3MERA

Crystal structure of the methyltransferase slr1183 from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr145
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
173
Chain Sequence
EPNDFLVSVANQIPQGKILCLAEGEGRNACFLASLGYEVTAVDQSSVGLAKAKQLAQEKGVKITTVQSNLADFDIVADAWEGIVSIFCHLPSSLRQQLYPKVYQGLKPGGVFILEGFAPEQLQYNTGGPKDLDLLPKLETLQSELPSLNWLIANNLERNKAALIQLLGQKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Slr1183 protein
publication title Northeast Structural Genomics Consortium Target SgR145
rcsb
source organism Synechocystis sp.
molecule tags Structural genomics, unknown function
total genus 47
structure length 173
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3merA00
2OYRA 5E1OA 5HOQA 3JWIA 5DSTA 3EVGA 3HCAA 3PFGA 1L3IA 3I9FA 3LX6A 5CM2Z 5M5BA 3MHTA 3CKKA 2B2CA 5EVJA 4E33A 2Q41A 3UJ7A 4ER5A 3B3FA 2P8JA 3G5LA 1DUSA 5FUBA 4R6XA 4C06A 4F85A 5HIKA 3TOSA 2AZTA 4GBED 4HTFB 2QM3A 4PNEA 2B9EA 3B5IA 3JWGA 2G8NA 4C04A 2ZCJA 2PT9A 4AUKA 4LG1A 5C9ZA 2WK1A 3OPNA 4ZTBA 1JG2A 2AOTA 3CJQA 5DM4A 5DTMA 2YXDA 5HILA 3LKZA 3T7SA 1FJXA 2JH9A 2AOWA 3PFHA 3I58A 5KYGA 3EGEA 1UWVA 2CMGA 3HEMA 3EVFA 4P7GA 2CMHA 2O57A 4OQDA 5GIPE 3DUWA 3UWPA 3LDFA 3HVIA 1QAMA 1X19A 2DULA 2GAFA 3E8SA 1F38A 4E2YA 5F2NA 1DL5A 5E9QA 5BXYA 3GRZA 3SSMA 5U4XA 2FRXA 5DXJA 4ER0A 4FSDA 3PS9A 3DXYA 5HFJA 3CGGA 4F86A 5CCXA 1RJDA 1P39A 2IGTA 3P9KA 4EK9A 2GLUA 2H00A 4MQ4A 3V97A 1WZNA 4RTRA 4QPNA 3Q7EA 2PWPA 3DOUA 2UYQA 5EIWA 3KQTA 1NV8A 4YUYA 3KQSA 2VS1A 4RVGA 5CCBA 3A4TA 3GGDA 3I53A 4CKCA 5K0BA 2AOXA 2IBTA 2VDVE 3NDJA 3T0IA 3HA5A 3NWBA 4FS8A 3PX3A 3ELDA 3G7UA 5EEGA 5ERGB 2PY6A 5DX8A 4MIKA 5K0CA 3A25A 3BT7A 2BR4A 3PTAA 2GA9A 2Y1WA 4FT4A 4NECA 2JJQA 4DQ0A 5FA5A 2DPMA 3FUTA 2AOUA 3E7PA 2WA1A 1G60A 1XDUA 3EVDA 3AXTA 4HRAA 4DMGA 5K0FA 3MCZA 1QAQA 4RSRA 5DSXA 5DM1A 3C3PA 5HIMA 3LL7A 2IP2A 5K0LA 4YMGA 5K0GA 2O07A 2UYOA 2YVLA 1I9GA 2E5WA 3D2LA 3GNLA 4HC4A 4KVZA 2V74B 5EHGA 9MHTA 2IPXA 2P35A 5EEHA 1VIDA 3F4KA 4CXMA 3KQVA 1KHHA 1SUSA 2BR3A 1X1CA 3P97A 5LQKA 3GJYA 3NVKI 3LHDA 4CKBA 2EJUA 4PYIA 3K6RA 4BP3A 2HNKA 5MHTA 7MHTA 2ZVJA 3FZGA 3IEIA 3OE5A 1U2ZA 2ZZKA 4GOMD 3GU3A 5EPEA 3REOA 1JG3A 4M38A 3TR6A 2PXCA 2CKDA 3DULA 2R3SA 2V7EA 1VL5A 4H0NA 5FA8A 3KQYA 4BY9E 4C08A 5BW5A 5F2KA 3SXJA 1MJFA 3AWIA 4PGHA 2KW5A 1IY9A 3CJTA 4RTKA 3MGGA 2BM8A 5KQRA 4RTOA 4CTKA 1D2GA 5EMKA 1G8SA 5K0JA 3FPJA 3MB5A 3FPHA 5FTWA 3DR5A 2C7QA 3BWCA 3B3JA 4DA4A 4GC5A 3X0DA 3R9XB 3DLIA 5CVDA 3DTNA 3EVZA 2I9KA 3FUVA 3EVCA 1B42A 1SUIA 5E1BA 2BZGA 3G8AA 2PX8A 4PGGA 3ELUA 2HTEA 3NJRA 2AS0A 2G71A 1KXZA 1WXXA 2ERCA 2ONYA 3GDHA 5LQAA 3FTDA 4RTSA 3G88A 4L7VA 5DRTA 10MHA 3PX2A 2PSSA 2QRVB 4AZSA 2YQZA 3EEYA 2O06A 3U81A 4GUAA 3UA4A 3MTIA 5BP7A 4AZTA 4EKGA 2ESRA 2OPBA 3OU2A 3PB3A 4OBWA 4X63A 4DF3A 1O9GA 1G55A 5DWQA 4IWNA 5EKUA 3BUSA 4FZVA 5K05A 2ZTHA 2P7HA 5JR3A 1WG8A 5CVJA 4ATNA 5EMMA 2BR5A 4KWCA 4CKEA 1VP9A 1OR8A 2G72A 3EMDA 2O05A 3EVEA 1QANA 1ZKDA 5FQOA 4U7TB 3THRA 3TM4A 2OKCA 3G2PA 1N7IA 1JQEA 1AQIA 3S68A 3UJAA 3LECA 1YZHA 1R00A 1X1BA 2P3OA 1IXKA 1TPYA 5IKMA 1I1NA 4KDRA 1WY7A 5FHRA 3ELWA 1YFLA 2I62A 3GWZA 3MCTA 4PWYA 2NNWB 2JHAA 4AZVA 3T7RA 5CVVA 1AQJA 1RI5A 5EG5A 3G8BA 5EMJA 3HCCA 2AN4A 2NXCA 3M6VA 5EKXA 3SR4A 3E23A 4POOA 3OZTA 5GINE 4HG2A 5H02A 3BGIA 5P8WA 4G56A 2JHCA 4KIGA 2P7IA 3UJCA 5HIIA 3GXOA 3RW9A 3LGAA 4E32A 3EVAA 3TM5A 5E1MA 3HVHA 3P9NA 2HR1A 2JHPA 3BKWA 4KIFA 5CD1A 4QVKA 1I4WA 5KVAA 1JG4A 3M4XA 3OZSA 2VDUE 5F2OA 2NP6A 5BW4A 5LQUA 1M6EX 1XCLA 4M7RA 5E2BA 2YX1A 3SVZA 4EVIA 5K0EA 3HA3A 1AF7A 5B1SA 4P7FA 4V0QA 2K4MA 1SQFA 2IBSA 4P7KA 3AXSA 2BM9A 2OB1A 3LSTA 4QDJA 2CL5A 3K0BA 2XYQA 4V0RA 3SMQA 4BP1A 2NP7A 1AV6A 4RV9A 3SM3A 1Q0SA 1M0EA 3NTVA 1O9HA 2PJDA 1NW5A 3L8DA 4E2XA 2IH2A 1QAOA 3E05A 3CJRA 2YXEA 2XVAA 3V8VA 4OX9Y 1XJ5A 4KW7A 5LQCA 5ICCA 5EZQA 2AVNA 4YMHA 5LQNA 5HEKA 4RTMA 4IV8A 2B3TA 2FCAA 2WA2A 1KPGA 3IYLW 4RTLA 5DX1A 3NW9A 2EJTA 4KDCA 5K09A 1L3BA 3MQ2A 5DTRA 5FADA 3GCZA 4XUEA 2ZULA 1JG1A 1L3CA 5FCDA 4ER3A 5HIJA 3B7PA 2EX4A 2P40A 4RWZA 3MAGA 3P2EA 3FYDA 3GRRA 2OXTA 2IH5A 4AX8A 3FTFA 1HNNA 3HP7A 2QRVA 5E8JA 2C7RA 5DLYA 2ZWAA 4LWOA 2JG3A 5DXAA 1YFJA 1YB2A 1BKYA 3M33A 3I64A 2OO3A 5K03A 1R18A 3ER9A 3JWJA 3LCVB 4R8RA 1XTPA 3UJBA 1Y8CA 4OBXA 2Z6AA 2PKWA 2P3QA 4DZRA 1JQ3A 1X1DA 4QVGA 1IM8A 3G2OA 5T6BA 1R6AA 3H2BA 3Q87B 1UFKA 5CUQA 2ZZMA 3CBGA 4GF5A 4YUVA 5T67A 3SX0A 3G2QA 2UYHA 4MWZA 3KU1A 4ISCA 1Q0TA 5E1DA 4E2WA 3KQMA 2C7PA 4HTFA 3BGDA 2XBMA 1XXLA 4HSGA 1NW6A 1NW7A 2AR0A 2O0LA 2HMYB 1QZZA 3BWBA 4LWPA 4OA5A 2ZBRA 4MTLA 1L9KA 4RVDA 4HGYA 3QOXA 3ELYA 1P1CA 4FT2A 2PX5A 5EMLA 5CVEA 2OZVA 3OE4A 4HH4A 3OFJA 4FSXA 2AOVA 4BLVA 4LECA 1ORIA 1ZHFA 1G8AA 4PIPA 4QQKA 4DM3A 2ZBPA 5LQJA 2AN5A 3C3YA 3UFBA 2EG5A 1FPQA 1G6Q1 1XDZA 3HA7A 3KHKA 2YUIA 1BOOA 3A7EA 3IV6A 4PYMA 3VC1A 2ZZNA 4M37A 1R8XA 3FPGA 5C0OE 1SVUA 3P2IA 2H1RA 4PIMA 4FR0A 1VQ1A 4B17A 2XYRA 3EGVA 2IDJA 5DTQA 4EKIA 4ER7A 3C0KA 5DM0A 5T64A 2OB2A 3KPVA 2JH8A 3DLCA 4RVFA 3OU6A 4IKPA 4R05A 4AZWA 4R6WA 5D1HA 1QYRA 3LBYA 4UOEA 5DRYA 3O31A 4C03A 3ORHA 5E9WA 3CC8A 3LPMA 3G2MA 5DX0A 1RI4A 3C6KA 4QPPA 