3MERA

Crystal structure of the methyltransferase slr1183 from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr145
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
173
Chain Sequence
b'EPNDFLVSVANQIPQGKILCLAEGEGRNACFLASLGYEVTAVDQSSVGLAKAKQLAQEKGVKITTVQSNLADFDIVADAWEGIVSIFCHLPSSLRQQLYPKVYQGLKPGGVFILEGFAPEQLQYNTGGPKDLDLLPKLETLQSELPSLNWLIANNLERNKAALIQLLGQKLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Slr1183 protein
publication title Northeast Structural Genomics Consortium Target SgR145
rcsb
source organism Synechocystis sp.
molecule tags Structural genomics, unknown function
total genus 47
structure length 173
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3merA00
2NXEA 2QYOA 3FUTA 1BHJA 4X41A 5FQOA 4FT2A 4HTFB 3P9NA 3MTIA 2QE6A 2NYUA 3V97A 1HNNA 1RJFA 3REOA 2B2CA 1L3IA 2GS9A 4OX9Y 3V8VA 3THRA 1R8XA 5EHIA 3UJDA 3F4KA 1VBFA 2EG5A 3G8BA 2WA1A 4DQ0A 1WG8A 3G2PA 3BKXA 1JQ3A 3ME5A 4FT4A 1U2ZA 3A26A 1BKYA 2ONZA 4RTSA 4HH4A 3LCCA 3GRVA 3KQVA 4P7JA 2ESRA 1JG3A 2FHPA 4U7PB 5GWXA 3UZUA 5H02A 5FHQA 2IFTA 1UWVA 4CKCA 1WZNA 5K01A 5MHTA 1H1DA 2O05A 4ATNA 5BW4A 1TPYA 2ZWVA 5EMLA 4FSXA 1RJDA 4CXMA 2JJQA 5HEKA 3UBTA 4EMSA 2AN4A 2A14A 4PCLA 3HNRA 4EKGA 3OU6A 3QOWA 5GIPE 4AZVA 2OBFA 4GBED 4RX1A 5GOZA 5LSAA 1EJ0A 4BP3A 3PFHA 5LQAA 2PLWA 1BOOA 3OZRA 2PY6A 4GUAA 4R8RA 4XUDA 4RTKA 5K0FA 4RSRA 2Y1XA 1QANA 4L7VA 2UYCA 1NV9A 2NXJA 3D2LA 5EOVA 4OQDA 3RW9A 1L9KA 2YXDA 3FPFA 2IH2A 2PX4A 2VDUE 4ER7A 2AZTA 5K0EA 4DMGA 2AOTA 3VC1A 1N7IA 1YF3A 2BR4A 3PVCA 3WSTA 4E2YA 9MHTA 2UYOA 1JG1A 2HMYB 3EGEA 3PFGA 1JR4A 4QTUB 1YB2A 5B1SA 1EJ6A 5K09A 5K0GA 4YUXA 5EKXA 3U81A 3OPNA 3DULA 2GB4A 5EMMA 3X0DA 2ZBQA 3DTNA 3G88A 3MQ2A 5EVJA 2YXLA 3HVKA 4OA5A 2V7EA 4GOOD 1D2CA 3P2KA 2O0LA 2YX1A 2V74B 4QVKA 1YZ3A 3RODA 3EMDA 4NECA 2XYRA 3P2EA 4E70A 4HRAA 4PYNA 2ZIGA 5CD1A 1L3BA 2PWYA 1UFKA 3E7PA 5BW5A 1AF7A 2OKCA 3BGIA 3KU1A 3EGVA 3OU2A 3I9FA 4QPNA 4RVGA 3R0QA 2AN3A 5DWQA 1JSXA 2C7OA 1YFLA 2LD4A 1EQAA 3NWBA 3HVIA 3M6XA 4LECA 1O9GA 5EIWA 5EG5A 3AXTA 1X1AA 2ZLBA 1PJZA 1MJFA 3KKZA 3BWCA 1O54A 4C04A 2BH2A 4PYOA 2GH1A 1Y8CA 1JQDA 3FZGA 3ID6C 5F2KA 5P8WA 1AV6A 2I7CA 3PS9A 2FPOA 2ONYA 4E31A 3DOUA 1R74A 4QDKA 3UFBA 2IBTA 3EGIA 3MAGA 2E5WA 5ERGB 2OPBA 5DX8A 4XUCA 3MCZA 4WVLA 3M6VA 7MHTA 3LDGA 2CWWA 3M4XA 2XBMA 2N47A 4C4AA 3LBFA 2O07A 1SUSA 3HA5A 3RIEA 5IKMA 3FUXA 2JH9A 5EZQA 3HM2A 1VP9A 3DMGA 5LQNA 3KPYA 1F38A 3OFJA 3ANXA 3EEYA 3THSA 5EGSA 3TM4A 1KHHA 3BWMA 2VZ9A 2B3TA 3Q87B 3SSNA 1I4WA 5E9JA 4RTLA 2C7QA 3SGLA 2P3QA 4IWNA 3LX6A 5LQUA 4M38A 2WK1A 4PNEA 2O57A 3LDUA 4BP1A 3I53A 3MERA 2G71A 3A7DA 3E8SA 3OZTA 2CMGA 2BM8A 3SX0A 5ICEA 5DTQA 3FPEA 4HTFA 4PYJA 2HWKA 3NVMB 1VE3A 5E1BA 2P40A 1M6EX 1RJGA 3K0BA 2ZIFA 3LBYA 5EKUA 1M0EA 1G60A 1G8AA 2H1RA 2I9KA 2CMHA 1O9HA 1V39A 4C07A 3SR4A 3T0IA 3BUSA 1P39A 1R8YA 4Y30A 2KW5A 3EVAA 5KVAA 3MHTA 3G2QA 4FZVA 4OA8A 5DRYA 3T7TA 1NW6A 3ER8A 1XVAA 4P58A 3GRZA 1I1NA 3B3JA 1SVUA 5FADA 5LQRA 4LWPA 5DTMA 3UJ7A 5DM4A 4BLWA 3IEIA 1PRYA 4RVHA 4A6EA 2GAFA 3P9KA 4AUKA 2QM3A 3B3FA 3E23A 3ELUA 3GCZA 5FQNA 3FRHA 3OZSA 4E2ZA 1DCTA 3FTEA 3AWIA 1WS6A 4G56A 4C03A 2Q41A 3GU3A 3EVZA 3FYDA 3P9IA 3C3YA 2OYRA 5CVUA 4EQZA 4GQBA 3BXOA 2NNWB 2PVCA 2VP3A 3L8DA 4HGYA 2YVLA 4RWZA 2AOUB 4FSDA 2B25A 2ZULA 5E2AA 5EHGA 5F2OA 3MGGA 3MCTA 1NKVA 4WXHA 4YV2A 2UYHA 1XCLA 3KQWA 1FP2A 4FGZA 3AY0A 4U7TB 4IV8A 3LKZA 2XVMA 3G7UA 3G2MA 2AVDA 1VIDA 2CKDA 2IGTA 3KR1A 2B78A 3NWEA 2YXEA 5DX0A 3UJBA 5FTWA 1JTEA 1N2XA 4M37A 3SSOA 2NP7A 2B9EA 1OR8A 2DULA 5IH3A 4C08A 1EIZA 3B89A 3LSTA 5DM0A 3FUVA 3TMAA 3LKDA 5DPMA 3C6MA 5BP7A 1QYRA 1D2HA 4RTJA 4RYLA 3TRKA 4KDRA 3FTDA 3NVKI 2YUIA 2FCAA 3O4FA 3GXOA 1NW3A 5T64A 1AQJA 2ZBPA 4QQKA 2G1PA 2ZVJA 4QTTB 5CVEA 1IXKA 4YUWA 3A27A 5KS2A 5GM1A 2G8NA 3UJAA 2OXTA 1JQEA 1FBNA 1N7JA 2PT6A 4F86A 2PT9A 3PT9A 4GC5A 4QVGA 3HCFA 3HTXA 1FPQA 1ZHFA 3I58A 4EKIA 3NMUF 2IIPA 1ORHA 2P1DA 4P7KA 5LQKA 5FCDA 1RI1A 1VPTA 5FWAA 3UA3A 3P97A 5CCBA 3GRYA 2PSSA 4RTRA 3DXXA 4PIPA 4POOA 4FS8A 3FUWA 4PYQA 1Q0TA 1P1CA 2JHPA 3BGVA 1F3LA 4H0NA 3GJYA 2ZZNA 4AX8A 4BY9E 1KPGA 2PBFA 3DLCA 5CVDA 5K0BA 5EQJB 3TLJA 2PKWA 5DTRA 2H11A 2OZVA 4P7GA 2ZW9A 4F84A 2JHAA 3UJ6A 1KR5A 1NW7A 2P3LA 4OBWA 4YMHA 3P8ZA 5T67A 2BR3A 3HA7A 5EC8A 3G8AA 3TQSA 5EEHA 5KYGA 4EVIA 1KPHA 5DSXA 1R00A 3HCDA 5JR3A 1NV8A 1EAMA 4ER5A 1IM8A 2VDVE 1B42A 2GPYA 2ADMA 2ZTHA 4E32A 1X1BA 4AZTA 1SQFA 3C6KA 5KQSA 4OQEA 3GWZA 3DXYA 3KHKA 3B3GA 2AR0A 4A6DA 4RTQA 1NBIA 2OO3A 4R6WA 5U4XA 2HV9A 3FPGA 3KPVA 3LCUA 3OFKA 5K03A 3BGDA 1KIAA 4X1OA 3BWYA 1ZGAA 2GLUA 3R3HA 3R24A 4RTOA 3R9XB 4MHTA 4V0RA 2EFJA 3HCEA 4C06A 1QZZA 2BZGA 5GINE 4R05A 3TFWA 2XYQA 3BZBA 1SQGA 2IDJA 3CJTA 3IV6A 3LDFA 4KVZA 5E1OA 2XVAA 4CWAA 4PONA 1JTFA 3HCBA 1WXXA 5CIYA 2EX4A 5C9ZA 3HP7A 3NJRA 5JUWA 3QOXA 3DXZA 2H00A 5HIIA 3M6WA 3NW9A 5FA8A 5EMKA 1BC5A 1INLA 3HEMA 5LR6A 3EMBA 2Z6UA 3S68A 4IKPA 5K8VA 2DPMA 1ZG3A 4YUZA 3KPJA 3C0KA 4CKBA 2YR0A 4HGZA 4GF5A 4O29A 1R18A 3T7RA 3TR6A 3M70A 4MWZA 4PINA 4ER3A 2QRVB 5E9WA 2EJUA 2P7HA 4CTKA 2NXNA 5DXJA 4E33A 2IH5A 1YFJA 2AOUA 2AVNA 3ELYA 2Z6QA 8MHTA 3GDHA 