3BFKA

Crystal structure of plasmodium falciparum rab11a in complex with gdp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
173
structure length
159
Chain Sequence
DYYDYLFKIVLIGDSGVGKSNLLSRFTRDEFNLGVEFATKSIQLNNKIIKAQIWDTAITSAYYRGAVGALLVYDITKKNSFENIEKWLKELRDNADSNIVILLVGNKSDLKHLRVINDNDATQYAKKEKLAFIETSALEATNVELAFHQLLNEIYNVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small GTPase Rab11
publication title Crystal structure of Plasmodium falciparum Rab11a in complex with GDP.
rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
total genus 54
structure length 159
sequence length 173
chains with identical sequence B, C, D, E
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bfkA00
2FU5C 2BHRA 3VNUA 1VKJA 1NIPA 1QVRA 5JI2E 4HLDA 2W0SA 3MLEA 3EARA 3QF7A 2QPTA 3Q85A 5D3MB 3T61A 1Q1BA 4F7WA 1EFHA 4TTRA 1UBEA 3TUJC 5CB6A 2I3BA 4PPQA 2G77B 2OCBA 3B82A 2C2HA 1P9RA 3WXMA 3KKMA 1E69A 1E9AA 1XTJA 1IONA 2MMGA 1DAEA 3O8CA 3V4FA 2ZSBA 3UG7A 2PCLA 2EW1A 3RYTC 3IIKA 3PFIA 1OF1A 4B6EA 3FWYA 3P4XA 1JECA 3UWKA 5C1BA 1G9XA 3FKSD 3RHFA 3K0SA 1VCMA 2K5UA 4HAXA 4YC7A 3ASZA 3CWZA 1XEXB 5EE0A 3UMRA 3K0CA 3LX5A 4BFXA 2BBWA 1SXJB 1N6LA 3LVQE 1SULA 1S96A 1E2JA 3RANA 5JSZA 3BBPA 4FCVA 4NBSA 4UQOA 2BMFA 2P6UA 1PUIA 2A7QA 3CNOA 1Y63A 4ZO4A 4HI0E 4AD8A 3S1AA 3FYHA 1DO2A 2ONJA 3BE4A 4EIWA 4I1UA 3T5DA 4DSUA 1DAMA 2GJSA 3I1FA 4D4JA 2ZJ8A 2QAGC 2ZE8A 2AD5A 1HV8A 2NO9A 4TMXA 1WE2A 4A0HA 1NF3A 5EE9A 1VYTA 1T0JB 3OEED 1ODFA 3MWLA 1TEXA 2IYUA 2DYKA 2O52A 3AGQA 4TLCA 1SGWA 3I72A 1UKVY 1G8PA 2CHGA 1E9RA 2IC5A 1W36C 3SZRA 3U7EB 2NQ2C 5F9FA 1U0LA 4LZZA 1YRBA 1AIPA 2JLSA 1WMSA 3KKOA 5TARA 5AUNB 3R9XA 2GXSA 4RVCA 4V0NA 1OYYA 2GCOB 1TUIA 2AHOA 2GJKA 4L9SA 4QGAA 1H8EA 1GIAA 4EFNA 2HT6A 4M1OA 3CUEF 3WHKA 1OXXK 3ZJYA 2ZJAA 2W6IA 5FBWB 2LKCA 4GSYA 5BN3A 3SI7A 2AXNA 3FMPB 2WICA 1PLJA 4JLDA 1C4OA 3KJEA 1LVGA 3DKPA 1ZYUA 2AL7A 4OQLA 4DDVA 2JJ1A 2Q21A 5CIWA 1J8YF 1J7KA 1AKEA 1E4VA 1NMYA 1W4CA 2BMDA 4FMDF 2JLUA 1E2LA 1W4AA 4LV8B 4IFEA 2OBMA 3AKEA 4JMPA 5FBLB 3B9QA 5KNCA 3IHLA 1NN5A 4NP6A 1F2UA 2QMOA 5B2ZA 4IRUB 4URZR 4E09A 3QG1A 4UXHA 5JJIA 1T6NA 4RY2A 4MKGA 3I32A 3DKVA 4KVGA 3K0FB 1F2TA 2JA1A 2NZJA 3I8SA 1MO3A 4UXJA 4B48A 4M4SA 1NRJB 2GXQA 3KJHA 1M2OB 3WYAA 4BFVA 2WJVA 3U3OA 2ERXA 5E7MA 3DHWC 2VHJA 5FPTA 4GRAA 2XB2A 2J9RA 4M1YA 5L8VA 4E5UA 2VP6A 1BYUA 3I4LA 2WAXA 3RLFA 4A2QA 2G0NA 3VX3A 3L0PA 2R6FA 1AZTA 2PX0A 4KBFA 3KQUA 1AS3A 1IN5A 4HAWA 1T3HA 3B85A 3EIQA 2ZRPA 1LW7A 3HJNA 3KQKA 2QQ0A 3U7FB 1VCOA 4MGYR 2CVFA 3ZZTA 4QL3A 5AR1A 1DO0A 1YHNA 2NO6A 1RJ9A 2ZANA 4L16A 3EPLA 1CEEA 4KV9A 3N2EA 5FOUA 2IYQA 3EAQA 2IYLD 3HWSA 3PEWA 4DLVA 2JASA 3P32A 1VG9B 2CCJA 2GXUA 4A0RA 1G8HA 3D3QA 3I5XA 3NIBA 4I4LA 2QMUA 1YR9A 3F0TA 1DS6A 3AVOA 3SR0A 1W47A 1W0JD 2C9YA 4MYUA 2CXXA 4WAUA 3RS3A 3JVUA 2R6DA 2WTUA 2CCKA 1X1RA 3CB4A 1KMQA 2XAUA 4TLEA 1YZLA 4K8OA 4LC1A 4NCNA 1N0UA 3TIFA 4Z1MD 5J4HA 3IO3A 2WKQA 2X1VA 1G20E 4TWZA 1E0SA 1LF5A 1P2SA 3Q9LA 4G5OA 3B1VA 3GEIA 1AA9A 2KWIA 3TQFA 4XWOA 4F93B 4DCNA 2QENA 3ZIAD 4PC7A 4ZIRA 3B9PA 1YU9A 3P27A 1NG1A 2HEIA 2RAPA 2O8DA 3CRW1 4BLQA 1KI6A 1P62B 4JZKA 4B43A 1HEIA 2YWHA 1CKEA 4RZ3A 4BLTA 1XMJA 1NG9A 5GVRA 3FHTA 1OFTA 4TMVA 3B6EA 1E1RA 3KQHA 3THWB 2ZE6A 4LPKA 1Q12A 2RMKA 4RJLA 2QSYA 3CONA 4Q48A 3PQCA 1PV4A 3EWSA 4R2HA 1I2DA 3NBYC 3NBFA 1OH7A 1I2MA 2QI9C 3SE0A 1U98A 1W36D 5AJYA 2CE7A 2FEOA 2V7QA 2Z0MA 3AGPA 5JCZA 4JYBA 4PSKA 3VTKA 1EESA 2YINC 1E9EA 1OE0A 2YWFA 3LLMA 3BFXA 1MRNA 5TB5A 3KB2A 1CJVC 1D2NA 1U0JA 1Z2CA 4BUJA 3EZ7A 4FIDA 5KTYA 4EPXA 4QNRA 2ASEA 1ZU4A 4B6FA 2QRNA 2BBOA 1BYIA 2P5SA 3V00A 1FX0B 1OXUA 4L8GA 3C8UA 1X1SA 2ZRNA 4M1KA 4AK9A 4RD1A 1IAQA 2OM2A 3HU3A 3PG5A 4KITB 5CLLA 1NBMA 1P9WA 2VQSA 3GLGA 3ZGXA 2IUUA 4DB4A 2J0UA 4TLAA 3U44A 2AWNA 3KDSE 5ELXA 3CNLA 3ZD6A 1PUJA 1J90A 3QPVA 1MO6A 4QNMA 2J7PA 3T35A 1P2VA 3VU9A 1GL7A 5KSYA 1T4GA 4M9QA 5FOSA 3RDPA 2QPAA 3DO6A 5DI3A 5TV2A 2CK3A 4MRPA 1II8B 1KZGB 4O2RA 5ANRB 4D25A 1ZM3A 4MH0R 721PA 5FTLA 2WWWA 2WJJA 4PPFA 4GL2A 4A92A 1YKSA 4DHEA 5L3QB 4P3YA 3KTAB 3Q5EA 2V55B 2VSOA 2ZTSA 4LJ7A 4YXWA 3NHAA 1Z08A 3R20A 4JLKA 4D81A 5KDOA 3H86A 1R2QA 1X86B 4M21A 2QAGB 1N3BA 5FR1A 1R0YA 5CJPA 3CPHA 5D3MA 1AGRA 1S4QA 2PLRA 1S0UA 3W90A 4ERNA 4A6XA 1OIXA 3WP0A 4V0MA 4HB2A 1DBSA 2VP5A 5CDFA 4X8OA 2CCGA 3GLIE 4QFMA 2YC2C 3KZ1E 3REFA 1AGPA 3SYNA 4BFUA 3V4RA 2EQBA 1LS6A 1COWA 2EFDB 4K81B 1W36B 1II0A 2XSZA 4A2WA 4BFSA 2IYXA 5K8UA 2QL6A 2OAP1 4WOPA 4LC0A 5E95A 4HLUC 4JVLA 5AWFC 2QROA 3F5FA 1NMZA 2ATVA 1Z0AA 4Q7JB 3BXZA 1XEXA 4DCTA 1IY1A 3CW2A 3J81k 3EZ6A 1TEVA 2EWVA 4DRZA 1P75A 1SXJA 1GNRA 3P1JA 1EGAA 5FUXA 3TLXA 4BECA 3BB4A 4M9XA 4LV6A 4CZ2A 1QHSA 2PMKA 5KO2A 3BD9A 1Z06A 2WOJA 1FFHA 3W6NA 4BLOA 2F7SA 1E98A 1TMKA 2ZI9A 3BRWD 3Q7QA 4LJAA 4S2EA 5KHOC 1Q21A 2GJ8A 3GLIB 2PT5A 4OQMA 2WWFA 3CR8A 5B58C 5HE9A 4D0NA 2D4HA 1XB2A 4GPTA 1IJFA 1KTVA 3O8DA 3DL0A 5EXTA 3TE6A 4DSTA 1E94E 1L4UA 5K8IA 1OIWA 2C5LA 2A2ZA 4QGFA 4MRVA 4GP7A 4NYIQ 4PSVA 1Q1QA 3P20A 4WW0A 4TZ6A 3K0EA 1BKDR 3T34A 2OT3B 2GILA 4URWR 4V02A 4JLOA 4KXFB 1XMVA 2A5JA 1Q3TA 1U2RA 1JPJA 4IDHA 1Y3AA 