2YV1A

Crystal structure of succinyl-coa synthetase alpha chain from methanocaldococcus jannaschii dsm 2661
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
287
structure length
268
Chain Sequence
MILLDENTKAIVQGITGRQGSFHTKKMLECGTKIVGGVTPGKGGQNVHGVPVFDTVKEAVKETDANASVIFVPAPFAKDAVFEAIDAGIELIVVITEHIPVHDTMEFVNYAEDVGVKIIGPNTPGIASPKVGKLGIIPMEVLKEGSVGMVSRSGTLTYEIAHQIKKAGFGVSTCVGIGGDPIVGLRYKEVLDLFEKDDETEAIVMIGEIGGGAEEEAAKFIEKMKKPVIGYIAGQGTAESKMKALEEAGAYVAKNISDIPKLLAGILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Succinyl-CoA Synthetase Alpha Chain from Methanocaldococcus jannaschii DSM 2661
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
total genus 91
structure length 268
sequence length 287
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2yv1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yv1A01
2YFQA 2AMFA 4H7PA 1R4NB 3ONFA 2ZKLA 3C7DB 3GNSA 1SBYA 3UN1A 2VOEA 1UDAA 1PJLA 2CDAA 1D1TA 5CG2A 3HADA 4R1NA 3BMQA 5F21A 3GVHA 3WBFA 4RL6A 4MVJH 3ONDA 4EUEA 1DB3A 2WYWA 2VHXA 3AW9A 5IFLA 3DHEA 4M49A 4FOOA 1XQ6A 3O4RA 4BMVA 5JYDA 4I5FA 3AU9A 1G0NA 4CV1A 5K9ZA 3NTRA 4O1MA 5AXAA 4IPTA 2CD9A 3ITKA 2VZ9A 4FFPA 4A03A 4BKUA 1FMCA 1KVSA 1O95A 1PZFA 3JYLA 4TVOA 5KCZA 3DBLB 1U8XX 2OHXA 4YQZA 1T2EA 3GK3A 2OL4A 1T1SA 3JQBC 4GGOA 3VTFA 4YAGA 4GPD1 1NHWA 4J1SA 4RDIA 4BB5A 3BMNA 3K8ZA 2PZLA 4WKGA 3W8DA 2JCXA 2AEMA 1HXHA 2NU7B 2VHYA 3BMOA 2Z95A 1CDOA 1Q2XA 3LC7O 4KTVE 5FYDA 3D4NA 3WBBA 1VLLA 3OICA 2D8AA 4RVUA 3GPIA 4ZQHA 4D0RA 5TJHA 4UEJA 4PVCA 1NFRA 2UV8A 4WCDA 3A1NA 2JCYA 1UXGA 1QKIA 3Q0EA 3ORFA 1QMGA 2DFDA 3CIFA 1LDNA 3DWFA 4BGIA 1I2BA 2PGLA 2W2KA 3B1KA 3KM0A 4IDEA 4PG8A 1M76A 4IBOA 2AXQA 3PHJA 1FF9A 1ONOA 2VHWA 3HN7A 3QRWA 3CUKA 4YT8A 3KZVA 1I33A 1MB4A 2HQ1A 1XELA 2AG5A 3R3JA 3UKOA 4HFRA 4CMCA 1VJTA 2PFGA 4RORA 4E3ZA 4U7WA 3I6IA 1K6IA 4E6PA 1PL8A 4WE3A 4DLBA 1HRDA 1K5HA 4BOYA 5DCUA 3BMNB 3TOXA 2RH4A 4AJIA 1H6CA 1OFGA 4CMEC 3EZYA 2C59A 4Q39A 1E7SA 1B2LA 3VKUA 2Q4BA 1AN9A 1OC2A 3KRTA 4M1QA 2YDXA 3JQ6A 3C24A 5CDUA 2P5YA 2D59A 3EYWA 4FN4A 5THQA 4AFNA 3VDRA 1AHIA 3DZFA 3CH6A 2X22A 3GVPA 1HEUA 1R0SA 5FI5A 3E9QA 1JLLA 1HSOA 3MJ4A 2JCVA 4XA8A 5KJ1A 4OAQA 3B20A 1TVEA 2P4QA 3Q3CA 1NHGA 2J6IA 4FC6A 4JJFA 5GMOA 4TROA 3RI3A 1GEGA 3ZWBA 2NU8A 3AUSA 3U49A 4DPLA 3F4BA 3H5RA 1GZ6A 1SPXA 4XB1A 5COQA 2J8ZA 4EZBA 2FN7A 2AA3A 3OH8A 4UREA 4AVYA 5TC4A 1DC6A 4OIMA 4WNIA 5TGDA 1R4NA 3PYMA 2Q1UA 3VZSA 1J0XO 3SJUA 1YDEA 3ASVA 1FDTA 3KUXA 1YQXA 1JWAB 2CVQA 4BNGA 4D43A 4RF5A 3FHLA 1E6WA 2O4UX 1KVTA 2B4QA 3DMTA 3ONEA 1NVGA 3P5SA 3HDYA 4AICA 4EITA 2YUTA 2F1KA 1IB6A 3GUYA 1RM0A 1PL7A 4PLHA 2SCUB 4EEZA 4CM5A 2X0RA 4QFCA 1HYEA 5IXSA 1P1JA 1XWFA 3DHNA 1YBAA 3KO8A 1EE9A 1IE3A 4XQCA 5T64A 1EVIA 1ZFNA 1WVGA 1U3TA 2I67A 3ZWVA 1QRRA 5JAIA 1DC5A 1LQTA 5JFOA 4TKMA 2JHGA 4I8XA 3EGOA 2HCTA 4WUVA 1TA4A 3ROQA 1BHSA 4JJGA 2BFOA 1ZSVA 3ADOA 5BNFA 1LLUA 4XZ3A 4FDAA 3ANMA 1Y9EA 3ETDA 4B79A 2H5LA 2F00A 2XF8A 1NR1A 3FNEA 1I3MA 4J91A 1NPDA 4Y98A 1FDVA 1GPJA 4DQXA 4L9RA 5A4DA 4IZHA 1LI4A 5U9CA 4XX0A 4J16A 2NTJA 5A9TA 1U28A 4BUCA 5I8ZA 3NDJA 4Y6PA 5I9NA 2C82A 4ZQEA 1XDWA 5JE8A 2VWGA 3GG2A 4W7IA 4J9UE 3VH3A 3CINA 1JN0A 4AJKA 5BSFA 3H9JA 1E1NA 1NPYA 2FPPB 1WWKA 2A92A 4KWIA 3SLKA 2Z1MA 4XD2A 1UP6A 1B8PA 1DRUA 4BGUA 4CM4A 4BIIA 1R6DA 1LSSA 4P4NA 3AOEC 2NQ8A 1GD1O 3WTCA 1NYTA 3S8MA 3RROA 3FNHA 3DAPA 1EFLA 2OUIA 3HFSA 3K30A 5JAMA 2WSBA 1KVQA 1PWZA 3DZGA 5DBGA 3S2IA 4G65A 2HRZA 4RF2A 4QO7A 2AG8A 1DAOA 1R0KA 1T24A 4RQUA 2YZ7A 5H82A 3AFMA 3BMOB 2EERA 4XEHA 2VYVD 5TF4A 4LISA 3DO5A 1GL3A 5KVSA 1E6EA 2W98A 4DXHA 2O4CA 1ADFA 3OJFA 5ER9A 4B7UA 1EBFA 4UUPA 1H93A 3E9MA 4RZHA 3HFGA 3MWDA 3FCOA 3Q9UA 2VWPA 4CLRA 1NWHA 3ZW9A 4R68A 3BZUA 4ONEA 1N1GA 1N92A 5JCXA 1GFSA 3GF4A 4JROA 3R1IA 3WSVA 2VYND 4MINA 1LJ8A 3O03A 3RUFA 3PEFA 2OO5A 2I9PA 3RC9A 4ZQGA 3DOJA 5ES3A 3RUHA 3IAHA 3C8MA 3U09A 1XGKA 1Q7GA 3X2FA 4R54A 5ENDA 4IQ0A 4CR7A 1YH3A 5I7VA 4TKLA 1ID1A 2A4KA 1P0CA 1PR9A 3CKYA 1GY8A 1OOEA 4BNXA 3BTOA 4CLOB 2O3TA 2B5WA 1U3VA 4BKQA 4CV3A 3E03A 4ALJA 1D1SA 1QYDA 1M2WA 4LCJA 4W9NC 4DTIA 5JBIA 2HO5A 4D79A 4GMFA 3UXYA 2B5VA 1LDBA 2Y05A 4WLEA 3PJEA 4QSMA 1KVUA 3GEMA 4MKXA 3D0OA 2WM3A 4D45A 1YXMA 2YW9A 2NWQA 