3LCCA 2GS9A 3SGLA 4C07A 5LSAA 2QYOA 3LBFA 4XUDA 3TKYA 2IIPA 3BZBA 1YF3A 1KPIA 2XYVA 2ZLBA 3ME5A 2AOUB 3UJDA 3TPZA 2PVCA 1RJEA 3CVOA 5FWAA 3BXOA 5E2AA 5ICFA 2EFJA 1DCTA 3A7DA 4RYLA 1RI2A 4WVLA 3T7TA 3HTXA 3QV2A 2PX4A 1L1EA 1KYWA 3NDIA 5EZSA 1WS6A 4U7PB 3KR0A 2ZWVA 2PGXA 1JTFA 3HCBA 4QTTB 3DXZA 3KR2A 3DMGA 2ONZA 2F8LA 3EMBA 3OFKA 4GC9A 4XUCA 3UA3A 4KRGA 4EMSA 3AJDA 3NWEA 5E9JA 3DMHA 4E30A 1ZQ9A 3R3HA 5GM2A 4RTQA 4RTJA 5C1IA 5CIYA 1NBHA 3R6TA 4FP9A 4R8SA 1FP1D 4K6MA 5E8RA 3UJ6A 1Z3CA 3NMUF 4PCLA 8MHTA 3P9IA 3OZRA 2B25A 3KQPA 1P91A 3I5UA 3LDUA 1NE2A 4A6EA 2OBFA 5K0NA 3A26A 5DT2A 3DXXA 2IFTA 2HV9A 4HGZA 2P41A 1HMYA 3M6WA 4O29A 5FWDA 4C4AA 2G1PA 1UIRA 1VP3A 5G02A 5GP1A 3G5TA 1EQAA 4YUWA 4JXJA 3BGVA 1RI1A 4OA8A 1JSXA 3FRHA 3TRKA 5GWXA 4Y2HA 2IH4A 4PCAA 5FQNA 2YR0A 3FPEA 2QY6A 2PV0A 2HWKA 3TKAA 3HVJA 2CWWA 1M6YA 3FTEA 5FHQA 3DH0A 1ZGJA 4M36A 4CTJA 2ZIEA 3AY0A 2XVMA 3THSA 3FUWA 4PYKA 3P8ZA 3ER8A 3LKDA 4ER6A 5IH3A 1EG2A 3EEOA 3O4FA 1XVAA 2Z6QA 3FPFA 3IHTA 3JWHA 4C05A 4EQZA 3HCDA 1MHTA 4DCMA 3EPPA 1X1AA 2R6ZA 1RJFA 2AN3A 3BWYA 5DM2A 4XCXA 5ICGA 1EJ0A 2ZW9A 5KS2A 2AVDA 2PBFA 5K01A 4YUXA 2ZBQA 5KQSA 1V39A 2IDKA 5GOZA 4BLWA 3WSTA 3KPJA 1TW3A 3LCUA 4QDKA 3B89A 3GIWA 1D2HA 2N47A 4PYOA 3OU7A 1KPHA 4RX1A 1KIAA 2ZSUA 2PX2A 1EJ6A 1PRYA 4P7JA 4X61A 3TMAA 1KR5A 3VYWA 1WXWA 1VLMA 4A6DA 2PT6A 4MHTA 2OY0A 3GRVA 5GM1A 5DPMA 4RVHA 2VZ9A 4GEKA 4PINA 4YV2A 1NKVA 3KKZA 4QQNA 4FGZA 4PYJA 3GRUA 3SSOA 3MERA 1YZ3A 4Y30A 4X60A 3HCFA 1ZGAA 5D1NA 2VP3A 5GIOE 4GOOD 2UYCA 3TLJA 1BC5A 1SQGA 3GO4A 3KQWA 2ZIFA 3C6MA 3FUUA 2AOTB 3BWMA 4PONA 1XCJA 5EQJB 3ERCA 3ANXA 1JQDA 3TQSA 1EAMA 3HCEA 2P3LA 2BH2A 3KR1A 1PJZA 1R74A 5CVUA 2A14A 1YUBA 3MTEA 1XDSA 2VDWA 4F84A 4DCGA 3UBTA 3PLAE 5LR6A 1F3LA 4X1OA 3UJ8A 1NT2A 3R0QA 2ADMA 3PT9A 3KR9A 4BLUA 2ZFUA 2FYTA 3GRYA 1P1BA 4E70A 3BKXA 2ZIGA 3O7WA 1D2CA 1RI3A 3KPWA 2ORED 4RTNA 4DKJA 5JUWA 2GH1A 4QTUB 3UZUA 5EIFA 2PXXA 2H11A 3QOWA 1BHJA 2FPOA 3RIEA 2P1DA 2I6GA 3FUXA 3ID6C 4E2ZA 4GQBA 5K8VA 5EGSA 3KQOA 3DMFA 5FULA 3HM2A 4YUZA 3A27A 4PYLA 1NBIA 4Z2YA 2FK8A 2NXJA 2LD4A 3M70A 2PWYA 4E31A 1KYZA 1ZG3A 3R24A 4YV0A 1NW3A 4PYNA 2G70A 1INLA 4CWAA 2C7OA 3SSNA 2NXEA 3CCFA 2NYUA 1VBFA 4P58A 5EHIA 3VSEA 3B3GA 2GPYA 3M6UA 1TW2A 3OCJA 2FHPA 3P71T 1T43A 3KPUA 4GOLD 5EC8A 5EOVA 1O54A 3FRIA 3UJ9A 3VC2A 1JR4A 2NXNA 2PXAA 3KPYA 5HZMA 1R8YA 3TFWA 1H1DA 1FP2A 4IV0A 1VE3A 3KQQA 2YXLA 1FBNA 4YV1A 3RODA 3HNRA 1SKMA 1NV9A 2I7CA 4RTPA 1NW8A 2PLWA 1N7JA 1ORHA 3DP7A 3M6XA 3NVMB 1G38A 1EIZA 3EVBA 3G89A 5LQRA 2Y1XA 3HVKA 4GOND 3FTCA 3FYCA 3PVCA 4PYQA 2UZ4A 2QE6A 1RJGA 4WXHA 2YTZA 2Z6UA 4OQEA 3LDGA 1KP9A 3P2KA 4X41A 2FK7A 3P9CA 5ICEA 1SG9A 2GB4A 3EGIA 1JSZA 1VPTA 1JTEA 2B78A 1N2XA
chains in the Genus database with same CATH superfamily
5HOQA 5IN5A 4DIOA 1KWGA 4BX8A 1U9ZA 4HLNA 3AFGA 4IG9A 4MS3B 4QXAA 4RD2A 3B2QA 1NN0A 1OBHA 2OD9A 3N2KA 2D5AA 4R6XA 2GN4A 4CRWB 2HA6A 2I4OA 1JH8A 2YV2A 3RYHA 3ZWXA 1WKCA 3IEPA 2ZBEA 1HORA 3LBIA 3JRWA 4JOQA 5CR9A 3W5HA 5IT5A 1IHPA 3DL4A 3K92A 2J6HA 4I1RA 4AUKA 4CI9A 1HEIA 4BXOA 3BMQA 3CSSA 3UYKA 4A2QA 1JG2A 2BI7A 3A58B 4YP0A 3TVYA 2QORA 4JFRA 4UHKA 3DZKA 4HL6A 1JA1A 3R8FA 3PFHA 4BV9A 2AFIA 3D6UA 3IXMA 2ZJ2A 4QYSA 3OZVA 1CJTC 1HF3A 3BC1A 3CEAA 8ADHA 2VDOB 1Y6QA 4M9ZA 2WIBA 4FUQA 4OQDA 4EG3A 2WWWA 4BIMA 1L7MA 2W00A 3K0CA 3FHJA 1AMNA 1BRTA 5H3CA 4FEYA 3CEHA 1UBJS 1F4LA 1QS0B 3GRZA 2HPHA 2J41A 2O2IA 2XJ4A 4K6GA 4OHKA 4P1ZA 3HMQA 1JDVA 2PX3A 2VEOA 2ZE7A 3PC4A 2IUSA 3T9EA 3W8RA 1M1YA 5BN5A 1FMTA 1NA5A 5J9FA 4AQDA 2FJPA 1MV8A 5BT8A 3S5JA 1RJDA 1RRPA 2RGBA 5EUBA 4BGVA 4Q3OA 2EZUA 1G3RA 4QTZA 4V24A 4A7PA 1ZVJA 2GLUA 2VR1A 4UQLA 4KPEC 1E7QA 1TZCA 2A6PA 2G4CA 2X8AA 3UPDA 2OCDA 5D3MB 4A5SA 1ABEA 1YOVA 3KQTA 3VNBA 4N9WA 4YY3B 3B1FA 3QE3A 1VA5A 3UW3A 4EYOA 1M74A 1GL6A 2AOXA 3HVUA 3W9BA 2AUTA 3NWBA 3DE0X 1TLLA 2CLIB 2PY6A 1N6LA 4WERA 1VB5A 4ZYTA 4RVOA 5F7ZA 3ZBTA 2X8WA 1I7QB 2ISQA 3QW2A 3AHJA 1MO2A 1DDGA 3EARA 3ZWWA 3A9UA 5JHHB 3DBLB 2V4ZA 4X6XA 4TT3D 3RPEA 2E37A 1KOLA 3LP6A 3D4PA 4TOIA 1PNOA 4U5QA 4RIHA 5DLPA 4DMGA 5HIMA 3U17A 1M72A 2K2WA 4A5OA 2V7TA 2QRGA 5EAIA 3SIRA 3WWZA 5IT9A 2UYOA 4J3JA 4P35A 5JS7A 3T5MA 3JQGB 1P7PA 1RSZA 4HC4A 5K51A 2V74B 1ADGA 2IELA 2YH2A 3OFSA 3WZLA 5IZCA 1E18A 2FWBA 5JCOA 4ZI7A 5B3KA 5DN6A 3FFWA 2QRUA 1SUSA 4OFZA 2UDPA 4IJUA 5JAIA 1DINA 4CEIB 5D86A 1DT5A 4BP3A 3KK0A 4HDMB 4ZQGA 5CEFA 3OTHA 3PSAA 5AKHA 5BUZA 4GAEA 2WWHA 3NHAA 4EHAA 4GBGA 1F2TB 4FFLA 2IOHA 4IS2A 4YP7A 3V8MA 4C76A 1V8BA 2XVZA 3EWSA 4AUMA 3PNSA 3W9UA 1ZWLA 2G08A 3NONA 3UKDA 2ZI3A 1CVRA 1K4YA 4R0NA 5COQA 4PZCA 3WWOA 1I14A 4J1QA 4C7XA 4QGGA 4C4OA 2NGRA 1MJFA 4EEZA 3JTEA 5AK4A 1L4FA 4R71A 4BAZA 2HLPA 3O4VA 2I66A 2A30A 3PRKE 4X1IB 4CV2A 1N2EA 2YUTA 4MSUA 5GV8A 1NP7A 1QZXA 4XIJA 3R5TA 2WP0A 3IUJA 1RAGA 4M8IA 3C5VA 3UK7A 2PXHA 2Q4BA 1ZK0A 4L8WB 2REXB 3X0DA 3GAFA 3AEZA 1AS2A 3NPAA 4R1QA 5KTOA 1KQGA 1G5TA 1JDZA 1SUIA 1Y33E 2BZGA 4G0ZA 4QPZA 4YXWA 3RANA 1K7EB 4C2AA 3JYHA 3HWRA 2GRAA 4CGZA 2HT1A 3GVCA 3JQDA 5D00A 4NE7A 2JC3A 3L0YA 5JCXA 5DRTA 3FE2A 3LXUX 1JZQA 5I48A 1W48A 1KE2A 1DO0A 5HK8A 3UA4A 