2BBSA 2JDID 4G5SA 3VR3A 3NDBB 1A2KC 3ADKA 5IRCD 1S3GA 2P3SA 4BLRA 1GRNA 3VKGA 4R7ZA 1G7SA 5DHFA 1JEDA 4PTLA 3CIOA 1G6HA 4URYR 1E2MA 4ITRC 2FZLA 5CLQA 2GDJA 3TJZA 3B60A 3GJ5A 1XMSA 1Z6YA 2GCOA 4WBSA 5CIQA 1M7HA 3FDIA 4AY2A 1E2IA 1ZNYA 4DXAA 3IPXA 3W3ZB 4D6PA 3ASYA 5AJXA 3OIWA 3BK7A 4OK5A 3EIHA 2F43B 1RE0A 2WBLC 3EIEA 3BS4A 1VHLA 4QM6A 4ILEA 3FTQA 1CJMA 2NOAA 1SVLA 4C9BA 1CR1A 4OBEA 2VP9A 2W0MA 4B3BA 3LQRA 2X77A 2ZI5A 2ZS9A 4IEEA 2GK6A 3FKSA 3GJ7A 4PR0A 1QBKC 3TBKA 4DLSA 2HV8A 2XTNA 4QRHA 2F1HA 4KO8A 1A2BA 4Q9LA 1GG2A 1RRPA 4QBHA 2PZGA 2I1QA 2FGJA 1P60A 3B13B 4LBYA 2WWYA 4Q4AB 2FDCA 2FPMA 5JFGA 5J4KA 4YMSA 1E2KA 2D2FA 3K0FA 2FZ4A 4LYAA 1G21E 5E7JA 2V1UA 4FMCF 2FF7A 3AF2A 1IBRA 1G17A 5EP1A 3SN6A 2IS4A 2OFWA 3UMSA 1ZIOA 2VO1A 1UDXA 2QPOA 2ZSFA 3IGFA 1H65A 2WMOB 4P32A 3P26A 2BKEA 4W5WA 3B78A 3L2OB 2WWXA 4TYNA 1BMFD 3PUWA 2I4IA 3O47A 3SFVA 1JBKA 4KBGA 221PA 3OEHA 5FOTA 2PJZA 2VTKA 4DSOA 1GRQA 1T3SA 4I1OA 3L0OA 4XVRA 2ZSDA 3VNVA 1C1YA 1P6XA 5D3QA 1OW3B 2PZEA 3BC1A 2KBFA 5L3SB 3HYRA 4CDGA 1KNXA 2ZJZA 3EPKA 1D9ZA 1KK3A 4JLAA 1OXTA 2EFEB 4O3MA 1YZNA 2JLXA 2JEOA 5DIFA 3ADBA 2NPFA 2XNSA 2FE4A 1G1MA 1FMLA 3K9LA 1VPLA 4PC6A 4GZLA 4A36A 2ODBA 4Q66C 4CEIB 3DMDA 1W46A 1YZUA 4UJ5A 2CL7X 4M1MA 1W4RA 3QENA 2H57A 4DLRA 1KI4A 4B33A 2OO7A 3VHLB 4US1R 4PC3A 1G8FA 4QOSA 1KNQA 1DAKA 1ZD9A 4A2PA 2IHBA 2AD1A 4MUBA 4NH0A 4OHZA 1O3YA 4YMVA 2ZS7A 1HTWA 4HATA 1E9SA 4BFTA 2GXAA 1GNPA 1DADA 1FP7A 3LO5A 2YOHA 2OLJA 3EWAA 3B5JA 1ZM2A 4OI2A 3UWOA 4PQRA 1PJRA 3ZZUA 4CW7A 2E87A 4HDOB 4WZ6A 3SC3A 5GJCA 5B64A 4HDQB 3IEUA 1KDOA 4S35A 2C9CA 1EFTA 3OIYA 1GZSA 2V9PA 2CNWD 3THWA 3L8ZA 2XZLA 4AWXA 2GBLA 4X8HA 1VIYA 3SS8A 3BIFA 4B3CA 5EE5B 2D74A 4U5XA 3KUCA 2ZROA 1ZM4A 4F92B 3U3MA 1IY0A 2FPLA 2BC9A 2N42A 4O2LA 4B75A 3RS2A 2JAQA 1RRFA 2Z83A 1IOZA 2C78A 1CRQA 3Q7PA 2FNAA 4KHZA 3CR7A 3O8RA 2O8BB 2DWOA 3B2EA 5IDVA 5EP4A 4Q9KA 3ZVRA 3AF1A 3SEAA 1XTQA 1G8GA 1XRJA 2YOFA 3RS7A 2QBYB 2LWIA 2WJYA 2GJ9A 2HYIC 1UBCA 3AP1A 4QJ4A 1G41A 2J41A 3TR5A 4JKIA 821PA 1FX0A 4KFRA 3A1TA 5LBIA 1MR3F 4AI6A 2XZPA 1G7RA 1XCPA 1US8B 4IVRA 1KI6B 4KODA 4X8LA 2RB4A 3O8BA 1EK0A 1XTSA 1KO1A 2ZAOA 5HZHA 4LRWA 3T1QA 4HUTA 1HUQA 1MO5A 1XEWX 2ZUDA 2QGNA 2ZRDA 4LUCA 3TMKA 1XZQA 3E2IA 2IX3A 1TQ4A 4TTPA 1CULC 1XNJA 2IA5A 4G1UC 1COWD 1Q0UA 1KKMA 3UPUA 3QXJA 1II8A 1G5RA 2JGNA 4NYIR 4Z1MA 1UKEA 3ZD7A 2ZSEA 5JHHB 2J59A 2VYFA 3GJ6A 2ZM5A 1ZNZA 4YMUA 5L3QA 3KKQA 1DAFA 3KTAA 1YRAA 2QN6A 1D8TA 1VYUA 3ZIAA 4Q02A 1Q57A 1SXJD 1U94A 3QPWA 1TTTA 2CL6X 3CPEA 2RGNA 1QHGA 4FI3C 1U9IC 2QAGA 3QKRB 1HT1E 4YMWA 2BIFA 2GWHA 3AM1A 3M0EA 1T9HA 3TGPA 1CXZA 2J87A 3KJIA 1JR6A 2V4ZA 5SZIA 1KK2A 2SHKA 1G5TA 3CM0A 3UIEA 4FMBB 2J0UB 1IM2A 2H5EA 2H8KA 4BZPA 4DIEA 5LDDC 1KSGA 4V0ME 3T15A 5DYIA 3UATA 1ZW6A 4IXNA 3QUSA 5DNYB 3GLFE 5EP3A 4PFSA 4OI1A 4A82A 4HAUA 4QBIA 1SVWA 2WJHA 5EE3A 1D2MA 2ZETA 4GMDA 1KI7A 2A5DA 3TVTA 3WNDA 2MSCB 2Z43A 4OL0A 1G8YA 5BN5A 2Z4SA 4JJZA 5A5GA 2RKOA 1B23P 1CP2A 1TF7A 3H84A 4JT4A 2VPPA 2GCNA 4PZYA 2XX3A 3LVRE 1PZNA 5FR2A 3UG6A 4CT4B 4DWJA 4RZUA 3GLIA 3AEZA 4FINA 2J0VA 1XPOA 2QU8A 3WHLA 1U8AA 5JS7A 4D2IA 3NEJA 3G82C 2YV5A 2RGEA 3QBTA 4TZ0A 4N3NA 3GLFB 4URVR 4MKIA 1ZUIA 2V54A 3KX2A 1S2MA 3SFZA 1VG1A 4QHSA 3NC1C 2ZRHA 2G88A 1CJKC 1O87A 2G1JA 5M04A 1HE8B 4DEXA 3X1DA 2IL1A 1MRSA 1VYVA 5JI3E 2BEKA 1XJQA 4GZMA 4ZDIA 3SJBA 4DSNA 3NWJA 2GZDA 4Z8YA 2PBRA 4QHYA 4CT5A 3VKHA 3BH7A 2BCJQ 5SZKB 2QT0A 4OK6A 2VH5R 4BGDA 5LB2A 2ZI3A 3RS5A 1E2GA 5BYKA 4W9MC 2NO7A 3AUYA 2ZJ2A 4V0LA 2A5FA 1E2PA 2G3YA 4C2UA 1OH5A 2UKDA 2GRJA 2GKSA 3OE7D 3EZFA 4LHXA 1U81A 2P67A 5H68A 3A8TA 2JLRA 4C0AC 2F43A 5C2JB 2VBCA 1WA5A 4B74A 1Z0IA 4LI0A 1KJZA 2TMKA 1RFLA 4Q21A 4LK2A 4DKXA 3FB4A 2ODWA 3THOA 2N46A 5K8LA 1GITA 3OEHD 3LD9A 3TUZC 5KPJA 4LHYA 1IXSB 4GBMA 1ESNA 2RH5A 1AKYA 5HKKA 5CYPA 4MYTA 5DE3A 4U02A 5GJWC 1CLUA 3RABA 2QP3A 2IK8A 4P0TA 2YC4C 1CR2A 3GLHE 4Q4AA 1P2UA 5KU1A 1QDEA 4LHVA 1AM4D 1YR7A 2C8VA 4LJ6A 3AF0A 2CBZA 4B34A 3E5HA 3BH6A 2B8WA 4BWYA 2HLDA 3IO5A 3E70C 3B8HA 3I3SR 621PA 1ETUA 1KK1A 2FFQA 4KJZA 2CLCX 5FH9A 4LY6A 2ZS8A 2P65A 1U90A 1XD9A 5FL7A 4Q4LA 3CX7A 4PPNA 3W8RA 1G291 3CKLA 4BPBA 4KFTA 1W48A 4OHYA 4MRSA 4D4KA 1Q44A 2GK7A 2Q9CA 1FQJA 1OIVA 4IW3B 4AYXA 5L3SA 1DVRA 5JRZA 1SQ5A 2JDIA 4U00A 1R0XA 4NPHA 4IDOA 4PHHA 2FFBA 3MWYW 4XVQA 4BEBA 3A58B 2I1VB 3GLHB 4NHOA 2C99A 3WMGA 2OHFA 2OXRA 5EE1A 1XCGB 3K9GA 3RRMA 3NDPA 4DUGA 3N5CA 3QKUA 4TL6A 5JJLA 3SQWA 2MSDB 3A1SA 1MO4A 2X2EA 4CEIA 1CIPA 2WIAA 3ONWA 2VP4A 1YZTA 5EXXA 5DN6D 1Z28A 2GZHA 3FHCB 3SDZA 4EUNA 3OIVA 2RHMA 4OHVA 1TX4B 1GOTA 3TVDA 2W6JD 1T91A 2ERYA 1K5DA 2YNMA 4PZZA 4QJ3A 3GMTA 1OV4A 1FP6A 3FMIA 3FPAA 4Q9HA 3W9YA 2O8CB 4HAVA 1SKYE 1KO5A 2QORA 2XITA 3AKCA 3T5GA 3CZQA 2WJIA 4Q5IA 2HXYA 2OEPA 4KSBA 3KL4A 4LGMA 2CMKA 4MYCA 4ZCLA 3RS0A 1IXZA 2QM8A 3VAAA 4EAQA 1AJEA 2Q9BA 3MUFA 5FL3A 2FGKA 4MDEA 3IQWA 5B57C 5FFMA 2NG1A 4AG5A 2R44A 3AF4A 2QTFA 5FTJA 2GNOA 3CO5A 4NCKA 4JJKA 3OF5A 1TAGA 5CITA 4A8JC 4JVMA 4RD2A 3FMOB 2QRZA 3TUIC 4OHWA 5H70A 3DMNA 1MOZA 1G3RA 1KIMA 1BIFA 4RCZA 1OFIA 2RGXA 5HTKA 3GJ3A 2L0XA 1SKYB 5E3HA 4LOAA 