3MERA

Crystal structure of the methyltransferase slr1183 from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr145
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
173
Chain Sequence
EPNDFLVSVANQIPQGKILCLAEGEGRNACFLASLGYEVTAVDQSSVGLAKAKQLAQEKGVKITTVQSNLADFDIVADAWEGIVSIFCHLPSSLRQQLYPKVYQGLKPGGVFILEGFAPEQLQYNTGGPKDLDLLPKLETLQSELPSLNWLIANNLERNKAALIQLLGQKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target SgR145
rcsb
source organism Synechocystis sp.
molecule tags Structural genomics, unknown function
molecule keywords Slr1183 protein
total genus 47
structure length 173
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3merA00
3EEYA 3KHKA 5KQRA 2GH1A 2H00A 3SM3A 5CVVA 1Q0TA 1M0EA 1TW2A 4K6MA 1JTFA 4KWCA 1SQGA 4PYNA 3B3JA 3PLAE 1KPHA 1ZHFA 3KPUA 5FWDA 2EJTA 5DM1A 3C0KA 3E8SA 4YUWA 3A27A 1KR5A 2LD4A 2N47A 3GNLA 5DTQA 4CKEA 1YFJA 1N7IA 3MCZA 2XBMA 3Q87B 3EPPA 4R8SA 4P7FA 2E5WA 1L9KA 5CVEA 1QAQA 3QOWA 1YUBA 3BWCA 4F84A 3HTXA 2PT9A 1ORIA 2OYRA 3BGDA 1JG3A 2G71A 2IDJA 5EZSA 3MERA 2Y1XA 2P1DA 3FUTA 4FSDA 4YUZA 1NW7A 2I6GA 2ZIEA 3HP7A 1O54A 4AX8A 2WK1A 4KW7A 1NKVA 1RJEA 2O05A 3OFKA 4AZTA 1X1CA 1P1CA 2ZW9A 2G72A 1T43A 1UWVA 2AVDA 2PV0A 5HILA 3CVOA 4YV0A 4HRAA 5E2AA 3FPHA 3HVKA 1X19A 2GPYA 1EJ6A 3HEMA 4HTFB 2IBTA 3ORHA 3T7RA 5FQOA 1DUSA 1FPQA 1I1NA 2JHCA 1Y8CA 3L8DA 5GWXA 2HTEA 2ZTHA 3THSA 2PGXA 3HA7A 4P7JA 4QPPA 4X60A 2CL5A 2OKCA 3PTAA 2G1PA 2ADMA 3FUWA 2JH8A 3LBYA 3ER9A 1R8XA 3FTEA 5DM2A 1XCJA 2FYTA 3NJRA 5D1HA 3EVEA 2HWKA 4ER3A 5LQUA 3LDFA 3HCDA 3KQVA 4OQEA 4GOND 4KIGA 5IH3A 2GS9A 5LSAA 1AF7A 1U2ZA 2B3TA 5K0JA 3NDIA 4PYIA 2P40A 2OO3A 2UYOA 4EMSA 4EVIA 3DTNA 3LKZA 4OBWA 2Z6QA 4FSXA 3SMQA 3OCJA 1IY9A 3GRYA 3KQYA 3TKAA 1UFKA 4OA5A 2BZGA 5T6BA 1VPTA 4PYMA 4M36A 2PXXA 4WVLA 1SKMA 3R24A 3FRHA 5T67A 2OBFA 3OZTA 1WG8A 3E23A 3LPMA 3VSEA 3FTCA 2Z6AA 3LSTA 2ZWAA 4RTKA 2QYOA 1G55A 4RV9A 3G2PA 1B42A 3C6KA 5K0LA 3KQPA 4LECA 1QAMA 3VYWA 2GLUA 5K01A 2P8JA 2R3SA 3HA5A 1AQIA 4Y30A 3EVDA 2JHAA 5ICEA 3U81A 3BGIA 5EEGA 5K0NA 5KYGA 1SQFA 3G8BA 3PFHA 4E2ZA 5DTRA 4XCXA 3HCCA 5FADA 5HIIA 1G8SA 2VS1A 3BWBA 3M70A 2VDWA 1KYWA 4ATNA 5EG5A 1RI4A 5EKXA 3AY0A 3R9XB 4HG2A 4E32A 3SSNA 5BXYA 3ELDA 4V0RA 3DULA 1HMYA 3UJ6A 5K05A 1AV6A 4POOA 2XYRA 4GEKA 5E8JA 1XDZA 1ORHA 2R6ZA 2F8LA 4PYOA 1JSXA 3V8VA 5LR6A 3O31A 3UJ7A 3KPYA 4GOLD 4IV0A 2ZWVA 3UJ9A 2VP3A 5E9JA 2YUIA 2OY0A 2ZLBA 2C7OA 2EX4A 1D2CA 3EVBA 3HCBA 4OQDA 4CWAA 2FHPA 2NXNA 2VDUE 2CWWA 3JWIA 3MB5A 3OZSA 3TPZA 3RODA 1ZGJA 2A14A 3OU7A 3DLIA 3FRIA 2PXAA 2AN5A 3KQTA 4PINA 1X1DA 3HM2A 3E05A 3EMDA 3UZUA 2FCAA 3LBFA 4R8RA 2Y1WA 5EIWA 4IV8A 5K0GA 2NP6A 3DMHA 1P39A 2HV9A 4PIPA 4RTJA 2XVMA 3SGLA 2PKWA 4P7KA 4EK9A 2P7HA 4DF3A 4E2WA 5G02A 3B7PA 2QRVB 5E1MA 2ZFUA 4KIFA 4YUVA 1PJZA 4XUEA 2BM9A 2G8NA 2P3LA 5DRYA 1WXXA 3CJRA 3A25A 2ONYA 3P9IA 3GRRA 5CVUA 2K4MA 2P35A 5H02A 4DCGA 5DTMA 2VZ9A 3UBTA 1TW3A 3P9KA 3K0BA 3ELWA 3ELUA 5F2NA 5EGSA 4MWZA 8MHTA 4QTUB 3FPJA 3JWJA 4A6EA 4RTOA 1I9GA 4RVHA 3UJCA 2PBFA 3P9CA 3EVAA 4YUYA 1KPGA 1N7JA 4FT4A 5ERGB 3LX6A 4DKJA 1P1BA 2I7CA 1FP2A 3TOSA 4RX1A 1KP9A 4RWZA 1RJGA 5GIPE 4YMHA 1X1AA 2NXCA 1NW3A 1R6AA 4E2YA 5EEHA 4RTQA 3HNRA 1QZZA 4M7RA 4Z2YA 3HVJA 3JWGA 3P2EA 2O0LA 3GRZA 1NBHA 3SR4A 1NW8A 1SVUA 3BXOA 4PYLA 3LGAA 3VC2A 3MHTA 3OFJA 3MTEA 1XCLA 4EQZA 2P3OA 4E30A 5FWAA 4AZSA 2BM8A 4GBED 5DWQA 3KR9A 1VE3A 5EKUA 3KU1A 4HH4A 1ZGAA 1JTEA 3NWBA 5D1NA 5MHTA 5C1IA 2H1RA 1UIRA 3AXSA 2Z6UA 4GC9A 4PGGA 5DX0A 4C04A 7MHTA 2AOWA 3EVCA 3O4FA 4PYJA 4CXMA 3GGDA 1WY7A 3GRVA 1SG9A 5EMMA 3HCFA 5DSTA 4C05A 5ICGA 3D2LA 2PT6A 3GJYA 3IV6A 2WA2A 4XUCA 4M37A 5M5BA 3A7EA 3NVKI 3SSMA 3M6UA 3A7DA 2AS0A 4RTMA 3FUUA 4OX9Y 2FRXA 3I5UA 1R74A 3BZBA 3CJTA 4E70A 3M6XA 3KQSA 5K8VA 2AOVA 2YQZA 3C3PA 4M38A 1D2HA 2PY6A 3FUXA 2I9KA 3TM4A 1YFLA 3HA3A 3PX3A 2YR0A 4X1OA 4PCLA 4C08A 5FA8A 1EAMA 3DUWA 2PJDA 4X63A 4BP3A 1JQEA 2P3QA 3I58A 5CVDA 4ZTBA 3CJQA 3T0IA 1BOOA 5E1DA 1KIAA 3M4XA 4BLVA 2B25A 5LQRA 1FP1D 1X1BA 1RI1A 2DPMA 1YZHA 3MGGA 3LL7A 1O9GA 3LDUA 5E9QA 4GC5A 1N2XA 5BW5A 2QY6A 1YZ3A 3UJAA 3PX2A 2PLWA 4P7GA 2IH5A 4QTTB 3LHDA 4FP9A 1MJFA 4BP1A 3DH0A 2XVAA 4LG1A 2EJUA 2AOUB 3NWEA 3R0QA 5EMJA 3UA4A 4GOMD 1QYRA 4QQKA 4PWYA 2ZBPA 4E33A 5K0BA 2C7RA 4B17A 2G70A 1EJ0A 4BLUA 1JG2A 1BKYA 3O7WA 2ZZNA 4FZVA 3I9FA 4PYQA 1M6YA 4AUKA 2JG3A 1F3LA 1L3IA 2CKDA 5CCXA 4PGHA 4ER5A 5IKMA 5EIFA 3LDGA 3OE5A 2O57A 4QQNA 1R00A 4KRGA 4MIKA 3OE4A 4BY9E 4PCAA 1V39A 2KW5A 3PFGA 4Y2HA 3KQOA 1RJDA 5C9ZA 3DMFA 3CC8A 4H0NA 1SUSA 3HCEA 4LWPA 1YB2A 4U7PB 1NE2A 1NW6A 3UJ8A 4O29A 1IXKA 1WZNA 2HMYB 1WS6A 2P7IA 5E1BA 3P71T 3CGGA 5C0OE 4FT2A 5CM2Z 3I64A 4F86A 4FR0A 3KQWA 4F85A 2BH2A 4E31A 4ER0A 2JHPA 2NYUA 3DP7A 3KPWA 3WSTA 2XYVA 4ER6A 3HVIA 3DXYA 5FTWA 3MQ2A 2YXLA 4JXJA 4X61A 5DLYA 2ZBRA 5K03A 4R6XA 2AOXA 3BWMA 5GOZA 2HR1A 4RTPA 2JJQA 3BUSA 3KR2A 1SUIA 2IBSA 4RTNA 5EQJB 4CTJA 3B89A 3EGVA 3MTIA 1EG2A 5HOQA 4R6WA 3G8AA 1XJ5A 3LECA 4KVZA 3KR0A 2IH4A 4CKBA 2YXDA 3FPEA 3IEIA 5JUWA 1VP3A 3F4KA 4WXHA 2BR5A 5HEKA 1G38A 3EVGA 3LCUA 1AQJA 2BR3A 5K0FA 1KHHA 4KDRA 2PX8A 1L3BA 2YVLA 3DXXA 