3GZNA 1KERA 5FOWA 5EY5B 2VAXA 2CUKA 1T2FA 2JFXA 4CNBA 3IDQA 1ATZA 5K99A 4TRNA 2ESRA 4QQRA 5LMZA 3QG1A 2VYQA 1M83A 2G0TA 3EEFA 4KUHA 4GMGA 2ZB3A 1H4SA 5HA5A 1BCSB 2XR1A 4FGLA 4Y1GA 1PFWA 3IURA 4ABYA 5AIAA 3R8XA 3ZCTA 1C2TA 2ZSJA 3JVVA 4DILA 4ZDIA 5JJBA 3QPBA 3CPEA 1O87A 5B37A 5HUQA 2VHUA 4HUQA 1QDEA 3U4QA 1T36B 1MW9X 5CJJA 4BCBA 1ARZA 3D9QX 1GQFA 3PWSA 4OCZA 2QMYA 2Q0HA 3ANNA 4YV2A 2BZ0A 1ZD8A 4N6NA 4PZDA 3WGVA 4PTLA 3AHFA 5BYBA 3RUEA 1AKQA 1EP2B 3VXKA 1Z0JA 1ZC4A 1CUWA 2B8WA 4UUMA 4C78A 5EMJA 2FZWA 4CMEC 2PVSA 3HCCA 2VKQA 3HLKA 3HWX1 3ODPA 5DV9A 4D9KA 1R15A 4K0KB 4J94A 4LOHA 4U7DA 1ZD2P 1WW3A 4BLRA 3FVWA 5I8WA 1BWPA 3L6EA 3K5IA 5F3RA 5BR8B 1VL0A 4YFYA 2P1RA 4KR9A 4D5EA 3LYAA 2VK8A 2GTIA 1YZQA 4IHKA 4D02A 3L4KA 1GG5A 1QQ5A 5F2OA 3WYNA 1HNXB 3EF0A 1XCLA 1ZM9A 2EHDA 2OGTA 2YX1A 4Q3KA 2NZUG 2VHTA 2ODBA 3L40A 4KP7A 1LK5A 1R5JA 1FFWA 3LSTA 4NG4A 1KQNA 4DG5A 3SHQA 4HN9A 2OYCA 1XZLA 4ARVA 2NP7A 3COZA 1GD1O 3ZHVA 2Y99A 2AYZA 4LSWA 3ZLUA 2XX3A 1XQWA 3P7MA 3WKDA 1Z0IA 2LR0A 3DB1A 2YIMA 2KMLA 3VR3D 4ETNA 5JZVA 2QQGA 1AHPA 2YXEA 4C5BA 4OX9Y 3AOEA 1JKJA 2ID9A 3VX3A 1WCIB 2ZYWX 3H04A 2FUG6 2JZCA 1EH5A 3V4ZA 3MGAA 4H4EA 5KHOC 1Z16A 2PE5A 3D6AA 5DX1A 2O6LA 2QU7A 1QOZA 2QX4A 5GADl 1PS8A 3AP3A 2QN2A 4MLCA 4QWMA 1KDZA 3K0SA 4CLRA 4C01A 5AJZA 3GCZA 4XUEA 3WDLA 2O3RA 1G5PA 1GA6A 1GPUA 1UCFA 4KR3A 3L43A 3FYDA 4CR7A 2V1UA 1NNUA 4FYVA 1ZICA 2J45A 4CLXA 4DWOA 4ENUA 1EE1A 2OO7A 3SHWA 1E8DA 1W6RA 2P9CA 2N1MA 2WU3A 4R2KA 3RC1A 5HW0A 1IZ7A 4GVLA 2RG7A 3A3YA 2A1UA 2DHRA 4N65A 2R62A 4NNOA 3U0VA 1PI3A 5BQ3A 4O4IF 3RC9A 2Q6IA 1QRUA 2RGEA 2HJGA 5ARCA 3WK6A 2WWIA 2P4QA 3U19A 2X41A 2BAGA 1UKBA 4MW4A 2IYWA 3IIMA 3SE7A 1EVEA 2A4MA 1R5BA 1E6MA 5A1TA 3SVTA 4B2YA 3O7MA 2WJIA 3RREA 1QUFA 3MXTA 1FFBA 3FNBA 4FDMA 4X00A 5E1DA 4E5SA 4MQEB 4HTFA 3BGDA 4GMHA 4WGGA 4PYIA 2VJCA 4LZLA 2ZT7A 2ZGVA 1XFDA 2B8JA 1M34B 4M8KA 3TCNA 5J4YA 2RBGA 4NCAA 1E9VA 4JMLA 2XUDA 2D3WA 13PKA 4IHJB 1NLFA 2PIDA 5AKEA 4N8DA 2ZB7A 3BIWA 4YO8A 3GJ5A 3H2YA 5G4KB 1IBCA 1ZHFA 2NT4A 3IBCA 1KK2A 4OF4A 1NWCA 5DYNA 4EJFA 2PSDA 3C3YA 3E5MA 1HLGA 3QVKA 2OXEA 1XDZA 4TS3A 1OLSA 1Y1LA 3PIIA 4QUDA 4Z86A 3T06B 2OQ2A 3UW1A 5LYJA 4OOEA 4NC9A 3TQIA 1IYZA 5ADHA 1MD9A 2RBKA 2UUAB 2GD2A 4J1TA 3HYTA 4ZVOA 5EMHA 3TZEA 1G41A 1YB5A 2O2YA 2R1ZA 4CIAA 1Z35A 3QVUA 2AMFA 2XW6A 2H7CA 4ZEMA 5KYXB 1T9KA 3ZWDA 4B35A 3UH0A 1MO4A 3TL6A 5D1HA 3VJMA 1W36C 1Y6JA 2NMVA 2HB6A 2X9QA 2WSLA 1YIDA 1Y4UA 3ORSA 4AJLA 1Y4ZA 3PE4A 4RE6A 3LO8A 3DZFA 3OTIA 3RVKA 1IWPB 2Z0MA 3WISA 2WU4A 3EOBI 1FUYB 1WMAA 2Q4OA 4MWOA 4R0VA 3SQNA 2J7KA 4CF4A 1V5GA 3K0FB 1QHEA 3ME5A 2O7QA 4OGLA 3LHFA 4BMSA 2BFMA 2R2GA 2XWSA 2I03A 2PIAA 1YO6A 1A82A 1U9IA 3O1LA 1CUUA 4H1HA 4ZAVA 2X8JB 1RE1A 4E4YA 5EZSA 3JALB 1ZL2A 2IYQA 4Q05A 2M6LA 5EXEA 2IP4A 2IOYA 3LC2O 1SQSA 3IAEA 2AZ4A 3OFKA 4WJKB 3TQOA 1XNHA 2WJYA 3NWEA 1RKXA 4RACA 1R8QA 1D6JA 1F51E 4J7CA 3NCHA 5HTOA 1SVKA 2QMHA 4B48A 3C4QA 4B0PA 5E8RA 1AKTA 3D0KA 2J3QA 2Q6TA 4PG6A 4YJHA 3C5CA 4L9AA 4DA9A 4HXGA 3H3JA 3HJUA 4CR8A 1ZI6A 1CV2A 3AK4A 3D1JA 4LF6B 5TGZA 4C4PA 1H2EA 3K1AA 3KZVA 1DHRA 1HEUA 3OT4A 2QZ4A 2GCNA 2DR2A 4Y67A 4OYLA 2YIJA 4L73A 3ZGXA 1MIOA 3E48A 1VGRA 4HGZA 2HHAA 1T8TA 2Q0QA 4KGXA 3L0SA 4ONEA 2D1QA 4OHVA 2JI8A 2ZT5A 3F1LA 2BFNA 2KX7A 1L4KA 3BGVA 2AC7A 1AVTA 1D04A 1NQXA 4KN8A 4OXIA 2XQGA 5JSFA 4M0EA 2H48A 2J9YB 4BGDA 1C7IA 2ZYSA 1UUFA 3A3KA 3LZCA 1MVLA 2BLNA 2VHJA 4YPFA 2O0JA 3NYQA 5I4CA 1NU6A 4JOCA 2X77A 3E3MA 1I4DD 3EY9A 1X15A 2VDRB 4XWOA 4EHBA 1D7OA 2XWJI 3IO3A 3BB1A 5T8KA 4J90A 1RR6A 4CMHA 4EUSA 3D64A 3A4MA 1MHTA 3I1JA 1YDWA 2W90A 1AF4A 2WTXA 2ZTVA 5FPYA 3OY2A 1F8GA 1EJ0A 2PGLA 3F4BA 3WK7A 4CG2A 5JMWA 1UIMA 3D4OA 1OXSC 1IOWA 1YXMA 4YJ3B 4I4CA 1X7DA 1TW3A 1FFXA 1KI6A 1WOMA 2IPAB 5JATA 4DR3B 3PXCX 5IK2D 4CCYB 2RJOA 4NHEA 3M6AA 5LVAA 2WJWA 1KPHA 2VWGA 1QH1B 4Q82A 1JHOA 1GSAA 4AO7A 1FYWA 3D5EA 1BMDA 4LY0A 4M83A 5FOXA 5AW5A 3D5QA 3EZ6A 3TLXA 1P8AA 1VKOA 3GH1A 1TVKB 2J1LA 3UGTA 4CTNA 4PINA 1YU9A 2ZUEA 5A4MS 1TM3E 3EC2A 5K6AA 4TWAA 3OE7A 1IY2A 3I6ZA 3KB1A 3MERA 3WDKA 4IGAA 3ZKAA 1JIKA 1TIBA 1UODA 1SC3A 3EIUA 4GOOD 1KOJA 1BC5A 4N4AA 2I1QA 4F6RA 5JTTA 2FETA 3KQWA 1ETHA 2ZOSA 5C18A 1VG9B 3WNVA 4PLGA 4CM5A 1S5PA 2WD7B 5LB4A 4DHEA 4ENVA 5ELXA 2PHZA 3BJRA 4AWAA 1SZPA 4UVHA 2A14A 1O8BA 2KLBA 3FCAA 5BORA 1N0IA 2YDXA 2ZJ6A 1KQ3A 3ILYA 5AHKA 1NMEA 3T1VA 2ADMA 2J4DA 3ZNQA 5ALYA 2MDTA 4M8SA 1OXUA 1NL3A 3R6DA 1SC1A 1ZM4A 1JZTA 3VPCA 1XTIA 2I3BA 1QP8A 2BFPA 1LDBA 2X40A 2WABA 4OQZA 2FPOA 3EX7C 2WZBA 1EUQA 3E7DA 3BQ9A 1PKEA 3VKWA 3SHVA 4BQRA 4Z1MD 4ZZIA 2HN9A 3NS7A 3BRSA 5EGSA 4Z3DA 5K8VA 2AZXA 3PC6A 4OLBA 1YJ8A 1MCZA 1XQYA 3RYFB 2CN1A 3A1CA 4A0SA 3ZTYA 4E31A 4R9VA 4N48A 3WLIA 1DLIA 1Y7HA 3SNHA 1I3CA 5FYQA 1ZH6A 5HZHA 3AKDA 4COOA 3SYMA 4OJYA 4RY2A 5C34B 2H65A 1Y1TA 3VC2A 3FGNA 3X1XA 4A6XA 5JPIA 2PUCA 4XAQA 3WL5A 1DO2A 4FR5A 5TS2A 3H7IA 3KKEA 3I9NA 3ZHTA 5LLTA 3HNRA 2JW5A 1TYCA 2BBOA 3MWDA 2D8MA 1M2HA 1X1QA 1X9HA 1IN8A 3VR5D 3QBTA 1Q22A 3HR8A 1Q0ZA 4A92A 3G89A 4FONA 4M89A 4LRWA 2QMEA 1IHOA 4GUDA 4NWIA 1TLTA 1NJ8A 3AEKB 2C58A 4JB0A 4AECA 1FW8A 2P69A 3CW2A 3NBAA 