4QTZA 1GYQA 2V6GA 3B6ZA 1EFKA 1MG5A 3LLVA 3KB6A 1PJCA 2FSSA 4LVCA 1E3WA 2RH8A 5JYEA 5EMHA 5T8KC 3WR5A 2B0JA 1EUDA 1PZGA 2EKPA 4BNWA 1UAYA 1E3EA 3OIDA 4ND4A 3ZCXA 5F1PA 2VRCD 4DBZA 1F8FA 2I65A 3QV1A 2WDZA 3GAFA 1GPDG 2OXIA 3PI7A 2BFPA 3QWFA 5CEEA 2JFFA 2AHRA 3WFIA 1ZMTA 4IZIA 1CJCA 5JY6A 4IIUA 4ZQFA 1ML3A 2D2IA 3FPLA 1B7GO 3ZV4A 4B8WA 3JD2A 3PHLA 2EP7A 2NUAB 1A27A 2E4AA 5EQFA 2BRUA 5G4KA 3HB4X 2EXXA 1Z7EA 1BGVA 4UULA 3WFJA 1VKOA 3S1LA 2EKQA 4DPKA 2DBQA 4QT0A 1PS0A 3W6UA 1IULA 3H65A 3RBXA 1FXSA 1PZHA 4GWGA 2GF2A 1UZLA 1BW9A 1SB8A 2BLLA 4FB5A 5DCYA 1HL3A 1H9BA 4JIGA 1JWBB 1Z75A 1NVMB 3DOOA 4OH1A 3WICA 5AVOA 5GZ3A 1YL7A 3HJAA 4CM1A 4IY1A 4QO8A 2GZ1A 1AUPA 4J90A 1DO8A 4MJLA 3FSRA 1XHLA 3HDJA 5HS4A 2GDZA 3ZZNA 4CLRB 1P0FA 4B4WA 5JLAA 3HZZA 3HUDA 3ICPA 4H15A 3JQDA 2PNFA 3LSYA 4PLFA 1EUCB 5AXCA 1NASA 4UEOA 3P2YA 4M86A 2CUKA 5LC1A 3L6EA 2DTXA 4J4HA 4XGKA 1BXGB 2FPIB 2UAGA 3RBZA 1ISIA 1AXGA 1JKJA 4G81A 7ADHA 3UICA 4XB2A 2VHVA 2H9IA 2DBZA 2EP5A 4II2A 1PJTA 2VUTA 2I66A 1QSGA 1XA0A 4NHEA 4MVJG 3Q1LA 1D3AA 1HTBA 4OMUA 3ZWXA 3UFXA 3ZWWA 4NBUA 2DKNA 4CMBA 1ZIDA 4MVJD 2B4RO 2X9NA 1WZIA 3NJ4A 1HYHA 5TT0A 1P1IA 1F14A 4BL5A 1WXDA 4OXNA 1VRWA 3U9LA 1G6KA 4CMKA 2IDZA 1DRWA 5L40A 3NTOA 5LDGA 1SNYA 1ZK2A 3FTPA 4R1UA 1OC4A 3O8QA 4O63O 2QW8A 3GHYA 3G1UA 1W6UA 2FZWA 1NFQA 3GDFA 2V7PA 5IN5A 2DUWA 3AI3A 4BNZA 3UCFA 3IUSA 4ITUA 2ZQZA 2NVUA 4WCFC 1LU9A 3U5TA 4JP2A 3W4JA 1MX3A 3K5PA 4A73A 1ENOA 4YXFA 1DXYA 1PS9A 1CYDA 4XGIA 5IZCC 4XDZA 4GX5A 1PJQA 5THKA 4RPGA 5TX7A 1KC3A 5EPOA 2O2YA 3PP8A 3SLGA 5KVCA 3JSAA 5ICSA 5A9SB 1NFFA 2C07A 1A4UA 1PJSA 1H2BA 1EK5A 2CNBA 4B4VA 1N8KA 1UXKA 1I24A 2Y93A 3GN2A 2NNLD 1B3BA 4WNCA 3K92A 2AEJA 3UAGA 3EC7A 3ENKA 3GVXA 3QWIA 2BH9A 1YGYA 4CM8A 3RBVA 1KS9A 1NX6A 1O9BA 4E0BA 2O3RA 4XQ9A 4WK6A 2Q1TA 2FPIA 3AFNA 5EL0A 4J9VA 1RM3A 3ZWYA 2WJPA 2O7SA 5B4VA 2GSDA 5TT1A 1PQPA 4HADA 3WGTA 2HDHA 3AJRA 3BTUA 3FNFA 1BRMA 4GX2A 1EEHA 4TZKA 2WE8A 5I7EA 3BXXA 1ZXBA 2A9FA 5G0UA 2NU9B 2GD1O 3UCXA 1ADCA 3ZWAA 1CQIA 2QZ9A 5A5FA 3ABIA 2OGUA 1WP4A 4JN6B 2O3QA 3PZRA 1IZ9A 1N9GB 4TRRA 1WAMA 4FJ1A 2NSDA 2G1UA 1MUUA 3PWZA 4NJMA 2FY8A 4EEXA 1SAYA 4LSWA 4A5OA 1A9ZA 1Q7CA 2DAPA 4UUOA 2JFGA 1X1TA 4P22A 2PD6A 1O89A 2NV6A 1V6AA 3RKRA 3D64A 1T4DA 2EJVA 3A4VA 1Y9AA 1O6ZA 3IOYA 2PA3A 3W4KA 2X0JA 5BR7A 4IDDA 1ENYA 3VTZA 3GG9A 4YTEA 1GUFA 1QLJA 4MVJA 4XJSA 3U3XA 1EDOA 8LDHA 1E1LA 2HMSA 1OMOA 3ZNPA 1CQJB 1UDBA 5BSGA 1DSSG 4IUYA 3GHHA 5ILGA 5F1OA 4AJ4A 1YDWA 1BW9B 1GAEO 3KXDA 4E2WA 1V8BA 3BYZA 3GGPA 4D3FA 2C5EA 2J5RA 4ALIA 1DAPA 1IY8A 3GGOA 2Q99A 5AXBA 3NUGA 2C0CA 3PFWO 5J23A 1U4SA 4GQAA 1E1MA 1DIRA 1LUAA 1QYWA 2VYVA 3PPIA 4BNMA 2OZPA 4B8ZA 4C7JA 1E3LA 3ANNA 4PZEA 4L4XA 4TRNA 2DQ4A 1Y8RA 3ETGA 1Y8QA 1E5QA 3ANLA 1LNQA 1IPFA 2NU6A 1QV6A 5KVQA 3TZHA 4FFLA 1ZNQO 3OJLA 2G17A 4IXTA 4Q3CA 3UCEA 3H4VA 4W7HA 3NYWA 3Q11A 1AXEA 3AUUA 3JQ8A 5TNXA 3KYDB 3OJOA 1N9GA 3KEQA 4YRBA 1GQQA 1WPQA 3CEAA 1BTOA 5JMPA 5CDGA 1NAHA 4BKOA 2HJSA 3KOUA 5IDYA 2NU7A 2IXAA 5B4TA 3L6OO 1UXJA 1EUDB 3ZNQA 1HE4A 3DC2A 3DOCA 1U5CA 3F6YA 1GYPA 1GCOA 3DONA 3FBGA 3H2ZA 3I23A 3SC4A 4RDHA 3TZCA 1H0KA 3WGYA 4U0JA 3PK0A 1B8UA 5DP1A 5A06A 4S3MA 4F45A 3RUDA 3GDOA 2PGJA 1DFIA 1DIBA 1TB4A 3NDIA 2XPCA 4ZRMA 1WMBA 2D5AA 4BKRA 3IP1A 1X14A 4JK3A 3HNPA 1R37A 3FPCA 4I9UA 4XYLA 4HBGA 1BMDA 3RJ5A 4UVIA 4N7RA 2PZKA 4IS2A 5C5IA 2EW8A 3FNGA 4YAEA 1QYXA 4YT2A 4RQTA 4KUGA 2XXBA 3DBLA 5T5QA 1E1KA 4HFJA 2P9CA 1GV0A 2QRKA 4KDEA 4B3HA 4P4GA 4R51A 3B1FA 2QX7A 5C7LO 1DLIA 1LQUA 4XWYA 3LT2A 4ALKA 4NJMB 3WSWA 1T2FA 1T1RA 4XR9A 1IPEA 1MFPA 4NMHA 1DRVA 3GMDA 3D3EA 4MIYA 1J6UA 4IGEA 3D5QA 4QXMA 3JQBA 4BO8A 1I10A 5A05A 2GCGA 3W4IA 5IF3A 5TJ9A 3C1OA 1TT5B 2Y99A 4W9NA 1WZEA 4RVSA 3WXBA 4DYDA 4ZGWA 3QA9A 2A94A 1CETA 4CMIA 1K6JA 2VCYA 3O26A 4PFJA 4DPMA 3G3EA 4CQMA 5BNIA 4HX5A 4Z3DA 1G1AA 4I9NA 2QQ5A 4NDNE 1BWSA 4CM7A 3WNQA 1R0LA 3V8BA 1XCBA 2VT2A 4I5DA 3H3FA 3E8XA 3O9ZA 2CSUA 2I99A 2A35A 4WGGA 5T8KA 1F8GA 1ZSNA 4MVJP 4UVDA 4GX0A 3EDMA 5FI3A 5K6AA 1VPDA 1ZKMA 4E5MA 4PLVA 4NU5A 2G5CA 1KY4A 3EZLA 2R6JA 1QLHA 2BF7A 1JAXA 4R3NA 4XYEA 2POQX 1VJ0A 2VNAA 1BXKA 4MP3A 1E6UA 3DZHA 4U6SA 4P38A 5A9SA 5IJZA 2JD1A 2RBEA 2HRBA 5H81A 4OXKA 2CZCA 5ITVA 4DIOA 