 1NYLA 2JIMA 4R3NA 5F1YA 3ZLBA 1IY0A 4D3ZA 3EBLA 1SVOA 3FHCB 4F85A 2ID4A 2OOSA 4DE5A 1ZNZA 3BF8A 4CMEA 2CZCA 3QWAA 3WZLA 3U1TA 4B3DA 3O9VA 1KVTA 2GEVA 2OY0A 5E7IA 4RMIA 1U94A 2VAXA 2IV3A 2EEPA 2FOLA 2YMQA 3NORA 1A27A 1JU3A 4JASB 3RVLA 1E92A 3DQZA 1KH1A 3G0BA 3UJ7A 2P79A 1SD5A 4TTTS 2BKXA 2RH5A 2BFWA 2PO5A 1Q7TA 1RWBA 2O5VA 4J0CA 3ICOA 4YCAA 4D96A 3U61B 1C9NA 1ML4A 1M73E 2ERCA 1YZYA 3C45A 4AMZA 2L0XA 2ILVA 4UD2A 1JDBB 2C1ZA 3AESB 3H6HA 2YTZA 4RIHA 3LUPA 1S3GA 2CVHA 3GH3A 4G5HA 4DSUA 3VA7A 3ER9A 4M83A 3FOEC 5IJXA 4GLOA 1PS8A 3HJGA 4QQRA 3WLJA 5LP1A 4A15A 3VNSA 4H7EA 4LI3X 4KC0A 4YECA 3G8YA 2QN7A 2O59A 1NUUA 4TMXA 1DKUA 1BOOA 1E7QA 4FCTA 4BOYA 5I9NA 3DNPA 3Q6IA 3M3DA 3AHCA 3AERA 3DBHA 4HB4A 1NU8A 2I0FA 4DRZA 1R5NA 3C43A 3OP1A 2ZRHA 2JLBA 3HCEA 1RRGA 1O96B 3QUCA 4Z0PA 3L05A 3AUSA 4ZVMA 1UOEA 5AVUA 3OLZA 1P9WA 4IIVA 3BMOB 3RVRA 3TLXA 5AXBA 5CNMA 1L5KA 5DO9A 5CT5A 2Y1CA 4CCAA 5LPNA 2CZQA 4K9SA 4DXAA 3DZIA 5CFRA 3T34A 2Y0DA 3WK9A 2AE1A 2PS0A 1TAGA 3ZN2A 2IOFA 3GROA 3J80A 1BHO1 3O3NB 4XYGA 4PPQA 4FFNA 4TWJA 1XAJA 2X9NA 2JAHA 4LY3A 2GFQA 3I2FA 3IBFA 3KJFA 3QOXA 3T99A 2VQEB 1GN9A 1R5JA 2EFDB 2ZB2A 3O4IA 1JHQA 1KDTA 1Q92A 4GX5A 1PFWA 5ALYA 1EM8B 1PJLA 4IEFB 4IF4A 1PX2A 3O2JA 3U3KA 2EEZA 3IJRA 3NC4A 1BX3A 1KPHA 2H1OA 1L5MA 4HXGA 4B3JA 1ZG3A 4BX9A 2NP7A 3QFRA 3E15A 1ZW6A 1J00A 3I92A 1KBOA 1FU8A 3PFWO 4KVAA 1R3DA 1R6UA 1CIJA 1RYDA 1U0HC 1YK1A 3GJTA 4L5BA 3SJBA 4A7PA 3EPHA 1GDDA 1GRVA 4ICIA 4B31A 3E03A 3T5BA 3BGVA 3SSNA 3E2MA 1AGNA 4KZPA 5FA5A 1PNTA 1X7YB 2A4MA 2WHEA 3HUDA 3X1YA 2R1TA 3S2IA 1DKMA 4GUDA 4RWZA 1SG0A 3CRZA 3URMA 4OHMA 4HZUB 3V46A 5AICA 4UOEA 1GAWA 1ODCA 3PD0A 4JROA 4O2BB 3VGJA 1RVDA 3WNDA 3GFBA 4KSYA 4DR7B 3L6RA 4LRWA 1LD3A 3GFPA 5ARDA 3T3NA 3SG0A 3D8SA 5I47A 1JLKA 1UEIA 4LZOA 5DLEA 4B84A 5KVAA 1UEJA 3A4IA 1GAXA 4F3NA 2QAGC 2OBXA 3SXUA 1Q57A 5B55A 2AYYA 3K96A 4ZZ0A 2YWXA 1GAQA 3BXGA 1KMHA 1Z0JA 5HJ2A 4IUBS 4BBAA 4PFSA 2Q62A 4UU1A 5CB6A 2RHTA 2VN8A 3GRZA 3HCNA 1K8YB 1G9SA 3T4UA 3TZEA 4TTSA 4RJTA 1XZKA 2YYSA 3H8VA 4KXYA 5AM1A 3KSBC 3X1JA 4AMYA 2C2KA 2G77B 2YL2A 3CIFA 3KQPA 1QU2A 1NVUQ 4NCAA 3P9KA 1DL5A 4EABA 4DT1A 1DDIA 3JQ7A 3ZHQA 1GLGA 3D81A 5F1KA 1T26A 1E9EA 3KQNA 3FWZA 4YX9A 1ZOOA 5E38A 5EKDA 4CV0A 4HYQA 5CHEA 2H07A 3M5PA 2YZGA 4FDMA 4TPKA 1Z56C 3CCFA 3TPFA 1Y8ZA 4IDBA 4ARZB 4HLDA 3EZFA 2HV9A 4M9CA 2JFYA 2X9LA 4JS0A 4BFWA 1E7WA 1K97A 3AHGA 4CM7A 4LBZA 3H5AA 5DEOA 1MQAA 2B2XA 4MVJI 3UMJA 5JBQA 1KRXA 4V3BA 1R5OA 1B2LA 4GZMA 4NYMQ 2ZUUA 4BQQA 3RGWS 1QK3A 1V6AA 1ZM7A 2PWPA 3DOJA 1UJ5A 5LXTF 5CH3A 3G23A 3GIWA 4NZNA 