3K0HA 1UT6A 2HSDA 1L5HA 1KI9A 1NVVQ 4NL4H 3GEHA 4PTYA 3VDNB 5DXFA 4AKHA 4II2A 4J7UA 1ISPA 4GE0A 4RHUA 2J30A 4CTMA 3S1SA 3BDIA 1OTXA 1V1RB 2EW8A 1N2XA 4Q4HB 4ZOCA 2ID7A 4NYMQ 1GP2A 2AUMA 5KYKA 1U1EA 1BGXT 1HYGA 2IE8A 5FV4A 2ATXA 2H8GA 1Z75A 3ZC3A 2XCLA 3DBHB 1GNPA 1YFZA 4ZVSA 5HIKA 5TIIA 3K9NA 4WQMA 5DCUA 1B6GA 3PFKA 5G0UA 3T9DA 4D82A 1LBTA 1VIMA 4JDPA 3RUPA 2OM6A 3RRXA 1YI0A 1Y63A 2IYAA 3ELBA 2DHEA 2CNLA 4PXAA 3GZJA 5FIUA 4BO1A 1N32B 1NXXA 3KBOA 3VZQA 3KD2A 1UOOA 1VE1A 1UJBA 1KNXA 2NU9A 1XLUA 2PQ6A 5PGMA 1DKQA 3SYNA 3V7NA 1MZVA 4NCHA 1UWVA 1POXA 2JL1A 5CA0A 5CB8A 3EVFA 3AOEC 4YONB 4INJA 3CHYA 4QARA 3BMXA 3Q7SA 4CMBA 4EBFA 4WADA 4OBBA 4DV4B 4BVAA 3A28A 3LO5A 3KJFA 4RNDB 2J09A 3HUFA 621PA 1XTKA 3O1JC 5A2GA 1S3IA 2YCBA 5BY2A 3H5VA 2GUWA 2B5WA 4KQCA 3QZUA 3TNFA 1WDWB 4MTCA 1EDDA 1O94A 3SZ3A 5FB3A 4YECA 4S1PA 1MB3A 1GTL1 2IXAA 3K7EA 3M5CA 1NHWA 2DU8A 2H00A 3EEQA 3FCYA 2Q5OA 2W2MA 4FHFA 4L08A 5CCDA 4RS3A 5CAEA 3V2HA 3DZCA 4XR9A 4TMZA 3VNRA 2WHPB 3I53A 5JNTA 2B0CA 4NU6A 4ASUA 4LJ4A 3GGCA 5IHPA 2HMVA 3UMMA 4A8JA 5AUQA 1KI4A 4TYMA 4C3VA 2ZQ5A 1ZM2A 3MBIA 3IHWA 4TXJA 3KETA 1UK9A 2GZSA 4JC0A 2OCIA 3DEIA 5BW8A 1PK9A 3IPAA 2Y1WA 3EZGA 2R1TB 3NBKA 1F8YA 4LYHA 2JGFA 3FPSA 3JASB 1OZ0A 1MOZA 4RHYA 1TMOA 2ZT6A 3LDHA 2CXNA 3SXPA 4KH0A 1I5RA 1QAQA 3IEXA 2DCMA 4LA4A 4IF4A 4KG7A 4RELA 4RSRA 3X1MA 4AJJA 4LDAA 3QSGA 2B7LA 2RFLA 1PNTA 3ABRB 2QQFA 2YWCA 2Q3CA 4XSHA 5HF9A 4JUFA 1Z34A 4NQRA 4B3DA 4GD3Q 4JKOA 4EJ6A 3W4IA 4LJ5A 4MUHA 3P97A 2RJNA 4PS0A 3IAM1 4ZMBA 1BFUA 1SZJG 3AY6A 1XZ8A 3Q5GA 4JD5A 4CKBA 1PWZA 3AZOA 4E11A 5KX5B 3V1YA 2XT9A 1PJSA 4BRSA 2H7VA 2HU5A 4HAWA 2X42A 5MHTA 4TLMB 2O8DA 2ZTMA 4RH3A 3CN9A 2M2IA 1JHPA 4L5BA 4AS1A 5CYGA 1KOFA 2PXCA 2CKDA 3UTDA 4XWAA 4G9EA 1AG9A 4BQSA 5FFNA 4Q01A 1MF7A 2V6BA 3GNSA 1X80B 3SEZA 4LUCA 4I0WB 3A1VA 3S8MA 5IZ4A 5JPCA 3ACCA 4H59A 2VBFA 1P9NA 1KO5A 5AW2A 3K3PA 2DTDA 2ZUTA 3LC1O 2JGIA 3OTOB 3QITA 2HIAA 3LLSA 3RRZA 3EXAA 1DJOA 4K6HA 3EAGA 4DBLE 1GPDG 4I14A 4IJQA 2BRUC 4MRAA 3RD5A 3MAAC 1TA0A 3R9XB 4JSYA 2VYCA 1H2AS 3E9DA 4AY5A 1Z17A 1T6NA 1WW2A 3L01A 4P4UA 2VUUA 3KT6A 4Q3EA 4YAWA 5BSWA 2PS3A 2PPVA 5C3MA 1SOMA 5L3SA 3RVOA 2PTGA 3G8DA 4HAIA 3QI2A 2I99A 2I4IA 1AGXA 2AXNA 2PQMA 3EXIB 5F7JA 1ZHOA 2JIZA 2O06A 4BOYA 1WW8A 3KLOA 1KTIA 3IAUA 2E4AA 4A27A 1E0DA 3OT5A 4C1NA 5ALKA 2VAMA 3HC7A 2YV4A 4UFOA 3FKQA 2DHDA 4BBAA 4D6YA 5L7WA 4LJ9A 1GUDA 4LX8A 3UQYS 5EKUA 1Y98A 1BH6A 2VTBB 1C41A 1FVHA 3I01M 3VHQA 1Z6QA 3CO0S 1YB6A 5I7RA 5CVJA 4DY4A 1JFFA 2RHTA 3H18A 3OBBA 2CLOB 2LW7A 3ZH9B 4EA6A 4KPYA 1RE0A 4JJIA 1QTRA 1XZNA 4DQXA 5BVGA 1YQQA 2DUWA 1P9LA 2X9VA 1ZI9A 1K5HA 1KJ9A 1SB9A 1DJNA 3ANLA 1I1NA 3BFPA 3PL1A 3TPCA 1BJRE 3H8JA 4XD7D 2DAPA 1BXRB 1GLVA 2LDXA 4UUQA 1T15A 4HFRA 5I9IA 2O8BA 1J8YF 1NSTA 3PHIA 4WV3A 2QNIA 2WE7A 4WPGA 3AYXB 3DDUA 3M6VA 3K70C 4O4LF 5FI0B 4KQFA 1XTRA 5H02A 1P1FA 1DBSA 1N3YA 2V7BA 4AZ0A 1YRHA 3MS2A 4BMPB 1NG9A 1QP4A 3LGAA 4IWXA 1UF9A 1XU4A 5K4HA 4CFZA 1OUMA 3EBOA 4Z7JA 1J9ZA 1EE9A 2NYVA 3DKKA 3DPSA 3R6LA 1KK1A 1U6KA 4UU7A 3T41A 2BN4A 2B8TA 3PQFA 2OTCA 4YP1A 3JD1A 4EUNA 1JH9A 1VFNA 1Z06A 4CIXA 3SVZA 4F72A 3DVQX 1KY5A 3IOMA 2C2OA 2P5UA 1VL6A 2CXQA 3AVPA 3RQIA 2ZI4A 4N7JA 5K4AA 7ABPA 1QSGA 1YK0A 2AFVA 2GHQA 2JKZA 3BE5A 4IXWA 2CLLB 3SNKA 3GCDA 1NVEA 1PZGA 1M0EA 4DSTA 2XKJE 1YL6A 4NONA 4A0QA 4E2XA 1JFSA 5JO9A 3PGLA 4ND6A 4DQUA 3AHDA 4AUNA 3HGTA 4IXMA 5JAMA 5FO0A 3O8RA 1ND5A 4RTMA 2W43A 5DHFA 3MWKA 2V0GA 4MV5A 1Z5NA 2ZR7A 4YRJA 5FUQA 2AKAB 2R97A 3ITEA 5FXMA 5ERYA 3WWPA 4MINA 1S96A 1JPVA 5K3FA 4BHTA 2GCIA 3H1BA 5FCDA 1NXTA 4QOSA 3ZNPA 4QDZA 2OK7A 3MB8A 5JNVA 1GUAA 1AUQA 2OK8A 4C0XA 4JLNA 2YKGA 1IVYA 4KO8A 2V65A 3VR5H 2FW1A 3U3DA 4EPTA 2ZWAA 1O97D 5CLLA 2I4NA 1Q3HA 2ZWIA 3H5AA 2PRKA 1E2GA 3A9SA 2PUHA 4C29A 1MNQA 3CINA 1A72A 2OO3A 4INAA 3GDGA 5EIBC 4DDTA 5FORA 2WT8A 4AYTA 3LCVB 1I7DA 1FXSA 3CLTD 1ZA1A 4HXYA 2P3QA 2A0UA 4X95A 4DV6B 4FI3C 4DADA 5B2EA 3WZ2A 3DW3X 3AUTA 2FSFA 1N3LA 2HRCA 2ZAGA 5BUCA 2VK2A 1P1RA 1HURA 4DGQA 1M2OA 3U4CA 1G5FA 1ESDA 3VR2A 5FBQB 1K66A 1GPBA 3LXRA 4O4JB 1AD2A 2Z3VA 1P6QA 2QKYA 5LJLA 3B70A 5GGYA 1RRMA 3A4IA 2Z56A 3KX2A 3MBOA 4MB6A 3N8GA 3DBIA 2PLRA 4HSGA 2OOSA 3GPIA 3BAZA 1OTYA 1RYHA 4V3BA 4XSGA 5ALPA 4URZR 1F6BA 3AJAA 1J0XO 3HR7A 3QOXA 2P2GA 4HRYA 4FT2A 3O4IA 4RD4A 4ZODA 3FDXA 2ZKLA 5EP2A 5FPTA 2FGKA 1DG1G 4GSYA 3T12A 2XVXA 4N7BA 3H2SA 1T1GA 1SOUA 4EJSC 2VATA 2O2ZA 1U2TA 4PLZA 3B13B 4LQLA 3MN1A 5A06A 2YY6A 4KMSA 1ECCA 2OHHA 3NXKA 4HNTA 3NKLA 5LCXA 5LQJA 2HA0A 3H4TA 2JLVA 4KXMA 5JFOA 5FF9A 1SULA 3AFHA 3JS5A 4FI3F 1W4LA 1IU9A 4WK6A 1S8FA 2R4UA 1JB1A 1PL7A 1SUBA 2BKLA 4G63A 3N0XA 2VQDA 4NPHA 4HD8A 4IMPA 4PR3A 1SXJE 3NU1A 4RMHA 1CUGA 5CDHA 1RWQA 1FSSA 3ADKA 3QELA 4C4YA 4ZYVA 2EX0A 3I72A 4WZ6A 1OGJA 3LIIA 4UARA 4FW8A 3K4PA 1BZYA 4OGFA 1YR7A 2Y6VA 4NFLA 5IAGA 1L1FA 3NH9A 3FFAA 4KXFB 4YCMA 4KV9A 3L4JA 2A9OA 1Y8ZA 1ZNYA 1T9ZA 3B12A 4G4IA 4ND5A 4Y0NA 2Q8PA 3G0HA 1CUXA 1C29B 1D2AA 1S01A 1OIVA 2ZANA 3UJDA 3ZXSA 2PZKA 4LYJA 3ZX4A 2JKVA 6REQB 4CETA 1IEXA 1VRWA 1AO3A 1QRDA 4WVLA 4ZCSA 3HTXA 2DOKA 1Y5IA 4E88A 3A1UA 4X6LA 1E5QA 