5H8WA 1BMFA 3CF0A 3DZDA 3FKQA 1CRPA 3AVYA 2AFHE 2ORIA 2R8RA 3IBGA 2O0HA 2O8BA 5FTKA 1XD2B 4GDFA 3AKYA 4G01B 1P2TA 2WWIA 2IEYA 3A4LA 1LY1A 1XF9A 3B1XA 4DBLC 2ZQ5A 1LS1A 2QBYA 2AKAB 3QVUA 1RYFA 1UAAA 4QHTA 1Z3IX 2FOLA 4P31A 1FTNA 3VHXA 5JWHA 1X3SA 1QHHA 4C2TA 1R0WA 3GCGA 5G40A 3PEYA 1US8A 2G1KA 4OJKA 1N6PA 3X2SA 4EDHA 4QKQA 3KQNA 2REXB 1G3UA 3NBXX 3A1WA 4HLUA 3HPRA 4RD6A 2ZRJA 4TYPA 2C77A 4PAQA 2ZJYA 2XJ4A 1EFRA 4UKDA 3CH5A 3EA5A 1G3MA 3DM5A 3U3JA 3CRMA 2J46A 1N5IA 5CJ2A 1RRCA 4TMZA 3LV8A 2NGRA 3M4YA 3TAHA 3LAWA 2ZU6A 5FUWA 3VR4A 5KDLA 4JL6A 4C0KA 3LW7A 4M22A 2IEZA 1WRBA 4HEJA 4JS0A 1NNEA 1ONBA 2IYZA 3RS4A 3NBZC 2ZRMA 2OBLA 1RIFA 1QHYA 1RVDA 1N6HA 3PCRB 5E7IA 2YKGA 3QKRA 2GVDC 1KOFA 3QEJA 2WSMA 3I5YA 1R5OA 2CNWA 3ADDA 5JHGB 3GEEA 1R10A 3QXSA 1SHKA 2GF9A 2OZEA 1NLZA 1E79D 4JLVA 2QG6A 4K46A 4A15A 421PA 3I61A 1G7TA 1QG2A 2VSFA 3AVTA 4AURA 3FOZA 5TXGA 1N25A 3KJGA 1M6NA 1ZMXA 2ZRFA 5J47A 4ZDKA 1N6RA 1L4YA 3QE0A 3VR5A 5JEEA 1DOAA 4UNPA 3WP1B 3T1TA 4G5GA 3BWDD 5F98A 4MUAA 2OSBA 3GPLA 2BBTA 2RHDA 1Z8FA 3TSOA 2PZFA 1HQYE 4DT1B 3A1UA 4EPYA 1DG1G 3GJ4A 4Q03A 4EJSC 3QI2A 1GILA 2AN9A 4C4PA 1G6OA 2FX3A 3LX8A 3PJRA 4DVGA 3A6PC 2BMEA 4LYHA 1FUUA 4B3DA 1G64A 3VR1A 2AK3A 4B32A 4PX9A 4XH9B 3HU1A 3EA0A 2O5VA 2UZIR 5DISB 4MRRA 4ZPXA 1PLKA 5BW8A 1KSJA 2PX3A 4BASA 3QG5A 1JXOA 3GLFA 2F55A 2XXAB 5JRJA 2ZVPX 1FUKA 3TW8B 3ZVMA 2PJRA 2XGJA 1N6OA 3W34A 4ASUD 4OHXA 2R62A 3FMFA 5SZHB 2E1RA 4HAYA 1NVXQ 1GNQA 3IIJA 4PZLA 1IHUA 4DDWA 4KFSA 2ZRGA 3A36A 1GUAA 3WMEA 1XEFA 5HKKD 2ZR7A 1YR8A 2GETA 4TYYA 4UJ3A 1GKUB 1GAJA 2YOGA 2BMJA 4LJYA 5FPYA 2Q3HA 5FPKA 3ZLJA 1JR3D 3U3RA 4HLCA 4Q4HA 1KY2A 3CZPA 4OJQA 3TRFA 3A37A 4C0JA 2XOKA 4TQUS 1XTKA 1A4RA 1T8TA 3LBNA 4HLQB 1OXVA 2P5TB 2HLDD 4RFVA 4ARZB 4XD7D 4P4UA 2ORVA 2VSXA 2ZYUX 3LQQA 4M1WA 2A5YB 5FL7D 4F91B 1SKQA 3EW9A 4C30A 4CEJB 1OJLA 1W4BA 3Q72A 2HXSA 1X8KA 3NHBA 2W2TA 1P9NA 5FBQB 3GD7A 1XJCA 3I92A 4NE2A 2WKRA 3W6PA 2GAOA 4BRUA 1TU4A 1BH2A 3T1VA 1NY5A 1OLOA 4AKGA 2OESA 4HZUB 4Q9JA 1DTSA 4XTCS 4FCTA 1Q1EA 1G18A 2Z6VA 1P61B 2QA5A 3K0AB 3LBIA 1DAHA 3MG9A 4ZI2A 2V1XA 2FSHA 5F2EA 4DUGD 5J4LA 2A9KA 5H1YA 1JR3E 1YZKA 2W2VA 3R7WB 1ZU5A 4DDUA 4JLMA 1E9BA 3Q5DA 4IHQA 3QF4B 1OKKA 2EYUA 3MD0A 4W5HA 1NSFA 1XXHE 2GTPA 4CRWB 1II9A 2FSGA 1T5LA 1G16A 3BAFA 3SOPA 3MFYA 4NYJQ 3RSLA 2R6CA 4H9GA 4CYMA 3PR1A 1W0KD 3IPYA 1KDPA 2FFAA 3VX4A 5FTMA 2EYQA 2IYTA 4E03A 4ZI3A 1EX6A 3WYFA 3LXXA 1G3QA 3GLHA 4A8JB 1ESMA 1M1YE 2QSZA 5JEDA 2HF9A 3U2QA 3BB3A 2ZRCA 3ND9A 2O0KA 1Z6GA 4NDZA 5KYKA 5JJKA 2QEQA 3T12A 3OE7A 4UNQA 2YWEA 1XXHB 3B1YA 2YVUA 3RC3A 1H8HD 3CX6A 3THXB 3SBEA 4RD3A 2GZAA 3K53A 2OG2A 4BZQA 2QTVB 3FVQA 5BN4A 3ZZ0A 3PIRA 4MKHA 1OHHD 3WNCA 1D5CA 2D7CA 3RAPR 1MV5A 2O8CA 2XTZA 2P6RA 3TW4A 2QP9X 1NN1A 3ETLA 4TT3D 3R8CA 1JEEA 2DWPA 3WBKA 2PT7A 2X2FA 3OESA 5GJVC 2OE2A 4KAXA 5CM8B 3VR6A 3TNFA 3RRZA 4B3GA 2WWGA 1DG3A 2B7CA 2REBA 3PEUA 4LV5B 2Z5FA 3KXLA 3TK1A 5CYOA 1N2CE 1U99A 4CGZA 3VQTA 2KBEA 4WXPA 2ZITA 4FMDB 3E1SA 4URXR 4II7A 4TQAA 3LFUA 3UANA 5EUMA 1K6MA 3HYTA 1DE0A 4IJMA 3AUXA 4TLBA 4V0OA 3OAAD 2QUZA 1V5WA 1NIJA 1X6VA 1ZCBA 2OUKA 2W2XA 2XNDD 4PAOA 4R98A 4JVNA 2IXEA 4H1VA 3MGCA 5KDDA 3U61B 5AJWA 2HUPA 1GM5A 3PEVA 1ZC4A 2FJUA 1KKLA 1TADA 2PCJA 1EFRD 4LJ9A 4UNSA 2ZRLA 1XD2A 1OYWA 4Q4JA 4RFSB 2YYZA 3D7MA 1U9IA 4QGHA 4DDTA 1WXQA 3BERA 4NTZA 1KMHA 1G3IA 4LJ4A 3IUYA 4CEHB 1NKSA 4MGZR 4PHFA 3M1IA 2EFHB 4N1AA 4MA4A 1K5GA 5DO9A 4OQFA 4KYUA 1I4LD 2EFCB 3GFTA 3H2YA 2ZAMA 1Q20A 4QBGB 1T8UA 4IOKA 5FPHA 2O8FB 4TSFD 5DN6A 2ZXUA 3C14C 1XJ0A 3KKPA 3WMFA 5TMPA 3QEOA 4YDHB 2IXGA 4PQYA 3ZS8A 4F4CA 2XJ9A 3KKNA 4Q18A 2GA8A 4D26A 1Q1ZA 3AVVA 2W6JA 2DCUA 2ZYVX 1E96A 2WIBA 2EVWX 2V6JA 1NJFA 1E2DA 4DCVA 1ZM9A 1VCIA 2NTYC 4EJSB 2DB3A 2OV2A 1KI9A 2WZQA 4RSGA 1FMJA 2IF0A 1Z07A 4GNKA 3C7KA 1JPNA 2IWRA 2JLZA 4FWTA 4JSTA 3QBVA 3DEFA 3MMPA 2C96A 3QJYA 5DSZA 5IHPA 5HE8A 4NL4H 3I73A 4ZKDA 1CTQA 4PC2A 1EWRA 4Q1FA 3ZYCA 3K70C 2HT1A 4EKDA 5FBVB 1EFCA 1TQ2A 4ZV4A 3PXGA 5DI9A 3ICEA 3BB1A 3LDAA 2QY9A 1QHHB 3UMFA 1W5TA 2FV8A 2A30A 2LKDA 4HAZA 4A1FA 4AIIA 3ZH9B 1E2EA 1WCV1 8OHMA 4IVPA 2DFKB 1G4AE 1GKIA 1LV7A 3MJHA 2NPIA 4LBVA 3H4MA 4JLNA 1N5JA 1RPZA 2JJ2D 4QBFA 3EC1A 3AF3A 1Z29A 2P0EA 2ZI4A 4GFDA 4JBYA 2AR7A 1E0KA 3EZ9A 1CBUA 1OB2A 4JIMA 2PMDA 3RRNA 2KI5A 3U4QB 1SVOA 2ZYWX 5BYJA 1KI2A 4JT2A 1P5ZB 2VP2A 1NN0A 2ZSAA 5JCPA 4DT1A 4IFBA 2FPKA 4KI0A 1F60A 2VA8A 5EZ5A 4Z51A 1KAOA 1R8SA 3BOSA 1TQ6A 2GEDA 1KI3A 3EZ2A 1EG7A 1ZJ6A 4O25A 2WV9A 1ANKA 5FOWA 3I8XA 2GF0A 2DY1A 2IXFA 4M8NE 2ZPTX 3OHMA 5DH9A 4MGKR 3R9IA 4KSCA 3DPUA 3T06B 1D2EA 1FNMA 1GWNA 2XOKD 4DJTA 1X8LA 4RD0A 1L7VC 1Z0JA 2QM7A 4X8MA 3RC8A 1Z5ZA 4N0DA 1XTIA 1QF9A 2XXAA 1IY2A 1UKZA 3SBDA 1NVVQ 1KSHA 1MABB 1KO7A 2PH1A 5JECA 4LX0A 1JI0A 1AN0A 4NYJR 1GP2A 4AKHA 4PAMA 4KLZA 1RC8A 2CL0X 4ABYA 3K09C 2BJWA 2ZJBA 1ZM7A 4URUR 2X8AA 1BO6A 2ZI7A 2BVNA 1KI1A 1IXRC 3K8YA 1JQJC 2BV3A 4PHTA 3U6KA 2AKYA 3PVSA 2R6GA 3X1XA 2HYDA 5IF9A 4FD2A 1R0ZA 4TMKA 1E9FA 2QTHA 4I99A 4M2LA 2QE7D 1J2JA 5KNDA 3FGNA 3TH5A 3X1WA 1FL9A 3ZVLA 4HUQB 1N6KA 5DLQC 3TAUA 1ZIPA 2ZRKA 3C16C 4ARZA 2OFXA 