3BFKA

Crystal structure of plasmodium falciparum rab11a in complex with gdp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
173
structure length
159
Chain Sequence
DYYDYLFKIVLIGDSGVGKSNLLSRFTRDEFNLGVEFATKSIQLNNKIIKAQIWDTAITSAYYRGAVGALLVYDITKKNSFENIEKWLKELRDNADSNIVILLVGNKSDLKHLRVINDNDATQYAKKEKLAFIETSALEATNVELAFHQLLNEIYNVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Small GTPase Rab11
publication title Crystal structure of Plasmodium falciparum Rab11a in complex with GDP.
rcsb
source organism Plasmodium falciparum
total genus 54
structure length 159
sequence length 173
chains with identical sequence B, C, D, E
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bfkA00
3HPQA 1XMVA 3K9LA 1Q12A 2CE7A 4RKFA 2WTUA 5EP4A 1BH2A 2GF0A 3CF6R 3RS0A 1Z6XA 2PT5A 1XMSA 1PV4A 4QHYA 2C9CA 1E98A 1KI8A 5F3WB 4YMTA 1M7BA 2CMKA 3GLGB 2IUSA 1QHNA 1ZBDA 1E1QA 1E69A 2VP0A 4D80A 2VP4A 3ZD7A 2XEXA 3LBIA 2ZR9A 3B6EA 3AEZA 2IYUA 4YDHB 1AS3A 1TPZA 5FR1A 4FMCB 3G5UA 4Q21A 3CH4B 2XXAB 1SGWA 2GJAA 3U7HB 4PHGA 5DE3A 5GJVC 1E3MA 1GVNB 3WXMA 1OYYA 3IO5A 4DDWA 4MRRA 4OHZA 1KJWA 3V00A 2OM2A 2QRZA 5C4MA 3KTAB 4NYMQ 2O8DB 3GJ7A 1OT3A 4HLUC 1XWIA 2AWOA 3CRQA 4UNNA 3PUZA 4B3DA 4CZ2A 3BFKA 4LYJA 2REBA 3KB2A 1O3YA 1C9KA 2I4IA 1YR6A 1W2GA 1TQ4A 2ZI4A 2JLQA 3QE0A 1GL7A 1SKYB 4G5RA 3P1JA 3RANA 3FMOB 3OF5A 3ICQB 1YZQA 2HJVA 1NSTA 3U3JA 4PZLA 3AVXA 2V3CC 2B21A 5EE0A 5BW8A 5E7JA 3AVYA 3LBNA 1IBRA 1VG1A 4PPGA 5LDDC 2QMHA 1A4RA 3WNDA 1E0SA 4D4LA 5M04A 2FGJA 4ZCIA 4JVNA 3BB1A 2IYZA 1TADA 3EA5A 5KDOA 3GLGE 1W0KD 3KXIA 1DE0A 1U0HC 4ZDJA 4PAOA 2VIIA 1U90A 2V1XA 3RVBA 3TMKA 1VG0B 1W0KA 1ZCBA 1K6MA 4IOMA 1J99A 4GP6A 1NY5A 2OAP1 1G3MA 1E2QA 3VR1A 1NVWQ 4D4MA 4BGDA 4RD6A 3WRYC 2WJJA 1NIPA 1G8FA 1P2VA 4IDHA 3REGA 3HU3A 5A5GA 5FTKA 4Q4HB 1RVDA 3X2SA 4I4LA 2RGGA 4RJLA 2A5GA 4HB3A 4JBWA 3QF7A 4BFUA 4GL2A 3U5ZB 1GTVA 4DVGA 1CJTC 4Q9JA 5HTKA 2GETA 1XD8A 1N6KA 5JI2E 3ASYA 2O8EA 4AWXA 4RZUA 4B2IA 4CEHA 1W36C 4OJKA 3EIQA 3ADCA 2ZJ5A 1HH4A 2PX3A 4GDFA 1G64A 1T4GA 3ECCA 4LOAA 4JLAA 1Q22A 2ZUDA 3L2OB 1KI6A 3CRVA 5HCNA 4BFXA 3KB1A 2O5VA 1FUUA 2EQBA 2VBCA 3EWAA 3OIYA 2OG2A 3W3ZB 5CITA 2QP9X 2F3TA 4IHQA 5F98A 3TGPA 2GK7A 2G1JA 3F0TA 1E9RA 1KMQA 4HB4A 4D25A 3QKRA 4JBYA 2P6UA 2N42A 1IM2A 4PQRA 1GRQA 2J46A 4WZAE 1CIPA 1KKLA 4KHZA 3P27A 4EPWA 3VR6A 3KKQA 1SXJB 3LA6A 3M1IA 3LQRA 3NH9A 1I4DD 4A92A 5BN5A 3L0PA 5KSYA 1KI3A 2HT6A 3AUXA 3U7GA 4JVMA 2IA5A 5C4GB 1XEFA 2EYQA 1C1YA 1D6JA 2BOVA 2JLSA 2SHKA 4XVRA 1ZU4A 4CEJA 1E4VA 3D3QA 2ZR7A 2QMOA 2CJWB 4LHZA 3TQCA 4KI0A 3Q72A 1ZNYA 3C16C 1XPRA 1G3UA 3OESA 4L4UA 1D9ZA 1XJCA 1IY2A 3BJIC 2CHGA 1N0UA 1IJFA 1GDDA 3UPUA 4UJ5A 1ELOA 2VTKA 2C2HA 3JZAA 2O8CB 5EXXA 3O8DA 1H8HD 3ZVLA 3GJ4A 2F6RA 2HXSA 1ZCAA 3Q3JB 1H8HA 3W90A 2ODWA 4B35A 2ZANA 3EW9A 3OAAD 1AQUA 2PX0A 1S0UA 2D74A 3KKPA 2QAGB 2IYQA 2BHRA 3AF4A 4L16A 4YONB 4HB0A 4DLTA 3FMFA 3OAAA 3VKHA 1E2HA 5KPJA 4TL9A 1R6BX 2P2LA 4IVQA 3SZRA 2OSBA 1YZTA 2MSEB 4HAUA 1KAOA 1KDPA 2LKDA 3SS8A 1TAGA 3EPLA 4Q7LA 1OF1A 2J3EA 3AM1A 1Q1EA 2EFCB 4FCTA 4A6XA 5LB2A 1UDXA 3QI2A 5HE9A 3X1ZA 1T0JB 3MWYW 4PSVA 3NIBA 3GJXC 3RS3A 4DT1B 2P6RA 5JWHA 4KFSA 4IW3B 3SQWA 5EXPA 5TVKA 2GDJA 1AM4D 4KV9A 3UK6A 3SBEA 3E1SA 2A5DA 2OCPA 4UNSA 3PXGA 3ZZ0A 4Q9LA 3LW8A 1NBME 4J0QA 4NYJR 2EW1A 2O8FB 2ZS8A 2BV3A 5EUMA 5EZ5A 4LDJA 3ZS8A 4GRAA 4KLNA 1G4UR 5KO2A 3LXRA 2GXQA 1CR2A 2AFHE 3M6AA 3R20A 2EFGA 2IS2A 2IXGA 1JQLB 1ZM3A 4TL8A 1NY6A 3AKYA 3K0AB 1PUIA 1Z3IX 4IFEA 3CPJB 3KQKA 2VHUA 1TMKA 1G7SA 1R2QA 4JT4A 1K5DA 2IHYA 4EPTA 1CS4C 1KK0A 1KI2A 1OKKD 3P32A 4M9QA 2ZJ2A 3IEUA 4B71A 4BECA 3RS7A 2LCFA 3T1TA 3SFVA 1LS6A 3N5CA 2Z4RA 2GBLC 3KQHA 4Z1MD 1EFUA 1EFTA 4M22A 1LS1A 1XTSA 3SC3A 3TR0A 4WZBE 4EQ6A 4C0LA 3CF0A 3KQLA 4PC2A 2ORWA 4N3NA 1RRFA 5FTLA 3IGFA 3PUXA 3KUDA 4NCJA 4ZIRA 2EFHB 2DB3A 4D26A 1G8GA 4YDSA 1UKYA 3VU9B 1GNRA 4QKQA 1ZYUA 3VAAA 3BBPA 5JBQA 5K8IA 5A4JA 1TEXA 3LFUA 2IWRA 1CR1A 5DN6D 4FIDA 3QBTA 5TV2A 3MG9A 1X1RA 1OFUX 2HF9A 4NDZA 1A82A 3EIEA 5DN6A 1P75A 1EFRD 1NVUQ 1LNZA 1NLZA 4NU0A 1AGRA 1UAAA 3LWNA 1EFRA 1CRPA 2IS1A 1QRAA 1QHYA 1U81A 4KSCA 3B1ZA 3CF2A 3QQ5A 1CJMA 3B1VA 5EZ6B 2ZI6A 1HQYE 2AWNA 2VHJA 3CNLA 4WBSA 3KFXA 3W5IA 2WWYA 4A2PA 3T5GA 1T8UA 4A36A 2C5LA 4OBEA 1BMFD 2WJIA 3WMFA 1KY3A 3AVQA 4EFMA 1T8TA 1UEIA 3ZJYA 4MYHA 3NC1C 4G0NA 1BMFA 4G01B 2BEKA 2K5UA 2ZEJA 3A4LA 3PCRB 3VKWA 4UNRA 5FR2A 4DDVA 2F7SA 1RW4A 1VMAA 3A1WA 3TRFA 1W36B 1X8KA 1ZW6A 2ZSAA 2FFHA 4M9XA 4MRVA 1SVIA 4FMDB 4PC6A 2QL6A 4M4SA 3AF3A 2IXEA 4C0BA 4OHYA 4DLWA 2V54A 4LGMA 4BZXA 2ZRLA 4US0R 3CRMA 2PL3A 3SI7A 4TL7A 2YWFA 1FPMA 1LF5A 1QVAA 2GZHA 1UKEA 3DOFA 3KUCA 5CDFA 1R0XA 1S3GA 1T5IA 3DKVA 2BKEA 4KFRA 621PA 2BBTA 1HE8B 4Q7KA 1DAGA 4F38A 1N6NA 3THWA 1F6BA 1Z63A 2O0KA 2ZRCA 1IHUA 2NO1A 4XIGS 3ZGXA 4HSEA 5JSZA 4NL4H 4IDQA 521PA 4TLBA 4BFVA 4HLDA 1L7VC 5KUTA 4BFSA 4LWZA 1GNPA 4GSYA 4CT5A 2X8AA 1G8YA 3DM5A 2IEZA 4L9WA 2B7CA 3W6NA 5H1YA 2RKOA 5K8UA 4M1KA 2RGEA 3QIAA 4DEXA 2HYIC 2FPKA 4IEEA 2CLSA 3VKGA 1HA3A 4ZCMA 5JWOA 2G0NA 5JRJA 2GJ8A 1RIFA 3T5DA 2HLDD 3AP1A 3QXJA 1Z2AA 1EWRA 4HUQB 1JR3E 1VTKA 