3ZVNA 3KOWA 3ZQKA 5M2QA 4A4DA 1E5LA 1FW6A 3RIGA 4MV4A 4TL8A 5A3QA 3L1VA 1PR2A 5MFZA 3WAGA 2FSSA 5DYWA 1Z4NA 4ZCTA 4XUCA 3DDHA 4HDRB 4YMIA 2NW6A 1FSPA 4LZZA 3P9QA 1F0KA 4MGZR 3L49A 1FSGA 5C1IA 4DLVA 1X70A 5DNEA 2BI4A 2XLBA 3N6XA 1H93A 5JTUA 2CXXA 4ARUA 5KMGB 3U6BA 3OIYA 3EXG1 2Y76A 1WBDA 2IYRA 5J47A 4KN5A 3RS5A 2WIFA 3RLIA 1W0CA 1U5BB 3JQFA 3IUNA 2BI8A 3IV9A 4Q9NA 2OEPA 1N75A 4QUJA 4ZCMA 4QXQA 4Y0AA 3VFDA 3I28A 1AK9A 4WXEA 5GP1A 5LA6B 3ZHZA 3G5TA 5AVTA 1GSOA 4ZIRA 3ORQA 1M2GA 3LPNA 4TKMA 1MC8A 3T1YB 1K86A 1UT5A 5SZJA 4PCAA 4O59O 2CXSA 3D7SA 2O1EA 3OF3A 4F9EA 3QXHA 2KJQA 3QPDA 1QGUB 1ZD4A 4RA9B 3ZE7A 1M6YA 2PCLA 1WPGA 1GNRA 1TM4E 4OV6B 4F60A 3MS7A 3SJZA 2VNIA 3EK2A 5CX4A 2PZEA 4A9AA 4G0NA 4IDBA 1PUIA 2WPDD 3P8ZA 2N46A 4FILA 4U7GA 4FNOA 4HGOA 1SBTA 3FPLA 3MJCA 2ACEA 3K2EA 4UMFA 5F4BA 5H4HA 4PRZA 4C05A 3BMCA 3I62A 3KLPX 1FL9A 2DBQA 7AT1A 5BSKA 1A2QA 4RMIA 1PEKE 3LTEA 3B9QA 2HDNB 4HDKB 5A7GA 2WWGA 3ZU4A 2ECOA 4EJMA 5K01A 1XPJA 1A5AB 1RM5A 3HZHA 5FNVA 4PANA 4JI4B 2GPBA 2Y0BA 1U3VA 2O4UX 3GIWA 5LZ2A 3IDZA 4KJZA 1U7HA 4CQLA 1X86B 4RX1A 2ODQA 5D7NA 5I7WA 4JS0A 1Y6ZA 3LC7O 5CLJA 1WXWA 1X87A 5A3SA 2GOYA 5BSVA 1LJLA 3GRVA 4Z2AA 3ZCXA 2ERYA 2SKEA 3QLVA 4US2R 4Q47A 2FWJA 1OYYA 5CXQA 1HQCA 4KXVA 5DP1A 4DLSA 3HXQA 2XE4A 3KE8A 4ENTA 2XZDA 1OXTA 2QTNA 2WUFA 2V1XA 2DTEA 4NKRA 2HRQA 5CM9C 3TI9A 4WJLA 1T0UA 2J3LA 3NHUA 5BUSA 4K26A 2VQ3A 4G8BA 3AR9A 1KH2A 3M6LA 3NANA 4CHGA 4WCVA 3AKEA 4LDPA 3U4DA 3ZW9A 2KE5A 4CCAA 2AKEA 2P0YA 3TQSA 2XGSA 2PUAA 3TZLA 4MQFB 1US8A 4HLUC 2EYUA 2P3LA 1P1HA 3R09A 4A16A 3GLGA 1R74A 4DEXA 3DE2X 1XTTA 2J08A 2OZKA 4BVEA 2ATCA 1FPMA 3C8DA 5IJZA 5LR6A 1E0JA 1Z6XA 5HM6A 3ICQB 2HY7A 4DSNA 3ZVMA 4K7JA 1YS7A 1IIRA 2DJIA 1Z26A 1IL0A 2KI5A 1AQ6A 1XAIA 2QLLA 2R8PA 2ZU0C 2HK6A 1GR1A 1I6WA 2VJNA 4BNGA 1W44A 2I22A 5U4QA 1CZNA 1E2IA 2XZPA 2ZSHA 3DCYA 4FUTA 2P1DA 3FUXA 3HM9A 4W5JA 4GQBA 4ZRDA 5KTSA 3CH6A 1P0MA 4YQYA 4OJNA 1W46A 1PJ8A 2TMKA 3VVMA 3ESDA 1NOJA 3D3EA 1NBIA 2A8YA 3CUSA 3K30A 3SN6A 3VV3A 3DTYA 1YBVA 1CR2A 2F3PA 1VE7A 2PWYA 5DI3A 3L0CA 4DMKA 3BRWD 1RHKA 1TB4A 3SQWA 4JT9A 2XTZA 2A86A 5DHUA 3T1OA 2ZUUA 4CWAA 4E21A 1VPDA 1UK8A 2G40A 2XMDA 3W2FA 1TW2A 1W5FA 4DNOA 4DR5B 1MENA 3QU7A 4R2WA 3B6MA 3F6YA 1YDMA 5EYPA 3LSYA 3WO1A 1CR6A 5HZMA 1LK7A 4CLOA 3NNNA 2PT5A 2IC5A 2Y1KA 1BMTA 5IVKA 2O5CA 4Z4FA 4W9NA 1BSVA 3Q10A 1FFSA 2FMIA 1CDEA 3EZYA 4JLAA 1I2CA 5LUAA 5AXAA 3H2GA 1EUCA 4FFBB 2BYTA 1PL0A 1PQPA 1Z0ZA 2QD2A 2CNKA 3MWLA 3F6SA 4Q7EA 4ROTA 4ZAFA 1T9BA 1XZFA 3GJ6A 4WXHA 1MXFA 5KDOA 4OKNA 4TUYA 5C7LO 5IWCA 2CW5A 4YWJA 1I80A 4FOSA 3NX4A 3Q3VA 1IN7A 4N40A 3TTTA 3HP4A 1K7XB 3DVAB 3GP3A 1W0JA 3FHTA 4XH9B 1NF3A 4TS1A 1NBWB 2CD7A 5ESRA 2PMFA 4TYQA 3ZZ0A 1DBVO 3L8CA 1FS5A 3EVGA 3JQEA 3PFGA 5C8ZA 1OFHA 3Q2KA 5J4LA 1H5UA 4PAQA 2V96A 1LDYA 2ZRCA 2ACVA 3B1WA 3O82A 4M55A 3QVLA 3NAMA 2P8JA 3WYFA 4IZHA 1DG9A 2P4HX 3IQWA 4GKAA 2E5LB 4DUGA 4PQGA 2QM3A 4TROA 3E1SA 3I73A 1RJ9A 3A1WA 2ZDQA 2MSKA 3E58A 1HKUA 4MULA 4Z8XA 5DLEA 3NBUA 3VOBA 1GWNA 3AT1A 2YXDA 1ZD1A 1UDWA 1LI7A 3N2EA 4KGDA 4GO1A 1MJ5A 4MV3A 1DBWA 4ZVPA 1E2BA 1QIMA 2MU1A 3MOSA 1NVXQ 2CJYA 4HWRA 4RORA 4GRIA 121PA 3DC2A 3CNNA 3K5WA 3I23A 4GX5A 3W1VA 3IQDB 5F73A 5KYUB 4L16A 1B15A 2QSZA 4A2PA 2WKPA 3W78A 1OMOA 5FWXA 5HKKD 5L7YA 1OXBB 3LWDA 2Q5HA 5F21A 1QLWA 1P75A 2RBEA 3MMSA 3WRXA 2WYVA 2ECQA 3VPXA 1GL7A 1FTQA 1P39A 3D7MA 4ZC1A 3SKYA 1OC4A 2WVHA 2EQBA 3BREA 4ZHQB 4NTZA 1WZNA 5KOHA 4FZJA 3Q7TA 2DUUA 3O8DA 3H17A 4YUYA 2VS1A 5DTIA 4DV5B 5BW6B 3RU3A 1ZESA 4I5IA 2FPWA 3ISTA 2Z2YA 4RXTA 2IF2A 4KDFA 3T3HA 2JIMA 4R69A 1HZZA 3ZQ4A 3I30X 3KUXA 1WHTA 3I6MA 1U0SY 3PUJA 4I19A 4J1SA 3O8NA 2PU5A 3G82C 3ZJ5A 3A25A 2LRHA 1P4AA 3SF8A 2HRRA 2LGJA 4D74A 4WLUA 1MO6A 2QD4A 4S35A 4TLBA 1Y80A 1KR2A 3GFTA 1DZ3A 2PUGA 3W77A 3ZPXA 1ETUA 4PM4A 5CG1A 1EXMA 4Z9XA 3WV5A 2SCUB 2WA1A 1CP2A 1YTUA 4HRAA 2ODPA 3EIXA 1OH6A 5DM1A 3C3PA 3ZU3A 2AHOA 3I37X 1BFDA 5ETJA 4RHXA 4PSUA 5EP1A 3T5BA 3W2EA 3UT5A 2NYAA 1YQEA 2K6GA 1S2NA 4X7RA 3N8IA 5P21A 5I45A 4W5QA 2RGUA 3PUYA 2ZIAA 4OLAA 1OI2A 3F7MA 1WKVA 5E4FA 2JFPA 4LOIA 1II0A 4Q4AB 4FGWA 3VR6D 1QNLA 5A9SA 1AUPA 1W8IA 3UF0A 4XW2A 1ZGBA 2HAEA 2HNKA 3GLFB 1B0UA 1Z7EA 2AFIE 1NQVA 1RS0A 2AJTA 2OV2A 1RYMA 3G5MA 4D0RA 3HA2A 1WY5A 4A82A 3C7DB 3OHMA 2PRSA 1J5PA 3LK7A 4UMVA 1O9BA 2DECA 2GF9A 4FZ5A 4AZ3B 1NXPA 4V39A 4YUAA 2Y4OA 3QF4B 1VLVA 2E49A 2HCTA 4IS3A 4UVGA 2NSDA 4D0SA 1W0KA 1CF4A 5I9SA 3ZGNA 2AQ8A 1GTSA 3R7LA 5AI0A 4EKNB 1V48A 1Z7YA 2R00A 3GUCA 2OCBA 2QTFA 4WOKA 3FSGA 4JLUA 3BB3A 1Y3IA 5IAAA 3WQSB 4BDTA 4KE9A 4DA4A 5AHRA 1BN6A 4ZVQA 4MO2A 1AXEA 3GOQA 3I5AA 3RR2A 2XB2A 4R16A 1C7RA 2OBMA 3HDTA 2QTZA 5JXWA 1VJ5A 4XXHA 4YAGA 1EK6A 3O95A 2RD2A 2G9UA 1F9EA 4F11A 5LXTA 4KHPB 4M6WA 4GSKA 5FFFA 1GO2A 1JQKA 1QUEA 3A1TA 2WF6A 4URYR 2KSQA 2P2NA 1WDLA 2J85A 1Z39A 1ZZGA 4MS4A 4DC0A 3TLYA 4LJLA 3LYLA 1SHKA 4MITA 2XUKA 4OEHA 1SEVA 5BWMA 3OU2A 1L5NA 1G21A 3FI0A 2AWNA 3I2FA 4LYAA 4Q1AA 5KO2A 1HOXA 1YC5A 1Z82A 5A6VA 3GJXC 1JNYA 3G02A 1TCBA 4N9QA 3REGA 4EABA 3ZW7A 5K8JB 4XIIA 5LJIA 3UT6A 1B00A 2XIQA 1W36D 4B83A 1KA9H 1E1CB 3CX4A 4Z8YA 1K9VF 