3BFKA

Crystal structure of plasmodium falciparum rab11a in complex with gdp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
173
structure length
159
Chain Sequence
b'DYYDYLFKIVLIGDSGVGKSNLLSRFTRDEFNLGVEFATKSIQLNNKIIKAQIWDTAITSAYYRGAVGALLVYDITKKNSFENIEKWLKELRDNADSNIVILLVGNKSDLKHLRVINDNDATQYAKKEKLAFIETSALEATNVELAFHQLLNEIYNVRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small GTPase Rab11
publication title Crystal structure of Plasmodium falciparum Rab11a in complex with GDP.
rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
total genus 54
structure length 159
sequence length 173
chains with identical sequence B, C, D, E
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bfkA00
2V9PA 3O8CA 4YQFA 2IK8A 3N2EA 4KCGA 1CR0A 1XBTA 2HJVA 2XEXA 1NG1A 3KJGA 4IVPA 4L16A 4OI2A 3GLIA 2F1IA 3CUEF 4HATA 3UG6A 4DLSA 5E7IA 2GJAA 1GOTA 2CLSA 4HUTA 5JCZA 3R9WA 1CRQA 1TQ4A 4FMCB 1M74A 1NKSA 4M1TA 4CEHA 3RS2A 3FPAA 2YINC 4JBXA 4TYNA 4LSGA 2RGCA 3AF3A 4BFXA 1OB2A 2DPXA 2H8KA 4ZDJA 1RRFA 3VNVA 2EFCB 4AD8A 1G9XA 3D6TB 4I1SA 3OIVA 4AI6A 1JR3D 5FTNA 5B2ZA 1OXTA 4OHVA 2O8FB 3A4NA 4RY2A 3LAWA 3LX5A 3QXJA 5GJBA 1GSIA 4PZZA 5DN6A 3KQUA 3TQFA 2O0JA 1Y63A 1ZM7A 4LRWA 1KIMA 3B5JA 2GF9A 3N5CA 5JCPA 3SHWA 5L3QB 3GQBA 1HE8B 4QGAA 4LHZA 1RJ9B 1CP2A 4Q00A 1E9BA 3SNHA 2F1RA 1R8SA 3UMFA 2OFOA 1CXZA 1WXQA 3D31A 4PO9A 5F9HA 4KBGA 1MO4A 3KTAB 5TDHA 2P6UA 3MCAA 3OAAA 5CIQA 2IYZA 3MMPA 4IOKA 4NYMR 4KV9A 2F7SA 4N3NA 1U2RA 5EXTA 5JLJA 2B8TA 2QAGA 4LJ8A 5J40A 3SU8A 4BLOA 3CNOA 1TU4A 4JKYA 1VCNA 4PHGA 1XD9A 1U0JA 5L3SA 2VA8A 2FSIA 2JASA 4JLMA 1JEEA 1ZM9A 2WIBA 2VHUA 5E7MA 4ESVA 4PPNA 3K9HA 1BYUA 1KI6A 1QVAA 4M9SA 1SVIA 5L3VA 4A9AA 3T12A 2CJWA 3RRYA 1G4AE 1QHGA 4RCZA 1Z07A 4CEJB 2HLDA 1T4GA 2O8BB 3DPUA 1N6IA 1AM4D 2PCLA 1E4YA 1U90A 4XSHA 4TL9A 4IEIA 3CF0A 1G19A 2F3RA 4A6PA 3B1XA 3ZDQA 1YZLA 5KDLA 4B43A 5KOYA 2WJHA 3MGCA 721PA 3AP3A 5B58C 5IF9A 1FMJA 3F5FA 1FX0B 4NONA 1E79A 2ZU0C 1EFUA 2QRNA 3QBVA 2QROA 3LVRE 4JKIA 5FUXA 3RS3A 3SDZA 1E9EA 1R10A 1E3MA 1CF4A 2JJ1A 2ZE5A 3CNNA 2XZLA 1N6PA 3PFIA 5JS7A 2J0QA 3AKYA 3I32A 3H2YA 4XJXA 3DOEA 1E2EA 4H9GA 3OEEA 421PA 1SXJB 3VR5A 1MKYA 2ZRHA 5AJZA 3T5GA 1TMKA 2CE7A 4UNNA 1IN5A 2W6ID 4YMWA 4D25A 1ZM3A 4X8OA 3UWOA 5BN5A 8OHMA 3LFUA 1R8QA 2FPKA 3QKRB 3KTAA 3MAAC 5EE9A 4MDFA 4QXAA 5AJYA 4W5JA 1DPFA 2MSCB 2AFHE 3K9NA 1Z08A 2FMXA 2ZE6A 4V02A 3A58B 4A15A 3PJRA 1ZM4A 2F9MA 4OKSA 1US8B 3AGPA 2D74A 1TUIA 2QTHA 3A1WA 4QHYA 4CIDA 5BN3A 5JMTA 1R5NA 2H17A 2ODEA 4TMKA 1HT1E 2ZI7A 3D3QA 2J0VA 2NOAA 4KSCA 3SFZA 3KZ1E 1NN0A 1IQPA 4NYIR 5JJIA 2OT3B 3B60A 1Z0KA 5CK5A 3TE6A 4RSGA 3I8XA 5FOTA 4DCUA 4PZLA 3GJ5A 2ZVPX 1S8FA 5EZ6B 2C03A 5JHHB 2QUZA 2OE2A 2GVZC 1Z6AA 4US1R 4TL7A 4BLQA 4MKGA 3ZVRA 5KNCA 3OE7D 2NMVA 1FQKA 2JLRA 4LUCA 4Q1AA 4IOMA 2JLWA 5AJXA 1NRJB 3AKDA 4LYFA 4MH0R 4RD2A 4NDZA 5D3MB 3KQNA 3VHXA 1A2KC 3EX7C 4FCWA 3UPUA 5FTJA 2KSQA 4ARZA 4CEJA 2GXSA 2A5GA 4Q9KA 1XPUA 4Q7LA 4QBHA 1II8B 2VHTA 4Q48A 5FOWA 4AC9A 5DN6D 1IJEA 4C0JA 5K8LA 2A30A 1G20E 4R71A 2PH1A 4NCJA 1G7RA 1U9IA 2Q21A 1U9IC 1Z8FA 3OIYA 3RVBA 2JLQA 1VCMA 1XJQA 3KUDA 3IDQA 4DJTA 1Z2AA 4BECA 1ZUIA 3ETLA 3U7EB 4AIIA 1G5RA 1E9FA 1IXSB 2QMEA 4MYUA 4F4CA 2HJGA 2GRJA 1DELA 1MABB 3AVXA 2WJGA 5GJWC 2R8RA 1XZPA 3B1VA 1WDTA 3JVUA 1OXUA 4P4SB 2HCJB 1XTKA 1ZRHA 4YDHB 3NDBB 4QNRA 3J81k 2OHFA 2V55B 5TY0A 2CL7X 3O8DA 3KXLA 1WBBA 3OAAD 4I1UA 2BDTA 3CNLA 3DHWC 1NNEA 3FWYA 4FCTA 1SXJA 1XTQA 4IFBA 4C0KA 3EARA 1IY0A 4Q47A 2OCAA 2CHVA 2NO6A 1QVRA 1Q22A 3F0TA 4HDQB 3CR7A 1OFIA 3NWJA 4WAUA 2A5DA 4Q02A 1R4AA 3DMDA 4MGZR 1SVMA 3CRQA 5EE1A 1T3HA 2OG2A 3AUYA 5KNDA 4I99A 2WKRA 2QE7A 3EZ9A 1M8PA 2NGRA 1US8A 5EE3A 1FUUA 4QJ3A 3P27A 3RHFA 1XEXB 1C1YA 1OXSC 2QPAA 4UNSA 3P26A 1COWA 1NSTA 5FTLA 1RKBA 2DFNA 4A0FA 4MQBA 1F2UB 1EWRA 2HLDD 3EZ2A 4DXAA 4PAMA 3LA6A 1KJYA 2ZJZA 3IHLA 2FF7A 1KK1A 1XEWX 4FN5A 1W2HA 3K0CA 3EIHA 3WMFA 3K0CC 2J46A 2FX3A 1N5IA 4POAA 1BIFA 4V0LA 2CLCX 4MRSA 2ERXA 1E79D 2H7VA 1MRNA 1GRQA 2O8EB 3CZQA 2Z43A 3WNBA 1II8A 2JJ1D 3EZ7A 3U7FB 2FSGA 1E4VA 3QNUA 5JS8A 3W6NA 4DHEA 5F98A 4QOSA 4LY6A 4NKRA 3U4QA 4G3XA 2GAAA 4Q1FA 3IIKA 3S1AB 3JZMA 3HPRA 2QA5A 2CXXA 4Q21A 1NG9A 1UFQA 2DWOA 2R6DA 4NL4H 4Q4HB 1YR9A 3AVQA 3W3ZB 1G7TA 3ZS9A 1SXJE 2FG5A 4P4SA 4PX9A 5L8VA 4O2RA 5GJCA 1EFHA 4LBVA 4U02A 4BLSA 2ZM5A 2JJ8A 4JYCA 1XEFA 3KQHA 1JJVA 3TKLA 2NTYC 4DZZA 3ZVNA 1JPNA 3EZFA 1N5LA 4Q4LA 2YV5A 3K9GA 5KU1A 4R7ZA 5EE0A 1J8MF 1Q1BA 3NBFA 4PAQA 3ZLJA 1G16A 2WTUA 4UNRA 4L4UA 1ZU5A 3IQWA 4Q7KA 1U98A 4UXHA 3B9PA 1BO6A 4NYJQ 1WBDA 4P0TA 1FFHA 3CM0A 4QM7A 1TU3A 2B21A 1DAIA 3BFKA 4ZKDA 3UMRA 1E98A 3BAFA 4DLXA 2K5UA 2PMKA 1G8YA 4RD1A 3BD9A 2RCNA 4HUQB 1K5DA 2ORVA 2P65A 1P3JA 1WP9A 2KI5A 1E32A 1Z47A 3SC3A 5K8TA 2Y8EA 4JL5A 2EQBA 3SZRA 4A8JB 3MJHA 3FOZA 5F9FA 4MRPA 4M1KA 3FHCB 3U44B 2OCBA 2OXCA 2P3SA 2QSYA 2WHXA 2Q3HA 1XMJA 5AJVB 2ZE8A 2ANBA 5FBWB 4GL2A 5FUWA 3KJEA 2GEVA 4G5GA 4L5BA 1K8RA 3H4MA 2CL6X 4FXPA 3SE0A 4B3DA 4F7WA 4ERNA 2H57A 1KMHB 3B9QA 3BB1A 1KAGA 3GLGA 4P4TA 3WY9A 2N42A 3I72A 2KBFA 4US2R 2C5LA 5B57C 5LD2C 2HYIC 1G5PA 1VMAA 4DC9A 