2VS1A 3NDIA 5CM2Z 1XXLA 2ZSUA 4CTJA 1NT2A 1KYWA 3B7PA 4DZRA 5K0NA 2P41A 3CBGA 5DRTA 3DMHA 3GIWA 2AOVA 3TM5A 3GO4A 3FRIA 1FP1D 2PXAA 5F2NA 4PIMA 3HCAA 3O31A 4FP9A 3KR2A 5C0OE 5DM2A 3M6UA 3CCFA 5K0CA 3DMFA 5GM2A 1X1CA 5E8RA 4QDJA 3UJ9A 3FPJA 4V0QA 3ERCA 1X19A 3DLIA 3DP7A 3NDJA 5FULA 2JG3A 2NXCA 3G89A 3QV2A 3SVZA 1RI4A 1D2GA 2PXXA 3TKYA 2P35A 2PXCA 4DA4A 5EIFA 1SG9A 2ZBRA 3O7WA 4LWOA 5LQCA 3EVFA 4KIGA 2K4MA 4LG1A 4RTPA 1IY9A 3GRUA 4PYIA 5HIJA 3VC2A 3K6RA 3A7EA 1SKMA 3FUUA 3DUWA 4PCAA 2C7RA 3LHDA 1XTPA 3G5TA 1HMYA 3Q7EA 5D1NA 5HILA 4DKJA 5DT2A 4RTNA 1I9GA 2P7IA 4GOMD 4K6MA 3SMQA 1XCJA 5E8JA 4X61A 5CVVA 5C1IA 5D1HA 3UJ8A 3GRRA 3ORHA 5BXYA 1ZQ9A 3TPZA 3EVBA 4AZSA 4QPPA 3KQYA 5K0LA 3LCVB 1NE2A 2QY6A 3CGGA 4ER6A 5ICCA 2PX8A 4CKEA 4MQ4A 3P71T 4BLUA 3A4TA 2F8LA 1NBHA 1M6YA 2XYVA 3TKAA 5CVJA 4R8SA 2HR1A 2YQZA 2O06A 3E05A 3MTEA 2C7PA 2BR5A 5E2BA 5FUBA 4E2XA 2IDKA 5HZMA 3KQPA 2AN5A 3EVCA 5FA5A 5G02A 2PGXA 5DX1A 4AZWA 1NW8A 1ORIA 2PJDA 3EVGA 3IYLW 3PTAA 1Z3CA 5DM1A 3SXJA 4R6XA 2GA9A 5M5BA 3I64A 3OU7A 4ZTBA 2AOWA 4RV9A 4UOEA 3A25A 2ZFUA 3G5LA 3HVHA 3LL7A 2FK7A 3EVDA 3JWJA 5EMJA 4KIFA 4YMGA 5EEGA 1RI3A 1G8SA 2ORED 3B5IA 4E2WA 1RJEA 3T7SA 4RVDA 3AJDA 1TW3A 3EPPA 3KQMA 3LECA 4GOND 1G6Q1 3NTVA 1VLMA 1P1BA 1EG2A 2I6GA 5ICGA 4KW7A 1XDSA 1MHTA 2ZZMA 1XDUA 1G38A 2OB1A 4P7FA 5FHRA 3OE5A 3GGDA 1VL5A 1L1EA 2ERCA 2OB2A 2PX2A 3BKWA 4M36A 3JWHA 3PB3A 1YUBA 2ZZKA 3FPHA 2G72A 3JWGA 4DCMA 4Z2YA 3EEOA 4F85A 5CCXA 3KQTA 2FYTA 2JH8A 3LPMA 2IP2A 2R6ZA 1FJXA 5HFJA 3UA4A 1SUIA 2WA2A 5DSTA 5HIMA 3OCJA 3JWIA 3SSMA 5ICFA 1T43A 2Y1WA 4KDCA 2UZ4A 3IHTA 1R6AA 2UYQA 2AS0A 3P9CA 4GEKA 3P2IA 4PGHA 4YV0A 4RVFA 3FYCA 3SM3A 2IBSA 1L3CA 3OE4A 1P91A 3ELDA 4ISCA 5DXAA 5E1DA 4RTMA 3PX3A 2QRVA 4QQNA 1NW5A 3CJRA 2AOXA 3EVEA 2HNKA 5HIKA 2AOTB 3I5UA 3LGAA 10MHA 3CKKA 4FR0A 1KPIA 3G2OA 5KQRA 3HVJA 5E1MA 3KR0A 3DR5A 4JXJA 1TW2A 3KR9A 4MIKA 1YZHA 4PWYA 4PYLA 4X63A 5K05A 1RI2A 3HA3A 4PYMA 1JSZA 1ZGJA 2P3OA 1ZKDA 4DM3A 1JG4A 2IPXA 2R3SA 5E9QA 1KYZA 5T6BA 3KPUA 3C3PA 4HSGA 1VQ1A 1QAMA 3UJCA 2JHCA 2PWPA 4MTLA 1X1DA 4XCXA 2IH4A 5EPEA 5K0JA 4KWCA 5LQJA 2ZIEA 1Q0SA 5DLYA 4B17A 4DCGA 3FTCA 4DF3A 4ER0A 1AQIA 3ER9A 1DL5A 4Y2HA 4GC9A 4PYKA 4C05A 5GP1A 3ELWA 2HTEA 2OY0A 3AXSA 3R6TA 5EZSA 3KPWA 3M33A 2PV0A 4OBXA 3DH0A 2PX5A 1RI5A 4IV0A 1KXZA 5GIOE 1KP9A 2FK8A 3BT7A 2G70A 3VYWA 3GNLA 2P8JA 2BM9A 2I62A 3BWBA 4EK9A 3FTFA 2NP6A 4BLVA 2ZCJA 5HOQA 1XJ5A 3H2BA 1UIRA 4YUVA 1WY7A 3MB5A 4YV1A 4M7RA 2ZWAA 4E30A 3CJQA 2CL5A 3TOSA 3KQOA 3CVOA 3KQSA 1XDZA 1QAOA 4PGGA 1JG2A 2FRXA 5FWDA 3KQQA 4HG2A 3UWPA 3VSEA 4HC4A 2EJTA 1DUSA 3PLAE 4YUYA 2YTZA 1WXWA 3CC8A 2VDWA 4X60A 4XUEA 5CUQA 4GOLD 1VP3A 2Z6AA 3HCCA 1G55A 1QAQA 4KRGA 3PX2A
chains in the Genus database with same CATH superfamily
3JTMA 2O2ZA 2WG0A 4DCSA 3NASA 3QG5A 2YHAA 3TG2A 3OURA 1P2BA 2PWBA 4RGBA 1U9IC 4O5OA 4UFNA 4ESOA 4PG4A 4NS1A 3A2MA 1NJ8A 4HH3C 1FL9A 4M1YA 1YZYA 4O4IF 4BO0A 1OBFO 4DHWA 1SOWA 4OAOA 2AUNA 2GS9A 1EWVA 2VKTA 1ZRNA 5AVVA 4OX9Y 1OVGA 2OYCA 2WIAA 3QE2A 1P3JA 1S3IA 5GY7A 1GUAA 2DTEA 4QU5A 2QRPA 1YZTA 3HABA 1HG1A 1WG8A 3KE9A 4GECA 4Z0PA 1EGQA 4AY6A 1HYQA 1F3OA 2JGDA 2X2FA 4JI7B 4U7PB 1CRPA 1QU2A 2FWBA 2HXYA 1KS9A 4B45A 4CMCA 5JNTA 1C80A 4KWIA 1GQRA 3H6GA 5D8DA 3WGVA 5EXTA 3NETA 2WJ3A 1TPYA 1U0TA 2IBMA 1Q1BA 2JJQA 3WLHA 4DJTA 1EXVA 3EJ6A 2FQXA 4WBXC 1QO0D 2JFYA 4OOFA 3QF4A 3H7AA 2REXB 3OJEA 3PHIA 4RVUA 2AZMA 2WFAA 5TMPA 5LSAA 1QO0A 1JSCA 1UBSB 2V97A 3QEAZ 1BOOA 4RVSA 2XGGA 1KYQA 3BIJA 2D0PB 3PR2B 4S0XA 4XUDA 4DM7A 2FZEA 3P4XA 2R60A 4W5OA 2F4VB 4J16A 1G0NA 2VDMB 5DBOA 2A5JA 4RSRA 3LU1A 1XEXB 1QYWA 4L7VA 4C30A 1KQ3A 1VSQA 4LNUB 4MVJP 2YXDA 3FPFA 4MO9A 5D3ZA 3FY4A 2J67A 1F8UA 2EGGA 2WQZA 3I6YA 2VDUE 3VUFA 1VJGA 4P4TA 1GNVA 4TVBA 2AQKA 1ZLXA 1JWLA 4IO1A 5HS6A 4G0WA 2PX3A 1DGQA 3WLIA 1WLSA 4LE0A 3I34X 2VJLA 4MQMA 5K0GA 1TADA 5ELXA 4D5EA 1FW6A 3U81A 3IRVA 4GXNA 5JZBA 4ZK6A 5FR2A 4HPXB 1U9CA 5ECWA 1R50A 3S55A 4YP9A 4D9GA 2K2WA 1PWZA 4GWKA 3OCUA 2FPLA 1VJ0A 2BLNA 4YMSA 4ZMSA 1P9LA 1T2NA 4PZDA 1E2HA 1PSZA 2LGJA 4MQBA 2FOLA 1KQPA 4HB2A 3REFA 3U44B 3RV4A 3N2YA 1XEAA 1XRQA 2BE7A 4BO4A 4RY2A 5EJ8A 3GLGE 4I1YA 3GJ6A 3BREA 3X2SA 5K99A 1Z2PX 4HQ0A 2ZR0A 4QPNA 1WVIA 2C7OA 1JSXA 3JQBC 2QUZA 3O6VA 4ZEWA 4XH9B 3FOWA 2JLAA 4QLBA 4OJYA 4E5VA 3W8EA 1PJLA 5ALMA 4B87A 1MC5A 3EXEA 3RU9A 2GH1A 1B73A 5L4LA 5AM2A 3ANYB 4CIDA 4IIJF 1UH5A 4P6VF 2QLMA 2NW6A 4CF4A 1OW3B 4P0QB 4JZYA 2J5BA 3L4JA 5D6NA 2PU7A 2C2XA 2VHCA 4JI3B 1XPOA 1G5HA 4FFRA 4L9SA 1XMOB 3WHIA 4HBZA 2EVWX 1UC5B 4LSZA 2G40A 7MHTA 3M4XA 1FXWA 1XA3A 5EPOA 1DXOA 4DLTA 1NUQA 3VGJA 3T61A 4F3YA 5KNDA 2GRAA 1K98A 3FW1A 3JARA 3KPYA 3LQYA 3OFJA 1YT5A 1CEYA 1HEUA 1QHEA 3FUCA 3OHPA 4XM1A 3AJ8A 3DFMA 2EJVA 1F4PA 2CNNA 2RHMA 4DGQA 5BYKA 1CJMA 4GPEA 2HLDA 3ZEIA 1XZBA 4AMUA 1RZRA 2GZ3A 4RA9A 5JYEA 4PYJA 1G5TA 3MLAA 4CEIB 4MMZB 4GLBA 4QUKA 2DTDA 3DNFA 3C2QA 2O5RA 3S2IA 3B6ZA 4R16A 1FSGA 1I2MA 5HJ7A 1L5ZA 1T0BA 1OVMA 1P8AA 2ABWA 2OHIA 2Q6TA 3DOIA 3G17A 4KNWA 4S1PA 5FBHA 4HVLA 3GPCA 4M1SA 5HQJA 1UBRS 1VMKA 1H2FA 1OT5A 5HKAA 2KW5A 3EVAA 1J22A 1TVKA 3VZBA 