1U8FO 3I9OA 3PXXA 5A1TA 1W0CA 2Y1DA 4BNVA 1UP4A 4ND3A 2QYSA 4GBJA 3GQVA 4TWRA 5B4UA 1YS4A 1NTOA 4R3WA 4YQYA 1AE1A 3MWDB 4DIFA 1A7KA 5JDCC 1ZEMA 4OQYA 1YJQA 2NACA 4PLCA 3ZWNA 1YB4A 4YPOA 1C0LA 5B1YA 4XGNA 4WCFA 1HE3A 1LLCA 1HYGA 5COAA 3MJCA 1ZCJA 1GADO 1DDOA 3ZWPA 1XIVA 3E82A 3RFXA 4CM8B 2DBRA 2DFVA 1F06A 4GSKA 3QWAA 1ORRA 1I3KA 4A10A 1S7CA 4UUNA 2DBVO 3V1UA 1ZBQA 3Q6IA 3ZNOA 4UAGA 2EV9A 2GASA 2GN4A 4KUHA 3RASA 4FCCA 4R16A 1X7HA 1M6HA 5L9AA 4B3IA 2C5AA 4ALNA 4DIBA 4JBHA 5EIOA 3GZ4A 1DOHA 1I3LA 4G5HA 3INRA 1X0XA 5KJCA 1SB9A 4Y6RA 4XDYA 1LDGA 2Y1CA 3KEOA 4L73A 1E92A 3OQ6A 3H9EO 3JQ7B 3TDKA 5CFZA 2GO1A 1HETA 3DBVO 3UW3A 3NT4A 4N5LA 1FDWA 2IE0A 3DBHB 4PLGA 3U4CA 5BSEA 1EE2A 3LU1A 5F3RA 1LX6A 2BD0A 1L1FA 5HA5A 4BNJA 3V1TC 4TRMA 4ESOA 1UXIA 3ZW8A 2NVBA 4I08A 4LVUA 3ZH2A 3GUCA 3WMXA 1N5DA 3M6IA 4FS3A 3ROPA 1XR3A 3ZV3A 3RAJA 2BGKA 4PRLA 2V65A 3KBOA 4J4TA 3AWDA 1P74A 4LRTB 1YKFA 3DBRA 2FWMX 3H3JA 4AG3A 3SJ7A 3VH4A 1YB5A 4OOEA 5GY7A 4OO3A 3CMMA 2FMUA 3ZU2A 1ULUA 4PCVA 4NNJA 5CP8A 2NUAA 5C7OO 3GOHA 3TL2A 2OORA 1I3NA 3NT2A 4IJKA 2CFCA 1Q1NA 4E5PA 1HE2A 3MEQA 2PKQO 4LCEA 1MFZA 3MOIA 2HKIA 1KETA 1U1IA 4CM4B 3DHYA 4NG5A 1LBEA 4Z9FA 3QP9A 3JQ9C 4OSOA 3WGIA 4MVJF 3L4SO 5JW6A 4J1TA 3A14A 3KSUA 1M75A 2X5KO 3GZNB 3UH1A 4IM7A 2X58A 4BNTA 1YJ8A 3BMCB 5L4SA 4CL3A 1ZSYA 5A04A 2FR0A 4RF4A 3D7LA 3LC1O 4Z0TA 4NZ9A 1DLJA 2QRJA 3FI9A 3VZQA 4EDFA 1C1DA 2P4HX 3VH2A 3IQDB 3PYXA 4GKBA 3WDSA 2Y1EA 1NWCA 4LMRA 3DMTC 5EERA 2I76A 5CEFA 1ZUD1 4RPLA 1ADGA 3SBOA 3RU9A 3ULKA 1I2CA 3H9GA 1CRWG 3PJFA 5KWEA 3KTDA 1R12A 1KC1A 4II3A 5K0ZA 3B1JA 4Y9DA 1YE3A 3PDUA 3C1TA 1Q7BA 1LRKA 4FC7A 4PG5A 1W4ZA 2FPGA 5G0VA 3D3WA 1C1XB 3VVCA 3OSUA 2J5KA 1Z6ZA 3INGA 4GKVA 3CZRA 4BNUA 3JYNA 3I9JA 3TF5A 1JQBA 1PGQA 1HDGO 3OJEA 3I83A 1UP7A 1GQ2A 3IKTA 3TZKA 4YACA 1ZJYA 2DLDA 5G2OA 1ISJA 2HK8A 2HU2A 1AGNA 2AE2A 3BIOA 2HAEA 1HDYA 1ADBA 2AE1A 4YJHA 2WD8A 3ICCA 4N18A 1XEAA 2J3HA 3ADPA 1PJ3A 2FR1A 3RFVA 1UAGA 2HMWA 3WQQA 4CMIB 1U2DA 3M2TA 2YJZA 5CPBA 1XSEA 4LW8A 1JVSA 3GEGA 1NPTO 2NU8B 3JQ7A 3QVXA 3DMYA 3E48A 2EHDA 5L3ZA 1OZAA 4L4RA 4MOWA 1I01A 4Q3AA 4YCAA 3KYDA 4OYRA 5JNLA 3KSDO 7MDHA 1KYQA 1LC3A 4NI5A 4AJEA 2Q3EA 2Y0CA 4PN3A 4ND5A 4MVJE 1K2WA 3VKVA 3GFGA 4Z3KA 1IHXA 1LDYA 5ER6A 4XYGA 5L7YA 1EMDA 4QQRA 1K3TA 2GUGA 4M89A 2PKRA 4XYBA 4K1LA 1HDCA 2ZK7A 3LQFA 5HM8A 3PDJA 3RFTA 3ZU3A 3TL3A 1YBMA 4ZA2A 5U4QA 4BNKA 1IHYA 3ZHXA 1A4IA 1DJNA 2EG9A 3KYCB 3R3SA 1V0JA 4FFRA 4EJMA 1P3DA 4KWHA 4IQGA 1X7DA 1RWBA 4D3SA 3HDQA 3UFXB 1CQJA 1TEHA 1LLDA 1NBOA 3FR8A 5BSHA 3KHUA 3WQRA 4G2NA 1HLPA 4DUPA 5JS6A 1O5IA 4U5QA 3GRKA 3VOSA 4FGWA 3P7MA 3DFZA 1P31A 4FFOA 3C85A 2D5CA 4A7PA 4B4OA 4NBVA 4U0KA 1PL6A 2GGSA 3W8FA 1N7HA 4J1QA 3LK7A 3AY6A 1LRLA 1GTMA 3M2PA 1CERA 1PX0A 2Q1WA 2FP4B 3PJDA 3OEWA 5CHEA 1R16A 3FD8A 4YRAA 4H16A 1JKIA 4RZIA 4J43A 2VZ0A 2EW2A 4W4TA 3RC7A 5CDYA 3QIVA 3D4PA 4K28A 4LRSB 1DFGA 5IAAA 3DXFA 4C7KA 1NM5A 1TLTA 3I52A 5TSDA 3ZWOA 2O2SA 3S55A 5KJFA 3TFQA 2Z5LA 1Y1PA 1E7MA 2Q45A 4YAJA 2W2KB 2PZJA 4K6FA 2OP1A 2ZB8A 2CDBA 2EF1A 3N58A 3P2OA 2BELA 1QYCA 3FRJA 3G1TA 3PTZA 2ZQYA 3AU8A 4BO3A 3PIIA 1D8AA 5I7FA 1ISGA 4J7XA 4ALMA 4OGWA 3NRCA 3GRPA 4CLDA 3KSZO 4PLZA 2Y68A 3GN1A 4Q3NA 1GUZA 5MGBA 1N1EA 4ROSA 3I3OA 4Z6KA 3ZGYA 1PJ4A 3DQPA 3ZV6A 1WDLA 5TRTA 3K9QO 3M1LA 2WMDA 3V1YA 4D42A 5K6AC 2IZZA 4WASA 3SEFA 4PLWA 1IYZA 1KERA 4A0SA 1DC3A 4NH4A 3C3XA 4ZN6A 3T7CA 2HK9A 4RLHA 3JQFA 1LTHR 1WW8A 2PD3A 4DVJA 3DBRB 1DIAA 1YVEI 4YJFA 3NEPX 5DZSA 4D7AA 2Y0EA 1V35A 4BS9A 5A03A 3AOEA 1RJWA 5L7WA 5T57A 1ISMA 1GCUA 2GERA 3IKVA 3STHA 1GR0A 1Y7TA 3HB5X 3WIDA 5G0WA 4IS3A 4OHUA 4EYEA 2E6UX 2GYYA 4IMPA 1XG5A 1P45A 3PQEA 3MZ0A 3DAFA 3S2GA 4BO6A 3QVWA 1HT0A 3F5QA 4GX1A 3EHEA 2DM6A 1PEDA 2DPHA 3IC5A 3HHPA 1V3VA 4IDBA 4J4BA 5CPFA 1NQAO 3WIEA 1HE5A 4YT5A 3PJGA 1EZ4A 3O8QB 1C14A 3NGLA 3RQSA 4EJ0A 3EW7A 4RJTA 1MC4A 4ID9A 1SCUA 4RVFA 1VL8A 1U4OA 3PQDA 4CUZA 3S2EA 2AEFA 2UVDA 3GGGA 5AYVA 1TI7A 4BGVA 3IMFA 5KJ6A 1HKUA 1KOLA 2GN9A 1I36A 5ICMA 2DU8A 3FF4A 3O38A 4CMEA 4IXWA 3ROMA 4IQ8A 4RVHA 2VWHA 4PRKA 3VC7A 4MP6A 4BV9A 2VUUA 3S2FA 1ZK0A 3F5SA 1DPGA 1JKJB 4GLOA 3LLSA 2NVWA 1GEEA 2YQ5A 4AJPA 3PQFA 2D3TA 2JHFA 1LEHA 4RO0A 1K0UA 4JLWA 5L95A 3ITDA 1K89A 