4YMGA 1O9HA 4RVFA 4QDKA 4DMGA 3HVHA 5FQNA 5GM1A 4DA4A 3E7PA 3FPGA 2CMHA 4C03A 3NDJA 3NVMB 4C4AA 3GCZA 3I53A 3AJDA 3AXTA 3RIEA 3NTVA 2YXEA 3KQMA 4ER7A 5LQAA 3R6TA 2IIPA 2GAFA 3KQQA 3G88A 1M6EX 1HNNA 1G6Q1 1R18A 2JH9A 4AZVA 3KPVA 1P91A 4QVGA 3QOXA 3A4TA 5HIJA 1L3CA 2H11A 3AWIA 3TM5A 1JR4A 4GF5A 4R05A 4KDCA 1VIDA 3BWYA 3SSOA 2ZIFA 3UJBA 3Q7EA 2ZSUA 3DOUA 5F2KA 3LCCA 1VLMA 3SXJA 2AN4A 3BGVA 5DX1A 5CIYA 5HIKA 4RTSA 5KQSA 2I62A 1JG1A 3UFBA 3GRUA 4MQ4A 3PB3A 3X0DA 5KVAA 4MHTA 3FPFA 4CKCA 3TR6A 10MHA 3FZGA 5CVJA 2GA9A 4C07A 1BC5A 1JQDA 1H1DA 1DCTA 2ZIGA 4G56A 5E9WA 1QAOA 3G2QA 4EKGA 2OB2A 3PVCA 4HSGA 5GINE 1I4WA 3NMUF 5CD1A 4BLWA 3C6MA 3GXOA 5FHRA 1ZQ9A 1MHTA 2GB4A 2V74B 2BR4A 2O07A 3MAGA 4YV1A 2HNKA 3OU6A 4HTFA 1RJFA 5LQNA 3PT9A 1G8AA 1G60A 5LQCA 1NT2A 1ZG3A 5EZQA 3THRA 5BW4A 2IFTA 3G5LA 3BKXA 1TPYA 2ZCJA 2YTZA 2IGTA 5DM4A 3IHTA 3LKDA 4LWOA 1RI2A 3K6RA 4DZRA 4RSRA 5F2OA 5HZMA 3ME5A 3B3GA 3UA3A 3UWPA 4IKPA 1JG4A 4QPNA 2EG5A 3G2OA 2AOTA 1Q0SA 2P41A 2AOTB 2UYCA 4C06A 2PWYA 2PSSA 4RVDA 2YX1A 1NV9A 2AOUA 4E2XA 2IH2A 2AN3A 5DSXA 3M6VA 3PS9A 2NXJA 2OXTA 2UYHA 3OZRA 1EQAA 2QRVA 2C7PA 3R3HA 1INLA 4ISCA 2DULA 5EPEA 2VDVE 4YV2A 2IDKA 5GP1A 1BHJA 3EVFA 3H2BA 3OPNA 2EFJA 5EC8A 2AZTA 3MCTA 3T7TA 4HGYA 2OZVA 3EGIA 3JWHA 5EOVA 2Q41A 5B1SA 3TQSA 3GO4A 2IP2A 2CMGA 2WA1A 3DMGA 2ZVJA 1YF3A 4QVKA 5CUQA 1Z3CA 2AVNA 4FGZA 4MTLA 1NV8A 1R8YA 3G89A 5LQKA 2B2CA 3EEOA 1QANA 3P9NA 1OR8A 3NW9A 5JR3A 1FJXA 4HGZA 1RI3A 5K0CA 1XXLA 2NP7A 3IYLW 5EVJA 4PNEA 2FK8A 5P8WA 4RVGA 5DXAA 3ID6C 3BKWA 5EMKA 5DRTA 1IM8A 2V7EA 2ERCA 3KR1A 2XYQA 3DLCA 4GUAA 1KPIA 3V97A 5K0EA 2UYQA 3ELYA 3KKZA 4XUDA 5HFJA 3KPJA 2B9EA 3P2IA 2ZZKA 4AZWA 4RTRA 5E1OA 1XDSA 3FYCA 4FS8A 5E8RA 2ZZMA 3QV2A 1RI5A 3CCFA 3G2MA 1D2GA 5DX8A 2C7QA 5FA5A 4V0QA 3CBGA 3GDHA 1JSZA 3FUVA 4OBXA 5FCDA 3TFWA 2PVCA 3HCAA 2PXCA 1L1EA 3M6WA 3M33A 4PONA 4X41A 3RW9A 2O06A 2OB1A 1ZKDA 3ER8A 3FYDA 3DXZA 1XDUA 2OPBA 3BT7A 4RTLA 3FTDA 3P97A 5EHIA 4GOOD 3REOA 2ESRA 1XTPA 2PX5A 3LCVB 3G7UA 5U4XA 4A6DA 5DPMA 1VP9A 3DR5A 5FUBA 1VL5A 5ICCA 5FHQA 1WXWA 3OU2A 3TKYA 1JQ3A 2ZBQA 4HC4A 3ERCA 5GM2A 5CCBA 4PYKA 4P58A 3C3YA 1NW5A 2PWPA 1F38A 5EMLA 3FTFA 5DM0A 2UZ4A 4OA8A 5T64A 3P8ZA 1VQ1A 2NXEA 3B3FA 4GQBA 5FULA 1DL5A 1KXZA 1FBNA 5E2BA 4L7VA 2PX4A 3ANXA 1PRYA 3EGEA 3P2KA 5EHGA 4YUXA 5K09A 5KS2A 1XVAA 3CKKA 3GU3A 1VBFA 4QDJA 2ONZA 3SX0A 3B5IA 3GWZA 1NBIA 4CTKA 3G5TA 2QE6A 4NECA 2QM3A 4DQ0A 2ORED 3TMAA 5BP7A 4EKIA 3EVZA 3VC1A 3TLJA 3EMBA 1KYZA 2PX2A 2ZULA 4PIMA 4DM3A 5GIOE 1EIZA 2FPOA 4UOEA 4DCMA 4U7TB 3SVZA 5LQJA 3UJDA 3TRKA 4IWNA 2NNWB 2AR0A 4RYLA 9MHTA 2IPXA 3A26A 2FK7A 3GIWA 5HIMA 5ICFA 5DT2A 3T7SA 5DXJA 3S68A 2B78A
chains in the Genus database with same CATH superfamily
3EEYA 3KHKA 4HRYA 4I55F 4KGXA 3RTBA 3SM3A 1AXEA 2VQ3A 4ZGWA 1FRNA 4K9KA 1JTFA 2GRJA 1YQ9A 2X7JA 2BBSA 2AFHB 3HY3A 2J6CA 3X1KA 3AL2A 4EYEA 1ZR4A 3HKCA 4YUWA 1TC1A 1V11B 3EIQA 4NU6A 3WIUA 1OUMA 4X1YA 4K3UA 4WY8A 1Z5WA 4A2WA 4NRDA 1LW6E 3JQPA 4RQBA 2RONA 1UP6A 3PX7A 3FDFA 1E7QA 2JASA 4IYRA 1Z82A 2JAWA 4ZVVA 2DERA 5JEEA 3WVNA 3QOWA 1NSFA 4MWTA 2VPWA 3ZZ1A 5EJ9A 3VR5D 4NDAA 2BMVA 4OLJA 1VMEA 3I2FA 3VC3A 2JAPA 4ZEXA 2QRPA 4OVKA 4O1IA 1KU0A 1C9DB 1HQKA 1B74A 1BVRA 1ODKA 1T34A 1Z35A 2CDNA 1DDGA 2FETA 3IMCA 3NLLA 2PH5A 3P9YA 1Z0FA 1GPMA 5J4KA 4NI5A 2FLWA 1YOBA 3U3MA 2DUMA 5CXUA 3BJIC 1X1CA 1KMHA 2Y2VA 3N7AA 4N7JA 2ZW9A 4FYXA 1FPMA 4C0LA 1NG1A 2GJSA 5AJVB 4AY2A 3I30X 1LD3A 4BCBA 2QPOA 5BQFA 1N5KA 2I4NA 2ASEA 1OLSB 1Y1SA 4I6GA 4YAIA 1FTSA 4FYYA 3Q12A 4MUYA 2JHCA 4X85A 2G9VA 2PU5A 2OKCA 4LJLA 3UANA 1GCOA 4LRYA 2A86A 2YRXA 3QUBA 3CX4A 3UB2A 3GMTA 2F3TA 4G5OA 5BSWA 2GEJA 3DTTA 1IVSA 1NF9A 1XTTA 2JATA 1DMSA 1H6DA 4YJFB 5FOUA 4MITA 4H1UA 1ZUWA 1B16A 1IWOA 3C87A 2XXAB 1RQRA 2P62A 3ZVLA 4FSXA 3NHWA 1Q92A 4ZO4A 2WI8A 3GRYA 1GPUA 1XUOA 4AKSA 1PZMA 2R8OA 4C3OB 4YB8A 5IKXA 4M36A 4C3ZA 3D7NA 4E15A 3ZGXA 1R5BA 2HDWA 6ADHA 3TXAA 5AKZA 4MVJA 4H17A 2VYND 1GV0A 3C6KA 3UHOA 4PQGA 1RWVA 1LX7A 1ZICA 1IATA 4PXYA 4RY2A 3REGA 3VX4A 1HTBA 2I0FA 3DZ8A 1I80A 2GLUA 2I29A 3CKLA 1NQXA 2HC9A 1UKCA 3HA5A 3S3TA 2Q2QA 4D9GA 3KK0A 4PHHA 1OWMA 4ARZA 4MB6A 3L77A 3FE2A 3ABOB 2XNDD 5T4EA 5C8VA 1FZQA 4V0MA 5I7HA 1XL0A 2HZ7A 2WAMA 4GVLA 1I2AA 4ND6A 4NMMA 1D4AA 4KR9A 3WL3A 4YPOA 2OESA 1NVVQ 1BSVA 1HLGA 2H2GA 3SYRA 2GJ8A 5F5LA 4MW5A 5K05A 2R47A 4HPWA 3UGJA 1XD2A 2QR2A 2JBHA 3K1ZA 4QDXA 3KT6A 1XDZA 2MSLA 2PRJA 3T3OA 2H4FA 1EH5A 1RRGA 1DIHA 1VJGA 3DOHA 4JQSA 4X6LA 3PYMA 1VL2A 3B2EA 1RJ9B 3AB3A 3KL4A 4P8RA 2CB0A 5DHTA 4M46A 2YZMA 3UNXA 2CWDA 4RIFA 4BEJA 2AG8A 1T5SA 3HCBA 3K0HA 1PW7A 4MJ7A 4QUBA 2NZJA 4Y3UA 7REQB 4INZA 4MVCA 3VHLB 1DLIA 2N1BA 4MPRA 2WSLA 3B6MA 3DAYA 3PPIA 4UAUA 3TOVA 1BVYF 4HWRA 4EF5A 3E05A 4DPLA 1QMPA 4G26A 2XDAA 4LY3A 5E0KB 4REMA 4ZFNA 1UOOA 1IOZA 4HL6A 2PH7A 4TRMA 1QGED 3DTVB 3IMKA 4JASB 1WM1A 4UD6A 3F5QA 1DKPA 2MT9A 1VG9B 1XU9A 2PSFA 1WHTB 3OPYA 1EVQA 4L6CA 1RRKA 3JQBA 1ACMA 2B1IA 3L7IA 3IJEB 2EKDA 2RBKA 3EMVA 3I76A 4ILEA 2C07A 4NYIQ 3TINA 3UMBA 4EG0A 3DWFA 4MDYA 2XUDA 2I6FA 1QIGA 2GUGA 5FYDA 2O0KA 2VZ9A 1E1QA 1XYGA 3FETA 