3MD0A 1II8B 4RIIA 1G4UR 4QXPA 1DQPA 4N3CA 1V37A 3G1WA 2JJ8A 1Z4LA 2R8XA 1AGXA 2XUOA 4IMJB 5ESXA 3BXOA 4ZC8A 5EY5B 4OJMX 1XXHA 1L0BA 4UVIA 3K09A 1FTYA 1NLUA 5DGHA 3V4VB 4YRAA 1JMKC 1OILA 3D8RA 4QKQA 2G1UA 2G0TA 3AJEA 1T29A 2J3MA 4FW9A 2A8YA 4QQNA 1NYTA 2ECKA 1V8BA 2FWJA 4O0LA 2PGOA 4R0VA 2F1IA 4XYLA 5EP4A 5B5SA 3HPRA 4ZOLF 4DT1B 3REQB 4AZ0A 1XMQB 4TS1A 1QLJA 3C5WP 1MRZA 3WTCA 4BTVA 5ICCA 1P2GA 3FLEA 4N9WA 5INTA 4A6PA 3I1FA 4LSZA 2HK6A 2MJLA 4QASA 1UF9A 4RK7A 4C01A 2HYIC 1U8CB 2EG5A 3ANTA 4FEEA 5BVHB 1H22A 3BD7A 3ZDYB 4DXHA 5FBHA 1XZQA 2ZWIA 1M72A 1ZRMA 2AQIA 2GRAA 2IK8A 5ECYA 3SIPA 4C0JA 4QBFA 2PRJA 3NBFA 3QU4A 5IZCA 4L9RA 4L0MA 4MQ6A 2IIVA 4XXHA 4B0PA 1ONSA 2XMZA 3N5CA 3OOWA 4RTKA 4HDMB 1OY1A 3P2IA 4I1UA 1L6RA 3AEYA 2HZBA 3L1KA 1NP6A 2NZUG 4Q4LA 1EK2A 1ZOSA 3U7EB 3ZY4A 3BWMA 1SQSA 4JENA 5AR1A 1VPVA 4ZVTA 2BMWA 4WINA 3QVTA 1JQJC 1E9DA 3PFKA 3PICA 4Y1RA 4Z7OB 5J5AA 2GN2A 2ZSJA 2Z6QA 1E1DA 1H2WA 4IFBA 4MLCA 5FFFA 1U1CA 3LLSA 4CE6A 5JWRA 2CL0X 3AILA 5LDDC 1L7XA 4Q37A 4Q24A 4A2QA 4DMGA 4E7PA 3O6VA 1X1DA 4P3YA 1K92A 1P72A 1KNXA 2H8KA 4L7VA 3QY0A 1WQ4A 2ZWPA 3SJAA 3TNDA 4MP6A 3FSGA 1Z88A 5KJEA 3K15A 4EKDA 1ZSNA 3LC1O 1R0YA 2ZXFA 5E2IA 4GP9A 2J85A 1IUOA 5F4BA 3HJFA 3WG9A 1H4TA 1NQVA 1BKYA 1J49A 1XI2A 2VBGA 1PEYA 2XY4A 3FKQA 4KNVA 4EIWA 2JKZA 1Y7PA 2J7KA 4XVCA 1WY7A 1ZSYA 5IFLA 3B6KA 3NDRA 3O84A 2IP1A 3TLEA 4AZVA 1Z6TA 2AEEA 4H17A 3ZZ0A 4UZFA 4NNPA 3HI6A 4UATA 3DL4A 2O3TA 1A96A 3PFBA 4FGLA 5JVDF 3GLFE 4E30A 2R6FA 4AY5A 5TIIA 1REQB 1M1YB 1F0NA 1U0SY 2JFOA 2QTVA 1LDYA 1FRFS 4HX2A 2JGKA 3KAQA 4Q4DA 4CM8A 2CJWB 2HF8A 4LNHA 1X86B 1ODKA 1E9SA 1RMQA 1OWMA 1LTHR 2NTYC 1ZICA 4JEMA 5FOWA 4HUTA 4JI1B 4JK3A 4RTJA 5AI0A 2R66A 4GU5A 4PNZA 3NTRA 2R47A 5HBRA 2O14A 5DFAA 1UKBA 2FJ0A 2V0NA 3AIIA 3E7PA 4LY9A 3VO9A 2Y1FA 1GGVA 1HQYE 1YTLA 4P83A 1SOWA 3SZLA 3JVEA 1P33A 2QW1A 4PICA 2C9CA 1M8GA 3STUA 2Y0CA 1FRVA 3SYNA 2PA0A 5J40A 1X42A 2Q28A 5GIOE 5C53B 3QELA 4W5OA 4ZD6A 2VNIA 1NW7A 2JEYA 1TKCA 4DLAA 5L6LB 4IL5A 2XT0A 3THYB 1U99A 1XBTA 4Q3DA 1N2GA 1I94B 1BGVA 4YV7A 5BPFA 1H2BA 5EHZA 4X95A 4GNKA 3A1UA 4DM3A 4EY6A 5GV7A 1G18A 4YV1A 3QF4A 3V00A 1HBJA 4NR0A 5JNUA 3DEJA 5CX4A 2P40A 3HBMA 3JQ8A 2R9VA 3B70A 5MN6A 1E3WA 3D2CA 3FB1A 3MUFA 4OHFA 1JE0A 5FPSA 3RI3A 2WJWA 1QO7A 4V38A 1IXKA 2VR1A 3JVDA 3UM9A 1YFLA 4WN3A 2ZBUA 1K0UA 1HE1C 2CWDA 4ML3A 5ER9A 2R6DA 2XADA 3QX9A 4ITVA 4L75A 1MV5A 4YUVA 1EFRD 3PR2B 3S2GA 4OLAA 1E2QA 1P4GA 2IKQA 2FX5A 4FKBA 5DI3B 4ZQHA 4GYWA 2FR0A 4ZOQI 3OT4A 3WYNA 3N6XA 4B4OA 4DIMA 3IP1A 4YAUA 1JJBA 1YQTA 2XQJA 1MVLA 4F4IA 3S5JA 1OUMA 