2YINC 4KYIB 1BS1A 1ZD8A 1M1YE 2HLDA 1U0LA 3K9HA 3T12A 1EX7A 4B43A 5IHPA 4LJ9A 1FOEB 3VQTA 1G3RA 1SULA 4OK5A 1KOFA 2W00A 4LYHA 2BKUA 3GJ0A 3PFIA 4FN5A 4IDPA 1US8A 2G0TA 3RS2A 4AI6A 4XVUA 2D3WA 4PX9A 3I92A 5FOSA 4PHHA 1NVVR 4A2QA 3ZZUA 2KE5A 1JR6A 2P5TB 4WOPA 2F9MA 3B9QA 4B32A 1FW6A 4PQYA 2Y8EA 4K46A 3A1UA 2OZEA 3FHCB 4PPQA 4BLSA 3IPYA 1NN1A 1R0ZA 1ZAKA 1GZSA 4WW0A 3DDCA 2BMDA 3QG1A 2NPIA 5DISB 2V7QD 5G41A 2X1VA 4D82A 5ANRB 1T5LA 5EP2A 4O0MA 3WBJA 2EFEB 2V7QA 3W5JA 1Z83A 4QL3A 2GK6A 1UJ2A 1MABA 4KFUA 4Z8XA 3TK1A 4YMVA 1KI9A 1OXVA 3QXSA 3RAPR 5CK4A 3VR4A 5B57C 2WSSD 1F2TA 2OCYC 2OFOA 4CF7A 4LJ5A 2ZSFA 4LJ6A 2X2FA 3CZQA 2QQEA 2ATXA 2W0MA 4M1SA 2WV9A 3CH5A 1VCOA 2OXRA 3QY0A 2CDNA 1E0AA 5JJIA 1Q20A 2BDTA 2CLCX 2O8EB 3MJRA 1NBMD 4CEHB 1TNDA 1XCPA 4MGIR 3DM9B 2B8TA 5TXGA 2Q6TA 1NBMA 2G3YA 4PTLA 1JJVA 2H92A 1IXZA 1G7TA 1OXTA 1U94A 1XF9A 4IFBA 5AR1A 3K09A 2V6IA 5LD2C 1KI6B 1YZGA 5TY0A 1IY0A 3B1YA 2XAUA 1J8YF 1KO4A 4IDNA 1N6PA 1XD2A 1XTQA 4W5WA 2CXXA 4TLEA 3TAUA 1P5ZB 4II7A 5GVSA 1KK1A 1CLUA 2YWGA 2RGXA 1JQJC 5KU1A 1II0A 4JKYA 3EXAA 3GLHA 2Q3FA 5DYIA 4BPBA 2W6JD 4A8JA 4A15A 3NC0C 3OZXA 3QKRB 4G5GA 3KZ1E 4HYYA 2ZTSA 3DL0A 5FBRB 1SVOA 2W6JA 4DB4A 4LV5B 3ADDA 1ZVQA 1XJQA 2FH5B 2Q0HA 1ONBA 1QG2A 2RAPA 3UWOA 3NDPA 1D2NA 2IF0A 3SEAA 2YC4C 1A2KC 3LVQE 4MDEA 4XWOA 3MJHA 4TMVA 1FZQA 3V9PA 5J40A 1T3SA 4CEJB 4NMMA 1E96A 1PUJA 1JBKA 1YZKA 1KJZA 1S96A 3U3RA 4O2RA 4NH0A 3K0SA 1R5OA 2ERXA 3I4LA 1QDEA 2UVQA 1TF2A 1JPNA 1ZU5A 1E2PA 2ZI5A 3QOFA 4FD2A 4M0LA 4JSYA 4ASUD 2GAAA 2OCBA 3EG5A 3KKMA 1N0WA 1E99A 3KKOA 1OIVA 4V0KA 4BLPA 1FNNA 3SU8A 3I73A 4B3CA 1E9FA 3GPLA 4CVNA 2ZRHA 1OXXK 5JHHB 3EZ7A 3NBXX 2ZROA 4GOJA 1KGDA 2ZE5A 2I3BA 4OQMA 3W8RA 1N3BA 3P20A 2GKSA 2VHQA 1PVOA 2OFWA 3W6PA 1R8QA 2P3SA 1KSGA 4AKHA 5F9FA 4ON9A 1PZNA 3CBQA 3IUYA 1KZ7B 2F1JA 5SZIA 4M21A 3T61A 3BOSA 3OIVA 1J8MF 1VCNA 1XEXA 2QTHA 4BLQA 4MUBA 2OXCA 2GZAA 3MWLA 1QG4A 4KBFA 1KZGB 2GAOA 4PXAA 1IN6A 5J4LA 2NZ8A 4TQUS 1AZTA 1F60A 4B33A 1G9XA 2XZPA 4EPRA 3JVUA 1Y63A 4DSNA 1BOFA 1KO5A 2JLYA 3AVVA 4Q5IA 3K0EA 3N2IA 2JLVA 3T06B 1GL6A 1VG8A 2QZ4A 4E22A 4CT4B 2VL7A 4IVRA 4Q7MB 1V5WA 3CO5A 5SZJA 3ASZA 4KXFB 4X8HA 3DVLA 2JLRA 2PCJA 2WKRA 1L4UA 1VDZA 2QPOA 3PQCA 4QJ5A 4A4DA 1Z6YA 4B6EA 1NNEA 4XH9B 1Q57A 4WVFA 1NG9A 3KXKA 1P72A 2OILA 1RC8A 4O25A 5D3QA 2XTZA 2AX4A 1FNMA 4HI0E 1G1MA 3C5CA 4OHVA 5L3VA 5EJEA 1OFHA 1R0YA 3BIFA 4JLVA 2E9SA 4M9SA 4LJAA 2H7VA 4DWJA 1FL9A 3ZVNA 4G5OA 5FL7D 3UMRA 4QGFA 1CU1A 4C0QC 3W6OA 2VLIA 1GIAA 3GCGA 1M74A 2FSIA 3K09C 1BIFA 2HJGA 5B58C 1WQ1R 1AN0A 5FL7A 2H17A 3JZMA 3BH7A 4ZV4A 4URXR 1YR8A 4MH0R 2ZQ5A 1VCMA 4D6PA 1Z0AA 4N0DA 3TSZA 4M1TA 3J81k 4NCIA 4R2IA 4DDTA 4G5QA 4JJZA 3OE7D 4JMPA 4A8JC 2QAGC 2QT1A 4BEBA 3U44A 2QBYA 1W46A 4NZYA 4EQ6B 1U9IA 2J0SA 4AYTA 1XD9A 2BMJA 3OE7A 3THYA 2W2VA 1M2OB 1IN7A 3I3SR 3EPHA 2ZJZA 2D62A 3DEFA 4ZIRB 1JR3D 4XSGA 1BO6A 1P61B 2GEVA 5JCPA 3DZDA 4H1VA 4I1UA 3WHLA 1JR3A 5J4YA 5FBQB 2RGBA 2OBLA 4LC0A 1G7RA 5HZHA 5FUVA 1R5NA 3IIMA 2ZE6A 4TYQA 1G21E 4US1R 2PLFA 2MMGA 1RRGA 5E95A 1G41A 3F3YA 4DLVA 1CEEA 2IS4A 3SJBA 3TLXA 1G5PA 2IT1A 1NIJA 3RSLA 5TMPA 3R9WA 5DIFA 2KSQA 5D3MA 2IX3A 4GMDA 1XZPA 2A5YB 4EJSA 1UM8A 4X8MA 3RRNA 1E1QD 3VX4A 3L43A 2ZJOA 4NTZA 5BN3A 3GFOA 5JS7A 2WKQA 2NMVA 1D8TA 2J9RA 2FZLA 3DO6A 5JJKA 2V1UA 5G3YA 2VO1A 2Z0MA 1EWQA 2ODNA 2DYKA 1DAHA 3LH5A 2FSFA 5EXTA 4D81A 1G20E 1KJYA 5F9HA 1E2MA 2WIAA 1CR4A 2A9KA 2MSDB 3EZ9A 3LY5A 1F48A 4B48A 1DOAA 3A1SA 1VIAA 4B3GA 4M1MA 4U7DA 2D06A 1GKUB 3BE4A 1YZUA 5E7IA 2ZR0A 3Q8XB 1N6OA 2C95A 4QBFA 1DG3A 3SYLA 5LD2B 4IXNA 3THXA 2HCBA 4L9SA 1E2IA 1WMSA 4URVR 3EZFA 5FPYA 1GFIA 1RRCA 2VSXA 1OPXA 2ZAOA 3IILA 4QBGB 5IDVA 3W8NA 4EKDA 3THWB 8OHMA 5JEDA 1F3OA 2ZSBA 2VP6A 2OHFA 4NYIR 5JSZB 2TMKA 2VSFA 3Q5EA 2OLJA 2D7CA 3O8BA 2HDNB 3TW4A 1CR0A 2G77B 4ZCLA 1XTJA 4JLPA 4XOIA 3SHWA 2YJTD 2YNMA 3P26A 5IRCD 1JEEA 4BWYA 3FWYA 2G1KA 3VR5A 3U4QA 4Q48A 2AD1A 4B2PA 3GP8A 3JVVA 3Q7PA 2KB0A 3WNCA 2E87A 4BFWA 2HF8A 3RYTC 1G3IA 3KQUA 2GTPA 3TVTA 1BKDR 1U9IC 2QM7A 2XSZA 4P31A 5CK5A 3TE6A 3I5XA 1Z47A 1GKYA 2BBWA 3ZH9B 4TYYA 3VHXA 1NRJB 1G17A 4PZZA 2OESA 2WWHA 1US8B 1E6CA 3HWSA 1F2UA 5J5CA 3PG5A 2G88A 4JLMA 1Z22A 2C8VA 5CDFE 4RD0A 4UXHA 5FTMA 2EU8A 3AF0A 3NVAA 821PA 4W9MC 2FEMA 1JAHA 3EPKA 4QRHA 1MO4A 1WRBA 2R6FA 3RC8A 1XTIA 2PCLA 1XTKA 2QPTA 1OH5A 2VYFA 4URWR 5L3RA 4R98A 1TUIA 5JECA 4W7SA 5CIQA 1QHHA 3T1QA 3OEED 4MRNA 3TH5A 4AYXA 1W0JD 2AK3A 1VPLA 2LWIA 1Z0DA 1IQPA 3WNBA 4FMDF 4PHTA 1L4YA 1O87A 3FFAA 3OEEA 4EJSC 2WICA 1W0JA 3RLFA 3AGQA 1AKEA 1MABB 4ARZA 4C30A 1TQDA 1NN5A 5KHOC 4B75A 3SFZA 1F2TB 2VPPA 3TNFA 3A8TA 2H57A 2RMKA 1KAGA 2I1VB 3PUWA 3WHKA 4KJZA 4JVSB 3VFDA 1S8FA 3X1DA 1UEJA 2PT7A 3GQBA 1XPUA 4KCGA 1NF3A 3NEJA 4TMXA 1XMJA 3AGPA 2YKGA 4MYUA 3AP2A 3FFBA 1G8HA 3MWKA 1GILA 2ZXUA 3E2IA 1QHXA 1YKSA 3EIHA 3BH0A 2A78A 3C41J 5DHFA 5B2ZA 4TL6A 2Q9CA 2ZAMA 1I4TD 3IDQA 4FXPA 3LVRE 2WBLC 1XD2B 1U8AA 3X1WA 4DCNA 1GP2A 2RGNA 3SOPA 1S2MA 3PEYA 4I99A 1W4CA 4RD1A 1XBTA 5FUXA 3GLHB 2WAYA 4GP7A 1G8PA 4I81A 3GLFA 2Q3MA 4A8JB 4F4JA 4DCUA 1ZNWA 3I61A 1GNQA 4TMZA 1KK2A 