1IHDA 3MTBA 3THXB 2EHDA 4NYMQ 4ASUA 4ES6A 3MQ4A 5F2NA 2XGOA 1AQYA 1G6KA 1GGJA 2IPOA 3T12A 5DNDA 1NVTA 1BCSA 3HXKA 2XGGA 3V33A 3ZHVA 2Y9MB 2X8BA 2QPLA 1ZL2A 4FT4A 1PTJC 1P9OA 4RKRA 1JVSA 4HX5A 1P1BA 2HNAA 3V3TA 3OP1A 2ZTMA 4YALA 4RWZA 3S2FA 3VKUA 4M6WA 2Z3ZA 3OBIA 4LMAA 4PIVA 1NVBA 3PEYA 1NLMA 4BAZA 1TAUA 4OK3A 1C1XA 3GNQA 3OUUA 5F3WB 4UE6A 1HPLA 1DC7A 5LKRA 2F90A 2OZKA 3H5RA 3BXOA 3FWZA 3FROA 3GX1A 4PAGA 1UXHA 3AUTA 2W2NA 3VGPA 3ZLBA 4M8LA 5JCPA 1ZRHA 3EPKA 4OJYA 2FW9A 1NU6A 2NUAA 4I1YA 5FORA 5IP5A 1CLUA 3P0RA 4YRFA 2F9FA 5C7IO 2Y4OA 4DDWA 4MRSA 1JP7A 1QC5B 1VB3A 2B30A 2OC4A 1GTJ1 3FPCA 3INGA 3MF4A 4RM3A 1N4DA 4X8LA 4ZU1X 5K4AA 2UDPA 1ZMOA 3CXUA 3V4VB 2QBYA 4AJ1A 4CFSA 4AO8A 3C85A 4II2A 1K5HA 1XPRA 3BAZA 1SG9A 4C05A 3DZCA 1XTZA 4DMUB 2VHVA 4H1WA 1OH5A 3QVOA 3IV6A 3OG9A 3F7MA 1O4WA 2PPVA 1X7WA 3K2EA 5ALFA 3NVKI 4AF6A 1VLLA 1OTXA 4HMOA 5IDWA 4MR9A 2E4ZA 1B23P 4ZVRA 5DT9A 2XNKA 1KE2A 2AFIB 1D1QA 1G21A 3PNVA 5FBHA 3EA5A 3VNUA 3HU5A 2VNSA 3M5CA 3M6XA 3BB3A 1N5LA 5DBIA 1BWQA 3RKRA 1D2AA 3IDOA 3U26A 3VA7A 1YL6A 1WCYA 4KQ1A 1VYUA 5IM5A 3DF7A 3PX3A 1T35A 3LK7A 1Z06A 1DAHA 5FB3A 1VJ5A 4L57A 4D3FA 5JAOA 3C2QA 3G0CA 4MR7A 1Z6QA 2M6RA 2JIMA 1JWAB 2P0AA 2FVYA 2VNHA 2W4QA 4I4TF 4DIOA 1NT4A 1BOOA 3EOZA 5E1DA 2BFOA 3QTLA 1LH0A 1N25A 5TPWA 2DX7A 4CEIA 5JQGA 4NY1A 2HA6A 1J0CA 3BT7A 4E6EA 3L6EA 3QWAA 5DCLA 4CIBA 1PZHA 3AONB 3ZR4B 1TEZA 4HWSA 2O8FB 3BORA 2O7VA 2VJOA 4I55B 1RRMA 5GAJA 4QTTB 1G8MA 2CHFA 3DH0A 1UKBA 3EUWA 1QGUA 3LQQA 3N5CA 4GPD1 1QQAA 3COZA 3HDJA 1OHHD 5JBIA 2WJHA 2IHNA 5A7HA 2ZRDA 3CG0A 4G8JA 4D79A 1CEYA 1SOUA 3CM0A 3O7WA 2SKCA 3I9FA 1WJGA 3T3HA 3JD0A 1DIBA 1L3IA 5CB4B 4DUGD 4BZZA 2CKDA 5CCXA 2Q99A 4B80A 1VGVA 2IODA 1A5SB 2ZUEA 4MS4B 3EXFB 3QF4A 1GR1A 2X8JA 1GNQA 1TM7E 1UINA 1GSOA 2VH2A 4G5QA 3KQOA 5B3LA 621PA 3CISA 3K0FA 4H0NA 4TMTA 4DDVA 1L8AA 4G85A 4PSAA 1SXJB 4XEHA 1O6FA 2QUZA 1IXKA 3RC1A 5IK2D 2HMYB 4LJRA 2OCKA 2RHWA 1MC1A 2YINC 3DEJA 2QTAA 3FYSA 1ESCA 4IV5A 2X2EA 1X7WB 3A9VA 3Q3EA 2A0FA 4CLRB 3VI3B 4HDSB 1JAXA 1VKNA 4UVGA 3W1EA 5DM60 3HHPA 5JAIA 3D4BA 2QV7A 3LFTA 1E9VA 4NF2A 5FTWA 1WTCA 4DRXB 4YAGA 1VA4A 4L4XA 4EHAA 4IOMA 5SZHB 5FUYA 2WZDA 2ZR9A 1VIVA 4DLSA 4ITRC 2IX3A 3FDJA 3KR2A 3AEYA 1YI1A 3FIJA 1WHSA 4RTNA 1PD0A 3QFFA 4RZ2A 3ZWBA 1P19A 3LWBA 2H1SA 1M2EA 3HYCA 4KVZA 2J9FA 3EZ2A 3QE9Y 3U4DA 5CB8A 4I9HA 3L0SA 5HEKA 3VYVA 1K9VF 2H1HA 1GUFA 3MMNA 4FXOA 1J2JA 1EFTA 4BNTA 4M0EA 3B6ZA 1T1IA 4R54A 4XWTA 1LK7A 2FPMA 3TNJA 4QDKA 3TQFA 3F90A 4ESEA 1TX4B 4Y7CA 5AI0A 3AFHA 2VTBB 3PXAA 1PT8A 3NVMB 1AIPA 1T9DA 2DSNA 2JLZA 2PKEA 3CRRA 2CLKB 3LX4A 2NMVA 4YP7A 3ZKAA 4OCZA 4Q39A 3BX1A 2WLSA 3N58A 1DWPA 1OU4A 1J4AA 2EFEB 2I6XA 2BFEB 2JH9A 4HNAB 1VHWA 1YMVA 3CIFA 4IGIA 1XOIA 3VU0A 4EMUA 3W8RA 5CDYA 3RUAA 5L45A 1A9XA 3LBAA 4YI5A 3OTGA 1E3IA 4XZ3A 5IHXA 4UEOA 3TZBA 1XROA 4DLKA 5BN4B 4ZMSA 3AUXA 1D4ZA 2XMCA 2AHRA 3K1YA 3ZU6A 2E4AA 5TV2A 5AVKA 1M2KA 1Z2NX 1FP4A 2Q7OE 2QN6A 1RPNA 3V2GA 4RTSA 1C9NA 2GEKA 1J9EA 2HSWA 2VT6A 3CLUD 4NBVA 4MHTA 5KWJA 2BHSA 4MUKA 5EIXA 1S4MA 4AO6A 2I8AA 1ACLA 1TOAA 3G2QA 5I9TA 1FA9A 3NMUF 1HQCA 1B0ZA 3GWGA 4XCQA 1BGXT 4LCBA 3E5RA 4ROTA 1N6RA 3L04A 2DECA 2ORVA 4LJ6A 1Z63A 3HJCA 1MF7A 8GPBA 3OMXA 3ZUPA 2JFWA 5EINA 3N8HA 1MXHA 5C7OO 4LVNA 3L82B 1TPYA 2I2BA 3SXUA 3ICOA 1YL5A 4UZSA 5DNCA 4GDFA 3GG2A 1IBSA 4LWOA 1M1NB 1KO4A 3K6RA 2BWJA 5E6SB 5KPDA 4WD3A 3G0GA 2YH2A 3NTOA 2X0JA 2D1SA 4G0VA 1N36B 2OQIA 1EX1A 2WTMA 1NU8A 3DAGA 3LV8A 1Q0SA 2QUIA 4KGZA 4FX5A 1X7YA 1PKEA 2EWVA 4PHCA 3MJSA 4WN9B 2UYCA 2Q0HA 2BUCA 4CE6A 4DEYA 4LY6A 4NCXA 1MB2A 1USVA 4TTAA 4G1VA 4HGRA 5CHYA 4QX6A 1LV8A 2XNSA 1LBEA 2J7PD 4YPFA 1ZHOA 4FZJA 1UKYA 4B09A 2HX1A 3WL5A 4LRUA 3PDWA 1IK4A 4O4LB 1CJCA 4V24A 5FPTA 4YAJA 3UCFA 2F3RA 4CM7A 2P65A 1TRHA 1Q0PA 3GCGA 1J2UA 3AHDA 2XY4A 1ODCA 2VJDA 3PIRA 4UVHA 1WWKA 4MQFA 4AJ9A 4PAMA 4KMSA 3P52A 4XDYA 1PV1A 1TMYA 3WYBA 3DFMA 3OEED 1HFWA 1F6WA 2VWHA 1U1EA 4PQYA 1ZJ5A 3TRJA 4MHOA 1Y80A 3P9NA 5F77A 1CZLA 4ZVUA 1WXDA 4MW7A 2R60A 4H7FA 3AW9A 1M1XB 3DA8A 5F5NA 1EKXA 2O14A 4U7WA 3WJAA 3L1UA 1JIQA 1NUQA 4M1QA 4LDNA 3KR1A 1JAYA 3UKJA 4CN8A 4FB5A 5MGBA 3Q0IA 1U3WA 4YO8A 3CMMA 4KIUA 3NTRA 3TPFA 2HN9A 3BD7A 5IH7A 1LI7A 1IAQA 3G6WA 2YYYA 3FA2A 3P2IA 3KLOA 1KJQA 3EAGA 2ACEA 1RXYA 4RLQA 4CN9A 5C1OA 5AVYA 5KREA 3T35A 3V80A 1WUIS 1Z4JA 2FWMX 4UASA 1PNVA 5AUNB 3TIXB 4B31A 5IT9A 3I6MA 2J3KA 1N32B 5CFLA 1AUXA 2PVCA 3C4JA 3VKFA 2BEWA 3V1MA 3T5GA 3MFQA 2O06A 1RHRA 3P4XA 2A5DA 2WTAA 3RSGA 1LLDA 2VXCA 2YN4A 2YRWA 2JPDA 4JCCA 3B6IA 3GOQA 3P26A 3ZY5A 1EUZA 1S3GA 2W0SA 2GNPA 4RJKA 2K2QB 1A8PA 3G7UA 5ESDA 3PUIA 1U31A 1Q0QA 3NOVA 3OQIA 1JWLA 3RFFA 1T91A 4S1NA 2PS3A 4QELA 4PPYA 4V1CB 1F38A 1C81A 3F7OA 4DL9A 4QZVA 3IEMA 5H82A 4DLZA 2OKGA 2F00A 5FULA 4R0VA 3HNPA 3NIGB 4MAAA 3WGNA 5HJ5A 5E2BA 1CK4A 1AKTA 1PE0A 1DKOA 1JDVA 2OK7A 1E1CA 3P2KA 4BFLA 2B1RA 4ND5A 4JS0A 3DT8A 4ZT2A 4TZKA 1ZJJA 3JD4A 5J40A 3LDAA 1J9ZA 2FN9A 3EMBA 2YN0A 4QAQA 4D4IA 4G0PA 2QVGA 4JX9A 4N3BA 1KYQA 1X1RA 5SICE 3O5AA 3TNFA 2PFSA 3FVWA 2D1TA 1J90A 2NT4A 1GG8A 3WLIA 4DLWA 3EIHA 2W70A 4Q05A 4H35A 1RE1A 2NNWB 