2FEAA 3UUEA 1YJ5A 3QVXA 3VUEA 3K5HA 3V48A 3MFQA 1L5VA 3ESAA 1M66A 1ZRNA 2O2DA 2XUGA 4EG4A 3KKPA 3L0YA 5LA6F 4PGAA 4QPCA 5BSWA 1MPXA 2B0CA 3FGZA 3N2EA 4R8RA 3FGPA 1N6LA 4ZANA 1I0LA 3Q0EA 1TPYA 2O1EA 1GDTA 1W0JA 1JF8A 3HNOA 1E6WA 1YASA 2PZEA 2WVHA 3KVVA 5HFAA 1N8NA 2P3QA 3R9KA 3BX1A 3EF0A 1EQUA 3TUZC 1MR3F 2V7TA 4LY6A 2RBGA 1DBSA 2G5GX 3AJAA 3LF1A 4OIFA 3ZDZB 4BUZA 5L3QA 1A1SA 1V25A 3CJTA 2C8KA 4DLPA 2ZVJA 3SDZA 4W4TA 2LTAA 2I6UA 1EA7A 3A6FA 2VT2A 4WOCA 5FUYA 3TTVA 1DELA 2FG6C 2Y1OA 4U63A 4DY6A 3U39A 2ODTX 3JY6A 3K32A 4R5HA 1AU9A 1NVGA 1Y1KE 2YQ5A 5TMEA 4W7SA 4YR9A 1FTQA 2A92A 1U6IA 1ZUNA 3TDKA 2AFRA 3VOAA 2C5FA 3GC6A 1XXLA 2QOEA 4ZZ2A 1TT5A 3OSZA 4HB0A 4RPIA 2ODEA 2X22A 1Z6QA 1PR9A 3NHPA 5I9TA 1ZK1A 5I4CA 1UAAA 2F4NA 3L4JA 2XEDA 2ZBDA 4KE6A 4ZJYA 5P21A 2I2WA 3DS8A 4M38A 3WWYA 5EMKA 1PU2A 4QJ5A 2IYFA 1ZHFA 4C7BA 5F5NA 1KR2A 1TNDA 1AQ6A 2YASA 3C3PA 4ZU3A 1JPVA 2XUQA 4Z5XA 2NXNA 4C0KA 4BNKA 5AVOA 3BN3A 4EG3A 4OMCA 1OTXA 2V98A 4X8LA 2BI8A 3VOSA 2O8CA 2IBMA 4KFRA 4IQGA 1HLPA 1RAIA 1U8AA 2HNBA 2VNJA 3SC6A 4BX0A 1P0CA 3BOSA 5CBPA 3V8EA 4YC7A 1B8OA 2GBPA 4EJ2A 2VK1A 3SICE 5CFNA 4DA4A 2H4ZA 2EQ5A 2W2KA 3B13B 4RTOA 4UM8B 5I7WA 4I14A 2OFWA 4ATNA 5IXYA 3GQBB 2ZJYA 3FMGA 4MKRA 1C0EA 3G82C 3ADKA 1KYIA 1O2DA 3BRQA 1ICIA 3NNNA 3FPEA 3AEUA 4B46A 5JSZB 1XZLA 1KZ4A 3DMTC 1O7JA 3IUEA 1P74A 5IYZA 5DP2A 2M6RA 2ZDGA 3L04A 3DEFA 4I5DA 3R76A 3WKCA 5EWLB 4EUSA 4F3YA 2NX2A 5HCNA 1PTJA 1AS0A 5F12A 3RARA 2O7SA 3IQFA 5JZBA 4GL4A 2MSCB 1M2KA 2QT1A 5AW3A 3A3YA 5ALEA 1GNQA 4B9EA 4CMBA 4X54A 4UOZA 4Z3KA 4DS3A 3LPCA 4Y0NA 5CCDA 4P0QB 1M74A 1NSYA 2ZTUA 3ZBPA 5IANA 1OVMA 4AY2A 2NZ8A 3FR7A 2YIVX 3B9QA 4RPGA 1XLVA 3VDNB 1F7UA 2X19A 1BE1A 3QV1A 3V4RA 1IEQA 2W8BA 4OLHA 1F8GA 3GGCA 4QTUB 4ARVA 5B7GA 2VYVA 5EJ6A 5JCPA 4UU7A 1PYGA 1Q6YA 1HOTA 3W4KA 1YJ8A 2WG2A 4L07A 4ZT5A 3JZAA 2IC5A 4NBVA 1M0EA 4NPAA 2ADOA 1XDUA 1E9RA 1X74A 2QDXA 2B1GA 3EMBA 1MT0A 3K9QO 1P2UA 3DE2X 4JLJA 5L4NA 4INJA 1BJKA 5J4YA 5K05A 1S8AA 3DPSA 1QKKA 5JZOA 4F1WA 4F1JA 4FVTA 5LWQA 1YH3A 1KYYA 2BGMA 2EJWA 4JC5A 4NZZA 4OYYA 1CB7A 3TZCA 2NV0A 5TT0A 3SWWA 4ZO9A 2AYXA 3LYLA 1Z5ZA 1DWQA 3L7AA 3I01M 5LR6A 1KI3A 1XEWY 2X40A 3F2IA 3KVOA 3MJEA 4YT8A 4W9MC 3DCYA 5JUWA 1JJAA 3OD1A 2XKKA 1E9BA 3WBJA 3JQFA 1PG0A 1GSOA 4CFSA 4CCYA 3CMCO 1T3SA 4YXWA 5CA1B 5C46F 1TFRA 4RIEA 1E1CB 3PKIA 3HR7A 4B4VA 4EYGA 2PT6A 3MWJA 1OA1A 4UE2A 2IRWA 4R9SA 1OX6A 2H9YA 5F2OA 4XDGA 1DLIA 3O4FA 5CLQA 4YAEA 5ECDA 4EG1A 1FTGA 4MARA 2GPAA 1YKGA 3SEAA 3HXMA 4AD8A 1WPGA 2JHCA 4GX0A 5EIBC 2QMOA 2XTJA 1JHZA 2J07A 4PAOA 5IJ9A 2PWZA 