2Q07A 3WGUA 5KBYA 3G2QA 4D0GA 4L95C 5C8VA 2XB6A 4BO7A 4BNTA 2H1VA 3T5TA 2QIPA 5BY2A 5LQRA 1SVWA 1X7YB 4MA0A 4BNFA 2QTGA 4U7FA 3N2LA 1NR1A 4AUKA 4WECA 1M1NB 2PRIA 3IV7A 1IAVA 4JC5A 3R4CA 3TGPA 1N78A 3Q7RA 3CFYA 1VHQA 5JANA 3N7AA 4C4SA 1PR9A 2PVPA 3E7FA 3KZKA 4OHXA 1MD9A 3SU8A 3WIBA 4PSKA 1FS6A 1GZUA 1YJQA 1XQ9A 1UP7A 4O4JA 3KHSA 1U3GA 1NUSA 2W2OA 1SC1A 3ORQA 4WXHA 4BQPA 4Y0VA 3KJFA 4OI0A 1IY0A 4OD0A 3R6LA 4A03A 1Y89A 5K2OA 1OXTA 4TL9A 1HDIA 1GYRA 1QQ6A 2AVDA 3NBYC 1MORA 4X1YB 2G88A 3M1AA 2ZI7A 4N40A 5ARDA 1L8OA 1JTEA 1QWOA 2J87A 2VYND 3OPYB 5T6MA 3RBZA 3VTZA 5TQ0A 3QE9Y 4Y6QA 3ET5A 2LWIA 3FNHA 4FHGA 4NJEB 4C5BA 1GT6A 1PF7E 3PC3A 1N5JA 1NOJA 3DDHA 2ACEA 1VPLA 5BN5B 2H92A 1A9RA 2PNJA 1ZD3A 1ZMRA 1C7FA 1DQRA 1KFBB 3HRHA 3MQFA 4JBXA 2I66A 4KDRA 4W99A 3TLXA 1NW9B 2YV5A 5CNKA 4DILA 3FD8A 1BDHA 1AX9A 2V9CA 1E9RA 5KSPA 2Q2QA 3I0MA 4IHJA 1C0LA 3AL2A 3ZWXA 2HFKA 2ZJAA 3JVEA 3IJRA 4BWGA 4W7HA 4YUWA 2CKMA 3A27A 2ASEA 3R41A 4MGHA 1JH9A 2HOQA 4CG2A 2VJBA 5KYWA 1P5ZB 2RK3A 4UD2A 3DLHA 4Q3OA 4MA5A 1N9GA 2W98A 4D6PA 2VF7A 3ENWA 1P6UA 4O4LB 1SOMA 4AULA 3NMUF 3NDBB 2DECA 4GVPA 4DLZA 1VL6A 1Y8QA 2WVHA 2B35A 2W43A 2BMFA 3UUFA 3DAGA 3O0DA 5EXEA 4D7AA 4Y8VA 3C41J 5HDBB 1P4GA 1AKNA 5DHFA 4BY9E 4DDUA 3DLCA 1KU0A 3KE8A 1TTHA 4WZAE 2V4MA 5GGXA 1RMQA 4JY7A 2Z98A 4LQCA 2AQHA 1JFVA 5E6SB 2YRFA 4ZPXA 3DM9B 4JD5A 2FF5A 1CDZA 4H17A 3NRCA 3LWDA 4AJNA 1IXYA 3OTIA 1KBQA 4CIXA 1NVDA 1E1RD 2CJFA 1R27A 3LT2A 4EB8A 1XB2A 3TIIA 4EG8A 2PX6A 2D4HA 1AGXA 2VAPA 3DYVA 4NJMA 1PL8A 2H48A 4YEDA 2YWBA 5KYUA 5JNRA 3AC0A 2FEWB 1OGIA 2ZAOA 3NWOA 4TMFA 3SOPA 4IJ6A 1FE8A 3UGQA 3KSMA 3LQFA 1XJQA 4EQ6B 3AG6A 4OGFA 4D9MA 1RIFA 4TQ9A 5CB8A 1FSSA 4WY5A 1H9BA 1PZEA 1Z7GA 1UC8A 2A1TS 4JP5A 3WFIA 3PE6A 4HNUA 3VQTA 5G0UA 2GBIA 3U4MA 2OO3A 2X8BA 1Y4SA 2ODEA 2PRKA 3HN2A 5H9VA 1XYGA 2HV9A 3PGMA 2YC4C 3MCWA 1TCBA 4TLEA 4HWRA 5B55A 2D1QA 1LTKA 3DMYA 2XQKA 4D8UA 3KYCA 2LUOA 2QRMA 3NBQA 4NE9A 4CFSA 1NYTA 4OKNA 4BNKA 3NH6A 1YHNA 1DTEA 3D6UA 3QKIA 4RELA 2BFFB 4M8LA 1YE5A 4IZIA 4UTPA 1ZI9A 3RIMA 4UTVA 5HCIA 4CYMA 4QQ8A 1B0ZA 1YQXA 1XZ8A 2CN1A 1JDJA 2EQBA 4IDNA 4Q4HA 2YJ6A 2O50A 1SKAA 1UK8A 5HJEA 3M6FA 4PX5A 3M6WA 3AEKA 2D5LA 2RHTA 4IZ6A 1O5TA 1ZXXA 3T15A 3BB3A 2C0PA 3OEHD 1C1HA 1OH6A 1CS0B 2ILTA 1GR1A 4UFPA 3MCVA 4N3AA 4HYTA 3F5FA 3K92A 4U2CA 1KTVA 2XGJA 5AWFC 1NN5A 2PZAA 1IMOA 2RHBA 5IJAA 3UGTA 4N0QA 4C3UA 4CCAA 4N5HX 3OWXA 5CB6A 4I6JA 2XTJA 2AOUA 2Z6QA 3UW3A 1V4VA 1UPAA 2B7LA 4BJ5A 4IJWA 1FJ2A 1XXLA 2QVZX 3I8SA 5EPUA 4IMPA 1HT3A 1TTTA 5KTYA 3CURA 2IW1A 2SKDA 1P1JA 1US8B 1EFRD 4FXOA 1QH8A 1X7HA 3TM5A 4GWLA 4YIHA 2Z9BA 1JBQA 2ZYVX 1NXSA 1TO6A 4NV3A 4PAQA 3RAGA 5JZSA 3HCAA 1DKPA 1TF5A 3M83A 3RUIA 1PT8A 3CR3C 3QEMB 3CPEA 3Q9LA 4JDPA 5K0CA 1DOAA 2GFQA 3PSAA 3WGNA 2XITA 3OM0A 4B6FA 4HFMA 5GM2A 4AJHA 1FDVA 1VYVA 3DUFB 4MYTA 4FQ8A 2D8MA 1PL7A 3AERB 4AP5A 3T3OA 1NN3A 8GPBA 4J03A 3W0LB 3ZD7A 1K89A 3TE6A 4DR6B 2XQVA 4WLVA 3T3MB 2QRKA 1P9RA 4YIKA 2CCGA 2PGJA 2H5IA 2Z43A 4G3XA 5G1NA 3ADDA 2K4MA 3KNZA 2EW8A 3V4OA 4H1WA 5AW5A 4JASB 2O8BB 3DAOA 3R3JA 4WFQA 1YJBA 2IDMA 1QHHA 1OI7A 4UBNA 4DKJA 1VPWA 4EZIA 3AF3A 2AEJA 2G80A 4CM4A 4FGLA 1B7GO 2IYTA 1X92A 4D02A 4W1RA 3KFVA 5AOCA 4Z0HO 2C3MA 1ODCA 2XHEA 3NIGB 4DLSA 1EDZA 3CGGA 3H7IA 6PFKA 1GSIA 4MDEA 4TQGA 2QTFA 3HFGA 3ZK8A 4YWHA 4DM4A 2RE8A 1FZQA 1MB2A 1E89A 3EDRA 2DY1A 3CLSC 2HR1A 3K32A 3MTEA 1Z7YA 2I3DA 4NP6A 1HK7A 3LWZA 5DASA 2KMLA 4Z9AA 4J8PA 2OAQ1 1QHGA 5F77A 1IN7A 2E85A 4L76A 1DKLA 2F8TA 3CRW1 2VLBA 1TJPB 3QLVA 3I64A 5G4KB 4FFBA 1W87A 1ZUHA 4IDEA 2HH9A 3HCRA 2PD4A 1EUDB 4NCHA 1T35A 4AYXA 4YRCA 3K05A 2NZ2A 2IHVA 4WZBE 4LE2A 4PXAA 2XEXA 1L7BA 2I2DA 2ZRMA 2ZVPX 1KO4A 2QYSA 4TWIA 1NU6A 3DFKA 2IUYA 3B5IA 5ECYA 1V0JA 1GRQA 3VI3B 4YCBA 3KQMA 4O1HA 4RIHA 3PG5A 1QP0A 1JI0A 3I1IA 3HEAA 1NY5A 5BQXA 3HSYA 5KTPA 4DTIA 1FB5A 1FDTA 4DBLC 5KNBH 3BDVA 4NZZA 2OB1A 5GMOA 1O8BA 2BFCB 1KY4A 1UEXC 4HVTA 1QC5A 1IG3A 2EKBA 3C6YA 3K0FB 3O84A 2FB9A 3W3AH 2MYUA 4RLQA 3B20A 1FP6A 2PTHA 3SC3A 3VYTB 1H6CA 1A9YA 1UK7A 3ST7A 4GLJA 3DG9A 5DYYA 3LH5A 4HS4A 3WSWA 4I99A 1QRTA 4M89A 2I3ZA 4J49A 2G06A 2WVGA 4ZN6A 3DFFA 4UM8B 3I9NA 1VKOA 4UVIA 5DI9A 2PKYX 4W9NA 4ZGWA 1IH8A 3EF0A 4H6WA 2YJ4A 2H4HA 3ZK9A 2QTTA 3EFHA 3UHFA 1WTCA 4GEKA 4UARA 3EWIA 3FYCA 4GGOA 1TIPA 1WXEA 3PQDA 3PWSA 3SM3A 1P91A 3T0FA 4ISCA 4URXR 3U7RA 1PYGA 3WP1B 4BNDB 1J2EA 5EHQA 1R0CA 3C6QA 2E55A 4GG1A 5K3OA 2AOXA 3G13A 4Y6OA 3WYGA 1OFTA 4BDSA 4OLBA 5BMVB 3HDQA 4C4TA 3R23A 2YQ5A 4WA7A 4FR0A 2P9HA 5DTIA 3WLOA 3DZJA 4ENTA 4KQXA 3RK1A 1OZAA 3ZHQA 3V8MA 5KJ1A 3QXJA 3IE0A 1PT9A 4P80A 3NTUA 2QN2A 4XJXA 4KQ2A 5HPYB 1J2UA 1SNYA 3TL6A 1LV7A 2XV1A 5KU1A 3HACA 5ITZB 1CQIB 2OMKA 3IAEA 3PUHA 2H65A 4M21A 4XCXA 1SXHA 5EPEA 3MWJA 3LY5A 2PYZA 1NXQA 3AX6A 1JYFA 3UCXA 1RHUA 4PLVA 4U9HS 4P53A 4Q7EA 3I76A 4UMDA 5DGCA 2HTEA 1W25A 3M33A 1TZJA 1NP3A 3S8YA 3H5VA 3IKVA 1XLUA 1KRWA 5DK4A 3E7WA 1ULUA 1JRLA 4R5MA 1H9CA 4AY2A 4MEJA 1C9MA 2D62A 2R68A 3IUMA 1L7XA 2Z5LA 3AUJB 4GRIA 4BCCA 5J2TB 4QFMA 2Z2XA 1GVNB 2Z4RA 1ND5A 1UZNA 2W8ZA 4UXHA 5JVDA 1JQBA 2X5JO 1GN8A 3OLXA 2YN4A 2VXCA 3CX7A 