2EVWX 3L8ZA 2OAQ1 4MKHA 4HDOB 4DKXA 3W9YA 3ZQJA 1D2MA 1ZUHA 4E09A 2FMXA 4NCKA 4A0FA 1UBCA 2F43A 3H0KA 2BCGY 1Z0JA 1FQJA 2PZFA 4H9GA 1UPTA 1W4BA 2BMEA 2CE2X 5JS8A 1EG7A 2QU8A 4NE2A 2X2EA 1DAIA 4P32A 2NIPA 1RJ9A 2QEQA 2A30A 4A0RA 1NP6A 3EARA 2CL0X 4ITRC 1NLFA 4Q1EA 1KMHA 4OI0A 1ZM7A 2Q21A 2JLXA 2QUZA 1P2SA 1G5TA 3QUSA 4NCNA 2GJSA 3BRWD 5EE3A 4G5SA 4PSAA 2P0EA 3CM0A 2QMEA 4LCBA 2QMUA 3PR1A 3Q9LA 2CL6X 1EX6A 4P4UA 4Q1AA 4RFVA 3I62A 3U6BA 1OH7A 3GFPA 1QBKC 1XU4A 3IBYA 3PIRA 1U99A 1W7AA 4RFSA 4QGHA 2GJ9A 2BBOA 5HE8A 3GLHE 2QTVB 1LTQA 4W5JA 4MQBA 1XEXB 2P65A 1XZQA 2GXUA 2PMKA 4L5BA 5AUQA 1GM5A 3KX2A 2FA9A 3H4MA 4RCYA 1E9AA 4JL5A 4OI4A 2D2EA 3SBDA 3GLIA 1DPFA 1YE8A 2VP2A 2XJ4A 1W1WA 2F3RA 4GZLA 4LV6A 4LSGA 4K81B 4URUR 3ZZTA 4ZDIA 5AUOB 3GJ3A 4TTQA 2GESA 2R9VA 2NO6A 1ZM9A 4AKEA 2ZSEA 4UXIA 3QEJA 4QHTA 3HU2A 4MYTA 5JMTA 1HY3A 1D2EA 2CNWD 2ZI7A 4JZKA 3ZLJA 2XX3A 3TSWA 3NEYA 3MD0A 4GZMA 2CNWA 2IYRA 3OHMA 3UWKA 4BLOA 1T6NA 1U2RA 1IN8A 3RABA 3PUVA 2NOAA 1NJFA 5CLLA 3U60B 1LV7A 4LC1A 1M7HA 4M1OA 3LXXA 1SVMA 1X8JA 1SVKA 3QKSA 2ZRAA 1QF9A 1TF5A 1HT1E 4IVPA 4TZ6A 1CKEA 5FPKA 2PH1A 3PEVA 4E07A 2KJQA 1Q0UA 3B85A 5TB5A 2ZUCA 3T1VA 1P73A 2ZJBA 4Q19A 3FHOA 4MITA 2FPLA 4JLKA 4EPXA 5J4KA 2RGNC 3RRZA 1J7KA 1DAEA 3B5JA 6Q21A 1JECA 1UKVY 3RS5A 2DPXA 2G83A 2HEIA 2HT1A 1Q44A 2HV8A 3VNUA 2JJ8A 1ESNA 1KIMA 1M7GA 2C98A 2QQ0A 3U44B 2QBYB 2AR7A 5EQTA 2NPFA 4TYNA 4GPTA 4ZI2A 3KJHA 3THYB 3FMPB 3U7FB 1QZXA 4DUGD 3KJEA 4DIEA 3QBVA 4DUGA 2CCJA 1AGPA 1KSJA 2QROA 3BFXA 4IXMA 2WWGA 5B64A 1YHNA 3Q5DA 3ZDQA 1ZNZA 1LW7A 1Y3AA 1Z6TA 1ZD1A 5FBWB 2A5JA 2WJYA 3ZVMA 3U3KA 4NCHA 1QHGA 2OT3B 3BGWA 4IEIA 2VHTA 1DTSA 1OIWA 2XOKD 2J45A 2CHQA 3R8CA 2DY1A 1W49A 1P9RA 1IN4A 2XOKA 4B3BA 3BS4A 3A6PC 2OUKA 1Q1QA 2AN9A 4DRZA 1B23P 3AH8A 4TYPA 4AURA 5C2JB 2ODEA 1XRJA 5D3MB 4DBLC 5DLQC 3OFND 4EJSB 4MDFA 3R7WA 5TARA 4B2LA 2GVDC 1N6RA 2N1BA 3KJGA 4NHOA 1P4SA 2WWIA 2A7QA 3OFNA 4EFLA 2QSZA 3DMDA 3RHFA 5AUNB 1OB5A 4NYJQ 3PEWA 2H5EA 2NQ2C 3B2EA 4G1UC 1UDWA 4R7ZA 2DWQA 4P0TA 5JI3E 5CB8A 4KYUA 3L0OA 3U7EB 5FTNA 4DLRA 2NTYC 2YHSA 2IBMA 2R6AA 4BQSA 3FKQA 2HXYA 3C7KA 1OHHD 1R0WA 1P9NA 3FDIA 4ERNA 4U02A 3SJAA 4LYAA 5EE1A 1E2EA 3AB3A 2F55A 1OHHA 4UNQA 4ESVA 2R44A 2YZ2A 3K9GA 2J7PD 5L3QA 3QVUA 4NPHA 4P33A 3EZ2A 4HAWA 4PAQA 4V03A 5GVRA 4C0JA 3THXB 1H8ED 4UQOA 2J7PA 4PO1A 4MKGA 1H8EA 3QNUA 1W48A 3DOEA 1G19A 2JCSA 4BZQA 2JGNA 1I2MA 3NG1A 221PA 1ZM2A 3C5HA 3NKVA 1NLYA 2FU5C 2IL1A 1GSIA 4A82A 2PEYA 1P2UA 4DJTA 3FGNA 3L82B 1LB1B 3PVSA 5FH9A 3PITA 5BXQC 5KDLA 1LFDB 4LI0A 4PR0A 3CB4A 3IBGA 4ZO4A 1UF9A 4AKGA 3IKJA 4OHXA 1RE0A 2J5XA 4X8OA 2N46A 4AK9A 1DARA 3IHLA 5DH9A 1N5KA 2Z5FA 2H18A 3AF1A 3K0FA 5G40A 4CGZA 3IIKA 4JBXA 4LHVA 4EPVA 5K8LA 4QOSA 3GJ5A 1Q3TA 1VIYA 2DHRA 2FZ4A 4AY2A 3SN6A 5KYKA 4OI2A 3TBKA 1G6OA 3U4QB 4QFMA 3GJ8A 1NL3A 2XGJA 3B1WA 3GFTA 1OXUA 3A1TA 1A7JA 3QXHA 4JYBA 1OSNA 3GEEA 3X1YA 3RRYA 2RHMA 4B34A 1WBDA 2C78A 4LJ8A 4GMXA 3HU1A 2B7BA 3CZPA 5CM9C 2MMCA 3DZ8A 4D4KA 1AS2A 5FUWA 1F2UB 3LLUA 2AXPA 2ZIAA 5UKDA 1D9XA 1XTRA 3T34A 3NBFA 2GJKA 1Z07A 4QXAA 2A3RA 2ZPTX 3SYNA 5AJYA 3O8CA 4FMCF 3UG6A 1L2TA 2RGCA 2NZJA 1YZLA 1EESA 4QBIA 3DKPA 4C3ZA 4C2TA 5CLQA 3TIFA 4YMUA 4M9ZA 1WE2A 5A0FA 1CTQA 4XTCS 3TR5A 1QHHB 4NBSA 3CIOA 3IEVA 1NMZA 1EFHA 1T3HA 1WBBA 4R9UC 4B44A 2J1LA 3A4NA 4ARZB 1U8ZA 1WA5A 3QENA 4TMTA 4IDOA 4GOXA 3SYKA 2ASEA 1WF3A 1DVRA 4GT1A 4CW7A 1ODFA 2O8CA 2WVJA 1JALA 3WYFA 1WP9A 3LDAA 1ZMXA 1DG1G 4OQXA 2DCUA 3N70A 4BEJA 2WOOA 1QVRA 1P9WA 2GHIA 2CEAA 2IYWA 1WDTA 2ZJYA 3UIEA 3PENA 4HLQB 4Q9HA 2E1RA 2QP3A 3AQ4A 4CYMA 1I2DA 4MYCA 2RH5A 1SKQA 1XFAA 2BBSA 4HZUA 4L15A 4Q66C 3ADBA 4HUTA 5JHGB 3FVQA 1GOTA 2F1RA 1JB1A 2PEZA 1JNYA 2GCNA 1KK3A 2GXSA 1E4YA 1NMXA 3H86A 4FINA 1H65A 5B30A 4PC7A 4XJXA 4JT2A 1OH8A 4MGYR 2WJVA 3ETLA 3GLFB 4ABYA 4RZ2A 1VECA 2WMNB 4JKIA 4B3XA 1T91A 5DYGA 4F91B 1SVSA 1OFTA 3AV0B 2ZYUX 5AJXA 5AJWA 4TLAA 4Q4JA 1G18A 3ZS9A 4MUAA 1E2JA 3K53A 1B0UA 4Z54A 3QSYA 1RPZA 4KODA 1A1VA 3AVOA 2F43B 4GBMA 4DCTA 2QRNA 4HDQB 1NVVQ 3KDSE 4W5HA 1LY1A 1II8A 4JIMA 1OB2A 5FUYA 4Y0VA 4QG7A 2QM8A 2QTFA 4LHYA 4DSTA 3CWZA 5FPHA 1RJ9B 1XXHA 3QVVA 1XEWX 1ZNXA 1I4LD 4K8OA 1VYVA 2R8RA 2PZGA 3IQWA 4PC3A 3G82C 1KMHB 4MA4A 3AVUA 4NYMR 4RZ3A 3QF4A 4IOKA 4PZYA 4DB2A 1FQKA 4JLBA 4KSBA 2J87A 3EAQA 2ZYVX 5JZVA 2DR3A 1OW3B 3P4XA 4IKEA 3VR2A 1ETUA 4V0ME 1N6HA 2C99A 2CHVA 3CWQA 2BJWA 1IAQA 2QPAA 2GF9A 2R6GA 4E03A 4QJ3A 2ZI3A 2YWEA 3LD9A 3FE2A 3QXCA 1XEWY 2ATVA 3PEUA 4RFSB 5DHAA 4TMWA 2KBFA 4Q03A 3F8TA 1U8YA 3GLFE 4JLNA 4HZIA 4QM6A 1E2LA 3O8RA 5IT5A 4JLDA 5C1BA 3GLIB 4AIIA 3QXXA 1HT2E 2JJ1D 1MRNA 4EIWA 1AKYA 2ZM5A 4U5XA 3FYHA 4Q1BA 1K8RA 1UBFA 1GAJA 4V0OA 4AG5A 2JJ1A 3EWSA 1ESMA 2X77A 2ZYWX 2ZRDA 4WAUA 3LW7A 4Q9IA 1NSFA 3VHLB 4JS0A 2ZS7A 2W2XA 2CCKA 4TTPA 5FI0B 5HPYB 1IY1A 3SNHA 3CLVA 3CX8A 5KNCA 3L8YA 2WSMA 2G6BA 3CNOA 4MKFA 4IRUB 1E9CA 1DAKA 2OV2A 4LUCA 1UBGA 2WJHA 4GFDA 3R9IA 1TEVA 3BORA 4IJMA 4ACBA 1MT0A 2UKDA 2IK8A 3HJNA 4PANA 2IUUA 4EUNA 5JJLA 4DSOA 1E79D 3GD7A 2XTMA 4WIAA 2YVUA 3QKSB 4LHWA 1E2FA 1E79A 2IYVA 1RKBA 1MRSA 2FN4A 2W0SA 5E4FA 2XB4A 3K70D 