1YS7A 3QX7A 1BU5A 5KJ6A 4FYIA 3WK7A 2F4VB 1USUA 1DG9A 2L69A 3ZNOA 1OFVA 2OTCA 2Q45A 3DBVO 2GH1A 2H00A 2IHVA 4JQCA 2MHCA 2X7HA 5CX4A 3PZBA 2Y3IA 1L7XA 4TS3A 1RQ7A 2ZQ5A 5BOVA 3ZE2B 4A92A 5A5DA 5COBA 1HLDA 1LPSA 4ZOLB 4CEHB 1CB0A 3GLFB 1ZHFA 1ISMA 3TH5A 4HVTA 3QEAZ 2FJUA 4ZVTA 3UUGA 2OUKA 3OX2A 3URMA 2Z98A 3D8TA 1JKXA 4IWYA 3ILHA 4TKUB 1CEQA 4I4TA 2XBMA 1S3IA 1MQAA 2EP7A 3MUEA 3OT5A 3QEKA 2C61A 4U5XA 1CUVA 2XKAA 4I9GA 1JEYB 4G0OA 4MV1A 3TBKA 3JTEA 3WDSA 4AKIA 1X3LA 1FLDA 2X3YA 4NNPA 3OQIB 3TTUA 3WK8A 3W6OA 5H9WA 4J7XA 2C59A 1M34A 1NI3A 2FUKA 3C6ZA 2JIOA 1S96A 5GMOA 3NNSA 2TYSB 1P1CA 3ON5A 1DFIA 2B94A 2K5UA 4WOJA 1ENOA 3HHEA 4YV0A 2R1ZA 5HILA 2E0IA 2FWRA 2NSDA 1DT3A 3FPHA 2EZ9A 4FYJA 2ZT6A 3RSHA 2OYCA 1K08A 1A7KA 1HG1A 1G2OA 2ODBA 3OEHA 3N75A 3ESAA 4AI6A 3L1IA 2XF2A 4EA7A 3KTAA 2HF7A 3NWJA 3OJOA 1NXPA 4MQFB 4C43A 1OGJA 3KX2A 3P5SA 5KZMB 5A0TA 1USGA 2PZBA 5C8XA 3HDYA 1AB6A 5D1HA 3EVEA 4EEKA 1WDTA 1XZIA 4AP6A 3KQVA 4Q4JB 4GOND 4FOOA 4QOJA 1P4HA 1AF7A 1U2ZA 2JGMA 2OLJA 4OMCA 4WNAA 4BQIA 5CB4F 2J3DA 2NSHA 2XDYA 3ZU5A 5JISA 1V9LA 4OGLA 1NY6A 2V8BA 1JHQA 4JD5A 5G0SA 3WWOA 4CL0A 2J85A 3KZCA 3DM9B 4D6YA 3KQYA 2BBTA 2E4UA 1JR2A 4BVAA 2W9XA 2CDCA 1FS4A 4NVRA 5A6VA 5L6LB 3FRHA 1Y1PA 4KXMA 2A9RA 4RJ2A 4PZLA 3D6MA 3RS3A 1TAQA 2WHRA 1C9MA 1G3RA 2I71A 1COWD 3LKBA 4KUGA 4Q21A 5DTEA 2X0EA 2PLAA 4HDAA 1AGYA 5KHLB 4NE7A 5JSZB 7YASA 3ZJVA 1AQIA 3KKOA 4XRGA 4H3VA 1TI7A 1UR5A 1V1RA 2DTEA 4L74A 4YCNA 1WCWA 1WUKS 2XVXA 2P9HA 2QRGA 3ORSA 3PEFA 4LBVA 5FADA 3ISTA 4PHFA 3S99A 2AHOA 1AY0A 3BWBA 2APJA 3E2IA 1L5SA 5FV4A 1TK3A 2P90A 3IVGA 4U63A 3MS7A 4TLEA 3TVYA 3AUSA 2HJSA 2XRFA 1O89A 1C9JA 4JJAA 2YOGA 2BMJA 2IU0A 3WX0A 4DLUA 3KQKA 1KY4A 1TT7A 4KPYA 4NPCA 2QIOA 5H5JA 3ITEA 2CXHA 3KB1A 1YCFA 2IU4A 3WL6A 1GUYA 4JJ7A 2P2CA 5D8DA 1PJTA 2FLKA 2WFLB 4G5HA 4YRRA 4MS3B 1WHTA 3D81A 2J3QA 3DO6A 4OQDA 4X1YB 1FFBA 3QX3A 2CWWA 3LO8A 4R5MA 1K8YB 2D5BA 4BMNA 2PS1A 3EYAA 3P0EA 1ZOOA 2W90A 1LF0A 2QJTA 3KQTA 4IJQA 4JL8A 3WRVA 4CLRA 4BB6A 5CA1A 3E9ZA 2BGLA 4MRVA 1GZUA 5KU1A 4H7KA 3PCXA 2X4DA 1YHYA 5KSPA 1FNBA 3VO8A 4Z7NB 1DC3A 2P7HA 4LE0A 5LN1A 4R9RA 1QDLB 1F14A 1Z68A 1DPFA 1Z36A 5G02A 3DBLA 5HKBA 5CB6A 1BE6A 1JXAA 3ENQA 1MABB 2IW3A 3NGLA 1Y3FE 2G0TA 2JLAA 1K4YA 1NMYA 1RWXA 3L4BC 3PICA 3T1TA 5BN4A 2XYGA 1O6BA 5ALIA 2D5IA 1OAKA 2WTBA 2D0IA 4XIFA 3K0BA 1PL0A 4XW2A 3RYIB 4AUEA 4RVOA 1BN7A 2QI9F 3ZXSA 2QXTA 2A7XA 3OPVA 1GM5A 3EPLA 1JHYA 1CXZA 1YNOA 4R9NA 4BU0A 4XXHA 5KJCA 3TO5A 3KZNA 1U9IC 3OE1A 5LMUB 4TKUA 3RS5A 2HSZA 5AO9A 4DANA 4KQIA 2J5KA 1XLWA 2QAIA 3KOYA 2WJZB 4MTCA 5EIOA 2QMQA 2JHFA 4FX2A 5KOJA 5KTSA 2AI2A 3EGDB 1RM0A 4ETWA 1JPJA 4L3WA 2BP7B 2FUCA 3LNTA 1ZCZA 1CY7A 1YQXA 2FMTA 1EUDB 2IPNA 1ZNWA 5B36A 1R2QA 4EUHA 2QX9A 4I50B 3KV1A 3QELB 3LUPA 4KQCA 3VGJA 4TMKA 1EXVA 5IXYA 3VR6H 2D59A 2GN0A 1XMXA 4K1LA 3C7AA 1C7RA 3TE7A 5ALWA 2H1FA 4NATA 1ZZGA 2VPPA 4HQ6A 3VV2A 3ACBA 5K0SA 1KVSA 3IUBA 5C1IA 1UIRA 4OREX 5T4HA 1IAVA 2C5EA 5LL6P 2V0GA 2GBIA 2ANCA 4UQLA 1RBYA 4MV9A 2BW0A 4TKZA 5AM3A 4LF8B 1QHGA 2H65A 1FU4A 2J31A 2W6JD 2RB4A 5HFAA 2PT6A 5EPUA 5GTDA 4YCSA 2WA2A 2JFPA 1YZTA 3QUAA 4Y2GA 1OXMA 3L1HA 4F04A 2V7QD 3UMGA 3BRWD 2JL1A 1PQWA 1UODA 4LZNA 2A1TS 1HFKA 2C42A 1TM3E 4ZPJA 3SE0A 1EUQA 3X2SA 1G5FA 3PQDA 2ZAOA 4TTIA 2VJYA 2HWWA 2WKRA 3MJEA 3K94A 4J0HA 4M38A 5DN6A 2J33A 4ZCLA 4AMUA 4JOCA 1Z6ZA 1YSCA 2ZB2A 4ZICA 4IDEA 4AB1A 4X1OA 3VPCA 3EGOA 2GVNA 3BE8A 1E6UA 1EAMA 1N6PA 4RVUA 2PJDA 4XR4A 4M0UA 2P3QA 1JTVA 3JQ7B 1E18A 3QVMA 1BDJA 3R5JA 3M4XA 4PLHA 1RM5A 4IXDA 3UBMA 1VG1A 2B25A 3FGNA 4JN6B 2EGGA 3VQTA 1DIGA 1HDOA 3CH7A 3PQ8A 1GVNB 3CCCA 3S5JA 1CW2B 3X1YA 3IERA 2G63A 4BFZA 4R2WA 5IJ9A 4TLMB 1A9TA 1CY0A 4FE7A 1JQJC 4HMQA 5AK3A 3WLPA 3ZZ0A 4NZZA 1TZJA 2HQ1A 3HS3A 2Q6TA 3JASB 4DUGA 1EXWA 1LS1A 1M34E 4ZKEA 5JJLA 5DLPA 3KDAA 3E2PA 4I1UA 1R8QA 4L22A 1P0IA 3WMGA 3JXEA 4HJRA 4MVJD 5HX7A 4F85A 4WKGA 2UXBB 4BYMA 1VBKA 2AR7A 3PEEA 5EJ8A 4F4JA 2VBGA 4GYWA 4LRQA 2G70A 2RJOA 4A27A 5AI9A 3TLEA 2XD9A 4BLUA 2Z2YA 4AVYA 1B1CA 1AG9A 1CETA 5EE9A 3W4KA 4XYBA 4Y2JA 2O2CA 5AVWA 5J2UF 1WZ2A 2WUWE 3TZKA 3VOAA 1X7XB 2BTOA 4UFNA 1XVUA 3OE4A 3ANNA 3I2HA 3GHHA 2QJFA 3IQFA 1J7JA 3K0AB 3KKNA 3LZDA 4DMHA 1Y9ZA 2VATA 3AR9A 1M2VB 4HN2A 4C6TA 4OHBA 5DEIA 2YOHA 1P45A 3DHWC 4FT2A 4BLSA 2ZXFA 3ICWA 4FNAA 2I66A 3MPUA 4IDQA 3GN1A 2UAGA 4P6VF 2Y1GA 4E31A 5JNVA 2A1IA 5U1PA 4MUGA 1B6RA 2W00A 1VJ0A 2PJZA 1XZMA 2O48X 3HWX1 4LUCA 1F8YA 2ZBRA 2V03A 3FCOA 1MAVA 3SLGA 2Q3EA 1XXHB 4RPIA 4HZUA 3ZDRA 1QC5A 1SUIA 4Z3OA 2C95A 4NOKA 5FBRB 5ALKA 3TW6A 1HV8A 3C24A 1J33A 2WOOA 5FA6A 3PFNA 2GDJA 3L8HA 1G38A 1QZXA 3O84A 3K7EA 4YREA 4O02B 2IY8A 1EM8B 3A6ZA 3UOAB 1E9EA 1KOFA 2B1GA 3KOXA 2PX8A 3VSBA 2WFZA 4QO8A 2FN4A 3FHJA 3N2EA 3NHPA 3G2JA 3VTAA 3TLMA 3IV9A 5A4JA 1SCUB 1XF9A 2WAAA 5GV8A 5HQ3B 4O2RA 1W7AA 3QPDA 5GM1A 1ZAKA 2FQWA 1B6TA 3FPGA 3UMRA 4AULA 5JALA 1UKZA 2CSUA 2FGKA 4C4XA 1G21B 3I53A 1B41A 1R50A 4OXRA 2C1EA 1FUYB 3GVXA 1CUFA 1VIYA 2CF5A 3ECAA 3H04A 2R66A 3FPBA 3OZ7A 3RPEA 1XD9A 2E6KA 4X71A 5DI3B 1C2TA 1R0YA 1YTUA 1AUVA 1P2UA 3LH5A 2Z09A 4FB4A 4OBEA 4V1CI 