3BK7A 2IA5A 3V1UA 4PSUA 2I62A 3UJ8A 1QGOA 1MORA 4D4LA 1RHUA 3KZNA 2DETA 5TPWB 1BS9A 4OF4A 1GKKA 3T7JA 3VR6D 3E0XA 1O94D 3ND6A 4GPAA 4PPNA 5T4FA 3SX2A 4OQZA 3DF9A 4FLEA 1FX0B 1FNNA 4KHPB 2CKMA 4O4JA 3LX6A 3BXPA 4G0WA 4H3VA 4MQBA 2P2ZA 1BU8A 3HO6A 4IXNA 4NENB 1ZA1A 2IYXA 3BL8A 1CUYA 4LF5B 3C15C 3SQXA 1VBFA 2YWBA 3GJRA 4NBTA 4EFLA 1JA9A 5CM8B 1NMXA 3WK7A 4AJ1A 3HXOA 3GDGA 6AT1A 2KW5A 3NH6A 4RXTA 2XEXA 1RLUA 2MU1A 3QKIA 5GONB 5BUZA 3FOZA 2ZBRA 1L8XA 2FPMA 2N42A 4TUYA 4EG6A 4O3FA 1O77A 4F9EA 4Y6OA 3WGIA 2QRPA 1T9BA 4YH1A 1TAUA 1NLYA 1OBHA 4L85A 3T7TA 2RD2A 2QP4A 3WLQA 1UFKA 2SKDA 4BGVA 2XNCA 3Q0TA 2AK2A 2FWBA 4WBNB 2FSUA 2VI5A 3K0CC 4KDRA 1NXTA 4ENPA 4D25A 1GGKA 2HL6A 3FFBA 1XRJA 3B1VA 4LIPD 3UT0A 1GTRA 4FBGA 1CXZA 4G4SP 3K71B 3DZFA 4HHEA 1C0IA 1FW8A 1VIAA 3BK1A 4WXMA 2OV1A 2BBTA 3OU7A 1N5MA 2HDNB 4QPJC 3PFIA 1C1XA 1VSTA 2EFCB 3NO4A 1AY0A 2CY0A 2QUAA 4FYIA 4IGKA 4CDRA 3R44A 1JDPA 1ZN9A 3F5QA 1D0SA 1WX1A 1TVKA 4Y1EA 1XDDA 3DT8A 3OHSX 2WLTA 3DO5A 2VDWA 5LIRA 5B4UA 4ENRA 3HYRA 4QD3A 3GLRA 5GOZA 3ZI4A 3SF0A 4EY3A 1RTKA 1QPZA 1X39A 3RWBA 1U9CA 2IZ6A 4LZPA 3HKBA 3NJ8A 3Q6NA 1CIVA 1N0UA 1R9MA 2VF4X 5J4HA 4I5IA 5GTDA 3TVTA 4PS0A 1WPQA 2BFCA 3CLHA 3GLIB 2G1PA 3H5VA 1VIVA 2H1HA 1E5LA 4FYVA 4UM7A 3V4LA 1SUEA 1IQRA 3CEPB 4X97A 1NJSA 1OROA 2V03A 1Y6JA 1RM5A 5K1ZA 3ROPA 2ZKLA 3K8YA 4J16A 4R3UC 5IMBA 3Q88A 4B73A 1THGA 1U04A 1E3MA 1ZFNA 1FDOA 3HM9A 4J0KA 1WXFA 2JI8A 2VEOA 4MGZR 3FNGA 4XD7D 2ZJBA 4AECA 3ZCSA 4DR3B 4UEJA 1R0CA 3RF7A 3V1KA 3DLCA 1THZA 1FYFA 5L40A 4BFYA 1M75A 5AJHA 2VTDA 1XCLA 1SXJA 3PFHA 1D2AA 2AFHA 2HLDA 4IO1A 4TL6A 4G5OA 3TN7A 1ML3A 2IFTA 5AVZA 3CRW1 5SYAA 3H8WA 16PKA 1O54A 4MWSA 1XWFA 5KYXB 1RP7A 2IEZA 4OUDA 5DRYA 2ABWA 3TKYA 4NBSA 4PX3A 4FSDA 4V1CB 2K2WA 5F23A 2FMTA 1J7JA 5HZHA 1U3TA 2KQUA 2D5BA 4JY7A 2Z3VA 3W9SA 3M82A 3OLCX 3AUXA 1C7RA 1FFXA 2J3QA 1X38A 3IEXA 2Q0QA 1AUXA 2HREA 3QPUA 5C4IA 1P8JA 3EIUA 3TX6A 1XUOA 4Z99A 1FXSA 3RBVA 4FS8A 2XYQA 4WEOA 1QJCA 1RE1A 1E9VA 3HKCA 4JBWA 4NBNA 1EGMB 1ZK4A 2AJDA 3KV3O 3VNBA 4DXDA 4DUPA 4IRMA 4GI7A 3HDTA 2W2LA 2A35A 4TOIA 4WSOA 3QLVA 1LDMA 1W4ZA 2XKJE 1QR2A 3LJKA 1RJ9B 2JD1A 4G9EA 4J2TA 1GTSA 4W82A 1CDDA 1JJ7A 3ACDA 3IESA 3O8LA 2JCSA 2OHOA 3OZBA 5FWXA 3TQFA 1QHGA 1WB4A 4QBHA 3I0NA 4C4SA 3O4VA 1WZNA 4HBZA 3H84A 2G3YA 1UKCA 3X43A 1NR5A 2JGJA 2QZPA 4GE3A 1RC0A 3DGFC 3VISA 4CKBA 1M10A 2BKLA 3HO1A 3WL5A 1AQYA 1NVVR 2JH9A 1CIPA 4PLHA 3SOPA 2IS6A 3I73A 4FWBA 3E8SA 5E95A 2PHZA 1YRQA 3E5RA 2UZ0A 3OUZA 5TMBA 3REOA 3RU9A 3DZKA 4UJ3A 4MMXB 2R6HA 2J9ZB 3MGKA 1KI6A 3OF5A 2UZ3A 1U0LA 1ENYA 3BCUA 