2OBNA 1NVXQ 3ADKA 5KNBA 4F93B 4XSHA 2FE4A 4DDUA 2KBEA 3IIJA 3SHFA 2ZRFA 2WHXA 1S3SA 2PLRA 5DI9A 2ZRPA 3B7GA 1DEKA 4A0HA 3WRXC 1NN0A 4TN1A 5LBIA 5J4VA 1T3LA 1HE1C 2QE7D 3GLIE 2BC9A 2BM0A 5AUPB 4R71A 4NKRA 3KXLA 3C14C 3H84A 2QE7A 1DS6A 2FPMA 1Z0FA 1R4AA 2V8OA 4KO8A 3MSXA 4BRWA 1E9EA 1Z8FA 5DI3A 1P60A 2HCJB 3LX5A 1GG2A 1G16A 3LNCA 2IWHA 1X8LA 2IF2A 4Q47A 3BB3A 1VKJA 2IW3A 3BWDD 5GJBA 4F4CA 5BWMA 1VHLA 4EPYA 2Z6VA 4BUJA 4LX0A 2FJUA 1ZC4A 2CK3D 3HYTA 2KI5A 3BH6A 3MMPA 1M34E 2IYSA 1IJEA 4M1YA 2CK3A 2WJGA 1N6LA 1WB9A 3R7WB 3BK7A 2ZI9A 1NMYA 1TUEA 5HCIA 4A2WA 5FTJA 1GWNA 4B47A 1T9HA 1CP2A 4LJ7A 2QSYA 2NO0A 2AL7A 1Q1BA 1YQTA 2EFDB 2CLDX 1YZNA 2VRWA 3L0SA 3NBYC 5SZHB 3GEHA 4QHSA 1EXMA 1AQYA 4B74A 4LY6A 4HUQA 4LBVA 3UANA 4DSUA 3AVPA 4URZR 4Q01A 4C7OA 5FL3A 4F92B 721PA 3QPVA 2R6DA 4ZDKA 5J4HA 5LB4A 2GNOA 3WMEA 2JASA 4BZPA 3S1AA 1KNQA 3IO3A 1X1SA 2ZSDA 3VMFA 3M0EA 4DEYA 2BVNA 1RFLA 3LLMA 1KSHA 2FV8A 5JFGA 4LPSA 5EUQB 2O8BA 4C0HA 1X6VA 1OE0A 1NG1A 1X86B 5L3QB 3EZ6A 4YMWA 5DGXA 4US2R 2F9LA 3U61B 2XSZD 1VYUA 4LRWA 2PBRA 4PHFA 1OH6A 4GNKA 3PUYA 2ZRIA 3D6TB 3RSOA 5CYPA 4OQLA 3W34A 4P4SA 3U2QA 5BYKA 1XX6A 4FWIB 4TQ9A 3WBKA 2QENA 3I72A 3BERA 5KDDA 1TQ6A 1Q1ZA 4EDHA 3RDPA 3B9PA 1JI0A 2WKPA 1IOZA 2Z4SA 4Q4AA 2ZRMA 1OIXA 1S4QA 2PMDA 4OYHA 3A37A 2YOHA 3C15C 4TQAA 5FBLB 2B92A 2IEYA 2R65A 1Z6AA 2GILA 2YC2C 2QY9A 2A5FA 2NO9A 2ZRBA 4RY2A 1JXMA 5HR5A 4QBHA 3AKCA 4XTRA 3WMGA 2XITA 3LAWA 3I8XA 2ZS9A 3ND8A 3C4JA 1DELA 1ZIOA 2Q3HA 3K0FB 3H2YA 4POAA 4DXAA 3EC2A 3LQQA 2ODBA 4DLZA 1IONA 2C03A 1FX0A 4DC9A 4DLYA 2V4ZA 1F5NA 3U6KA 3K70C 1J2JA 2IHBA 2FEOA 3N2EA 2ZJAA 1RZ3A 1SKYE 5G3ZA 4FCVA 4JLJA 2AD5A 2W6ID 4C4PA 2WWWA 2QNRA 2WPDD 2B6HA 1CULC 1E1RD 2XJ9A 2W6IA 3UXMA 1GUAA 4FW9A 4YLGA 2WIBA 2WPDA 3CX7A 1E1RA 4E5UA 2GBLA 2YWHA 3AVWA 1E32A 2P67A 2ZUBA 1BYUA 4BLTA 1FFHA 2IUTA 4I1VA 1TX4B 4H1UA 1S9DA 1E2DA 1AA9A 2UZIR 1CXZA 2WOJA 3TKLA 1IXRC 2QG6A 1KO7A 3FTQA 4LBYA 1G4AE 2QT0A 2Q9BA 2DFTA 4V0MA 3KQNA 3NXSA 1N5JA 1CBUA 3TW8B 4OK3A 5H68A 3NDBB 4PSKA 2J0UA 1MO3A 3UATA 1L8QA 4LHXA 5E3HA 3NHAA 2EYUA 4C0SA 2WAXA 1IXSB 4F4IA 1KYIA 1K5GA 1AS0A 1W2HA 2RCNA 3MCAA 3QPWA 1WXQA 1C4OA 2VSOA 1OFIA 1N0VC 5JLJA 4CEIA 1J90A 2AKYA 4DHEA 1CF4A 2BCJQ 3ZD6A 4XVQA 4TSFD 4TT3D 1Q21A 3TAHA 3TVDA 4HAVA 4WA7A 2ONKA 4WXPA 4TSFA 3WYAA 2V55B 4TT3A 4P4TA 2IS6A 2O52A 1VCIA 2AHOA 4JL8A 4PO8A 2YV5A 2VQSA 4NYIQ 1FMLA 1GITA 1ZJ6A 5TDHA 4NP6A 1TQ2A 2FGKA 3MRSA 3UMSA 3MLEA 3LO5A 1TF7A 3WY9A 4OJQA 4JSTA 2WWFA 2I1QA 4HZUB 4AG6A 4B6FA 1R7RA 5L3SA 1KDRA 4BFZA 1N25A 4QNRA 2P6NA 3I5YA 3QPUA 1SXJE 4BE7B 1E2NA 2PJRA 1E9BA 2DWOA 2L0XA 1ZIPA 2O0HA 2VEDA 2JA1A 2VF8A 2JATA 3OEHD 5K8TA 2H16A 2RHDA 4Q7JB 1MV5A 3V4RA 3OEHA 3I32A 1S9HA 1OJLA 5FOUA 4D2IA 1XB2A 4KU4A 5BN4A 4B3FX 2PZEA 3I8SA 1FTSA 5FOTA 2NO7A 1KSFX 4JL6A 4D0LB 1V43A 1A2BA 5GADl 4S35A 3LBHA 4Q4JB 4BFTA 2JLWA 1LVGA 1XP8A 4R2HA 1VHTA 1XDBA 2CCGA 3QEOA 4OK6A 3GMTA 4C0AC 1II8B 2VHCA 1E0KA 3R9XA 1FMJA 3U3OA 1AZSC 1R8SA 2HYDA 2R6CA 4IOLA 1AJEA 1XXHB 3WP1B 1MO6A 1T0HB 4B73A 4C0KA 4ESHA 3QKUA 1RRPA 1II9A 3QF4B 2ZVPX 3D8BA 4TWZA 1W5SA 3SJZA 3VTKA 3THOA 3EASA 4HAYA 3MGCA 4MRPA 3U3MA 3V4FA 1OKKA 1TU3A 3EC1A 3Q85A 5EE5B 2FSGA 4PPFA 5LPNA 3A36A 3AUYA 5P21A 2ZYTX 2LKCA 3BC1A 4KBGA 4QJ4A 3SDZA 1SQ5A 1PLJA 1UFQA 1XCMA 3BFVA 5BQ5A 4Z1MA 1A5TA 2GVZC 3CR7A 2XB2A 3KJIA 2REXB 2GCOA 2QGNA 1MOZA 2C04A 3HPRA 3L0IB 5FFMA 4HAXA 4XWKA 1RYHA 1ZUNB 5KNDA 4U00A 2AK2A 2JJ2D 3CPHA 3BAFA 1UBEA 5KSPA 1TTTA 3TQFA 2JIZD 1KI7A 1P2TA 2W2TA 2EWWA 3QJYA 4DCVA 2JJ2A 3D7MA 4MKIA 2JIZA 4OL0A 3REFA 3X1XA 1OYWA 5KOYA 1EGAA 1HTWA 4DLXA 3RRMA 3TSOA 1XXHE 2BJVA 3UMFA 3LV8A 4RSGA 2F1IA 5JWRA 1FP6A 2IYYA 3OIWA 4TYWA 4PFSA 4LJYA 5GJCA 1GRNA 1KO8A 2YOFA 4QC2A 4WZ6A 4M8NE 421PA 4G3XA 1E2GA 3TUIC 4B76A 5FBVB 2BMFA 2DFNA 2OEPA 3GLGA 4C9BA 1OV4A 4LK2A 4Z51A 2XNSA 3GJ6A 2WMOB 4Q1CA 4OHWA 2R2AA 1PLLA 1SHKA 4UJ3A 3ZQ6A 2H1LA 2XXAA 5AK0A 4ILEA 3TJZA 1G6HA 4Q18A 4PPNA 2CBZA 3B8HA 4AC9A 2IYTA 1Z2CA 3IHWA 1MO5A 2UZ3A 3DPUA 4GI7A 2ONJA 1Z06A 2XTNA 5DNYB 3K70B 2H8KA 1P7CA 5FI1B 1XCGB 5AJVB 3KTAA 2NG1A 4TTRA 3QKTA 2O8DA 1ZINA 3NHBA 4RD4A 2B8WA 1BYIA 4QGAA 2GEDA 2WWXA 4D4JA 1S1MA 3K0CA 5C46F 1M8PA 1ZC3A 3A4MA 4KVAA 4L8GA 2VP5A 1U0JA 2W83A 1CRQA 4OQFA 1KY2A 1YRAA 2C77A 4KFTA 4Q00A 1S1CA 1PLKA 2ERYA 1N2CE 4NONA 2DFLA 4Z8YA 1X3SA 5DI3B 3FKSD 3K9NA 4LJ4A 4UKDA 2D2FA 4V0NA 3FKSA 1UKZA 4BRUA 3TUJC 4C2UA 3AKDA 2F1HA 4Q1FA 3B1XA 4HEJA 3I1FA 1XNJA 4Q9KA 1HURA 4Q1DA 3CKLA 5IK2D 2ZRJA 2RB4A 3SR0A 3KL4A 4N0EA 2JAQA 5IK2A 2YYZA 4QNMA 1AK2A 1KNXA 3B78A 1Z0KA 1SZPA 4M2LA 4V0LA 3FHTA 2WM9B 1DAMA 3E5HA 3DHWC 3CR8A 3UG7A 1JPJA 2OLKA 2ECKA 4KAXA 4M53A 4ZKDA 5H70A 2RGDA 2RGAA 3IPXA 4Q4HA 4LPKA 2QGZA 1AIPA 3FB4A 4C7OB 2VF7A 3C8UA 3HR8A 3Q7QA 3QG5A 3TUZC 4JJKA 1SVWA 5EE9A 3P4YA 4QGGA 1E2KA 1YRBA 2NGRA 4ZKEA 1R10A 1UADA 1KKMA 3HR7A 2OE2A 4EFNA 3S1AB 1FUKA 3BB4A 5AWFC 3K8YA 4YQFA 1XPOA 1PJRA 3NH6A 2ZRKA 2O8BB 1XMIA 5L8VA 3O47A 4A0GA 5CYOA 3AVTA 2KWIA 3RWOA 4OQNA 5KTYA 4XD7D 3SQXA 4OKSA 4WXRA 3MAAC 4RD3A 3CW2A 3R8FA 4XD7A 3NBZC 4CIDA 2ZE8A 1Z0IA 4P4SB 3WYGA 2EWVA 5C18A 