3MERA

Crystal structure of the methyltransferase slr1183 from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr145
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
173
Chain Sequence
EPNDFLVSVANQIPQGKILCLAEGEGRNACFLASLGYEVTAVDQSSVGLAKAKQLAQEKGVKITTVQSNLADFDIVADAWEGIVSIFCHLPSSLRQQLYPKVYQGLKPGGVFILEGFAPEQLQYNTGGPKDLDLLPKLETLQSELPSLNWLIANNLERNKAALIQLLGQKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Slr1183 protein
publication title Northeast Structural Genomics Consortium Target SgR145
rcsb
source organism Synechocystis sp.
total genus 47
structure length 173
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3merA00
1RI2A 2PKWA 2WA1A 2C7PA 4GOMD 5GM2A 3FYDA 4IKPA 1XXLA 5KS2A 9MHTA 2AS0A 2P7IA 1NE2A 2NNWB 4RTSA 3DXXA 1G38A 5FA8A 1TW3A 3R6TA 2VZ9A 4QDJA 1VQ1A 3OCJA 4PWYA 3SSOA 4RTOA 1RJGA 3RIEA 4QVGA 5D1NA 2GH1A 5EVJA 4CTJA 3HTXA 3REOA 5DRYA 3DXZA 3OPNA 5EC8A 2YTZA 5GOZA 5CVVA 3CBGA 1KR5A 5DSTA 3T0IA 1VPTA 2UYQA 2P40A 2ONZA 3M70A 2PSSA 4PYIA 3MCZA 2Z6QA 3EGIA 3C0KA 2FK8A 3G2PA 4P7JA 5E1DA 3TQSA 1NBHA 5MHTA 2P1DA 4HGYA 3FYCA 2QYOA 5H02A 1XDSA 1X1AA 1VP3A 1ZHFA 4RSRA 2OYRA 4CKBA 4CKEA 3LDGA 1P91A 2NP7A 3DOUA 5LQUA 3OZTA 5KVAA 1YZHA 1D2GA 4YV0A 2BR4A 3T7TA 4HTFB 2IH2A 2ERCA 1ZGJA 2JG3A 3IEIA 4QTUB 1XJ5A 3QV2A 3TKAA 1KXZA 2PXAA 3O7WA 2PJDA 3EEOA 2G1PA 1EIZA 1JG3A 3HP7A 4GF5A 2I62A 3M6UA 4DCMA 3MQ2A 3T7RA 3LBYA 5GINE 1BOOA 3UFBA 1MJFA 2K4MA 2G8NA 3GU3A 3P8ZA 4R8RA 2JHCA 5DRTA 3GRRA 2V7EA 2PWYA 2AOWA 3HVIA 2O57A 3Q7EA 1Z3CA 2QM3A 5DTQA 1I9GA 3ID6C 4HSGA 1VBFA 5LQKA 4OQDA 2DULA 5DM4A 3SGLA 4U7PB 4BLUA 4XUDA 4AZSA 4C07A 3VC2A 3P71T 4RVHA 4V0RA 2PWPA 4DCGA 1F38A 1DUSA 1G8AA 4X61A 1G60A 2PY6A 4K6MA 1QAOA 3TKYA 2BR5A 2Y1XA 3BT7A 5E9QA 3MERA 4CTKA 2OY0A 3AWIA 3DR5A 2UYHA 4PINA 3MAGA 1NV8A 5K05A 1P39A 5E1BA 2PGXA 3JWHA 4CKCA 2VP3A 4IWNA 3ELYA 3EGEA 4DA4A 4AZWA 3FUXA 5HOQA 5G02A 3C6KA 3HM2A 1AQIA 4M38A 2PLWA 3AXSA 2H11A 3VC1A 5DM0A 1EJ6A 2GB4A 1WS6A 3HCDA 3OFKA 1VP9A 5B1SA 4NECA 3KR0A 2YXEA 4RTKA 2BR3A 3TFWA 3KQYA 2WK1A 5EZQA 3NMUF 4EKGA 2IH4A 1KHHA 4RVFA 3LECA 1XDUA 4KWCA 2AOVA 5CUQA 4C4AA 2HMYB 4YV1A 2IBTA 4XUCA 5EMJA 2ZZMA 3HA3A 3GDHA 1O9HA 2QY6A 3FRHA 1R00A 3LKZA 3TR6A 4C08A 3IYLW 3LBFA 3CJRA 5DT2A 4RV9A 3EMBA 2KW5A 2YQZA 3UJAA 2YVLA 3MTEA 1JG1A 3DLIA 5EMMA 3A7EA 4XUEA 2YUIA 3OE4A 3LDFA 5FA5A 5T67A 1JG4A 3NWBA 1ORIA 1WZNA 5EPEA 4OQEA 4BLVA 1AV6A 3I58A 5ICFA 3RODA 3FRIA 3DUWA 3UJCA 2B78A 2NXNA 2AN3A 1IM8A 2YXDA 5CIYA 1N7JA 2G71A 4CWAA 2PXCA 2ZWAA 4PCLA 5KQRA 3EPPA 4IV0A 1XCJA 4LG1A 2CWWA 1NW6A 5FTWA 3QOWA 3TM4A 3SMQA 3KKZA 4MTLA 4P58A 5FADA 3UBTA 5EZSA 3TPZA 2IP2A 5D1HA 3NDIA 5E2BA 3TLJA 3V8VA 3BUSA 4HRAA 5CVEA 3I64A 5C0OE 2UYCA 4E2XA 2A14A 2F8LA 2BM8A 2IGTA 3NTVA 2I9KA 3B89A 2O07A 5CVJA 2AOTB 3UJ9A 3NVMB 3UJ8A 4PCAA 1XCLA 2WA2A 4P7KA 1SUIA 2Y1WA 3R3HA 5DX1A 2C7OA 3AJDA 3LDUA 4B17A 3R9XB 3O31A 3LGAA 3GRZA 4OA5A 4HH4A 5F2NA 5EEHA 3E23A 5EKXA 2B9EA 3DTNA 3G8BA 2NXJA 5K0LA 4E30A 4R8SA 3SSNA 1I4WA 3BZBA 3HCEA 3VYWA 2CMGA 1KYZA 5HFJA 3NVKI 2IPXA 1FP1D 2XYRA 3E7PA 3KPUA 1N7IA 1JR4A 4AX8A 2IDJA 4QPPA 5CCBA 1DL5A 3P9IA 5DX0A 2FCAA 1R8XA 4X60A 2VDVE 3ELWA 3KPJA 5ICCA 3ER9A 1V39A 3BWMA 3K6RA 3P9NA 1F3LA 3KQPA 4E2ZA 5K0BA 1AF7A 1UIRA 2JHPA 4KRGA 3TMAA 1YFJA 2GPYA 1M6YA 2YR0A 3A4TA 1SKMA 1XTPA 1KPHA 1TW2A 4PYNA 5EG5A 2OB2A 4HG2A 3SVZA 2C7RA 3PB3A 4F84A 1RI5A 4ER7A 4FT2A 2XYQA 1U2ZA 3S68A 1L1EA 3HVJA 2OBFA 1VL5A 4X1OA 2ESRA 4Y2HA 5ICEA 5K0JA 2R6ZA 4C04A 3M6VA 5DX8A 4LECA 2AZTA 3P2IA 3SM3A 1WXXA 4PYJA 2JHAA 2CKDA 3KQMA 2ZIFA 3BWCA 4GUAA 4CXMA 3BWYA 3P2KA 3DMGA 4A6DA 4PYKA 2FK7A 1FP2A 2B2CA 1XVAA 2EG5A 3FTDA 4Z2YA 5DXAA 3EVDA 3GO4A 3B3FA 3PFGA 1RI4A 2PXXA 5EMLA 1KYWA 3ERCA 3NJRA 3B3GA 2FRXA 2FPOA 2ZULA 4GC9A 5BP7A 1JQ3A 2G70A 5K0GA 3M6WA 3CKKA 5BW4A 4DKJA 5T64A 4M7RA 4O29A 1KP9A 5LQRA 1YZ3A 3FPGA 4GC5A 1NV9A 4PIMA 3Q87B 3HVHA 1RJDA 1YB2A 2P8JA 4FZVA 3UJDA 5K09A 4FR0A 2AVNA 3BKWA 2P3QA 3B5IA 5LQNA 1YF3A 1D2HA 4HGZA 2CL5A 5GIOE 3HCCA 4A6EA 3CC8A 2VS1A 3FTEA 3BGIA 4FT4A 3THSA 3DH0A 5HZMA 4RTPA 3SXJA 3C3PA 3DULA 2YX1A 3GWZA 3B3JA 3H2BA 4R6XA 4MWZA 5E9JA 3TRKA 1OR8A 1XDZA 2FHPA 2ZLBA 3FUTA 1SUSA 3HCFA 3ER8A 3OZRA 2JH9A 5DTRA 1QAMA 5E8RA 3BGDA 2OB1A 4WXHA 3PX2A 4PYOA 4QTTB 5FUBA 3PVCA 5FWAA 5C1IA 2PT9A 3RW9A 2GAFA 3A25A 3PFHA 3C3YA 4KDCA 1IY9A 2ZZKA 1Q0SA 3G2MA 3OFJA 3FUVA 4PGGA 2DPMA 3OE5A 5EEGA 1PRYA 5CCXA 2YXLA 2PX8A 3F4KA 4PYLA 4EQZA 5P8WA 1G55A 1O9GA 2P35A 3LCVB 3QOXA 4RTRA 3HVKA 3EVBA 5FQOA 1G8SA 1P1BA 3LSTA 2O06A 4E2YA 4AUKA 5GIPE 1HNNA 1MHTA 1JSZA 1WXWA 3THRA 1VE3A 2B3TA 3G89A 3E05A 4YMHA 3G2OA 3EVZA 3LKDA 3G88A 4KW7A 3P2EA 3DLCA 4HC4A 3WSTA 1BHJA 2GA9A 3LHDA 2Q41A 5FCDA 3G5TA 1Y8CA 2HR1A 5CVDA 1YFLA 1DCTA 3KQVA 5CD1A 4PYMA 4ZTBA 1VIDA 3EGVA 2G72A 2P41A 4MQ4A 2QRVA 2XVAA 3X0DA 1ORHA 4UOEA 3PT9A 3G5LA 5ICGA 3BXOA 5LSAA 2NXCA 5K8VA 2XVMA 3ME5A 2AOXA 2ORED 1RI3A 4KDRA 1RI1A 2I6GA 3ELUA 2CMHA 3JWJA 3P9KA 3R0QA 5DPMA 4E70A 1WG8A 3BKXA 4QDKA 4YUWA 4RTQA 4BP3A 1P1CA 3KQWA 3A26A 2IIPA 2OKCA 3EVCA 4X63A 3SSMA 4E32A 2ZVJA 3PS9A 4FGZA 5HILA 4YUYA 4BP1A 1QYRA 1IXKA 