5IX8A 1ZR4A 3E2IA 1TTHA 3FMFA 3GFPA 3RVMA 4CM4B 1FTYA 2IUUA 3LQRA 4NH0A 3WMFA 4OQPA 3RRNA 2ZIUB 3FLBA 3A10A 1X1BA 4LCEA 3DBRB 5IKMA 2VJBA 2J3EA 4HRVA 1GADO 1G18A 2AX3A 3DE4X 3AUSA 2MYTA 2PZLA 4TS4A 2JHAA 4Z0PA 2I7DA 4AZVA 4HZUA 3EDYA 4XRRA 2E7ZA 4M0LA 2GK7A 2CLSA 3TEMA 3JARB 3HKEB 2F4VB 2O8FB 2C3MA 4WH0A 4DBLC 5GINE 3AY7A 4N3GA 1SB8A 3TAHA 5T4HA 1X7HA 3FGOA 3OO0A 4IUBS 2FN8A 1RXVA 1W88B 2NWQA 4GZ6A 1E4VA 4LVUA 1KDYA 3UBMA 3X2FA 1DAHA 4RV5A 3CONA 3G85A 3W5JA 3OIDA 5ENDA 3ZHXA 4G1MB 1RBMA 2QTVA 3DXFA 2FPIB 4J0HA 2IJGX 4BQOA 1PUXA 1B41A 1WE2A 4Q15A 3L07A 4U6SA 2R8XA 4E5VA 2ODAA 3MGBA 4LWZA 4L8GA 2B92A 4NV0A 4C6SA 3AF0A 3Q3EA 4QYWA 6PFKA 3PA8A 3DL7A 4DV7B 2DWUA 4NH4A 1XCMA 2CL5A 3CRMA 4PG4A 4XX0A 1OIXA 2P0AA 3HBFA 1B2RA 4M9UA 1H9AA 4OATA 3EDOA 3V8QA 2RB4A 4TT8A 1VJGA 2ZJAA 1PFVA 2ODWA 2W2LA 3TSZA 1IUOA 4G24A 2NUTB 3AR2A 3VKGA 2ZPUA 3H1AA 4YC7A 1DKPA 3NYRA 1KSFX 1Q74A 4FTWA 1IN6A 2QY9A 4GZ3A 1K7CA 5FOSA 5I8ZA 5TJHA 4KDCA 5J4KA 1WTAA 2DPHA 3MQ2A 1XDGA 3LUDA 1A1SA 3QLEA 4XDYA 5IAKA 4ARZB 2ZI5A 1JHMA 1JG1A 5AUNB 2Z5LA 3WLKX 2GARA 2INGX 3G59A 3MUFA 4J0FA 4OI2A 4BE7B 3WLOA 3GRRA 4WOBA 2KHZA 2FVXA 1PNRA 3VYSB 1KXJA 1E6CA 3MFQA 1HNNA 1ENYA 1Q7RA 3DHWC 3GLUA 1E2EA 3HP7A 4IYRA 3IVMA 3CR7A 2OORA 3NI2A 3R1IA 5EJGA 4H1UA 1PT6A 1XCGB 1YR9A 4KX3A 4HVLA 2CLFB 2ZS9A 1E62A 3GPDG 1JJAA 2VDJA 3R5SA 4LKRA 3UANA 3WSVA 4BUZA 3IB3A 5FNVF 1BGWA 3CZRA 2P62A 5LDDC 3QX9A 1BQ3A 5ALQA 3TK1A 4EA8A 2WTUA 2YN2A 3K6JA 4NBTA 3SLKA 4F5EA 4MVJD 4B40A 2SHKA 4NYMR 4OJMX 1KZ7B 1J5EB 4NZOA 5EQDA 4C7JA 1U4NA 4BFZA 2GEJA 3QYJA 2F90A 3U26A 4ZTBA 4XVHA 3MLAA 5ER9A 5CDSA 4IM7A 2CF6A 3BWBA 3MJSA 3IP6A 4B79A 1D9ZA 4URUR 3PL5A 4JEMA 4HAXA 4UM7A 3VZDA 1YTLA 5FAXA 2GESA 3DOEA 4B81A 3EC1A 4JMPA 3W8NA 1DKOA 1SZCA 2N75A 2OZVA 2JFBA 1GDHA 2ZEJA 2P6NA 4L2IA 2OL4A 2HWWA 2RI1A 4FOTA 1PG0A 1ORTA 3H1FA 3JQAB 3W7BA 4LDNA 2XYGA 2VHWA 4JLDA 1G6Q1 4PYMA 3N58A 5LQMA 4OQQA 3RJZA 1QFJA 1KYQA 4UBJA 1R8XA 5CT4A 4KXLA 1SHLA 4F93B 1YMVA 2Q0SA 4DGSA 3BRQA 4EPVA 3PKIA 1GZDA 4X1YA 3AJ8A 5MFPA 2JCVA 3EZNA 3RG8A 2OHXA 2R4TA 2H06A 4R1NA 4PY2A 5TEWA 4YR7A 2XQKA 1B6RA 2BM0A 3ZEIA 5I4KA 4AIIA 2QTHA 1M67A 2XMPA 4P3KA 4UCFA 3UAYA 4Y2RA 4DCNA 1GYRA 4E2FA 3B6IA 4Q9JA 3PXGA 3MWJA 3Q7RA 4XDZA 3N0TA 4GQAA 3ZR4B 1YC2A 4BLOA 3R8CA 2QYOA 4HN2A 4RS4A 1NXVA 1PFQA 1UWLA 3VDXA 4PXYA 1FFGA 1P7CA 2P9GA 2Y1OA 4JLSA 1KAMA 4NCBA 2M98A 4F46A 4LYYA 2X2PA 4Y6LA 5FWAA 3BEOA 1QG6A 3A7DA 2RHDA 4RF3A 4LF5B 2HBQA 1DP4A 5CA1A 1PEDA 1L1EA 1UBLS 4NCNA 1BMFD 1Q14A 2QD1A 5B5SA 5KWJA 4P4SA 1FSFA 2ZIXA 1A8SA 1M54A 3DC7A 1DAFA 2L0XA 5DZSA 4YMHA 2RIPA 2WF9A 1X3SA 4KE8A 4IILA 4MRVA 4RIEA 2HU8A 1G8MA 2Q5CA 2BMJA 3C16C 1GZ7A 3HQ4O 4FP9A 3HLTA 4Q6WA 4TUYF 2WQ7A 1FFEA 3I39X 1BFKA 4PO3X 1VA4A 2QT1A 2MIIA 1E1LA 4OQ4A 2DBZA 3VR6H 1G3UA 3LUGA 1ZL0A 4EMUA 1D2RA 2FKAA 2VNKA 2BZ1A 3KXDA 1EHIA 5DT2A 3CUKA 5JDCA 3GLTA 2D6FA 4DXDA 4Y2PA 1QIDA 2HSJA 4BWVA 1VKNA 1UR5A 1SXJC 2ZXFA 5EE9A 4Y6OA 3RRYA 1QE0A 2GYUA 4IO1A 1EQAA 1RLMA 2E3JA 4QEDA 1OAAA 3EDRA 1JSXA 3QTLA 4YASA 4ZRMA 2ZPTX 3OZCA 3D1VA 1IPEA 1SRQA 2QY6A 3QH4A 1VE6A 1M8JA 2PG3A 4L5AA 3R3XA 1WLYA 3AI3A 4Q7JB 7REQA 1HDGO 5IG2A 3U40A 5FHQA 3S2GA 4M36A 1E89A 3NFYA 3AY0A 3IFSA 4RMNA 5KNBA 3HDVA 1N2IA 3I04A 4OIMA 4YRQA 3EUEA 4IDOA 5IH3A 1PDOA 1XTUA 1NLMA 2PGAA 4ESVA 4N1AA 1DFGA 1YI1A 3JQ9C 3NBQA 4LTDA 4Q16A 1JR3D 4CJXA 1OX6A 4JU9A 2AN3A 4Y9TA 3ZKWB 4YX9A 1Q2UA 3V4SA 2Q29A 4J07A 4AWBA 1Q7GA 1UK6A 2XT0A 5E6RB 1RCUA 1L5FA 1NVAA 3IOYA 2VFAA 3B89A 3QV1A 2RI0A 2ZRHA 2N47A 3OJCA 4M3NA 4S2UA 4WEOA 4X24A 1DARA 4S1TA 5EL0A 3SDZA 2DM6A 4WLFA 1VKJA 4RZIA 2A0KA 3VYWA 3VX4A 4OY3A 1ID8A 1QLJA 2MR5A 3JVEA 4DMCA 4UEOA 1XE3A 5EUCA 1FYDA 1Z6YA 3ZYCA 3KLMX 4BX0A 1XTVA 1AMUA 4ZVTA 2J0QA 3LQ1A 2YJ4A 4PPGA 4F5DA 4AXBA 2C7VA 1RU3A 1Y9EA 1VC2A 1CS0B 2HMTA 4YMWA 4ZJZA 3H5RA 2YVKA 2UYCA 1E7SA 2C7BA 1P7ZA 3OQBA 2JHFA 4IDHA 2OCPA 4FJ1A 3EW7A 3BWMA 2YHIA 4B1FA 5CDYA 2I3AA 2GBPA 4C2UA 5KNDA 1ZUHA 2XMBA 3ANXA 3BMNA 4Z4HA 1T6YA 1V3TA 3DONA 1O6GA 1RXIA 1A98A 1HL7A 1VECA 2R00C 2YASA 2YMQA 1UT8A 2ZWMA 3C45A 3HDGA 2XA9A 3AP1A 4MRMB 1Y37A 3RNOA 4M88A 1IBRA 1OX4A 2C1ZA 3TXXA 2DX7A 3KR9A 1EESA 2WUDA 1LLDA 2JCXA 1VZ2A 3RJ5A 4ZK2A 3FXAA 1N2SA 3E3OA 1PK7A 1J8VA 3RTCA 4B6RA 4DPMA 1AHHA 4ZZ3A 2GDJA 3QOWA 1WQ4A 4TZ6A 4I36A 3NHWA 4R7ZA 5AW4A 1LI4A 4YRMA 2B4QA 2WB4A 2PT7A 3HM2A 2IOQA 3M70A 4F3NA 5AJWA 1E4EB 3R24A 2WI8A 4R8VA 1OH8A 2I91A 2HMAA 2YXBA 2O7SA 4PZAA 4KC0A 4MLZA 3W05A 4RBNA 5EHIA 4JT8A 3N86A 4JXKA 1YJ5A 4G86A 5TSDA 2JCBA 2ENUA 4NARA 4X91A 1ZP6A 1O54A 2ZS7A 1RQXA 2GBCA 3Q40A 5A4JA 3GVXA 5F98A 4Y9DA 3W8EA 2EGUA 3GDFA 4PW0A 4JUIA 3EB9A 5I9LA 4GM0A 4BNMA 3VBCA 2EWVA 4P38A 5A5VA 4R2MA 4LRSB 2C42A 1AY0A 2A1TS 2J9FA 5EZYF 3SE0A 3T1TA 3KOXA 1FNCA 2RHRA 1RXEA 4JKYA 3LP5A 4GWKA 4GYJA 3N8DA 4D46A 4GI3A 4RJKA 1RFLA 5IF9A 4QNMA 2QWXA 3DUFB 1RJGA 1SU8A 1ESZA 1GDTA 2W42A 2B8NA 4IX9A 1VG0B 3UB3A 2J87A 2KYRA 3B7GA 4H4CA 4HWTA 4DC9A 5J43A 2XMCA 1UJ5A 1KY4A 2FPPB 3FHLA 4L0QA 4KVFA 4DMUB 2R1VB 4FKZA 1P45A 2CD9A 3PCRB 3UEOA 3CW9A 4BFUA 4NOJA 1BMQA 1AZTA 1E3QA 2JIPA 3A3PA 3C0KA 3NTXA 2OVBA 4N8SA 