1AQUA 2ZI3A 2BMFA 5DYGA 4M1SA 4YLGA 3WRYC 5A4JA 1KSGA 3LNCA 2RGNA 2H1LA 2RGNC 1HH4A 2O8EA 1RW4A 2GJKA 3AQ4A 2WSSA 1R0YA 2FU5C 3PEYA 1XCGB 2J7PA 3G82C 2D7DA 1WA5A 3BH6A 4OQXA 1P62B 5DIFA 2VHQA 1R0XA 3BOSA 1GITA 4KFTA 2ZI5A 3BFVA 4DIDA 1NLFA 3TAHA 1BMFA 2GF0A 4Q4JB 1AS0A 1ZC4A 1OFUX 2D4HA 4KXFB 4GRAA 4Q4HA 4RD4A 4HAUA 5CLQA 3A4MA 2GWHA 3PG5A 3QQ5A 3LRPA 5DI3B 2J0SA 2G9NA 2P2LA 1G64A 2XSZA 1QHYA 3TGPA 3NG1A 1W0JD 2IYLD 3CX8A 1W4CA 1CR1A 2QAJA 2XTNA 4TT3D 3V4RA 4IXMA 3GEIA 1SVOA 4LC1A 4BEBA 3SQWA 1NL3A 1S2MA 4IDPA 4BFZA 2BEJA 2IF2A 3EA5A 4PC6A 3SEAA 3SI7A 4LX0A 3AF0A 2WPDA 2WWFA 2IT1A 1E2HA 1TEXA 1TADA 4TLBA 3SJZA 3VMFA 1NIPA 4YMUA 3K70B 4F38A 1VHLA 1DEKA 1EG7A 1UKZA 2R2AA 3PUXA 4LJAA 2IYRA 5F2EA 3W9YA 5AUOB 3AP1A 4HB2A 4A8JA 1SZPA 3WHLA 2DCUA 5H1YA 1DTSA 221PA 2J5XA 3GLGE 1KHTA 3U44A 3C5HA 3DZ8A 1FP7A 4NYIQ 3D7MA 2J0UA 2OESA 2J9RA 1YRAA 2ERYA 1B23P 1E0AA 3CKLA 1M2OB 1QG4A 2WMOB 2YOHA 2X19A 2XITA 2AXPA 5FR1A 3I73A 2GK6A 1RC8A 1P2VA 1KMHA 2ONJA 1RYHA 1N6RA 4C0BA 4MGIR 1N6KA 1HQYE 3QKUA 4QC2A 1UKEA 2XGJA 1CRPA 3TUZC 2DHRA 1H65A 3T1QA 3TQCA 1N6OA 2CNWA 1IOZA 4AYXA 3U3MA 2ATXA 4AKEA 4YONB 4JLOA 2F1JA 2XAUA 3E5HA 4KU4A 2X2EA 1U0LA 2Z6VA 2GHIA 3HYRA 2ZSEA 4G5OA 4E03A 4YXWA 3GCGA 2ZAMA 3OIUA 4GZMA 2YKGA 3NTUA 2P6RA 1P2SA 2WJIA 1ZIPA 5IDVA 4Z1MA 4MKHA 1OH5A 3I92A 5FUYA 4WIAA 3CB4A 2FGKA 1PJRA 4Q18A 2QBYB 1UBEA 3KKOA 3TAUA 2BM0A 3CRRA 2KJQA 5CDFE 4DDWA 1QG2A 3LH5A 4M0LA 5JSZB 2FV8A 1R7RA 5EP1A 4JIMA 2X77A 1OFHA 2IUUA 1E1QD 2JJ2A 3W5IA 2HF9A 2FZLA 5GVRA 3PUYA 1NBMA 5BWMA 3D8BA 4GMDA 2OEPA 3IILA 4UNPA 1VYUA 3VTKA 4BASA 5FFMA 1OIVA 2ZITA 1TNDA 2VRWA 3KJIA 3MLEA 1ZBDA 4DLRA 1T8UA 4FMBB 5FBQB 1XNJA 4DUGA 5JI2E 2BCJQ 4LC0A 1G3IA 4RZ2A 4EQ6B 2ZU6A 1OJLA 4PTLA 4RD6A 1PUIA 3T1OA 5EXXA 4NE2A 2V4ZA 2O8DB 2AD1A 4DEXA 5JWRA 5CK4A 5FPHA 5P21A 1BKDR 2W2VA 2BBWA 3F8TA 2GEUA 1Z6TA 5EP3A 4JLJA 3LLMA 2P67A 4KITB 1A1VA 1W4RA 1VTKA 2VLIA 3PEVA 5TVKA 4PHHA 4KHZA 4EIWA 1NN1A 2XNDA 4K8OA 1G3QA 2QEQA 4PC7A 1T91A 3RS4A 2V1XA 3B1ZA 1S4QA 3L0PA 3NEJA 1Z6YA 2GKSA 2VYFA 4C0SA 4D4LA 4HI0E 3PR1A 2BHRA 2GJ9A 2G6BA 3GJ6A 5G3ZA 2IS1A 3QXHA 1FQJA 4C0LA 3L43A 1CLUA 4UXJA 3OZXA 1QBKC 1UEIA 5J5CA 4ZDIA 3UATA 3B82A 4QBIA 5KSOA 1CS4C 2F43B 3QXCA 4G5RA 4DB4A 5HCIA 4I1VA 4M1YA 2VHCA 1DADA 1YQTA 3IIMA 2OILA 2XSZD 2XOKA 5E4FA 4TYWA 3LDAA 1U8ZA 4DLTA 1W36C 3ICEA 4MYTA 3VKWA 4LJ4A 1TQ6A 5CM9C 1KOFA 1FOEB 3AGQA 4US0R 3LXXA 3BB4A 2JLZA 4X8HA 4GMXA 2CK3D 4QHSA 3KX2A 1NBME 3BBPA 2GCOB 2QP3A 4B35A 4DLZA 1P61B 2C96A 1FPMA 2ZAOA 5IK2A 1Q1QA 4B33A 3WMGA 5JSZA 1RFLA 2ZJAA 3RSOA 2N1BA 2ZJOA 4JYBA 4DSTA 4DVGA 2AFIE 1IN4A 5HPYB 4KO8A 2PZEA 3IHWA 4QG7A 1YE8A 6Q21A 5FPTA 3HU2A 3CX7A 3CIOA 1G7CA 1N3BA 2IYSA 1HURA 3NBYC 4LYHA 3ASYA 4TMVA 4URUR 4NCNA 1YZTA 3MWLA 2IC5A 2IXGA 3IPXA 2E1RA 2IHYA 1GRRA 3E70C 3WMEA 3PQCA 1CJTC 3HPQA 2I1QA 3U2QA 5J4YA 1K6MA 1CULC 2IYVA 4XVQA 3SQXA 4X8MA 3I3SR 3EIQA 2O8DA 1DG3A 3TSWA 1Z6XA 5E7JA 5GADl 2EFGA 4UJ3A 2ASEA 4MUAA 1X6VA 4DKXA 4W7SA 5EXSA 4IDQA 2D2FA 3K09C 3PENA 4V0NA 3VR1A 3AUXA 4LBZA 4C4PA 1XXHB 1E0SA 1P9WA 1BYIA 2B7CA 2G1KA 2RAPA 1V5WA 1G41A 2AX4A 4FMDF 3NKVA 1E2MA 4OHXA 4LYJA 2RKOA 3QKTA 1ETUA 2CBZA 4B2LA 3QE0A 4Z1MD 3SBEA 2FWRA 3KFXA 3AF1A 4OL0A 4A82A 2ZRDA 5C2JB 4RFVA 4E22A 3QIAA 2BOVA 2D06A 2FNAA 3KUCA 4IOJA 4F4IA 5B30A 2A9KA 2IXFA 4P3YA 2BBTA 4Q7MB 1KI9A 5DI9A 2LKDA 2J45A 4NHOA 1KI1A 1NLYA 1RPZA 1MO6A 1AGPA 1N5KA 2FEMA 2ONKA 2GXQA 3K0FB 2DFKB 3IEVA 2A2ZA 2JJ2D 2VP5A 3AH8A 1N2CE 5JRJA 4N0DA 3LD9A 3I62A 1TL7C 2VH5R 1E1RA 1DAHA 4M2LA 4F93B 2C9OA 2G0TA 4ASUD 4FIDA 1R0ZA 1AK2A 2UZ3A 1J70A 4PR0A 5KPDA 1XF9A 3KKPA 1F3OA 3GJ4A 1TF7A 2QM7A 4K81B 3AB3A 5LBIA 2JIZA 4HDOB 1U99A 1AZTA 2JLXA 4UXIA 3RANA 2FZ4A 2C77A 5KHOC 1QZXA 1S3GA 4IDOA 2J7KA 2GZDA 1ESMA 2CVHA 1E9RA 3AVPA 3IUYA 3EXAA 3MRSA 2CVFA 1Z3IX 3DMNA 2H5EA 2RGDA 3DO6A 2I1VB 2EFHB 1NJFA 3A8TA 1SVWA 1MV5A 2XNDD 1XU4A 2DWPA 1UDXA 2J3EA 2QP4A 1MH1A 3B2EA 3NC1C 3NVAA 4O2LA 4LWZA 4IHQA 3ZYCA 2IX3A 3VKGA 2QAGC 3UANA 3KB2A 1W46A 1NVWQ 1HQCA 1KMQA 4BWYA 1FNNA 2HF8A 1PLLA 1TTTA 4A2QA 5FH9A 2W6JD 2D2EA 1Q20A 4EJSB 2PJZA 3IIJA 4M9XA 4WOPA 2OLJA 3LX8A 4R2HA 2A5JA 5J4LA 4TZ6A 1E96A 4C30A 1CJUC 1XXHA 2ZRKA 4PO8A 4W5HA 4XIGS 2EWVA 2IW3A 4GOJA 3Q8XB 4HYYA 5HE8A 1UEJA 4YMVA 5DH9A 1J8YF 1SHZA 3RRNA 2C99A 5BQ5A 4I4LA 1W36D 1YHNA 1W4AA 4DCSA 1QHNA 4EAQA 4G0NA 4RD0A 3UG7A 4EFLA 4DLVA 2QY9A 4HLDA 5FPKA 3KL4A 5FI0B 1E2PA 2OM2A 3FKSD 2BBOA 3PXGA 3RLFA 1LS1A 3TW8B 1DAEA 2OBMA 5DSZA 3V00A 1E2QA 1LS6A 1MRSA 3RAPR 1IY2A 2YWFA 3VFDA 4HAWA 5IK2D 3PUVA 4QL3A 1C4OA 3LBIA 3R8CA 3TJZA 4OQMA 4DWJA 3U6KA 3K0FA 2G77B 2CE2X 2O8FA 1IBRA 1IAQA 1N5JA 4U7DA 4PQFA 3GEEA 1Q1ZA 1N0UA 3X1ZA 4JLNA 5CJPA 1Z28A 1VKJA 1CR4A 2V3CC 4LOAA 1LFDB 4NCIA 2MSDB 4B6EA 4WA7A 2PCJA 1P5ZB 4Z8YA 1EXMA 5L3QA 1L2TA 2IYTA 1N6HA 1RJ9A 2QZ4A 4L9SA 2ZSFA 2IA5A 4DB2A 5JRZA 5A0FA 2QMUA 2YNMA 3AP2A 3SJAA 1TAGA 3FMFA 2F3TA 4TLAA 2JLVA 3TH5A 3T61A 2BEKA 3EW9A 2QGZA 3W90A 1Q44A 2JDIA 4EDHA 1G17A 1IN7A 1T0JB 3VR3A 1DE0A 1OKKD 1Z0DA 4LHYA 4MKIA 3IPYA 3LV8A 3KKQA 4AKIA 3ZIAA 1ZCAA 4C0HA 2YJTD 3NC0C 2WJYA 4MYHA 1LNZA 