3THYB 4L9WA 1XBTA 2D2EA 4Q00A 1E79A 1OKKD 2GJAA 2OFOA 5AK0A 3R9WA 4CEJA 5KOYA 2DFLA 5G3ZA 1GKYA 2ZIAA 2G9NA 4MYHA 4C0HA 1CR0A 5HPYB 1D6JA 2VHTA 2HJGA 1WBBA 3AVXA 1OFHA 4TYQA 4L15A 2R9VA 4BE7B 2IYRA 3CLVA 5C18A 2F1IA 2F1RA 2WVJA 4HZUA 5K8TA 3C5CA 4JYCA 3DOFA 3IHWA 1N0VC 4DLWA 3EPJA 4I81A 2WAYA 3K0AA 1XFAA 3ZS9A 2B6HA 1KHTA 1LFDB 4DZZA 5L3VA 4AKIA 4LBWA 1VCNA 4R2IA 4AC9A 2VEDA 2IUTA 2ZE5A 4YLGA 1KJWA 1C9KA 2VL7A 3R7WA 4Q4HB 4IDQA 4MGIR 4GI7A 1ZD1A 3QF4A 4IDPA 4LYJA 5KPDA 2NZ8A 3AVQA 1SVKA 4DEYA 5J5CA 3QIAA 5EXPA 4RKEA 5KNBA 2VP0A 4D80A 2CVHA 4ASUA 3VKWA 4ZKEA 1E2HA 1M7BA 3OFND 1R8QA 2CDNA 2ZRAA 5FUVA 4YDSA 3K70D 1Z0KA 3DZ8A 1GVNB 3F8TA 3LXRA 2ZUCA 4GP6A 5C4GB 5GADl 2DPXA 2YJTD 4TYWA 4OQXA 4OKSA 4A8JA 3ECCA 4B2IA 1QHIA 3HR8A 1Z83A 4FWIB 4PO9A 4AG6A 1JR3A 4IEIA 1TU3A 4G5RA 4M53A 5CM9C 2RGNC 3EASA 1RKBA 1YQTA 3TR0A 1XXHA 4ESVA 3THXA 5UKDA 1Z6TA 2WKPA 4XD7A 4A0FA 3W3AA 4XIGS 3QY0A 3L82B 2DWQA 3PUYA 4NCHA 4DB2A 4PXAA 1XPRA 1NLYA 3PUVA 1FPMA 4FXPA 5G3YA 1VMAA 5A4JA 3C4JA 3JZAA 1I4TD 2ZYTX 3REGA 4AYWA 1M8PA 1KZ7B 4TMWA 4B35A 1U8ZA 4Q9IA 1UDWA 1OPXA 3U7HB 3QVVA 2D3WA 4LJ8A 2DHRA 2DFNA 4I1SA 1XU4A 2ANCA 5SZJA 2OCYC 3CRVA 2OCPA 1E3MA 4A9AA 2DR3A 2AK2A 1NP6A 5KUTA 3QQ5A 2C95A 2G6BA 2HJVA 3SJAA 1P73A 3MWJA 1ZNWA 2ZI6A 4B2PA 3GJ0A 4P33A 4B73A 2RGGA 2HCJB 3KFXA 1G7CA 2VHQA 5KSPA 4D4MA 1SVIA 3AQ4A 3N70A 3TQCA 1Z6XA 2QQEA 3CPJB 4BFYA 3GFPA 4FMCB 2HF8A 5BXQC 5AUOB 1XD8A 3HR7A 2BEJA 2FA9A 2IYYA 2IW3A 4NCJA 5BWMA 1R6BX 4Q7MB 3FFAA 1FZQA 2Z4RA 3ND8A 1KY3A 3QXHA 4QGGA 1W0KA 1E0AA 2KJQA 4RFSA 3VMFA 2F6RA 3K70B 1W2HA 4P4TA 4XVUA 2C04A 1OFUX 2IUSA 1XZPA 2VRWA 1W1WA 2KB0A 2XB4A 2B7BA 4DLUA 4EPVA 4IOLA 2XZOA 4JBWA 3SNHA 1VG0B 2IHYA 3AV0B 3KXIA 4Y0VA 2IYSA 4CEHA 4KVAA 4NZYA 5E4FA 3TSWA 1W2GA 5FTNA 4YMTA 4C7OB 3K0CC 3WY9A 4EQ6B 4FCWA 5DHAA 2J0SA 2RCNA 4XJXA 1DARA 2RGBA 2O8FA 2IYWA 1A1VA 4YONB 4IDNA 1H8HA 2CLDX 4NMMA 4JL8A 5J4VA 4N0EA 1Z47A 1GL9B 4KLNA 5JBQA 2RGAA 1KDTA 1IQPA 4DLYA 3C5HA 3HDTA 1OHHA 3SQXA 2CJWB 4DCUA 2H92A 2RGDA 3OZXA 3U6BA 5CK4A 3LW8A 4Q7LA 4EJSA 4TT3A 1NVVR 5FUYA 5GVSA 3WNBA 2AFIE 1W44A 4L4UA 1QG4A 3VFDA 4Q4JB 1E6CA 4NU0A 4QG7A 2CEAA 1XDBA 2FFHA 3EX7C 4GMXA 5HCNA 1SZPA 1JALA 1VG8A 3QOFA 2RGCA 2B21A 4BEJA 1KMHB 3B7GA 2H18A 1ELOA 2IT1A 3MAAC 3GJ8A 3Q3JB 4R71A 3L0IB 1FNNA 1HQCA 4CIDA 2VF8A 1ZUNB 5AJZA 1T5IA 3LBHA 1JAIA 4IVQA 1WBDA 3QXXA 2O8EB 2EU8A 1S9HA 4DLTA 3OAAA 1XX6A 2XNDA 4LSGA 2C9OA 3A4MA 3C41J 2ODEA 4HB4A 5AUPB 1WDTA 4H1UA 2ODNA 2JIZD 3G0HA 1P4SA 1Q22A 3LNCA 4V0KA 1CU1A 2Q3MA 2GVZC 2F9MA 4Q19A 1R4AA 4AYTA 5JS8A 2ZU0C 4HYYA 4GOJA 1E1QA 3DOEA 4JL5A 2X19A 4HDCA 3DM9B 3MRSA 3U4QA 2D7DA 5G41A 4D0LB 2HDNB 2E9SA 3W5JA 4F38A 1EXMA 5FOXA 1A82A 4ZCMA 1JB1A 1Z6AA 2BCGY 2QMEA 4TQ9A 5EXSA 2V6IA 3BFVA 2ANBA 3L0SA 1OB5A 4UNRA 1HA3A 2A5GA 1VDZA 4PO1A 1G4UR 4DC9A 1XCMA 1E2FA 2QGZA 4ZCIA 1EFUA 1ZNXA 4ZDJA 1MT0A 1UEJA 2JLVA 1B0UA 1CJTC 4F4IA 4ON9A 4TSFA 4JSYA 4JBXA 2WPDA 2ZJOA 3OIUA 4WZAE 1NL3A 2WSSA 2XTMA 3GFOA 1L2TA 3SHFA 1E9DA 2ZJ5A 1EX7A 3NH9A 1J99A 1MABA 2Q9AA 3ZQJA 3CF2A 5FI1B 1T3LA 3BFKA 4OQNA 1S8FA 1P3JA 1IN8A 3KFVA 4V03A 2P6NA 1E0JA 3AVUA 1CJUC 4RKFA 4UXIA 3AP2A 4A4DA 5IK2D 1OH6A 4RZ2A 3NKVA 4RCYA 1P7CA 1XEWY 4XWAA 4BFWA 5CB8A 1IN6A 3BH0A 1F3OA 1XP8A 1TPZA 2GEUA 4G0NA 1LNZA 1QZXA 2QZ4A 1AS0A 1CS4C 4KCGA 2DBYA 1S9DA 3MSXA 1E99A 3DDCA 4TL9A 4GT1A 5HZKA 4HUQA 4ZDWA 1RZ3A 3D31A 1VECA 4XWKA 2CE2X 3NEYA 3L8YA 4DIDA 1J70A 2ZR0A 3THYA 3RVBA 4QM7A 4GOXA 4MDFA 2GHIA 2V8OA 1RW4A 1G19A 1Z0DA 2FEMA 3CWQA 4XTRA 5TVKA 1XPUA 1X8JA 2JJ2A 2PEYA 4Q1BA 4C0QC 5IT5A 2KE5A 1OXSC 1QHNA 3ZDQA 1F5NA 3UK6A 4MRNA 3W6OA 4CF7A 3CNNA 1RRGA 1R7RA 3K1JA 1NSTA 3SJZA 3U60B 1S3SA 2H7VA 4ESHA 2YZ2A 2JLYA 1KYIA 2JLQA 2GAAA 3W8NA 4MITA 1ZD8A 1E2NA 3QKSB 4F4JA 3T1OA 3A4NA 3IEVA 3N2IA 4LHZA 2UVQA 4OI4A 4W5JA 3U7GA 2OAQ1 2FMXA 1TL7C 4KFUA 1FOEB 1R5BA 3IIMA 3ZQ6A 1XWIA 2G83A 2ONKA 1HYQA 3C15C 2YHSA 5HCIA 4MKFA 1BS1A 3SYKA 3B1WA 2GEVA 4FN5A 2B8TA 3SU8A 5LD2C 1GDDA 3NC0C 1ZINA 2LCFA 1KJYA 2FSFA 2AWOA 5L3RA 2IS1A 1ZAKA 3FHOA 3GP8A 1P72A 4DLZA 3CH4B 4A6PA 2P2LA 1CF4A 1OH8A 1IN4A 1HY3A 4Q1AA 4Q1CA 3RWOA 4D82A 3VR2A 1UADA 4P4SB 3LH5A 3L43A 1XTRA 5FI0B 2W83A 2O0JA 4WA7A 4JVSB 4ACAA 1VIAA 3NTUA 1XMIA 1HE1C 1E2QA 4PPGA 2A78A 5JMTA 1KK0A 1KGDA 1QHXA 4M1SA 1YR6A 1H8ED 2QE7A 3AP3A 1AS2A 1GSIA 1R5NA 2ZUBA 2HCBA 1GTVA 3U3KA 1AQUA 2IYVA 4BLPA 3X1ZA 2W6ID 1MKYA 2BDTA 2W58A 3G5UA 1S1MA 1TQDA 4US0R 3K9HA 2GESA 2WOOA 3AVPA 4Q47A 2IS2A 1AK2A 1UFQA 2B92A 2N1BA 2OILA 4OYHA 2JJ1D 3IKJA 1ZC3A 5DGXA 4Z8XA 3RSOA 4Y0AA 2C03A 521PA 5KSZA 2J5XA 2R6AA 3GEHA 1ZBDA 2J45A 2QP4A 4A0GA 1AQYA 1OSNA 4J0QA 1D9XA 2CHQA 1Q3HA 2WMNB 2Y8EA 3PUZA 4RD4A 4B3FX 4NYMQ 4LYFA 4BZXA 1YJ5A 2ECKA 3BORA 4C3ZA 4M1TA 2OLKA 1DAGA 3CF6R 3NH6A 4Q1DA 4OI0A 5JSZB 4XSGA 2ZE7A 4IOJA 1JNYA 4OK3A 3IILA 3S1AB 1ZRHA 4PO8A 3WYGA 2J3EA 1NN3A 1YZGA 5DYGA 5CK5A 4W7SA 2R65A 4G3XA 3ADCA 4HB3A 5HR5A 1W7AA 3P4YA 2J1LA 3AH8A 3NVAA 2Q3FA 1PVOA 3KXKA 3R8FA 4EPTA 1ZCAA 3TKLA 3TSZA 4PHGA 1V43A 1JQLB 3AVWA 4IXMA 1G5PA 5TY0A 1M7GA 4PQFA 2FN4A 4TMTA 2PL3A 1UBFA 1ZVQA 2H16A 3GQBA 3MWKA 2IF2A 