4U00A 3BEDA 4BWGA 1U81A 3ABQB 3DOIA 4UBIA 3A6GA 3NPMA 5EVJA 3V55A 4D3FA 5BPFA 3E9YA 1OFUX 1GTVA 2NU6B 3HU3A 3ON5A 4GBMA 4B3SB 1DUSA 3SIPA 4WKPA 3V1NA 4X54A 3TOSA 4TV8B 2E85A 2SBTA 2CF5A 4MVJH 1E79D 3BHNA 3WGTA 2BFBB 3PG5A 4L76A 3KHTA 3MRXA 1WL8A 2RGAA 3R9WA 1ES9A 1MRNA 3NR2A 2VP0A 2IHUA 1ELOA 1Z08A 4FDAA 3PD1A 1N5KA 3MTAA 4I4TA 4ZYYA 4LE2A 4ESHA 2GYVA 4EF6A 1AU9A 2CDAA 5TGTA 1IM2A 4EF4A 1NPYA 3MUEA 5AVZA 4GKJB 1ZNQO 4UMDA 1EUDB 4XI9A 1XZGA 1M1ZA 3KYDB 3MT9A 4RDHA 3HLYA 3E8SA 3NJ8A 4XTCS 3NUQA 1S1MA 5EWMB 1DL5A 2V7XA 1KMMA 2C94A 3E9ZA 4UUPA 5G53C 5U4XA 3QP9A 2FRXA 4CZ2A 1C3VA 2UVPB 3QNUA 3OKAA 4GRDA 1TT7A 3IE1A 2PGJA 4QPDA 5CCXA 4XWTA 3T1NA 3W5UA 1JKFA 2R79A 1RTTA 4RJ2A 3V97A 4D5GA 3BN3A 3UAWA 1Z7WA 4QPNA 3W7AA 4JP1A 5LKRA 3H11A 5EJFA 4D92A 1E2QA 4B6QA 2AD1A 1VTKA 4QA9A 3TW8B 4BVLA 5CCBA 2PRYA 4DDWA 1OF1A 1VG8A 1LQ2A 4HQFA 1DTEA 2D7CA 1P61B 4P93A 3R77A 3IVRA 5C4IA 3A2KA 2BISA 4R98A 5C5EA 5HZKA 2H9YA 1PNQA 2JB9A 1RAEA 2OR3A 1YNOA 1GDDA 5A71A 5TB5A 4C3ZA 1THGA 2BR4A 1JRLA 2PWZA 4HLCA 1GQSA 1HYHA 2JJQA 1W5TA 4AMZA 4F1WA 5DMHA 2OD7A 4WUVA 2HMWA 3H9CA 4BGEA 1L8AA 4BEVA 4DV1B 1W36B 4IVPA 1SRRA 3AXTA 1PZNA 3OUZA 3N74A 5L3ZA 3IQIX 1F2UB 3QKRB 2OFXA 2O07A 1ZK2A 3V1TC 2XWQA 3SR0A 3VYVA 3D2LA 4EO4A 2W9XA 4IOJA 1V8OA 4LGVA 3GNQA 3UG6A 5EGNA 4DJEC 1UKZA 4PE5B 2VLIA 3E9MA 1KU0A 3H5IA 1S9HA 2BR3A 2Z4TA 5FL3A 3MNFA 1TZKA 4TYWA 2HK7A 1P3Y1 3GROA 1F0PA 1SUPA 3MCUA 3U56A 3U6KA 5EIBD 2WILA 1NLZA 1PX0A 1JG3A 1Y8QA 2B1JA 3GJSA 3IJRA 4J1NA 3TI7A 1RXYA 3CIOA 3ICVA 4GZMA 2DETA 3D7NA 2VTVA 1S6YA 2WKRA 3ITNA 3PU6A 5C7OO 2CLKB 1SUFA 1CDZA 4C14A 3C24A 4J43A 1N6OA 4ZA2A 3JSAA 3WLTA 1NJ6A 1CFZA 2BEVB 2BM8A 3HH8A 2O8VA 5CJ2A 4XYGA 1BDIA 3AL3A 3BFJA 4LOLA 3OE1A 1VCNA 2JIQA 2GN8A 2RHJA 3MC1A 2GYYA 4PLYA 4EITA 2OLEA 1NKTA 2O4CA 1JQBA 1OC2A 3KFLA 2Z5GA 3DTNA 5AI4A 3HFSA 2AMJA 2QDXA 4EWLA 2EXXA 5AW7A 1TM7E 2WNSA 3C8HA 4W8GA 2REQB 5KU1A 2HTEA 4JLKA 4N3BA 5EJIA 3O2QB 4CEHA 1TMYA 7MDHA 2JDIA 3G9TA 1EX1A 1VJDA 3L3BA 3TIIA 4R1TA 2CNWA 3DV0B 1SURA 2PSSA 5G40A 4M0KA 2D62A 1XXHB 2H2WA 4BMOB 2A59A 3V6LA 2OMKA 2IEAA 4UM8B 3ZIAA 2C92A 3PTLA 3ADOA 3NIBA 2ZUDA 4AZTA 3WMRA 1K06A 4I5GA 4O33A 1RTKA 3GFOA 4OBWA 3QLJA 3CV3A 4OK6A 4FBMA 1JE1A 3RFCA 4AY4A 1GPYA 2JFQA 2FZKA 3OJEA 3OT1A 3QY9A 4DBZA 2VTDA 3F49S 2GA8A 4FZVA 5DNCA 2QZSA 1X1SA 1C3OB 1YUMA 4ZI3A 1M6HA 2BR5A 3P9YA 5JYEA 3QVSA 3TR6A 4U7TB 4M1ZA 4TVOA 4OK5A 3CVVA 5K0SA 2EW2A 4JJKA 2VHYA 2M32A 4YJ2B 4HLDA 3RLFA 4GXRA 5BSGA 4AO6A 3RAFC 3CH4B 3IKMB 4Q4LA 5IULC 3ZDQA 1GGNA 1TM1E 4PBSA 1X77A 4FMBB 3A6PC 2BMEA 4WZBE 4WX2B 1N34B 4M1SA 5B1DA 3RHZA 3BGIA 2BFDA 2DUMA 2JHCA 3D1LA 3EIHA 4KE7A 4E32A 3OZUA 4IH1A 4DLZA 2DFVA 1H6CA 1V16A 1NY6A 4O3MA 3M3HA 3N9IA 1HWYA 1T35A 2YOFA 3TOXA 4DJDC 1RC8A 2Z95A 4ZQFA 3Q5DA 3TTUA 5C2JB 4H6WA 1SCDA 1BW9A 1U3WA 1K2VN 2V0NA 3HYRA 3BD8A 4MLDA 1M6EX 4M7RA 2EATA 3N6RA 4YLEA 2IV2X 2QPOA 5B1SA 521PA 4AN1A 3NBFA 3RK0A 1XWIA 1MORA 3O75A 2OV8A 2FP4A 4OHXA 3U61B 2IBSA 4ZVMA 2OB1A 3BXGA 2O52A 2OBNA 4GLFA 1OPXA 3O1IC 4E09A 3FRJA 3G0IA 1YZNA 2B83A 1NW5A 2P90A 1QCYA 1EGVB 3DCJA 2V6JA 3L7KA 3ZWNA 4MGYR 4RFSB 3HVRA 3EAFA 3FMGA 2DHQA 2FH5B 3QXCA 3ZEAA 4ARSA 5JSZB 4JYAB 2JBAB 1NI3A 1RYFA 3AIIA 2ZI6A 3CPSA 5KTRA 2OZLB 1KQFA 1GFIA 1WU7A 2PZMA 2UYYA 4QOIA 1L5KA 2ZULA 2FAXA 2FPSA 3DB2A 2D2IA 4DT1B 5JLJA 4M9CA 4AFNA 1DEOA 1JS1X 3OX2A 4I1VA 4WDQA 5IJXA 2OXTA 4UM9D 5YASA 4HMPA 3WBFA 2IRWA 1MG5A 4ZI5A 4LVOA 3DKIA 4OLFA 3N53A 2G9RA 3ZWMA 1S4QA 3ND7A 5AOBA 5IN4A 5CD9A 5DXAA 4FYIA 5T5QA 2XAUA 4U2FA 3AUAA 2DT8A 1KC1A 1W19A 1R18A 1E69A 4BRZA 2IHZA 2J3DA 3AGQA 4B73A 3NO4A 5KU7A 1G63A 1XHEA 4DZRA 3L0OA 3I6BA 4QVGA 2FEWB 4PYRA 4ARAA 4LRUA 3SICE 4U2KA 1T0PA 1UFKA 1GRNA 2JLQA 2QS9A 5CX1B 3ANYB 2WJHA 3KLBA 4XQCA 4XQ9A 4HAUA 3QFSA 3X1JA 2IYEA 1EKXA 1L7XA 1W25A 2UYHA 3LG2A 4BPBA 2G0NA 1SCBA 4FBLA 4A2CA 1Q0TA 1P5HA 5ALLA 4WBSA 1ZRMA 4CI0B 4XYMA 3EIWA 4BGIA 1SHJA 3PKJA 3KVNA 4X20B 4RVDA 1ESMA 1P0FA 1YKFA 5JARA 2A9KA 4NFYA 1TD9A 2VCEA 4OHCA 3RI3A 3T3EA 3WGHA 3A14A 4UE6A 2FW8A 3WY9A 1U28A 4L8VA 1AH2A 3OE4A 4HQLA 1QU3A 1DJMA 2QE7D 1GCGA 1W35A 1TKRA 3K9QO 4E5MA 2AG1A 4RDXA 1T1SA 4MR9B 1ZRSA 1LW7A 1JGTA 2Y77A 3BQNB 2QU8A 3TLGB 3L0ZA 2D1RA 2DE0X 3WNQA 3A06A 2JK0A 3ZWYA 3LDAA 4YDHB 2NYRA 2CGEA 4WCFC 2H0AA 1I5OA 3N5CA 4GWLA 4JJGA 3CNOA 4AF7A 5H0IA 2VPXA 3COYA 4PLWA 1QS0A 3WIBA 4DB2A 4ZU1X 5J1TB 2QB5A 2XYRA 2IDJA 1XF1A 5FUYA 1F2VA 5KWEA 1Z2CA 3SKVA 4G36A 2WM3A 3KHSA 1DIBA 1E66A 3OU6A 3F96A 1OI4A 3O93A 4R05A 3GN1A 3R5XA 4NK4A 4Z7QB 3HKDB 3HB4X 3INGA 2C29D 2HXSA 5F64A 3EASA 5DRYA 1ZVMA 5D3MA 3E81A 2JK1A 4RCZA 3RFFA 3W79A 3NC1C 3Q9NA 5TMEA 3RFUA 2ZRGA 1OE0A 3UPUA 4HQ0A 2XF2A 3P9XA 2CBXA 1HH4A 1VL8A 2X1MA 3DL0A 2GK4A 2IZ7A 1FB5A 4D9GA 4DL9A 1CZLA 3TPZA 5DK4A 3RCBA 5ICFA 1FNDA 2QUAA 1SVSA 2IYNA 4DDVA 1IJFA 4MYSA 2F3UA 3LZ6A 2I7XA 2JD2A 5ALTA 3DBLA 2ZYVX 3PP8A 4KQJA 3AG6A 3V8BA 2F43B 1DWUA 5F33A 3CMCO 3HCBA 4GKVA 1QF7A 1W1UA 3HBLA 4S1VA 1XEXB 2F8LA 2IQ5A 5A4IS 5KHAA 1WVGA 2LP4Y 4ZO7A 3ZE0B 5KDDA 1GPH1 3JQGA 1PJQA 1NM5C 1U2DC 1X92A 4C7MA 1KZYC 1NMQA 1KNQA 3Q88A 4W9RA 1U4OA 2F9LA 