1RJEA 1N2XA 3UA3A 3FUUA 3GIWA 2IDKA 3LCUA 5E2AA 7MHTA 4RTJA 4RTNA 2AOUB 3M33A 2IFTA 4F86A 5U4XA 1NW8A 1INLA 3A27A 3UJ7A 4DMGA 3KPWA 4EKIA 4ER5A 3PTAA 5F2OA 3FTCA 4LWPA 5LQCA 1R74A 5HIKA 2HWKA 3FPJA 3K0BA 5FQNA 2EFJA 1KPIA 4ATNA 1SVUA 2ZFUA 3DMHA 3G7UA 2XBMA 2FYTA 2ZBPA 1L9KA 3NWEA 3UJBA 5LQAA 3GRYA 5EIWA 4DQ0A 1UWVA 5FWDA 8MHTA 3JWIA 3UJ6A 3EVEA 4E33A 2ZIGA 4PONA 3UA4A 1QZZA 3V97A 3G2QA 5KQSA 2P3OA 1ZG3A 2BM9A 5CVUA 4GOOD 3C6MA 4XCXA 5T6BA 2BZGA 5DM1A 2UYOA 5K0CA 5M5BA 1EG2A 2Z6AA 3JWGA 4GBED 5CM2Z 1Q0TA 1JTFA 4OX9Y 1R6AA 5C9ZA 3M6XA 3GXOA 3R24A 3TOSA 3GRVA 2HV9A 4KIFA 4P7GA 3EMDA 1M0EA 1X1DA 4PYQA 3GJYA 3MB5A 2BH2A 2EJTA 5JR3A 1R18A 3UWPA 2H00A 4H0NA 1D2CA 4G56A 4MHTA 4R6WA 2HNKA 5EHIA 5BXYA 2ZSUA 5HIMA 5HIJA 2ZCJA 3D2LA 4DM3A 3GRUA 5GWXA 3KR2A 2EJUA 2N47A 2PX4A 5GP1A 2AR0A 2OO3A 3HNRA 2Z6UA 2R3SA 4RVGA 4ER0A 1ZQ9A 3GNLA 2UZ4A 1WY7A 3HA7A 3AY0A 2H1RA 3HCAA 3KR9A 4QQKA 3KQOA 5EMKA 4POOA 3CGGA 1B42A 3EVGA 2XYVA 3OZSA 5DM2A 2ZBRA 3FPHA 3O4FA 3IHTA 3BWBA 4HTFA 2IBSA 5DLYA 5EOVA 4RVDA 4OA8A 2O0LA 5HIIA 1SG9A 3KQSA 4C05A 4YMGA 5DTMA 1PJZA 1QANA 5K03A 5KYGA 3HA5A 1NW3A 3I9FA 3KHKA 4FSDA 4GQBA 4LWOA 1EQAA 5EHGA 4EK9A 3G8AA 1BC5A 3LPMA 5BW5A 4C03A 4DZRA 5FHQA 5HEKA 1ZKDA 3ELDA 1M6EX 5DSXA 2P3LA 5JUWA 2OPBA 4R05A 3U81A 4QVKA 4GEKA 4QPNA 5EGSA 4E2WA 3HCBA 5E1OA 4KIGA 2PT6A 3CVOA 1NW7A 1NT2A 2I7CA 3EEYA 5K0NA 2ZZNA 4GOLD 4YUXA 1ZGAA 1L3CA 3L8DA 5LQJA 1JTEA 3OU7A 4ER6A 3T7SA 3TM5A 4F85A 2AN5A 4M36A 2V74B 3AXTA 4AZVA 3KU1A 3OU6A 4FP9A 4EMSA 3CJTA 4Y30A 3GCZA 1NBIA 1L3IA 2NXEA 2ZBQA 4JXJA 3FUWA 4ISCA 4FSXA 4OBXA 3I53A 3EVAA 1X19A 3MCTA 1FPQA 3IV6A 3KR1A 3MTIA 2JH8A 4BLWA 4RWZA 1KPGA 1TPYA 4RYLA 4C06A 4PNEA 3LCCA 1AQJA 1JQEA 2LD4A 2OXTA 1H1DA 5FULA 2C7QA 1X1CA 3ANXA 5E1MA 1EJ0A 1JQDA 2ADMA 3CCFA 3E8SA 4OBWA 3PLAE 5EKUA 4DF3A 4ER3A 1O54A 3NW9A 3P97A 4V0QA 4RTMA 2IH5A 3EVFA 3P9CA 1KIAA 1YUBA 4M37A 3SX0A 2AN4A 5FHRA 3HEMA 3VSEA 1SQFA 3FPFA 1FJXA 5K0EA 1FBNA 3I5UA 3PX3A 1NKVA 4PIPA 2NP6A 5IH3A 2HTEA 2QRVB 4KVZA 5DXJA 2OZVA 3DMFA 3UZUA 2PV0A 4YUZA 1G6Q1 2AVDA 4U7TB 1HMYA 2QE6A 2PX5A 1UFKA 2PVCA 4AZTA 3OU2A 2EX4A 3CJQA 4YUVA 1EAMA 1R8YA 2ZW9A 1RJFA 4FS8A 1JSXA 1T43A 2VDWA 1SQGA 2ZIEA 2NYUA 5E8JA 5EIFA 5E9WA 2O05A 3GGDA 5GM1A 3SR4A 4YV2A 3FPEA 3KPVA 1NW5A 3KPYA 3DP7A 4RX1A 3NDJA 4IV8A 3BGVA 5DWQA 2GS9A 2PX2A 3MGGA 1JG2A 1L3BA 2E5WA 4PGHA 4EVIA 4MIKA 4P7FA 2ONYA 1QAQA 3B7PA 3ORHA 3DXYA 5LR6A 3KQQA 4E31A 2B25A 1BKYA 4QQNA 3FTFA 2GLUA 5ERGB 2VDUE 3A7DA 5K0FA 10MHA 1X1BA 3KQTA 4RTLA 1I1NA 2AOTA 5F2KA 4GOND 2PBFA 3LX6A 4X41A 3LL7A 4BY9E 2ZTHA 3FZGA 2AOUA 3MHTA 2ZWVA 4L7VA 4WVLA 2JJQA 2P7HA 5K01A 3M4XA 5EQJB 5IKMA 1VLMA
chains in the Genus database with same CATH superfamily
1RI2A 2F48A 1H2EA 2FZEA 1C3EA 3IELA 4FKZA 2UZ1B 5DK6A 4EPXA 1YS2X 3QXSA 1GPKA 3PDJA 4YCBA 4TQ9A 1UH5A 4ZFNA 2WF7A 4GX5A 3G8CA 3OCJA 5K3CA 1QG4A 1J99A 1OSNA 1L7BA 2Q1TA 3W5HA 2H3EA 2XXJA 2ZWMA 3JSAA 1JZQA 1TQ8A 2I76A 4IDCA 4R01A 1S9HA 4R9NA 5F21A 3HTXA 3H5VA 4C6TA 4JYZA 4UNQA 3FHJA 4LVOA 2WTAA 1ZM2A 4P4NA 1TCAA 1IH8A 4PYIA 2Z09A 2Y3IA 1IZ7A 2LZ0A 3H3XA 4BWYA 3RC9A 4DA7A 1PVVA 5I9BA 4WK6A 2ZYAA 1T9DA 2IU4A 3JD3A 3KKNA 1ZGHA 4O2AB 1VP3A 3DA8A 1Z6YA 2X6TA 3ETLA 1YE3A 2R4QA 2CFIA 4EI9A 4Z9XA 1JFFA 5TQ2A 5AVRA 3AF6A 2WWGA 2V45A 3LLCA 4MQFB 3JQFC 4M1EA 2V0CA 2ROQA 4X5OA 2I1WA 1G5RA 4J0JA 1DADA 4EF6A 2AQIA 3ZV5A 3KSRA 1LQTA 3AHGA 3JQ9C 2W7TA 3R7DA 1ESDA 4H16A 3ZC3A 5B6IA 2FQXA 1PUJA 2VTBA 1XPOA 3PDCA 2QJFA 1IN5A 4HDSB 3SN6A 5A4DA 2XZLA 2B8NA 3QK7A 2G9QA 3KZMA 4DV1B 2ONKA 2W2MA 4NAHA 1JR6A 4QU0A 3P8ZA 1YQUA 1YZLA 3I42A 5TV2A 1ZUWA 2AOWA 1IQUA 3K70D 3DHYA 3ETGA 4EMBA 2IYWA 2NO9A 4NICA 2HX1A 2ZB4A 3PU6A 4GICA 4EGFA 2DPXA 3FZEA 4GE0A 5LP1A 3PC4A 3ADOA 4BPBA 2QG9A 3RSGA 3RJ9A 3V2HA 2QJTA 1YZFA 3O8BA 3VC2A 1U99A 3EC1A 3P71T 3TLKA 1W1IA 2OMEA 3VU9B 1K7XB 3FCAA 4KZKA 3SIWA 3TI7A 1JQBA 4EA6A 4WKOA 5CDYA 1ZH4A 1O6FA 4U9UA 1U63A 3FOBA 4C7KA 1QAOA 3F71A 2C8VA 1Q6ZA 1XWFA 3FCEA 2MYNA 3H97A 1GTMA 4UASA 4LC1A 5FF9A 4I50A 2JVIA 4X1KA 1PBNA 4ZYZA 1E2GA 5GMOA 4PHTA 2XVYA 2OV6A 2KJQA 4JOQA 4PINA 4C3OB 5IPFA 1FA9A 5E3HA 2AB0A 2FW9A 4JR0A 4BL5A 1W4RA 4OUKX 3H4IA 3T3PB 3NX4A 1Y1QA 4ZVKA 1KETA 2PLWA 4ECEA 4DR7B 2XRFA 5EE3A 5EJMA 3RU9A 3H42B 1E7YA 4QELA 3IVCA 1OWNA 1JEQB 1B8OA 4NECA 5TT0A 4AKGA 1XMOB 1XQ6A 5IW8A 2XRYA 1EK5A 1W36B 1K1EA 3IAM1 4RVFA 4YYZA 3G0BA 4PNPA 5CUQA 5TARA 1OOEA 2HMYB 4YV1A 4PX3A 4QL3A 7MDHA 2H65A 4JNCA 2HPZA 3GDWA 2I6XA 3GDHA 1TC1A 4NBNA 3LKZA 3L1VA 3M6FA 3NYQA 1EFLA 4G07A 3LBFA 4KP7A 4NATA 1I7QB 4FM9A 1KK3A 3CZPA 3EXEB 5J9FA 4DAEA 3JTMA 4R8KA 3O82A 4Z51A 2AWOA 2Z3ZA 1FLDA 2FFQA 4OXIA 4MP3A 3NS7A 2I4OA 4ZZ2A 4BO1A 3ECAA 4YAOA 1QH0A 5TQVA 4TRJA 1R0LA 2YDXA 1BFUA 1NI4A 4RD3A 4IXDA 4RE5A 4UDXX 3S7ZA 1X39A 2M9MA 2YXDA 2VAWA 2NT3A 3QU9A 4R2JA 2H1FA 4AO6A 2WP0A 5JI2E 3LK7A 4OM7A 1JWAB 2IYYA 3GJZA 5I7AA 3F2IA 2HGZA 3UB2A 3P45A 3T7EA 3GFGA 4ENWA 3TM4A 1UWLA 2ZYGA 4KDFA 3E82A 3OF2A 3U1VA 1ZD4A 3L6RA 1H94A 5EZSA 4CL0A 4OJNA 3EK2A 3WK8A 2XGOA 3BUSA 3EGWA 3OT4A 2XYPA 4HRAA 3RYHA 1A8HA 3SKYA 1XVIA 5BVHB 1FTWA 2OSVA 1WXGA 