3SNKA 5JY1A 4ZO4A 3VDRA 4B75A 2Q5LA 5KYUA 5T4EA 3RYHB 3O4JA 3FJ1A 4CQLB 3IB3A 3TMAA 3QW2A 2YXDA 4FFOA 5CLLA 4E1VA 3KSMA 1VSBA 3C3MA 5JQWA 3U4HA 1K3UB 3I09A 4CMGA 4R1NA 4N47A 4KN8A 1XEXB 5TS3A 1NONA 3A9SA 4HEA6 4YJFB 1EXMA 1U2DC 5CPFA 3IE1A 1CYEA 4MQLA 1RLMA 1SU4A 3CNLA 2F9FA 1NZFA 2D5AA 4TZKA 5E0KB 5GGXA 3VKWA 4BMPB 2J9FB 3O8NA 1B3BA 4C0XA 5DULA 4AP5A 1VHJA 2VDJA 3O93A 4NATA 2FEPA 4X41A 2B8WA 3K6RA 4TL7A 4YAFA 3UT5A 4BQFA 3T5PA 4FWTA 2WVAA 2ZE5A 2HF2A 1HZJA 1SQGA 4ESEA 3R5FA 2P75A 3R4VA 1XZBA 4JKIA 4XQGA 3QKWA 4Y6PA 5ILGA 1LSSA 1VJRA 4UMEA 5E1MA 1IVSA 4Q3AA 3BERA 4DLRA 1C29B 4X1IA 4CKYA 2H1LA 4HR7A 2O3RA 4QGBA 3STWA 1XZAA 2OUKA 4NMHA 3TNYA 1L5HB 2I6SA 1IK6A 1GLNA 2J7PA 5H68A 2QX6A 1D8TA 4ZXPA 5LN1A 1Y6GA 1PT9A 3KU4A 2XUJA 2XDWA 3E9CA 2E82A 1Y34E 3K4HA 3OPYI 4KLNA 3G17A 1EUCA 3MXOA 3QEMB 4GRIA 2HEGA 2AZTA 5H3CA 1C30B 6REQA 1JPUA 2G36A 2WWRA 2DPYA 1VLVA 1VJGA 2GD0A 2QS9A 3KS9A 2QUZA 1XTVA 4C30A 1PHRA 2AJ8A 2OBNA 2X6QA 3I12A 1WA5A 4I4TF 4KR9A 3T4EA 2HMWA 3UMYA 3QW4B 2G76A 2OORC 3ONFA 3K6SB 2RBKA 4FYYA 1T5TA 1R15A 3VUFA 2OFFA 3JSXA 3NRCA 5CJPA 3RCBA 3DXFA 4HFNA 4NE7A 2X8BA 2ZRAA 5DV9A 3DBLA 3CX7A 4OMUA 4WK2B 3T3PB 1JEAA 2UVPA 1UFVA 1RQXA 3MYYA 1KK1A 2AMFA 2CUTA 4XWGA 4IIFA 3BVPA 5KVVA 3DMRA 1OB2A 4OXNA 1AHHA 2C84A 3WHPA 3AHDA 2OG2A 2I1QA 4IS2A 4ZVKA 4JT2A 1WW3A 2PSJA 1ICEA 3FG9A 1PUIA 3I1YA 2JRCA 1E6CA 3L18A 1U5CA 4B45A 1LPMA 2AC4A 4RO0A 1VJTA 5HWSA 2XGOA 2FN4A 3MINA 3RJ9A 4UDNA 2GZAA 5FNVA 4A3SA 5T5QA 2Y27A 1TRKA 2H2IA 3EVZA 4HDKA 4C4YA 2WSBA 4RQUA 4XDHA 1M8FA 4TMYA 2XITA 5B2FA 3GLFB 5CT9A 4CKEA 3E5HA 3OBIA 1RMTA 5DCUA 1V1RB 2XJ9A 4GKBA 4MUHA 5JAZA 1KI1A 3MA0A 4HJXA 1DHRA 3CUVA 3IEIA 1Z39A 2IS2A 4Q93A 1Z38A 4WN9A 3GJZA 5JS2A 1QWSA 5CG1A 1FEZA 1LRJA 1OX4B 1R4MB 2QTNA 1TF5A 2VQDA 3V7WA 3G2PA 2WHYA 1I7PA 3GDFA 1W88A 5L6MB 4X90A 2HCRA 3BE6A 4GMXA 4ZVQA 5JAMA 3VJKA 3W3AD 1WIWA 3H13A 1V5IA 3GQVA 1JIUA 4MV3A 5K3EA 1PL7A 4TTJA 4DARA 3UAXA 4JI6B 1QIFA 1I7DA 2BFEB 4E4YA 1FF9A 1BN6A 4ITRC 1FIUA 3ZHOA 1FMTA 3RBZA 4J0GA 3QJGA 5BSRA 2P0AA 4EL5A 3A6GA 3CUTA 2BISA 1S9DA 2GJKA 1KVRA 2QGNA 1V43A 1K6IA 1I10A 4GZ3A 4O4IB 3RRYA 2O54A 4F60A 5CPBA 1Y4SA 3S1LA 4I55F 4FHDA 4PC1A 3KHTA 1T1JA 4S2EA 3ESDA 4GM0A 1Y4UA 4FT4A 2NG1A 2HMAA 2GXAA 2CBXA 1P1FA 2OHJA 1S2DA 4D9JA 2JAUA 4YUYA 2GEJA 2WOJA 1PR6A 2WZCA 3BFJA 5AFSA 4DV4B 1JUDA 2E85A 2J48A 3NOXA 3RYFA 3KD2A 3HDJA 4INOA 5JV5A 3E7WA 3SP1A 1TADA 1OPRA 4AY3A 3IUMA 5J2UF 4ECEA 1R9JA 4QYSA 2OFXA 1YVPA 5ERGB 1O94C 4XWKA 1NQOA 4QX6A 1DBPA 2ZYHA 4OFXA 3S0JA 3HSKA 1VBMA 4BNDB 4LJ4A 1RXYA 2GNOA 3EGVA 