3F3SA 2C04A 4KWEA 4NV3A 2WT4A 4OP2A 5T7BA 3LWBA 2ZYRA 5EIAA 4UXHA 2G4LA 1SWVA 2VJAA 5B7QA 2YJ5A 3AF6A 5HUHA 4CEIA 1KEEB 4HDMA 1P19A 2E6UX 2ZAOA 2WF7A 3IESA 3NT2A 4KTTE 4X45A 4LXIA 2GPSA 1F2TA 2DB3A 2IXEA 3AR6A 2G1PA 4BV3A 1VP3A 3Q8XB 1JEEA 5J5VA 4UHBA 1TRKA 1T6BY 3BL8A 2XZTA 1E5DA 1UBFA 2GEKA 2P2SA 3NGXA 2X0NA 4W6ZA 1KYIA 2JJ1A 4EVSA 3JQPA 1MX1A 3AWDA 5DE3A 3R4CA 3ROXA 3EDCA 3QLTA 4HEQA 5BR4A 4B3MB 3KD3A 4DANA 3V3TA 2VBIA 2OKGA 4X1IA 2YWDA 2E2WA 2LIPA 4H3KB 2X5KO 2A84A 3QE4A 5GOTA 2E89A 4I4TF 4EKYA 2ORYA 5F3WB 1DTSA 4A03A 5AVYA 1BAPA 1MC5A 2AR7A 1NBMA 1OAOA 1T4MA 1SKUA 1WKBA 3WWDA 4RQTA 5H80A 1U02A 2UU9B 3N05A 3VOAA 2B20A 4ZGWA 5JS1A 2OO5A 4LXYA 3D6NB 5HBRA 2R6ZA 1BO6A 3NT4A 1YAHA 3V5NA 4F4HA 4L0DA 1KEPA 3PXUA 4AMUA 1TU3A 4RPGA 4N01A 4MW9A 4MKRA 2WJPA 3QEOA 2QD3A 4OHBA 3TSWA 1SCKA 1DPGA 2PUTA 2J67A 1N1DA 1OA0A 1U1CA 2ZUBA 1MN6A 4N49A 4JB8A 5CH3A 3V1UA 3O2SB 1XLTC 2PEYA 2RGYA 4PYOA 1HYQA 4TTTS 4C43A 1EJ6A 2D2EA 4WE3A 2C5LA 3TMAA 1EK2A 1Q92A 1UEIA 1UJMA 3MG9A 3WE7A 4HAYA 5CDTA 2XMZA 5HRUA 3TNYA 2HEGA 1VLLA 1BCSA 3LFTA 4RVHA 5I4IA 1U2SA 3P9PA 4GOKA 1V4NA 1IQ0A 4NOLA 1RMTA 2BEJA 3DFFA 4QQNA 5LIPA 1ZSVA 4O4LB 5FJIA 1EVLA 4JZKA 3GG2A 1EFTA 3NOOA 1ZCZA 1SBCA 2OV1A 3GGSA 3HCFA 5GIOE 3G8YA 1ZJJA 1T36A 3N2ZB 4D9FA 4B71A 4LTNA 1Z8DA 3OLXA 3GO4A 4QM7A 1XRLA 4KTVE 3BHMA 3EZ9A 4YGXB 1AKMA 5K3OA 2PBRA 1CE8B 1QKJA 4OHWA 3LBAA 2GN9A 4JZYA 1YJXA 1KORA 5IHXA 1J8FA 3P2OA 1MB9A 3E3NA 3O92A 1JLHA 3VSBA 1URPA 3ORRA 5J2TF 1DZIA 2R7AA 4H7KA 3LKVA 4JLWA 2OUKA 3EISA 2HDOA 2RKBA 3ICCA 4I8DA 1QM5A 4U2CA 3IQHX 5DYGA 4Q9KA 1UPXA 4BLUA 4E70A 2M9MA 1YMQA 4G4GA 2C95A 4L1KA 2IS2A 3UWMA 1F7VA 3LUAA 5JS6A 3AP2A 3Q1LA 1R16A 2NTEA 3SX2A 2A92A 2A7QA 1F5NA 1PV1A 2MR6A 4AMGA 3MWYW 1T24A 1TZ2A 4I8IA 2DT5A 2D0OB 4JBNA 4Z2YA 3AJ9A 5DH9A 2IYSA 1Z33A 2D0DA 2ZAYA 4TN1A 2XGGA 4DA6A 3B6JA 2A88A 1JJBA 1BEUB 1X2EA 3OEYA 2FEPA 3DGFC 1SKYE 4IKEA 3RABA 1CP3A 2R6DA 5JBNA 3F8WA 3VH4A 1J00A 3OLVA 3B3GA 3OCJA 1T43A 4NZNA 1VLJA 3FBTA 2PX6A 5EC8A 3UJ9A 3CVXA 3OEEA 4MVJP 2D59A 3IL2A 1WCIA 1R8YA 3TFWA 1H1DA 1U8XX 2BV3A 4IV0A 4JIGA 1HDZA 3KQQA 3DVSX 3I42A 5GZ3A 1C0KA 2WJ4A 3ZWKA 4XR4A 4D43A 3U44B 4KR2A 2A9PA 5A3VA 1H8ED 1ZISA 4JI0B 3OM8A 4IRMA 4AG5A 2C96A 3KYJB 4NZ9A 2QRNA 1KP3A 2HXYA 2Y1XA 1XO1A 3NIDB 4MRSA 1T8PA 3DL2A 3MJTA 3F3YA 3EXFB 3LYHA 1DBIA 1I2MA 1QIEA 1W5AA 3DAOA 4DSAA 5CITA 3KTFA 1C7EA 4EB6B 5BO5A 5AJYA 1ZOSA 2CBZA 1VPEA 2W48A 4NDZA 1DIOB 2GB4A 3DWGA 3LOQA 2P6UA 1KDPA 1N8KA 3FCOA 1QQ6A 3IR5A 2AE1A 1CW2B 2Q3MA 2BEWB 2COKA 3AYZB 3EYAA 1DC7A 1SXIA 1USWA 1Q7EA 3ONEA 4OGGA 1A8UA 4PNPA 5AXCA 1HTTA 1KH3A 4EW6A 1NULA 4ZV7A 3G5LA 4BTVA 1NJFA 2RDMA 4G0VA 2PA3A 4UAUA 1P0CA 1XAHA 1RNLA 5JD6A 4TSFD 5A6SB 1ZR2A 1OIWA 4BB9A 4D0GA 4C04A 3L93A 1GKIA 1N5OX 2BIFA 1Y6FA 1CF2O 1DIGA 1PTKA 2WK1A 3M1AA 4LG1A 1E94E 1RYBA 4C0JA 1FJXA 4M1KA 1EX7A 3I58A 5KYGA 2X19A 3TLEA 4C6RA 2CMGA 1M34A 3QXSA 4JVOA 1Z47A 2Q27A 5K9ZA 1ZDMA 1N1MA 1E9SA 2QR2A 4QHSA 1S1CA 2NU8B 2C4MA 3HVIA 4QGFA 5G4KA 4TXHA 1F38A 4GIBA 1PV4A 3SSMA 4K9OA 1E77A 3B51X 3HMKA 3VYRB 4B47A 1WV0A 1JHYA 2HJ9A 4EATA 3AB8A 3HBJA 5CB4B 1EINA 2BKAA 4JR0A 5MGNA 1EJBA 3BOSA 2IGTA 2VJLA 1OHHD 3ZE1B 3DBOB 4EFDA 3N7AA 2FTKE 3S2YA 1NQWA 4LXUA 1PLLA 3JR7A 5KYXA 4EJSB 5B1EA 1QE5A 3KELA 3E61A 2FZCA 4YNBA 1SXQA 2EVWX 5HR5A 1W1IA 2WJ6A 3QFCA 4RJTA 3C15C 2JBWA 3KXLA 3PX3A 1EA5A 3H5OA 3UY4A 2IOFA 3FVQA 4KLNA 4HK4A 3E8MA 2HJRA 5K0CA 1R6DA 3WBJA 4WFKA 1TYEB 2F8SA 3VPGA 1A9PA 1O8CA 1SVLA 4L5JA 4MMYB 1M33A 3V8NA 1JUDA 4B9AA 1BE6A 1DE0A 1G60A 2NU7A 4TSRA 4BBPA 3PGVA 2P78A 1FLAA 4JBHA 5JY6A 1ECLA 3IAM6 3VKFA 1UM9B 3EPLA 4BZZA 2IW1A 4Q7MB 1X9IA 2X8JA 1F3OA 3A70A 1ISMA 3JALA 1XRRA 2QQEA 1G59A 3MMZA 2FXVA 2YOGA 1NLYA 1KMQA 4J29A 3WLNA 1VIDA 3F4KA 4FCCA 1PVDA 1YD7A 2XAAA 3OCWA 5B6PA 1GCUA 2OLJA 2J33A 4KLZA 2OFFA 3T5CA 1VLZA 1VDZA 2NPOA 1CKEA 3TMYA 3UWSA 1NTRA 1GGEA 3N8HA 4DC1A 5E4TA 4O2AF 3IEIA 4QFDA 3LQFA 2EQ5A 2QP4A 4NZMA 4S2EA 1AZLA 2ZYAA 2GZMA 1VJ0A 1VL5A 2C00A 4QT0A 3RASA 2WFLB 3QVWA 4B4WA 1I7LA 1FNSA 1HA3A 1MX3A 2GQ0A 2HA2A 3W9YA 3TX2A 4BNDB 1SVNA 4AI6A 1BQEA 5KQRA 4DMLA 1JAXA 1LJ8A 2XB4A 5EE0A 3BZUA 1O77A 2WHQA 1M1NA 1FDVA 2H1CA 1PF7E 3ZNOA 1OH5A 4LSMA 2UUBB 3P5SA 2C7QA 3MWGA 3B3JA 1TZJA 3PTZA 1NI4B 3PI7A 3GRAA 4EPYA 2FEKA 2NSYA 3VHLB 2MSLA 5E1BA 2L19A 1ULBA 2H9AA 5DISB 2PX8A 4L3VA 4PGGA 1V9SA 2Z43A 1QRAA 3H75A 3K09C 2ZJZA 4RTSA 2Y2VA 1E61A 1IY1A 4GG1A 3HSSA 2C3YA 3CXUA 3COSA 3VH1A 3UJPA 4MI3A 1WU8A 2VVTA 2L18A 1SC6A 6Q21A 1CY2A 3WKCA 2BGUA 3G49A 4WI1A 1Q0RA 4LHZA 1Q0LA 1XZAA 5DTJA 4EKGA 4YJ3A 3F3MA 4N18A 2CSUA 3N8KA 1R4NB 1YZVA 4HY3A 5CJPA 3ZCPA 4UM9B 1A9SA 1BX3A 2NO1A 4GNRA 5M34A 4BWFB 2HJSA 4KUGA 4NIMA 4CCYA 5SYNA 1QH1A 3WGMA 4R1SA 2P2CA 1FVOA 2HCBA 1HSOA 1H8HD 1LV8A 3HJCA 4MAMA 4ZVUA 5IUJC 1TVKA 2PH3A 4CL2A 4C0LA 3EWNA 3GUYA 1XMSA 4R83A 1GAJA 3GVHA 3T38A 3P32A 3NAGA 3GWZA 2Q5JA 2YFYA 4XFJA 1CRLA 1B23P 1OYVA 4BV2A 1C7FA 2PSJA 3KLNA 1J8MF 1H1TA 4JA2A 5CVVA 2UAGA 3B9RA 2CV1A 2ABWA 1IH8A 3G8BA 4CDNA 1Y3CE 2HMUA 3A05A 2QGNA 1RKVA 1HLDA 1MNAA 4KIGA 4WHMA 2WD7A 2CJPA 4QOFA 1D1SA 1U3GA 2GXQA 2HXGA