3TUZC 4G2TA 3RJZA 1IG3A 2VYVD 5DIFA 1RRPA 3G8DA 3N3AC 3GK3A 4O2LA 2G5CA 1E77A 2DGDA 1M2FA 2OHOA 3HMQA 1P1FA 4P4TA 1XB2A 4R05A 5J5AA 1U28C 3TB4A 4N5DA 3M81A 1U5AA 2YWBA 2RHCA 4QSMA 1E60A 3WNCA 2LWIA 3JQGB 2E9SA 1H9CA 4MEBA 4MWSA 3JZDA 1L7NA 4BKRA 3GJ7A 1JG1A 2OV6A 3K0SA 5DP2A 4X1KA 3A1NA 1RE0A 5AQEA 4MGZR 2G4CA 1GA4A 3HLYA 3OP4A 2HIGA 4V0OA 5TJHA 1M6NA 3BSFA 3AP3A 3JQAD 1FFYA 1KYIA 2PTHA 3ZDXB 3KCNA 4BIIA 2HJWA 1JB1A 2GT1A 3WQBA 4U2GA 2SCUA 2AGVA 4C6RA 1F5NA 3T5DA 3NB0A 4E5VA 3CWZA 4S1VA 2BEKA 3AKCA 4AG6A 1U2RA 1EFKA 3O7MA 4P0PB 1V16A 2VWGA 1XZJA 4KO2S 3A3KA 1KRHA 4ZVQA 1CS4C 3SI7A 3WQHA 1J0BA 1YJ8A 1XMJA 2IGTA 4NV3A 3LKDA 2X23A 1HT1E 4YMIA 1RI2A 4UUBA 2VZ8A 4QPZA 5IKPA 2VRNA 2P41A 4J16A 2WB2A 3I72A 3LT0A 4KRFA 4J2OA 3H42B 1KVTA 1TFUA 2C7VA 1DQRA 3AMVA 4ONEA 5LOVA 1L4LA 3FVVA 3DVSX 1ZCJA 3AR5A 3HA2A 3GAFA 4HNSA 1FFEA 3MJHA 3B1YA 5JVDA 1PYDA 3L0BA 3MZ0A 4R8MA 1XHLA 4ZCPA 2B36A 3GA7A 1CUHA 2NPIA 3L9XA 4GWKA 3RVSA 1T2NA 3VZDA 3FJOA 1A72A 3R9KA 2GJ9A 4G36A 2VP9A 5FO0A 4JSYA 4DRXA 3NC1C 4ETNA 1MJGM 4KR0A 5FOVA 4M8KA 3AO0B 1MAHA 2CVOA 5CP8A 2VK1A 3TFQA 2JZCA 3RWOA 1FTGA 1XVVA 4I8XA 3EGIA 2W2QA 1QH8B 4YHHB 1JIVA 2Q41A 3EQZA 4CLHA 4DXAA 1CY2A 1PKXA 3ZTTA 4ZYXA 4AJOA 4ARIA 4FDUA 2XB2A 5D2CA 3W9SA 5C1DA 1X8LA 5JI2E 4DR1B 1WU7A 3S2SA 1D04A 1OH6A 1EB8A 1TUBA 1W0KA 4NMWA 3G89A 3HBJA 3NT2A 2W6PA 4FMPA 4O2BB 3EB9A 4UBIA 5PNTA 1FMTA 3NATA 3PTLA 4UCXA 4H7IA 1NR7A 4LOIA 1V1JA 1X42A 5BNFA 1HUQA 3OWXA 2CY0A 2D8MA 3MW8A 3PWKA 5P8WA 5H80A 1QIMA 1NBME 2HLHA 5FUVA 3TCKA 3AR2A 4NCKA 2BGRA 5E7JA 5BSHA 2F3PA 5KNLA 3AY7A 3EBPA 4PG6A 3R6WA 2DRIA 1UP4A 2QEQA 5LBIA 3WIOA 3AEKB 4BASA 2E85A 3B1WA 2IY7A 1ADGA 1DHTA 3BREA 2XIQA 3A1CA 3IUYA 2QMOA 3M6MD 2P4HX 4GP7A 4MV4A 3QV2A 4NFLA 5K2MA 3KSBC 2O8VA 1T9CA 1P4RA 4B6FA 1X80B 4RLHA 1O08A 3VNQA 2OO7A 3GPDG 1RHKA 2WABA 1SCKA 2BKAA 3CCBA 3GDHA 4LHVA 4JHXA 1ST3A 1T1EA 4UBOA 4DGSA 4P31A 4QODA 1K0UA 1MD9A 1L8QA 2B34A 4BHTA 3ZGLA 1DB3A 1DXHA 5LYYA 4NEHB 4CFZA 4U2CA 3JQ7A 4AXXA 1E9RA 1CUDA 2A5GA 1QDUA 1QV9A 2X6RA 4XIYA 5SZKB 4F96A 2DU8A 1WXWA 3I45A 3WGTA 4L76A 3ERCA 3HDTA 5C80A 2YHIA 3M2PA 1RXIA 4Q93A 3DPIA 2I7DA 3W7BA 3VDMA 2BTQB 2W93A 3WLKX 1MO6A 4XWOA 2AYZA 4WV3A 1VC2A 3FX2A 1C8LA 2NTYC 3TD9A 1RKQA 2IKSA 1XK7A 1ZY2A 2OHHA 1SEVA 3HCWA 5EHGA 3ANXA 3DD5A 5JH7F 2I65A 3D6JA 4QDJA 2MCFA 3RS0A 3ZI4A 5C1BA 4XUEA 5LLTA 5KSWB 4UBNA 3L8CA 3PGA1 2QMEA 1DAFA 1N9GA 4ZOEA 1N0UA 2ORED 2OOSA 1PK8A 3BIOA 3ZU4A 2R87A 4DQ0A 3EVZA 4KIJA 2YN2A 4KRXA 2JGDA 3NXKA 4KE8A 1AQUA 2BHRA 1N2IA 2BDUA 1JA9A 1FQJA 4KXYA 4WFKA 3K0FB 4W1SA 5CMLA 5LNK6 1MJGA 1UZNA 4CQMB 3TG2A 1SHJA 4C6HA 1SVKA 2GZ1A 5ALUA 1GU7A 3D1JA 4M9QA 3VPSA 1B00A 1L7PA 3Q1KA 4GVPA 5I7WA 3S7TA 3JV7A 4L9SA 5I48A 2QX8A 4L5AA 3VNVA 3CZRA 4DMMA 1MH1A 1U0JA 4F5DA 3ZDCA 2JKVA 3UY4A 1P77A 1C4XA 1RRCA 5FUWA 1SHUX 3PGVA 4Y9UA 3M82A 1ZP6A 1SQGA 1FTNA 1K3UB 4QOEA 1GTL1 2BOVA 1N1DA 4NIMA 3A2KA 4IR7A 3OJLA 1KPHA 1M7HA 3O83A 4YDHB 4W5JA 4IJKA 5FWDA 4XWAA 4CKEB 3R0VA 5BSTA 5KKNB 4LFBB 4M9UA 3TRFA 1Z25A 2ERYA 4L3OA 4K9QA 1YRLA 4NV0A 3GFOA 5JS8A 521PA 2QD5A 1MEJA 2MDTA 2K7FA 2Q62A 3ROTA 4JVNA 1U3TA 1ZBDA 1RXUA 3PD0A 5GVRA 3QELA 3RVQA 1WPGA 3U3KA 1EA5A 1N0WA 2I6GA 3TZ6A 2ZIEA 4KK3A 1OT3A 2C0CA 2V4ZA 2O1WA 2XXJA 2E7ZA 3EXAA 3L0IB 5KWEA 4EBBA 4UVIA 3WBBA 3AKYA 1SQ0A 2C4NA 1AGPA 1Y4ZA 4DIEA 2GAAA 1PZGA 2BVNA 4JR2A 4HRAA 3RYTC 2BONA 3CLSC 3WLHA 3ITDA 3ZQKA 5KJFA 2BGGA 1E2PA 4BX2A 2EQBA 4JEIA 4N0DA 3SHOA 2OFWA 3MLAA 1OLXA 2OHJA 1DUVG 3R7NA 5BQ3A 2RK4A 1Q5PA 4ITVA 2BFAA 4NBRA 5G0UA 4PG5A 4BKOA 1PL8A 3C45A 2YQ4A 5EWLB 1XCJA 2FFHA 3A32A 3E9MA 3GLKA 1XZPA 2HWKA 1EZ4A 1XRPA 2WZQA 4IILA 1WXEA 2CFCA 2ZEJA 2VJKA 4XDGA 4YCJA 4DOMA 5LSAA 3U7QA 3AVOA 1T1SA 1YJCA 1M83A 2VSQA 4UFOA 2PMFA 2WP8J 3N2NA 4R1LA 4D4MA 1RTTA 2H4ZA 2OSVA 2CHQA 3JCZA 1RS0A 2W98A 2P9QA 3HN6A 1RXSA 4Q4LA 1XEWY 1WB6A 2JJMA 4FHGA 5T67A 2YJNA 1C7IA 2YV1A 3RB8A 1W96A 4I4IA 4ZJYA 1JR3A 2HCTA 4ZU6X 1V48A 1PG2A 2FGJA 2IEGA 1JDNA 3A2NA 3ZCXA 2YJ3A 5CK4A 2GRUA 2D2IA 2G9UA 4MWEA 3RT1A 1GSHA 4H59A 5LM3A 4YAOA 5FOQA 1G16A 1JS1X 5ALSA 7REQA 4CMEC 1ZLYA 1BRMA 4EZBA 1JEQB 2QTZA 1H6BA 1HURA 1H93A 2BC9A 2BZ0A 2ZSIA 5COQA 3OAAA 5EEGA 4ZCSA 2QAGA 2W6ID 2DUWA 3DR3A 2RC6A 3VKVA 4EP1A 4HK4A 1YQDA 1AK1A 1DTEA 3A1VA 1MPTA 4GBGA 3UVEA 3VPGA 1EDZA 5DMHA 1W5BA 1ABFA 2BISA 1PNOA 2RARA 3CE6A 1E92A 3COYA 3RYHB 5J4HA 4U02A 1GYPA 1XEAA 4GOJA 1ZFNA 3IIMA 2XMDA 4QKQA 3Q10A 4D99A 2IELA 3ACCA 4QBIA 2ISCA 3K9BA 4QE3A 4BX9A 4TYYA 4LPSA 2VIIA 1WW8A 3D54D 4C2BA 1MABA 1V96A 1L5OA 2PMBA 4YAEA 1OFUX 1V3TA 3E3MA 4L0QA 1JIIA 2VDUE 1T3ZA 3TPZA 2O8BA 2BGMA 3GCDA 4Q4HA 4ISBA 2GCOA 1PFQA 1FX1A 3WMFA 5TB5A 1EI9A 2O9JA 3BDVA 3FOFC 1C8VB 1VSQA 4Y6LA 4Y2YA 1C41A 3DZJA 1ODSA 2W6JA 4HUJA 4U2KA 5HA5A 1TYAE 1QV7A 4HZGA 4LNUB 5CR9A 1TK2A 3NIBA 4DF3A 4NEQA 3PL1A 1XI2A 4UCQA 3WMXA 4CDNA 2XE8A 3MXTA 3NS7A 2BKUA 1T3LA 2PZJA 1BS2A 1M0SA 1LDYA 2BM9A 2GFQA 2ZFUA 3ED5A 4X6XA 1BXGB 4B85A 2P91A 1C29B 4R3NA 5CVUA 4B7AA 2EERA 4EG7A 2IYFA 4KVGA 4GZLA 1E2QA 3ZGYA 1VKHA 2JRLA 3JYLA 2OAEA 5DULA 3RRMA 5BORA 3ZD6A 2CLDX 4F21A 3FCUB 3U3DA 3JQFC 