1SHZA 5ELXA 2OO7A 1NJGA 3KKNA 1YU9A 2O0JA 2ZVQX 2GRJA 1G7CA 2A2ZA 4ACAA 1DADA 2ZU0C 1NN3A 2FFQA 3EPJA 4Q4AB 3PJRA 1SXJD 2CVHA 1HV8A 3K1JA 2FSHA 5JCZA 1G5RA 4ZPXA 3OIUA 1FP7A 2VP9A 2C9YA 1SXJA 1U98A 4RCZA 1J70A 5E7MA 4TLDA 1CJUC 4KITB 1ZP6A 2WSSA 1TU4A 2FFBA 4HLCA 4UNPA 3MFYA 2WZQA 5F2EA 2ZITA 4O2LA 4PO9A 2XZOA 2HUPA 4V02A 3LRPA 2C9OA 4EAQA 4IOJA 1HQCA 1ZRHA 1CJKC 1FX0B 2X19A 1ZUIA 5FPTA 2CJWA 5AJZA 4TZ0A 2Z83A 2GA8A 4F7WA 4BASA 2JLUA 1EK0A 2ANBA 5KSZA 3K0CC 4DLUA 4O3MA 2QI9C 2P5SA 4ZDWA 3RNLA 4ZI3A 1Q3HA 2ZJ8A 2JDID 3B82A 5EP3A 4P3YA 3PV0A 1D5CA 2CL7X 2JDIA 3B13B 4OI1A 1QHIA 4RVCA 4PQFA 2QAGA 1Z28A 3SE0A 2BM1A 4YXWD 2FF7A 4QM7A 3CUEF 1Z5ZA 2FFAA 2VA8A 1NKSA 1QHSA 1Z29A 1Z6GA 2OFXA 3KFVA 1KTVA 1VG9B 4YXWA 1HUQA 2J41A 2XZLA 4AYWA 1WCV1 3W3AA 2IYLD 2AXNA 4A6PA 1VYTA 4A1FA 1P3JA 2GZDA 3CX6A 1P6XA 2C96A 2J0UB 2AFIE 2OBMA 3RC3A 4M1WA 3CNNA 1G291 1RYFA 2ORIA 4DT1A 4AKIA 1DAFA 3A1VA 3ZVRA 5J47A 2GWHA 2BWJA 1COWD 2DWPA 2QORA 4LBWA 4YC7A 2DBYA 5KPDA 1E0JA 2D7DA 1MKYA 4GOKA 5BYJA 2QN6A 4HATA 1COWA 3BXZA 3B60A 3SJCA 3T15A 4CEIB 1LF0A 4RKEA 2MSCB 4ASUA 4AD8A 4LBZA 1YVDA 2O8FA 5JRZA 2D4HA 3AF2A 3E70C 3EA0A 3ICEA 5JEEA 5CB6A 2BEJA 2ANCA 4I1OA 2JEOA 1CJVC 4N1AA 5FOXA 4CRWB 1HEIA 3BD9A 1P62B 3HP1A 4FCWA 2J59A 4LV8B 3MUFA 4PAMA 3VX3A 2FDCA 3CPEA 2OCAA 2QP4A 3K0AA 2IC5A 4S2EA 2R62A 4UXJA 5DO9A 4DZZA 3RS4A 3FMIA 2J7KA 5IF9A 1MH1A 4PC1A 1TL7C 2QAJA 1JJ7A 4FWTA 5HZKA 1KI4A 1XJ0A 1KDOA 2PJZA 5L3SB 1DO0A 1HYQA 2J0VA 3ONWA 4MGZR 4LYFA 5CIWA 2V6JA 2FG5A 3T35A 5SZKB 2GEUA 4JVLA 4HLUA 1N5LA 4HAZA 1SVLA 3A58B 1YR7A 4FI3C 4RZXA 4LZZA 4DIDA 4FMBB 1GRRA 2Q9AA 2IYXA 5EXSA 3ZYCA 3NTUA 3FPAA 1N5IA 2FWRA 1SXJC 3G0HA 1YR9A 2BIFA 5GJWC 3VU9A 4CDGA 1NI3A 5CJPA 3RWMB 1G3QA 2ZRNA 4BFYA 1JEDA 3ND9A 5FPSA 2XNDD 3DMNA 5KSOA 5FOVA 1W47A 2ZETA 1N6IA 4A9AA 1NKTA 3H1TA 4D0GA 3MWJA 2XNDA 3EX7C 2J0QA 1JAIA 2CVFA 2V9PA 4JLOA 1R5BA 1DBSA 3ZIAD 1JXOA 1W4AA 4KVGA 3LX8A 2YOGA 3WP0A 2Z43A 4JYCA 2GCPA 3ZIAA 4XWAA 4HB2A 3UKDA 4TLCA 1IN5A 1EFCA 1YJ5A 3HDTA 4Q4LA 2FNAA 4KLZA 1ANKA 4HDCA 3CONA 121PA 1OXSC 3FOZA 4DLSA 1M6NA 4RD2A 5CJ2A 1KO1A 2DFKB 1KDTA 5DSZA 1FTNA 1W44A 2ZE7A 3M4YA 1GL9B 2FX3A 4I1SA 3AKEA 1GKIA 1W5TA 2QA5A 1ZD9A 4MGKR 4TMKA 3T1OA 5EP1A 4D0NA 1E94E 3VR3A 1E9DA 1DO2A 3F5FA 1Z08A 2ORVA 5H8WA 1W36D 3NWJA 2REOA 4Y0AA 5FOWA 1KI1A 2ZREA 2VH5R 4YMSA 4MRSA 3HYRA 2AKAB 4X8LA 2GCOB 1OLOA 2JLZA 3D31A 5CM8B 2W58A 1E9SA 1KHTA 5G53C 3GEIA 4BLRA 1MR3F 2FOLA 2GXAA 5HKKD 3AP3A 2ZU6A 4DCSA 4URYR 2G9NA 2IXFA 2ZRGA 3IQXA 1W4RA 3CRW1 5HKKA 1ZM4A 4Q02A 3CRRA 3VNVA
chains in the Genus database with same CATH superfamily
1B6RA 4E94A 3K9LA 4QT4A 3THWB 4RKFA 2R7LA 1UBKS 3PC8C 2WTUA 5EP4A 1BH2A 1PWEA 1XG5A 2GF0A 3L1UA 4OA8A 1JR2A 3TLGB 4CQJA 2FP4A 1P81A 3EBOA 2ON6A 4QHYA 4X97A 1KI8A 5DGCA 4NIMA 3B51X 4D74A 3OPYI 2V7WA 5IWAB 4MA0A 3O4RA 3GLGB 1RRMA 1FF9A 2AJCA 4UCFA 1KMIY 2ZBFA 4KV7A 1E69A 2JFUA 3KOMA 4F7DA 2PQ0A 4RWEA 3GQVA 5H3CA 2YN2A 3LBIA 2ZR9A 4M86A 1DXOA 1H0RA 1XZBA 1RI1A 4NFHA 5FHQA 5FR1A 3H5AA 2C1EA 3DJFA 3DP7A 4NZZA 5JBNA 3QWFA 4Z4QA 4YAGA 1SA0B 3DL4A 2CXUA 5GJVC 3IKLA 1RHMA 1ZK0A 4W9RA 4WWHA 3WXMA 3PNMA 5IS2A 1ZR4A 1FRQA 2YBEA 1KJWA 1X7WA 1J2RA 2OM2A 3KKEA 4H3SA 2QRLA 3BMNB 4ND5A 2F48A 4RXTA 3GJ7A 4XLZA 4DUPA 4HLUC 4QATA 2XKKA 4BFLA 1C8BA 4PIMA 2XUHA 1U4SA 4IUDS 4MSUA 3P9RA 4JH0A 4UNNA 4II2A 3D6HA 3T9AA 1MG0A 2LV8A 4GAEA 3W3AH 4RSMA 3ZWXA 4YYZA 5KC9A 3NMUF 4PSUA 5LJIA 2REBA 3NHKA 4DV7B 5GY7A 3L1JA 1JX6A 3OO0A 1SKYB 1X1CA 3P1JA 4YGYA 4N76A 1NSTA 3WNZA 4D9IA 4HAIA 2Q41A 3KLBA 4QA9A 1CG6A 2B21A 1T3ZA 1ZVKA 5E7JA 5EE0A 3SFTA 3LBNA 1DL5A 4MV0A 2R00A 4L6CA 3D1JA 4I9NA 5HKAA 2OB2A 1VP3A 3F46A 1M8GA 3ZDCA 5HUQA 4EUSA 4GEKA 1DE0A 3Q6NA 2AZMA 5AVQA 2VIIA 2HA3A 3EXHA 4PZUA 5KWVA 4IOMA 1HDXA 3VR1A 4IDGA 1UDBA 2CXNA 1C50A 1TCCA 3NALA 4RD6A 5HGJA 4EECA 2ZUFA 4J1QA 5HIKA 4WJKB 5LXTA 3SXUB 3KOOA 1P2VA 2ZCVA 4IDHA 5A9TA 4NR0A 3D0RA 5F52A 1EXNA 2OY0A 2J9GA 1UQTA 4MUXA 1KOLA 5A5GA 2J9FA 3C7DB 4Q4HB 3TINA 4GZ6A 5F2KA 3X2SA 4XQEA 3M5DA 4HB3A 1AHIA 1AKWA 3BCHA 3BVPA 3QF7A 3CJTA 4JBWA 4RGVA 3K16A 4EMBA 3V4OA 1VJCA 4ES6A 3RO7A 3CMMA 4KQHA 3FKJA 5TC4A 1DSSG 1XD8A 5AVXA 5ESWA 4D9GA 2VUSA 1R9MA 2I67A 4RZUA 5IHXA 1VKZA 1MNAA 1Q50A 2V4UA 2VI5A 3EDCA 3ADCA 1HH4A 2PX3A 1UJNA 1ZDMA 4ML3A 4EG5A 1XAJA 4XVHA 5F51A 4FC7A 3JD4A 4JLAA 4RHFA 4C07A 1Q22A 3L2OB 4TM7A 1T9KA 1QRUA 4B2YA 5AM3A 2ZIZA 5A06A 1EK6A 3JYQA 1BFDA 1Q15A 1RPAA 4RHCA 4WK2B 4BFXA 1MHPA 1WU7A 2HTEA 4ODIA 3P0IA 2OG2A 2OHHA 2NZUG 4ARSA 1EUYA 3AUKA 2GK7A 1Y6RA 2WAAA 3UV6A 1SBQA 3UHJA 1OFVA 3DKIA 4Y18A 3GX1A 3QKRA 4KMOA 2N42A 3MCTA 3LZDA 3FYTA 2AXQA 3RHSA 3UOGA 4BNJA 5KTRA 3BHNA 1AGYA 4TXMA 4KR3A 2J46A 4WZAE 3RVOA 4QYMA 2IXBA 2MHCA 2QTAA 1WDMA 3ZDEA 4FB4A 5BN5A 1I4DD 4JASB 5A4MS 2DUUA 1GEGA 1GG5A 3L0PA 1KRXA 1QFSA 3DHNA 1KI3A 2PUFA 4FE3A 4UUOA 3U7GA 3JQFA 5F23A 1UBSB 1XEFA 1FYDA 1C1YA 1D6JA 3DFIA 4R2MA 4XVRA 4JLUA 1ZU4A 5CXSA 1NTOA 4S05A 3KPVA 3OQ1A 1RWBA 3CS3A 5LQSA 3ANTA 2QXTA 3GN2A 1AV6A 2YMPA 3D3QA 2Q07A 3PNLA 2QMOA 5BNWA 2CJWB 2NQTA 1XE3A 4KI0A 2GCIA 4GX2A 1KFKB 3ZI7A 1ZNYA 