1AKYA 4KFRA 4WXPA 1QF9A 3L0SA 4TL8A 1XXHE 3ADKA 1IM2A 3W6PA 5AR1A 3KB1A 4IEEA 1XD2B 1J2JA 2ZS7A 4ZPXA 3PEWA 4YMSA 1KNQA 2XB4A 1AA9A 1G3RA 3DVLA 4EJSA 5AJWA 1UPTA 4JS0A 5BW8A 4RFSB 3NDPA 5JEDA 1EX7A 2PZGA 4QFMA 5FL7A 1KSFX 1S1CA 2EVWX 2NO7A 2YOGA 3ZZ0A 2ZR0A 4DLWA 1RRPA 1F48A 2O8BA 1QHXA 1BH2A 3RWOA 2WIAA 4JBYA 3M6AA 4HZIA 4DLUA 4I1OA 2FEOA 3N2IA 5G41A 3K1JA 3H86A 4ZDKA 1E1RD 2B8WA 1DAMA 4B2IA 4JVMA 1CU1A 1KTVA 2ZREA 4IDHA 1G18A 1LW7A 1Z6GA 2XB2A 4HAVA 3LWNA 1TQDA 1FX0A 3EWAA 4TL6A 3FMIA 3OFNA 1F2TB 4JL6A 3CW2A 4FMCF 3SS8A 3CBQA 521PA 3QG1A 1RYFA 2BMEA 3AF4A 3W5JA 1N0WA 3TBKA 4B3BA 1J90A 1FP6A 4A2WA 3PUZA 4LZZA 2AR7A 3IKJA 3ZVLA 1SXJC 5TB5A 1Z2CA 5M04A 4BGDA 3IO3A 2F55A 4Q5IA 3RNLA 2C9CA 3I1FA 2XZOA 3UMSA 1G6HA 2HXSA 2PLFA 3QKRA 1W2GA 4O0MA 1LB1B 4GOKA 3LVQE 4Q1CA 4D4KA 3CR8A 1SVSA 2R6GA 1YR8A 4JJKA 2WV9A 1KI8A 2VQSA 4U00A 4BFTA 2MMCA 3BE4A 2Q0HA 3RWMB 4GSYA 4BFVA 1EFCA 2H16A 3LW7A 1A5TA 1KY2A 2GESA 1U8YA 1WE2A 1XD2A 1R5BA 1T5LA 2VPPA 2EFEB 3AV0B 3HU3A 5BYJA 2AK2A 4C9BA 3CLVA 4PO1A 4IVQA 2FFBA 1XCMA 2A5YB 4RFSA 1CEEA 4N0EA 4DCVA 2BMJA 1VDZA 4B3CA 4D4MA 3ZS8A 3AKCA 4ITRC 3F3YA 5D3MA 4B48A 3IBGA 2FPLA 3NHBA 4Q4AB 2C2HA 1XTIA 4EPVA 1LVGA 2ECKA 4RCYA 1YZNA 1KDOA 2FFHA 4FI3C 1VG1A 1P9RA 2QQEA 5CM8B 2BCGY 3BRWD 3MJRA 2ODWA 3V4FA 5JI3E 4TSFA 1TX4B 2ZE7A 1G3UA 1U8AA 3M1IA 4MGKR 4PPGA 4EPWA 5FOVA 5JEEA 1MR3F 3OEED 1AQYA 4RZXA 2ZYWX 1H8EA 4TMXA 5D3QA 3PVSA 4HLQB 1MABA 4KLNA 2W2TA 1DBSA 4G01B 4KAXA 4P31A 3WYAA 5JWOA 1HT2E 3TIFA 4XTRA 3VR6A 2PX3A 5FPSA 1OIXA 1YZUA 1F2TA 3UXMA 2JDID 4PXAA 4LJ5A 1GRNA 1U0HC 2NPFA 3DM9B 5LB4A 4OI1A 2IUTA 1OPXA 5CIWA 1A82A 3U3OA 3U7HB 1R6BX 4KSBA 3SOPA 3EASA 1YVDA 3T1VA 3TRFA 621PA 1AS3A 2IYWA 4NBSA 4DSOA 3X1YA 5AK0A 2GILA 1W4BA 3ONWA 2W0SA 1W49A 1XMSA 3B13B 4C0QC 2R65A 1NP6A 2VF7A 2C04A 3HJNA 1KZGB 2VP0A 1R5OA 3EC2A 1NN5A 2GCNA 4NTZA 1L4YA 4Q9LA 1LTQA 2YC4C 2B7BA 4JSTA 2IWHA 3AVTA 4R98A 1W7AA 1GL7A 3B78A 1L7VC 2GXUA 4G5SA 1QHHB 1XEXA 5JBQA 1W0KA 3WYFA 2VP4A 2ZSBA 4NYMQ 4D4JA 4GZLA 4TQUS 1E0KA 2NIPA 1S9HA 2RGBA 2N46A 2CLDX 2QM8A 3ND8A 4I81A 3K9LA 1GTVA 1F2UA 2Z83A 3FTQA 4CW7A 821PA 2O8CB 1OYWA 3AVWA 1UBCA 5KYKA 3WRXC 1VG8A 4LDJA 1X8LA 2H92A 2QQ0A 2Q3FA 4BPBA 1RRCA 2ZRPA 2ZSAA 4ZCIA 4QBFA 1LF0A 2MSEB 3BJIC 4NU0A 3ICQB 3KQLA 4Q4AA 1YR7A 1ZD9A 1VIYA 3LW8A 1T6NA 2BJVA 1A4RA 2P5TB 3OF5A 3KXIA 4DDUA 3O8BA 3OFND 1JXOA 5HTKA 4JLKA 2XJ9A 4V0OA 4XD7A 2FFAA 1XJCA 2QNRA 1D9ZA 2B92A 3HU1A 4OYHA 2HYDA 3THYB 2WMNB 3RS0A 4LV5B 1P72A 4ZCLA 4R9UC 3S1AA 4CZ2A 1XFAA 1WRBA 1NMXA 1SXJD 5DGXA 3QBTA 1Q0UA 1SKYB 3FYHA 4M4SA 4B44A 1ZMXA 4LPSA 5EP2A 4C7OB 1VG9B 1JJ7A 1KSHA 2C9YA 5DYIA 1FTNA 1I4LD 1K5GA 2IYUA 3EC1A 2QU8A 3QPWA 4A0HA 5E3HA 2GCPA 2QE7D 1T0HB 1IN6A 2BIFA 1ZIOA 3EAQA 4TN1A 4BFUA 2WWGA 4FCVA 2D7CA 4IW3B 1L8QA 4OBEA 3VR4A 1NY6A 2YYZA 4MRNA 1COWD 4PPQA 5CDFA 4W9MC 5KUTA 1EWQA 1WQ1R 1OB5A 2VSXA 2Q9AA 3E1SA 5K8UA 2RHDA 4HB0A 4LV6A 1FNMA 3ND9A 4GPTA 1NI3A 3QPVA 1SVLA 2LWIA 3WHKA 4HAXA 4HEJA 1KO1A 4HUQA 1T3SA 3CO5A 1NLZA 1QHHA 2WVJA 2Z4RA 3ZD6A 2WM9B 4XTCS 4A8JC 2UZIR 2AKYA 2CCKA 3VR2A 2FDCA 1U94A 5EUQB 3DDCA 1PUJA 1KY3A 2J1LA 3BC1A 1P2UA 2G83A 4KLZA 2O8CA 1EFRA 4Y0VA 2O0KA 4WZ6A 2IHBA 4JLBA 2VSFA 4DBLC 5FPYA 4IVRA 2A7QA 3SFVA 4OQFA 4XVRA 1G6OA 4DT1B 3DKVA 4Q1EA 1CKEA 4TSFD 2ZR9A 1SGWA 3B85A 1KK0A 4UNQA 4BRUA 1PZNA 2J59A 1VCOA 1H8HA 2IEZA 4PHTA 4PC3A 1E94E 2JEOA 3A1VA 1I4DD 4Q7JB 4FMDB 2GETA 2HXYA 2NQ2C 1F60A 3RABA 3WP1B 4RKEA 4ZCMA 1EESA 4AKHA 1G8PA 3T15A 1UADA 3AF2A 1GZSA 1D8TA 2E87A 3MG9A 1E69A 4Q9IA 3RRZA 5LDDC 3THYA 2RGEA 1M1YE 3CRMA 1M7HA 4LHXA 4NPHA 5H68A 4M1OA 4B47A 3BH7A 4Q4JA 3SN6A 2EFDB 3RRMA 2X8AA 2J87A 4C7OA 2P5SA 4CT4B 5CITA 3GP8A 2IS2A 2OXRA 1GVNB 2AKAB 2HT6A 4QJ4A 4FWTA 1DS6A 1OH6A 5DI3A 3FVQA 4L9WA 3IEUA 1DAKA 5KDOA 1G21E 4WBSA 4TTRA 2QSZA 3MSXA 1TUEA 3BB3A 3BFXA 1KAOA 4CYMA 2LKCA 1FMLA 1KO8A 1KSJA 2JGNA 2V54A 1T8TA 3A1SA 2QTVB 4QRHA 3WYGA 3HR7A 2R9VA 2XNSA 4NZYA 5EXPA 4EPTA 1JNYA 2SHKA 3T06B 3FFBA 2ODNA 1C9KA 2AWNA 4MYCA 3SR0A 4QKQA 4QM6A 3VX3A 4PC1A 1OLOA 4R2IA 1XZQA 1X3SA 1NSFA 3CF2A 3K70C 2WWHA 1T9HA 4Z54A 1RZ3A 3DOFA 2CEAA 4IRUB 3C16C 1ZAKA 2ZUDA 2ZUCA 4KFSA 5HZKA 2ZJBA 2OZEA 2IBMA 2DB3A 1GKYA 3GFPA 1G8HA 1QRAA 2WICA 4TLEA 2C8VA 1ZNXA 2GA8A 5JJKA 1E99A 5G40A 4BEJA 4BLPA 1IN8A 4UQOA 4BRWA 2IL1A 3EA0A 3REFA 3W8NA 1OIWA 1II0A 2WSSD 3HDTA 1UBGA 2J7PD 1Q3HA 2BKUA 3FB4A 2YVUA 5FBVB 3AVVA 1VHTA 2GK7A 4G1UC 4DT1A 1P7CA 3MD0A 4IOLA 1S0UA 3CH4B 1XMIA 3QG5A 3U5ZB 2ZPTX 1E2NA 2YWGA 1BMFD 1ELOA 3L0IB 4LPKA 5E95A 4PSKA 1XRJA 4PHFA 4P33A 5C1BA 4F92B 5UKDA 4TLCA 1DAGA 2AWOA 3QF7A 4ABYA 4Q1BA 1Q57A 3R7WB 4AG6A 4CT5A 1SKYE 2GAOA 3Q7QA 2WKPA 3SBDA 4OHYA 1OF1A 5AUQA 4WVFA 4E09A 3IQXA 4NCKA 1Z29A 5DHAA 1DVRA 5TV2A 4AYTA 2WAYA 2OBLA 1E2FA 2ZI9A 5FBRB 5C4MA 4HAYA 3TNFA 1JXMA 2WZQA 3ZVMA 1N6NA 4FINA 1Z0IA 1UM8A 2PLRA 3HYTA 3GLIB 3OHMA 3CH5A 3M0EA 4PSVA 2HV8A 3QXSA 2QBYA 3H84A 1G8FA 1CR2A 1W1WA 2WPDD 4MUBA 3ZJYA 4BLTA 3I61A 1QDEA 4TLDA 1XDBA 1MOZA 3QEOA 1GFIA 3UIEA 2DBYA 1UF9A 4J0QA 4DIEA 3M4YA 2UVQA 2QT1A 4PZYA 4FD2A 3ZD7A 3N70A 3NXSA 3PCRB 3MWJA 4LV8B 