1Q6YA 4YUYA 1TO6A 2WVHA 5LWHA 2VDWB 4PNHA 1MC5A 3OO1A 4E46A 1EFHA 2EJWA 5BOSA 4RORA 2HIHA 5HP4A 1DQNA 3JW8A 4FFVA 3UWSA 2QG4A 1TAHA 3TL3A 4FDLA 1ULBA 3H9GA 4V0KA 3Q40A 2GO1A 2Z2KA 3MS4A 2IC5A 4HDCA 1CJUC 4DBZA 3PFCA 1UT8A 1V5GA 1K2VN 1RWNA 2DT8A 4GMKA 3K5PA 1ABEA 1IG0A 1NJ1A 5B3JA 1VYTA 4EX7A 5JAZA 2FPIA 2ORIA 3IBCA 1MMFB 4CBVA 3CUEF 4H16A 5HQJA 3BD8A 4E5NA 2VG8A 3WGVA 4BNZA 1VCNA 5I4KA 1KC1A 2GFIA 2B4TO 2QRKA 1STOA 2I4TA 2QXUA 1RWKA 1JWBB 4Z1MA 2YRFA 3FB1A 3GHYA 1SH7A 3MLBA 4JBLA 4B3HA 5BMVA 3SKYA 4Y6QA 1XCGB 4WLNA 5BSKA 4GLOA 1E3WA 3GLGE 3N59A 2XZLA 3SIPA 5JZ9A 1T24A 2I78A 1Z4LA 2JFUA 5MHTA 4I9NA 3DZDA 2Z6UA 4GC9A 4G9EA 2XJ4A 2AOWA 2FFQA 2SECE 4ARUA 3OMWA 4P4GA 4UNPA 3ASYA 3H6GA 3HFJA 4BNJA 4WCDA 5LBTA 4XUCA 2OUIA 1J39A 1DBWA 3A7EA 4QU9A 3QHAA 4EW2A 4R68A 5EJ4A 3MCVA 2H3HA 2X1LA 2NO9A 4XSHA 4CF6A 1UJBA 2JFNA 3LL4A 4L2IA 4RENA 2HMUA 4TL7A 1HK7A 3KB8A 3LUCA 5IJ9B 3PR1A 1T4BA 5EVCA 5IUJC 5ILOA 1G1AA 5HUHA 3T41A 2D62A 4JYMA 4WJKB 4XD7A 3D7KA 3EODA 1O94D 3E22A 3AX6A 4EFMA 3AKDA 1ZIDA 2EATA 4PCLA 4WWHA 4B87A 4AIIA 4KO4S 2O8CB 4O3MA 1SAYA 3GUHA 3G23A 2R0QC 5CVDA 1A82A 1MOZA 4FSHA 3MT8A 3DDZX 4RU1A 4U6SA 5BR8B 2HPHA 1BEUB 2Y1KA 3PJFA 3RVPA 3MGGA 4Z4FA 1GCUA 1B4DA 2I55A 5IXJA 3JQ8A 4IINA 3ZY6A 3QXHA 1UT6A 3PYLA 4I1PA 2PZLA 3RBAA 2Q3FA 4E7OA 3UH1A 4JV5B 1DV1A 1SKAA 4FP9A 3IUJA 4MW9A 3DPUA 2EJUA 5EMJA 4QLOA 5K0BA 1X2BA 1ZK4A 3VPFA 4JYPA 4A0RA 2QNRA 3NANA 4RMNA 5CYFA 3B20A 4ZI3A 4ZREA 1K3FA 2HREA 2DVMA 2R6R1 1XU4A 1VCIA 4F9EA 4YDQA 5A3SA 2O59A 1V39A 2H4YA 3AFIA 3AM4A 2WUGA 1L5VA 3QXSA 1XKXA 1L1QA 2DHQA 4Y2HA 2IIQA 3NRBA 2AL7A 1U2PA 3ABZA 3BSSA 3HCEA 1SC3A 2NO6A 4RVNA 4YN3A 2OV1A 2JCXA 2W6IA 4FD3A 3SHTA 4FR0A 5HOEA 1EWKA 2WJIA 4ER0A 3DP7A 5FLYA 1KBZA 4J4TA 5G1PA 1COZA 1F51E 2R85A 3BQMB 3CRZA 3HVIA 5IBRA 2ODEA 2J0UA 2P79A 3B78A 3W5IA 4UFPA 2FPGB 3D6AA 2GBCA 3A9CA 4Z9FA 4DR5B 3DT9A 3HZZA 3O74A 4CYMA 4L15A 4BQRA 4BZWA 5BSVA 2IYEA 4CTJA 3ZWQA 3QKIA 3WZMA 3VH3A 1G5HA 1Y7IA 4MRMA 5DYGA 1NMQA 3JYHA 5T5QA 4GI5A 1TCBA 3O2SB 1XNGA 1XWIA 3FPEA 3IEIA 1T4GA 3VR6D 1WCXA 3AJAA 1C7QA 1KJJA 3D6TB 4EG1A 4MS1A 1PJ2A 5EERA 1HLFA 2MSDB 1REQB 5E6SA 3ZU3A 3M6LA 4D3YA 4Y9DA 1JJIA 2VUTA 4FKBA 4BDTA 4CVNA 1Z7YA 3KTDA 1OXSC 1XELA 3EXEA 3IP3A 4FDTA 4M9XA 1JJAA 4OFZA 3SYLA 3U44B 4DA4A 4KR6A 1MIHA 1CWUA 1Z2EA 4B3MB 2Y68A 1NBMA 4LNUA 4XJSA 3NHSA 3C3MA 3G7NA 1YTLA 2GPAA 3B5EA 3W8FA 3RIEA 5EHNA 4BMYA 3D5EA 2FMIA 5IT5A 3P2YA 3KQMA 3SDSA 2B8TA 1ZVQA 5K6TA 3KQQA 2AF3C 3CIOA 1UAGA 5IWAB 1J1UA 2IOYA 3CPJB 2AQ8A 4YBZA 3RS4A 1MB4A 5F12A 3MC1A 5BRNA 1Y1QA 2RKWA 5HRCA 2WW8A 1UK7A 1M7GA 5JLJA 3Q7EA 2GN8A 3AF4A 4LOAA 1HFEL 1UFQA 4FKMA 2NZUG 3BERA 4TROA 3RDPA 2VK2A 1G8FA 1T3GA 1QOQB 1HRKA 1PGQA 2NV6A 2HBYA 3I1YA 5JYEA 4O4LF 1A1VA 1GPNA 2C5SA 3M1IA 3OIFA 4FMCF 1Q3KA 4GM4A 4C07A 3WKAA 1XZNA 2PCLA 3D4LA 5JJKA 2XCQA 5E9WA 5BV1A 3Q8WA 3D6FA 1T5OA 5BW8A 4GNKA 3AKEA 2RAVA 4DMKA 3H2IA 3CKYA 1RXEA 1IBRA 1OLXB 5AM5A 3KL2A 2E4WA 2JEYA 4IIEA 1YZVA 1NT2A 2CXXA 5CH3A 1WPRA 4FIDA 3THRA 1AN0A 2LPMA 2ZCJA 2I03A 4IAOA 4WZBB 3JVEA 3VZBA 1U3CA 3IBFA 2VQSA 4DZRA 3ETJA 3UA3A 3KALA 5TR9A 2MYUA 4A2CA 3OCYA 1SD1A 4I3FA 5EIBD 2F9LA 4OD0A 4EGQA 1EDOA 1CVIA 4PBSA 1SFRA 5SYMA 1QV6A 3TLAA 5CH5A 5HTOA 1NATA 2YZKA 3NT4A 2AN3A 1JIXA 1E4YA 1YQQA 4UMEA 2OXTA 2J67A 3RO7A 2OBXA 5BSGA 2QTBA 3GCWA 2C7PA 3R3HA 4ISCA 4BQFA 2VDOB 4NAUA 5HWSA 4HNHA 5G4KB 3OOHA 5F98A 4G0XA 3T7TA 1V25A 2FW0A 4DC9A 4U8HA 5F7JA 1ZD3A 1UK6A 2GAIA 1XRMA 3LKVA 3MPOA 5EZYB 1WSWA 2J5XA 1U8FO 4F5EA 4WLEA 3LPDA 2XE4A 3Q7RA 5D3ZA 2ZRPA 3JQ9A 4O2AB 2C4UA 5EXTA 1R5OA 3G9QA 3RBZA 2MOKA 1U8CB 4IO1A 4MTLA 5FNVF 3OTIA 4KN9S 1NV8A 1FTYA 2W58A 1RQLA 3K70B 1N3IA 1IQUA 1FFAA 2VPXA 1VCOA 1UADA 3ER6A 2CDAA 3ETHA 3GJXC 4WAUA 3C15C 1LTHR 3V7YA 4WTOA 4WLUA 2DBYA 2RGBA 3GNSA 3DHYA 3L9WA 1ZYUA 4HB0A 4XUDA 2OPHA 2ZZKA 1QTRA 3AI2A 2GD6A 5AW9A 4A6XA 5IF3A 1KWKA 1QRRA 3DMTC 2RJ3A 1QZTA 1Y5LA 4JI8B 1SWWA 1G5IA 4DEXA 4MV0A 3TDKA 5HNKA 1G3IA 4QJ5A 3OEHD 2JFFA 3EMKA 4EPYA 3RSFA 2FF7A 3CRW1 4LE1A 2ZIZA 4UD2A 1TQ4A 1T5BA 1ZEMA 2E4YA 2IZ6A 1U90A 3A6FA 4HB2A 2IZOA 3FAZA 1YU6A 5TXGA 2PRIA 2OB1A 3IHWA 1JDTA 3ZPXA 3N6XA 2OPBA 4C4RA 3IT3A 1VYVA 4YRLA 3SZUA 2CT8A 1G5QA 3AW8A 3RAPR 4DSOA 1RLMA 1LU9A 3PGMA 4XVCA 2OECA 1OT5A 1I2ZA 1SCNE 3GD7A 3OO0A 3ZK8A 3B3QA 4UHEA 1ORWA 2BFBA 2ZIAA 4QC2A 1D1SA 5THQA 5CCBA 2V0NA 2X9VA 3W06A 1NW5A 4ZTZB 1X0VA 1MIOB 5KVQA 1J5PA 4LW8A 1M73E 2PGAA 2J30A 4G1UC 4KWIA 5TE9A 4CQMA 3ZE9A 1G5TA 2V7UA 2WWFA 1Z47A 1XLTA 4L7VA 2B82A 3CF0A 5DHUA 1PRYA 3RVRA 3ZGZA 4MRNA 2EAUA 5FOSA 3ZWYA 1H22A 2B61A 2NVUA 1LPPA 2ZUUA 2WSSA 1NBIA 1NQOA 1DOAA 2MSKA 1A76A 2QVYX 4GPEA 4PZCA 1OIVA 4J91A 5DCUA 2WFAA 5IT4A 1TT5A 2E82A 3IV7A 3VC1A 1WEHA 3ETLA 1V7QA 1ATIA 1C50A 2YS6A 1TECE 2FEMA 3IPLA 3MTQA 4XCVA 1GKYA 2IEDA 2CDRA 2G6BA 2LV8A 2OL4A 4UHKA 3A6PC 3LXUX 5LP6C 1UUFA 3IESA 3LIPA 5KVSA 1HG0A 1ZUD1 4J6FA 5JS1A 3IIJA 1CZOA 1DAIA 1XQ6A 3FYTA 4V0NA 1SU8A 1Z4NA 4W99A 5CVCA 2PQ2A 4BEVA 2DSTA 2PZKA 2O1SA 2YVKA 4V3CA 1XQYA 4PSCA 3U49A 3ZIDA 3ZCSA 2AZXA 4O1HA 4F6LA 2YL2A 1K06A 1E5TA 3LUAA 3IPYA 3EGXB 5MN6A 5EA2A 