5IZ4A 4Q1FA 1A97A 1ZIPA 3CVOA 1KDVA 4ZI7A 4V2UA 4OLAA 1JVBA 1QB8A 2E7ZA 1UBMS 1R8SA 2X9NA 3UWPA 4OMFG 2BF7A 3IERA 3ZJTA 4P3XA 3H5OA 1A8SA 4HC4A 4MV0A 4RFSA 3WMGA 1Y63A 3EGDA 3I2IA 1XTTA 3JQ7B 2P1RA 3CLRD 2RGEA 2PGLA 3TINA 2QN3A 4BWYA 5B3JA 1RACA 3J80A 2NXEA 2BGWA 4K9SA 4MKGA 5HGXA 4KXFB 2JGAA 1NYQA 2QQGA 1WUKS 1DCKA 1NJ1A 4BLOA 1QRSA 1IJFA 3G7SA 4MJ7A 2W6OA 2YDXA 2M98A 2WAOA 4AMBA 1RJFA 1R8QA 2PAAA 1PCXA 4UNIA 4L02A 3TI7A 2OVFA 2FVXA 2CNLA 3K1YA 3L0PA 5AD1A 3UJDA 2XZPA 4DQ0A 5JMWA 1JFFB 1DC7A 1XR3A 1Z5UA 3I28A 3K6SA 5I8ZA 4FCTA 1YB7A 2XE7A 3EF3A 3LHIA 2EOAA 5CLFA 4BBZA 3AGPA 2EDCA 2YVQA 3A9TA 1AGPA 1ODFA 2QLJA 4RPCA 4HOYA 1Y7TA 1FIUA 1G64A 1ZM9A 1W73A 1H1DA 4RL4A 2ZWVA 2A5LA 3OCYA 5JADA 5G0VA 3OJLA 4FMDB 1NY6A 1LSJA 4RORA 4KFCA 1SR8A 4J4HA 2GO1A 3RFCA 3HNRA 4BU0A 3I72A 2OQVA 3GEBA 1SB8A 3Q2KA 3X1KA 1OJLA 1JLHA 3P2YA 1TB4A 1EAYA 1OPRA 5H59A 2PLWA 3F6BX 4DBVO 7REQA 1L5WA 2OVBA 4R8RA 1Z0AA 1ZM7A 2WYIA 2GPSA 1X2EA 5BVHB 3ROFA 3N5KA 2ZG6A 3GQBB 1AKMA 2R25B 3IQHX 3AKCA 4NFLA 1QM5A 3BD6A 4O2BB 3ND8A 3C3WA 1U3WA 2NSYA 2CDCA 3GJQA 2DH5A 2PX4A 2A0KA 2R8BA 1HDYA 3MJEA 3NWPA 3C7KA 1IE3A 3C6ZA 3EK2A 3GFGA 3RU7A 3TF5A 2AZTA 3Q5DA 2CD7A 2K7ZA 2YFHA 4CCWA 3U61B 1YF3A 3IUJA 3WSTA 2IZ7A 3T4EA 3DTVD 2EAUA 4QTUB 3SXUA 5K09A 1AUXA 4YA6A 1UFVA 1RIIA 2BFEB 1CK4A 1SC6A 1O6ZA 5H16A 1MJ5A 3DTVA 3EDOA 3TLZA 3LFUA 4OEHA 4ZT6A 4HFRA 5JBQA 5EJGA 2PH7A 1KMHB 3V4ZA 3C3DA 2RD2A 3NR2A 4M3NA 2Y0BA 4NECA 4RDHA 5FPSA 5B6IA 1LX6A 1VE9A 4N5DA 1UFKA 2BY4A 2REQB 2EGUA 2OKCA 3JQPA 1S0UA 2XEDA 3ZVNA 3TTXA 1QB7A 4CF7A 1CRWG 5GJVC 1RCUA 2ZYDA 1CUXA 1PTKA 3R9WA 1FMLA 3OQ6A 4E4YA 1JMKC 1UK9A 2ZVQX 2WUFA 3TJZA 1X1AA 4C04A 1RWBA 3FGOA 3U16A 1Y1LA 3RVQA 1X70A 3ZI0A 2JAXA 1Q7BA 1BMFA 3U44A 4KPYA 4BL5A 1Q7CA 4ME6A 3WMFA 1JBKA 2QD2A 1XK7A 1H9AA 4Y2YA 2ZCUA 3CU5A 3S2FA 3IMCA 2NQTA 3CISA 1ETUA 3F7MA 3CX8A 5I7FA 1N6HA 2P30A 2YY7A 3EZ7A 5C52B 1HI9A 1X80B 4TSRA 5JMOA 1AT1A 4JX9A 2UYYA 1MH1A 1FRNA 2RI6A 1G2IA 2X9QA 3GEMA 2C4UA 2CZQA 3CUTA 3LC2O 4WTOA 1LWNA 1N0WA 2JH9A 1DAOA 1A2KC 1VP9A 1XAIA 1L8AA 1UBKS 5EN4A 4Y9SA 4R0VA 3TLGA 3VU0A 1KHHA 2BZ0A 2VZ9A 2JBWA 4CM9D 4RTLA 1V8PA 3THOA 1F7UA 2R86A 1MAVA 1RQGA 3HG7A 3V33A 1D7AA 1PGQA 4B35A 2CJPA 3K8ZA 4ESHA 3ENZA 4CM9A 1FLVA 4F7DA 3A7DA 1CKEA 1DFGA 3A6LA 3FFWA 5C8YB 2O1SA 4AAYA 4NCNA 3W1VA 5IFKA 1TU3A 3CG4A 1NMXA 1VE3A 2FRDA 2NX2A 3VU1A 2IEYA 5A06A 2JVIA 1TJ4A 1G60A 4HQLA 2PT7A 2VN8A 3CE6A 1LKZA 3HPQA 3G6WA 4BFXA 5ALVA 1LS1A 1ZD2P 4DLWA 1YIDA 4F6LA 3PPVA 1Z4KA 2DERA 1Z73A 1ZYUA 2H6EA 1F7VA 4V24A 4LYHA 3HDTA 1XX6A 3KCNA 1XVAA 3PKJA 4MP6A 4QLAA 1I1NA 1M7BA 2DE0X 2YXPX 2D54A 2Y1DA 2YWCA 3B6EA 3GGOA 4LOHA 4RMIA 5D01A 5FTKA 3D5QA 4EPXA 1ORDA 2WWHA 1IXRC 3D8RA 2ZPTX 4XARA 2VZEA 3K6JA 2O8CB 2CC2A 1KSHA 2J7KA 1EEXB 1CZNA 4HY3A 4G4SO 1T5IA 1J5XA 1MAUA 2BONA 5CVUA 1NQXA 1R5NA 4BATA 5EP2A 3BE6A 4PU0A 1ZVVA 1DTSA 4L3WA 1M67A 1TF7A 1AMUA 4D8TA 2PSDA 4FSDA 3FMVA 2B25A 5EHGA 2XWBF 3UANA 4L5IA 1HYHA 3UY4A 1E94E 1MX9A 2OUIA 3IBTA 3IP5A 4JROA 1PK9A 1QJCA 2DT8A 2BCGY 1H94A 2HMUA 3AY6A 1W4RA 5FBWB 3KR1A 1CP3A 2CKDA 3AB7A 2IGTA 1GNTA 3CG0A 3MLBA 4HAOA 5IC5A 3TEFA 3TPFA 4H6XA 5K8TA 2ZBFA 3SZRA 4OXRA 4EG3A 1SGWA 1MN6A 1W9MA 5JZOA 4WUVA 1X86B 2BGNA 3T06B 4MOWA 2ODQA 1H1LA 4Q6BA 4A0QA 1VCNA 1Q1AA 4URVR 5LYJB 1ZP6A 2Q2WA 3T7DA 4EF4A 2GZRA 1XFDA 1JG7A 2ZUCA 3E35A 5B4UA 2B0CA 5KNBD 3VYSB 3EX7C 4MB0A 4TKMA 4LS3A 1FUEA 3W3AD 3A31A 2BUCA 5CVEA 4JITA 1X1RA 3COYA 1Z08A 5KNBA 5CA1B 2ZIVB 3EQ2A 3L7DA 4BNJA 4MJXA 4U7DA 1QG4A 3W3AA 4CMKA 2ZANA 4JSTA 1AMNA 3KEMA 3U0VA 3SQXA 3I58A 1G41A 4UM9D 1CG6A 1MO4A 2CVQA 1CLUA 2PK3A 2QGFA 3EA0A 4ZVUA 1L7OA 3VPHA 2X77A 4EENA 1QHYA 3GEGA 5ALRA 3GRYA 2O4UX 3KOXA 1M2WA 5HHTA 4LYDA 3ZD9A 3OZVA 4NZPA 4K9MA 2N1MA 1Y37A 3LUBA 1KPGA 3A9CA 2ATCA 3WDSA 2RGNC 4IFIA 4CG1A 4HDNA 1I3MA 1PV1A 3BMCB 1L5SA 3HDJA 2ZW9A 3TTTA 1S8FA 1DO0A 5A9RA 3QUSA 4I36A 4KQ1A 1HNWB 2J85A 2YVAA 3VNVA 3NG1A 3PCXA 1IDN1 1L6IA 3U6KA 1YR2A 2JNWA 4IIUA 1TOAA 4UNNA 4ZCQA 3DAYA 3HBLA 4I2VA 3ZY4A 2DSTA 2HY7A 1OV4A 5AR1A 3EEBA 3QX3A 1YR7A 3GZNB 3X1JA 4E32A 1DX9A 2JRLA 4B9EA 2GCPA 4OQEA 1CD5A 2Y92A 5EJ6A 5AKZA 2IS6A 1EE1A 1B8PA 2VTVA 1W34A 1AMOA 4XTRA 4QBIA 3K1TA 2YWFA 3K4HA 1VYTA 2EFEB 3CF2A 3ENVA 4NFSA 5IM4A 3FOFC 1GM5A 2YINC 3BRQA 3OZCA 1HXHA 1S2NA 3FNGA 2WD9A 3H8SA 4G6ZA 5E3HA 5CA0F 4J0CA 5AUQA 2OAEA 4NBRA 4LHEA 2I1WA 3U4GA 1QZZA 1SQ0A 1C4KA 1YULA 3S0JA 3TZ6A 2D59A 2Q29A 2DWUA 3H9UA 2PNFA 4QOIA 2GF9A 2XDYA 5G0SA 3FVVA 1KFEB 3V8PA 3WQQA 4EY4A 4RADA 3FVRA 3L06A 1U3UA 3DDOA 3DO5A 3R3SA 5AJZA 3TZEA 5EKSA 1UDRA 5KREA 3KQNA 3IEVA 3MK31 2QN9A 4JI8B 4KPUB 3ZIAD 4YCMA 3OPXA 1XAJA 2CJYA 1WCXA 2DU8A 2FX5A 1Y6FA 3KD3A 3K09A 3HQ4O 2BSXA 4TYYA 3AM5A 4OGWA 4HNRA 3ZIAA 4IDDA 3L8GA 3HBJA 2A9KA 3ZQUA 2C54A 2P0AA 1Y3CE 2WJPA 3DV0A 4COKA 1S4MA 2I6FA 4OUKX 4L6AA 4Q15A 3ITEA 3RC1A 4CTJA 4J94A 3ZOZA 1GIAA 2WD8A 1VZ2A 1FC0A 1FX0A 4S2EA 5CB4A 3F67A 5JJBA 1Q1GA 1YCGA 3FRIA 5TY0A 3ZGOA 2NGRA 4QHTA 2ZS9A 2I3AA 3WMRA 2OV6A 4YHBA 5C0OE 1BDIA 2V45A 4RF2A 5G53C 1Q5PA 2FLWA 3HUUA 2DQ4A 3I73A 4QQFA 1CUVA 1TO1E 2FQ1A 4MXDA 2XTZA 4PQGA 1XEWX 