1UJ2A 2C98A 1G7SA 4A36A 3PV0A 4E07A 1X8KA 4WZAE 3GJ0A 4HDCA 1I2DA 5B64A 2OCYC 2NZ8A 5DLQC 3ZQ6A 3I5XA 1KK2A 1M34E 1QHIA 1OH8A 1ZD8A 1X1RA 4LJYA 2JA1A 2GJ8A 5CYOA 1CJMA 4K46A 2WWXA 4EQ6A 4KYUA 2F9LA 3TK1A 3L8YA 2QENA 4KVGA 1E2LA 4YC7A 4D81A 5H8WA 4JBWA 1H8HD 4HZUB 4NH0A 2VIIA 5J47A 1MT0A 1ZNWA 2VSOA 1KNXA 2CNWD 4ZV4A 2R62A 1D5CA 1KI3A 2YOFA 2FFQA 4LK2A 2MMGA 1UKYA 4W5WA 4BZXA 3T1TA 4RJLA 1WMSA 2BMDA 4ON9A 1R2QA 2O52A 4D26A 2RMKA 4YXWD 5G3YA 1OE0A 3VHLB 1GKUB 1CTQA 2ZJ2A 3U6BA 4BLRA 5EJEA 3QENA 1HA3A 3MUFA 2YWHA 2ORWA 3EIEA 3GD7A 4TMZA 2IS6A 1D6JA 1WB9A 2KB0A 4F4JA 2AN9A 5KSYA 1VG0B 3NIBA 4RZUA 5L3SB 2BKEA 3R7WA 3SHFA 3TLXA 3CWZA 4WW0A 2F43A 4ZI2A 2WSMA 3JVVA 5BN4A 2W2XA 4TTPA 4OI0A 1S9DA 4BFYA 1KI6B 1RVDA 1NF3A 4IKEA 1VPLA 3A6PC 1NVVR 3AM1A 2CJWB 3U61B 2VTKA 1N25A 1YR6A 1JI0A 3OIWA 1JBKA 1NBMD 2OV2A 2PZFA 4EPYA 4OK6A 1D9XA 2ZS9A 4KODA 3CF6R 4Z51A 3KDSE 3FHOA 4DCNA 1NVXQ 2WJVA 3L82B 1ZW6A 4Q1DA 2ZI4A 3OE7A 2GCOA 4ILEA 3V9PA 4H1VA 3VQTA 4DUGD 3K70D 1M7GA 4B75A 3Q5DA 4BE7B 2I3BA 4KYIB 3VKHA 3U3KA 4AWXA 1AJEA 1ZNYA 4CVNA 3P4YA 1KI4A 2JLYA 2OAQ1 3C41J 2D62A 2G0NA 4TYPA 1TQ2A 3AVOA 1WCV1 1ZCBA 4B32A 4MA4A 2NO0A 1E2JA 4OK5A 1V43A 3DM5A 3TR5A 4NYJR 3IO5A 1W48A 2OFWA 2HCBA 2O0HA 4HZUA 2ZJ8A 3A36A 4HAZA 3TSOA 5AUPB 5KSPA 1KJZA 3H1TA 3KQKA 2B6HA 4IJMA 3EPHA 1E9DA 2QI9C 3C7KA 4A2PA 1OXXK 2XOKD 2UKDA 2BJWA 4QHTA 3QKSB 4MKFA 2G88A 3RDPA 3BWDD 1S1MA 3NEYA 4OK3A 2A78A 3W3AA 1E9AA 2RH5A 4MITA 4X8LA 2QPTA 3OESA 2BWJA 3VU9B 3EPJA 1JPJA 2IS4A 2GDJA 1GILA 3GLIE 1LV7A 1XJ0A 5CJ2A 2EYQA 3GFOA 2WWYA 3ADDA 1SQ5A 2JATA 3TVTA 4A92A 1XPRA 3Q72A 1IHUA 1P9NA 4QGFA 4AG5A 1N6LA 1YZQA 5TMPA 1OH7A 4JVNA 1EFTA 1JQJC 2FGJA 3OEHA 3FE2A 1OSNA 3QUSA 4RVCA 5KDDA 4ARZB 2BVNA 2ZVQX 3I8SA 4NCHA 2L0XA 3BS4A 2GTPA 3WNCA 4XSGA 4TZ0A 1KKMA 1OFTA 2WJJA 4HB3A 4B34A 1ODFA 5TXGA 4JLAA 3WP0A 4ZIRB 2OFXA 1XTJA 2EYUA 1KDRA 2ZI6A 5LB2A 1X8JA 2ZRMA 2FH5B 5JFGA 1KI7A 4ACBA 3HWSA 4B73A 2AD5A 2FA9A 3KKNA 4TMWA 3X1DA 1KO7A 5DO9A 1ZUNB 2PX0A 4B3FX 3QPUA 1X1SA 1G5TA 1EX6A 5JJLA 1B0UA 1KYIA 4WXRA 2ZJYA 2GZAA 3ADBA 3C8UA 2ZS8A 2ZXUA 3AEZA 4HLCA 5DHFA 1JECA 3GLHB 4II7A 1OXVA 4PC2A 1YZKA 1JAHA 1ESNA 3A1TA 3QOFA 4PFSA 5KSZA 2OAP1 4WZBE 1PV4A 3CPEA 4A0GA 3LY5A 2QG6A 5JHGB 1HE1C 4DDTA 3C14C 2YC2C 4MDEA 1FZQA 4XWKA 3ZQJA 1JALA 1GL9B 1XB2A 3RS5A 4EJSC 2ODBA 1JQLB 3EWSA 2HEIA 2X2FA 1ZC3A 4V0MA 1HTWA 1Z06A 3QKSA 1L4UA 2DFLA 4DSNA 2C78A 3SJBA 5J4VA 2RGXA 5CB8A 2G1JA 4BZPA 1P60A 2PEYA 3WXMA 2C95A 3VU9A 4URZR 2IF0A 4KJZA 4DEYA 2KE5A 4B6FA 1XMVA 2FE4A 1A7JA 1O87A 4QGGA 2ZEJA 2R6CA 2H18A 2RB4A 4L8GA 5FOSA 5SZIA 5C46F 1GP2A 3H0KA 5SZJA 4OHZA 3Q5EA 4D80A 1JR6A 1VCIA 3P32A 2REBA 4URXR 2BBSA 2JIZD 2NO9A 4GFDA 1D2EA 2NG1A 4QBGB 3U3RA 5SZKB 4D6PA 1CIPA 4C3ZA 2EU8A 3QEJA 4EPXA 2FN4A 1ZM2A 3KKMA 1A2BA 3LLUA 4V03A 2PJRA 2ZRCA 4ZIRA 3U7GA 4B74A 1GDDA 4O25A 1KKLA 3U4QB 1G4UR 4GBMA 4FWIB 1KDTA 4BFWA 2XTZA 1NMYA 5JECA 5IT5A 2WWWA 4KI0A 1T3LA 2PL3A 2ZRGA 1XP8A 1R0WA 1I4TD 4AYWA 3Q85A 1YKSA 4XH9B 1GKIA 5FBLB 3W8RA 2ZIAA 2OO7A 2VEDA 4MRVA 4PQRA 5A5GA 2GJSA 3NH9A 4TTQA 1XEWY 2Z4SA 4AY2A 2JAQA 3A37A 3GLHA 1T5IA 3VAAA 4DRZA 3FDIA 4V0ME 1TF5A 3QVUA 1DOAA 4M1WA 1UDWA 3RC3A 4HB4A 2GVDC 1YZGA 3GJXC 3DL0A 3KXKA 2XJ4A 3THWB 4PAOA 2AHOA 4JZKA 2AK3A 2VF8A 1W0JA 4HLUC 4HLUA 4LJ7A 1ZVQA 3I5YA 3WNDA 4TT3A 3CRVA 1PLKA 5HKKA 3PIRA 2GZHA 5FR2A 3OEHD 2KBEA 2IWRA 5JWHA 2ZYVX 1J99A 3UK6A 2V6IA 2ZJ5A 2ZYUX 3MWYW 3B6EA 2ZSDA 2R44A 2GNOA 4JLDA 1KK3A 3B8HA 4LBYA 4OJKA 5GVSA 3CONA 3TSZA 2ZRNA 3GLGB 1UBFA 3T35A 5LD2B 3P1JA 3W34A 1E9SA 4Q01A 2Q9CA 4FW9A 3ZZTA 1AKEA 1D2NA 5EQTA 4CGZA 2IYXA 4JSYA 4TWZA 3C5CA 1YJ5A 5AWFC 2TMKA 1NVVQ 1FW6A 3KJHA 3FMPB 1UKVY 2PEZA 4PSAA 5EE5B 3RS7A 1AIPA 3GEHA 5EZ5A 3ZIAD 2J41A 3K0SA 1OV4A 2ZRFA 1PLJA 3BGWA 3BXZA 4XWAA 4S2EA 2WAXA 2Q6TA 5KNBA 3CWQA 4CEIB 1BS1A 1XX6A 5FL3A 1KI2A 1W47A 1IY1A 1Z0FA 3GLHE 1ZU4A 3KFVA 3T34A 1JAIA 4AK9A 4DLYA 2IEYA 1P73A 3BERA 5KTYA 3EPLA 1GNPA 3R9IA 5IRCD 4ACAA 1XD8A 1IJFA 2DWQA 4AURA 1M6NA 3GMTA 4AKGA 1GM5A 1AS2A 1CJVC 3X2SA 3SYKA 1D2MA 4JL8A 5J4KA 1E6CA 4JMPA 3ECCA 3W6OA 5FTKA 2QMOA 5H70A 1E9CA 5FL7D 5GJVC 4D0GA 1PVOA 1HUQA 4IXNA 3JZAA 5DE3A 5HE9A 3THXB 1IONA 1DAFA 1M7BA 1YRBA 3RYTC 3FHTA 4TMTA 5J4HA 3FKQA 2CCGA 1IXRC 2OSBA 2ZRAA 5FI1B 3IGFA 1GIAA 4XOIA 2RHMA 2FJUA 3FGNA 3THWA 4M8NE 121PA 4MGYR 2ATVA 1E1QA 1Z0AA 3B1WA 2PMDA 3LO5A 4M22A 3GJ3A 3QY0A 4C0AC 1AN0A 5KPJA 3FFAA 4BZQA 1E2GA 1OYYA 1E2DA 5CLLA 4ZDWA 4TYYA 2J0UB 1NY5A 3U3JA 4CF7A 2IYQA 4RZ3A 4LJ9A 3UKDA 4D82A 4XVUA 5JZVA 4A0RA 1QHSA 1ANKA 3NH6A 2FSFA 2NPIA 2DYKA 2ZTSA 4JLPA 2XTMA 2ZR7A 1VIAA 4KFUA 2LCFA 3Q9LA 5FOXA 3EG5A 5ANRB 1RIFA 2Q3MA 1JEDA 4OQNA 4JT2A 2AXNA 2ZQ5A 2REOA 2ZANA 1ZYUA 4D2IA 4A1FA 2HUPA 2WKQA 4LBWA 4NP6A 4GNKA 1DO0A 2WOOA 3QF4B 2W0MA 2DR3A 5C4GB 3BH0A 4LJ6A 3B1YA 1GWNA 4BUJA 1ZUHA 1BOFA 1ZNZA 1OW3B 3QXXA 4O3MA 2RGAA 3WBKA 2GEDA 4D0NA 1DARA 4LYAA 2OCPA 4TQ9A 1SHKA 1J7KA 2D3WA 1AZSC 2YHSA 2YZ2A 3ZZUA 1NKTA 2X1VA 4B71A 4CEIA 4M9QA 1NIJA 4BQSA 2F6RA 2ZUBA 4EFMA 3FMOB 3TMKA 2V6JA 1P75A 2JCSA 5EUMA 4OI4A 4OQLA 4M53A 3TVDA 4B2PA 3O47A 4IDNA 