3ZZ1A 1G3UA 2GASA 3OESA 2YWXA 4LE2A 3KNZA 4L4UA 4PCLA 1XTVA 3BJIC 2RBEA 1IJFA 1GDDA 4YWHA 3UPUA 1ZITA 1DRJA 2C2HA 3JZAA 2H3EA 4L5JA 1F8XA 2I4NA 4NULA 3AFIA 2LIVA 4W4TA 1YIOA 5IANA 4C4XA 2F6RA 3DEIA 4OJNA 4KVZA 1RM5A 4UAUA 3K6SA 1IUKA 4GVLA 4RK7A 3CVXA 3PPIA 4H7IA 5D1NA 1P0QA 3I9MA 3VOAA 2BHLA 3QELA 4QFDA 1K6JA 2D74A 4EZEA 2QAGB 2IYQA 1VQ1A 1YR3A 2BHRA 3AFOA 3D1LA 1POWA 3MBOA 3OAAA 2ACVA 3E22A 4OGLA 3SX2A 2OSBA 3WQSB 3UM9A 5LYYA 3TE6A 1O08A 1KAOA 3L8GA 4BO5A 1KH1A 1KAEA 2DRIA 2DJIA 1YZVA 3F7MA 4OF4A 3EPLA 1ORRA 1JF8A 4EHHA 3N2GB 1QAQA 1L5MA 1VKNA 2J3EA 3COPA 1XU7A 2EFCB 3PFFA 3R77A 4GUDA 4DSZA 2BN4A 4B3IA 5LB2A 4HY3A 5A04A 5ALYA 4FSXA 1D04A 5EZYA 5JYCA 1LLQA 1OX4A 1T0JB 2IUFA 3G2OA 3KHKA 4KSYA 3K5PA 2QQFA 3SC2A 2P6RA 5AESA 2NYAA 3H2IA 3MB8A 1T2CA 3UAZA 2JCBA 3PX7A 1VB3A 3VNQA 1UP6A 4IW3B 2X8BA 2HBQA 1TKRA 3KG2A 1YQDA 5EXPA 3W78A 3AEQA 4PINA 2NQ8A 2E89A 5TQ0A 3E1SA 3ROGA 1Z3CA 1XZNA 4RM3A 2ODTX 2VCHA 4Q9LA 2JFNA 2OV4A 3LW8A 1NBME 3UCXA 1VLZA 2GN9A 2O8FB 2VXOA 1NNI1 3UV3A 2BV3A 5BMVF 3ZS8A 3EWIA 4BBPA 1G21A 4TZTA 3OZUA 3CZRA 2PUJA 5C9ZA 2ZDGA 4OHCA 3L46A 1RYDA 1SZJG 2AFHE 2JLAA 2OKCA 2RAVA 3I2GA 3N8NA 5LL6P 1RLTA 2IS2A 2EFGA 2P1ZA 4E30A 3ZHXA 1Z7YA 3AC0A 2XOXA 3K0AB 3MTQA 1PUIA 4QE3A 1Z3IX 3EGDA 3KYBA 3I04A 3PFBA 4RVHA 1ZGZA 2VHUA 5BWLA 1K5DA 2IHYA 2ZZKA 1OKKD 1C9MA 2GN4A 4EKIA 1EDBA 2ZJ2A 3IEUA 1OTHA 3ECAA 3D54D 1OBVA 3NCHA 4JNCA 3S8MA 3LPDA 3A4YA 3T1TA 4BNWA 5DGTA 1GU1A 3N5CA 3CY6A 1NONA 1FS4A 3BKWA 3H11A 5L6MB 1DX9A 5KVVA 4Z1MD 1EFTA 4IH9A 4DG5A 5CXUA 3TR0A 1NW4A 4FHEA 4B17A 2H11A 2VH1A 2XWSA 4RS3A 2G72A 3U9TA 2IOFA 4AF8A 1ENZA 1KTIA 1IC6A 5LLSA 2ZT6A 3BF7A 2G82A 3PUXA 3CHYA 4J0KA 4Y2GA 4ZIRA 4U1RA 2BEVA 4OJTA 1V7QA 4Q4CA 4RK5A 1X92A 1UKYA 4HNGA 3OP4A 4UVEA 1GNRA 1JG3A 1ZYUA 3OCZA 2JGIA 4F9EA 1PQYA 4MV6A 5JBQA 3HC7A 2EZ9A 2I6GA 1A9YA 3ZU4A 4KLAA 4B45A 1CR1A 1ONOA 4FIDA 4DPMA 4PLWA 1A5ZA 4NDZA 3RT1A 1TJ5A 4YAIA 4JK3A 1Z5WA 1P75A 2W6OA 1EFRD 1NVUQ 1CV2A 3TZQA 4NU0A 4BO2A 4E5DA 5AQ1A 3LWNA 4BJ5A 3NHPA 5A1TA 4ZYUA 1XZIA 3AVXA 1UIMA 3S28A 1RBZA 5KMGA 3GDGA 2IS1A 4S0ZA 1QHYA 1U81A 2WSYB 3JVIA 4YB8A 5DGIA 4E6EA 4IX9A 4JUBA 4PYLA 4EHJA 5KYXB 3P5SA 5EZ6B 3ZOKA 2ZI6A 5BV1A 4OSPA 3CNLA 4L4YA 4KGZA 3WX0A 2OCGA 2Y0EA 4Y2VA 3G2NA 4OXKA 3STTA 3E7WA 1L3IA 4WUVA 2WWYA 4A2PA 3C3KA 3AR5A 1AVTA 1T8UA 4LHEA 1JEQB 2H4WA 4RPGA 1BMFD 1MRZA 4MCIA 5BORA 2I4LA 3AVQA 4EFMA 1G0OA 3HY6A 1RWOA 1HYEA 4NZPA 4G01B 3IBCA 3WZMA 3A4LA 3PCRB 5CPFA 3VKWA 1BKSB 3LY9A 3V8MA 2F7SA 3CVOA 1VMAA 1E3TA 3DF9A 1U7OA 2ZSAA 1D2CA 2CFSA 1T36B 3PHLA 4L02A 2ZZNA 1VBNA 4MRVA 1YB2A 2WUWE 3NNNA 5KYNA 1PNQA 4LGCA 4QTXA 5CPBA 1UQRA 1M1YB 3GFBA 2QL6A 1O96A 4HS4A 4TTSA 3TQHA 4OHYA 2DPHA 4HQ0A 4QULA 4DLWA 4B7XA 5TGDA 5MN6A 3PNKA 3FJ1A 3VR6H 1F8GA 3QE9Y 3SI7A 4TL7A 4CIVA 4L75A 1U2DA 4OMFG 4Y0NA 5COBA 3SQDA 4EO7A 1FPMA 1LF5A 1PYDA 1MC5A 1QVAA 3DOFA 5CDFA 2WRZA 3OFKA 2GKOA 3OIGA 2IW1A 1T5IA 1PL8A 2H7YA 4BGVA 4AY6A 2O19A 2BKEA 1U2GC 2E37A 1JPUA 3LUJA 2RGWA 2QIPA 4KVFA 1DC4A 3LK6A 1DAGA 1ZHFA 4LOJA 4WCFC 4Y2XA 3THWA 1Y5NA 1I32A 1K66A 2PZKA 3I2JA 4XYEA 4RENA 2AOTA 5E1OA 4A0QA 3GH1A 3IVXA 5BYAA 3ZGXA 2PWZA 4FLFA 4WY5A 4JOCA 1F8YA 4BQEA 5JSZA 1CK4A 4DABA 1U5BB 4NBRA 2GYYA 4ER7A 1IVYA 4Y3UA 1N2GA 5KUTA 4BFSA 1N0IA 1FYVA 1BH6A 1DIHA 1QCCA 1VGVA 1WUYA 1Y6JA 2PFKA 1DC3A 2BI4A 2QW0X 4J1TC 3ZU3A 4YV1A 3F98A 5H1YA 5K8UA 1DOZA 4IXTA 3AKZA 1XL0A 2GA9A 2HYIC 3HKBA 4MLDA 4YRPA 2VRCD 2QRKA 1HA3A 4AWBA 5JWOA 3CLRC 1RIFA 2W6NA 1GU0A 3AP1A 3QXJA 1M72A 2YHAA 1RQ7A 4ZZ2A 5ITZA 4JENA 1HRDA 1E7YA 3ZW8A 1P1FA 3B6MA 1BS1A 1A4IA 3I2FA 3D6UA 4D4IA 4IHJA 3U1VA 3LTEA 2OQRA 1FOEB 3RBVA 4DDMA 5U9CA 4OK5A 3HDVA 3A10A 3AZPA 1RQXA 2W00A 4LYHA 5A3RA 1RKXA 2MYTA 4YRKA 2VXYA 2Y1OA 4XVUA 3EZYA 2E6UX 2PKRA 3KS9A 4RY9A 3I92A 3KVOA 3I52A 4I2VA 5FOSA 4A2QA 1AB5A 2QYSA 4LOKA 4IV0A 1Z15A 2ZJFA 1XKXA 2VBGA 3PHCA 4A5SA 4PQYA 2J8ZA 1JHPA 1FW6A 3QVWA 1DI0A 4C78A 2DH5A 3HXTA 3IPYA 1ZAKA 2O7NA 3QE3A 2YWBA 3O91A 2BMDA 3GZ4A 1HLPA 1PNTA 3O95A 4QOIA 3C3EA 2HHCA 4RACA 5C8YF 4Y30A 2VK4A 4OHFA 1UXJA 3ONEA 2JIOA 4OAOA 2AG0A 3OPYB 1T5LA 2BGLA 2V7QA 1R1DA 2PGAA 4QL3A 4CKBB 5F35A 3UUEA 5HW0A 1F7VA 4J9VA 1SOAA 4MWOA 5BVHA 3MGGA 1KI9A 2A9OA 1C7EA 2BF4A 2G5GX 3V4PB 3IEXA 1I30A 4LJ5A 4WXYB 4LJ6A 5AW2A 3PIIA 3PLAE 3IE2A 1BN6A 4NMXB 5KX5A 1V5FA 2ATXA 2W0MA 1JJIA 3UHOA 3QYPA 4H2DA 2OK8A 5JJIA 2QKYA 5LUBA 4XSVA 2W90A 5HHTA 4GRIA 4CEHB 4U9UA 4YRRA 2XIQA 4UUNA 3DM9B 2HBYA 2QTGA 4FGUA 4KB5A 5TXGA 5ICEA 2J5RA 2G3YA 4XCQA 5JNRA 3MPOA 4LX8A 5BUCA 1A98A 2ICAA 4ZRNA 4DSAA 5KTPA 2V6IA 3L8EA 4ND6A 3C74A 1LVHA 4RQAA 4NJEA 5TY0A 4NMWA 4Q16A 2XMPA 4N9WA 4WFIA 2D5BA 2ZIVB 1XD2A 2Z09A 1Z88A 4P83A 5TGTA 5HBRA 4II7A 1F4VA 2O20A 3O8OB 3UQYS 2V7GA 3MD9A 3HCEA 2RGXA 1JQJC 1K8ZB 1G59A 1II0A 5CVJA 4JKYA 3DVAB 2I0FA 2Q3FA 3ZU5A 4BPBA 1R0KA 1SC9A 2W6JD 1X7ZB 3NC0C 1A7KA 5IUNC 1NM5C 1AKQA 1ECGA 4G5GA 4CTKA 3P0EA 4CHGA 3AO0B 5E38A 4B4UA 4DCOA 3UAVA 4WNAB 1JIQA 2NUPB 2PKYX 3CGWA 4AXXA 3QEMB 3U4HA 2RAPA 2YYYA 3TKYA 1GPMA 2JAUA 1BWSA 3NDPA 5MN4A 1BMTA 1A2KC 4PX5A 3V32A 4EX7A 3NR2A 5A1JA 3HUDA 3LVQE 4XWOA 1H2BA 