5E4FA 4NZ9A 5IHPA 4N9QA 2JRLA 3FPHA 3AIMA 4OP2A 5DBOA 4EGAA 1M2FA 1ZXBA 4M1KA 2P6RA 1YBMA 5E9QA 1JYFA 3GPLA 1ONNA 2ZUTA 1XEFA 1QQ6A 2R7KA 3R3XA 3AL0C 2B7CA 2I87A 2JLSA 5HEKA 2WAYA 4G0YA 1OX5A 5K03A 1W36B 4Y8VA 4WJZA 1TUBB 3OU6A 3REFA 4DY4A 1E1MA 1ZOIA 2FEKA 2QGFA 4GPEA 4Q1CA 5JG7A 5J47A 4Z4HA 6YASA 1UK6A 1YQWA 1QE0A 1OKKA 4JLSA 3OOSA 5FA8A 1WETA 5IJZA 3BGDA 5EWJB 2IWHA 3V8PA 4EZIA 3HB9A 1JQKA 1IBMB 3L0DA 1F3OA 5KSOA 2OB1A 5EZ5A 5DTEA 2YZ2A 5DP1A 4HRVA 4YV2A 1P91A 1GXSA 3GGSA 4MVJM 4QELA 2PD4A 3B60A 4W8GA 5AK0A 4OQQA 2CT8A 1N3LA 1GV0A 1OLSA 3KWJA 2A0FA 4P1ZA 2CN1A 1XQVA 5F7ZA 4JSYA 2IZ1A 3O4GA 4I5EA 4KMSA 3P45A 4OHZA 4TV9A 2DUWA 5ALOA 3IT0A 4FE4A 3RT7A 4EX7A 2HHHB 2XA1A 1JG7A 3GGDA 3X2SA 4IQ8A 3BREA 1KIFA 2FK8A 5EIWA 3GLGE 3IEVA 1E0KA 1WAMA 3TOVA 5JTTA 2BGGA 1E63A 2FN8A 1H69A 2I2BA 3L41A 1BMTA 4RFVA 4Y9SA 5IN5A 2Y0EA 3ZU3A 4B3HA 4E5SA 4XLLA 3KSZO 1VCNA 3VPSA 2IEYA 2CYBA 2KE5A 3M1YA 2ZAMA 1FRZA 3U3RA 1C4WA 3KVRA 4NY1A 3KIPA 3M1IA 3ZTYA 2ZJ8A 4KQMA 3VRHA 2NO9A 2W6JD 4AJJA 2QX7A 3LUFA 1R66A 3GI1A 3MT7A 4Q9IA 4R1MA 1MW8X 3CUSA 1ZIXA 4BNZA 2CNDA 3EWIA 1QGED 1WUJS 2P4SA 3PNVA 3MTGA 4KH1A 4QUAA 1L5LA 1XMXA 3UPTA 2XB8A 1UP4A 4U2FA 1JSZA 1D7AA 5AP9A 3SDSA 2F8LA 5J23A 5EAIA 4Z9YA 1M6VA 2EBUA 4QOEA 3R5XA 3U4QB 2GK3A 5ULLA 3G9ZA 2HFJA 3KB2A 4MWGA 2XUPA 4QYMA 4IJWA 4RY2A 1P44A 3GUUA 1PCXA 3H11B 2E6UX 1PS0A 5DI9A 1JHRA 5DNWA 3DDNA 3KCQA 1WBDA 1AKQA 4J03A 4XVHA 2H2WA 1BFKA 4YRCA 2ALJA 5LP6C 4EJ6A 1GUBA 5CVUA 4MNTA 3JYOA 1GCIA 2J30A 1J0DA 4UAJA 1EWQA 3ZDQA 3JAMA 2J3EA 2E48A 3V8MA 4QPDA 2ZRPA 4WACA 3TWOA 3CS3A 4S35A 1Q83A 2E9SA 1V5WA 3D1JA 4TVSA 5K51A 4M8KA 3X2FA 3N8HA 3GG9A 4CEHA 3OCUA 3TJRA 3ECAA 1WOYA 1AGYA 3H2IA 3AY3A 4M0UA 3KL4A 2BLNA 3G2IA 1LPAB 3UN1A 1HETA 3GGPA 1VXOA 4X24A 3AFHA 1E4YA 4UMDA 3U60B 4YRTA 3G9QA 3H2HA 4EK9A 4TKVB 4GO1A 4CIWA 3BFXA 3QFHA 1MIOA 2YVUA 1EFPA 4I8IA 4TYWA 3ZV3A 1DQYA 3FCYA 3HCOA 1T0BA 2L82A 2BFFB 1FUIA 4G5QA 2XMSA 5EE3A 4Q9LA 1Q84A 5JZ9A 3VYRB 3FZGA 3CF4G 3OJEA 3NDBB 3PUVA 2PH1A 1FLAA 2V7QA 3O73A 2FLKA 4QUGA 1ZRHA 1JAIA 1NF2A 2JJ1D 2JGLA 3R74A 3SY8A 1EFHA 3V8NA 2JKVA 1OC4A 3WGKA 2OMEA 4MRMB 3RSHA 2BRUA 3KJNA 1QCCA 1RWWA 4CQMA 2Y1EA 3WDKA 2X9GA 3PDIB 2VDKB 3BE5A 4HGOA 3X3HA 1E2EA 5K6AA 4DADA 5HF9A 4CMJA 3B5JA 3FA2A 4J0JA 1MGOA 1XA3A 1TO2E 4BKOA 1ESDA 1SC9A 2YBDA 4HS9A 3WC4A 4AC9A 4RZUA 2QN9A 4NYMR 2DPLA 4PXAA 5HIJA 1JAHA 3FYCA 3D43A 4AS2A 2H2FA 1V4BA 4AG6A 2LCQA 5C5CA 3U7QB 3EGDB 3IKLA 4FOOA 3H5RA 1PJRA 2GXUA 1VMIA 3LOQA 1E59A 3NV7A 4J90A 4ZOBA 4EECA 4FD2A 5LQNA 2QX4A 1BKSB 4JFRA 1EEXB 3W6NA 3F46A 3LXRA 