4LMRA 3H5LA 3QELB 3ZKWB 4FOTA 1NLFA 1OXTA 3HI6A 4HFNA 3SF8A 1U0OC 3BFJA 3E2MA 3K09A 4WEOA 3UBMA 4FQ7A 1RRCA 4EYSA 2C7OA 5JT1A 2OL4A 3WYFA 3OTIA 1OFVA 3LGAA 3TO5A 3WYBA 1V5EA 2E89A 3W5BA 2O7SA 5EKXA 4BNLA 3DTNA 4XWWA 1C1XB 4Y9UA 4V1CA 2PJRA 1I4WA 1NURA 2FXVA 4Q3LA 2OV4A 2JBHA 2IPXA 1FMFA 4H4CA 1GHTA 1KL7A 4GMKA 2FCAA 1CYDA 4PLVA 1O8CA 3LI2A 5D85A 4DQUA 1A96A 3NFYA 1T8RA 5AVWA 3JQAD 4FYKA 4M9SA 4ZODA 5JZMA 3N3AC 4ZVVA 1I4EB 4P2GA 5EG5A 2Z6VA 4QECA 2CLSA 1ZL2A 3KLPX 4EG0A 1V16B 2GFIA 1U2SA 4KNVA 2HDNB 3QG1A 1SM4A 4Q7KA 5BUQA 3VI4B 1ISMA 1LBTA 1R1DA 2QD1A 3QPVA 4A8TA 1HY3A 2TS1A 2Y0EA 2AQKA 3Q6NA 2H54A 1L1EA 2V4UA 5HS4A 4RV5A 4IOMA 4HFRA 1VDMA 4MR8A 2CNWD 3N53A 4J7AA 2Z4RA 4LVNA 3WHIA 2ZDQA 4BBJA 1J20A 3HMKA 3R7AA 2WIGA 2IOQA 2Q9CA 3BWYA 3ED1A 4H1WA 4QICA 1A9TA 4D46A 1TK3A 3I9V1 3VYTB 4A6DA 5ITZA 2DLCX 1VJGA 3R3XA 3L2OB 4X54A 9LDTA 3KD2A 1X8XA 4UNSA 5JJLA 4I1IA 3EBLA 1N5KA 4X94A 3V5NA 3UKOA 2JFVA 4X8MA 5AHOA 1E89A 2C7VA 3E9ZA 1TECE 1YA8A 4XIIA 1H42A 1W8IA 3PR2B 2W4MA 4YECA 3ESRA 1ML4A 1XVTA 1P60A 4L8WB 3SYNA 4I5FA 3T3EA 1EQ2A 5F2EA 1K3TA 5DI9A 4BFXA 3QI7A 2B1QA 2RC5A 3QY0A 1SG6A 4FMDF 4ON9A 4BU0A 2D74A 4TM8A 2KPOA 1IQ0A 3FOFC 5BR4A 1M83A 5AVQA 5GZ6A 4N76A 4DVGA 3UT6A 3IL2A 1FFXA 3R3VA 4QASA 1ZMOA 5AVVA 3LYUA 3WXMA 3DXFA 2IZOA 4A6EA 2IZ7A 2PLRA 3BGIA 2VP0A 5IEBA 1E18A 3VU1A 4BKPA 4MW6A 4NK4A 3ZQ6A 3QITA 3U62A 5AKEA 3BZWA 2QTZA 2J5BA 3GMIA 2JBWA 4OH7A 5CCEA 4JDUA 3TF5A 1Y7LA 4B80A 1NQTA 3WMGA 4FOPA 3L79A 3N7TA 1FVXA 5DI3B 1VA5A 3TJRA 1A5BB 4XSGA 1EH5A 2DY1A 2ZR7A 5DP2A 1KEZA 5AQEA 5C1IA 4CV3A 1LPNA 2PT9A 1PP4A 1CUSA 2YVQA 4ARUA 2Q5EA 3WBJA 4ZAGA 2XOXA 3R40A 1AN0A 2OESA 2GVDC 5EIBC 3DQPA 3WLLA 2X2PA 3ZYZA 2QS9A 4XVQA 3S1SA 1RZRD 4DCVA 2WYWA 4ZOAA 3VX4A 1DKPA 4FMPA 4UXJA 5LZ9A 2JLAA 5UKDA 1IBCA 4JS0A 5JBNA 1MQAA 2GJ8A 2I4NA 5AVTA 1OYWA 5EUQB 4MVCA 3BRWD 2R66A 3HBJA 1WR8A 1MRSA 3P2MA 2X3UA 3GBVA 4UEQA 1HDYA 4BQOA 4YR9A 1SB9A 3UWOA 2JFHA 3STWA 1LBEA 3D54D 4LYYA 3G88A 2Q7DA 1IUPA 4AJEA 3HUDA 1B2LA 3I6MA 3LIIA 4X45A 2EAUA 5CB4A 1BHJA 3HUEA 4Z9AA 4C7OB 2EL9A 3HGMA 2QLJA 5DASA 1AKWA 2ID7A 4ZCIA 1LS6A 2HSZA 5CJ2A 5CDUA 5KTPA 1M5RA 1P4RA 3CX4A 3P9QA 4K0RA 1JDBC 2DUWA 3GZNA 4XDYA 3BRCA 3K2IA 3OUTA 4J0CA 1G8JA 2ZQ5A 2DBQA 1M2VB 1XCOA 2D5IA 2GI4A 2W2PA 2PFSA 3ZWWA 2XECA 3B1VA 4L22A 4V03A 3EQ2A 5EL0A 4O4LA 821PA 4V0SA 1QHXA 5G40A 1DDIA 4C21A 1ILWA 1D2RA 2AFHA 2VYVA 1QF7A 2QXYA 2ZJ3A 3QPAA 4WT7A 3LPDA 4HZUB 1WCV1 1BEZA 1IG0A 1UF9A 4HQKA 1B26A 5GONB 2D6FA 2QN6A 4TQAA 4CXMA 4G23A 2DQYA 4ZVOA 3ZXIA 1XKLA 1MOZA 4JBNA 5EWMA 2DYKA 5KWEA 4UAVA 3E70C 3UEOA 4EYOA 4MQMA 4PZZA 4TZTA 2O2GA 1V4VA 3R4VA 1ZI6A 3VTFA 5FQNA 2EFJA 1K7SN 3MLAA 4FZRA 1Q19A 1SCKA 3T52A 3H83A 1CY7A 1XCGB 1AV6A 3TQQA 3W4IA 1KMHB 2JH3A 4Q34A 3AJRA 2OK7A 4ZIRA 4DIUA 1L5FA 4H3KB 1AO3A 3AUTA 3ROTA 4OYHA 1KMNA 1PZNA 3I9OA 2K5UA 3BERA 1GD1O 1MB3A 1E20A 4Y2XA 3ETHA 1FIUA 3AINA 1YAHA 1F1BA 4LRWA 2MYUA 2V1UA 1M2OA 1XIVA 2FWRA 2O0HA 4D25A 3HWSA 4A6XA 4N5NA 3QVMA 2WP8J 5COAA 1G2QA 1R6AA 1W52X 1XDDA 2VJLA 1PJQA 3K4HA 3M6XA 2P11A 2J0VA 3EIUA 3EFOA 3VVLA 1NG9A 4HNRA 1N25A 2BKAA 3B36A 4TRNA 4G4SO 3MM4A 4CT4B 4B8WA 1GOTA 3WZLA 1DV2A 2GARA 4F3CA 2OCAA 3H8WA 1BHQ1 1M34E 3E4CA 4IIXA 2OORA 4YRQA 5HOEA 1Q1BA 3AJEA 3O4VA 1NBMA 1GNRA 5IKOA 1D2CA 3IDZA 1ZM3A 1E9AA 1Y8QA 5C5CA 2WYHA 3VZPA 1ZP6A 5DO9A 2ZSUA 2J0UB 4DEYA 1RBMA 3D2LA 2FKAA 1TA0A 1RQNA 2BP7A 2V6IA 4NNJA 1F2UA 3R75A 4F45A 2IEBA 3IP3A 3NBAA 4TXJA 4G0OA 3TRDA 2CL7X 3ACCA 3KTAA 4K03A 5H68A 4EFMA 1ZUIA 3CEMA 3KTOA 4BFWA 1FQJA 1WY7A 1QMPA 3IESA 4HDMA 5AM2A 1CBUA 1TDJA 1B42A 5AVSA 1JJAA 2WIBA 3GG2A 1UOPA 4E22A 2PH1A 3UHPA 1MAVA 3RDPA 5DLYA 3M81A 2ORVA 4MUBA 1VSTA 4IDQA 3KQSA 1NC1A 5B7PA 2NADA 4NPCA 2ONCA 4HPXB 1CUIA 5IMBA 3STHA 4AWXA 1FLNA 2FQ1A 2XEDA 4K3UA 4PC7A 2Z83A 4LCJA 3I9FA 3W9BA 2FMKA 1IJKA 4JL5A 1RW4A 4QEDA 5A4MS 4B4UA 3DZIA 4DMFA 4EFKA 2BZ1A 2IX9A 2ZVQX 3L5KA 3FTPA 2FFJA 2YICA 4MI9A 4RIFA 4CM1A 3SE7A 4M3NA 2QP4A 3RUAA 3SEFA 3AFOA 1NF9A 1HOTA 3U81A 4ENQA 5KDLA 3K9GA 3CU5A 3GD5A 2FW6A 3WBFA 4CLRB 3H9GA 2W0MA 2M6LA 2JGMA 3GC6A 5H3HA 1PV1A 5CHYA 3OU7A 1U0LA 3PR3A 4OHCA 4AK9A 1SXIA 4Q66C 3PTZA 4I6EA 3U44B 2HMAA 5K3FB 4U6NA 3AHHA 1DIRA 3CJTA 4MWGA 3F6BX 4Q4LA 4V0NA 1NBIA 2H4HA 4AS3A 4C20A 3LWZA 2WF5A 1XZFA 1MQSA 1BGVA 1EVZA 3HCOA 3QVWA 3A1UA 3R5FA 5CURA 5JSYA 1AUQA 4RYLA 5JIBA 2WT8A 3HBFA 3BHIA 3OD5A 2DBVO 4ZU3A 4I6GA 4PC2A 4ZV7A 4DIFA 1DAHA 3ICVA 2C97A 3TZQA 2XODA 3ILHA 3LYAA 1G5HA 5AUQA 1KBZA 1YL7A 2FI1A 4JQOA 2F1HA 3EGXA 2ECFA 2I7TA 2HU7A 4MWDA 5EKUA 5BSRA 3WRWA 3P9CA 3ZGLA 4LV8B 5JVDF 2A1UA 3O8CA 3G6KA 5E4YA 5FWYA 2QTMA 4WKNA 3QIVA 4Z9FA 4YRKA 2Q1WA 2QZJA 4O6VA 2H52A 3EW9A 3LKBA 3RS7A 1J23A 1FBNA 5HK9A 4J16A 5AOVA 4FYWA 3Q5DA 3C2QA 4TT8A 4GZ3A 2XSZA 3RS2A 3FMPB 2SCUB 5EYPB 3FDXA 1OI3A 1UQRA 4IW3B 4PR0A 2BTOA 3L0YA 1Y5RA 3R74A 1TTQB 1FQKA 1WV1A 2PVCA 3OU2A 4FFVA 1IN6A 3C8DA 2QVZX 2BOVA 3QVGA 2SKDA 1J8FA 1GZDA 3HBAA 3BB1A 4Y9SA 2K7FA 4N8SA 4DR1B 2LW7A 4H3VA 3U7QA 1RFLA 2EERA 1U04A 1N6NA 3IMGA 2O05A 1MT3A 3RS0A 1E7RA 3RUPA 2FR8A 3MTBA 3NOQA 1CB7A 3DP7A 4FFLA 4WK4B 