4HUJA 1YWGO 1LSOA 2GZ3A 4JGBA 1PWXA 3JQ9A 1YO6A 9LDBA 2J3IA 2ZJ0A 4FPXA 4XX0B 5T6BA 3NJ8A 4AJNA 1DJQA 1D7OA 1ISFA 5EN4A 3VVBA 3E5MA 4ZVVA 3I9MA 4GL4A 1BXZA 5DT9A 4ZQBA 4A27A 1EUCA 4M8SA 4CMHA 1SCUB 1XLTA 1T2CA 4BGEA 5JSFA 2P9EA 2J5QA 1VI2A 2W2LD 4E12A 2YFHA 1B3RA 1T26A 3G79A 4NBWA 1T2AA 2O7QA 5JAQA 2ZYAA 4E5KA 3L0DA 4IMRA 4GVXA 3OETA 2J3KA 4LN1A 1RKXA 3H2SA 4FSHA 1T4BA 1Z74A 3QSGA 4ALLA 2FZEA 3EAGA 4R5MA 3QLJA 2ZTMA 1PZEA 4K9DA 4PG4A 2G82A 2O3UA 1EQUA 3HQ4O 1O0SA 3A28A 4E21A 1LDMA 1YL5A 3RWBA 4XYMA 1PGPA 4PLYA 2JD0A 4PZDA 4GSLA 1RYDA 5T67A 1Z82A 3CMCO 1QXSA 1VSUA 3C7AA 2WWRA 4AJOA 4R41A 4RF3A 1H2HA 3QW2A 2NQTA 5BT9A 3DDNA 2BFMA 1JDJA 3OBBA 3U0BA 2RHRA 3H5AA 2H1SA 1HWYA 5HWSA 2AQ8A 2QRLA 2X9VA 4RV9A 4IJVA 3BHJA 4FJ2A 1ZH8A 4TVBA 4BNHA 1LSJA 2I3GA 2JL1A 3I4FA 3TWOA 1ENPA 4Z9XA 4UVGA 4XIJA 1BG6A 1E3WB 1FDUA 3VDQA 4DQUA 1UXHA 2V6BA 3CPSA 3D4OA 2BKAA 3W8EA 4WLVA 2O3SA 4XQEA 4TQGA 5KKAA 1X13A 5I9MA 1ISHA 1PGNA 4MIEA 4ZRNA 2P9GA 3F1LA 3DB2A 4JP3A 1FK8A 5H83A 1VKNA 4GI2A 4MO2A 3D3WB 4NQZA 3LVFO 1JAYA 1E3SA 4BQPA 3PLNA 3LT0A 3PGJA 3OQ1A 2EIHA 4UUMA 4XR4A 3WQSB 3KLPX 1Z73A 5DF1A 3U4DA 4MKZA 4YR9A 3BAZA 4QFDA 1DHTA 4FR5A 1Y5RA 3IDSA 2BFAA 4A2CA 2EWMA 4KUEA 5F5NA 1Z7BA 4HNHA 4YJFB 5TIIA 2B83A 1XYGA 1MV8A 1SO8A 3WB9A 1HLDA 1PSDA 2Y67A 3WLEA 4Z0HO 4BNNA 3OF2A 3SC6A 1LDEA 2WD7A 3I1JA 3OFSA 1L7EA 2EKLA 2QG4A 1Q0QA 1NNUA 4W99A 1PGOA 4OQZA 3E1KA 4L4SA 1T2DA 1E0DA 5KJEA 1JVBA 1UUFA 3L9XA 4NFYA 5AOVA 1XU9A 3COSA 3EMKA 1O94A 2WTBA 3OQBA 1X0VA 2PD4A 4E31A 3NAQA 4JJIA 4YJGA 3PVZA 2QYTA 2IODA 1V9LA 4URFA 1ONPA 4INAA 4XCVA 3WGZA 3ZDFA 5IZCA 4FIZA 4UVEA 2X86A 4E30A 5KOIA 1QORA 4BQRA 2ZB7A 4GAEA 3F1KA 2Y66A 2ZCUA 3UVEA 5A9RA 3KETA 5IZ4A 4YWJA 3H8VA 4WECA 2LDXA 2RAFA 2G0TA 5L51A 3QVSA 5JC8A 4BNLA 4EW6A 2HJRA 4K26A 3I6QA 3VPHA 1J5PA 3A9WA 2CF5A 4OSPA 3UGKA 4KOAA 4I5EA 5L7TA 4FQ8A 3PHIA 4EUHA 1N2SA 3V2GA 1K6XA 2VOJA 1RM4A 2CVOA 4CQLA 2OFPA 1EVJA 3DZKA 5JO9A 3DTYA 1Y5MA 4R01A 4CQMD 1SEPA 4DRYA 4CLEA 1DIHA 2YYYA 3K96A 2QHXA 1CF2O 1PIWA 1VM6A 5A02A 4CPDA 1H94A 3IL2A 2PV7A 3IP3A 4D41A 5BNTA 4UVHA 3JQAA 2DPGA 2VZ8A 4QX6A 2C20A 5B37A 1JTVA 5C37A 4E2YA 2W2LA 4I5GA 4YAKA 1L7DA 2C7GA 2QZZA 3MTJA 5IG2A 4P4LA 1KY5A 1XKQA 3TZQA 2VWQA 4GH5A 3QVTA 1PGJA 4PLTA 3DR3A 1C1XA 3EK2A 1RYEA 1PR3A 3R6DA 4MVJI 3KV3O 2BMAA 4FW8A 1F12A 1SEVA 3MCVA 1NVTA 2C2XA 2CVZA 1W8DA 4AJHA 3AM4A 1EVZA 1KIFA 1GYRA 3QJ5A 1ZK3A 2B69A 5CEJA 2YHIA 1VC2A 1U3WA 4YJHB 4BHTA 2UUPA 1Y8RB 2IRWA 3EUWA 3TZ6A 5C3MA 1FDSA 3U4HA 2WYUA 1B16A 1FJHA 2B4TO 2OP0A 5HTOA 4U6QA 1SOVA 2VT3A 3WYBA 3AUTA 2B35A 4JQCA 4L74A 1BVUA 1JA9A 4OKIA 4RPHA 3RD5A 5JC1A 3RUAA 1W73A 3LT1A 2CY0A 2PWZA 3JV7A 4Y8VA 1PS8A 4J3FA 4N5MA 4MPDA 4O5OA 6LDHA 1GUYA 2PLAA 5CAEB 1ZO8A 4AJLA 1IZ0A 3DFUA 4YT4A 3DAGA 2GZ2A 1ZW1A 4BO5A 4BVAA 3BTVA 4ZHSA 1YOVB 1G0OA 1B8VA 2ZATA 3E5RA 4Q3EA 1U7HA 1M67A 4R5HA 3RKUA 2Q4EA 2X0IA 4ND1A 3L07A 4YJGB 5L4LA 5IXYA 4NPCA 4WEQA 2BI8A 3WGOA 5JO0A 3L6DA 4E5NA 5G0SA 5IN4A 3OMLA 3FBTA 4Y67A 3I4CA 4OKNA 5TQVA 3QWBA 2NM0A 3KYCA 4CL8A 4CV2A 3WGGA 1S6YA 1WNTA 3RIHA 1EK6A 4CR8A 1MXHA 2V6MA 1MG0A 3JD4A 5L4NA 1H6BA 4EBFA 4DQVA 3RUCA 3JD3A 2PR2A 3ASUA 1TT7A 1ENZA 3EVNA 3BMCA 5JCJA 3AI2A 1HDZA 3B70A 4TMFA 4ILKA 5F5LA 2VQ3A 3DL2A 3MJEA 4WLUA 1H9AA 3AM5A 3OEYA 1I32A 2EGHA 1P77A 4CJXA 2B36A 2PH3A 4YDRA 2V6FA 3AY3A 3AM3A 1KEUA 1JLLB 1ULSA 3UF0A 1PU2A 3FWNA 1SOWA 3H9UA 4O6VA 3PRJA 5DP2A 4WPGA 2X5OA 4NFHA 1IUKA 4RVGA 4BO2A 4ZICA 1U7TA 1Y81A 1BVRA 4PVDA 3WNVA 2X0NA 3FN4A 3K2BA 4HV4A 3F46A 1HZZA 3GH3A 3SX2A 1ZK1A 3RJ9A 3WWZA 2EEZA 2BGLA 4FOSA 4LK3A 2AW5A 1YRLA 1NAIA 4AJ2A 4MDHA 3MTGA 1WDMA 2YHIB 1WLYA 3LF1A 4N5NA 3G0OA 2H6EA 2E48A 4M87A 4WOJA 2IEBA 4DMLA 3T4EA 1QG6A 2J3JA 1GZ4A 4CUJA 5GZ1A 5IDWA 3I9NA 3NV9A 4B7XA 3K73O 3WG9A 1A71A 2H63A 1B0AA 5DOZA 9LDTA 3AUAA 1B26A 3PZBA 5EJ2A 1E5LA 4KDFA 3PGXA 1GV1A 2JAPA 4M54A 3ZU4A 3MJSA 3R0IA 3JQ8B 4E13A 4EUFA 5JY1A 1I8TA 2ET6A 3GVIA 1ZVMA 3DTTA 2HMTA 4C4OA 1EBUA 2NLOA 4W82A 1KEPA 1MGOA 3ZU5A 4HWKA 2ILTA 4HNGA 2YHUA 3UHAA 1U2GA 1OI7A 4RLSA 2O48X 2YQ4A 3H7AA 3PHHA 4JBGA 1TXGA 1ZXLA 3OHSX 2FP4A 2VTEA 2OMEA 1ZJZA 4GWKA 5ITWA 3VHRA 4TSKA 2Q50A 4XRRA 4CV0A 4IJUA 2ZJ1A 1P1FA 4GVLA 3GEDA 2RIRA 2GPTA 