2EJTA 2NUTA 2WILA 4EY3A 4JUIA 3VHXA 1XHEA 3GNLA 3LXRA 1J21A 3MCZA 1G9TA 1K88A 1L7EA 2XRZA 3PQCA 3VYRB 4J9VA 1D0SA 3SF8B 3TQTA 2E5WA 2E1RA 5F1PA 3OSZA 3KUKA 3HTXA 3A37A 2XUAA 1SULA 1EFRA 1UZAA 2R25B 3SJUA 4DJTA 5H7XA 4BRSA 4C76A 3FUTA 1E79A 3MXOA 4Q1EA 4N1AA 3GJTA 5KTPA 5I4BA 3OQNA 3H9QA 3FLBA 3HU2A 3HP7A 2YMQA 3K0CA 4GQAA 2VHEA 3B70A 3W8NA 2O05A 2GZSA 3OFKA 5EP4A 2DFPA 4Q3CA 4GAEA 2JFZA 3CVOA 1I6KA 3H11B 3Q8KA 2H9IA 2DQYA 2Q9BA 1K6XA 3ORHA 3T7RA 1QVAA 1DUSA 5FQOA 1LEHA 5L95A 3L8DA 5GWXA 2XZTA 2E89A 2PGXA 2EJBA 1R88A 3LOUA 2R5FA 4ZEVA 1E2MA 2JH8A 3E7FA 2YHUA 1CC1S 3D7SA 4ER3A 4OQEA 1FY2A 3FCSB 4G65A 5IH3A 1L1FA 2R1TB 4RDXA 9LDTA 4OI4A 3C6XA 1QS0A 4AKGA 1JHMA 2I7VA 3EASA 1PJBA 1K89A 2EYUA 3HO8A 4OATA 2QNIA 2BTQA 4TSFA 4V0LA 1Y8AA 1QP4A 4TWIA 5WRFA 4OA5A 2BZGA 2Q2VA 2GZHA 1C80A 3AUKA 5C3UA 4OFBA 1E2EA 4PPNA 4WVLA 1S1MA 1ZW6A 5T41A 3DKIA 1GNLA 5HSGA 1BXZA 2X77A 1IN8A 5BQPA 1HOTA 1PUIA 1Y9EA 1EE1A 5JAUA 4XJVA 1KTVA 1B42A 4IIJB 5T6MA 3MSXA 2CZCA 5C8DA 3TZCA 1A77A 1I2DA 1V47A 1VZ2A 4L9WA 3UFXB 5CDSA 3SZRA 3GGOA 4D4JA 2PE5A 2J7PA 3CWCA 5A9RA 5BPHA 4LI0A 4Q01A 2Z43A 1SQFA 4ZRMA 3RD5A 1U81A 2LIVA 2J3IA 3C39A 3W2FA 4EYQA 2VDWA 2VTDA 1M66A 2FFBA 2OV2A 3WYEA 4OUDA 1Q14A 2HHCA 3DFUA 3AFGA 4PZEA 4E32A 5HJ7A 4AJLA 1SU4A 2BKLA 3AEKA 1OC2A 5B64A 3R23A 1JYFA 3AF3A 2XYRA 4RXTA 4MGKR 2P5YA 1E79D 2C2MA 4G37A 3RUPA 6ABPA 1PJLA 2CN1A 3EDQA 2C7GA 3AP2A 3ED1A 1EFRD 8ADHA 4BVJA 4IV0A 4KO3S 5AXCA 2DLCX 2VP3A 3PQ4A 2O2JA 4MQUA 5AW4A 4UUMA 3QNMA 3QMVA 2ACVA 2OHIA 4AF8A 1KFCB 3UC5A 2WG1A 5KAPA 1XAHA 1S2OA 4OH1A 1O97D 2P9GA 3SYTA 3WFJA 1E2NA 4LPKA 1MXFA 2Q49A 2ZYDA 3N7UA 2Y2UA 3U7HB 5DI3A 5AJTA 4MUHA 1TA0A 2IYRA 4E08A 3NBKA 5FNZA 4XTRA 1VKZA 2Y0EA 5EZ5A 5IPFA 1SD2A 1QFMA 1K8XB 3DVQX 3AIKA 2K87A 2QZZA 5JS6A 1NNI1 2VTEA 4LN1A 1NXXA 2Q1XA 4LVUA 3WRYA 4K6FA 3KHUA 1EPUA 3RKSA 2OXEA 1MC8A 2DBZA 4HOYA 2BTEA 1BFKA 4MQLA 3T7AA 4W5OA 2ZJOA 4IKEA 4OAPA 2VOJA 3Q7SA 2BE9A 1YZGA 4EYOA 3S2IA 3TNDA 4OU5A 2MR5A 1KMIY 3H83A 4J0CA 1AKYA 4RH3A 2WAYA 1AH2A 5DBHX 3DZIA 4JHLA 3SZLA 1JEYA 1E1RD 1K7XB 3JYPA 3NASA 4LDRA 2FMXA 4JLWA 2WD7A 4RCVA 2A7QA 4CU2A 4MUNA 1Z74A 3MM4A 4K7JA 5AVZA 1Z0DA 2QPTA 3CMCO 3O82A 2IITA 3FGPA 4J3JA 1M1UA 3B6JA 4PLPA 5C2JB 2DQ4A 2OC9A 2H7VA 5AJWA 4PX3A 3RRNA 4YXWD 5THKA 2QTNA 3LLUA 5G3ZA 5H3CA 5CDGA 4JJ4A 1JIJA 1NF8A 2X4GA 3I4CA 2O0LA 1Y9AA 3G49A 4FTWA 3TSYA 1CNMA 3BSWA 1ZMTA 4C21A 4Q24A 2K2WA 3OEWA 4UE2A 1U0SY 2HA7A 4X3OA 3NHFA 4QGFA 3M1YA 3ZU2A 2CLSA 1XCLA 3V32A 4S05A 1UBKS 1UPAA 1L5NA 3R76A 4BFVA 3KR9A 4H1VA 4L4SA 2GZMA 4U5QA 4ON9A 2HJVA 1Q7RA 1SPBS 2JGLA 1R0RE 2ATVA 1SBYA 2GTIA 4V03A 1FZTA 5L3ZA 2H1RA 3AVWA 2XOXA 3GEEA 2ZAMA 3CZAA 5HBRA 5EESA 2NUTB 4DSNA 2JGDB 2YHAA 5BR7A 3WWEA 1NJ6A 3GGDA 4PQRA 2W2MA 2XYPA 2X0DA 5HW0A 1XP5A 3I32A 1ZGBA 2F8MA 4W5RA 3HFGA 3BZUA 4R40A 4KAAA 1T2CA 2G83A 4U9UA 1AHHA 1KAOA 1MH9A 1Z2DA 2BAGA 3QPBA 3LI2A 3AB7A 3K3PA 4OUKX 1G2QA 2F64A 3AHEA 1WDKA 3M6UA 5GZ6A 4LAFA 5IK2A 4QTYA 5JTTA 4B40A 4AFNA 4QTZA 4QUJA 3KD2A 1OBOA 1YC5A 3QFCA 1R16A 3TEMA 3OPQA 3KKMA 4DIFA 3C3PA 5BT9A 1KGDA 3HN7A 5DLEA 3HYNA 5IDXA 4RKYA 1K75A 4C6SA 2LNDA 1NDHA 3QG5A 4DVGA 1VL6A 4MROA 3X43A 3B1XA 5TEWA 4MR7B 4X63A 5CAEA 3KP1A 1ULZA 1J24A 2CLHB 5ITZA 2AH5A 3A6HA 2XT6A 3JTMA 2QUHA 3PUKA 1ZXBA 3TVTA 1FP1D 4A8PA 4X3CA 4R2IA 1YZHA 3IR6A 3X1ZA 2V7BA 3EQ9A 1EGQA 4RELA 2Q3HA 3ONFA 1V4VA 5AP9A 1TCCA 3WA6A 1YZ3A 3ZW9A 3BFPA 3VDNB 4RL4A 4QBKA 3TZLA 3GQBB 4OHYA 2EBHX 3UHPA 1YBHA 2DJ5A 3LDHA 2J9XB 3PGXA 4LG1A 4NPHA 3UA4A 3DEFA 4QUDA 1E4VA 2AD1A 4QQKA 4CM9A 2ID9A 1XFAA 1DBPA 1LNSA 2VYNA 3KJEA 1DT5A 4HPXB 5DBEX 3ABIA 1FEZA 4EA8A 1ANKA 3ROFA 1M6YA 3F6SA 3GDFA 4FI3F 1X39A 4PGHA 4CPDA 1ES9A 3WGIA 2GYVA 2WPNA 3JAMA 3ZVNA 1CE8B 2MTBA 1FFXA 3ORQA 4BTEA 1SCQA 4ZK2A 1G17A 2VWQA 1CP3A 1E0SA 3D8HA 1IBMB 2ZUCA 1N4AA 1WV0A 4ESOA 5G0VA 3WGGA 1Z2PX 1QTQA 4DB2A 1EDBA 4WL0A 1S4QA 4HYQA 4C7OA 2HPZA 2WJVA 4QOFA 1DG3A 2FX5A 3BXHA 2CXPA 4TTSA 4YAUA 4XJTA 5JTUA 3HRIA 1CUGA 4L8YA 4PEVA 4D3XA 1GAEO 1P7CA 2VOEA 4F86A 1RWOA 1RKBA 2CXSA 2TS1A 3U5ZB 2JLSA 3JATA 2RKOA 2BH2A 5C8YA 3CUTA 3TNLA 1L4BA 2CXOA 3FYUC 1ML3A 4IJVA 4LV8B 4IW3B 2DAPA 2GPJA 4MV5A 4OHVA 4B34A 1TF2A 1XRNA 2VYCA 3FMVA 1PSWA 1QG4A 2RHMA 3WYGA 2BKEA 2HR1A 4OSOA 2CXQA 3BD9A 1E1DA 1LSUA 1M2NA 5EQJB 4C0HA 1X9GA 4R6WA 1DKNA 3L41A 4JP5A 3RTAA 1PBNA 3DG9A 1KZ7B 2ZCUA 1XMSA 3H5OA 2QJOA 1PZFA 1WCV1 1IHXA 1JXMA 2R2GA 2V9PA 3WV5A 5KU7A 5K2OA 1LVHA 4KWEA 4BB9A 2PGLA 2X40A 2YJTD 4M89A 4R01A 4UHFA 4TMWA 4OP3A 4KLCA 5CIQA 3R4VA 4L3VA 4O5OA 1PR9A 3RHFA 1SQ5A 2F67A 1G21E 2H2AA 2XT0A 1X1TA 4B6EA 4DWOA 4AC9A 4F12A 2WVGA 1JKJA 1R10A 1I0IA 3E4CA 4BNFA 3CR3C 3PNKA 3T7DA 5DYTA 4B1FA 4Z0HO 5KX5F 2DYKA 1JDUA 3F7TA 1XZHA 3I01M 3K8ZA 2JIZD 4V2IA 3I9V1 3PBKA 4GECA 4ZYYA 3A4TA 2VPYA 3OUTA 1TB4A 3O2JA 1T8UA 2QE7D 2FUG1 3FKSA 4R1MA 1ZK2A 4U6QA 2LE0A 4IMIB 1YZKA 1B2RA 2AK2A 3Q3GE 3BGVA 3GA5A 4LHEA 2WFLA 4OYRA 4AZ0A 3V48A 3P0IA 4EATA 4GP6A 5DGCA 5FLEX 2GTPA 1X8KA 3AI7A 2YCBA 3TMYA 1JQDA 2ZRLA 3H9JA 4J1TC 1BZYA 1T5TA 2ZIGA 2GK7A 2HDHA 2FSPA 3NOQA 4EKGA 4HSGA 5DOVA 5EJ7A 2Z2IA 2RIPA 