3U9TA 5I7EA 1JXQA 2YWGA 3W9YA 1WUIS 3UJHA 5FOQA 2C8KA 2BEKA 2HQRA 4V38A 5CHEA 4W7IA 5AVYA 3C15C 4F5DA 5JJCA 2K7ZA 2ET6A 1NHGA 3ACBA 3PWSA 3ORHA 4NCNA 3WK9A 2X1LA 4L8GA 1G7SA 4HEHA 4RQAA 1K4YA 3SS9X 3RIGA 4F3KA 2OEPA 1VE5A 2IW1A 1ZYUA 1WVIA 3GFFA 5JSZA 1NSYA 4C43A 4Z0NA 2JVJA 3FZGA 3U3OA 3CLTD 3N2ZB 3OF5A 4NOJA 3RVBA 4HNAB 3V1YA 1ID8A 2WTEA 2PRIA 2LCIA 5AJZA 1QRTA 2QZ9A 5FLYA 4XH9B 2F59A 4DWVA 3BF8A 2WA1A 2JGDA 1OI4A 4K9KA 3U31A 1O97C 3CLSD 1P5HA 5T3YA 1W87A 1QFYA 3S2EA 2QLBA 3DEYX 2NZYA 5JS7A 2AS0A 1N7HA 5TB5A 1NE2A 2YL2A 4FONA 1TADA 5LA6F 1TW3A 5A4FS 5CVTA 2R8EA 2FZ5A 2VZ9A 3WLFA 4GM4A 4MRRA 2IHNA 3WO1A 1Y3AA 4HDNA 3NHZA 1ZICA 2WVAA 2XWPA 4MI6A 5DRYA 2WNHA 5F1OA 4N41A 4N3GA 2PMWB 1G2PA 4LNHA 4A3SA 1DG3A 1VKJA 4MDFA 2ZI9A 3E2PA 1K8ZB 2WSIA 4J1SA 5KZMB 2J45A 3BXEA 2Z6QA 1V7QA 3ANYB 1JSLA 4NU8X 4S2UA 5MF6A 4LXGA 1DX9A 1GCAA 5E1DA 1HURA 1DOZA 1K4KA 2DPYA 1X7GA 1XNQB 1RU3A 3GT4A 4CKEA 4H1VA 1TMYA 4NV1A 4Q3AA 5FI5A 3W90A 2DPGA 4BMOB 4BNJA 3MCUA 4DMHA 5JS6A 4G5SA 5GVSA 5CG2A 2B35A 3DOUA 3I92A 3QHPA 4JWTA 4BB5A 4CHGA 2XZDA 5L53A 3DE2X 3F0TA 1GV0A 4IIFA 1Q21A 2WTBA 5LP6C 4REQB 5DLDA 4E09A 4PX2A 4S1VA 5FLKA 3T5GA 5B53A 4LDNA 1D8AA 1B0ZA 2CUTA 3PL1A 1N6HA 4DM4A 3RAEC 5KMGA 3EEOA 4DCMA 3W4KA 3KALA 3V1LA 9GPBA 3BD6A 3PXXA 3T7RA 4OXRA 2PUEA 3UFBA 3QV1A 5J4LA 3HR7A 2X19A 2WAMA 1JEJA 3HYTA 5DOVA 2J3QA 5CYOA 1GZ3A 1V7ZA 3RIMA 4IUDS 4OHRA 4YRCA 4Z3DA 3Q7EA 4OUDA 5LP6F 4W5WA 5F33A 1YQXA 2NVWA 5AM0A 4FDTA 4YQZA 1UPTA 2FUEA 2PSEA 1YZKA 1N6OA 3UCEA 1P3JA 3VR4D 5T7BA 4IF4A 4FMCF 3EFHA 4V0RA 3FFXA 4LRSB 5H1YA 4BO3A 1I94B 5FUXA 2GEUA 1ULTA 1CIVA 2VXBA 3DV9A 3JQ8B 1G8AA 2DHEA 3IE1A 1JQ5A 5C1PA 2GEBA 2PY6A 2AQ8A 5DJ5A 4EB0A 4WGGA 1Z0FA 1QP7A 4G1VA 4DLLA 4MAFA 3DC2A 4KH1A 2WUEA 2BFBB 4WN9A 3BVPA 4FYVA 3AESB 4LPSA 2CCJA 4GP9A 3SE0A 2VP5A 2R5WA 2DWQA 4CKCA 1Y33E 3IQGX 1JPJA 3OCWA 4IWNA 3ROQA 3EE6A 5LOVF 2HOQA 2NU6A 4EA9A 1I7DA 2ZRGA 5HOQA 4ZMRA 2GCOB 2YASA 3AXSA 4RKRA 5DM0A 1WS6A 4TV8A 1XTJA 4QOHA 3AUYA 3TZEA 3T1NA 1Q3HA 2BR3A 2IHVA 2PH7A 5EZQA 3QWIA 3L3BA 3RHZA 3SHWA 5CFRA 2UAGA 1OXSC 4JC0A 3P19A 4ECAA 3IDOA 4WMLA 3VR3A 1WDWB 1U1FA 3NTXA 4XYMA 4Y6GB 3MN1A 4HH1A 5JVDA 2ZZMA 5KKNB 3S7TA 3KOOA 2XAUA 4J03A 4C08A 2JJ2D 3IJPA 1FFBA 1S2IA 4RV9A 3K0FB 4U8HA 4NNPA 1AKUA 3MTEA 1CE8A 3U3JA 1Y7HA 3WTBA 1T5OA 4FKBA 5JS1A 1U0SY 3IIKA 2RHMA 1KEEA 4IYRA 2FWBA 1L7MA 3E9EA 2X41A 4EG5A 5HMLA 4JIGA 5CXUA 4CI9A 1R0BA 2AN3A 1HBJA 1O77A 2XYGA 2PBRA 5DYWA 1O95A 5JS2A 3VR1A 1G9XA 5HKBA 2YWBA 3CMCO 4G2TA 3IPLA 5EXXA 4ERNA 3A9RA 2OHIA 5DNYB 1O2DA 3CCBA 4B34A 1JQAA 1P1IA 8LDHA 1JJBA 3D2BA 3GFBA 2WWVD 3FVVA 1M66A 1MX1A 2UXBB 1Z4IA 3FSJX 4ZEOA 3ZWOA 5JU6A 1R6VA 2C2KA 3K32A 3TLJA 3ILYA 1K8YB 1LLCA 1NUAA 4IHKA 3CLKA 4DANA 2QTCA 2OPHA 1EEXB 5C1DA 1PNTA 3SD7A 1SC3A 2VT6A 3O1IC 2ZR9A 3ZCVA 1D1PA 4R0MA 1WDMA 2NU8A 2ZOSA 4YCCA 2WA2A 3HO1A 4B7AA 1G21A 2Y1WA 3MWFA 2J6BA 2J9RA 3VKFA 2GBIA 1G5IA 2NSLA 2V03A 1WIWA 2I6SA 4DG5A 1POWA 3AVOA 3FHCB 4MUKA 4D0RA 2IXDA 4PN7A 2FU5C 2EZUA 2RGDA 1WUJS 5TGDA 1GUFA 4WBNB 1XPUA 2QD5A 3GT0A 2O7QA 3VO9A 2NUAA 5AHKA 4RD2A 3FNQA 1AY0A 3CY6A 2PWZA 2CW5A 2SHKA 3GMSA 1ID1A 3QFSA 5EFZA 4BEVA 1ZGBA 2VQ6A 1SUPA 1F1JA 2HA6A 3LUJA 4G97A 1XVLA 1Q6YA 2FG5A 4JI7B 3NV9A 1IAQA 1OC2A 1CDDA 1YVUA 2GTPA 3AGQA 1M6YA 2QJRA 3C4JA 3KEOA 4UEJA 1XC7A 3KSAC 2B1RA 2A0YA 4HG2A 2DZDA 2G7ZA 4WY8A 3KG2A 1WSBA 4CYMA 1XWWA 4FT2A 2HK7A 2NGRA 2C9BA 2R62A 3VZRA 2QVGA 4B46A 4MEJA 3DWIA 3HVJA 4MUAA 2FLVA 5FJJA 1JFFB 3INTA 4ZJYA 4DLYA 1JMKC 4B3CA 3KKMA 2AZTA 1CNFA 1Z6ZA 3TW6A 4DJFC 3LQ2A 1FFSA 2X4LA 2CJFA 4D3DA 2BMDA 5CD9A 5BXQC 5KREA 3L0IB 3RRNA 1NYQA 6REQA 4IDDA 4ID9A 4MKXA 2D5BA 3B8EA 2NO5A 2RONA 2VDOB 1AV7A 2EXXA 3L7CA 1H9BA 3PUKA 4GZMA 3WYDA 1OGJA 1QU3A 3NBUA 5ULLA 1J2JA 3VKHA 8AT1A 3WGTA 1DAMA 4D3FA 1EP9A 2G70A 1EUCA 3LQ1A 3O7MA 3WDSA 1Y3FE 4XDHA 2CBZA 3CKKA 4BKOA 4B3RB 3E9NA 1WAMA 3ILXA 3JYQA 4O29A 2FPGA 5GGXA 1NV9A 3AVVA 4A15A 4CG2A 3RAPR 2AR7A 4PO3X 1Z62A 1RJDA 3GD7A 1PV2A 3TAXA 3EBOA 2XUFA 2OXIA 1MRZA 3WGOA 4IHJF 1KZGB 3AH8A 1YF3A 1DXQA 3SLGA 4R3UC 5J4VA 3GGCA 5K7SA 1K5GA 1C3OA 4V39A 1RLOA 2AZDA 4GLBA 1VIYA 4O4IF 5T4HA 4EB8A 5BSFA 5JMOA 2P4HX 1GLVA 2LV8A 5ALZA 2IHJA 1ZBQA 4GI3A 2YX1A 2HWXA 2IYNA 5CK5A 5E9JA 4X1KB 2FHPA 4LJYA 1QZXA 2XKAA 1T9AA 3CR8A 3FYSA 5JEEA 2HH9A 3D3JA 1M3SA 4N0QA 2Z0MA 1WQ3A 2QTNA 3BGDA 3IEUA 3QEJA 1SQ6A 4QTTB 3RS4A 4DLZA 1TTHA 3JWPA 5I9LA 4CU2A 4DEVA 4LRQA 4KQKA 5LOVA 1EESA 4KDCA 1WETA 4PGFA 2EHDA 2G76A 5ITWA 5KINB 1EX6A 4PGGA 1GGEA 1AHHA 2HA5A 2DPMA 4BFVA 1Q57A 2EZ8A 2QT0A 3C3DA 4GM0A 3QJYA 2PX8A 3PHLA 4I9HA 3RRXA 5D00A 1B23P 1LBIA 1M5TA 1KMQA 3ADCA 1YNOA 4MRMA 1P1RA 3WLKX 4TL9A 1OLUA 2W4IA 2CBXA 4JSYA 4ALKA 3RJMA 1JWLA 1TMGE 2MSLA 3I12A 4D8TA 5HW0A 2ZROA 2W6OA 3LHIA 2VWGA 5IJ9A 2HLHA 1NXOA 1UBGA 3ZPXA 3NHWA 2YOHA 4M9ZA 3KUXA 4Q6BA 1SU7A 4BNGA 1IYZA 1JAYA 1KDTA 3EAGA 4R83A 4LDPA 1VA4A 2XMBA 3RUEA 4ZK2A 4CR6A 3TE6A 1MMFB 1FNNA 1D04A 3A32A 2XVMA 4OV6B 5KYTA 3D31A 5DW0A 1OB2A 3LWDA 1MB4A 2FZGA 4EJ0A 1T2UA 2ETXA 5A02A 4EGAA 1LI7A 3P96A 4LY9A 1KJNA 2IIPA 5KYKA 1NQVA 3KZVA 4TKMA 4FK8A 