4AJJA 3DZJA 2UDPA 4OJNA 4J6FA 4E32A 5DULA 2ZCVA 5L53A 3VAZA 3LDHA 1F17A 4D46A 4L0QA 2JKVA 3F4LA 3HG7A 4E4YA 2R00A 1MXFA 2Z1NA 1T25A 3HWRA 5DN9A 2NVUB 4QEDA 3F3SA 4B4UA 3MWEB 2HMUA 4R1TA 5CG1A 1EVYA 2HUNA 3LF2A 5JCJD 2YDYA 4GGPA 3IJRA 1UZNA 1V3TA 4I9HA 1OBFO 4M55A 4YVFA 2BHLA 3TPCA 4BO4A 1HF3A 3GR6A 5COBA 3RVDA 2NTNA 3PLRA 4WLNA 5CAEA 4R9SA 4IDCA 3FWZA 2IYOA 3X2EA 3ST7A 5FFFA 1DIGA 3LC2O 2HMVA 1PJBA 4DYVA 3HN2A 3QQPA 1PQUA 2GN8A 1ZEJA 2YY7A 4F6LA 3I9LA 1E3IA 3BHIA 4F46A 2JD2A 3ZV5A 4HFNA 2NADA 1LA2A 4DREA 1E7YA 1KEVA 2X5JO 3ON5A 3WOHA 4H3VA 2WEKA 5I8WA 2NTVA 2IZ1A 3OJ0A 4MP8A 4J0EA 2X23A 2FOIA 2EJWA 1M66A 5L45A 4PIVA 4RVDA 4AJ1A 2VYNA 2X6TA 2D1YA 2IEDA 4D3DA 3GFBA 4CR6A 3V2UA 2ZB3A 3ENNA 3TFOA 1QV7A 4BO1A 3V5NA 1CQIB 2DT5A 3JQGA 3T7EA 1LSUA 4NBTA 1BDMA 5LDHA 3JQGB 1ZZEA 4XKJA 3NGXA 1J49A 3E9NA 3LZ6A 3TSCA 2ZTLA 4Q3BA 1UH5A 3VPFA 5IDXA 4TRJA 1WDKA 4IGFA 4Z0PA 1JW9B 2Q46A 3ETEA 3UOGA 2JAHA 2O3JA 3IIEA 2UYYA 4RPJA 2DVMA 3WMWA 5GZ6A 2BI7A 5FF9A 3JYPA 6ADHA 2ZIZA 3KYBA 2XOXA 3RC2A 4CUKA 1C1DB 8ADHA 2Y1GA 4IINA 3RC1A 3JD0A 1DFHA 5KKCA 2Q1SA 1U3UA 1MP0A 4U8GA 3SVTA 1WMAA 2VRBA 1E7QA 2I3AA 2JJYA 3BTSA 1C0PA 2R00C 4F3YA 4GLLA 1MA0A 4N54A 2JFHA 2AQHA 4WCFB 3Q9NA 1X1EA 4YBZA 4CM6A 1P1HA 1P33A 3JYOA 4ND2A 3GNQA 1B14A 4Z9YA 2ZYDA 1I2ZA 3TNLA 4J0FA 4KMSA 1M6WA 3OECA 1YB1A 1I5RA 3LT4A 3AY7A 3K2EA 3BMQB 2XXJA 3L4BA 3OIFA 3IJPA 2Y0DA 3TN7A 1KEWA 5EESA 4CMJA 2P2SA 3ZHZA 1R4MB 5FWNA 3N7UA 2C2YA 2BGMA 3WYEA 2CDCA 4JX8A 1RPNA 3U62A 4AL4A 3WYCA 4J2OA 3BHMA 5I9LA 2NU6B 2Y1FA 3RCBA 3MWEA 4PGFA 4I1IA 3DZBA 1AHHA 1H5QA 1VL0A 1D4FA 3GVCA 3JD1A 3HE3A 4E2ZA 1KBZA 4F6CA 2CF6A 2D0IA 2QIOA 4R1SA 3OIGA 2B37A 4A26A 2GR9A 3QHAA 5I7SA 4DWVA 1ARZA 3DZIA 1E77A 4NK5A 4DBVO 4OL9A 3PIDA 4BNFA 2E49A 3H5NA 4YYZA 4L8VA 5C7IO 4TZTA 1GQYA 2W8ZA 2RHCA 4E33A 2PZMA 2IXBA 1DBVO 4RCVA 5DDIP 3H6KA 1VL6A 1YQDA 2DUUA 4NBRA 2YV1A 1EDZA 4QECA 3ZWMA 3FR7A 3MOGA 3L77A 1YBVA 3LYLA 1YONA 3L9WA 1EQ2A 4LMPA 4NK4A 4J1NA 1U5AA 2X9GA 2CMDA 5G0TA 4EI2A 3GT0A 3NT5A 2C54A 5G4KB 1PQWA 4EJ6A 4W6ZA 3ZN2A 1ONNA 1SC6A 1F0YA 4DL9A 1H6AA 4MKRA 3AOGA 4OM8A 1CIVA 1NXQA 3D5TA 3QVOA 5DCWA 1JKFA 3Q2KA 1E3JA 1QP8A 4JNKA 1X15A 2R2GA 4IDAA 1NP3A 2DTDA 4XQGA 4OXYA 4WEOA 4R69A 3JQAD 4R4JA 1YL6A 2VN8A 3ZNNA 1DHRA 3MJTA 1XU7A 4FJ0A 1P44A 2D4AA 3D1LA 4BKPA 3QWHA 3VZRA 2O50A 4BV8A 1MLDA 1C0IA 3RUIA 4DMMA 4NU6A 3GPDG 1Z45A 3TQHA 1LRJA 3JQFC 4JCOA 3F47A 2FPPA 1HDRA 1I0ZA 1LLQA 4CLOA 3V2HA 3G17A 4X54A 1N7GA 1R66A 4B3JA 4CM9D 1HDXA 5A5EA 3N74A 5JDIC 2FPGB 3GY0A 3W1VA 1C0KA 3KVOA 2X8LA 3VPSA 1YQGA 3PYLA 4D0SA 4O0LA 2Y1OA 4D44A 1CEQA 4WJZA 2PK3A 3E6AA 3I9KA 3WLFA 2Q2WA 2P5UA 5DNAA 1B15A 2LDBA 3GA0A 1SMKA 5JMWA 4CQLB 1ZK4A 4BO9A 1PJ2A 5HS6A 3GC6A 1BSVA 3M1AA 2HK7A 1V3UA 2VTDA 4PLPA 4P8RA 4E2XA 4RGBA 3NTQA 2ZB4A 5KVVA 5ENVA 1VSVA 4UEKA 4LSMA 3IS3A 1Q0LA 3NKLA 5AXDA 2HLPA 2WD7B 5FEUA 4HXYA 2Q49A 1EUZA 1E7WA 2RCYA 4HKTA 4DLLA 4Q9NA 4KQXA 3WGQA 3MJVA 1U9JA 3JQEA 1GU7A 3GDGA 5HBRA 3TJRA 4MIOA 4YA6A 3T4XA 2PTGA 2YV3A 2TMDA 4BO0A 4FBGA 1SZJG 3OP4A 3HSKA 4IJWA 3WTBA 4PZCA 3C1AA 5MDHA 4J2HA 4L75A 2EGGA 2GNAA 4K6CA 4BNIA 3KLMX 1YOVA 2FHSA 3Q2IA 4KTTE 1RM5A 2VUSA 4EGFA 5ILOA 3P19A 3G49A 3CZMA 1R4MA 1E7RA 1X7GA 1NQTA 3C7CB 2FR8A 2WE7A 3DEYX 1Q0HA 1HSZA 2I6TA 1A7AA 3CE6A 5CDSA 2WYVA 2O23A 4CM3A 4KZPA 3PWSA 3EVTA 1UDCA 1H6DA 1A9YA 2PH5A 3RU7A 2IYPA 3RUEA 4IIVA 5F1KA 1BDBA 2P91A 3DBHA 2OBYA 2IZ0A 4DGSA 2NU9A 1NQ5A 2ZTUA 5JDIA 2AQKA 5KNLA 2GLXA 3OM9A 2C29D 5JXWA 3IUPA 3SXPA 4ZJUA 4IDGA 2PY6A 3A06A 4NFSA 4WLFA 4Q3DA 3VH1A 2AQIA 1JU9A 1IL0A 3ZHBA 2DTEA 3CTMA 1UR5A 4ZD6A 1I30A 2UUOA 4NJOA 5JDCA 4YB8A 1HDOA 4XJTA 1Y8QB 4YJDA 3WJAA 3PHGA 1J4AA 3WS7A 3ZHYA 5TLSA 4FFNA 4J49A 3JQCA 5AQ1A 1OAAA 3L4BC 5DBFA 5U1PA 3FTNA 3ROKA 4CQMB 2HSDA 3PWKA 4CM9A 2SCUA 1PTJA 1LC0A 4WLOA 4JXKA 4WOKA 2GRAA 1DC4A 2I5PO 2VRCA 3NDRA 4DA9A 3JCZA 4DC0A 2W90A 3W6ZA 4L76A 3EY4A 4XIYA 1MC5A 5A3VA 3INTA 3WJ7A 3AK4A 5DBIA 4ZU3A 4R9RA 4OOFA 1O8CA 3VZPA 2G76A 2OBNA 2OOSA 2X7HA 2XAAA 1IOLA 2E37A 2FRDA 3E18A 4MVJM 4PG7A 4BB6A 4CODB 2VHZA 2ZYGA 4BNYA 3NX4A 4JBIA 5HRUA 1GZ3A 4Y6SA 1QYVA 4QUKA 1HZJA 4S1VA 4HFMA 3ZWCA 1R15A 1A5ZA 2DC1A 3VPGA 4NR0A 4NIMA 4B7CA 3BA1A 5CDTA 4LGVA 