3MBOA 3LNCA 4TV9A 1EX7A 3RIYA 2WM8A 3K31A 1T5LA 4G5RA 4ND3A 4RD3A 1TZCA 3PWSA 1ZQ9A 3I12A 4UZEA 3SG0A 3IDAA 3LYHA 2HNKA 4HTFA 1E0DA 3ZZNA 4Q34A 4CQLB 5JD5A 1BO6A 4YCDA 2PZFA 3F6RA 5LQCA 3NM4A 3X1JA 1RHUA 1CUXA 1B3RA 1ISFA 1TVKB 3FYUA 3IUPA 3QA3E 4ENTA 4N82A 1KDRA 4FS3A 3S8YA 2Z58A 2BGWA 1TEHA 1T0BA 2OGSA 3BRSA 2GXAA 1JBKA 2M32A 3VVCA 1O0CA 5JCJA 2EJCA 1U2GC 4DDKA 3S7ZA 5E3JA 3UOGA 1F5SA 1SC4A 4Z54A 1Z2AA 2YZGA 5ALRA 4ZC1A 3GB9A 1QG6A 1TJ5A 5DSXA 2NAFA 2HCRA 16PKA 2IHJA 3T06B 3JQFA 1PS9A 1IEXA 1QHSA 5HIAA 1UBGA 1JKJB 2XXBA 4Q7QA 2FPGA 2COUA 2VDVE 3HJBA 4JUBA 4XAQA 1B14A 1H94A 3H17A 1YJ5A 2HADA 2XCOA 1OYYA 3LBHA 2FSSA 4OQFA 5J2TF 5JO9A 4HGYA 1GKUB 2XUKA 1P0MA 1QG0A 1BD3A 2C4KA 4B73A 3S2ZA 1TCUA 3I1FA 2Q1YA 1M74A 3B38A 1UJ2A 3EAQA 2GAOA 2ZVJA 5HM6A 3FDZB 4W5TA 4WT7A 5CUQA 1EE9A 2GZAA 2BBOA 2WINI 3G0BA 5EMNA 4C6TB 4NSNA 2VTKA 3JWEA 3EEOA 3NM5A 1P9WA 4ZEWA 1JL3A 2WMOB 3QYAA 4A15A 5ES3A 2MU1A 3E9RA 3R40A 1M1YE 1FLAA 4PNEA 2ADOA 4XD7D 4CM1A 4RVGA 1D6JA 5B2FA 1F6BA 4UM7A 2C8LA 3Q9NA 2FEWB 4MUAA 4OEHA 1Q57A 2JAUA 3F8TA 5DRTA 4BP9A 6LDHA 2WRZA 2XYQA 4KQFA 3H0EA 4LJ8A 4YRCA 1I7SB 3FSRA 3CO5A 1S9HA 4RSMA 4AZWA 1SIUA 4FJ2A 2II6A 3U3ZA 4WKPA 4ZN6A 1MOSA 4FFRA 1GAXA 1V41E 2VDMB 2R8EA 2BL4A 3CH5A 4FCVA 3OTOB 2ZZMA 4LA4A 4N48A 1J8QA 4JA2A 4RULA 1DBRA 1XTKA 2BFPA 4DR3B 5M34A 3I9V6 2FRVA 1Z5NA 2WUEA 4MYTA 2H06A 3DDCA 2B20A 3FUVA 4HFMA 4QYWA 1Q21A 4TMXA 3RU2A 1XMIA 3M33A 4XPIB 3VZPA 2IHKA 4GVXA 4MGEA 4HVCA 1XNQB 5FEMA 1MX5A 2ZWPA 3CUSA 3DL7A 4LX0A 3AUUA 4D3ZA 4II7A 1UMBA 1V5EA 2ZRGA 4TMFA 3REQB 1FDVA 1ZUIA 1UBCA 1Y3CE 2XTAA 2PX5A 1RABA 3KC2A 5AW6A 1XXHE 4TYNA 4XASA 2R4UA 3CLHA 3PPYA 5FUBA 1NP6A 3C74A 4LDQA 2XKKA 9ATCA 4UBLA 5FWNA 4EAAA 5LP6A 2FPKA 4BFTA 1ZVJA 4CMBA 2J41A 3O8RA 3WIEA 4HMPA 1Y8ZA 1P8AA 3P9SA 2DP4E 4EL5A 3ETCA 5A04A 2YUTA 5T64A 1NFRA 1X9HA 1K9SA 4C20A 3MGCA 4CV1A 5K3FA 3P2MA 2HRRA 1YACA 4CQJA 2HT6A 4YCAA 1NUPA 4INPA 4BPBA 3UJNA 3L1JA 3HKCB 3O0TA 3NBUA 3I8SA 5CFRA 1GAQA 1TGVA 1PWXA 3VMFA 2I87A 1S0UA 2IX9A 3A6JA 3KNZA 4XTCS 3G1UA 4B3BA 3GJZA 4FGJA 3SNKA 3WZLA 2GXQA 2NYRA 4M53A 3SHFA 5IAOA 1E2GA 2AI3A 4NHOA 1YB4A 2DHDA 1L4NA 5J23A 2OFXA 4NABA 5BV2P 1U1FA 4IUCS 2QDXA 3FDXA 1SB8A 2V6GA 4DM3A 1LC0A 4LF6B 5A9TA 4HAUA 4Q6WA 1I0ZA 4COKA 3Q5GA 5A4MS 3SVLA 1P0PA 2AMVA 4TPKA 3ABQB 2Y1EA 4IJUA 4KRYA 4Q3NA 5ABPA 3DDHA 4Y2VA 3CYFA 3ZI0A 4AY6A 4NWIA 1XA0A 2I76A 1KS9A 2WV9A 1K4KA 2QU8A 5DSZA 1F6DA 5I01A 4B71A 1JU9A 4EHBA 2OVFA 3AG5A 4K0RA 3SD7A 3ZE1B 5EZYA 2ZIVB 3A9WA 5FUMA 1G7SA 2IVFA 4WNCA 1TO2E 3KS9A 2PV7A 1SU6A 2ZRNA 3OH8A 4H1HA 3V2HA 1W0JA 4R3WA 3I9LA 1R3UA 5EUBA 3VAYA 1UKAA 1TLLA 3WGUA 2DF8A 4ZKDA 1H4VB 3NAQA 1FRFS 2Q2WA 3B51X 4MYSA 1XDWA 3LVFO 5JVDB 3AOGA 5AJYA 5EXEA 2FLVA 2GPSA 1BCSB 4P92A 2O5EA 1KZYC 1SMKA 2PSEA 2QIPA 2DFDA 1XDDA 3K0CC 3NJ8A 3IR7A 3TJRA 2P1DA 1V8DA 2QRQA 1SCJA 3BQ9A 3GVIA 5FF9A 2W7TA 3ZWDA 4U8GA 1NJSA 2RAFA 3ISVA 4GMGA 4KDFA 5JC8A 2YHBA 2R8ZA 2UZIR 4OXXA 1B8UA 3LY5A 4OX9B 1XZDA 1L5HA 4ABTA 1SM4A 1YFJA 4CCAA 4M1EA 1LA2A 1Q0HA 2ON6A 4G1FA 2CGEA 1FVOA 1XZGA 3TIVA 1T9GS 2UZAA 4HTFB 5LQSA 1HT2E 1DOZA 2B4YA 2INGX 1KR2A 1FPQA 3ET5A 3QKUA 4R2XA 1Y8CA 3LIIA 3WMWA 3HA7A 2BGIA 2VUSA 2YXBA 4J7AA 3UXEA 1P17A 2ZB3A 4KPUB 1OFHA 1VZ3A 5EE3A 3UAZA 1X7ZA 2B4RO 4KIGA 721PA 3DEHA 1J8DA 1W93A 3OY2A 4H77A 3TZHA 1JG6A 4RGYA 3D8SA 3ESYA 2CVPA 4MAFA 4KX5A 4R1OA 5DASA 2HSJA 1IY9A 1RAFA 3I3OA 3NIDB 4RK1A 2D3TA 1IIRA 4J7CA 4LMRA 3N86A 3BHMA 4XD2A 2DR3A 3DE1X 3RC2A 2R6FA 4LK2A 3LPMA 1AV7A 3WE7A 3LSTA 4OHKA 4OQNA 1DAMA 1G55A 3H9CA 5LZ9A 1GUAA 4Q4AA 4DJDC 1A2QA 2X13A 3JYNA 4XB2A 3R6GA 1V9SA 4KQ2A 4WZBA 4B0PA 3VYWA 4D0NA 5AJZA 2ZUDA 3LPNA 3OFVA 4CIDA 4LISA 1CU1A 4TQAA 1IXRC 1F4VA 1KC3A 3I8OA 3KJGA 4PC7A 1KZ1A 1HDEA 5JAMA 3GI1A 2FE4A 4EVSA 1VOTA 1T2AA 4IDAA 3OZIA 5CA0F 2X15A 5JARA 4MCJA 2R00A 4G4JA 4PTYA 2GN2A 4F3CA 3KQUA 3QBJA 4WGGA 1L6RA 1O8BA 3PTZA 4NENA 4X1IB 3WKCA 4GEKA 1AV6A 1L7BA 3HGMA 3IQZA 2HAEA 3WLEA 1CUBA 4A0FA 2OA0A 5BN5A 3QFSA 1Y48E 4C1BA 2E21A 1J9GA 2YQ5A 3UJ9A 4J90A 2Q9CA 5I3ZA 4ZV4A 1AT1A 2OY0A 1XN1A 2EDAA 3EVBA 4XPZA 4X65B 4O2BA 4KNWA 2GILA 3UYLA 4DHEA 4WJLA 1YCGA 3O8LA 2VP2A 4A1OA 3ZK7A 1D5CA 3C5HA 6REQB 4US0R 1M1YA 3HM2A 1SOWA 3EMDA 1C1HA 2Y05A 3E6AA 1P39A 4G41A 2NWQA 4KFUA 2WWYA 2JCVA 4YXFA 4EK9A 1NJ8A 5JH7A 1A2BA 3IQXA 3G79A 4KQEA 1BTOA 4CETA 4O8ZA 2Q1UA 3NYIA 4TUYA 3LQYA 3FLMA 3V7WA 5IG2A 5GV7A 4R8RA 2Z5GA 2J6HA 1S8FA 2OMKA 5ENDA 3GLVA 1U28A 4YUVA 2AG6A 2IV3A 1Q15A 4CG2A 3SK0A 3WSWA 5BNWA 5JQWA 4L5CA 3GRRA 5IVDA 1PDWA 5M2QA 5HYVA 3UCXA 4OSEA 5FR2A 1A7AA 1OBCA 4EGSA 1ZK0A 1QF9A 2IOFK 1W5TA 2QENA 4IVPA 4QTUB 4Q7LA 1ZIXA 4ND2A 1NMEA 2HU2A 3DJYA 1LKZA 3MGBA 4IQGA 5FBQB 3TW4A 4BV3A 1NURA 4HAXA 2Q1WA 1YRWA 3SXPA 4DB4A 5I8ZA 5JNUA 1DQZA 1BEEA 4MRRA 3ORFA 3M9LA 3ZQUA 2QXYA 3PF9A 1SBTA 2EKLA 1T4DA 4IO0A 5DV9A 4YMHA 2IWHA 4JXKA 1XRJA 2EGUA 3B13B 4JGBA 3THWB 1RYZA 2PR7A 2WE8A 2AFHA 1EDEA 3IOBA 2QRHA 3JWGA 2IHZA 5LOVF 4MK4A 4R8VA 4GNRA 4ZHQA 5CFZA 2ZBGA 4FW9A 5LUBA 4EY5A 2O8EB 5JD3A 1LJ8A 4LSMA 3H8JA 3OFJA 2PR2A 2AZMA 2VHWA 1JQKA 3DBIA 3GQVA 3TGLA 3A9TA 1YQUA 2WNHA