3UJ9A 5KYKA 3FPJA 3N59A 1GTZA 3L1VA 3LXMA 2G09A 3MXTA 1W75A 1RPTA 3GRFA 2QX8A 4UHJA 4BNIA 1YJ5A 3DWIA 2G1AA 3L0SA 3SKXA 1QIIA 3JD1A 4CN8A 1KFJB 2DFDA 2REOA 3OZGA 4QXMA 1ZSNA 1FX1A 2AF3C 2I22A 4QSMA 1SKMA 2P5SA 4KR3A 3IB6A 5FI1B 1YR6A 2P7IA 3BILA 2BBSA 4FXPA 5M3BA 3KYDA 3HZHA 1XCJA 5DNCA 4ZRMA 5E8JA 2P6UA 2RAPA 1NQ5A 3WNDA 2GK7A 3GRRA 4JNCA 4LYFA 2WQ7A 2XF2A 3LF1A 1WABA 3O92A 1JZSA 4NONA 3NHSA 1EFDN 3KQYA 1NOIA 1NE2A 1T9CA 1HZZA 3I83A 3LCVB 5K0LA 4YAKA 1MTZA 4X44A 1TRHA 3ETNA 4KN8A 3F5QA 4BU1A 1RS0A 2D74A 1ECCA 1DC6A 1AXEA 2XYVA 2L69A 4NQZA 3TKAA 1MABA 1JDBB 2YBDA 3FSGD 3OIUA 4G4IA 4HMPA 4TV8F 4JJIA 1Z4JA 2FF7A 1EVEA 1HT2E 2BC9A 3JVVA 3X2FA 1UXHA 2IDKA 1M8KA 4G5FA 4ENSA 2J3KA 3FZEA 1SCUB 5FA5A 2VSXA 2PJDA 3EVGA 1JFSA 4E1BA 3U5TA 1C0IA 1VECA 3EWAA 3U4IA 4QU8A 4WGFA 4EA6A 5B36A 4RCZA 2F55A 4YO8A 4JUCA 4R9VA 1VCOA 3VV3A 2CT8A 1DWOA 2CW5A 3AYXB 2XDQA 1R4NA 4A0GA 4G8DA 3M5WA 2QU8A 4YQYA 1BRTA 2GD0A 2CMKA 3DONA 3FMPB 2XE8A 5FR1A 4DY4A 4FGWA 4OSOA 1EMDA 1MRNA 3GUCA 3V6MA 2F3RA 3ZWDA 5GV8A 3W6PA 2YFYA 3OX4A 3DS8A 4BUCA 1Y5LA 5HA5A 2RGAA 2H1CA 4MPJA 4F3RA 5L3SA 5A5VA 3P5SA 1SZCA 3KYBA 3RRFA 1PR6A 1U3TA 3PHHA 3T7CA 1CT9A 3DL7A 2IKQA 3RS7A 2AWNA 3WOVA 3MWGA 3OLYA 4LJ7A 1D9ZA 1UOQA 1UMKA 3W5HA 1BVHA 4I5EA 2VNJA 3IAM1 4MPDA 3IAUA 4WADA 5FWXA 5HYVA 1WUYA 2AFHA 2Y71A 2IP2A 3K53A 4TYNA 2NVUB 1H65A 4TWAA 4YN3A 2JLYA 3MTAA 2GHQA 2EV9A 2PQ2A 4HN9A 4Q05A 5EJAA 5F9FA 3T9DA 1MOQA 2H1SA 2VR1A 2H57A 4JB3A 3LS2A 2DG2A 4R2LA 3OQMA 1ISGA 4KQMA 2PKCA 1KVQA 2YV3A 5JD3A 1V37A 4DR1B 1SM4A 3AKZA 1BWQA 4NH4A 4EZEA 2R6CA 4U2FA 2JFVA 5JI2E 4CQMB 5IXJA 1PQPA 4PLCA 4OYRA 4U2EA 4F60A 4YT8A 2AW3A 3PQ8A 3L3BA 1XA4A 4IOMA 4KV7A 1XZPA 1HT1E 4HF7A 4YJ3A 3WYNA 1XWWA 3C98A 3L41A 2IYZA 2VAWA 3GMIA 2P9BA 5AI5A 5I4KA 4QFDA 1GT91 1YR8A 1KDYA 1CUBA 1KPIA 2AZXA 4FYVA 1Q0LA 1CULC 2GDZA 3HVJA 3IHKA 4PYLA 3KR9A 4TXLA 1YZHA 2YHIB 5GZ3A 1EB8A 4HJRA 5K3CA 1JAYA 3UATA 1CR1A 5CLLA 4ZZIA 1AK9A 4I55F 1JJFA 1JG4A 2GZDA 4LMRA 1B8NA 2CDRA 2IPXA 3H5NA 4Q7JB 2X2OA 3IULA 3QBEA 1D6SA 3BL6A 1PI3A 1NLYA 2YJTD 4WD3A 4NYJQ 2C9BA 4YJ2A 5AW1A 4MTLA 3W8DA 1DHTA 1B4DA 3SR3A 1E6LA 1RWKA 4TN1A 3NORA 4ZHSA 3OQNA 4DCGA 4DF3A 2O14A 3OT1A 5CFNA 3PGLA 3HJHA 3QKRB 3D8SA 4D25A 4TTPA 3LC1O 5GP1A 1V6AA 3TD2A 1HSZA 2HK9A 3ZVLA 3D8BA 2XNHA 2D5IA 4W63A 4J4BA 1V26A 4MV6A 4R40A 1XAHA 2XNDD 4ITVA 4INPA 1R37A 4O8CA 4GGPA 4A0HA 3AW9A 2FVYA 4OTZA 2C95A 2H4ZA 1L5GB 3FOCA 1E2FA 1AKYA 1D4FA 4OREX 2XNDA 1SULA 1C1DA 1AUQA 1NJSA 2CL0X 3A9UA 2PS1A 1TC2A 1J8QA 2OHVA 4R1MA 4I1PA 3MSCA 1JZTA 4JBLA 5H81A 2VTKA 1TA0A 4JEUA 1UZLA 1QYVA 4XWTA 3A6HA 5H3LA 3PX7A 3IAXA 4JDUA 2Q6OA 3QZUA 4QYIA 2R65A 1MGOA 1FPMA 2OKGA 2Q1SA 5JCOA 3H0EA 4J16C 3BHNA 4F4CA 1VA5A 2JAHA 3ASVA 3WGIA 4OGGA 3ZD6A 3BB4A 4ZYXA 3HK2A 4G0VA 4UUQA 2Q4TA 4PR0A 4TLCA 3TTYA 4JZKA 2F67A 2WYHA 4XVQA 2E5LB 2YYAA 1I01A 1E3SA 3E0QA 4ZAFA 1RE0A 2C9YA 3E22A 4YJFB 4I3HA 3OTQA 4E5SA 3WIDA 4G09A 5DP1A 1TZCA 5EINA 3O2QB 4OX9B 1J8DA 5JBNA 2VT7A 1EVKA 2XNKA 3IP6A 1KI3A 1X8XA 3QELB 2LTAA 4RK7A 2VPQA 3V97A 1TK2A 2EF1A 3LO8A 4F8YA 4I14A 1GGVA 3DBHA 3C3XA 1RKQA 4LHVA 4LWZA 2HCTA 2EG5A 1SBIA 1QK3A 2FW8A 3NC4A 3Q6IA 3S27A 1CETA 3FHCB 1NFFA 2FW1A 5KTNA 2HIHA 4TROA 2UAGA 3KS9A 4P7JA 1T1EA 5E4TA 1E9FA 3RKSA 1M75A 3JRWA 1W0JA 4TWRA 3VU8A 2BBTA 1ENYA 2BGRA 2WIFA 3K1AA 4XGIA 1C3JA 3KKPA 4ATNA 2CNWD 3AL3A 4LFCB 4OQQA 5AW8A 3OESA 5IXYA 3IURA 2IX9A 6AT1A 4LPSA 3LRXA 1J42A 1N1GA 1Z74A 4MKXA 4YGXB 1PX0A 1UJ5A 1T5LA 3C8MA 3MXOA 1BEEA 1KZYC 3NUGA 4KYIB 4QEDA 4XR4A 3ZBUA 2JLSA 3PFHA 4LDAA 5A7GA 4W6ZA 5ITWA 3KWLA 1T9GS 4HXFB 3INGA 1FYVA 3SI7A 1YS1X 3ETCA 3H1GA 4ETWA 2PVSA 4ZXPA 3WLRA 3O3MB 1A2BA 5KINB 1UPCA 1W5FA 4OQDA 5IAGA 4DRXA 4QHYA 1EDEA 3NIWA 3U7JA 1QLHA 3H9GA 3KWMA 3LC7O 3GMTA 4R5HA 1ISMA 2BFDA 3P9SA 1L5RA 2IZZA 4M98A 2IVFA 1E8MA 1NG1A 4HADA 1P60A 2DMRA 3A9SA 2XUAA 4L5AA 5I9LA 2PSJA 3KUKA 4CMHA 1M74A 1HLPA 2W2LD 1BWRA 1E6KA 1NQTA 1M3SA 2HPHA 2HF2A 3RU2A 1M6VB 1ZGBA 4IL5A 5EKXA 3X0DA 4DGSA 3IPAA 1J21A 4YUXA 4Z1MD 4K03A 2W2LA 4ONEA 2FPPB 2YXLA 4EJFA 1UC4B 5A71A 3VSCA 1JDTA 1D2CA 1EE2A 4OQNA 2WF9A 4Z1MA 1E9CA 4ZCMA 1YR9A 3EAQA 1JLRA 1JFRA 1HYBA 4UDNA 3P1JA 4UEOA 4QRDA 4BBPA 3EMDA 1NVBA 3HO6A 4BVHA 2NO1A 2POCA 5AK6A 4ROSA 1T2UA 4IY1A 4WPGA 4A91A 4PYNA 4MUJA 2UUBB 2WIGA 3JW8A 2HKIA 3I23A 3PIDA 3KU1A 2CVHA 4MYDA 5DGXA 4B33A 1CDDA 4B75A 1T2EA 4NDAA 2EP5A 5HF5A 1QTIA 2ZYSA 3AOEA 3B85A 2VXYA 3IDQA 5EIWA 3ZWYA 3HDGA 3QE4A 4DQXA 1GQSA 3DE3X 4QBKA 4TLAA 5ALIA 3AEUA 1B2RA 2YV2A 4KXVA 2Q3HA 5P8WA 3E9MA 1K6XA 3B53X 3KV3O 3NYQA 2HXSA 4H27A 5JJ5A 2C7GA 1F5NA 3A6ZA 3G5MA 3PEUA 5EYPA 2VT2A 1TTPB 4JHXA 2AN1A 2IUEA 4IXMA 4HAXA 4ZJYA 1J1UA 4N9QA 3V42A 5FB3A 1S4QA 3GT4A 2EIHA 3DCIA 3M6VA 4DA6A 2IQIA 1GDDA 2AXNA 2OCYC 3KJZA 2FAXA 3U7IA 2BI7A 3ETEA 2CHUA 2GN0A 2ECFA 1XNHA 2HUNA 1E2DA 2NO6A 2V98A 3HA5A 3OOYA 5C80A 3VJRA 5A0VA 5LQNA 1ZONA 1G3MA 2XUPA 1DPGA 2YOGA 3OSZA 2E49A 3PVZA 2QVYX 1MGPA 4TT3D 4V3CA 4IWNA 3ZWNA 1QLWA 3IELA 2IPOA 3AH8A 1MEEA 1I8TA 3S1AB 2AJTA 4PNEA 5GZ1A 3H99A 4US2R 4GDFA 3HY4A 4DC0A 3SX0A 4TT3A 3I04A 5EUBA 1QVVA 5JAZA 2J7PD 