1LXCA 3VPXA 4FD3A 3TRIA 2TMGA 3JQAB 5LCXA 4YRDA 1BXGA 3UUWA 4KP7A 4HY3A 5G4LA 4DC1A 3QY9A 4BMNA 1VE9A 3ZI0A 4HP8A 4XRGA 4CLXA 5A3JA 3GMSA 3K31A 1DEHA 1Y6JA 3U4IA 4CLHA 4BO7A 1C3VA 3WX0A 1GDHA 3CSDA 2VNSA 4IDFA 4J7UA 1TT5A 5B12A 1P1RA 5KTKA 3OA2A 2YV2A 3WWYA 2PGDA 3F9IA 4KQWA 1CWUA 2X1HA 4FGSA 3PFFA 2FSVA 5DOVA 4E5YA 3CXRA 2GN6A 5EINA 3OA0A 2ZTVA 5BQFA 3RSHA 3GNTA 1P1KA 5JPIA 3I5MA 1ZMOA 1UZMA 5EQDA 1XQ1A 3GLQA 2E82A 1VJ1A 3H9QA 3JTMA 3K6JA 4FFMA 3WGHA 2X4GA 4PG6A 5ADHA 4CMAA 2Q2QA 4DLAA 4YAIA 4GMGA 1NQOA 2Q2VA 4BMSA 2C7VA 2PKQP 3GAZA 4O59O 2W4QA 3QE3A 4RPKA 1P9LA 5TS3A 1QR6A 1A72A 2P68A 4J7CA 3GZNA 5IDQA 3AI1A 3JYQA 1KVRA 4YEDA 1UJMA 1NR7A 5KIAA 4CMGA 3TOZA 3HDHA 5JAZA
chains in the Genus database with same CATH superfamily
1BJRE 3S44A 3PKIA 2NYRA 1Z33A 1R4NB 3USCS 3PQ8A 2ZKLA 4KNWA 3UZUA 2HRCA 2BM9A 5FBLB 2VOEA 1UDAA 3OQJA 3E3MA 4NATA 4BN4A 4NS1A 1RLMA 1D1TA 1X19A 2R8PA 4K6KA 5CG2A 1GRRA 4TQAA 1S2OA 3DNMA 4OVKA 5D84A 3WVNA 3GL9A 3HGQA 4IUDS 1V45E 4DLPA 3KZKA 5EMMA 1DS6A 2VHXA 1OWPA 1NOJA 3VGJA 2JI9A 5CGQB 3F6BX 5EWLB 2GEJA 4M49A 3OZSA 3T7DA 3MNFA 1XQ6A 4CW7A 4BMVA 3T1HB 2HGZA 1Z0FA 4GZ5A 1G0NA 1TM2A 1XJ5A 3I09A 2ES4A 4MJ3A 5B58C 1EJ6A 5FHQA 2CD9A 3K9FC 2WQZA 4W5NA 3ITKA 2WU8A 4A03A 5JWOA 2CUZA 1KVSA 4LOAA 1V5EA 2A1IA 3B51X 4B48A 2YBDA 3JYLA 3LJKA 4G0YA 4N6NA 5KCZA 4RK6A 3UB2A 2VSFA 4ZIRA 1T2EA 3GK3A 2OL4A 3JQBC 4MR9B 4E11A 3N28A 5T41A 4EHNA 4O4JA 1OH8A 4RDIA 1YJAA 1TFRA 2RB4A 2RGYA 1BGXT 3BMNA 3IAAA 3L93A 4U7GA 3ESXA 4YO8A 3VYSB 4EG4A 2PZLA 4JLJA 5K0FA 4B2YA 4YQEA 4XVQA 3EISA 1IWOA 4M8LA 2YJ3A 5F98A 2GN0A 4DF3A 5AK3A 5TQ2A 1FMJA 1KK3A 2LNDA 3CNHA 1YIDA 1ZR4A 1UBCA 2EWWA 4GO1A 2XYGA 4NMMA 3C3PA 4D0RA 2AW3A 1DBPA 1NFRA 3M49A 1MIOA 4F92B 4ZCIA 4AKHA 4WCDA 2VCHA 4DSNA 2XOEA 1QKIA 1NJ2A 2I6GA 1QMGA 3NWPA 2XDYA 3HDGA 1G8AA 1Z0DA 2J08A 3CIFA 3DWFA 1CDDA 1LDNA 2VP3A 3H1GA 3ML1A 3TDMA 3B2EA 1JH8A 1U8UA 3E9YA 4Y6LA 1M2OA 1KZ7B 3IPYA 4PG8A 4ID3A 4PNHA 2EZTA 1ATIA 2JEOA 1ONOA 3QRWA 2MTBA 4OFWA 5DE3A 1I33A 2HQ1A 1L7PA 3C15C 5CVCA 2AG5A 1HGXA 2NUPA 4MWBA 5K3SA 4CMCA 3B9RA 1ZC3A 4FQ7A 1HI9A 3SFZA 1YF3A 1KMCA 2KJQA 2GJAA 4HAXA 3K70C 4DLBA 2QVYX 1HRDA 1K5HA 3VISA 5J4VA 5E3JA 3KKMA 5DCUA 2KLBA 4UAJA 4C0QC 3R7WB 5FBWB 1H6CA 4KO3S 1KE1A 1GNQA 1E63A 1AN9A 1OC2A 2ZT8A 3KRTA 5EOVA 2WG2A 4XUEA 1HQDA 3GCZA 2IP4A 3N2LA 2OPHA 5CDUA 3MSXA 2BGWA 3SAJA 4AFNA 5EJ5A 3EDOA 1K98A 3VDRA 1G3IA 4B7ZA 1PTJC 3DZFA 4QUJA 1E99A 2XE8A 1F60A 2GZDA 3PICA 3EDRA 4ZAYA 1VQ1A 5IK2A 1JLLA 5JD5A 3TUZC 4A82A 5CK5A 3B20A 1PVVA 2P4QA 2PKXA 4ZOBA 4JLBA 4URWR 1NATA 2B34A 3TKYA 5ECDA 2GEVA 3O31A 3U49A 4F84A 4EZBA 5C5EA 1CX9B 2FN7A 4L28A 2BHTA 4OIMA 3LCMA 4WK0B 2FKAA 4WNIA 3VPBA 1R4NA 1X1RA 2XCUA 4WK2B 4ZP1A 2Q1UA 4CF5A 4Z4HA 4XFKA 1Y34E 5B3LA 3RHTA 3OLYA 4N5IX 2H85A 2ZSBA 1I7NA 2CVQA 3BSSA 5LZ7A 1U1FA 2QQEA 2Q9UA 4NE9A 2G88A 2CZQA 1E6WA 3QVKA 3CLUC 1SG9A 1U0LA 1XTTA 4B6EA 1GG2A 3HDYA 1MVNA 4EITA 2HIHA 1LV8A 3VDNB 2FUEA 2F3QA 1YJCA 4FYHA 2QD2A 1RM0A 4AX8A 1J1IA 3KBBA 3ZHQA 5JSKA 2SCUB 4CL2A 2YJTD 1CLUA 2X0RA 1JT9A 3V7FA 3IBCA 1EE9A 3QF4A 3SR3A 4NBLA 1SD5A 1ZFNA 4R9VA 4C6RA 1WVGA 2R9VA 3L6CA 4LF6B 5JAIA 1DC5A 2JFQA 1DJLA 3JWHA 3T3HA 4EG0A 4TKMA 2JHGA 2GMWA 3DGEC 4I8XA 2ZSAA 5KVAA 2AC4A 3L4KA 2DPMA 1TA4A 3GDHA 1BHSA 3PQ7A 4JJGA 3RS4A 1QHSA 1VJGA 3ADOA 5BNFA 1LLUA 1ZBDA 1VRCA 3ANMA 3BERA 3ETDA 4KN5A 4B79A 2WINI 2H5LA 2ORWA 3BFKA 3O74A 3SJCA 4RJJA 1JH9A 5BVGA 1NR1A 1UANA 1NPDA 4OMCA 1YZQA 4L9RA 4DQXA 1QB7A 4QUHA 5LKRA 1OLUB 4IZOA 4RD1A 1LI4A 2CL0X 3D2BA 3K0EA 2B6HA 2Q4TA 3QF7A 1BCSA 2OXFA 4J16A 3ZE2B 4DHEA 5A5DA 1HG1A 2JPDA 1C1HA 3IAM1 3RIGA 1LGYA 5SICE 4TZ6A 4HNTA 2J3MA 1IG0A 4QGGA 2C2BA 3NHWA 5C32A 1PJAA 2OR3A 1KA9H 4F6RB 3IVCA 1GN8A 3H2GA 4PTYA 5CA0B 4Y6QA 4F3TA 1PWHA 4RIEA 1CS0B 3Q9LA 4KIFA 5DW0A 3V80A 1RRCA 1QU2A 2OV1A 4J9UE 2HBYA 3K53A 2ZSDA 5BSFA 2WMOB 1YI0A 3FY4A 3FOBA 3VVMA 2XUHA 2CJXA 3QU4A 1JHQA 2QV7A 4WX2B 2XRMA 2VDVE 1S8OA 1B8PA 3CWQA 1DRUA 5FOSA 3GPLA 3EIUA 4CM4A 4CTOA 2WTXA 3BSFA 1R6DA 2FMFA 4AY6A 2VBFA 3AOEC 4DDTA 2HUPA 1KP9A 3S8MA 4JUAA 4N3AA 3K5HA 3M5WA 4S0XA 1E79D 4FBLA 4A6EA 3FNHA 4B85A 3DAPA 3V4RA 1BMTA 5F12A 3FOFC 4RMHA 2RHDA 2WSBA 1E2FA 2CLMB 3UPTA 1PWZA 2VLIA 