4OJYA 3O4HA 5T6BA 3WRWA 2PUEA 1TQHA 1J90A 1TQ8A 3EF1A 2P41A 2X3UA 1DAIA 2WT4A 4JWKA 5D6OA 3RD5A 3S2YA 3WBBA 3R4CA 2Z58A 4RPCA 1U0GA 3TZBA 1Z16A 2FUEA 3U4CA 2DFPA 1YVEI 3AESA 4P38A 1UDCA 4ZU1X 4HNVA 5B1YA 4RKQA 1IZZA 3UC9A 5JHHB 3SGLA 2IYEA 1F51E 3GD7A 1L2TA 1UJCA 1NE2A 3BMNB 3FB4A 3LYAA 4LVNA 2W6QA 3TB6A 3MT8A 1O6FA 3TSWA 4JI4B 4ZIRB 2BY4A 1F8FA 1NQ5A 3NWEA 4XVQA 3N2YA 5GOTA 3S2FA 4C04A 4LHSA 4ZEMA 5K0ZA 1NW5A 2J45A 4TRMA 3OG9A 4MHSA 1EVQA 4PYMA 4XIFA 3QY9A 5KX5F 1G5IA 3W04A 2WAXA 2O8EB 5BQXA 2Z2YA 3RKRA 3TUJC 2HLHA 4IVQA 2G09A 4D8YA 1ZD5A 3H6GA 3CUKA 1X7ZB 1O96A 5AVYA 4LFAB 3TTUA 3MMNA 4R6WA 5JY6A 1EX1A 3BDVA 5IJ0B 4EP1A 3BMOA 3UGKA 2QLJA 4L5YA 4BAGA 3JQDA 3E9RA 3BZUA 2C5GA 1QIIA 5GM1A 3UJ3X 4KJZA 5DM60 4OMDA 1T6NA 5G0SA 1LI4A 4JP1A 1QIJA 1ZUWA 5K7SA 5CU7A 1OHHD 3QOYA 3CNNA 4XD2A 5C18A 3DFIA 1BROA 1DBVO 4N3AA 1EFVB 1VKRA 1Z0IA 2ODPA 3BCRA 1KJNA 2SKCA 3IPYA 4UCXA 1BWPA 5DX1A 1HO3A 1PSZA 1Y4AE 5AKHA 2FUCA 1G9XA 2RH4A 2VYCA 3CWZA 1EM8A 2QMYA 1XPRA 5HF6A 3VNQA 1ZCBA 2ZIFA 3A6LA 1R0SA 3DEZA 4HNQA 4IJUA 4AW9A 4D6XA 2Q2NA 1K7CA 5M2QA 2V8BA 3EQZA 3KJZA 4TN5A 2EQAA 1LSJA 1FDWA 5JMOA 2A0YA 3UPUA 3IXMA 3KUCA 4GC9A 3WMGA 1T6BY 4K0KB 1PG5A 2PK3A 4PNPA 1X7YA 4BFCA 1IXZA 2Z9CA 2YRFA 4N5NA 1JG6A 4MCAA 3WYGA 3EEOA 3R9WA 3BGOS 1SBYA 3QX8A 3W3AA 3S3TA 3ZI0A 3GYGA 3DTNA 4HZUA 3LA8A 4U2EA 3OJ0A 1YC2A 1CVIA 3DE4X 4O2BA 3AINA 2VKQA 4ETNA 1RIFA 2BUAA 4OOEA 3VR2A 1N0HA 2HMTA 3LUHA 4FTWA 1IDOA 4BKRA 3G2OA 1SUSA 4KQCA 4MUGA 2CXXA 5JSYA 4N3GA 1T6XA 1IEVA 1VCHA 3G5MA 3D3QA 1L4KA 4OATA 1T2AA 1H9AA 1JV2B 1B00A 4LTNA 3H2ZA 4NRDA 5EJIA 2FQXA 1RPTA 2B2NA 1Z2CA 4P4SB 1C5KA 4LSGA 2IJGX 4MO9A 2I54A 2IXAA 4JEUA 2Q1UA 1BC5A 1UJMA 1RXIA 3AR9A 4LHWA 1YR2A 5EEGA 2QXYA 2JKYA 2XSZD 1SPXA 1ZLXA 2ZSAA 3GBPA 5EJAA 1XHFA 1SZJG 3MUOA 2XYGA 3LRPA 4IMPA 1WKBA 1TO6A 1EX6A 3F7TA 3MCVA 1SBHA 1AGPA 2YVAA 3UOWA 3L7DA 4M9QA 2WF7A 4GXNA 4B82A 2WE7A 1XELA 2HU2A 5TVKA 1BDHA 4GKKB 4WASA 3BZBA 1XD8A 4C3UA 1UL1X 3WL4A 5ITSA 4L3OA 5KTMA 2C5HA 5JI3E 3WO0A 1TMGE 2G0NA 2Y4NA 3PL5A 2EP5A 2BTOA 1U1DA 3KKOA 3F97A 3QSGA 2Q4EA 4ARZA 5IKMA 2BZGA 2EWVA 3F8SA 5IUNC 3TI9A 4Q18A 3PK0A 3MUEA 2Y0PA 3KQWA 4LPSA 1J8DA 3KLBA 4DJAA 1GRNA 1TZMA 4W7IA 3WWEA 4H6VA 4D4JA 1UPCA 3IS3A 5G4LA 3M5CA 2XPCA 4L78A 1L5SA 2PIAA 5KNCH 3MN1A 2HMUA 3TD2A 1II8A 1YZTA 3ZJTA 3TMKA 1J5PA 2BR3A 3T7DA 1LLUA 3RVBA 1USUA 3TKAA 4AO8A 1IOWA 2UAGA 2E5WA 2IYTA 4C7JA 1O6ZA 4OQDA 1R8SA 3T3GA 3TYXA 3LCMA 3AVUA 4ZRMA 1Z6YA 2YIMA 3P0EA 3V3TA 2ZSDA 3NASA 4W9RA 4ETWA 4ZI7F 3OTOB 2R85A 3QE3A 3CVXA 2CLIB 1JMVA 5EGSA 1P4RA 4AWBA 