4LJ5A 1U8YA 3H0KA 4GOKA 1N5LA 3OFNA 1A7JA 4UNNA 2JLWA 1Z2AA 1N6NA 2NMVA 1KI8A 4HSEA 3RNLA 2UZ3A 3CRQA 2CLSA 4LHWA 3WBJA 1LTQA 1A5TA 4PC1A 2PEZA 2D06A 1KO8A 1QRAA 2MSEB 3EG5A 4PANA 3QPUA 4DLXA 2REOA 3SHWA 4C0LA 4C7OA 3LWNA 1N5KA 4EPRA 4EQ6A 4U7DA 1TNDA 2CHVA 1KDRA 1DPFA 1SXJC 4WVFA 121PA 5GJBA 5JWOA 4FW9A 6Q21A 4LBZA 1AZSC 4QXAA 5AJVB 2F1JA 3W5IA 1ZP6A 2BKUA 4BLSA 4YQFA 3WRYC 5FOVA 4WXRA 2WWHA 1F6BA 3OEEA 1SVMA 5C4MA 1IN7A 3MCAA 2XEXA 2CJWA 5EZ6B 1UJ2A 3KB1A 3JVVA 1TF2A 4B76A 2ZEJA 4KU4A 2WJGA 5KSOA 2BM1A 5F9HA 3WRXC 1HT2E 3LLUA 5J4YA 1E9CA 1N0WA 1LB1B 3PITA 1E1QD 1IJEA 4BRWA 2Q6TA 1NY6A 5LB4A 4US2R 1UEIA 1F2UB 1KSFX 3V9PA 2WHXA 2J7KA 3U5ZB 1JAHA 4HZIA 2F9LA 1UPTA 1HURA 2J0QA 3EC2A 2ZREA 4TLDA 1E1RD 1F2TB 5FBRB 2KSQA 4B71A 1OT3A 5P21A 5C46F 2G0TA 4IKEA 2NIPA 3LRPA 4TL7A 1T0HB 2O8EA 2PLFA 1UF9A 4M0LA 5JLJA 3LY5A 2OCAA 3GJXC 2WPDD 2ZVQX 2V7QD 2OBNA 3K09A 4B47A 1J8MF 2NO1A 1KAGA 2IS6A 2WSSD 1Z0FA 2FH5B 1WQ1R 1FTSA 1Z63A 2AX4A 5FPSA 4CVNA 4G5QA 1W49A 3SJCA 2BJVA 3QXCA 1RJ9B 3JZMA 1SVSA 3Q8XB 4Z54A 4TTQA 2Q0HA 3QKTA 4EPWA 2BWJA 4MQBA 3X1YA 4C0SA 2VIIA 4DCSA 4O0MA 1HH4A 3ZVNA 4JLBA 2BM0A 1NBMD 4NKRA 1KO4A 1E4YA 2F3TA 2DFTA 4HB0A 1JJVA 2D62A 1PLLA 4R9UC 3PENA 3MJRA 1NMXA 2QMHA 1YZQA 1GRRA 1CR4A 4Q7KA 1TF5A 1NVWQ 2J7PD 2ORWA 2VF7A 1NI3A 1BOFA 3FE2A 4QC2A 3AB3A 4AKEA 2CK3D 4B3XA 2AXPA 1WP9A 2QNRA 2ZR9A 1WB9A 3EPHA 1NJGA 4TN1A 4D4LA 1RYHA 5F3WB 4B2LA 1F48A 3QSYA 2VHCA 1I4DD 1M34E 2BOVA 2A3RA 1JJ7A 4YXWD 2NO0A 1FW6A 5JWRA 4ZIRB 4NCIA 1VTKA 3B1ZA 4E07A 2O8DB 4WIAA 1YVDA 4EFMA 4L5BA 1W5SA 1FQKA 2R2AA 3PV0A 2EWWA 4LWZA 1S1CA 2YWGA 1E32A 2QT1A 2FG5A 2JATA 4JKYA 5LD2B 4PSAA 2W00A 1W0JA 3F3YA 1NBME 3KQLA 4Q01A 1U0HC 2C98A 3CBQA 3IQXA 3GLGE 1EWQA 2JJ8A 3QNUA 5J40A 1ZUHA 5EQTA 3IDQA 2F3RA 2XSZD 2FWRA 1DELA 1DEKA 1WF3A 2JIZA 2WM9B 5LPNA 1JXMA 2VHUA 2OXCA 3I62A 1DAIA 5A0FA 4E22A 4D0GA 3NG1A 3ICQB 1L8QA 4EFLA 4Q1EA 2ZRBA 4BFZA 4IOMA 3AKDA 3HU2A 3UKDA 4XOIA 1Z22A 1N6IA 2IWHA 1GFIA 4JLPA 3A1VA 3UXMA 2FSIA 4C0BA 1UBGA 3HP1A 1NLFA 3HPQA 3PUXA 2H17A 3BJIC 1MH1A 4NYMR 3NXSA 3QKSA 4KYIB 5EP2A 1YE8A 5B30A 4POAA 2QAJA 3DVLA 4B44A 3H1TA 4I1VA 5G53C 5BQ5A 1NVUQ 3GLGB 2ZRIA 3CRRA 2JCSA 4JLJA 4RZXA 3D8BA 3M6AA 3U44B 1UM8A 3BGWA 3D6TB 2IBMA 4LCBA 3SYLA 5CDFE 3VU9B 5EUQB 4BQSA 1VHTA 1TUEA 2GCPA 2GBLC 1GL6A 5EJEA 1M74A 3RRYA 3CX8A 5DI3B 2MMCA 3K9NA 2V3CC 2H1LA 4M9SA 2EFGA 1LF0A 5JZVA 2VLIA 4LDJA 1QVAA 4LPSA 4M9ZA 3LA6A 1NKTA 3KUDA 4NONA 1K8RA 4QJ5A 3IBYA 1SHZA 1UKYA 4WZBE 3RWMB 5IK2A 4TL8A 4P4SA 4ACBA 4XSHA 3EXAA 3FFBA 5AUQA 5TDHA 2ATXA 1SXJE
chains in the Genus database with same CATH superfamily
3OHSX 5AI4A 1X2EA 3L6UA 1NIPA 1KIFA 1PJQA 1QVRA 2HPZA 4HLDA 5A4DA 1MEOA 2RHOA 1Q1BA 4F7WA 3OIFA 4KIJA 1D7AA 4TTRA 5I7UA 4RS4A 5DLEA 2VYVD 3ZJVA 1UBEA 2XAAA 4TWJA 4F6LA 1DDIA 4MV1A 3PIIA 5GM2A 3IAS1 3KDPA 5CT9A 3KZKA 1RJFA 3WXMA 3A32A 1O96A 1XTJA 3BXOA 3WWCA 1VLQA 4CLOB 2EW1A 4EJFA 4RX1A 3PFIA 4YJDA 4LNHA 4B6EA 1K3FA 1JECA 5CURA 1MJFA 3UWKA 1KJ9A 2Q27A 2CFRA 5BYAA 5C1BA 4YHHB 1VCMA 4GF5A 4WZBB 1JZQA 1VFNA 2PKEA 4HAXA 1T9ZA 3WLRA 3CWZA 3N3AC 4ZQFA 2GYVA 5BSKA 3RFXA 2NP6A 2PLAA 1M1UA 1PEYA 3L8HA 4ZZIA 5CB4B 1GPKA 3IR6A 4R3UC 3B7PA 3IOEA 5CCEA 1SULA 1S96A 4NBVA 3MNFA 1HC7A 4FCVA 3OH8A 2WHPA 4NBSA 4UQOA 4YJ2B 3UOWA 4CN9A 3KHUA 3N5KA 3BTUA 4R7GA 4RL6A 3WQHA 5ED4A 4UM9D 3DLAA 4AD8A 1F12A 1S4MA 2XOXA 2H4FA 4EPRA 4EIWA 4GPBA 4I1UA 3UK1A 2IPXA 5I9BA 3T5DA 3UB4A 3ZLVA 4PZUA 3RGWS 3AEYA 2PX6A 3T9CA 5CBKA 2DT8A 1HV8A 4TMXA 4MLPA 1WE2A 2FY8A 3FRJA 4HEHA 3TDMA 3WBFA 3D8NA 1BXGA 2Y1GA 4JQCA 3V8RA 1AUVA 1T0JB 1ODFA 1TEXA 5EC8A 4E33A 1ZOLA 3KNZA 1U9ZA 3HM9A 3OP4A 3I72A 4B4WA 3OE4A 1GPBA 1UKVY 1G8PA 1W85B 2CHGA 2IHVA 2TMDA 4F9GA 1C1DA 3ZCQA 1W36C 1IWOA 1DQRA 1FFCA 4ZT4A 2NQ2C 3G1WA 3WS7A 5F9FA 4LZZA 1QGED 1AIPA 3O38A 4P5DA 2EQ5A 3GJRA 3VPFA 3N8KA 3PHCA 1NVKA 1WMSA 1ZJ4A 2NZUG 2SCUA 4A03A 3R9XA 4ZVUA 4RVCA 2BFWA 2H1IA 4V0NA 1BXRB 3M3HA 3PHBE 1OYYA 1TIKA 2GCOB 3AHFA 1FVHA 3DVSX 4MUNA 1W8DA 2J30A 4FS3A 1U7UA 4MWZA 4L9SA 5KWIA 1ZISA 4ECEA 1MZVA 1GIAA 1ZN9A 5KTPA 2I2WA 2VN8A 3CUEF 2XQIA 2W22A 1E8DA 2P8JA 3WHIA 3O2JA 3BMXA 1C80A 3F4KA 5FBWB 5AH0A 4CT0A 3S1SA 4XJTA 4DR4B 1UPFA 2MYTA 1T1SA 2QVZX 3SI7A 5BN3A 1OUMA 4JLDA 1M5RA 1PLJA 4GLBA 4CKEA 5C7LO 2J9FB 2IHTA 5JVDB 2WA2A 2AL7A 3HVKA 3HBAA 4HQLA 4OQLA 3T0FA 4F12A 5HKBA 1HETA 2Q21A 3CH7A 4FYJA 4L6AA 4V2UA 3A1CA 3IH5A 1CQZA 1AKEA 1J7KA 1NMYA 1T2NA 1W4CA 3CCBA 3FLMA 3U4HA 3ND6A 4F2DA 4OTZA 4L4YA 5BRJA 1E2LA 4FHFA 1W4AA 5DIZA 1EJ0A 4KXYA 1K0UA 2NAPA 2NVBA 2WAAA 3AKEA 3GZNA 3NB0A 5A6SA 3LYHA 3PQEA 4DV2B 5KNCA 1N5MA 4UEJA 4L4SA 4UULA 5AICA 4Q7QA 1NN5A 3WIDA 5BV7A 2RI0A 2QN1A 3AK4A 5K2OA 2WZBA 4URZR 1BCRB 1NR1A 4E09A 1VMKA 3NV7A 1K89A 5CT8A 3HRIA 2IHUA 3O90A 3SYMA 5WRFA 4MKGA 3H4VA 4JODA 3E9YA 4KVGA 1NPDA 1UT8A 2GTIA 4M4SA 1NRJB 2GXQA 4I50A 5AKIA 5EOVA 1M2OB 3D8HA 3AJAA 2J8ZA 2WJVA 4BFVA 2X4GA 3U3OA 5F51A 5E7MA 4Z4FA 1E7QA 1J9EA 4YRPA 4J0JA 5FPTA 6PFKA 2J9RA 4M1YA 5EJ6A 5JPDA 3I9V1 1WXFA 1WIWA 1BYUA 4MRAA 4A2QA 4EG5A 1ODTC 2BGMA 1EZ4A 1MF7A 2B37A 3IPAA 4LF6B 1AZTA 2PX0A 3WJ7A 