1Z22A 2ZRJA 1VECA 4ZO4A 2CCJA 4GP6A 2FPMA 4NMMA 2XX3A 3UWKA 1F5NA 4URWR 3HP1A 3THXA 3R20A 2V7QA 2Q9BA 5HKKD 2VP6A 3AKEA 3CPHA 3MFYA 3CRW1 1GNQA 3BK7A 4LCBA 1Y3AA 2IXEA 2CK3A 2Z0MA 3K0EA 2QT0A 5CB6A 1GAJA 1I2MA 4Z8XA 4A6XA 4YDSA 5SZHB 4CRWB 4V0KA 3TW4A 4EUNA 2PT5A 3WBJA 2ZRIA 2PBRA 1P4SA 2CHQA 4LHVA 3VX4A 1H8ED 1KDPA 3PITA 4JLVA 1ZINA 4ZKEA 4JT4A 3HR8A 3LXRA 3ZGXA 3DKPA 4B76A 1Z63A 1OT3A 1KJWA 3X1WA 1P6XA 1OHHA 4Q9HA 3GLFB 1TEVA 4TYQA 5FTMA 4PQYA 2PT7A 1ZJ6A 2CL0X 2ZYTX 3K0AB 4Y0AA 4XWOA 3PEUA 4TQAA 3TUIC 2DY1A 2E9SA 4QJ5A 2DFTA 2XXAB 5HZHA 1SVKA 4D0LB 4Q66C 3CPJB 1XTSA 4RKFA 4YMTA 3EZ6A 3IBYA 2AL7A 3RC8A 3QF4A 1W44A 2Z5FA 4Q19A 4B3XA 1N0VC 4PPFA 2QTFA 1XWIA 2V8OA 2ZROA 1ZD1A 3LBHA 4M21A 5IHPA 1GUAA 2BC9A 2W58A 3AVUA 4F91B 4H1UA 1Z0JA 1W36B 5ELXA 3SJCA 2A3RA 2OLKA 2GBLA 1Q1EA 1W0KD 2GBLC 4JJZA 1Z5ZA 5KO2A 2BV3A 3GJ7A 1G291 1DG1G 4A4DA 5EP4A 2QL6A 2ZETA 3CZPA 3L2OB 4LGMA 1HEIA 1XTRA 3T5DA 1E0JA 4M9ZA 1HY3A 1EK0A 1TPZA 4G5QA 5BXQC 1JR3A 1JB1A 3ASZA 4RD3A 3ZH9B 1G8GA 3CX6A 1E2IA 2CDNA 4DSUA 3BORA 2QMHA 2JLUA 1ZP6A 3I4LA 3P20A 1G3MA 1LY1A 5C18A 2WBLC 2QPOA 2KWIA 3SYNA 2QORA 2WWIA 1DO2A 3TR0A 2A5FA 4XD7D 4LHWA 3K8YA 4ASUA 1KGDA 3A4LA 4N1AA 1O3YA 4EKDA 2EW1A 2REXB 1Z83A 1NMZA 2ZRBA 3E2IA 4CDGA 4HSEA 4P4UA 2XZPA 1KO4A 2P0EA 2VP9A 1P2TA 4MRRA 3U60B 1MO3A 2WOJA 1GG2A 3ADCA 2FSHA 4GOXA 2GXAA 4JVLA 3P4XA 5DISB 2VL7A 1WF3A 2CHGA 4DCTA 3GLFA 1II9A 2O5VA 3LQQA 1GNRA 3SYLA 1VYTA 1X86B 5G53C 5L3RA 1CJKC 3C4JA 4ESHA 4URVR 2BM1A 4L15A 2OUKA 1IXZA 3K0AA 3X1XA 2QN6A 2HT1A 1GL6A 3DZDA 5CYPA 2JLSA 3QJYA 1MO5A 3GFTA 2FOLA 5AUNB 4E5UA 2F1HA 2V1UA 2W6JA 2XXAA 3GPLA 1RE0A 4Q03A 2VBCA 4P32A 3THOA 1NJGA 1HYQA 2OBNA 1FUKA 2VHJA 4CEHB 4GT1A 1XCPA 4ZI3A 3Q3JB 3Q7PA 1UAAA 5DNYB 2W83A 3NHAA 2VO1A 3LQRA 5LPNA 3BIFA 3B7GA 2IYYA 1FTSA 3EPKA 4KVAA 2QP9X 1CBUA 1E2KA 2YWEA 3A1UA 4EPRA 1W5SA 1AGRA 5TARA 5K8IA 5HR5A 2G3YA 2V7QD 1TF2A 1JR3E 2R6AA 2EWWA 4KBFA 3FKSA 1Q12A 3L0OA 1EFRD 1F6BA 2NO1A 1SULA 4UKDA 3QVVA 3L8ZA 2HDNB 1XPOA 3NBXX 1EGAA 4EFNA 1ONBA 3VNUA 2RGGA 4B3GA 3PUWA 1VYVA 2ZRLA 3G5UA 4UJ5A 3C15C 5FUVA 1NN3A 1RRGA 1G1MA 2IUSA 4GP7A 3GJ8A 2NZJA 4Q9JA 3R8FA 2R6FA 2I4IA 1Q21A 4U5XA 4LI0A 3MWKA 3QSYA 4S35A 1W5TA 2QGNA 1OHHD 2QRZA 4JVSB 3RSLA 5F3WB 1LF5A 3REGA 1Q3TA 3DEFA 4OHWA 4BFSA 4URYR 2QAGB 2P6NA 3AVYA 3GLFE 3LBNA 2W00A 4QGHA 2W6IA 4QNMA 2ANCA 3NBZC 1S3SA 4C2UA 1U81A 2VP2A 4DDVA 2ORIA 1SKQA 1YU9A 3G0HA 3R9XA 5FOUA 3O8RA 1OKKA 4GDFA 3K09A 3QI2A 1HV8A 4M1MA 4OJQA 1KZ7B 5BYKA 4IFEA 4PANA 1S96A 2CMKA 5HCNA 1KO5A 3K53A 1NVUQ 3TUJC 1FL9A 4GI7A 4C2TA
chains in the Genus database with same CATH superfamily
2V9PA 3CURA 1UOEA 3O8CA 2NUBA 3UAWA 2NTVA 1CQJA 1E6KA 5LMUB 5BNIA 2XTJA 2HJVA 2XEXA 3WYCA 1LK0A 4OI2A 3AR9A 3CUEF 2HNBA 2RKWA 2W8BA 4CV1A 2WT4A 1JKIA 3IHTA 2H85A 4JV5B 5ITZA 2B5VA 3WZLA 4E5SA 4Z49A 5IS2A 4N65A 4NEGA 1CRQA 2UXCB 2H1HA 5KZMB 1NKSA 2VBGA 1VGRA 1G8JA 3AL2A 3JQ9A 3O21A 3JQ9C 2YWDA 2IEBA 1DXOA 2FZEA 4MWGA 2DPXA 2XKAA 4ZDJA 1SB8A 4I1SA 4KR9A 1SUDA 3V4SA 2H2IA 5B2ZA 4KIFA 3ANMA 3D2BA 1G20B 4AY4A 4XDZA 5ADHA 3QXJA 3MMNA 3IEXA 2Z58A 2BGNA 4OQZA 1L7BA 2O0JA 1QQAA 4C21A 3K92A 1XR3A 4C3UA 2PO5A 2QJFA 1Y63A 3GPIA 4G5XA 4QEKA 4KJXA 1V9SA 5B53A 3OTHA 1KY4A 2HX1A 1WY5A 4JXJA 4PLWA 1E9BA 4RDHA 5KOJB 2F1RA 2Z5LA 1Y1QA 3DC7A 1GAEO 5A2QA 1EFDN 3C7DB 1ML4A 2CY0A 2I55A 3DE6X 5F9HA 1Y3BE 4WI1A 5BN5B 4J7CA 3BWXA 5I7HA 1T36A 3OCUA 4FS8A 3JQBA 2P6UA 3EZXA 3JQBC 4GS5A 3ZQ4A 4QO7A 4EB6A 5JNUA 4AO7A 1L3BA 4FE3A 3IOEA 5EFOA 4IOKA 2OD7A 1WVIA 4MPJA 1EHIA 4KNYA 4MCIA 4X20B 4C78A 4N3NA 5JLJA 3VH1A 1FA9A 1IPHA 2ILVA 2I80A 2IX9A 3WRVA 4D98A 4HS9A 2CLFB 3P9IA 4BLOA 4BNDA 2AFHA 1Z2PX 3NV9A 3L7JA 4OBWA 1K4KA 4V39A 1VCNA 4BMYA 1BQEA 2VDMB 3AERA 4N3GA 3ZW8A 2BDEA 2HKIA 2VA8A 3LO8A 4OUDA 2JASA 4JLMA 3G0CA 3H6HA 1AQJA 1W36C 1QYWA 1RD4A 5KTKA 1E7QA 3KOMA 1BYUA 1KI6A 1QVAA 1A88A 4M9SA 4GDMA 2ZSKA 3ELDA 4WKBA 5L3VA 1TK9A 4RTRA 1DC6A 5DM60 3N53A 5TIIA 4JOCA 3U0BA 3IAAA 1WHSB 5DNEA 1IK6A 4XX0A 4XJSA 2VJMA 4YRTA 4KQWA 3PT9A 3JRXA 4CEJB 1T4GA 3E9QA 5FT9A 2JIBA 1P5HA 1EMDA 2W2NA 4X00A 2VPZA 1TC1A 1YQEA 3ZNNA 4Q93A 3TZKA 1FNDA 4XSHA 4ISCA 1D04A 2HCFA 2Q28A 3ZHUA 1VFPA 2C3UA 4I8IA 4PGFA 5I9MA 3SSNA 2RHWA 3SSOA 4B9EA 4D57A 4F97A 3CF0A 1G19A 2F3RA 1VPWA 3B1XA 4DA0A 4KREA 4BFCA 5IH7A 2XWQA 2QKYA 4EZIA 4PFJA 721PA 3AP3A 5B58C 5IF9A 3F5FA 1HEYA 1X7WA 3GL9A 1EFUA 1D6SA 1M2FA 3LVRE 4JKIA 5FUXA 1E9EA 5HJ7A 2XYHA 2Q8PA 3MSCA 1XZDA 3KPVA 1QYCA 4Q3OA 2BFNA 3Q8LA 1T3GA 2SNIE 1SG6A 1V5FA 2IKQA 9MHTA 3I32A 5GGXA 2OHXA 4DR5B 2XMGA 2YIVX 9ABPA 3H16A 1Y6QA 2PA0A 2GT1A 2FZVA 3SYMA 4EA8A 3C3WA 3TLKA 2QAIA 5AJZA 1R6UA 4P36A 3SVLA 1A3CA 3N1UA 1YZYA 2ET6A 1IN5A 2P4UA 2Z30A 3FAKA 2XF8A 4UNNA 4AUKA 4WZZA 1L7EA 4YMWA 4D25A 3ZCVA 3L1UA 2CUNA 4X8OA 1CUHA 3I2YX 1XL0A 2FPKA 3LFUA 4J3FA 3KTAA 3MAAC 4CTJA 2KLHA 3BWBA 3F73A 3LFTA 5DJ5A 1Z08A 1IULA 2Y1DA 4V02A 4AU1A 1L8LA 4LZWA 2G70A 4S24A 3PJRA 4OKSA 3AGPA 1N3YA 4YT2A 5GV8A 2W2MA 1W85B 5EUCA 3EDCA 4CIDA 5JMTA 1R5NA 2H17A 3H8JA 2GTHA 3LIPA 1JIKA 1O03A 2ILTA 2ZI7A 2I22A 2J0VA 2AJTA 2XYQA 3GGOA 1NN0A 1IQPA 3ZEAA 