1IHXA 1JBEA 2WAYA 2V7XA 1X7HA 3IX7A 1EWYA 5IZ4A 2G80A 4HAIA 3WK6A 5G4KA 3SF8B 3ZDQA 1BO6A 3ZD8A 5FOTA 1U28C 3QU5A 3WKDA 2P9TA 3NWPA 5IVHA 1WMFA 1W0JD 3B70A 3PJDA 4IFTA 4OYLA 4B09A 5AQ1A 3STVA 1MENA 4ALMA 1SVUA 3O1HB 3PGMA 2QMUA 3EZ9A 3RKSA 3VH2A 2FZCA 1UJNA 4NBKA 2XCTB 1EFPA 1D6SA 1UXJA 1CT9A 4GUDA 4XWAA 3U19A 3DOFA 1ZD8A 4XWOA 5BW8A 5G0VA 5JOQA 2FE1A 2VEDA 5BN5A 1I6LA 4FFPA 4YDQA 3KQKA 4X1IA 2P77A 4MI1A 1JNYA 4IKEA 1Y3IA 2C9CA 2JVKA 2OFWA 4M89A 3N0VA 4DRYA 5L3VA 4TXHA 1RAGA 3UW3A 3O94A 2Z6AA 1HNWB 2AI1A 3WA6A 4F7DA 1PR0A 4WX2B 5CJPA 2Z5GA 5IWCA 2LIVA 4QEKA 5JNSA 3EIFA 4J3NA 4HDAA 3W8NA 1XWIA 2JAWA 2CN1A 5IS2A 1XSEA 3EULA 3OE7A 1Y3CE 5ECWA 3VYRB 2JFBA 3P2JA 1PK8A 3R0XA 4MUNA 5SYNA 4MR8B 1H05A 1ND6A 1OASA 1J0BA 4ND5A 4TKUA 2H00A 4OQYA 3WGYA 4EW3A 5E6UA 2P9FA 2AD1A 3WIUA 5LBUA 2NXWA 1QRUA 2FN4A 1GFSA 3KJQA 3ZW7A 5ITZB 3LXRA 3M49A 4IL5A 5KYYA 1ZISA 1CF2O 2XMDA 3HNRA 2BFMA 4JBLA 4P7BA 5DHUA 1I3CA 4RGBA 1FSZA 1ZOOA 2EP7A 2Y4NA 2A0FA 3IB6A 1U7PA 4MW7A 2H1RA 3WKEA 3JZFA 4BGUA 5ITVA 4BIIA 1HLDA 2VAMA 3FDJA 4RZ2A 1T4CB 2ZBRA 4QFDA 5E0OA 4MS1B 3O4FA 2GUWA 3O21A 1GARA 3DMTA 4KTVE 3COZA 1MJHA 4Q3KA 3STYA 4OLHA 2WFZA 2B1JA 4UVEA 1T15A 4NQRA 3LC1O 5HUJA 1PJZA 2VC2B 4B6GA 1UBNA 4JBIA 2I6TA 4ODIA 1XAJA 4WK0B 2PUFA 1V11B 1D4ZA 1XDBA 1V2GA 1Z0DA 2N75A 2R11A 1DKMA 1JA0A 1FFXB 2REOA 1D6NA 3G8AA 5BW5A 3D6VA 3O1JC 1CU1A 4GPTA 4IHJA 1DGQA 1DCMA 2R4UA 4WVFA 4MV7A 2OPBA 3FOEC 1JG6A 3FXAA 3IHLA 4TTQA 4YDHB 1EG7A 2VCHA 3LGXA 1D5WA 1C9DB 2BFNA 2XAAA 3K2QA 4GOLD 3E3AA 3VZDA 4WY5A 3C39A 1U3UA 2D0IA 2V6GA 2QW8A 3LBNA 5JANA 3UOGA 1KRWA 4AF6A 4EEXA 4F85A 1FS4A 1X77A 3HDVA 3ZK7A 3KKQA 4KI0A 4B31A 1H6AA 1N3YA 2IXBA 1EMDA 4KODA 5EP3A 1TU3A 2H1IA 3WLSA 2AX4A 5B1HA 4QDXA 1RQ2A 1QVRA 2BGLA 2GZDA 4YCJA 3PHHA 3RI3A 2Q1YA 2QA5A 3B5JA 4ISCA 1NYLA 3Q2IA 2MWMA 3KR1A 3HXQA 3Q3GE 1TPYA 4E3ZA 3MRVA 3B1KA 3FGPA 4G5FA 1R0KA 1XNRB 2PRJA 4CM4A 4YT8A 1W4ZA 2XD4A 5C4IA 3TTVA 3UMRA 3ZNNA 1PIWA 1E1LA 4US1R 2WVHA 3OCXA 4NJEA 4KQFA 2HEIA 3MGAA 1CS4C 2AYXA 2ZJ5A 4H08A 1YUBA 4YFYA 3W4JA 4E11A 4PRLA 1KJQA 3TNYA 5CB4B 4CKWA 4N65A 2EBUA 2GAIA 3EIWA 4NVRA 4P32A 3R77A 1Q1GA 1T8WA 4KVZA 4LY0A 4R7ZA 4LQ4A 2BGWA 2Y0PA 4P0QB 2EJWA 1TF5A 2IPMA 3RVPA 2PV0A 3GZNB 2ACEA 4X7PA 4YJ2A 1BVHA 3L18A 2QAGA 3UNXA 1DAOA 4ZALA 4MVJF 1ESNA 2HEGA 3CJQA 4Q1CA 3ZW9A 2ST1A 3AOEC 3CVWA 1RJFA 1JLLA 3BB3A 3N76A 5CFOA 3L8ZA 5ARDA 5B2EA 3OKFA 4KITB 5CITA 3FHTA 4FGJA 1R6XA 2P2ZA 3GGDA 4NOLA 3HY6A 5BNFA 3UXMA 2AFHB 3SJBA 4UXHA 3IUYA 5B3AA 2Z04A 4RX1A 2PK3A 4DT1A 4LOIA 1TB4A 3PFIA 3WIVA 3MOSA 3BDIA 4CFYA 1XI2A 5CGZA 3SDZA 2QP9X 4X6LA 4DGQA 3PC3A 2Y2UA 4RPIA 3AL3A 3M82A 1ZA1A 2CD7A 2CXRA 3CRZA 2XOKA 4GDFA 3EARA 2G83A 4FCWA 3MTGA 2A1TR 3KVYA 1JHYA 4NE2A 5F2KA 1PG5A 1M54A 1Y0BA 2CK3D 3B53X 3LUBA 2CZGA 4CIXA 4BY9E 5L6MB 1CQIB 4JELA 5FOUA 4DSZA 3DF7A 5KYXB 2IELA 2IYAA 4JBGA 5EPUA 2W71A 4EW6A 1NULA 1DDOA 1MH9A 3HG7A 5AK5A 1RWOA 4RXMA 3NYRA 4PBTA 5DNDA 1CD5A 1J09A 1M2OB 1NM5A 1T9GR 2A5DA 3W9UA 4BPRA 3MWGA 3PLRA 2N0SA 2H2FA 1TJYA 2NNWB 2W8BB 2ASVA 3EX7C 1V71A 4K9RA 1ADGA 3L7LA 1ECLA 1U8FO 3OFSA 5BMVF 4TMZA 4FN4A 5C7IO 4X66B 2A78A 4TMWA 3RIEA 1KFJB 4F93B 5ED4A 1XJ0A 2JRLA 3Q8WA 4PS0A 4HS4A 4K7JA 2F67A 2VWPA 4S0ZA 1GR0A 1GFWA 3EYWA 3OIWA 3UHOA 3L40A 3RVLA 4EY5A 3N8HA 1QPGA 1U2DC 3H5AA 1DOHA 1GGVA 2DFVA 2XWJI 2XBUA 4H7JA 2MYPA 3AM1A 2QRHA 1E7SA 1N8KA 3DLAA 3EXIA 3GFOA 2BP7B 2OO5A 4KK4A 3CWCA 4HGYA 1F2UB 3S3TA 2RGUA 3WLMA 4NCBA 2UVQA 4M9RA 3LDGA 2YWHA 3KTAB 3IEXA 4M0PA 2DR2A 1CUJA 1E1QD 1HLGA 3IAS6 3R3UA 1MW9X 3MTJA 2VKTA 2H31A 3KYJB 1YZHA 5IAEA 4NONA 2R8RA 1LZKA 1JI3A 2XMCA 2XE4A 3F5FA 4ME6A 4LHWA 3SS7X 3TS1A 1ZGJA 5AJWA 2FH5B 4UNRA 5IZCA 3QV2A 1K6XA 2O5EA 1RRMA 4EI8A 1AUOA 5J58A 2Z9CA 3DDCA 2C3MA 2CVFA 4XAQA 4R2HA 1TFUA 2C5AA 2QN2A 3CPEA 3MUFA 4FMDB 4PO9A 5IXYA 2ZTLA 3TYXA 3SZ3A 1DQSA 2ES4A 1WV0A 2G8NA 2O3JA 3AR4A 3W0LB 3BA1A 3NJ8A 1BXRB 4D3XA 1SXHA 1YZVA 4N01A 4PZ9A 3THXA 1A27A 2VSXA 4QEZA 4U2CA 4FUTA 4Z4HA 5BYJA 4OXYA 3P0RA 3IURA 4C4XA 4WBSA 1EWKA 3RK1A 5KTOA 1PL7A 4X8LA 3F7MA 3L7NA 1FU8A 2B30A 2PWPA 2YHIA 4FYHA 4BYMA 1GNLA 2Q3FA 4BO4A 1E9EA 4BMCA 1SCAA 1UMDB 3GLGB 5BR1A 3CRRA 4ZRNA 1DC8A 4L75A 3JYNA 4F1JA 1S2MA 1C1YA 2BI7A 4X93A 1E2UA 1F8UA 1X2EA 2HFJA 1XXHA 4OGKA 5E9QA 3UOAB 4JC5A 4RVCA 1DPGA 1NLZA 2FEAA 1OKKA 2D2VA 3EZFA 3IJ5A 4D4IA 2A1IA 5F7OA 1FFHA 3KXPA 3S55A 2ZE6A 5JY1A 2GHTA 2Y1LA 1QH8A 1OQAA 4H7HA 1HTTA 4XJXA 5KOJA 2BGUA 3N2GA 2WM9B 4YJFA 3AB8A 4AKSA 3DSRA 4O4HA 2WHQA 4DL9A 1RABA 2IYXA 2V1XA 1KQ3A 4Z7NB 2GB4A 1U31A 1ZD3A 3HCDA 4B83A 3DAFA 3H7AA 1AF4A 4U7HA 1U0HC 3WMFA 3HN6A 1S96A 2AUMA 3FR7A 4Y2SA 4F11A 3CLRC 2IH4A 4B79A 1Z0UA 1N7GA 4LE1A 3OZEA 1NF8A 1S2OA 2QTVB 3D3EA 3ACDA 1BJTA 4HR7A 2G9NA 2NWQA 1CZLA 4HGOA 2ECPA 1HZZA 3VJMA 1YRWA 4U8GA 3WAKA 1OPRA 3CJRA 1H8EA 4B48A 3TLXA 4AVYA 1LBHA 2OGSA 1BN7A 1JG1A 3HYSA 3O95A 5FA5A 4KLNA 5AESA 2VAXA 2O14A 3CNHA 5ADHA 2CXHA 1F8XA 1FFCA 4RK1A 2GFHA 3I58A 5A9SA 3IUBA 5KDDA 2K87A 5J63A 2ILVA 3DUWA 4G0VA 3H1AA 2ZRPA 2P65A 2WZCA 1PG0A 2R7NA 3ETNA 3G0GA 3U7QB 2VJYA 3PDWA 3M3DA 3ZHUA 5JAOA 3LCJA 2RD2A 1NVTA 