4Q3NA 3FKJA 3PEEA 5TX7A 1AS3A 2CMDA 4KZKA 4O4IA 3KQUA 1B2RA 1V7ZA 4UVDA 4HAWA 1B73A 3RNOA 3IRUA 4FNAA 1XCLA 1PZHA 3U7FB 3DLBA 1TYCA 2CVFA 4E70A 2FZ5A 4ALJA 1ENOA 2ZANA 3QLUA 4JR1A 5FLXA 3EPLA 4HQKA 4JXXA 3H5RA 3OTQA 1WL8A 1OZFA 1T9CA 2VF4X 2V97A 5L4LA 3HB1A 4RKQA 2WFMA 2VJQA 3GOHA 2JASA 3NVMB 5F77A 5C1PA 1UOOA 1A8SA 4A0RA 4F04A 1L4FA 4L8WB 2BPOA 3NIBA 2Z5LA 4UOZA 1NW4A 5ALVA 2RHLA 2H5LA 2ID9A 1W47A 4RK0A 1JH9A 2EAUA 3SX4A 1W0JD 2PN1A 1H2HA 4MYUA 1SUDA 2QN3A 2J3KA 3RS3A 4N0PA 3V1TC 4EYSA 3DULA 3UBMA 3W4JA 1KMQA 3QA9A 4W6ZA 4K8OA 4EG0A 3TNDA 3RI3A 3IO3A 5A4FS 4XPIB 4UTNA 3AUSA 5JISA 1G20E 1A2QA 2QLMA 3PF8A 4UTVA 4KR6A 4KVZA 3GEIA 2KWIA 4R2WA 1E1LA 2IUFA 2NACA 3E53A 1K2VN 1KYXA 5T57A 4CLRA 2F3QA 3PGJA 3PRHA 1YU9A 4X1OA 3ZHVA 1MHPA 3GNSA 2PVPA 1T6BY 3K0HA 4X1KB 3SIWA 4BLQA 2A88A 2WFAA 1P62B 3D8RA 2V3VA 3EN0A 4M99A 4F3YA 1CY8A 3QU4A 5K3OA 3A2LA 4BVJA 1WB6A 3LKVA 2VR1A 3B6EA 1QOQB 4KWEA 4JOSA 4L6CA 2M6LA 3S3TA 2RMKA 2BELA 3UXHA 3C6QA 3PQCA 4TX1A 3EWSA 2BH2A 1I2DA 3DQPA 1V8BA 3NBFA 1AVTA 5F9MA 2Y0BA 4PF1A 4CUJA 3AG5A 4LSMA 1W36D 5DBHX 3AGPA 4L51A 4ZT2A 2HZ7A 4JYBA 4PSKA 3TLCA 2G9UA 2ZBVA 3L05A 3KSZO 1FBTA 2IXTA 2X9QA 4JJFA 3QE9Y 2AX3A 4HNGA 5IWAB 1H2ZA 1XWWA 1PBTA 5EJFA 1NNLA 3MHPA 2GCEA 5LC1A 1U0JA 1Z2CA 3ZK9A 3WAJA 5B7PA 3KOZA 2WUEA 3TQRA 3TQSA 1ZXXA 1CQPA 4B6GA 1D2AA 1VKHA 2VQDA 4CM4A 1EXDA 1QQ7A 4NCXA 1ZGAA 4B3FX 4B6FA 3WFZA 4AXXA 1S8NA 4DS3A 3TLKA 4EB0A 2DHQA 2P5SA 4DR2B 5ALWA 3JVDA 3ZGYA 5JCOA 1VHDA 4PGMA 1X1SA 2DC1A 3KZNA 1IAQA 2XCIA 3HU3A 3JTMA 4H60A 3TKAA 2QUBA 4RULA 1OJ7A 4XGKA 1RC1A 1X1AA 2M2IA 5JS2A 2IBTA 2IEDA 4NG5A 4HX9A 1SN7A 2PKRA 1PR5A 2DPYA 3OQOA 3DLIA 2AWNA 3IAHA 1UR5A 4YRRA 1H2EA 1DUVG 1HTBA 3Q10A 1N7GA 5CTAA 5CBPB 2E48A 5JSYA 3T35A 3HMQA 1P2VA 5KSYA 1T4GA 1QQBA 2I8AA 3N7TA 3N8DA 3RDPA 3G8BA 2QE6A 2IVFA 5DI3A 5TV2A 1VI6A 1DHTA 1II8B 4DRXA 1IEWA 1FXWA 5ANRB 1SUSA 5I7HA 4O02B 721PA 4Y2SA 1YR3A 1ISRA 4J49A 1NONA 5FTLA 1MAUA 1BHQ1 3I83A 3DZIA 3KTAB 2JBAB 4S0XA 2VSOA 5CT4A 5DZSA 4C4SA 4DILA 4TVSA 2X0JA 1QRTA 2NUTA 2J6HA 2NUAA 3FN4A 2ZJ1A 4PIPA 3KLMX 2EIXA 1UMCA 2QR5A 3FUXA 5JTUA 3ZN2A 4DIFA 1C4KA 1JR4A 4UTXA 2QAGB 2R7NA 2I66A 3V1YA 4YCDA 5BSFA 5CJPA 1KY5A 3X44A 1N8TA 1S4QA 4KKVA 2PLRA 4LXUA 3ER8A 4ERNA 3ZU4A 3V55A 4V0MA 3LUFA 5T4FA 4HB2A 1V5EA 4QFMA 3V4RA 3OSUA 3FPLA 1JTFA 2EQBA 3I34X 1W1IA 4M9CA 4CPDA 3VSDA 1II0A 2XSZA 2IYXA 4TXMA 2BEVA 1W9MA 2OLEA 2XGMA 4CIAA 2OQRA 2WD7B 4Y6RA 1J0BA 5AWFC 3OJFA 1JBQA 1ODCA 2HK9A 3RYFA 2ZB3A 2WILA 1JKMA 2WWTA 3ZY6A 3HJFA 1NBWB 1IY1A 4XIFA 3J81k 1DINA 1YFKA 2VH2A 3KD2A 3NEPX 4IHJB 1P75A 3MF4A 1GNRA 2XVZA 1ML4A 1S2IA 2XGSA 1EGAA 1V71A 1KJJA 1XTBA 2J33A 3LBFA 3QV1A 4GPEA 3GRFA 3VC3A 4F1JA 2DUJA 3HDVA 1QHSA 2PMKA 3R77A 1QONA 2FP3A 1FFHA 4BLOA 4RHYA 1BW9B 1GD1O 1MUUA 5B4UA 2ZB8A 1NQTA 2FLVA 5JYDA 2WWFA 1QE0A 3ZKWB 5HE9A 4ZEOA 2D4HA 2GEFA 2NT3A 4GPTA 1T6XA 3RS9A 3ETJA 4R8RA 4V24A 3LO8A 5DGHA 5EKDA 3FPBA 1E94E 3AU8A 4KUGA 3WRXA 1HEUA 1IMOA 2A2ZA 2IIVA 4NCAA 2V9ZA 4H0CA 2WTEA 3K0EA 4G4SO 4BNHA 5CA1B 3T34A 4B0PA 3GELA 1ULSA 2Y1OA 2WR8A 3KO8A 3BGOS 1JKFA 1H2AS 3RQIA 4QTTB 2H51A 1L1FA 1Y3AA 1Z4QA 4GYJA 3LUBA 3G13A 2VPYA 3DGEC 1W5AA 1A2KC 2O1XA 1GZ4A 3AM3A 3GUCA 4J0KA 5C0OE 1YQ9A 4BLRA 4EF6A 4AU1A 4PTLA 2OWDA 2E85A 2G4LA 5IFKA 5KNCD 2FZLA 5CLQA 5LLDA 1ML3A 4C5BA 3RHZA 3RARA 1Y7HA 3B60A 3UJ8A 4WBSA 1BXZA 1Z6YA 3ICOA 2Z9DA 2IHZA 4OMFG 1AT1A 3O95A 4AY2A 1EP9A 4I2NA 3TF5A 3PQ5A 1S2DA 3KZVA 5AHXA 1SCKA 1SVUA 5KJFA 3W3ZB 1CRZA 1CZHA 3OIWA 3C74A 2JKYA 3EIEA 3ZE0B 1NZDA 4BX0A 1JFRA 1WW3A 1W88A 1OBVA 4QAQA 4YQEA 4N47A 3K32A 3TFWA 4YGYA 1UDCA 1QP0A 1C3OB 2W2MA 4ILEA 2JBHA 1ODKA 3UT0A 1CR1A 3V8BA 2B20A 2X86A 2VP9A 4FB5A 4R31A 5LMZA 4YRGA 3LHSA 1S2GA 3UAXA 2ZI5A 4O2AB 4BNNA 1KQ3A 2ZS9A 1FRZA 3NHZA 2GK6A 3QPDA 4DLSA 4HDRA 4F2HA 4DV1B 1JE1A 2XTNA 4P7KA 1XTPA 1P6QA 1AXGA 2XH8A 3F1KA 4KO8A 4ZK2A 5BVGB 3KLNA 3PXXA 4RA6B 5TR9A 3C3PA 1JFSA 4JI7B 1RKVA 3GP5A 3A3NA 3AHCA 3C39A 1F4PA 2CN1A 1E3EA 4JEIA 2FGJA 4LBYA 2O3TA 4A6DA 4WK6A 2FDCA 4ETWA 1JQ5A 1CF2O 3COYA 4BNKA 5DNVA 1GYPA 4Y2JA 1E2KA 3K0FA 3C85A 1I32A 1ODSA 3OZGA 1MA3A 3A1DA 4LYAA 5E7JA 1IBRA 2V1UA 3BIWA 2I91A 4JQZA 1JDZA 2NSJA 2FQYA 3CLTC 3PHLA 4MQ6A 4IMJB 1OFUA 3MS7A 4G67A 4UAGA 2MSLA 4GM1A 4O2BF 5A2GA 1XDDA 3DTVA 4ALNA 3GRRA 1NVDA 3P26A 2FN7A 4GMFA 4TYNA 3LHIA 5FJIA 3PUWA 3WICA 4H0NA 3VZDA 1JBKA 3OEHA 5FOTA 3U81A 4F6RA 4G41A 5DMHA 4I1OA 2LBPA 4YWJA 3VNVA 2Y3IA 2GN9A 3HY3A 2GLTA 1P6XA 3EISA 2B4YA 1OW3B 2PZEA 4D79A 3G7NA 3KEQA 4ZU3A 2PSHA 4BQQA 5L51A 5I48A 5ISMA 4MQMA 2VJLA 4IWNA 4ROTA 3NLLA 1Z37A 1P7VA 1MTOA 3GJYA 2ZBDA 4XVHA 2WNIA 5D7BA 3T7IA 3RSHA 1Y1QA 2NPFA 2XNSA 1QVWA 4RELA 1G21B 1KERA 3K9LA 4ZREA 5LQKA 3FVTA 3I6BA 4QUKA 5TGZA 3DMDA 4TPKA 5DK6A 2C9ZA 3SS7X 5K01A 1YTLA 1UJCA 1X7YB 4PLPA 2ZG6A 4M1MA 1W4RA 3QENA 1KI4A 2B98A 2OO7A 4QELA 4KQMA 3RUDA 1SPXA 3UB2A 4DMCA 3VHLB 5C8ZA 4MHSA 1A77A 3HJTA 5KYXB 1M1NB 1TK9A 1TM7E 2GT1A 4PC3A 4ZQEA 4QOSA 1DAKA 1TJPB 2C97A 2H2FA 3FW1A 4IYJA 4N6OA 4MUBA 4XGRA 1PJBA 3L0DA 4M7WA 1RU3A 4BFTA 4CF5A 1GNPA 2IPOA 4S2UA 1PYOA 1FP7A 1SUPA 3MJTA 3D4LA 