4WZBA 5JAQA 4QAQA 4LXYA 1BHSA 3FHTA 3B2NA 4NMMA 1H23A 3W6ZA 4ZALA 1JBKA 3TNYA 1YNOA 1KJZA 1RSZA 3IQIX 3L6RA 4FGSA 3ZVNA 1GA4A 3I3OA 2JZNA 1QOZA 2Z98A 3VH3A 3K0SA 1WSDA 5FTJA 2ERXA 3OZ7A 4RULA 1JPNA 4M0LA 4D42A 4JSYA 2D2XA 4OB7A 1JI3A 5K0CA 3OC0A 3CXRA 1OASA 1V9CA 2B4KA 4ZK6A 3UJNA 4V0KA 3H8WA 4RA9A 1BW9A 1FNNA 4BLPA 3SU8A 5B3JC 1AQJA 4GXNA 1JKJA 3G2HA 3P0JA 4N7BA 2X5OA 4GOLD 2XNHA 4BP1A 4OYLA 4QGBA 3P96A 3F3MA 3B3GA 4WERA 1LBHA 1KGDA 2XI4A 2ZE5A 4A73A 4XAQA 3B1KA 4B84A 5BQ3A 2I71A 3CFYA 5JXWA 2VHQA 1QSGA 1XRRA 4FT4A 1KSGA 5KB3A 5FCDA 4CR8A 5F9FA 1M8KA 3IUYA 1KZ7B 2QTVA 1YDHA 1YL6A 2YXLA 2ZBPA 3H1EA 1TO6A 4M21A 1VCNA 1XEXA 2QTHA 5K3FB 4L4ZA 4PSCA 1QE3A 1M6WA 1T3TA 2H51A 3ZHCA 3DLTA 3P2KA 5IZCC 4MMXB 4PXAA 2LE0A 3E27A 3HB7A 4ZV9A 4I66A 4IAOA 2EGUA 2NUAB 2P40A 1AZTA 2HA2A 1UBRS 3PZRA 3EEOA 2B1GA 5NULA 5B4TA 3RSFA 5LN1A 1EFKA 3A26A 3G5AA 3F3KA 1UBTS 1M1UA 1WO8A 2X0IA 4U9IS 5JO0A 4CT4B 1WTCA 5JOQA 3NEAA 4Q7MB 1V5WA 2M2IA 1RM4A 3AUAA 3WWPA 3CO5A 5SZJA 3ASZA 2Z6QA 1LCIA 6YASA 1N57A 2FJ0A 4QJ5A 4MRMB 2EWMA 2Y1CA 4XH9B 2XVZA 4WVFA 4DS3A 3JV7A 2OILA 3FNQA 4YCDA 4RF4A 3N7TA 4UCXA 3K8OE 1FNMA 4HI0E 4WRRA 3OQIA 3Q9UA 1H5NA 4DPKA 3ZDAA 1OFHA 1J24A 1JLMA 1R0YA 2HA7A 2DSTA 4JLVA 4JP2A 2V7UA 1C2TA 4KO4S 1IZZA 1NYRA 2P4QA 2BF7A 2D5LA 3CYFA 3HWWA 1SELA 4EVIA 1CU1A 2NPOA 3W6OA 2YWDA 3BXEA 3ZGNA 3IV7A 2HJGA 3UFBA 4QFBA 4OHPA 5B58C 1AN0A 1NVKA 5EQFA 4GBJA 2H17A 4LSMA 3VV3A 2PJDA 3BH7A 5JCOC 5JXIA 4J2OA 3ZY6A 2FX5A 1M6HA 3QH4A 1IZ0A 3SZMA 4QVIA 3NKFA 1LH0A 4RF3A 3VO9A 4CHTA 4WBNA 2H08A 1O8CA 3J81k 1CUAA 2HAEA 1BROA 1E8NA 1WPXA 3IRVA 2XUOA 1SUIA 5ALLA 5CFRA 3I09A 3ZBPA 2OORA 3ZR4B 5DDIP 3WGOA 2WU8A 4A8JC 2QT1A 3GEMA 3IAEA 4MR7B 3U44A 1W46A 3L5OA 4WZ6A 4EQ6B 5IYZA 1ZQ9A 3ZCUA 5KC8A 4O08A 1NJSA 1C0PA 4X1OA 4PU0A 1X7XA 4KO1S 5DTQA 4XX0B 4UBOA 3AI2A 3E9QA 2VXCA 3CUWA 1S3IA 3LPLA 3MAGA 1E7QA 3NTQA 3R3XA 4LRUA 4P34A 5I8PA 1JR3D 1KXJA 3E58A 2A7XA 3ZNNA 3SZUA 3WIBA 5D51S 1UK9A 2E6KA 3WHLA 2Q2OA 5FBQB 2C94A 1BX3A 2EZUA 3T5BA 3BE5A 4KQGA 3DO8A 4LC0A 1LPMA 1L4GA 5FP0A 5DPMA 1GY8A 5A7FA 5HZHA 5FUVA 2B1JA 2F3UA 2HRBA 4F60A 1N7JA 1ITZA 3USCS 5LZ2A 1TDJA 3EIXA 1RRGA 3NDJA 2YV2A 4ZOCA 4KHPB 1T6ZA 2DHCA 1KFJB 3MELA 1L8OA 1CEEA 2UUOA 1JNXX 4UBKA 3TLXA 1PAUA 3AF6A 1L7PA 1RU3A 4M0KA 3ONNA 4OIFA 4WKNA 4O63O 5FEMA 5EINA 4AZ3B 4EG8A 3U13A 3R9WA 2JRLA 3G9XA 2J5KA 4GMDA 5D3MA 3UTDA 3AYZB 3ZZMA 2IX3A 4XEUA 5IVIA 1BVHA 1J1ZA 1H2HA 3B70A 3G8BA 3BQMB 4WDQA 4BATA 3C87A 4G36A 3GFOA 2FVYA 2VZ9A 5DGDA 2IXAA 2NMVA 1D8TA 1ZH6A 2J9RA 2WDPA 2HRCA 5B3LA 1DQNA 3OOWA 1EWQA 5M7EA 3F9IA 2FSFA 2AG8A 3DCIA 3ESRA 2VPTA 1G20E 4KQCA 1MNQA 4YWJA 4ENTA 2DWUA 1CR4A 3DCJA 3L7BA 2MSDB 3RQSA 5GIPE 2ZXFA 4ZVKA 2WP0A 4MA5A 5HWSA 1QTRA 3JYLA 1GKUB 3NGMA 3WGGA 3BE4A 4K9SA 2FN3A 2F59A 2ZTHA 2EBWA 1DG3A 1XHEA 4YRAA 4CM6A 3CR3C 1V1JA 4M7WA 3ZXYA 2C2ZA 4Z53A 2OHIA 4FP9A 3F4KA 4PZPA 1A4UA 1DFHA 2IHVA 4XDGA 2O06A 1WMSA 4YJ2F 3W9UA 2WG1A 3BJZA 3HL0A 4URVR 1ZD5A 4KIFA 4DMRA 2O8NA 3EISA 4QDKA 1X7DA 1LJUA 1KEWA 1WW2A 4AMGA 5JZBA 1WZ2A 1GFIA 1O6BA 1U3TA 2VSXA 2ZAOA 1JQEA 1V3QE 2AN1A 2EL7A 1TD9A 4JQYA 1SCUA 5DYNA 2W4QA 4EKDA 2QS9A 3RK0A 3AM4A 4JODA 3K35A 1EWYA 1GPLA 1V71A 1KS2A 2W2QA 3DOHA 4ZO9A 3BRQA 2VP6A 1WULS 2PN1A 1J1UA 4BKUA 1OLUA 3EQ7A 1UAGA 1A9RA 1UK6A 2G5TA 1J2EA 3EE6A 1UFRA 3QGMA 4H7PA 4N6NA 2H5IA 2D7CA 1PT8A 2C4MA 2WK1A 4FX2A 3CUYA 1GAQA 2JI6A 3QTBA 4H17A 1WY7A 3R1IA 4WGGA 4X54A 2Z5GA 1A8HA 2B4QA 1UANA 3VR5D 2YJTD 1IRXA 3BM5A 5EWMB 4MV4A 1SBCA 5H81A 3ZHBA 4F3NA 1PJ2A 4K9QA 2G1KA 2TRSB 1UEXC 4QVKA 5ABPA 1IM8A 4DLBA 1SHJA 4M0MA 4WCDA 1VE1A 1CUUA 2P3QA 3JVVA 3BCRA 2CV2A 2KB0A 1LSJA 5C8ZA 5AM5A 4FSDA 4ZAZA 4E1AA 1G3IA 3GVPA 3WAGA 3KQUA 3BUSA 4LS3A 1EB8A 2LVBA 1Y5RA 2J3QA 4C7BA 3ZH9B 3FAZA 2O8CB 1G17A 2BD0A 3CMCO 5AK3A 3TR6A 4BTLA 4MWGA 3AIOA 3NAMA 2NT3A 4TRJA 1YIDA 1V6CA 1E4EB 2AEMA 2WT8A 2Q2WA 1F2UA 5J5CA 1KIFA 3G6WA 3FPEA 5IAGA 2WAOA 4RD0A 3FVVA 2DJ5A 2E18A 3JWIA 1NW3A 4UXHA 1V37A 2EU8A 3MTGA 5JCJD 1J6UA 1DDOA 5LYJF 3KELA 2BJHA 4EFKA 4F85A 3AW8A 3EVFA 1JAHA 3EPKA 1FCJA 2Z3WA 4HVCA 4QRHA 1MO4A 3RC8A 1BDIA 1PK8A 3R74A 3RUPA 1A88A 1EKXA 5L3RA 1U0BB 4RMGA 1WPGA 1TUIA 5LQMA 1SUCA 3TKAA 4AYXA 2I99A 3NHYA 5CH5A 1OWPA 4PYKA 4S1NA 4EJSC 3FFAA 5DJ5A 4R51A 3U1BA 1KEZA 2WICA 1G38A 1T2AA 3DAHA 2Y6UA 5T8KA 1D4ZA 4MROA 4ARZA 4CV0A 3COJA 4C30A 1NN5A 3BWMA 1EHIA 1KPIA 5C5DA 4RL6A 3IAUA 2H57A 5EVCA 4DOMA 5H16A 1EE9A 1U7ZA 2IIVA 3R5JA 3PUWA 4I50A 2Q8QA 3PHIA 4IJUA 4DLPA 2GPNA 2C5AA 1RIIA 1UEJA 2PT7A 3X1DA 2FB9A 4DWWA 4KCGA 4OQ4A 1KZHA 2CMDA 1WM1A 3E7FA 5BWOA 2CD9A 1G9TA 1E1CA 4F46A 1U9CA 3GFFA 3DEZA 3MWKA 2FZEA 1I7PA 3STUA 1ETHA 1QHXA 3O90A 1OVMA 2HPAA 3FNRA 3BH0A 2A78A 3B3QA 2RKWA 1HYGA 1KIAA 3C0KA 4JC0A 4JJ8A 3DV2A 4TL6A 3IJPA 1W9MA 1I4TD 5G0UA 3WL6A 4KK4A 4DANA 4FXPA 5I7HA 2BSQA 4P7BA 4DMLA 5HDBB 2VJBA 4EG1A 4U0KA 1GP2A 1PQPA 2GCGA 4JR1A 5CB4B 1NKVA 1E3WB 1W4CA 4O6VA 1K08A 4ZVPA 3JU3A 5ECYA 1M6YA 3RODA 1A8SA 4Q82A 2VS1A 2WAYA 4I81A 4GI1A 3ZWMA 4ZT4A 4DQDA 1J25A 2E4XA 3GLFA 4F4JA 1XCOA 1FQOA 1XRQA 3PJGA 1JQAA 1GNQA 2QG4A 4U8HA 3EH1A 4YPFA 4TMZA 