5GOTA 4M37A 4TLAA 4QO7A 1SK8A 1WP9A 3L8CA 3ZVRA 1E2JA 3CQ9A 4JQSA 5T4HA 4RQUA 4EQ6B 2YZ7A 2Y6UA 1FX0A 2BJWA 2G72A 3HUTA 4XEHA 3LWDA 2VLBA 2FDCA 4CDRA 3JWEA 3I3SR 4I1PA 5KVSA 4KEAA 4QQ8A 3OMWA 1BMFD 5CK4A 3ZXYA 4X61A 2O4CA 5K05A 1ADFA 1J5XA 3OJFA 5ALFA 2GCIA 1Q84A 1EBFA 3BFVA 4UUPA 1N5IA 4GC5A 5EGNA 2WFAA 3HFGA 5IW8A 3RBAA 3ZW9A 4H3KB 1N1GA 4C4XA 3W4KA 1A8SA 2XWPA 3HL4A 4HBZA 4DNOA 1RC1A 1GFSA 2VP4A 4RXTA 1Q5PA 4RADA 1IJKA 2C5SA 3WSVA 1GA4A 2VYND 4FNMA 4MINA 4MI9A 3O03A 5H7XA 1N5RA 2VK1A 3PEFA 4IQ4A 1JZTA 2RGUA 4G36A 6REQB 4NQRA 3HBLA 1C3EA 2I9PA 3AFOA 4ZQGA 3DOJA 5ES3A 2XX3A 5EIWA 5FL7D 3ZY2A 3W9BA 4DJJA 1OZFA 3IAHA 3S7TA 3C8MA 1OD6A 2JLSA 1Y5NA 1XGKA 3WI7A 2KE5A 4IQ0A 3GLHA 3PPYA 1UBSB 2PSFA 4DUGD 3DZ8A 1UIRA 4TWJA 4BCDA 1F0KA 1QE5A 3L06A 4IHJA 1WSDA 3A8TA 5EUCA 1GY8A 2R6HA 4BBZA 3LGSA 1CK4A 4HPXB 3THWB 2B25A 1U3VA 1XVLA 5KOJA 1XCPA 3GLIB 4BRUA 3QVGA 1K7CA 3E03A 3OLVA 2WLSA 3CS3A 4ALJA 1M74A 3UC5A 4D79A 1ZMRA 4DTIA 2HSZA 4M7RA 3EX7C 1AZLA 3NC1C 3EW9A 1LDBA 1R5BA 3G0BA 2Y05A 4WLEA 4QSMA 1CEYA 3CVUA 4U5XA 1ORHA 4FFBB 3U81A 4NZMA 1ZOIA 1UBUS 3D0OA 4D45A 3T0GA 4ARVA 5EKTA 1W52X 3VZBA 3MHPA 1YVPA 3W7VA 5IS2A 1C7QA 2OAQ1 3LPNA 4FSDA 1FRVA 6GPBA 3QFFA 5INTA 1U2GC 2I4NA 3A6LA 4XSHA 4C03A 5T8KC 3WR5A 2G5PA 3DW1X 3QBDA 2H54A 2EFJA 5EZQA 4WOBA 1IEQA 4DEXA 4XAQA 1J8MF 5EIXA 3VR2D 4ND4A 1SY7A 1GNTA 1K3UB 4JR1A 2ZRKA 4BJ3A 2W6OA 1GPDG 2XY4A 2PWPA 1G8GA 2QROA 3QWFA 1T35A 4D6YA 2GCOB 4IZIA 3RRMA 2H1IA 3IP6A 3LH5A 4CKBB 1HT2E 3X1DA 2OSVA 3GLFE 4FYPA 2GAFA 4E14A 4XUDA 2W0SA 1SURA 3D8SA 1URPA 4B8WA 1P4AA 1IFXA 3FCSB 3I12A 1N77A 1KOGA 2FN3A 4I50A 2NUAB 1A27A 1CE8A 5EHNA 4HH4A 1DKRA 3JASB 3HB4X 2EXXA 4ZO6A 1BGVA 4CCWA 3MWLA 5EMKA 2HQBA 2HZBA 1N78A 2D4HA 3EZ6A 3H0KA 2GD2A 5K7SA 2DBQA 1U3CA 2G83A 4G09A 3IAXA 2JLZA 3TQRA 4DR4B 1IULA 4HDNA 3ZKWB 2VATA 4Q7KA 3M6MD 5BSTA 3JRXA 3AKZA 2GF2A 4WBSA 3DM5A 2ZRNA 4WACA 3OPXA 2JFWA 4EB6B 4JVNA 2C00A 4DWWA 1H9BA 3FGNA 1LPSA 4W5JA 1JWBB 4GPBA 4QREA 4OH1A 4QZVA 5LQMA 3URMA 2CBZA 1PZMA 3HJAA 2WIKA 1GL7A 1AUPA 1AKUA 2QJRA 1DO8A 2P75A 4MJLA 1IBKB 3FSRA 1XHLA 1M34A 4URUR 1AZSC 3VNRA 1EFUA 4JS0A 4RJIA 3IT0A 4B4WA 3HUDA 4D80A 2FKNA 3ICPA 1RXIA 4GOJA 3VR2A 4PLFA 1EUCB 4U2FA 5AXCA 4UEOA 2ZBGA 1R8SA 2O1SA 3ZE1B 3A6DA 4BP1A 3VYRB 1BXGB 1I94B 1KTVA 5AKYA 4HXEB 1Z5PA 3AF1A 2OLEA 1C9JA 1FYWA 2NO4A 1XMPA 2O6HA 2P62A 3LT5A 4XB2A 5T4BA 4DAOA 2H9IA 2DBZA 4WNYA 4II2A 2ZDHA 1OT5A 3MCWA 3HSYA 4NHEA 2PZEA 4MVJG 1D3AA 1HTBA 4Q16A 4Q1DA 2HJ9A 4OMUA 2VBCA 5GM1A 1ZN7A 1JR3E 1RXEA 3CURA 3KLBA 5FQNA 2FEXA 3ZWWA 2VC2B 4CMBA 1ZIDA 2AUMA 4MVJD 2NTEA 5HUHA 1WZIA 2P5SA 5TT0A 2P0AA 5JSQA 4LZLA 3G5UA 3RTAA 1A82A 1IXKA 2XQGA 4PZPA 3U44B 4LWOA 3U9LA 3ZE6A 4Q5IA 1P5JA 1XRMA 4IL5A 3K6RA 3QEAZ 1N8TA 3FTPA 2BOVA 4HQKA 4MA0A 4O63O 3Q9SA 1RJ9A 4Y2UA 5KCMA 2V7PA 2DUWA 3R24A 4M2LA 5E4TA 4G0PA 1J8FA 3UCFA 4WCFC 1TA9A 4ITUA 3OKFA 3NALA 4CEJB 3UK2A 4HDRB 4P5DA 1WW2A 1MX3A 3PEYA 3RANA 1FW6A 2FQXA 4MYDA 2A0UA 3N39C 1H69A 4DJTA 3UY4A 4HXGA 3PB3A 4A73A 4RYDA 4YXFA 2R7MA 3GLFB 2RI0A 1CYDA 1WX1A 3THOA 5DTRA 1WXXA 3FDJA 1FLNA 3LTEA 3PDIA 2WMYA 1C3XA 4C5CA 4EEKA 3EIXA 4FFDA 3AHEA 3NEJA 2CJFA 1FP4B 3CV3A 4UMDA 4OM7A 1T29A 1ULHA 3CLHA 3X1WA 1A88A 1TVKA 1A4UA 2ZWAA 4D9BA 1EK5A 4B4VA 3S81A 3JATA 4FINA 1HOXA 1UXKA 4EY8A 1W0KD 4OL0A 4M1WA 1FTSA 3GN2A 1GAJA 3VZCA 3F4KA 1B3BA 3SDBA 4BPBA 1S96A 4AUMA 3K92A 3SQOA 2AEJA 3O2JA 3UAGA 1OB5A 3ENKA 1OU0A 2XBUA 4RMNA 3TIFA 4UM5A 3VTAA 3W3AD 1Z56C 1NX6A 1D6NA 1P60A 2O3RA 1U2ZA 3OI7A 2ENUA 2X1LA 3HP4A 4WK6A 1VMEA 3K4HA 3PNOA 5M2QA 1QZTA 4G26A 4JYPA 1RM3A 3ZWYA 2WJPA 1H4SA 4TX1A 1T6YA 1GNLA 3BGOS 3HJUA 2GSDA 3FA2A 4P34A 4ZQCB 4C04A 1A8IA 1PQPA 3OM0A 3N8NA 5F9HA 3D7SA 1BRMA 5CTAA 4GX2A 1EEHA 2JGDA 1ZGGA 2WE8A 2XVXA 3R40A 2A9FA 4C21A 3UCXA 4KH0A 1I1QB 1FSSA 4EY3A 5I7EA 3SKYA 2QZ9A 3ABIA 3NP7A 2OGUA 4IMJB 3PZRA 5AR1A 1N9GB 1FFCA 1CG6A 1WAMA 3AXTA 1SBNE 3PXDA 2NSDA 3RR2A 2G1UA 1D07A 2Q3FA 7REQA 5IC5A 3P97A 1C7FA 1Y8ZA 1JSZA 2XE4A 4NJMA 4EEXA 4F06A 1FPQA 1M2VB 4DBLE 3KDSE 4BP3A 3ESYA 3CX7A 4LSWA 4KV7A 4R8KA 1Q7CA 1TYZA 3OF3A 4A5OA 3EUEA 4UU7A 2IL1A 3ADKA 3W79A 4XD7D 4B6RA 3F6SA 1AKEA 1O54A 5CM2Z 5SY9A 3WWEA 4IKOA 4ZVMA 4UBMA 3A9RA 2P2GA 