1LC3A 2R87A 3HXKA 4QOFA 1THMA 1XZ8A 4OI2A 2JFOA 1YDGA 4ZGGA 1N8KA 1VB3A 3H2BA 1IVYA 1YFJA 1BMQA 3LRXA 3ZZUA 1OZAA 2E87A 4WZ6A 5DYNA 3BD7A 4E5VA 1ADYA 5GJCA 1JHPA 1N9KA 1V48A 5B64A 3IV9A 1FSGA 2GK3A 2IBSA 1VBMA 1QC5A 2FHSA 2WA1A 4RK5A 5IMBA 4UPEA 5ARBA 3I30X 1XHLA 1GZSA 1E6MA 1LGYA 2CNWD 3F5DA 3C6YA 3W2IA 2GBLA 2XZLA 5J63A 1X0VA 1S2NA 3IJ5A 2XQGA 4G63A 3RFUA 3U17A 5EE5B 3ZE7A 3A7EA 1P7ZA 2WVAA 3GDFA 3QZUA 3RADC 1ZM4A 4F92B 5IM4A 1L5NA 2BC9A 3BWCA 2IV7A 2RH8A 1PQWA 4B75A 4YRDA 2VTBB 1D1PA 1X7GA 2XBUA 3DDNA 1KS2A 2C92A 4JEHA 4YRQA 4HZGA 3ZYZA 2UUPA 1CRQA 4AUKA 4KHZA 4JUDX 4XUEA 3VR5D 3O8RA 2DWOA 2O8BB 4NABA 3WKEA 3B2EA 2XHEA 2JH9A 3R24A 5IDVA 2ZTLA 3OSZA 3ZVRA 3SEAA 2BTQA 1G8GA 4MUMA 4WKCA 4PYQA 1PR3A 1NUSA 1X7WB 2QRLA 3SDBA 1GKKA 2AZMA 1YBHA 3AP1A 1FE8A 2H4HA 2QVXX 2J41A 2PFKA 1O5IA 1YQGA 1REQB 4QXPA 1FX0A 1U0BB 5LBIA 1HDIA 1QH0A 4BVEA 3ITKA 3O9VA 4KQGA 3GC6A 1XCPA 2VZLA 4WNAB 3BSWA 1US8B 4IVRA 1Q50A 4DC1A 1NRWA 4X8LA 2R8PA 1HQKA 1FLVA 3IJPA 1EVJA 3H3XA 1XTSA 4GI2A 4LOJA 1DTWB 1KO1A 2A3NA 3D6MA 3T1QA 1HUQA 4JBIA 3OMWA 3G88A 4DM7A 2BI8A 4LUCA 1Z75A 4QRIA 2YIMA 3FLAA 4O4LB 3FSRA 4TTPA 1JHUA 2VH1A 1VJDA 3I01A 4G1UC 1Q0UA 4HK4A 4U2EA 3CLUC 2PS9A 1IPFA 5CCXA 4MI6A 4Z1MA 2YMQA 2Q5FA 1QMPA 2ZSEA 3HKDA 4G8DA 4KK4A 2VYFA 1XZAA 1U2DA 3WKAA 3H11A 2PH3A 4YMUA 1D2HA 3MLAA 1I94B 4AO7A 4RV9A 1S5PA 4S3MA 1Q74A 1WAMA 4MPDA 2QN6A 1T2FA 4ZZ0A 1D8TA 3WTBA 4DA7A 1IZZA 4U2FA 3CLTD 3QVSA 1A71A 4Q02A 7ABPA 5T4HA 2C2ZA 5DX8A 1EVKA 1VKNA 2GPTA 1TGVA 3CPEA 1VE9A 3QPWA 5HDBB 4B3MB 3BZUA 1BEEA 1V8DA 3QKRB 4TOIA 2QRUA 3GL9A 1C9YA 3JRWA 3AM1A 1FDTA 1ZX1A 4GC5A 2WTMA 4JJAA 2HTEA 4ID3A 1L7DA 1ZD2P 5CNIA 4Z53A 4XGIA 4JSRA 1OTYA 2HMUA 1KK2A 4WDRA 3TW8A 4FMBB 4BZPA 2WRZA 3R6DA 2Z9BA 1KSGA 1YWGO 3KAQA 2R00A 3T15A 1YB5A 1KZHA 5DYIA 3TSCA 3UATA 4IXNA 3QUSA 4CN8A 1KQOA 4Z6KA 4GX5A 3Q6NA 4OI1A 1GQRA 2AYYA 3AR9A 3DMTA 3P0JA 4HAUA 1SVWA 4QFBA 1KDYA 3FB1A 4ER6A 4Z4QA 2DPGA 1HDYA 2PT9A 2OHIA 4GMDA 4X1IB 2P4UA 1KI7A 2JC3A 3HXQA 3KYCA 2QSUA 1AKNA 2JFGA 1H0KA 3WNDA 5BSUA 1VYHA 3L7OA 4MVXA 1N1DA 1TMGE 5CX4A 5BN5A 3T3IA 5AW9A 3TPZA 4WE3A 1TTHA 4MW0A 1BEUB 2AC7A 1B23P 1P74A 3F67A 3L8GA 2JGIA 3BK1A 5HZGA 3H84A 3EXHB 3R0VA 2VPPA 4RK7A 4PZYA 5LZ7A 2PX4A 2BGKA 2XX3A 3LVRE 2B3TA 5FR2A 2NYVA 4DARA 2P3QA 2Y1CA 4DWJA 5F78A 3GLIA 1QX3A 3HHEA 3WHLA 3BHMA 4MVJI 3G82C 4GPD1 1FU7A 3DEHA 3QBTA 4X90A 2Y1XA 2ONZA 3M5CA 1GTSA 4TZ0A 4EBBA 3K15A 4URVR 4MKIA 1ZUIA 2IZ6A 2V54A 3KEFA 4HNQA 4YJGA 3SFZA 5BMVF 2E37A 1WPXA 1HE8B 4OGFA 2WT4A 4H15A 3X1DA 3PXCX 5JS6A 2XYQA 2BEKA 1XJQA 5J5AA 1DLJA 1FTYA 3SJBA 3D43A 1ZITA 2GZDA 2PBRA 3BUSA 3DOIA 3GYBA 3L8DA 4IXDA 1QZTA 3FJOA 1F6WA 1G60A 1Y8QB 5EZYB 1CUWA 3ADOA 4R4JA 4M7PA 1DCKA 3UYLA 5CNMA 4NOMA 2JCVA 3UJAA 3RS5A 1CUXA 1E2GA 3V9AA 5BYKA 1PGPA 5K8JB 4W9MC 5IUKC 1H6CA 1OH5A 2GBPA 4FOOA 1PWXA 1M6YA 2UKDA 3DUFA 2OCIA 4EYOA 2YMLA 3AF5A 3PD1A 2FZCA 3KHSA 3LHDA 3HVJA 2PRSA 4GE0A 3DEKA 5K0JA 2Y0PA 4HPXB 4OHRA 3NWBA 1UBRS 3P7MA 2BFFB 4TS9A 4EI2A 4NE9A 1JKXA 2RBEA 3CT6A 4BV8A 3ETHA 1G4HA 4WN9A 1RFLA 1QYXA 2FLWA 3BQ9A 1Q0ZA 4LK2A 4Y30A 4DKXA 3FB4A 2ODWA 1RQRA 2JI9A 4NBRA 4AUEA 3BCRA 5HQJA 4WK2B 5F7OA 3OEHD 3LD9A 1FY2A 3VR6D 4F1WA 5EG5A 4Q9DA 4LXHA 5G2OA 2RH5A 3TSAA 5HKKA 3ZDZB 2Z1NA 3LYAA 4DA8A 2VYCA 2WP0A 4U02A 1AKMA 5GJWC 1CLUA 1ZK3A 4MKRA 4KKXB 5LDHA 1TCVA 3SX2A 3K8QA 3TXXA 3R4CA 4MQEB 3RTEA 2R7MA 4YP0A 5HTOA 1IBKB 4EVRA 1DCMA 1UAYA 3T8YA 4OMDA 2XWQA 4ARIA 3JWHA 3HRHA 2V59A 1WR8A 1AM4D 3FTCA 4GOMD 4C6TA 4LJ6A 3AF0A 3GEBA 5CVTA 5LOVA 4X85A 4BNFA 1RWQA 3LUJA 1AO0A 1TK2A 1ZOOA 1Y6JA 2D1RA 1NJ1A 2QRGA 3PE4A 3JATA 1JX6A 3W8EA 621PA 4G36A 4FNGA 3MINB 4MUKA 3KWLA 1L3IA 2ZS8A 5DGTA 1IEXA 2P65A 3P9NA 4PPNA 1V16A 5EXDA 3WL3A 2FR8A 4KFTA 1W48A 1HT3A 4DNQA 3AB7A 1L5OA 1JMVA 4LI3X 4YYEA 2H2IA 3V8NA 5EJ5A 5IKEA 4EZBA 4HN4B 2GK7A 2NU9B 4Z3OA 3L7LA 1VM6A 4FSDA 1XO1A 4EJMA 1N2GA 1LSOA 1N2OA 1SQ5A 2Z8YM 4HQNA 4LCEA 5B1EA 3I2HA 2JDIA 5JRZA 3B8EA 5KJ6A 3CZCA 4IDOA 4JJ8A 1NQXA 4XVQA 4BEBA 4FFBA 2VDKB 1P7PA 4NHOA 4UU8A 3CRNA 3SGLA 4DADA 1Z7BA 4Z0NA 3WMGA 2R79A 2JA2A 5CB0A 2OHFA 1OLSA 2OXRA 5EE1A 3EG9B 1G63A 3D7NA 1WUHS 3NDPA 1NUPA 3QKUA 5C3MA 3SQWA 3ZDCA 2YHBA 3VJRA 3EEFA 1CIPA 1ZK0A 2CXUA 4F5YA 4DCPA 4LC9A 3MJCA 2VP4A 2JGLA 4EUNA 4Z9XA 3OIVA 1USIA 4OHVA 1XZJA 3TWOA 3DZKA 4L74A 1VQ1A 3NVDA 2W6JD 5P8WA 1OXKB 4QJ3A 4GAEA 3FSEA 4MVJF 4PZZA 2QB5A 4R1SA 3FM9A 1DO8A 1WCYA 1C3EA 4IGFA 1P9LA 4ER0A 3FMIA 1QMGA 3FPAA 3RFFA 3II6X 2O8CB 1BA3A 4Y2RA 1GLVA 3JALB 1SKYE 4X71A 6ABPA 3T5GA 3I23A 4UE2A 1UKAA 2HXYA 4DLNA 3G89A 2D5BA 4K87A 3PTAA 3KL4A 3JQDA 4E46A 2DAPA 4R51A 4WCFC 5E9AA 1OYVA 4V1CB 4ZCLA 7REQB 3VAAA 2XYVA 1EIZA 4GLLA 3L5OA 1R6XA 3DVQX 4QJIA 2YQ5A 5B57C 4TTTS 3GF4A 2AF4C 1MA0A 1PD1A 2HGZA 1FDWA 5FFMA 5KJCA 4BTLA 3LK6A 4M0MA 5FTJA 1UJ4A 3CO5A 4RA9A 4WGFA 4RH0A 3ENVA 3OF5A 3OPYI 5CITA 1IOLA 1D7OA 4DV6B 2FK7A 3TUIC 2QRZA 3PEFA 2FEAA 4H1TA 5JCJA 5H70A 3DMNA 1G3RA 1KIMA 4KR9A 2RGXA 5AKXA 1XRLA 5U4QA 3GJ3A 2A57A 1VA5A 3WIEA 5E3HA 1XZDA 1UC9A 3HKEA 3Q87B 1BMFA 4G8BA 3CF0A 1ZRSA 4QX6A 1CRPA 2AFHE 3NVKI 1YK1A 1T2DA 4DUPA 