1OU4A 4G8BA 3B60A 5CK5A 1RVV1 3I8XA 5FOTA 1XQWA 3GJ5A 1JG2A 5M7EA 1S8FA 1J9EA 1XCBA 2C03A 2ZKLA 2MTBA 3RD5A 4A16A 5JHHB 2OE2A 3TX2A 2Z9CA 4US1R 3GQVA 3HBJA 2NUAB 5KNCA 2NMVA 1FQKA 2JLRA 4Q1AA 5E6RB 4HXFB 2ZJ7A 4MLCA 3ABSB 5FB3A 2J6CA 2VTBA 2VAVA 1KYTA 5D3MB 3LVBA 4QXQA 2HTEA 4MVJD 1A2KC 4L8YA 3SAJA 1CNEA 1Y4DE 3EX7C 2A0YA 1Y6FA 5FTJA 3T3EA 2YHAA 3KRTA 3M3PA 2A5GA 3N05A 5IAJA 5CFMA 1IG3A 3I0ZA 4QBHA 5DNVA 3DZIA 4AC9A 4Q48A 4AP5A 1PZMA 3FHJA 2AMFA 8LDHA 4WA8A 3G7SA 4C0JA 2V7EA 5K6AA 2WWTA 3K9CA 1V25A 4XE5A 4M0DA 4G97A 4HOYA 4UD2A 5EA2A 3JSAA 3NWOA 5K6AC 4WPGA 4I46A 4N5LA 3CEPB 3C2QA 1PT5A 1K6IA 4GMKA 1ZUIA 3U7EB 4Z4EA 5DN9A 1YQUA 3OCXA 4F21A 4CMGA 1E9FA 2QMEA 3RNOA 4FONA 5JCJD 1DELA 5IM4F 1G9TA 1ZUNA 1WDTA 4QZVA 2WA2A 4FUQA 2H4WA 2HCJB 2DMRA 1MVOA 1XTKA 2V7TA 3SX4A 3D8HA 1IDN1 1ZS9A 3AXTA 4PS0A 5F2KA 2V55B 3D0QA 3ENZA 3R0QA 4HQ6A 4QULA 2BFBB 3O8DA 4WBNA 3OAAD 4XGRA 2JF0A 5EHQA 4DMFA 2D8AA 1R50A 4TXHA 4V24A 5A7FA 3KZOA 4C0KA 3EARA 3T0GA 4EX6A 1XRPA 1NBHA 1AXEA 1Q19A 4Q47A 5LQRA 2X3UA 3E5MA 3O8OA 3OCWA 1N9GA 3ZY2A 1A2OA 3HCPA 4PV7A 4WAUA 3SF8B 5E9AA 2BR3A 4Q02A 3DMDA 3WYDA 4FHCA 1KWKA 4JYAB 1SVMA 3QVTA 3HKBB 3CRQA 4RV4A 5DT2A 2QR2A 2Z9DA 1FUUA 1HE3A 4E51A 4QJ3A 3P27A 1OGJA 2CVZA 1ECLA 2H0AA 4NULA 3FGPA 1C4KA 1ZH6A 3N6XA 3Q3EA 4MW0A 1UBRS 3BFJA 1EQ2A 1VI5A 2PWYA 3PEFA 4FJ0A 5EWLA 1CQWA 3F9RA 4KRFA 1QE3A 4PLPA 4JLWA 1FYVA 1FSFA 4TUYF 3ESXA 5TPWA 4EL5A 3WLKX 4OFWA 3ZXYA 2ORYA 3N75A 1BJKA 5LA6A 2ZJZA 5H3HA 4V1CI 2W6PA 1KK1A 4GE3A 2EX4A 4C7KA 4PYJA 4MQ4A 4LSWA 2CEKA 3IJEB 4UASA 2IP2A 3K0CA 3R3WA 3R5FA 3K0CC 2P9BA 4K6HA 2J46A 5G0WA 3TEJA 3ZY6A 5DT9A 1L5HA 5KQRA 1N5IA 1EHCA 4POAA 1YC5A 3A14A 1TCCA 4CLDA 5I7WA 2W71A 2ZWPA 4CE6A 4QYTA 1G8KA 1T0UA 4QWWA 2FDCA 3JU3A 3LF2A 1WCIA 4YAOA 1W88B 2RGWA 4MRSA 4HRXA 4LF9B 3T3NA 2FW1A 1TGVA 2K2WA 4YRNA 1GRQA 1L5KA 3F6EX 2E21A 4R6WA 2YRXA 3EZ7A 1NU8A 1FQWA 5EYPB 4Z7NB 3U7FB 3EWIA 4ZVRA 4CDNA 2PY6A 3NOQA 4MV4A 2H3EA 1C7FA 1UMKA 2ZSUA 4N7BA 5E7QA 2OV6A 1N33B 1MU0A 4LY6A 1RHMA 2J5KA 4Q1FA 3IIKA 3O38A 1V3VA 3JZMA 4TXLA 4EMTA 1EM8B 4YO8A 1R4MB 2H1SA 4XFJA 3VOBA 4YAIA 4NL4H 4Q4HB 1YR9A 4O4IF 2QSJA 3QX9A 3TS1A 5I4CA 4L74A 2FG5A 2BI4A 2HF2A 5IN4A 3RHTA 1Z8NA 1I7LA 4O2RA 1ZEJA 2CFIA 2AHRA 7GPBA 4K05A 1EUDA 5CBKA 1V5IA 4NV1A 3GF4A 2BHNA 3TZEA 5AVXA 2JHAA 3E9YA 1DAPA 2VQ3A 4RGYA 4YJ2F 2PIDA 3DBVO 3E3NA 2XZTA 3OUTA 1N5LA 4HNAA 3C6XA 4DZZA 4IHJB 1YBAA 1JIJA 1JEYB 1V6CA 3RYFB 1J8MF 4MTLA 3ROKA 3WQHA 1J8QA 4EG8A 4UNRA 1FFXA 4L4UA 1ZU5A 3IQWA 3U3XA 3B9PA 4A6EA 2AOUA 4AJLA 1IE3A 4GOND 2IGBA 2VDNB 3KBBA 3MK31 3CM0A 3OZ7A 1WBDA 6REQA 1UDCA 5B55A 2V7GA 4K9QA 1MHPA 1JPUA 2EEPA 3LMKA 4F1WA 1E98A 3DF9A 1TI7A 3PD0A 5EVJA 2H2FA 2K5UA 1T6ZA 1G8YA 2PMKA 4RD1A 4Y67A 3HGTA 3BD9A 5CEFA 5I45A 1TVKA 1I9CA 1N8KA 2FX5A 4MB0A 2ORVA 2OOKA 1JG1A 1P3JA 4ZALA 5TQ2B 3DCYA 4MGHA 1M6VB 1EJ0A 4RK5A 4A8JB 1JLSA 3MOGA 3OMXA 4M98A 4M1KA 4XGNA 3FHCB 3VU0A 3TTTA 3H5TA 3AUSA 1U3GA 2JS7A 1HDGO 3I04M 3PQEA 3QUBA 4N5DA 3C87A 5FFFA 1VLJA 2C9MA 1XMJA 3OPVA 4CIXA 3D5QA 1QCYA 5FHQA 3KM0A 3G2QA 4MS4A 5KHAA 3RSZA 1HRDA 2BZSA 1H0KA 1SA0A 4GHWA 4GVPA 4L0DA 4OHBA 3CKKA 3G5MA 3TFQA 1Y33E 4ERNA 1KMHB 1NJ6A 3B9QA 3BB1A 1KY5A 3HCNA 4P4TA 4LY0A 2I2WA 2N42A 3E7DA 3WY9A 3ZE6A 1UPXA 4RNDB 1XNQB 2ZI3A 5DYGA 4LSMA 5IMBA 1B0PA 1RABA 1U0TA 1FVOA 4GVLA 4WKGA 1ZUWA 3T3IA 1M83A 5JYDA 2OKCA 5L7WA 2O8EA 2PXHA 1DIHA 3UOWA 1ZGAA 2FU5C 1VA4A 3PEYA 1BNCA 3BH6A 5HDBB 4B82A 4G0XA 3NJRA 1UOQA 1WCWA 4X6LA 5B4TA 1N1MA 2VHQA 5JJCA 4DNFA 1R0XA 1FFGA 4IIGA 3DCIA 3GA5A 1GITA 4KFTA 2A1UA 3TN7A 4RTJA 4FOLA 3SR4A 2JFFA 4DIDA 2HWKA 2HRCA 4NH4A 4WUTA 1E5TA 1BMFA 4CG3A 1V8ZA 4Q4JB 1AS0A 3KOWA 1ZC4A 1OFUX 4GRAA 4RD4A 3MTJA 3AETA 5WRFA 3EXFA 4YCLA 3A4MA 4RY0A 3EXG2 2G9NA 3UJ9A 2XSZA 4FFOA 2WUWE 5AW1A 5BSKA 2V96A 1Z56C 4KXVA 3L4BA 2Z6QA 1VXOA 3L4BC 1DEHA 2IYLD 3I6BA 4OGLA 1DFHA 4IH4A 4I2NA 4CV2A 1VE1A 4BEBA 4KRYA 3HA7A 2ZIVB 2D1TA 5BSMA 4OGFA 1BHSA 1IOLA 3C6BA 4ZXPA 1AB5A 2A58A 3ZW9A 2YXDA 4BFZA 4RMIA 2GPYA 3HEAA 4J03A 2IF2A 3EA5A 3A9UA 3VJKA 2XUKA 4CCYB 3MELA 4D7AA 5B6JA 5ALLA 3W2GA 3BFPA 2YWJA 4ZPJA 1Y48E 3O8QA 2X8BA 3CWCA 3RBZA 1TEXA 1S8AA 1FUEA 2C07A 1Y5IA 1Y6JA 3VMFA 1WKCA 1NIPA 3JRWA 3AB7A 1T29A 4BTLA 1DEKA 3QQPA 2XGOA 3AHHA 2IYRA 3GRUA 1M34B 3PKIA 5DNWA 1J42A 5AUOB 4HB2A 3F46A 4MAFA 1C7IA 1GGKA 5KVCA 4LF5B 1SZPA 5H1YA 4DMUB 3WKDA 1DTSA 221PA 4WN9B 1LA2A 3GLGE 3U44A 1D4FA 3D3WB 2P6PA 3C5HA 3RRXA 1YNSA 5CXQA 2FWBA 1VE5A 2JCYA 3V6MA 2OESA 2WZDA 1VOTA 1TM3E 1YRAA 3LX4A 3RTBA 2JH3A 3WGGA 3CKLA 4Y1FA 1QG4A 4RETA 3L8CA 4MLZA 1U7HA 2AXPA 2ZIZA 4OQPA 5FR1A 1QF6A 4ZP1A 2BR5A 3FDJA 1YUMA 4LCEA 2ONJA 2WF5A 2HLPA 3EZYA 3LPAA 2Q2WA 3O0DA 3OOJA 4L51A 4MGIR 5E6UB 4C0BA 1JEQB 4PBRA 4RXTA 4GM4A 4WOBA 3QKUA 4XEHA 4HH4A 2BUAA 4IHKA 4MO2A 3WB1A 4UEKA 2X4GA 3I1JA 3KU4A 1RZRD 2XGJA 2X9VA 4CHTA 2DHRA 1RAFA 3MWGA 5EGSA 1Y1KE 4XIYA 4MVJG 5TC4A 2NZUG 2C31A 2JI8A 2WP8J 3B1FA 3MEQA 1RDFA 3HKDA 8AT1A 3CN9A 2F1JA 1M2WA 2Z6VA 4Y6SA 1ZGZA 2GHIA 3HFGA 5E1OA 4EYSA 3DE1X 1SD5A 4BZWA 1P0CA 2JFBA 2WRZA 3ZDAA 4PLVA 3HJTA 4W8GA 4CM9A 1M0EA 1UL1X 1EDOA 