3E03A 2I7TA 4S1WA 2HWKA 1B1AA 2X0NA 3TNFA 3PJEA 1GSOA 1YBAA 2ZIFA 5EKUA 3TCNA 3LDAA 2C5HA 2XA1A 3M9WA 1J5PA 2ENWA 4IW3B 1W4BA 3QG1A 5DE3A 2PMBA 3CH6A 3B13B 4UHDA 4BQOA 2DLNA 1G8GA 4FZVA 4B6GA 1FTYA 3D9QX 2VT6A 1CR4A 4QU0A 3BICA 3F3YA 3RSQA 1AUPA 2QX7A 4LWPA 1BH6A 2RH5A 4EX7A 1E1QD 4XGKA 1IN6A 1PRYA 3IX7A 1K2WA 2GAFA 1JMYA 4P33A 4MRNA 1T2DA 2G3YA 2PL5A 3GYBA 1E1QA 3PNLA 3SS9X 1CQPA 2QB5A 2QA5A 3M4ZA 4PPNA 1FTGA 3C3YA 3FVQA 2QNIA 3AZQA 2CK3D 3Q88A 5CBPB 1NJ2A 4PBTA 1W5SA 1FY2A 1BYUA 1II9A 3G9XA 4GZ5A 4K1LA 2E2WA 1E20A 2V6MA 4L75A 3RVBA 3T1HB 3MCTA 3FVWA 4OXQA 3AY0A 4IV8A 5SYAA 5JS6A 3COZA 5ALEA 3I2YX 3P2OA 3OQOA 1L7PA 5K6AC 2O2XA 4M37A 1SXGA 3WNZA 4YX9A 1XZQA 3GFPA 2XQJA 1NMEA 1Q11A 1U5BA 2J45A 4PO9A 1HQYE 2Y66A 2A3RA 3AHDA 3B52X 3QJYA 2FGKA 3EY9A 2VSYA 4B09A 1XP8A 4E14A 1RQ7A 3WWYA 4RTJA 4RYLA 1C9NA 3FLBA 4KGXA 1RZUA 4G4SP 5TPZD 1FFEA 2IA5A 2NV6A 3CYFA 4EY7A 3A4IA 2QOEA 3GHHA 4NNPA 3RABA 2HBRA 3VAZA 3L7LA 3EIUA 1H6BA 1PEAA 2V4UA 1YC2A 3VR4H 1OZGA 4P83A 4QTTB 5F7XA 4LMAA 2VSQA 4OBBA 3W7BA 1YACA 2YICA 2P4HX 3ZIUA 3KRTA 2HMTA 1N2OA 2BP7A 1DRJA 1EFVB 2ERYA 4Q9AA 3TLKA 4JXXA 4ZVSA 4XOUA 1K0UA 1L8QA 3I1FA 3IFSA 1QVAA 2C98A 5I7OA 3B1KA 5CH5A 5CXSA 4F1JA 2C3YA 4N8SA 2PH5A 4JXKA 1QG6A 4U7HA 1I7PA 2Q3CA 4KSCA 2YWDA 4FR2A 3U1TA 4NH0A 2IS2A 2PZBA 1YDHA 2XMSA 4FS8A 1FFYA 4PYQA 1W4LA 1ZCBA 4M7PA 1R8JA 1BX0A 2ZZNA 3LWNA 1NNEA 4AX8A 2PBFA 1PQUA 3BQMB 2NUTB 1M5UA 3DEYX 4MWSA 4L8YA 3NTOA 3GFSA 4P7GA 4W82A 3OZIA 1EM8A 1NURA 1EZ4A 3UJ6A 5K3SA 1QCDA 2OGSA 4K9PA 1FXUA 2HK8A 2Z8XA 4GOXA 5IM5A 3TJMA 4DCVA 4MRVA 1PK8A 5EC8A 3H11B 5I9IA 1ZBQA 3LCJA 1C50A 1U2SA 4HX5A 2GASA 1Z3IX 2C4KA 2PBLA 3PGXA 2AC7A 1I2CA 4Q3LA 4AURA 2J9FA 1R0WA 3JZIA 4P86A 3DOHA 3CS3A 4XWWA 1ZHHA 4LCBA 1RQ2A 3S5JA 3ZWAA 4BNWA 2RAVA 4PZPA 4UFOA 4OQZA 1V9SA 3ZWWA 2C59A 2PUVA 5KMGA 4OGKA 1KMMA 2WYOA 2RGXA 2J48A 1SD5A 2WTAA 2NWQA 2O8DA 2HCFA 1KOLA 4RTOA 4YDRA 1RKUA 1UKZA 2Z1DA 3DTTA 4TRJA 3ZS8A 3EPLA 1X7ZA 4UTNA 3BHJA 3HLYA 2ES4A 2JD2A 4RKFA 4XQCA 4JBWA 3WA6A 2F1JA 4R05A 4WK4B 4MS3A 4OL0A 3ZNOA 4Q47A 3QHAA 3A1UA 2PV7A 1Z0DA 4AMGA 3SSAA 1LPBB 2VPZA 3LKVA 1QIKA 4ZRDA 3SQMA 1ISJA 3HP7A 1QGED 4B2PA 2AMJA 3DZ8A 2NN3C 3NJRA 1FVHA 3RSHA 3D81A 2F8SA 1WXFA 2IEDA 3K0EA 2WJJA 4EL0A 5FA8A 3QVGB 4CUJA 4DG8A 3ONDA 2QM0A 4V0LA 3HVRA 2A84A 2BKEA 2SECE 2IPLA 4YACA 5CEEA 3OG9A 1M7GA 5IXSA 1ZG3A 4UU7A 5C18A 3GLGA 2OFWA 2FZLA 3MD9A 5ES3A 4B82A 1RC8A 3CQ9A 4G2NA 1D1QA 3PXUA 5FA6A 3WIOA 4XWOA 3M70A 5EIOA 3BYZA 4D4GA 2X6TA 4QRHA 2B1QA 5WRFA 4EF5A 2NXNA 1XF9A 3AR8A 3PDHA 5F5NA 1E5XA 3EVNA 1GZ3A 3NEPX 5EKDA 4C88A 5DSZA 1WE2A 2EYUA 2RI0A 5F9MA 1WQ4A 3SXPA 1NT2A 1UM9A 3D4PA 2DPYA 1RTKA 4JLMA 3UMJA 2CYAA 1K3UB 2HBZA 3QLVC 1YCDA 3N0RA 4A92A 2AOVA 2R48A 2Y1LA 2CFCA 4F1WA 4IQ0A 5MGNA 4EFNA 3O31A 4FP9A 4ALKA 2XZOA 5DM2A 5DI3B 1M2FA 4XVRA 2LKCA 1NTOA 3L8EA 4GMXA 3DMFA 3EIXA 1U8UA 4BAGA 5I7VA 1NBMD 1WKCA 1V4NA 2FZVA 2HSDA 4B3MB 1FQKA 2EKDA 2YQ4A 2CFTA 1YS6A 4FVTA 5FTNA 1JU4A 2PWAA 5HK8A 5HNKA 1DEKA 3GPIA 5C3MA 1UFQA 5HP4A 3L93A 3O8OB 3TOVA 2W6ZA 1KGDA 4QTYA 4CF5A 1N5LA 1B8UA 4MQEA 4I1UA 2GGSA 4R8LA 1IUOA 5GONF 4CIYA 4RTPA 2AJCA 3ICQB 4L8LA 2WSIA 3KZOA 2QMHA 2RJ3A 1BCSB 1WCV1 5HILA 1VJ5A 3L0ZA 5JSYA 4GOMD 1V25A 2IYSA 1KFCB 4RS4A 3ESDA 1SZDA 3KDAA 3B6KA 3ORRA 2FKNA 1L8XA 3VOAA 5DHRA 4UZEA 4DEYA 2J9GA 3M9XA 3USCS 4BXOB 4WJLA 4H3VA 1WMAA 3MS4A 3R75A 4J29A 2V58A 3E1KA 3GW8A 4JLNA 4XW2A 1QQ5A 3S29A 2GXUA 2X9VA 4R51A 5IAEA 5FUBA 3Q7QA 1CQJB 4CM8A 4D5GA 4DDVA 5LOVF 4RA6A 1NW8A 1ORIA 3RVNA 4E3WA 5KYTA 2PFGA 2VH5R 3FLEA 3X1MA 1G20A 3NU1A 4UOEA 2E21A 2OQRA 3WLFA 3WLAA 2VJAA 3HVHA 3VAAA 3VHXB 2X9LA 3KXDA 1MIOB 3LCRA 5HCUA 3TG8A 4E7OA 4JC8A 2ZR8A 2FZGA 3AR3A 1WMSA 4KNVA 3K2EA 3NT5A 5AQ1A 5H82A 16PKA 2VH2A 3H9QA 2RKOA 3DNPA 3HJAA 3O8BA 2CCJA 3VMMA 2G0NA 1QPBA 4MQFA 3S44A 2H08A 5BVGB 1IBKB 4XIIA 2GN6A 4DSOA 3WIVA 2J9ZB 3CT6A 3W05A 3ZV4A 3GLIB 1PDWA 2ZWPA 1MNQA 4GE0A 4DIKA 3P96A 1L1EA 2OB2A 1Y6JA 1NXXA 3FCOA 2AA3A 3JWGA 4IG4A 3BBPA 3T3GA 2R7NA 3TB6A 2V54A 1KZHA 4KFRA 3ZJ4A 4JP3A 3ZC3A 4M8KA 2AQ8A 2VAMA 1I6KA 5KOJA 3FCAA 4JEMA 4R1NA 3ZHXA 3DL2A 4CMJA 2XQIA 3GP3A 2BGKA 2XTAA 3L7CA 4OQFA 3ONVA 2P4UA 3O8DA 5HBRA 3RNLA 2IZ0A 2WTUA 1G5PA 2OCGA 1U2DA 1JF8A 1NXWA 1RWNA 3OMWA 4DJ5X 5GTDA 2CNKA 1GAWA 1XNJA 2IXEA 2ZYRA 1SCAA 3BFXA 1NFQA 2OXRA 3ESCA 1F6WA 3HB4X 3VC3A 1E59A 1W35A 4N0MA 3H1TA 1Q6ZA 1YQQA 2BZSA 1RDFA 1NW5A 3FE2A 3HSSA 4L4ZA 4ZQFA 4BV9A 4PHCA 1U8CB 1DG3A 1VSUA 5KQLA 5FFFA 1U2QA 1LSSA 3WLNA 5HM8A 3LQ1A 1XXHE 3NBUA 3EEFA 3K4QA 5CYFA 3VH3A 4BLQA 4WZAA 3AP3A 4B46A 1YZFA 1PP4A 1YIAA 4MRPA 5T6BA 1R6BX 3C3PA 3CLTD 4CMEA 5JQGF 2OR3A 3LUDA 2RJOA 4YT4A 1SBQA 2IH4A 3FTNA 1Z4OA 1UFOA 1NVXQ 1RFLA 1WMBA 1BROA 2HO5A 4FJ1A 1I24A 3NKVA 1U6JA 4QELA 2VHTA 2P11A 3OFNA 3HYNA 3IUEA 2ECKA 4C4YA 3STHA 3UV6A 1QV7A 2P9JA 5K45A 1GZ6A 2P6RA 4N6GA 1AS3A 1BWPA 4H6PA 1M2OA 1FP7A 1Q1NA 3BQNB 4DXAA 4JYBA 5C35A 1W93A 2HJHA 1NXPA 1YO6A 3ASZA 2HFJA 3NHMA 2MSKA 5FPHA 3VYWA 5LZ2A 3A05A 4LX8A 1YS2X 1RRKA 4QT0A 4BRZA 2FPKA 1USUA 4YUVA 1JJIA 4RHEA 1WHSA 4G0MA 3TLAA 2WUWE 4B8YA 5HJ5A 4FU0A 4C29A 1DEHA 