4FYYA 2P79A 2DHEA 2YVQA 4ZVOA 4G01B 1P2TA 2WWIA 2IEYA 3IT1A 2O2XA 1NBAA 1P7WA 1XF9A 2PTHA 4H3SA 2DETA 3JQPA 4YV7A 5I7OA 4OL9A 1EGVB 3DSRA 2HK8A 5EIOA 5A9TA 2AKAB 3ZCVA 4UEQA 1O0CA 2FPPA 4L4ZA 1T5TA 2H9IA 2FOLA 1PJCA 3VHXA 4J7CA 1U31A 1TM1E 1V7CA 1QYRA 4C2TA 1R0WA 5KAMA 1ZKDA 2W9XA 4I5DA 4JT9A 3RFTA 2G8LA 3MILA 4ENTA 2LRHA 4EDHA 3FUTA 2P35A 2REXB 1G3UA 3ESRA 4J4HA 1U3GA 3FCYA 2ES4A 2VJMB 4ZJPA 4BEVA 1YKGA 3DEZA 3M89A 2Z4TA 1EGMB 4NLLA 4P08A 4RD6A 4BAZA 4K9OA 4ZRDA 1O57A 3FJYA 2VF2A 4LMAA 4PAQA 2ZJYA 4MRMB 4BGUA 1NT2A 4OM7A 4WFKA 3L40A 4D74A 3QNWA 1IG0A 4BXOB 3KWJA 3TINA 3U3JA 4ZHSA 2R5FA 2N75A 4O8CA 4BMSA 1ICEA 2NZXA 1IEQA 2UVPB 3A26A 2HM7A 2YHIB 4NOLA 5AJTA 3ZW9A 2RGRA 1CVRA 5JSUA 3GPDG 4MSUA 5ALFA 3BFJA 2AE1A 4FUTA 4KJXA 2GNPA 3PT9A 2XRMA 2FUCA 4JS0A 2J9XB 1U6JA 2IYZA 3RS4A 4PS0A 3IT0A 3QBEA 3PC3A 5E7IA 1N6HA 5F2NA 1H2BA 5TPWA 3K6SA 5T64A 3I39X 1KOFA 1BKSB 1M6VB 2E2WA 2Z1DA 1SUAA 2AZTA 3TIVA 4IH1A 4EENA 3U0VA 4D9HA 1L7OA 3E1GA 4K03A 5JHGB 2VJBA 1TUBB 3VJLA 2OZEA 2IPLA 1HPLA 4JQOA 5EJMA 1PNVA 2QG6A 3K1TA 3CEMA 4A10A 5A3JA 8ADHA 3UAWA 2O6LA 5DSXA 3VC2A 4EELA 4A15A 1QPGA 3LY8A 4UMDA 1ZW1A 4FZVA 3T3OA 3OJWA 1N25A 1SG6A 2IZZA 2XIQA 3PYMA 1J6UA 1C41A 5JEEA 2VSYA 3WP1B 5H9VA 3BWDD 4MI9A 4DNFA 3GPLA 3A3KA 2BBTA 4DREA 2CDRA 2P27A 5JXWA 2TRSB 3TSOA 5IM4F 2CD9A 2PZFA 1GZ3A 5BQPA 4DT1B 1RM0A 4EPYA 1CDZA 2D1SA 2LV8A 4GGOA 3OI7A 1CY6A 3QI2A 5TQVA 5EIXA 3FNRA 4BRSA 3OJ0A 1GILA 2OHVA 1G6OA 5J1SB 3KKZA 3PJRA 3B9BA 4U5QA 3LLVA 1NI5A 1G55A 4EI8A 2FQXA 2J0EA 1PDWA 3PGVA 3Q3CA 1GUZA 4QVGA 1G64A 3VR1A 4HGNA 1JVNA 1XFDA 2C4MA 1X1EA 3IDAA 4PX9A 4HGQA 2WTXA 1SIWA 4MWEA 4QUBA 1GL3A 1K66A 3G0BA 3HU1A 3KQWA 3GR6A 2LDXA 3O4JA 4MVYA 4MRRA 3WJ1A 3WLOA 1ATZA 4F5DA 5MDHA 2BEWB 3MD9A 3E5MA 3R5FA 3ZUPA 5BW8A 2WM3A 2PX3A 3EVTA 4HAIA 4BMYA 3QG5A 3F9RA 2F55A 5K0CA 5JRJA 5KNBD 4NH4A 1UOPA 3ZVMA 4P36A 3TQQA 1J1ZA 1ZQ1A 2W2KA 3K05A 3QUBA 3FBGA 5B36A 3SBXA 2ZT8A 2X41A 2ZQZA 1FX1A 3IIJA 5J2UF 1LDGA 4PZLA 3BWYA 1IHUA 4HRXA 3W05A 2YMPA 2DHCA 2O54A 1DEHA 2QTAA 1NUAA 5HKKD 3IV6A 3QYJA 3LM8A 1PD0A 2ZR7A 1XYVA 3ONNA 4TYYA 1XNRB 1GKUB 4G0VA 1KQPA 2BMJA 5FPKA 1DUIA 2Q3HA 1ENYA 3RF7A 1EP2B 1LVUA 2GARA 3A6JA 4C4TA 1N1GA 1NYLA 2JZOA 1RKQA 3L8FA 1RPAA 1JLRA 1GAEO 3A37A 2G9QA 4HDSA 1E5VA 2EARA 1QP4A 1A4RA 4BNYA 1EH5A 2NN3C 2BFPA 1CUSA 5K4AA 1CUIA 1Q0HA 4M3NA 3CUWA 4MCHA 1J5PA 1QG6A 4J9UE 4RIHA 2Y67A 5TC4A 3W3AD 3L1UA 2ORVA 3UH0A 4G9BA 3EOBI 4KIFA 3VISA 1W4BA 2QVCA 4IV0A 1GTL1 3HXMA 2W2TA 5AXAA 4MS1A 2JIDA 4KGVA 5FBQB 2XXJA 4DQLA 1UMKA 5AKLA 1Y1RA 4MB2A 2GZMA 3I92A 4NE2A 4EK9A 1JZTA 1QCDA 1BH2A 2H63A 3OZWA 3S1LA 1NY5A 3SKVA 1SZCA 4KPUB 3G9UA 4AKGA 1PYDA 2F4NA 1PFQA 1DTSA 1RPJA 2SKCA 3QE2A 4O1IA 5E3JA 3O26A 5JXHA 3KXPA 3N53A 4F3RA 2PFGA 2V1XA 3BMCA 3WK5A 3QTLA 3WDLA 4IH9A 2GCGA 2VCYA 4JI6B 3A7DA 1JR3E 1XPJA 2W2VA 1TECE 4HN2A 4JJEA 4HKTA 4NHEA 3UWDA 4RDHA 4DDUA 1E9BA 2HXGA 4IHQA 4X61A 2CXPA 5BNWA 4W5HA 3E7XA 2C58A 5K05A 3P45A 3CJQA 1YIDA 2AOTA 2OG1A 1HX7A 3FNGA 4AUNA 4NYJQ 3E03A 3TTVA 4H9GA 4CYMA 3AYZB 2YJ5A 3PR1A 4HFJA 4WFJA 5IC5A 5GINE 1BA2A 1O6CA 4N5HX 3O8LA 2OVBA 2EJBA 2RBKA 5CYFA 4TRMA 3OT5A 4Y6SA 5AVXA 3OEWA 2FFAA 2FPIB 2EYQA 3OQIB 1SBNE 4BWGA 2ERCA 2EX1A 1P9OA 1RCTE 3MMXA 4JITA 1RHUA 4NMWA 3GLHA 3WADA 3WYFA 1QDLB 1ESMA 1QS0B 5TQ0B 5KOHB 3B5EA 3VSEA 1T8WA 2BLNA 2HF9A 1W8IA 4MYSA 1G9SA 2XCQA 2VHXA 3PZRA 2DH5A 3IUPA 3U2QA 4C7VA 1DWPA 3U16A 3VO1A 5E2BA 3B48A 5JE8A 1J39A 1HDGO 2O0KA 1YQWA 4RLQA 5TQ2B 2QEQA 1IWPB 1BVUA 2FX2A 4ND6A 4ZT6A 4UNQA 3PC2A 5B6IA 5DYWA 1YV9A 1VE5A 1H8HD 3THXB 1I1NA 3UHAA 3BE5A 4J1SA 5IMSA 3K53A 4XCVA 3HVIA 2QTVB 3FVQA 2XHZA 3ZZ0A 2GBGA 3LWBA 4K28A 4MKHA 2OV6A 2VAMA 3U4MA 2ZT7A 2R1ZA 2R4QA 1MV5A 3VC7A 1MB9A 5KTSA 4YLEA 4BTVA 1MOQA 3L6BA 2XW6A 1DBVO 1JEEA 2DWPA 4YMIA 2PT7A 4WINA 5DGIA 4P7JA 5HMLA 3OESA 1MVLA 1KBOA 1ZOIA 5KVVA 4OV6B 4RZ2A 5CM8B 5EKSA 4UMVA 3TMYA 1EPUA 3ZNQA 1UK7A 3N6RA 4DR7B 3N0WA 4U6SA 2OQVA 3KYJB 1WY5A 2VXYA 4LV5B 3LUPA 4QQ8A 5A5FA 3ZDAA 3R0ZA 4L0QA 2X5JO 4H6XA 2BRUC 4QOIA 5L53A 1CX9B 2X13A 1DKPA 2ZITA 3CEJA 4TS4A 3VVMA 3R4VA 4UCFA 4BVLA 4DANA 1SWWA 4URXR 4TQAA 4F6CA 1IH8A 2HMTA 4F46A 4JGBA 3UANA 3UAGA 4BE9A 3FJ1A 2O3SA 5EKUA 1KEWA 1AGYA 1FRFS 2HBQA 3BXPA 3E9RA 4EFDA 3HDHA 4GD3Q 4I9FA 5LP6A 5FNVF 2OUKA 3PSHA 3QYFA 4LQDA 3JQ9A 3GJQA 3PCTA 1QUFA 4H1VA 4DIKA 2AOXA 3MGCA 1DJLA 5BSRA 5E6SA 4RADA 1VSTA 3W1EA 4DDWA 3SVLA 4CMIA 1FP1D 5JSKA 1TADA 3BTVA 3DCJA 5KKCA 3R40A 3BXXA 5KWSA 4UNSA 4DDKA 3FWHA 4MW1A 1NP7A 3OZ7A 2Y6UA 5MGNA 1V6AA 2ATIA 3FI0A 3UT5A 2G8NA 2VAVA 2QYOA 4KR0A 2DTDA 5IPFA 3WA6A 1ZN2A 2XXBA 5JZBA 1K5PA 1PBNA 2FETA 2HSGA 1AH2A 5F2KA 2C5HA 1BDMA 4FEEA 2HY7A 4WOJA 4ZP1A 3MOSA 3BULA 4U7PB 3OZDA 1H4VB 3ND7A 1KQNA 5DO9A 4M49A 2WWVD 2EFCB 2V5AA 1E89A 3GFTA 3H2YA 2ZAMA 3WDKA 5IYZA 1QH9A 1Q20A 1PNRA 1Y9EA 3BN3A 3HEBA 4DCMA 4QPDA 3OLZA 2E4AA 1ZQ9A 3OFVA 1R4MA 4R84A 2LPMA 3OICA 4TSFD 1DHRA 5IBPA 2ZXUA 3WMFA 5HIMA 2QRVA 5EVJA 2IXGA 4PQYA 4R0VA 3KEGA 3LP5A 4JR0A 1A96A 1Q1ZA 4UUPA 3EF1A 4DMUB 2DCUA 4EFKA 1P2DA 2AFIA 1ZJYA 1FYXA 1P3DA 1ENZA 3TLZA 3AXTA 1UFKA 3AI3A 1V41E 1GU1A