5EPUA 1T1SA 1OH5A 3PI6A 3ED5A 3G3EA 4G9GA 3P0EA 2G36A 4DIUA 5KYWB 5FUYA 3CB4A 1ZH4A 4U3JB 1ZIDA 4Q18A 4XIJA 4K2HA 1V96A 5EMNA 4LF4B 1TZBA 3CRRA 2KJQA 3FZNA 5DLDA 3FRHA 4DUZB 2Q5CA 3QU5A 4MR8A 2AOVA 2VJAA 1D1TA 4Y2RA 3X1MA 3AR4A 4OXIA 3SIPA 5IKOA 1NUAA 3UOAB 2X77A 4AJHA 2IUUA 1GPYA 1Y7HA 3IUQA 3ND7A 1E1QD 2V4UA 1M5UA 5DU2A 5JDIC 2FZLA 4UPVA 1TJPB 4M0CA 5ALHA 5BWMA 4R3NA 1NT2A 2OEPA 3IILA 3I6ZA 3O74A 2AE1A 5CVVA 4Z3OA 1PKEA 3TLJA 5FFMA 4HY3A 2WHPB 4RZSA 4J2HA 2XVXA 3CKMA 1I1NA 4Q0MA 3COWA 4XOUA 5FBQB 4ZT5A 3T7DA 2BCJQ 4LC0A 3TE7A 1J2UA 2YDYA 2ZU6A 4PTLA 3C6QA 5LZ2A 3T1OA 1JU4A 4RYLA 4CM1A 2CT8A 3H7IA 4NE2A 1JGTA 3D6JA 2V4ZA 3ER8A 5MN6A 5JD6A 4DBLE 1SIBE 1GL3A 5FPHA 5A7HA 2W2VA 3V7YA 1U8TA 4KUHA 2BYTA 1Z6TA 5EJ9A 4MA0A 4DLBA 2AJBA 4PLGA 1DB3A 3U40A 2UVPB 4E1AA 1MJFA 5A4MS 3SWWA 1HX7A 3WK7A 3FIJA 1UJCA 3ZGYA 4TKUB 4C5BA 1K06A 3EVZA 2GUGA 3RSSA 1VA5A 1M2OA 3UMBA 4DE5A 2V1XA 3NUGA 4IUYA 1J2YA 2HU8A 3QVXA 5A1TA 3L0PA 3NM6B 2VDWB 5LKRA 4AMZA 1O0CA 4WECA 1BHQ1 1TRHA 2GKSA 2C4HA 2EW2A 4JP8A 4WNCA 3UUWA 3PR1A 2HQOA 4HP8A 1JDBB 4NAVA 5B2EA 3UA4A 5GAJA 3CXRA 3T7KA 5ICEA 5JH7A 4PSCA 5CNJA 4C0LA 2D54A 4FDAA 1XTPA 3L43A 1CLUA 4YAWA 4WNAB 4OU4A 2OBYA 3GOQA 1QBKC 2MR5A 3QK7A 1ZH8A 3HVHA 4DB4A 1U9JA 1PJQA 5G1PA 5E4FA 2X7JA 4KNWA 1U3TA 2H2AA 1L4BA 4PQEA 1EWTA 2C3PA 5JSUA 2BFDA 4LJ4A 4R8SA 4WRRA 3BXOA 1FOEB 3OT5A 1DKMA 1TYDE 4P7BA 3T1YB 3B8EA 3GRKA 1YB2A 2C84A 4I4TB 2XI4A 2MIIA 3B52X 4JOQA 2G9ZA 2EKQA 4L0CA 4EHHA 2YMPA 2XIJA 1EBBA 4AP9A 2IY9A 3V8QA 2GCOB 2QP3A 3LY9A 1TDJA 1QDUA 4HBZA 1QPBA 1IY8A 1ECCA 4R1SA 1P61B 4U2FA 1FPMA 5B1YA 3E61A 3WMGA 5JSYA 4NMHA 1RFLA 1B93A 3D02A 1QE0A 1QIMA 2AFIE 5HPYB 2A9VA 3IHWA 4QG7A 1F9AA 2PMFA 5FPTA 5TQVA 1EGHA 2IHVA 2XE8A 1F8YA 3GZ4A 1X2EA 3F9IA 3HJBA 3KXDA 3WX0A 3PUHA 5BWCA 4LYHA 4WY5A 4YCMA 4NCNA 1YZTA 2FTKE 2NU6A 1T9BA 3DMGA 1M1UA 2Y1GA 3NT5A 3SNKA 3QA3E 4JUBA 1E6EA 3RFFA 1HETA 4FFDA 4RXMA 3RARA 2I1QA 1F8UA 3U2QA 4A10A 1SPXA 1CULC 4XVQA 1PI3A 3C45A 1QGUA 4BB0A 4X8MA 5I7EA 1C29B 1K88A 2FP3A 1DG3A 3IP6A 4YRKA 4EGJA 1O4VA 3A1FA 1JIUA 1SNYA 5GADl 1MW8X 1HDYA 2EFGA 4UM7A 3ET4A 1VLQA 4N4AA 5FHRA 3SBOA 2D1RA 2WA1A 4D79A 2CVQA 1PHPA 3ZD8A 1BH6A 3PENA 4WOCA 3UPTA 1YT5A 3DBHB 1SFRA 2DX7A 3AUXA 3UMJA 4MV0A 2MT9A 3JAWB 2BFEA 2VKQA 1E0SA 4F06A 1P9WA 1BYIA 3KEQA 4HEA1 2B34A 2UV8A 4AMVA 1O58A 4YHHB 2QV7A 5HZGA 4FMDF 4HWPA 3DLIA 1L9XA 2R8EA 4CMHA 3HXPA 2OMEA 2RKOA 5K3FB 1JG4A 1JDJA 3RLIA 5L4NA 1OXKB 3MRTA 5LQUA 3N0WA 4B2LA 6AT1A 2FWRA 3KFXA 4TTJA 5CIYA 2BT4A 1GV1A 1R37A 4LRTB 4QPNA 5AJUA 4CKBB 2OP1A 4PYRA 2D06A 2I3ZA 1M2VA 4YB8A 2C4VA 2A9KA 1J6UA 5A02A 3ZBQA 4HNTA 2LIPA 1T34A 4LTNA 4Q7MB 4DHWA 2PUBA 3MAGA 4RMHA 5JPIA 2QRGA 3BZBA 2XADA 3OQVA 4F71A 3F6BX 3U16A 2Q5EA 4JYPA 4OHMA 4Y9UA 3ZHBA 1N5KA 3W5UA 2XECA 2ONKA 3K0FB 1IC6A 1DJLA 3RS9A 4IJ5A 2A2ZA 5L45A 2FP4B 2VP5A 4R5MA 4Z4QA 4FEAA 1YDGA 2AJCA 5JRJA 2GPTA 3NDRA 4RPGA 5JSHA 2PX6A 2OM6A 3LD9A 3ZLVA 2GPAA 1UWCA 1U02A 4ESEA 1BQ4A 3RUFA 4F93B 5ITWA 3M8KA 2C9OA 2N3ZA 2WD8A 3OIDA 2DSTA 2ZB8A 4JA0A 2Y0CA 1J00A 1E7YA 2WABA 3NYRA 4FYMA 4R68A 1NM5A 1NM5C 3KKPA 4EARA 1F3OA 1TF7A 4K81B 1OQAA 2JIZA 1DC4A 4HDOB 2ZJ1A 1FFBA 1YA6A 4NI5A 1WO8A 1X7ZB 2IY8A 4NHEA 4RO0A 4UW9A 1PR3A 1JSLA 3WIBA 2FZ4A 1SK9A 1H4QA 2Q3DA 3WMXA 2P8JA 3ASVA 2Q7DA 4B46A 1H1LA 2P9ZA 2XGSA 3N6RA 2QSUA 1WB5A 4YGYA 3E1GA 1YFJA 3MRSA 3EXAA 5TVGA 4I3GA 4AQDA 5BWLA 4KR2A 5DBOA 1RHRA 3ZDRA 2IXDA 2H5EA 4BJHB 1H0RA 3DO6A 1JWLA 4Q3NA 2BSQA 4NBKA 1SHTX 3O8NA 2J3EA 3D6FA 5A62A 1MH1A 3NVAA 2IX3A 1ZCFA 1TJ4A 3D4OA 1OMOA 4IDCA 2WJ3A 5CDUA 4UEQA 2QN9A 1NVWQ 3I9MA 3E4DA 1FNNA 4ZD6A 1D6NA 4NMLA 3ZE7A 5FH9A 5LQSA 2GDZA 3ELWA 4TKZA 2W6JD 3HRIA 4DR4B 3UWMA 2YZ7A 3CEMA 2PJZA 4F72A 1XPJA 3S8EA 1QC5B 3PPWA 5K1ZA 3EQ8A 3OPNA 1XXHA 4JC8A 4W5HA 5AD1A 4XIGS 4RE6A 2R7KA 2XRFA 1JXQA 4KWHA 4GYWA 1NLMA 5HE8A 4FYWA 4HDRA 2DQSA 3AONB 4YMVA 4PGGA 3IESA 1LUAA 3RRNA 4I4LA 2BCEA 4RIIA 2ZIWB 5IBRA 2CXOA 5CU7A 3EXEA 3GAFA 4AF8A 4QUEA 1EK6A 1O94D 2VJDA 4EFLA 4RVUA 2GM9A 4R2JA 1T15A 3DV9A 3JALB 4HLDA 4DMGA 3VBCA 1HORA 1IU9A 1BDMA 3LHIA 4RA6A 4XWTA 4D8WA 3MINA 2HA6A 3F7TA 1I5RA 3E23A 5GWXA 1ZIXA 3ND6A 3IPLA 5IFLA 3TW8B 5FLXA 3AKZA 2ODQA 3UNXA 1I0ZA 3ZHVA 4JT9A 3RC7A 4RGQA 3RAPR 1IY2A 1QYRA 3PSAA 2GPSA 4DJAA 5IK2D 1O6CA 4QL3A 4ZEXA 5GZ6A 3R8CA 2I4LA 3FM9A 2X9GA 4NIMA 1G2IA 4OQMA 3UGQA 1BU5A 5BWNA 5DHTA 1N5JA 2C2XA 3R3SA 4PQFA 4D0GA 2W11A 1Q1ZA 1N0UA 3OE1A 3QLUA 5LCXA 4JLNA 3OX3A 5F1OA 1Z28A 1VKJA 1LLCA 4D4HA 3JWEA 5LQCA 1Z9BA 3FFXA 4N0MA 5EEHA 1TM7E 2ES4A 3IT1A 1JILA 2CMDA 3LUAA 3A3PA 4WA7A 5L3QA 3N5KA 3W77A 3GG2A 4KAAA 4UE2A 2HHLA 2QZ4A 1WLSA 5K8VA 3C7TA 1TXGA 1GGEA 2GK3A 1MC4A 4HG2A 4OKNA 5JRZA 5A0FA 1EBUA 1MF7A 1HO3A 1EFAA 2WAOA 1DC8A 4QOGA 1M2KA 1USVA 2F3TA 3ZC3A 3H2GA 2JLVA 1LDYA 1M6EX 3A9SA 4NFLA 5D5HA 3T61A 1R9JA 2QD4A 5DM70 3IDSA 1E5QA 4YMLA 5C9ZA 1IN7A 3PC8A 5F12A 5FADA 3OLXA 3PC8C 2WF7A 5ECWA 1OKKD 3N8GA 3VR3A 4MPTA 3NTOA 4UHJA 3M5PA 1WZUA 1VMKA 2MINB 3NORA 3QI7A 1JJIA 5D86A 4C0HA 5AVYA 2OAEA 3RSCA 3QLVA 4QX6A 1ITZA 4WCFA 3GR6A 1LNZA 3KO8A 1KXJA 1JF8A 3NHJA 4WXPA 2H59A 2W90A 