3ZVRA 3M6IA 2HWXA 2TMYA 3WV5A 4EY3A 2PMFA 3G0DA 4ZT3A 1A69A 4U6QA 1WU8A 1U8EA 4QXPA 1FYEA 1OLXB 1TKBA 4DV0B 4LDQA 5ALKA 2JKYA 3TQFA 2J9RA 5AVTA 1E6CA 2XRZA 4H16A 3DQQA 3DLAA 1RWPA 2J0VA 4HQFA 1NW4A 4IDBA 3MW8A 2UXDB 1XL1A 3OQIA 4BV3A 3GT7A 2AZ4A 1MO5A 2JFWA 3BM5A 3LK7A 4R1PA 2ZYUX 4B6QA 4BTEA 3RVSA 4QASA 1WZ2A 1PJ8A 3ZV5A 2G4CA 3JRXA 3ZH9B 1TQDA 4NLLA 1LBIA 2EYQA 2OUKA 2WEKA 5FUVA 1JSLA 2H17A 3AHGA 4Q01A 2OFFA 1EHCA 3K73O 3K9HA 1R64A 2GO7A 5JECA 3VR4A 3T3NA 1U9ZA 5EHIA 1ZITA 3ESRA 3W5UA 4F6RA 4HTAA 1D8AA 1C3LA 4ZQHA 3S4YA 3TD9A 4FEEA 1UWKA 4UDYX 3VYRB 2J3IA 1DDIA 1EX9A 2XKAA 1ZGHA 1MDFA 1AA9A 1KOFA 1GQYA 1T3ZA 2DC1A 2ESRA 3KTAB 4EG4A 2OZLB 2RC5A 5CA0B 4KITB 2GF0A 3ROQA 3CEAA 1K4MA 3KL4A 5A9SB 2CXRA 2FCRA 4PS0A 3C8HA 5AVUA 1TZBA 4B3JA 2W6JD 3TGWA 2W2KA 1HPLA 3A1NA 5DBFA 3SS7X 2QYTA 3OLQA 5BT8A 3QSYA 1II8A 1PWHA 2M6RA 4YRNA 5F7JA 1G17A 2W6JA 1OUMA 4URZR 1KAQA 4ND4A 4BP3A 2I76A 3OZRA 4WXRA 2X0JA 3DGEC 3KSBC 1DAEA 1U1DA 3H83A 3ISTA 2O3QA 1P7ZA 2Y2VA 3SYNA 2HPAA 5KVCA 2QW1A 3O8LA 2QTMA 2HD4A 3OT5A 2JANA 4EY5A 3D2LA 1TVEA 1G7CA 1GP2A 3QHPA 4LOLA 4M86A 3VC7A 4ND2A 3IGFA 5JEEA 1HLFA 4V1CB 3DNMA 2YJGA 2B92A 5JV5A 1XLWA 4M1ZA 2NQ2C 3GPDG 1AKUA 3ICVA 4FDTA 4TMVA 3EGEA 2SCUB 5EJ5A 4DCTA 3ZX4A 1DU4A 4FLEA 5FTMA 5IABA 3HR4A 1BA3A 2IW3A 4K81B 2GVDC 1ZUNA 2OGWA 4M87A 5LQSA 1HFKA 1DJNA 1W5EA 2G5CA 2I5PO 4MDHA 4F45A 4W9MC 4BMXA 2Z58A 2BELA 4ZU1X 3WL4A 3N74A 4J9VA 2FRDC 2O0LA 4Z4IA 3GNSA 2V74B 4QTZA 4RNCA 1X1SA 3GAZA 1E92A 4WY2A 1W9HA 4WCFA 1ICEA 1N2JA 3EZFA 2FQYA 4KQWA 1BJKA 4W5TA 1AKWA 5IVPA 3D0OA 4KK3A 2JHGA 4RVGA 1XGKA 4FOSA 2IYNA 2V0CA 1TGVA 3M3HA 4WZBA 1EQAA 3DT6A 4LRXA 4G85A 1ZMTA 2ZM6B 2QYHA 2FJPA 5LFAA 4D97A 1VSVA 1V16A 2WSLA 1AVTA 1O54A 1T8SA 3HSKA 3REQB 1Y8CA 3TEJA 1OOEA 2H31A 3RTDA 2YZ2A 5EJ2A 1XA0A 3K0AA 1R74A 1TAHA 3DR3A 1AHNA 4EKNB 4Q4CA 3QVSA 2VRBA 1ZA2A 1LF5A 2WMDA 4FPXA 5F64A 5CFRA 3QI7A 4EYEA 3LOUA 4G5RA 3L4KA 5CNMA 1JDUA 3K70C 4OXKA 1UAAA 3QH4A 2LVBA 1SUSA 1MXHA 1ZCJA 2XMPA 4PRKA 4B7XA 2GZMA 4LZJA 1JPJA 3DMGA 2IYEA 2L17A 2B3TA 4Z9XA 4MQLA 4I50A 3WISA 5ADHA 4LF7B 5A4JA 5A3VA 4X7RA 4B5LA 1F48A 1FP4A 4FDAA 2XBUA 4INAA 1M9NA 2DHCA 3BMOA 3I53A 2IYAA 4L15A 1FUYB 2G71A 2C1EA 4L72A 4ZGGA 5ICEA 2M6KA 2H29A 3G8YA 2O20A 3IBYA 4Z9FA 5AHXA 1BS2A 4RV5A 1LBHA 3EZNA 4V03A 5E1BA 2ZJ0A 2GN2A 3O93A 2WV7A 3R44A 3DC7A 2O54A 4MUXA 4ZVNA 3SN6A 1KI8A 1FXSA 4US0R 1O9HA 4GI1A 2W2TA 2H2DA 3IAM6 1WWKA 3ZY6A 2C2OA 4RQBA 4ERXA 3FPAA 1I5EA 2CEKA 2I99A 3SE0A 5I4BA 3ZDZB 1P1HA 5I9TA 2QQFA 1BJRE 4BBJA 1WA5A 3LPAA 1TD9A 4Q3DA 1GSHA 4K9RA 2LIPA 1T0IA 3F1KA 3WJ7A 3PR3A 4FZRA 2QMQA 2Q0XA 1RYHA 4BLWA 3D2AA 4BE9A 2JHFA 3BRWD 3O73A 1GFWA 3A32A 3DD5A 3IVRA 4F2DA 5B7GA 3LUJA 1PWYE 2YIJA 1QCZA 2ZIWB 2IPNA 3KU4A 2ZKIA 2FP4B 4X5OA 5EJMA 5FNVF 3E8XA 4EQZA 3H2GA 4MKHA 1CU1A 4C3VA 4J7AA 2PEYA 3V2IA 4MUEA 3H9BA 2YVLA 3H1EA 5IJ0B 4QG7A 3OT4A 5COQA 3H4IA 1QRDA 4C0HA 3IBFA 4HDQB 2AUTA 2ZOSA 3I4LA 3O2JA 1CZOA 4L8FA 3QQ5A 1DC8A 4LC0A 4R7GA 5DOVA 3AR2A 1XEXA 2X0EA 4B7AA 5IASA 2AGVA 4LNUA 3RTAA 1J1IA 2B78A 1OIWA 1WW2A 2MOKA 4JR1A 5BV0A 1KEUA 4OAQA 2CLMB 3D7LA 4BN4A 4IJKA 4D99A 3V8EA 2DULA 3IPRA 4F2WA 3BGSA 1MX5A 4Q1EA 5I7HA 1S9HA 1TIBA 2FFAA 2GWRA 2GXQA 5JAHA 5FT9A 4AG5A 3BGOS 3VTFA 3U80A 1IQRA 4R81A 2OM6A 4UTXA 3TTUA 3NVKI 4YAOA 1IQPA 4QGFA 1Y7IA 4I55B 3G1TA 1TE2A 1BVUA 2CCKA 5E4FA 3P52A 1UMDB 3B6JA 4TXMA 2OFOA 3T38A 2CSXA 4M0UA 2OO5A 3HJBA 1XRSB 1Z36A 5DGTA 1X3LA 4NNOA 4Q12A 4WASA 1TQ4A 2X4GA 3G23A 2FMXA 2PT9A 2Q5IA 3P0FA 4ZRNA 4W1SA 3WGJA 1XZEA 3QXSA 5EFOA 1JA9A 2FSVC 2B9VA 421PA 4DJEC 2PA3A 4AP9A 4EKIA 2F9LA 2MMCA 1YK0A 2WLSA 4MZDA 3T95A 1PG5A 5IDYA 1XD2B 2OG1A 5FCDA 1MX3A 3Q2OA 1RYMA 1VOTA 4LFAB 2ZRGA 3L0YA 4FMPA 3O8CA 3IKMB 4C4ZA 1Z26A 1MO3A 3PV0A 1AV6A 2JHPA 4CKEB 4C6HA 3IQGX 2ZQZA 2O5CA 5CTAA 4FK8A 2I33A 3L4SO 3TSAA 4ZKDA 3D7MA 4EUKA 4GX1A 2IUFA 4FYXA 4HAWA 3I2JA 3IEPA 1DJMA 1RLOA 4LNHA 5DIZA 3UAVA 3IOMA 3TVYA 4E12A 4ZCLA 4JL5A 4E1AA 1ZU5A 2B4KA 1SBHA 4U39A 3QQPA 4XB2A 8ABPA 1R66A 2KE5A 5SY4A 3RSFA 4L57A 2NIPA 4YMVA 1EAMA 2ZAYA 3WHPA 5BPHA 4P4UA 4ND8B 1COZA 2I03A 1GUYA 2VPPA 4L5YA 2J5RA 4WCDA 3QFTA 5LA6F 4V38A 5SY6A 4ALIA 2O1XA 2QORA 1Q17A 2QY9A 3GWZA 3WA7A 1KE1A 4FDLA 2FKAA 5JS1A 1YCFA 5AVRA 3SQLA 4XLZA 4ON9A 3MLEA 2AJBA 3B7WA 4CN9A 1M34E 2HJVA 3OD5A 4MP3A 4D6YA 4YP7A 2ZYGA 1JKXA 5KVVA 2X9GA 3F7NA 3ZGYA 4NWIA 5GINE 2EHJA 1LTQA 4GPTA 3MC1A 4EG0A 3IVAA 5E1OA 2EZ4A 2JFUA 3MUEA 4PONA 3VR5D 1T6NA 4PLTA 4A8PA 1G291 1FRZA 3SFZA 4JT4A 2IXGA 3Q3EA 3ZU2A 4N1AA 1CR2A 5FDFA 1X7YA 9ATCA 2YZKA 5EXDA 4BS9A 1U8XX 2AE2A 3EMBA 3WLTA 2HIAA 3H8WA 1P6QA 4IKPA 2A5DA 1P2SA 4OB8A 3KPJA 1M1NA 4IJMA 5LYYA 4YUZA 3DT9A 2GM5A 1R18A 4JU9A 2FPRA 1ZK0A 1ML3A 3R8XA 3DFIA 4P3KA 5SICE 5JPIA 5A7FA 5HM6A 1ESMA 3GDHA 3IDOA 1ADFA 3V7NA 1Q1QA 3NHLA 1E64A 3D0KA 3KZMA 3RAEC 3TQCA 2HU5A 1W0KD 3L7JA 5LP6F 4X1YA 3GPLA 1E3JA 2PS3A 3JWPA 3PGKA 3ACCA 1KMNA 5LWHA 3OPYA 3QFRA 3GLIE 3RR2A 4UHFA 4KR0A 5D5HA 1QP7A 4NJEA 1CF4A 4K9DA 4NCJA 4BPBA 3TAHA 1PYOA 3E3NA 4DEXA 5BN5A 2R7KA 1PZHA 3M6LA 1VL0A 1X1CA 3KT6A 2N3ZA 5I7UA 1Z16A 2DWCA 1HFJA 1OXKB 