2EV9A 1IZZA 4AURA 2D0OB 3BAFA 1XQVA 3CINA 3KKZA 2ATEA 4LK2A 5FADA 2HF2A 1XJWA 3K6KA 4HH0A 2EZTA 4WDQA 3X1KA 2XCRB 3AKYA 1UKYA 2AN1A 3B9PA 4X8HA 3V8VA 1WZ2A 1MP0A 2J5QA 3HXLA 1SCUA 2G3YA 5DHTA 4JEUA 2RBGA 4HVAA 1VYVA 2QTHA 2W6IA 1DAGA 4OH1A 3L8FA 3NVMB 4Q05A 3LL4A 3I72A 1E58A 4K2AA 1NVGA 1NVVR 2BYTA 1UAAA 4FW9A 1NRJB 1Q7GA 5DX1A 4M87A 3V4PB 1ITZA 1GITA 1H0KA 4Q4JB 3FPKA 1UODA 2ZXEA 1JGTA 1NYTA 3AR9A 4NPAA 4OHWA 3RUHA 1T5BA 4IIJA 3ZY2A 5K0LA 5ADUS 4DDWA 3UW1A 1EWQA 4MVYA 1HT1E 1YIDA 4LN1A 2JGDB 3DBIA 2G9VA 3AF1A 3GJ3A 2O8DA 3HCEA 4NCAA 4QFMA 2GM9A 5G0UA 2QMOA 3W5SA 2XBLA 3C85A 2FP3A 1JMYA 3FCXA 3RLIA 3P0HA 4JB3A 1GG9A 2JIZD 4A03A 1XLWA 3F3MA 1IY2A 2VDVE 4KN6A 4HDNB 2IRWA 1AF7A 2Y9MB 2V3WA 1HE2A 2FWPA 4NZPA 2BISA 4LPKA 2KYRA 2ZSAA 3F46A 4P92A 1GLNA 2CXXA 3SIPA 2WJ3A 5JDIA 3Q9LA 2OV1A 5C8ZA 3RARA 4RMJA 1SELA 3G9UA 2P27A 1Y81A 2FDCA 1YB1A 3FWPA 1UMCB 3GGJA 4CKEB 1PLJA 1YRHA 4R1MA 3ISTA 1V43A 1WUYA 3QU7A 2BW0A 3M6VA 4UD2A 4LECA 3C3KA 1T2AA 1PJ3A 4TS3A 3AF3A 4ZU1X 4DA0A 5JZVA 1QQBA 5JZ9A 4IR7A 4MWSA 3NWOA 4KN9S 3OHSX 1DAEA 3H04A 3HJUA 4LDZA 4MGHA 1Q1EA 3KUUA 5F52A 5C3MA 1FP2A 1UBOS 1E99A 3P52A 4YDRA 1MLDA 1XVAA 3FTDA 4QUKA 2X3YA 3DEKA 1Z2EA 2GMWA 5KMGB 5L4NA 3JD4A 2H4YA 3QTBA 4HZIA 5EMLA 1PX0A 1EE2A 1RYZA 2I8AA 1PZXA 4JR2A 4AS2A 1QG2A 1BWSA 2VO1A 4D0GA 4KXFB 1OH6A 4I4IA 4L1KA 1J7JA 5BW4A 2WT9A 3FLAA 1WE2A 2B1GA 4OUDB 1BVRA 2XQVA 4GLFA 4F4IA 4JX8A 3CM0A 3T7DA 1OCEA 1YWGO 2LRHA 3IRUA 5C2JB 5TS2A 2ZJBA 3IQZA 4CMEC 1DQPA 1D9XA 2L0XA 3K8ZA 3ZVRA 5FUQA 2UKDA 3BCHA 4N7MA 1WLSA 3RADC 5CLLA 4INZA 5KNDD 2ZR8A 3LQKA 5EIHA 1E1CA 1D4AA 5CAEB 2PPLA 3FPCA 2GNAA 3SXJA 1XP5A 3N6VA 1N2SA 4MWZA 1ZSVA 1SZPA 1BYIA 1XN1A 2BJWA 2CLEB 2DBRA 4OQZA 2J09A 3HCFA 1QLWA 3L92A 1CZUA 5IT0A 1MABA 1W1UA 3BD7A 3Q8KA 2X40A 4Z8XA 2WILA 3MJTA 3Q3VA 2NU6B 3RW9A 5FUBA 1PTKA 3ZY6A 1I5EA 4N82A 5FPSA 3VPXA 2PCJA 1KBOA 2OQIA 1Y9JA 4V0KA 1KAOA 2WJHA 3RTDA 5BQ5A 1BN6A 1CIJA 2GKSA 2WG1A 1FYEA 3SIXA 2EKDA 1TYCA 4CEJB 1UWCA 1CV2A 3EGCA 4GPAA 4TL6A 1O9GA 3D7MA 3MF4A 4JQCA 4JUIA 4M98A 5JVDB 2JLUA 5FQOA 3NBYC 2XGSA 1P1BA 3RHTA 4UM9B 2VBCA 3OLWA 5LYJA 1GG8A 1UT6A 3H5WA 3UTDA 4D9GA 3VZCA 4KIUA 3ZGNA 4AMBA 1XZBA 3DMDA 3N05A 3PGA1 4EATA 4IOLA 3PLNA 4L2IA 3TCXB 1KEEB 3GFSA 1SULA 5EJ6A 2RB5A 4K1XA 4ENVA 2C2HA 4CG1A 2PZ8A 1Y8CA 2WJJA 4UEKA 5CVDA 1YFLA 2HR1A 3KQVA 1BE0A 4AMVA 2JLWA 4RY9A 4UOEA 4LCEA 1ORHA 2RH4A 1ATZA 8ATCA 3ZNOA 1XD9A 2Y6VA 1WG8A 5DW3A 1AHNA 1PEDA 1E0JA 2Y2VA 4C4OA 2AJLI 4YUWA 5FKJA 6ADHA 3P20A 3JASB 4JHXA 3VU0A 1XPRA 4MCAA 2WJYA 1COWA 3A11A 2YRXA 4MV1A 4R3WA 3VR4H 3ZBTA 4FFRA 3TNDA 4XD7A 2OZLA 2Q2OA 1EBBA 3DJYA 4Q7LA 1VKZA 2UYYA 3LCUA 4ZAVA 2NU8B 5DHAA 3UXYA 1E3DA 1L5GB 1G21B 1IBSA 3RVQA 3SXUA 2GJ9A 4DIEA 1M0TA 2R84A 5HMMA 1H3EA 2YV3A 3K1AA 4Q48A 4JU9A 2R9VA 1GZVA 2W2OA 3SXPA 3SHFA 4YPFA 3OAAD 4UMFA 3V7UA 2QGFA 1YMUA 4HDRA 3ZWKA 3T6KA 3G5MA 1WMDA 3F6YA 3F1KA 1VFNA 2FX5A 3GJXC 2NUAB 3D8BA 4Q12A 3ZD6A 1ZH2A 5T5QA 4HLUC 1JP7A 4L8FA 4Z7JA 3UA4A 3KUDA 4NCJA 3WL6A 4PAGA 3OZWA 1ZG3A 5CVUA 4OHFA 3UTCA 4YRMA 2YZKA 4O0LA 1CQZA 1PW5A 2UYOA 1BA3A 1YIAA 2QTWB 2PA0A 1RCUA 2XUPA 1A9PA 5AHXA 4YRFA 2ZAIA 2XMRA 2ZEJA 4X24A 3PXAA 3OTGA 1TM4E 4XYLA 3LF2A 1NBOA 4GPZA 4F96A 1KJWA 4DIKA 1G0OA 2G63A 2X4GA 3U7EB 1GU1A 4UTRA 4TKVA 3IAEA 1YMQA 4AKTA 1UZLA 1IJFA 1XNJA 4UULA 1I2BA 1OXUA 2K6GA 5HF6A 2NYAA 1P3Y1 2QSUA 2M98A 2DECA 2ZWOA 4FNMA 1N77A 3V46A 4CM6A 3AB3A 4HVTA 3IQFA 4C2AA 3CF0A 1DKLA 3WHKA 5A4IS 4YJGA 4G0UA 1CQPA 1YZQA 4UD6A 1LDEA 2E7ZA 3G23A 5GWXA 2N47A 4B71A 1E1DA 3ENZA 3OE1A 1A1VA 3MYYA 4I55F 5EWLA 2XB8A 3O0DA 3WFJA 2TRSB 4BO5A 3ZHYA 4ZYWA 1IWBB 2ZAGA 1B43A 3HHEA 3ZQ4A 3W3AH 3K1JA 5LXTF 4HTFA 1PS8A 4RFSB 2HA7A 4QPCA 1Y9ZA 5AXCA 1S4QA 2FPGB 5T4EA 1R9NA 2FN3A 3I6ZA 4GXQA 4Z9YA 1F3OA 3CR7A 1LPPA 2ISCA 4EARA 1V9LA 4WDRA 3GT7A 1PJBA 3PICA 5EIOA 4GQBA 3WE7A 3DLBA 2XTZA 4PTLA 5L3SA 1T6ZA 2G6TA 1X15A 2QM7A 4H59A 1C7RA 4CIDA 1C3OB 4FMCB 3ZJ5A 2E4ZA 3GEMA 4C0XA 4R5MA 3WMEA 1XTSA 4D02A 5CJJA 3EDQA 4FD2A 1B8UA 4RYDA 1QKKA 1ZITA 3HCBA 4XJSA 4OMDA 5DHRA 3O9VA 4QJIA 1JH9A 1I7SB 4YVFA 1UBLS 2IYOA 4H77A 1UOQA 1P6XA 5AW6A 3T7SA 5EXTA 3WQRA 4OAQA 1JLSA 1IE3A 1GADO 1VMDA 5CLGA 1WY5A 2P6PA 3MLBA 3Q7TA 3K0KA 1ZJ4A 4EYKA 2JAPA 1Y7IA 5LOVB 1WXHA 4KPYA 2AFIA 2HHLA 3KU1A 4IIDA 1TAGA 4DCPA 3KOXA 1T0PA 3S2FA 2CVOA 4DR2B 5IFKA 2N46A 1SWWA 1QTQA 5DGCA 1QOPB 1YXMA 5KVVA 1FPQA 4MRMB 1DQNA 4D9HA 2PS1A 3FB1A 3EUEA 4A8JC 1KQGA 3ANXA 2B94A 1OBFO 1S9DA 4LCBA 1K9VF 2AXPA 3CCFA 4GGMX 4PXYA 2JGJA 4XGRA 5CW1A 5B5SA 3FUCA 3IAFA 4BKUA 4OKIA 1IOLA 1W1WA 2WKQA 1RWKA 3DEZA 2IK8A 4X8OA 3QEBZ 3IOCA 5AW8A 1FJXA 3C16C 4M46A 1DEXA 2HKIA 3ZV4A 2PMDA 3D0KA 3QG5A 2P69A 4N18A 1KI1A 3PUWA 2BY4A 3RGWS 1T26A 1VHTA 2L17A 3GG9A 5LDGA 4NABA 4U7TB 1HMYA 4TWAA 3RYIA 2R6CA 3CA8A 4RELA 2QP3A 1G41A 3Q40A 4F8YA 1QLJA 2JF0A 2FG6C 1EM6A 3PGKA 3K5PA 4FS8A 3SYMA 4YO7A 5FNVA 1U65A 5D3MB 1YKFA 4FFBA 3NBXX 2J3DA 1RWWA 2JIOA 3CG4A 4Z4CA 1DJNA 3AT1A 3NDJA 5IX8A 16PKA 4CDGA 2VVTA 3OETA 4GHWA 1FUYB 1Z83A 4P98A 3V4LA 4W1PA 2R5NA 2LBPA 3PQ6A 4FHFA 3RKUA 3NETA 4JZYA 4MIKA 3B6EA 3JYOA 