3OKCA 3BCUA 4X44A 4Q6WA 1E3DA 3AR7A 5AR1A 3WMWA 5DGIA 5BMVB 5C35A 5HHTA 4G2NA 1J2JA 4R0NA 2AOTA 3ZU6A 4ENQA 2Q6OA 1KNQA 1NUQA 1AA9A 2XB4A 3M82A 5FV7A 3Q0EA 4HFJA 2A9PA 2RC6A 4MS3A 4CM4A 1S4MA 1UPTA 3DMHA 4K6OA 4X45A 4BQQA 3RUIA 4EGSA 3N2GB 3NDPA 1EX7A 2AMVA 2F3PA 2PZGA 3ZBUA 3FYCA 5K0NA 5C1DA 1S1CA 1Y81A 2DP4E 3HDQA 1AF4A 4IIVA 3P9CA 4UAJA 5T5QA 3UBMA 4RIEA 3EVCA 2NV2B 2IZ6A 4MUFA 4PNZA 1VBKA 3SKXA 4MUJA 1QHFA 3MGGA 2WUEA 4UVEA 5REQB 2VNAA 3HMKA 4ZJYA 5CP8A 1I13A 1XUOA 4ZU3A 1HYGA 3UV7A 2AF4C 3S55A 3ONVA 4LY9A 3RWOA 1DEOA 1K89A 3BTSA 3NIDB 3FKJA 4DLUA 1LCIA 4WK6A 3N2IA 4KH0A 3G5LA 3H86A 4IX1A 1O97C 3ZWWA 5H82A 1F0YA 1IHYA 4DJDC 3D64A 4WLVA 1L4LA 4IDHA 5HIMA 1BFDA 1Z6GA 3C0KA 3WGVA 1R9MA 4RKRA 3W5BA 4OXXA 4ZEWA 1G5HA 3RV3A 3V8MA 4KK4A 2OWDA 5EJAA 5HWSA 3WA7A 4RMJA 1F2TB 4JL6A 5JSZA 521PA 1KYYA 1SCIA 2XQVA 1RYFA 3AF4A 2JIDA 3F6PA 1PYOA 3TTUA 3UFXA 3VNSA 3ZQKA 3TBKA 4B3BA 3DDOA 4BNHA 4MV9A 1KPGA 3IOCA 4KPGA 1FP6A 4G5YA 4B5LA 1Y0BA 4LZZA 5C8DA 3IKJA 3ZVLA 5TB5A 1R6TA 3CVUA 1SCUB 5M04A 3D7RA 1H0HA 1ORIA 2F55A 1YZFA 3DBRA 3CG4A 4JH0A 3RNLA 1F17A 1L5ZA 1VC2A 4ZAGA 3CR3C 1NX6A 1UM9B 2JIMA 3SEFA 3S2GA 1W8IA 2WYOA 3H11A 2E89A 3I1FA 5FA8A 4EITA 5KWEA 3QKRA 2J67A 1UT8A 5D3ZA 2JCBA 1OLSB 1PEDA 1UJNA 1I5OA 3OLCX 3CMMA 3RSHA 4KTTE 4Q1CA 1KP2A 4CU5A 1SVSA 2R6GA 4I55B 5CR9A 4MW6A 3SQMA 1JQ3A 4JJKA 4IR7A 4W1RA 5A3SA 3WB9A 3I5AA 4G4GA 2I2BA 1DRWA 1CERA 2OK7A 2RB5A 1IUPA 4J1NA 4QSMA 5DTQA 4OAPA 3RJ5A 3DR3A 3R5SA 4GX2A 1C7QA 3EHEA 4O4JF 1OROA 1XD2A 1KY2A 2GESA 1MO2A 1WE2A 2Y1XA 3BMNA 3MQ4A 5LBTA 4E30A 5BQPA 4BRZA 5GV7A 4AP6A 1MW9X 3RU2A 1VJ5A 4F9EA 4GPBA 4GI1A 2JEYA 4YALA 3AY0A 2I9KA 1XCMA 4ND5A 2A5YB 1JT2A 3DDHA 2ZB3A 4IWXA 1F4PA 3OFJA 4P2GA 4RY9A 3P97A 3M5CA 2O7RA 1U6KA 3AKCA 3OWHA 3ZS8A 5KYVA 3JYHA 3F3YA 5JS2A 1PWYE 1WHTA 4QFCA 1XKLA 1Z17A 4X6XA 5COQA 2VATA 4Q4AB 2YHUA 4PYKA 3S40A 4EPVA 3C3PA 2E4ZA 1AXRA 2ECKA 1IEWA 1YZNA 3ICPA 4HNGA 1NSYA 5FCDA 2YVLA 3ZH2A 2FFHA 2ZWOA 1VG1A 3AJAA 2GM3A 3BRWD 4DS3A 4TVKA 4BAZA 4V1CB 5JI3E 5TGZA 1CR6A 4TSFA 1UQTA 1SBCA 2YW9A 5EIBC 4JOSA 3UVEA 5TMDA 4EPWA 5FOVA 1GSOA 1H69A 3B3GA 1H8EA 3ZK9A 2WMYA 1MABA 1U1DA 4KLNA 4KAXA 3HLTA 1QYVA 3H65A 5CTJA 5JWOA 1DBIA 1AKRA 1BKSB 1M1YB 1YL5A 3LHKA 4M7RA 5LYYA 2JDID 4PXAA 1P0PA 2FLKA 3RKUA 2RC5A 3RH0A 3WBFA 2VN8A 2YFKA 3CUVA 4OI1A 4BN4A 3DV0A 4HR7A 1FRFS 4HGRA 1A82A 1QNLA 5E1MA 1AZWA 2JGDB 3T7JA 4KSBA 4IUBS 1R3UA 1W9MA 3TRFA 1AS3A 4BP8A 2PTHA 1IQ0A 3LHSA 4PNEA 5ECDA 2FK7A 2JBAB 1X77A 1LRJA 2R65A 1WOYA 4C6TA 3U09A 3E7WA 4NCXA 3QU7A 5E3IA 4DV0B 4L5AA 4RSRA 2BFAA 1NN5A 2JD0A 1TIKA 1EGVB 3L05A 1LTQA 2IU0A 3BF7A 2QUHA 2YVKA 4BMCA 2GUWA 3AVTA 4AJ1A 4R98A 3MD9A 2IEGA 1L7VC 1SIOA 2WVGA 4JEIA 3UGJA 2PHZA 2QN8A 1W0KA 4W82A 5CW2A 2VP4A 3OZAA 2DBVO 4D4JA 4TQUS 1E0KA 1ZMTA 1X80B 1EA7A 2NIPA 1S9HA 3EOBI 3KLMX 4RLFA 4RDIA 2D6FA 2JCVA 2QM8A 4HFMA 4LX8A 4BGEA 1GTVA 1NW8A 1F2UA 3DEAA 2E4YA 4CW7A 3OKPA 3NKFA 1I80A 4XYLA 2XE6A 5E2IA 2D5IA 3RTCA 4RIFA 5CNIA 1PTKA 4PINA 2J9XB 4G4JA 1Q7EA 3RIXA 3TTSA 1SQ0A 4B83A 4OLHA 4Y9RA 4O4HB 4LDJA 5I9IA 5K7SA 1JLLA 1KERA 1RRCA 4Z9AA 2WWVD 3FD8A 5CEJA 2ZRPA 1L7AA 1UMDB 2ZYSA 1E9VA 4FFMA 1V2HE 2B4YA 3BJIC 3ICQB 1TUGA 1USGA 3UK1A 1HSZA 3WGHA 2R1TA 4M37A 1T6NA 4FGLA 3OF5A 4DDUA 4BP1A 3OFND 5KAMA 3VU8A 4JLKA 1EUQA 2EXXA 2FFAA 5AM5A 4XVCA 1LBHA 2B92A 3HU1A 2HYDA 5THXA 2C5BA 2PL5A 1P72A 5K3SA 1XTBA 4ZCLA 3OY2A 4R9UC 3S1AA 4CZ2A 3FTDA 1WRBA 3FETA 3UMGA 1NMXA 5C7LO 1U0NA 5K01A 1AKQA 1ISRA 2HAEA 3QELA 4CKYA 2CXTA 2XCUA 3RFVA 1Q0UA 5HMMA 4M4SA 1CDZA 3TDKA 4B44A 4NXMB 1T5DX 4LPSA 5H4HA 1VG9B 2A9JA 4IIJF 1EIWA 3MUOA 1XZKA 3IPAA 4F60A 1BCRA 4WXMA 2OENG 4MNTA 2ZFUA 2OLEA 1QTNA 4A0HA 1AV6A 3KC2A 2J9YB 4C4AA 3TL6A 2GCPA 5JRDS 2QE7D 1T0HB 4OIFA 4UZEA 4GXQA 2BIFA 2G71A 4NMWA 4TN1A 5ALPA 5HG0A 4BFUA 2ZCJA 4LXQA 3N8IA 4RPHA 5CYGA 1LWOA 1L8QA 4IW3B 2YYZA 1Y5MA 1COWD 1PHRA 2J9FB 1Q2UA 4PPQA 4M8IA 4L5YA 3C3EA 1EWQA 1WQ1R 2CDRA 1CDEA 2Q9AA 4RULA 1ZGBA 3DP7A 3BMOB 2X22A 1TZJA 3R0JA 4LV6A 1IWOA 4ZWNA 5ILGA 3PSHA 3Q7RA 1NI3A 4NBTA 3ETJA 3TL2A 1KQOA 4D9NA 1RM4A 3MWFA 4XFDA 3F4BA 3LX6A 3UYLA 2WP0A 4AT1A 1LEHA 1KO1A 2RHRA 1T3SA 3G5AA 3KSAC 1NLZA 1QHHA 2WVJA 2Z4RA 5DOZA 1OAKA 2X5XA 3QTBA 1FDRA 3DFMA 3FTEA 4G36A 1MJ5A 3IDAA 1W1UA 3U1BA 3CVXA 3QJGA 2UZIR 1JHDA 2AKYA 2P5YA 2Y76A 4JB0A 3SHQA 3S70A 1A7AA 4B8YA 4CLRB 1LGYA 2J1LA 1KY3A 2NU7B 1CRWG 4QUAA 3BC1A 4RDXA 5GIPE 1EE9A 2JHFA 2RJOA 3A0UA 3A28A 4RL6A 4ZOLB 2O8CA 2FG6C 4X60A 4J3NA 1NXVA 1U04A 1V2GA 3L7CA 4FJ2A 3VPSA 2O2HA 1J5EB 2NT4A 1Y3IA 4WZ6A 4RS4A 4DBLC 5FPYA 4J3JA 3HY3A 5E1DA 2NQTA 3LL7A 3RO7A 3KNZA 3SFVA 1K27A 2P2DA 1NWCA 2E37A 2AMYA 1KK0A 1NVEA 4LS3A 3FZEA 2E2WA 4UNQA 1I4WA 1PZNA 1QO7A 1H8HA 1J1ZA 1I4OA 1XXLA 2HXGA 2IEZA 4JB3A 4KGDA 4PHTA 2JEOA 1M2GA 4Q7JB 1I4DD 1QO9A 4UFNA 5SYNA 3WNQA 3G17A 2NQ2C 4J0JA 3RABA 3WP1B 2R48A 2FWPA 1PJCA 3AFNA 3CCFA 1W4LA 3MC1A 2G7ZA 4QDZA 1DV2A 4JX8A 4IQ8A 1BCSA 1PS8A 3UTCA 4BNVA 1GZSA 3B12A 3K5HA 3MG9A 3UQZA 4ZZ1A 3THYA 1SELA 4BBPA 4AECA 5ULLA 5GONF 3KLPX 5I7SA 3CRMA 2CFTA 2F4VB 9ATCA 5C8YA 4MVJH 5ALGA 5H68A 3NM5A 2QRLA 2YYAA 4TV8F