1XZGA 4HLUA 5LWQA 1IBRA 1B8OA 1WXHA 4RH0A 4GU5A 4ZVRA 3AINA 2PFSA 4QEZA 3L8YA 5HWSA 1S8NA 2LCQA 2HZ7A 5LBIA 1T4MA 3MJHA 1T9AA 4KIGA 4Q9DA 5DEOA 1QIGA 4V0KA 2I78A 3GRUA 3N07A 4PYIA 2R8OA 13PKA 2CXHA 1DADA 2BHRA 3T6KA 4DV5B 5A4DA 3QU7A 3B12A 4O4LA 2XQFA 3IAS1 4XWYA 3O47A 1HTWA 3WBBA 4WK0B 2QSZA 3HFJA 1BE8A 4U00A 1ZHOA 1E9AA 3ZJ5A 2C84A 3OCWA 3R77A 3PJGA 1YVEI 4W8OA 4DZZA 3IL2A 2CLDX 3K20A 3B2QA 4MQ4A 4NU5A 5E6SA 2HQSA 1OFUA 2V5VA 1KK3A 5TR9A 1P29A 2H9AA 4YMUA 3QLEA 1YZUA 3KJIA 3E05A 4ENWA 1ZW6A 3WLSA 4D9NA 5H80A 2AX3A 5DH9A 5HZMA 3A6EA 4NABA 1WAMA 4DV2B 2RGUA 3IYLW 2WHPB 5SZIA 3T9CA 1TNDA 3OU7A 4UKDA 5IBPA 3CEJA 3UAWA 2AOWA 5FOSA 3I2KA 2X1VA 4R2XA 3H16A 3L1UA 4KO2S 3VVLA 1HG0A 5LIPA 3M34A 4EQ6A 1KY5A 2ZT6A 4FCWA 5KJCA 3QXXA 4R9NA 1S6YA 2Q8QA 4JGIA 2XAAA 2FN9A 1YA4A 2F3PA 1GKIA 3GY0A 2FXIA 4PLYA 2GOYA 2MCFA 4DRYA 3HUTA 4ARIA 4GICA 3QPAA 1I33A 3VKUA 5JT1A 2JKZA 3G2LA 3QVXA 4KW7A 2ZZMA 2QMOA 2PJUA 5KTMA 3SWWA 3WICA 1PV4A 3SK0A 1YUNA 1LQUA 4P5EA 1VLQA 3PC6A 4I9NA 2JASA 4BX3A 3BJEA 1EFHA 4PG7A 1YUBA 2V7QD 1W30A 4QOFA 4Z2YA 1CRQA 1ZOSA 1PLLA 2GFIA 1LI5A 3ZUGA 3EEOA 1OMOA 2BFFA 1KETA 4BFUA 2I1LA 1GU7A 1Z8FA 5AJWA 2A0YA 2V7QA 3G2HA 5UKDA 3T9EA 3C16C 3UA4A 4DL9A 4RMJA 3SSMA 4D3FA 2WWRA 1A3CA 1P31A 3L0IB 3PFWO 1U99A 3RUCA 4UAUA 1QHFA 1RQLA 3G0GA 1U1FA 4PGHA 3DOJA 1CS0A 1JAXA 4EJSA 5CLQA 5KX5F 4ZO8A 2HLPA 3T5PA 3GARA 3WRYC 3JTEA 1GARA 2MINB 4NS4A 3A4YA 3BJRA 4TN5A 4A15A 3DE7X 2XRFA 3P4UA 1M2JA 1QFZA 3PZBA 1HE5A 4TMZA 1RW4A 3I5UA 4FHDA 3IPXA 3QUBA 1V7QA 5I9BA 4UPVA 5L7WA 4CKZA 1UPXA 3R76A 4J4TA 1QF7A 1YJCA 2ZI6A 3GZJA 1OAOC 2GYYA 5F1PA 5K05A 2ZJ5A 3JAMA 4E03A 1RI2A 1US8A 3BXEA 3QU2A 2YZGA 1CHNA 5KDDA 1B3RA 5E9QA 8OHMA 3L79A 3KPUA 1E1KA 2XXBA 4GPD1 2Y9PB 1N5KA 3QEMA 3U1VA 2IRWA 3K8QA 4W1QA 3VBEA 5A03A 4ZZ3A 1P0IA 4YPVA 3K0CC 1VE1A 3GD7A 2FR8A 4OXXA 3FTCA 4ER0A 1YL7A 1IUPA 2P2DA 2Z2KA 2X4DA 3AERA 3DUFA 3OEWA 5AM4A 5ALUA 3VPXA 5HR5A 2ICAA 2Q6LA 2WI8A 3ELWA 3AXSA 1RSZA 4KMOA 2Y1EA 5CDUA 3E4CA 2GA8A 4KCGA 4BEWA 4FNMA 4Q18A 4Z5XA 1CEEA 4JI1B 4M1MA 4INOA 2O8BA 3L77A 2OORC 5EFZA 5DBHX 3WMWA 4HGRA 4PGMA 1NU8A 4IMJB 2P8JA 4HRYA 2R0QC 1PJ2A 2NP6A 1SEVA 5B53A 1JHDA 2H4XA 1LC0A 2A88A 3PDCA 3ILHA 1JXQA 1Z0KA 2WIDA 4OMUA 4CIBA 4H31A 1M33A 1WPRA 1G6KA 3CJQA 2R4QA 3NWJA 3A4MA 3J7AC 4MICA 4K8RB 3RI3A 1K7CA 2FSGA 2G0AA 3PNVA 3SF8A 3I30X 2OGUA 1U1EA 2C03A 4N8DA 1QQBA 3GYGA 2JBHA 1DUSA 4J3FA 3ITNA 5EQTA 1WXWA 2C3UA 3C15C 4KGDA 1S96A 2J08A 1G6OA 2DTXA 2WVAA 2XGSA 2WF5A 1DWUA 2J0UB 2XWJI 3EULA 2P79A 1AKEA 1XFAA 3ESYA 4OXNA 4DC1A 4L0CA 1ONNA 1MZPA 4LRWA 1EFAA 3QNWA 1VXRA 2DBYA 5G4KA 3LF2A 1KWGA 4DW8A 1AXGA 3FUTA 4PZAA 4HTFB 5KKCA 1NE7A 1EUDA 2EJWA 1G7TA 2JLRA 4HLCA 1V7CA 5THXA 4D79A 4QM6A 3ANLA 3VH1A 4EX6A 4HJXA 2FNAA 3QWBA 3ISVA 2J3HA 1HQCA 4G9EA 1C9DB 1UUFA 4EYKA 1G2QA 4ZANA 1FNNA 4QAJA 1L7RA 1LPSA 2B1JA 5ISMA 4DR3B 1SG6A 2RHWA 3MWLA 4GX0A 4HH4A 1IY8A 4ZQBA 2WDPA 3PPYA 3RTBA 3UQYS 4E3ZA 2ETVA 4K6KA 1H2AS 1TVCA 1Z38A 1ZS9A 1Z17A 2BFCA 2YW2A 3UBMA 1KEZA 3K0FA 2JLXA 3QEBZ 4CIAA 1H0HA 3P9YA 3HZOA 5EMLA 1WHTB 2ASVA 4M8IA 2Y0EA 1N6KA 1O87A 3F46A 4FFWA 4IPTA 5J2UB 2GBPA 3LX4A 3RUEA 1WUTA 1LLCA 2A14A 1PT7A 4PAWA 1E2UA 3UK0A 1IHXA 5IFLA 4EKGA 3QOWA 3GROA 2V1XA 3TFQA 1YB4A 1GPAA 2CE2X 1YRHA 3G8CA 4C6TB 2PY6A 4RTKA 1Z0SA 1HH4A 1EQ2A 1GNPA 3BJZA 1RXCA 3M8KA 4HX9A 3A28A 3RREA 4TQAA 3GUUA 2WY2D 4AX4A 4K2AA 4KREA 1Y7LA 1D4AA 4BNDA 5BSVA 2IYYA 1VBNA 1EQUA 5HZGA 3PUIA 1PR2A 1V43A 3ZHOA 1NM5C 4ZODA 4Z7JA 3FGNA 3AVTA 4HAZA 3USZA 5B1YA 5LMUB 3JZDA 4NCIA 5BMVA 3LTEA 1E61A 3HDHA 2PD3A 3O4HA 1JEAA 1Y42X 3VSBA 4MWTA 2A0FA 4FDVA 4Y1FA 1XMXA 1DB3A 1TZKA 3VO1A 1A4XA 2GB4A 4X9XA 4XX0B 2ZBQA 2B4AA 4ND3A 1OBVA 5TQ2B 2OESA 4RZ2A 2YWGA 4WBNF 3C85A 1NRIA 3P2KA 1EG7A 1ZA1A 2OWDA 1TJYA 5BQFA 1OGYA 4ZOLB 5A3RA 1CQIA 2A1UB 2JGFA 4ZOEA 4YI3A 4EATA 5ITZA 2A1TR 2PA0A 3JD0A 2ZDGA 2XYRA 3GX1A 1S5PA 2IK8A 2BFBB 5F12A 1YAHA 2VNHA 3M4NA 1X2BA 1QF9A 2VRCD 3CF6R 4BC0A 3QVKA 2BI4A 4F97A 5C1OA 1HUQA 5CM9C 4P2GA 3STTA 4ZI2A 2WU8A 4L3VA 3CONA 1VCMA 2Y1FA 3TDNA 4LECA 2EJCA 3M6XA 2PTGA 2WHYA 3ORSA 5EG5A 2JCBA 2A9QA 3MBOA 2ET6A 4H6VA 2V96A 4PYOA 1N32B 1KP3A 1RNLA 3MJRA 1J0DA 3F47A 4E31A 2IUTA 5J2TA 1T9KA 2G77B 2GT1A 1RLJA 1Y3DE 3DOUA 5JARA 1M76A 1WZUA 3BMNB 3DVRX 4KI7A 4YCDA 2XCIA 2GCIA 2O4CA 5TT0A 2DCMA 5G3ZA 1AY0A 4M83A 5KYWB 3EXG1 2O7SA 4JLJA 2MT9A 1PYDA 2ZTUA 1QDEA 2B83A 2Z95A 4MVJE 1GJRA 2O07A 3RC3A 4D0RA 3C3AA 3WL8A 1OU4A 1UXGA 1O77A 3MG9A 3LZCA 2I8CA 4G1EB 1WKBA 3UV7A 3JQ7A 2PSEA 3Q5EA 2OV1A 3PVSA 1LGYA 3CKMA 3OTHA 2QVGA 3PQ5A 5LOVB 2AYXA 4JLBA 1N2CE 3A36A 3VPGA 1SHJA 4EFMA 3TZBA 4ZO7A 4C0KA 4EG5A 4BCBA 5B1HA 4DIEA 3ORFA 1RQPA 4KDEA 2B1IA 3K2BA 4BNYA 1M6EX 3AVQA 5JU6A 3A4LA 3K0BA 3MT7A 1RC1A 3EYWA 1G8AA 5AM5A 2GXSA 5FI5A 3H8JA 3L49A 4C07A 4HYYA 3SR4A 4CDMA 1ZJZA 2JLUA 4KIJA 2F62A 2M1ZA 1JFFA 1X9GA 3IC5A 4XJTA 4P81A 4ZYVA 5EWMB 5KAMA 5AUNB 5AH0A 1M1YB 3PNYA 3WAJA 3EOZA 5IKOA 1JDNA 2D7CA 3GRZA 4LQ4A 4AY3A 1WXDA 1Q7TA 3FDXA 2HCRA 3RJTA 2YCLA 3HXTA 4IINA 2VF2A 3PUWA 4KU4A 4WUTA 3BWVA 3FLMA 2Q3FA 3NUQA 5A6SB 1C0KA 1DG9A 1DXHA 3NXKA 1GGHA