4R1UA 2X9LA 4YAIA 1SVLA 3O3CA 1JZSA 4G8JA 3WICA 3ULKA 2NUTB 2NZUG 4DLTA 1YFKA 2OORC 4OOEA 3F6PA 1J8YF 2WJVA 4C0BA 5AKYA 2FSSA 5BN5B 2AOUA 2AR9A 3RC2A 4HMPA 3LIPA 3Q3EA 1QFZA 1V5GA 1H3FA 3N8GA 3RASA 3BS4A 5K01A 3F8SA 3EGOA 5AW7A 3FSGA 4O63O 1CRPA 1K2VN 4GKVA 1EK0A 1SCDA 2KMLA 4IKPA 5ALQA 4XWYA 2JRCA 3SZMA 4B44A 1XXLA 2H9AA 3DVRX 1ECCA 1P0MA 4C7BA 2C3OA 5DDIP 4LF8B 9MHTA 1QNFA 3E81A 2ADFA 5BOVA 4C1NA 3ET4A 3C8HA 4XI9A 4BRSA 4YCNA 2GBCA 1DAKA 1KNQA 2DFLA 2VLBA 4QVGA 3A06A 1ICIA 1RQXA 1T6NA 2IYQA 2EFYA 2HD4A 2MOKA 3CISA 4HF7A 1O6ZA 3JRWA 3QKSA 5HS6A 3I76A 5B2ZA 1ZCBA 2B4QA 1YBAA 3RS9A 1QWOA 2ONZA 1WKCA 3KAKA 1UFVA 3FNHA 3NKLA 1EGAA 4BVKA 5I01A 1ESZA 4LE0A 1FF9A 1NOJA 2BF7A 5AI4A 3DBLB 4EBBA 1Q92A 1JEOA 5DYIA 3HMQA 1S8NA 3FYCA 3T06B 1CUFA 4R9RA 1Q12A 3JQGB 2HXSA 1W19A 4DV2B 2BFEA 1J0DA 1R4AA 2ZT6A 3RAJA 1C0EA 1NBEA 4PPGA 3T1OA 3QJ5A 3RM3A 4QRHA 1O08A 4QYWA 1MCZA 3ZDYB 3I4LA 3GJ6A 1GN8A 4YACA 1FLAA 2FX2A 4EO7A 2VPPA 3MUEA 2X0JA 1XEWY 1J97A 4QUGA 4Y67A 4UVDA 3ZXXA 3M4JA 2YRFA 2QUAA 4KDEA 3N2NA 3DDWA 3O7WA 1U0TA 5HYVA 3SC2A 4LQDA 1XVUA 1UANA 5JHHB 3WB0A 3CTPA 1YHZA 2TMKA 1J21A 3D8UA 4IHJB 1E3SA 1LRLA 2JHCA 2PWYA 2X15A 3E6AA 4MQBA 4BV9A 2PQ0A 4O4IB 3WV5A 3WYEA 1VPEA 2ZAYA 2I1LA 2XUIA 1U8XX 2WYVA 2XMPA 1QK4A 3IIMA 2JGFA 2W58A 1ENZA 1YDEA 3MVEA 5SZKB 3UIEA 2F3SA 1ZIYA 3M5CA 1DUSA 1V0JA 1H8HA 3IAM6 2DR0A 3LVFO 4LC0A 1A5SB 1BWPA 5KNCD 4YRPA 4DUYB 1A4RA 2ANCA 2RGWA 2BR5A 2C5SA 2N42A 1U7WA 3NDBB 4QIHA 1ACLA 1ZLXA 3ZD9A 2C00A 2E48A 3BORA 3BCUA 5E4TA 3VXKA 3WKBA 1JV2B 2BONA 3T7KA 3ZGXA 5A5DA 4QPDA 5CNJA 5TJ9A 5D01A 4R41A 3HYNA 2FETA 1QGYA 3L4BA 1FMLA 4KE6A 4W6ZA 3KYIB 1P45A 4AZWA 1JHMA 3HN2A 3NHJA 5AW9A 5KBYA 1O03A 2FXIA 2F1RA 3C6KA 4NYIQ 4P8RA 3OFNA 4FBMA 2TSYB 1I5RA 3VGPA 3JVEA 1BA2A 1E79D 3PWKA 2FR8C 2O4UX 4F4DA 2VF5X 1KHHA 1S2DA 3BGWA 3NM5A 1PWEA 3TINA 3VPDA 8ABPA 2QU8A 3LRPA 4OTZA 1KYQA 4M86A 4X6YA 4EEZA 1RPAA 1Z4MA 1YOVA 3GEIA 1UOEA 3IT2A 2R0QC 2HAEA 3KRTA 2GA8A 3ILSA 1SPBS 3NKVA 4B0PA 2BHTA 3AEYA 1M2HA 1B7GO 2QAGB 2GRUA 4M4SA 5CA0F 5H3LA 2VK1A 2GBPA 3RODA 4DLBA 2VKQA 1JLLB 2XE6A 2ZYRA 3IDQA 3ITKA 3R7FA 2C4NA 2PNJA 4ZI7A 3RCBA 2VJCA 1FX1A 4CM3A 1AU9A 1MN6A 1RBYA 2ZYSA 3ZV6A 3ZE9A 1GUDA 3WLHA 3ZU6A 1KIFA 1TKBA 3A1TA 3SMQA 3CRVA 4P58A 4JJ7A 3HPRA 1PJLA 1W96A 1L2TA 4RZHA 2OAP1 1FP7A 2DU8A 2G1JA 3VDNB 5CVEA 4D43A 1JYFA 4RF2A 3NB0A 4W4TA 3KOUA 4QDUA 1FNMA 1M2GA 5H5JA 2BFCA 3AI1A 3L43A 4M55A 1GPMA 2RSLA 4OATA 5K9ZA 2FEPA 1L5HB 2HCFA 2HLDA 4WPGA 3CB4A 3VH4A 3I1IA 4NE9A 1N5OX 4YXWA 3V1KA 1EFVB 1M0WA 1QTRA 2ZUVA 4OHVA 3O38A 4AJOA 4BZQA 3UQYS 1V6SA 5EJ9A 4DN6A 3D4OA 2F8SA 4RK4A 3PNBA 1YQWA 3AM3A 1RS0A 2ODPA 3C3MA 4HLNA 2IPLA 1LLUA 2WUVA 1QIGA 4OHPA 1DIBA 3EHEA 3KPUA 4LSGA 3ZUGA 4FGWA 3OCCA 1FYDA 1PSWA 2Q3LA 1N4AA 1R8XA 4KV7A 4J1QA 5EFOA 2IYLD 4N8DA 4W63A 3OQ6A 2DFNA 1NJ5A 5F76A 2DFKB 4HO1X 4I4LA 3P9NA 3KQPA 2CY0A 1VMKA 2VRNA 2JHPA 3NHUA 1U1CA 4G4SP 1V1MA 4URYR 3K4QA 3UAXA 1YFJA 3BJIC 4NESA 3VA7A 4NK5A 1F8YA 2JJ1A 3IXMA 3SIRA 4OHYA 1QKIA 4I1YA 3AHIA 2F1KA 3PB3A 3EXIB 2J4CA 5JBIA 5M04A 5ECDA 5TGZA 5FOVA 1H66A 1VL5A 1IXZA 2G4VA 2OGTA 1NDUA 2YOGA 2ECOA 3MBOA 5HCUA 5BWMA 3EMVA 3BJEA 4M0LA 4WJKB 3PYMA 1EKXA 4GO1A 1RAEA 3OOEA 1GGJA 2KQUA 2PQMA 5DLEA 4X65B 5IVKA 1JIUA 3OZCA 1MC1A 1RRGA 1V41E 3HNPA 4Q4HA 5ALSA 1JDJA 1UXKA 1MIHA 2VJNA 4KVGA 4CUJA 4GDMA 3AUJB 1JT9A 4BE4A 3C3WA 4NXNB 1L7EA 4XARA 2P2YA 3VQTA 4Y2RA 2ZDHA 2O3UA 3GO4A 2QROA 2CWDA 2ZULA 2UVPA 5K0GA 2QUKA 3PP8A 2JIDA 4MVJI 5HM8A 3UKDA 2D1YA 2H4JA 1KP9A 1PT6A 3FPGA 4FHZA 2ZT8A 3T7CA 1J06A 4I1PA 2E4WA 2X9QA 3PCTA 3SJAA 4DPKA 2NZ2A 3DDHA 3SFVA 4B6EA 4KQ1A 2CLOB 2OCIA 3R5XA 3DZKA 3PNMA 4II3A 5DBHX 4HKTA 2FW8A 1TUGA 4G89A 2YHIB 2BT4A 3WNCA 4XGQA 3S8YA 4G86A 4X44A 2FWMX 3VTZA 3IOMA 2FVYA 4NPHA 2Z3WA 1WPGA 3OM1A 2FPMA 4R2LA 4XFJA 2FG7C 1S8OA 2ZYVX 3GV0A 4TT3D 2IKSA 5HBGA 1Q17A 3QKWA 3OO1A 3ZWAA 4P5PA 1SUSA 1K0UA 4GBGA 2NZJA 3W7BA 4A10A 2JH9A 3K0CA 4PAQA 2GRJA 1JIVA 5E4FA 1IBLB 2D5CA 1C1DA 1QH8B 2IYRA 2AEMA 5E8RA 5KOJB 2Z5FA 4EJSA 5K3EA 3EVTA 3THOA 4YJFB 3ZDBA 1JA1A 2MU1A 4O4HB 4INOA 5IUNC 2IEAA 3E3NA 3OFJA 4RENA 2EYQA 1AMOA 4EH1A 2AFHE 1EGQA 5CCXA 3NH6A 1LLFA 4YLGA 1F6WA 4AQ7A 2NAPA 4M7WA 1T13A 1YQQA 3WGKA 4Y1RA 3BE6A 2EHJA 2WUWE 2J6HA 1WXFA 2XQIA 3ASZA 1VLQA 4LJ5A 4BV2A 1MHTA 1FFYA 1LBQA 1O96B 2Z2ZA 3BC1A 3EDRA 2XUDA 4YMHA 1J25A 1I2ZA 1KO4A 1V1JA 3EVZA 5LJLA 5MGBA 5KNLA 4OMCA 4PAOA 3JVDA 3N28A 4GOXA 2B5VA 1XKQA 3PDHA 2Q41A 4I81A 3Q6MA 4MRSA 1PK9A 4FBGA 2GO1A 3UJ3X 4NYMQ 1HG1A 4RJIA 1R27A 2AWNA 1A8SA 2JATA 2V5VA 2WF9A 4X0EA 3BXOA 4H0FA 4IFBA 5IASA 5LSAA 1EX7A 2AOXA 4W99A 1U6KA 2JEZA 4BNUA 4E70A 2P5TB 1RJWA 3ZZ0A 4O8CA 1GTG1 4RTQA 4MV5A 1KZYC 3PXGA 1P8JA 1GKLA 3HFGA 4RQUA 1N2IA 3KVNA 3TTWA 3RYCA 2GPNA 1MNQA 4FGZA 1N8NA 3BK2A 4UCFA 4XM1A 3RREA 4EI2A 4Y1EA 4BP1A 1SCUB 3ZWBA 1QYRA 4BHTA 4BWFB 2WY2D 3H65A 4G5GA 3H9EO 3PIRA 3QWFA 1U3TA 3OZIA 3WB1A 1PDWA 4P36A 5IK2D 5IT5A 2X14A 4GOJA 2AUNA 3G79A 4MV3A 2D06A 1FXWF 1G20A 3B3AA 2A35A 4K88A 3EWSA 4LFAB 2OCXA 3EZ7A 5LQCA 2IIBA 2PEYA 1ABEA 2RH9B 3IVXA 3ZJTA 3B60A 3N7UA 3DMHA 5GV7A 