4D92A 5ES4B 1CQPA 4L27A 2EVWX 1CUJA 2D3TA 2EX0A 3G2PA 3ZGZA 1T24A 1EX1A 2X3UA 2JFBA 3COZA 1GTL1 4FILA 4DKXA 3WIEA 1HMPA 2FMXA 1ABEA 4NCKA 2F43A 1C8KA 4R8SA 2XDQB 2YJNA 4RPHA 4H9GA 5JNLA 1DCTA 1C7QA 5EWLA 4F6CA 2CE2X 2H7XA 4C03A 1F51E 1EG7A 1KU6A 2YNMC 4P32A 2X2EA 4X1IA 4QO7A 4Y9SA 3WGUA 5KJEA 3WV4A 2YY6A 3HHEA 2A30A 4X3PA 1G5HA 4A0RA 2JVJA 3KTOA 4AJEA 2RH4A 2CJYA 1QG0A 2BGRA 2IHZA 2XGGA 4XQCA 4Y98A 1KMHA 3L7YA 1GGNA 3JQ6A 2Q21A 1AUVA 3G2KA 2QUZA 4UU1A 1V5IA 5AHWA 1FTGA 4I8XA 1DC8A 4XIFA 4ZVOA 5A3SA 4D43A 2YBDA 1Z7EA 5CMLA 5KTNA 1WSAA 3HNOA 4YA6A 2JI9A 3FDXA 2KS6A 3H17A 4C4ZA 1VHDA 2P0EA 3ICVA 5H5JA 4B6OA 2CDCA 3FF4A 5LQUA 4DR5B 1ZHHA 2QMEA 3CNEA 4G4JA 4P98A 5E2IA 5H02A 5C3UA 3RU7A 3V48A 2Z8YA 3WLKX 1Z12A 4MRAA 2QMUA 4CM5A 1E20A 3PXAA 2CL6X 1EX6A 4JLWA 4P4UA 4J43A 4Q1AA 2FRXA 5AFSA 5K9ZA 4YP1A 4BIIA 3CIFA 1C1DB 3GPBA 4Q9AA 5B7NA 3IBYA 1TM7E 3PIRA 1U99A 4JLSA 1OU0A 2GJ9A 2PBFA 1ORWA 3AB8A 5HE8A 2Q3CA 3ACBA 4INJA 2P65A 3NVKI 4AZTA 3U31A 4R1MA 3PUKA 3ILHA 3P19A 5K0LA 1HK7A 2QUIA 4NICA 4HLNA 3MBKA 4OY3A 2DUWA 3TTSA 3AESA 3L0DA 2DPGA 2XJ4A 2F3RA 3WSVA 3FLAA 3GY0A 4URUR 3KHUA 1DUSA 5G2OA 2VPIA 3GJ3A 2HKIA 5ERYA 1PHRA 1UFOA 1Y7LA 4MAFA 2DT5A 2I7TA 1ULUA 7GPBA 3AH8A 3OECA 4XPZA 2NO6A 2R1UA 3ZGVA 1R3DA 3INTA 5IAKA 4AKEA 3QEJA 2IHNA 5A03A 2XA2A 1ZD3A 3GUVA 2BDUA 4MYTA 1XTBA 2FR1A 4C5BA 2NVUB 5CIYA 3CWCA 3KQQA 2HJSA 4JZKA 5EFZA 3AUUA 4KQ1A 1OI4A 2I2DA 4GZMA 3SLRA 3U80A 3SSMA 3UWKA 2VBIA 4FBMA 5B3AA 3RABA 1IN8A 3PUVA 1UT5A 1JG7A 2NOAA 1A8QA 4OYYA 1UPCA 3DWIA 3PJFA 5EMJA 3HBJA 1RM3A 4ZZ0A 4KDEA 5HS4A 2GHTA 1M0WA 3O9MA 1O58A 3PE3A 5ICCA 1KJIA 1ZGCA 3LXXA 4V2UA 1XVUA 1IBMB 3RSQA 1BC5A 1HDRA 1QF9A 4ZQIA 3JQQA 3R40A 5FPKA 3ONDA 3UPDA 4ADSG 2H9YA 2L82A 3EA4A 1MVLA 5TB5A 1YE3A 3T1VA 3AHHA 1P73A 4JWTA 1RNLA 3GYGA 4MITA 5IVHA 1D1QA 4EPXA 4HPXB 4IKPA 1DCMA 5JD3A 3FHJA 2XUZA 1M73E 4ZVRA 3B5JA 3ZNPA 3RS5A 2FCAA 4YRGA 3FFWA 1FSFA 5BSTA 3BL6A 4LY0A 1ACMA 2HV8A 1MH9A 3DNFA 3I4CA 3I9OA 3UY4A 3VNUA 3E9YA 5LNK1 2QUBA 5KQPA 3BHMA 2AR7A 2NPFA 3DONA 5THQA 4TYNA 2VF4X 4WUTA 1H9CA 2NZXA 3U7FB 4AAYA 3KJEA 4CFZA 4F3YA 4DIEA 4CLOA 4J0HA 1VGRA 2VRNA 1GXSA 4YCSA 1S2NA 2VCEA 1GQSA 1YI0A 2ZBGA 3G88A 3NGXA 2O7VA 4P36A 3ZU2A 3DSRA 2JBAB 4EO4A 4YR7A 2OOSA 4DWVA 4EVRA 1XLVA 3FLBA 4HC4A 4JYAB 3C3WA 1YRHA 4CUJA 1DLIA 3P71T 2WJYA 3UENA 2OVFA 3ANYB 5CG1A 3FCOA 2OT3B 1OIWA 2CHQA 1OROA 1EFAA 5SY9A 1HYBA 2IV7A 4JXXA 1RLJA 1IN4A 3ORSA 4G23A 1EVZA 2XVMA 4CU5A 1ZOSA 2XEDA 2Y1DA 3R6WA 1AXEA 1YONA 1XRJA 1M3SA 2FP4B 5DLQC 4DBLC 1MVNA 5TARA 3QYAA 1PNOA 1N6RA 1UOPA 1VE5A 2GVDC 3TD2A 2CLHB 4R84A 1X8XA 2HIHA 4YAJA 3VAZA 5JY1A 2A7QA 3ZCQA 4EFLA 4ZHQF 5BN3B 5JNTA 5K45A 1H0SA 3S40A 5AUNB 3EZXA 4UVIA 1CS0A 1JDBC 3ESBA 4MV3A 1SVNA 4JU8A 4L0DA 2HDHA 5DBGA 4J90A 1UDWA 1YFKA 5IH3A 3VV2A 5BV8A 2DWQA 4P0TA 3DXYA 4RVUA 5IUJC 4FLEA 1SUEA 3ETJA 1ZMTA 5CDHA 2WFZA 3KQVA 4KYUA 4WNCA 4BS9A 3L0OA 2AC4A 3U7EB 5C81A 2UUAB 1P3Y1 4YDRA 1Z7BA 2NV6A 1OA0A 3QU4A 3GLQA 4JQZA 2HXYA 5E8RA 3C7KA 1W581 1F4LA 1O94C 1R0WA 2FMFA 4IILA 4ERNA 3SJAA 2PX8A 3BTSA 5L40A 2L18A 2XMDA 1ZVJA 2F55A 3FSGA 2CZGA 4N6GA 4DKJA 3K9GA 4MPPA 4RLQA 2J7PD 4AJPA 5GVRA 1U28A 2IY9A 3EZ2A 3FLEA 1NVFA 1QORA 3KLNA 4PAQA 3N6VA 4UQOA 3NUQA 5GPBA 1EVKA 2ZDQA 3DEHA 1QP7A 4CQLA 2FK8A 1CUBA 3IPLA 4G56A 1L4HA 1TIBA 4MV7A 1H8EA 3SIRA 2IP4A 4F0JA 2YUIA 5ELLA 2JGNA 4HNSA 3NG1A 1ZM2A 1CUDA 5LWQA 2FU5C 3U3ZA 1RJWA 5L6LB 3TX2A 2GFIA 2O5RA 4HR7A 3WIVA 1THGA 3K15A 1GJRA 3R41A 4FKMA 2AFVA 2QV0A 2Q2NA 2QVZX 3PITA 3REQB 4BUZA 2HUNA 2B61A 3A11A 1LFDB 1RKVA 1WCIB 4LI0A 4WN9A 3KE8A 4FYKA 5HIIA 4V1CA 3URKA 1NPTO 4CCYB 3D6AA 4WACA 2FMHA 4INAA 4LXHA 5GMOA 3S99A 1DJMA 3WL3A 2SCUA 1DARA 3IHLA 1PK9A 1TQHA 1V47A 3PNBA 4DIFA 2VLBA 2H18A 3TNDA 5A62A 1OZHA 4JBXA 1K5HA 5DCUA 1PDWA 1VIYA 4JJAA 2FZ4A 4Y6OA 2VJOA 3SN6A 4BVEA 2V9ZA 4OI2A 5KYKA 5KYTA 3RSZA 3VZBA 4KACA 2HQBA 1KR2A 3O82A 3U4QB 2ZR8A 2WTMA 3RVQA 1NXPA 3NWPA 4P6VF 2FQXA 4XARA 3L07A 3ZGOA 3CUTA 3HJBA 5A7GA 2B30A 4FWBA 5IG2A 4UMDA 2JKVA 2ORYA 3GFTA 3TQSA 4KYTA 4CQNA 3C3XA 3A1TA 1A7JA 1M2JA 3QXHA 2G70A 2H48A 4TS3A 1KZ4A 1FDIA 2AN5A 3BWYA 4YRJA 2PLNA 3I2HA 3RBXA 4AKTA 3GEEA 5AOBA 3AI3A 3V6LA 3RRYA 1GZVA 1WDKA 3QTLA 1Y5IA 3U17A 1PT6A 2QJTA 4LF8B 1Z4LA 4BX9A 1D2GA 3DLAA 3DZ8A 3GPIA 3UXEA 2OO5C 1MJHA 1AS2A 2O2YA 2WTBA 3IFSA 3M34A 4K0KB 3NTRA 1TJYA 2O48X 1G1AA 3H8SA 5UKDA 3VH2A 3ZV3A 4CL8A 5CA1B 5E9AA 1P33A 1B6GA 2H31A 3DNPA 5KTOA 5K05A 1USGA 2FMTA 2IU0A 5EQJB 4BMOB 4H3KB 4PS1A 3TW8A 1IXKA 3UG6A 1L2TA 1UXIA 2WG2A 3NO4A 2J0EA 1YZLA 5IP5A 2VDWA 1EESA 4C3ZA 4C2TA 3TIFA 1VL1A 4AVYA 4ZZ1A 4YMUA 1ISJA 1R6VA 4YT8A 1CTQA 3TYXA 1W6RA 2JS7A 2VH2A 1X2BA 3CIOA 5ADWA 2GBIA 2XPCA 1T3HA 3GA0A 3C6ZA 1V4VA 1LBTA 5TMEA 2J1LA 4P0PB 1SXQA 3X2FA 1RE1A 1HFWA 2C2XA 1BSVA 1U8ZA 1WA5A 3GEDA 4N39A 3KV3O 1QIEA 4GOXA 4B3HA 3UUWA 1DVRA 1NXSA 4J0DA 3H5WA 1S7GA 4S3MA 4DG9A 5JH7B 3U61B 3GZJA 1PFVA 2WD9A 1O5OA 3KSMA 3TE7A 3WS7A 4MS4A 1PHPA 3AR4A 1Z8NA 4CLHA 2I33A 2CLOB 4IDCA 5JSQA 1NC1A 2OXFA 3OOHA 4AB1A 3H87A 4H0CA 2GHIA 3D3WB 3VJRA 3N1UA 5LM3A 4GKJB 2IYWA 3WZLA 2GD2A 4TXLA 4Q9HA