3FNEA 4QDJA 2SKEA 3H1TA 1CPYA 1LI5A 1O87A 1VGQA 3LZCA 1XQYA 2O8VA 2XWSA 1YB7A 1ZM9A 3QG5A 1RKVA 4DLUA 1MEOA 2DU8A 5E4YA 5G0WA 3REQA 1F0PA 1YMQA 1JHVA 3DFFA 4MUNA 4ARAA 1EI9A 3TR5A 2EIXA 2XODA 4DVJA 3RFTA 1BO6A 2BM1A 5BVHA 3EIHA 5K8LA 1B74A 2C03A 2ESRA 2FRVA 1MOSA 4LJAA 5B12A 5KWIA 3L8EA 3OE5A 2CL5A 2ISSD 4EM6A 1A2OA 2AS0A 4EMTA 1B16A 1GR1A 1E2GA 1LF5A 5DNDA 3GLHE 3M70A 1G5RA 3ONDA 2QIPA 3GRAA 3SEQA 5L3SB 2IIBA 4G4JA 5A03A 2BFNA 2R8ZA 3ZWXA 1DIHA 1IJBA 3GNTA 1SC4A 1UMDB 3BS4A 3KJIA 2VNHA 4WXYB 1LBIA 5H02A 4ZFNA 1J42A 1V5GA 3OC6A 2FMKA 3MTQA 4CT4B 4RTRA 4B83A 3ISVA 3T1YB 3NHAA 3N8NA 4ZTZB 3HKDB 4IBOA 5REQB 1FCJA 1GNTA 2IYRA 4W8OA 1J9EA 1K98A 4ZYLA 2R6JA 3IA7A 1CUDA 1WMEA 1Z73A 2F8MA 2UDPA 2CFOA 3EG9B 1N6OA 3OHMA 4OJNA 1RZUA 4D0LB 1U1FA 1VKOA 3DGEC 1V95A 3THXB 1ZITA 1NY5A 2VPYA 4B4KA 5L7WA 5IJ9B 4K05A 4UNRA 3PGJA 2NLOA 1EXVA 1L7BA 1ESMA 3P4XA 3PGMA 4JNCA 2VC2B 2ARKA 1BJRE 1XA0A 2Y1DA 3NKLA 4BIMA 4JI5B 1ENPA 1ZUIA 1J8YF 1K5GA 3IA2A 4X6UA 4FNMA 5F7OA 4TYNA 3JWIA 3HVKA 3KV1A 3OF3A 1NL3A 3R75A 2FW0A 1MIHA 3L6BA 4HOYA 1DXOA 2GZMA 4G5SA 4BO0A 1B8UA 2DECA 2I9PA 3GB9A 3HEAA 4RANA 4Y30A 4LRQA 4O1HA 4FXPA 5I9IA 1OFTA 1CY0A 4MLDA 3LT0A 3KUDA 4NXNB 1UXOA 5LOVF 3GN1A 1D4FA 2ETXA 3KQMA 1MO4A 1JSXA 3KHUA 2AVNA 1A04A 1ORTA 2CJWA 2D1SA 1Y3IA 3K3PA 4KPEC 4YPVA 2FQ1A 1FXWF 4KQJA 3U31A 1KOLA 2DCUA 2JI9A 4YQEA 3IXLA 1KGDA 1RFGE 1YU6A 2EGGA 2L19A 2WLSA 3EOZA 4H35A 4IG4A 5SZIA 5EINA 1K6MA 1WW8A 1T3TA 2IUFA 2JJ1A 1IY1A 2NO1A 2ZETA 3ZIDA 1DWPA 4CM4B 3TRKA 2LXNA 2HSZA 1T1IA 2H18A 1I4WA 1J07A 4K6HA 5KNCA 3QXSA 3EWAA 3IDFA 4AZWA 2CXUA 1YR3A 2FMXA 3AI3A 3G85A 3N2NA 5CIYA 2LVBA 1VPWA 4C2TA 1O9HA 3GAAA 1QU3A 3LKDA 1Q7CA 1W4LA 3WRXA 4O3MA 5A1TA 3CVVA 3PGKA 4OY3A 2VJMB 4WZBE 1EE2A 3Q3VA 4R8KA 4LWOA 2PV7A 3D3JA 2YS7A 2PMBA 4REMA 4ZAGA 3OP4A 4A0GA 4B3CA 5IDXA 1HTTA 2VQ6A 1G98A 1PV2A 2WKPA 2JGEA 2H29A 3QVSA 5EIOA 4DN6A 2G8NA 3UKJA 3ONNA 4FGWA 2QUIA 1X3LA 2EOAA 2FPWA 2VJOA 4IDNA 3Q9LA 3MMPA 4KWCA 1F2UB 3B8HA 2OG1A 2A3NA 1WHTB 3SBEA 3TQRA 1T0JB 5CVTA 4C08A 2X76A 2Z4TA 5T6MA 3GNLA 3EGWA 5HZGA 1BDMA 1JHOA 3L4SO 4N76A 1TTHA 3BKXA 5DHAA 4EFNA 4Z7NB 2R3SA 3P94A 4Y2PA 5DI3A 1GG9A 2GARA 3N8KA 3RWMB 2WU1A 4CNQA 4PAGA 1NJ5A 3FSRA 2BJVA 1EAMA 1ISFA 5BW6B 1MG5A 4C7OB 1I9GA 3FPAA 1EJ0A 1SWVA 4XIYA 3VNRA 4LDPA 2JLRA 3HJBA 1FRQA 2J3KA 3AO0B 3EXHC 3MTDA 2GTPA 3CF0A 4JBYA 4F45A 5CB4F 1Q0QA 4FM9A 2F64A 1KMCA 1U65A 3PNKA 4J2HA 4JB0A 4PCUA 4DGQA 2IBTA 1MA0A 2D2FA 2FZ4A 3KZXA 5ARBA 5HKKA 3KETA 4UVGA 1WV1A 4C78A 1LGYA 4ZVRA 4E5UA 4C9BA 1KZ9A 3I30X 1M2NA 3INRA 1F1BA 3I6ZA 4FUTA