4QGAA 5JWOA 2DE0X 2O8DB 2VQ3A 3FJ1A 4JYBA 2OWDA 1Z75A 2NO7A 3LA6A 4ML3A 2CXTA 4OPMA 1BEEA 1QIIA 5DBEX 1OY1A 1P77A 4B3MB 1NPYA 1N2CA 2P3OA 4UM8B 1CJSA 1HQYE 5IDQA 2BM9A 1DB3A 1TYAE 4X97A 5JNRA 4J43A 1C7FA 1RKXA 1YVEI 2ZREA 3BQNB 4PFQA 5EIBD 4IYJA 2JFXA 1DPFA 2J41A 3Q72A 3QEOA 3MRTA 1D3AA 4MUGA 4YV7A 3JVUA 1GDTA 1T1SA 3AFHA 1V95A 1Y6JA 3B51X 5AKHA 1EXNA 2C98A 1CY1A 5JBQA 6LDHA 3EMDA 1IDN1 1CRZA 1R66A 3V1MA 4GZ5A 4G5QA 3M2PA 5I9SA 3W8RA 4BQQA 1W30A 4F5WA 5PNTA 1JVSA 4WKBA 4GP6A 3C5EA 4OU4A 1TKAA 1KKMA 3GLGE 1I2MA 4L8YA 3ZZNA 3B13B 2VJAA 4KLZA 4BJ6A 2H1CA 2PO7A 3NIWA 3O2JA 4FE3A 4K3VA 4NKRA 3LO5A 4AICA 1BGWA 3X1WA 3HJFA 2ORIA 2HU8A 3QXGA 5ALHA 4WFIA 4EAQA 2WU1A 3PFCA 4MDYA 3ICPA 4I14A 1SXJA 4BFSA 1JU9A 3D8RA 3NHMA 4CW7A 4EG3A 2XYVA 1N33B 2GCEA 4NCXA 2PYDA 1HTBA 4CIYA 3TFOA 3A2NA 1AS2A 4JJ8A 3ZZTA 3PC8A 2XGGA 1GZUA 2IYVA 4MVJM 5HTOA 4YMGA 4EYEA 4UMVA 3GCXA 1P4AA 3SZLA 3ADBA 3MOGA 1X7YA 1XZEA 4JEIA 3M6LA 5EHGA 3TDKA 4XB1A 1HORA 3WO0A 2P1RA 1P0FA 2IS6A 5J2UF 2L19A 5HDBB 2CVPA 1EX9A 1WBDA 1S8AA 2HJWA 4ZCQA 1CR2A 1W44A 1ZNWA 5COQA 3NDPA 2EEZA 5G0WA 1BDHA 3T8YA 1ULSA 3AMVA 1QG0A 3DEIA 3CVOA 3E58A 4HYYA 3TZ6A 4KHPB 3HZZA 1AK1A 1YBHA 3ECCA 2E85A 4X84A 4K28A 1XP8A 4IFEA 1O94C 2GDZA 3SU8A 4HOYA 5D8DA 1CQJB 4KXXA 3TQOA 1L8XA 1Q0PA 3OU6A 4DUGA 4ZOQI 1VJDA 2YN2A 1WD5A 1QH1A 3T4UA 3O90A 3OJEA 2GR9A 3I53A 4FTWA 4K6FA 2OR3A 6AT1A 4MARA 3Q5GA 1DRUA 1EHCA 1IUOA 2ZK7A 2CLHB 1JILA 5C8YA 3DCYA 4QUJA 3UAVA 4MR7A 1US8B 1X1CA 5LYJB 4EOGA 2ADMA 4CQLB 2WDPA 4RD6A 1YIOA 3S5UA 4BFTA 3RQIA 1CR1A 1O54A 3P97A 5KX5A 4L2IB 4ARZB 4B40A 2IXGA 5ECYA 3BMCA 1TF7A 2FN9A 2YHAA 4NY1A 5TMDA 2I7VA 3EYAA 1K06A 2FSHA 6GPBA 1IQPA 1MV5A 5AHRA 2JW5A 3MWDB 2Q49A 3I5UA 4D44A 1NKVA 2BJHA 3PQCA 3CSUA 4HB2A 1IUNA 3GI1A 1ZXBA 4Q18A 3TLMA 3H05A 2FWNA 3DMFA 2OOSA 2E49A 1G6Q1 3OEHD 1C8KA 1U5CA 2GESA 5LZ5A 4BMDA 3QUAA 1HYEA 4OL0A 3PNKA 2C4UA 3BOSA 1WNTA 4TYQA 4AZTA 1DC3A 4TUYF 2V58A 2QHXA 2RKWA 4LTDA 3IODA 1A8UA 2VDWA 3ABOB 2BMWA 3NEJA 3K9CA 3ORRA 4WOJA 1MB0A 2H8KA 3FPEA 2ZUBA 3VMFA 2PG3A 5IF9A 2DJ5A 3GLIA 1CF9A 1SC1A 2BCGY 3FMGA 4ZQEA 1WJGA 1EVJA 2ATXA 3PVZA 1VG9B 4KYIB 3WLQA 3UUFA 4KGZA 3R0IA 4P7FA 1Z35A 4F4UA 1W9MA 3Q15C 2YZ2A 3K1AB 1AIPA 4NU0A 4NQZA 4P86A 3I4CA 2JHGA 3DT8A 4FGKA 3OLXA 1PR5A 4ONEA 5K0FA 1RR6A 1Z12A 1PZEA 2H9IA 4HDRB 4RTLA 3V2GA 3L6CA 3MMPA 3N8IA 5IBPA 3TXXA 4JN6B 3OUUA 5A71A 4BVEA 1QIKA 4X1YA 1W75A 5C7YA 1V9SA 2H17A 4QBHA 3MHTA 5CA1F 1ISRA 3ZQKA 3CVJA 4HQLA 2GDJA 2CLKB 4FNGA 3UYKA 5C37A 4OJQA 2EW1A 5KTKA 1CEEA 1VJRA 4QLOA 2C7PA 4GOMD 2WSLA 5DH9A 3ZHOA 4XX1A 4BJ1A 1GTL1 1Q16A 1M8GA 2LIPA 4JVSB 4RUKA 4W9NA 1YS9A 4UHJA 4NDZA 3H1TA 2VRWA 4UM9D 1VRVA 1GAWA 3IVGA 3HXMA 4UFNA 4RK0A 4R4JA 3VPSA 5LD2C 1K6IA 1TK9A 5ABPA 1SG0A 4GI7A 1UBRS 4ZT5A 4EG6A 1TM1E 2WPDD 2JAQA 2ZG6A 2JL1A 1PX2A 1N5IA 4X90A 3ZH2A 3VSBA 1UZNA 2P40A 4F2GA 2QTRA 2W8ZA 1ICEA 2GRAA 5CH8A 4YJGB 3TLBA 5BWCA 3TQSA 3PEYA 4P82A 1AQYA 5D3KA 1ZHFA 1XTZA 1Y1PA 1P2DA 2BEWA 1FJ2A 3LHKA 3I2IA 4L74A 5F3WB 2PT7A 1QHHA 4GX2A 3AEUA 3HDYA 2XCLA 4HTFB 5DIFA 3TXYA 2X1HA 5IDWA 4I1SA 3AY7A 1Z47A 4HNTA 1MX9A 1UOOA 3V33A 1DJPA 2KBFA 3EJ6A 1N3BA 2G1PA 4ENTA 5JWRA 3V7YA 5LDHA 2I80A 1PFVA 4WOKA 5L3SB 2J9ZB 3FNEA 1EP3B 1NVBA 2VHUA 2XXAB 4P22A 3HFJA 1XMIA 2YIDA 4MYDA 1DCKA 1U3VA 3IP6A 1UC8A 3SGLA 4OFBA 4FWTA 4QM6A 5FI1B 1YU9A 2ISQA 3AEQB 3JXEA 3JR7A 4D3ZA 5LIRA 2JCVA 2IU0A 4NENA 1C7IA 2XDQA 3T9BA 2QJOA 3H2JA 4CMGA 3THYA 4MPDA 1K4MA 1W5AA 4GP7A 2HWUA 1XNGA 3T54A 4CV0A 2IS1A 3PUVA 3EUAA 4CTKA 4F5YA 3A3KA 3DZFA 2B0CA 1I7NA 2R6JA 3RFXA 4MYCA 3IALA 3WGMA 2BGKA 2IQIA 4MKRA 3R6GA 5JYBA 1X8JA 4C78A 4IGKA 4DA4A 2GAOA 3NBFA 2WSSD 1Z26A 4BLTA 3HNOA 5JROA 5F9FA 4XLZA 1Q20A 4H17A 3VR2D 2UU9B 1ODLA 3OA0A 4YRAA 2BGJA 1TCUA 3B48A 4PIVA 1XZDA 2BGMA 2F90A 3GLUA 2WIFA 1AA6A 4FGUA 1A76A 3L0ZA 2AEEA 2ZRCA 2B0JA 2D5LA 4IJ5A 1NMZA 2XHZA 2ZJ0A 1P33A 1I1HA 3FRHA 1BZYA 2IZ5A 4R81A 4WACA 3ZE0B 4DNPA 1FXSA 5CR9A 3UPDA 3IYLW 5LIPA 4S1NA 5H16A 5KCMA 3DG9A 3EMBA 4CE6A 3P9SA 1UBKS 1ZMRA 2QRQA 1J1IA 3THWA 3RYIB 3H2GA 3ZDZB 2IX3A 3JQAA 1WZNA 3I6YA 2PLNA 5EPEA 1V5FA 1JHOA 2PKQO 5CYPA 1Y4ZA 4YALA 3HE3A 1KDVA 4JJIA 4F6LA 4YC7A 3K0AA 4MUIA 4GEGA 2GYVA 4JI1B 2G71A 3Q3IA 4FFBB 4XSVA 3ZU2A 5HZGA 1E9SA 2FFAA 2VQDA 4HTAA 5TPZD 4BQIA 4YR7A 1AMNA 2D7CA 1J8DA 1O3YA 1NM5C 1P1JA 3M83A 4U9IS 3DZJA 1EJBA 3JZIA 5FBWB 4CF6A 1VB5A 2XB2A 3DEJA 4HSEA 4RLFA 2CNWA 1QC5B 4YPOA 4REMA 3W5JA 1IATA 2EFCB 3GCDA 4IEEA 4LDJA 5ALUA 5BN3A 1C1HA 4Q0MA 1TKRA 4OBEA 5HE8A 1X7WB 1I5OA 5ERXA 3HJTA 1AH2A 3V32A 5CT6A 1ZFNA 2QRJA 3VVMA 1RAAA 3OC0A 4ZVRA 2X5XA 3COPA 5DYTA 4J6FA 3VJKA 1H2XA 2IUEA 2R5FA 3AR3A 4KIWA 3K94A 5IYZF 4ALIA 2VRCA 1IVSA 1EK6A 3NI2A 4NMMA 5J1TB 2OO5C 3ICWA 4WY2A 2R8OA 5BRJA 5JQGF 3DB1A 3RD5A 3WXBA 4IQ4A 4R8SA 1FP4B 2SKCA 4IWXA 1EDZA 3S1AA 2F9FA 2WG0A 2EWWA 3EXG1 3S0JA 1BE1A 2GTIA 2P9YA 2RKBA 3B9RA 3ZY3A 4F3YA 1FP1D 3U4DA 1K68A 3FGOA 4I46A 1N7IA 3EAFA 1K7CA 1SBNE 2YJ5A 2VBGA 5AVKA 1WZEA 4G0WA 4G26A 3DOOA 3U5TA 1HG0A 1R8JA 4N5DA 5JNWA 2ID9A 3PBKA 3ROMA 3ZK9A 1F3LA 2YQ4A 3OHMA 3WADA 1B6GA 5CDGA 2FPRA 3A4TA 2XND