3AR6A 4MZXA 1NBEA 2V7EA 5J40A 3TRDA 1D0IA 1IG3A 2XCTB 1Y9AA 5CVUA 4FGLA 2H2IA 2P30A 3IOYA 2OVBA 4EG8A 2X0JA 3KR1A 1E2PA 3KQKA 2XB2A 1ENYA 2FPLA 2RI6A 2ZP1A 3VTZA 4BB9A 3A9UA 1HV8A 4DV4B 3PFIA 2Q0XA 3LUJA 1OLXA 4L1KA 3USZA 3SSAA 1NNLA 3DTVA 3A6PC 3OY7A 1BQEA 3LS2A 4Q9IA 1HX7A 3ZNPA 1CQJB 1UDBA 4L8GA 3R7NA 4F97A 1MX1A 2ZJ5A 3IE2A 2D2EA 4DC9A 4KR2A 5F1OA 1Y9ZA 3ZK9A 2LGJA 1GAEO 2H11A 1MABB 3BE4A 3NBUA 1V8BA 2O20A 1U0GA 2G36A 3GGPA 5BRAA 1EXVA 4JUDX 4ALIA 3M83A 1KZ6A 1SVSA 2ZJ8A 3GGOA 3G2KA 4KGVA 5ICEA 3OC6A 4MRVA 1FRFS 2O05A 5HEKA 4BJ6A 1U4SA 1E1MA 1Z6AA 2EQAA 4QYIA 5G02A 3EUFA 1QYWA 3KJQA 4BXOA 4BWFB 4OP2A 2PAFA 3WMRA 2OZPA 4C2AA 1OV4A 1E3LA 3ANNA 4PZEA 5E1OA 3NIFB 1Y8RA 4LWPA 3EVBA 2C57A 1YI8A 5JRDS 2I6SA 3RYFB 2NU6A 1QV6A 2GCOA 4FFLA 2JA2A 3KT8A 1CJSA 5J4YA 4E94A 3LA6A 4Q7MB 4JSYA 3DKKA 2WUEA 3DCYA 4Q37A 3JQ8A 2V4ZA 1VE3A 3KYDB 2ODWA 5IJWA 5JJIA 1Y3FE 1JFTA 1WPQA 5D5PA 3ZY4A 2V5AA 3COZA 4HOYA 4JASB 4YCJA 3E2PA 5B4TA 1EPUA 2AH5A 4D8VA 5KYGA 3ZNQA 1U5CA 3I23A 4BFZA 4XVUA 3MS7A 1USKA 4FSXA 2AMVA 1H0KA 4QPJC 5CHYA 1AKMA 3ZE0B 1DFIA 3QOFA 4MV1A 3T34A 3VR4H 5HOEA 5CCXA 1NR5A 1WMBA 2D5AA 2WBLC 2XT6A 3NDPA 1VG0B 4HDMB 3HNPA 1R37A 4ZALA 2DECA 2VP6A 3FPCA 3GP5A 4WKOA 2QYOA 5GQSA 4XYLA 2ATXA 2H06A 3RJ5A 2ZS9A 2WR8A 2CCJA 4HMQA 1O94D 3QEJA 3FNGA 4AUKA 4KUGA 4DS3A 2VK4A 1S3GA 4FZVA 3DBLA 4MS3B 1E1KA 1LQ2A 1SOMA 2NO1A 3GGCA 4R83A 5JXHA 1OFIA 1WXFA 2NSLA 4B3HA 1B23P 4P4GA 4RY9A 2G5GX 3CYFA 4EY5A 1NP7A 1TZMA 2WFMA 3E2MA 2ZIVB 2WIBA 3TLXA 2QX7A 2YC2C 5C7LO 2G08A 1N2BA 1DLIA 4QXPA 2YWRA 3I2HA 1A4XA 2WC1A 3N1UA 4NJMB 4H6XA 2NQ2C 4K8RB 2J3DA 4NMHA 3TEJA 4M7WA 1ADJA 1J6UA 1L4EA 3D1VA 4IGEA 4LBWA 3LYUA 1I10A 2GCGA 3DXZA 3R0XA 4DR5B 1IUNA 3FSJX 5IKOA 1RMTA 2PSDA 5TJ9A 3RLFA 5ITZA 2MSKA 2Y99A 1O6FA 2E85A 3F74A 4GLJA 4YGXB 4ZGWA 3QA9A 4YV2A 2OLKA 2G63A 4CMIA 1K6JA 1MB0A 2VCYA 3EUAA 1BXRA 4B33A 4RNCA 1KFCB 4DPMA 5BNIA 5E0KB 2ANBA 1NN3A 4Z3DA 2K87A 3TOSA 1QUEA 2JJQA 2OWDA 3DL4A 4FDLA 3X1JA 1G1AA 5C1DA 5CDFE 2QQ5A 2VAMA 4ZVPA 2ZSFA 4HEQA 2UKDA 3WNQA 1R0LA 3IEPA 2ECQA 5ALOA 1SKQA 5CCBA 3EDYA 3L0YA 5GIPE 3CW2A 5AK0A 2XYQA 5EG5A 3HWWA 1BX0A 1ZZGA 4D6XA 3I45A 4IVNA 2CSUA 3FG9A 2JFXA 3KPUA 4WGGA 5T8KA 4KR9A 4MVJP 3VPAA 4GX0A 3KV1A 3EDMA 4BYMA 4EJSC 3NHMA 4TLMB 3STWA 4PLVA 2UVPA 4BLQA 4NU5A 4AP9A 1XE3A 2G5CA 5ALUA 1KY4A 2A5GA 3EZLA 5JFGA 1QS0B 3EWIA 4TV8F 4UHCA 2WB2A 2POQX 1ESCA 2PLWA 3H83A 1MT0A 1BXKA 4ZEVA 4MP3A 3DZHA 4U6SA 1N8NA 4D57A 1AMNA 3N5KA 4OQEA 4F5EA 3GJRA 3V7WA 3HYLA 2B20A 4NOLA 3EA4A 2XOKA 3JARA 1E8NA 2IXEA 4ZGBA 1E3TA 2JARA 5ITVA 1QO0D 2P65A 3WADA 3PXXA 5A1TA 1FQJA 3SCZA 1DWPA 3ZTWA 4ND3A 4ZCTA 4MPRA 2G1JA 3AR7A 3W2EA 4XWKA 1XZFA 3I5XA 1QJ4A 2QYSA 4EQZA 1K2VN 3D8BA 5B4UA 5JMTA 1UKEA 1XN4A 1M6VB 1DAGA 2WPNA 4II7A 4R3WA 5DFAA 4EFDA 3CF0A 2E89A 5MFZA 4MQBA 1KAEA 1IY2A 1RHRA 3A4NA 3WWPA 4M22A 1R64A 4UJ5A 4DQ0A 1Z62A 4S1WA 5JFTA 5K09A 1J33A 1G41A 2AN1A 2GDJA 5B1YA 1G4UR 4EKGA 2AOTA 1ETUA 1XRJA 4XGNA 3AL2A 1W5EA 4WCFA 1HE3A 4ZARA 4TSFA 3R3VA 1TO6A 5COAA 1KXZA 1VYTA 1DQSA 1ZCJA 1PHPA 1PR0A 1GADO 3BH7A 1DDOA 2JATA 4TMZA 5LP6A 3R9KA 1L8XA 4CM8B 4RACA 3ITEA 1RI3A 3SHQA 1GPKA 2AR7A 2V5VA 4AN4A 3GBPA 4A10A 3IAM6 1S7CA 1IK6A 1PFGA 1IIRA 4FCTA 2G9UA 4KODA 3REGA 3ZNOA 3I8SA 2GASA 4MQ4A 1ECLA 1WOMA 3R6GA 2PCLA 1WHTB 2X9QA 2UYCA 4C30A 2RGDA 2WM9B 4PU0A 2C5AA 5E7QA 5C7YA 2DPXA 2R751 4KPFC 4UNRA 1I3LA 3HYRA 5D7BA 1KSGA 4HNUA 2ECOA 5KJCA 3Q5GA 1XXLA 5FUBA 4DNFA 1NI4B 1M8FA 4F4JA 4Y9RA 1U9IA 1A97A 2Y1CA 3L4EA 2ZIXA 2FUNB 2XWBF 4MLZA 1SCKA 3EFBA 2EF0A 3BDAA 5LQDA 3DBVO 3UW3A 3NT4A 3U4CA 3TLZA 4MRSA 3ZLTA 4LOLA 3V1TC 4H0FA 5LMZA 4M0UA 1UXIA 4EHIA 2CWWA 4HEA1 4DA7A 2NO6A 2NVBA 3G7NA 4LVUA 1Z83A 4QA9A 5HE9A 3M6IA 4C1BA 2JIBA 3DB1A 3AT1A 4UNSA 4YREA 5C31A 2XF2A 5ALMA 4EB3A 4PRLA 5ED4A 1OAKA 1JFFB 3EG9A 3OPYB 2YV5A 1MABA 1P74A 2VYFA 1KP2A 3T9FA 3DV9A 3VUFA 4AG3A 2H65A 5KYUB 2NP6A 1B2RA 5GY7A 4B09A 4BWGA 3CMMA 1A9SA 1OHHD 1XMVA 3ZU2A 2BE7A 2V7QA 1KU0A 3RABA 4G4SO 2VAPA 3T7RA 2ONZA 3U9TA 1CUZA 5MF6A 3W05A 4WUTA 1E1QD 2WM8A 3T06B 1Q57A 2TMKA 2O8EA 4I4LA 2HXSA 3NT2A 3EGWA 4FOLA 2VDUE 5CIWA 3QYFA 1HE2A 3CFYA 4X93A 1AMUA 5CCDA 1PD0A 1DQPA 1DDIA 3B2NA 4H4DA 3ZGNA 5KMGB 1P19A 4Z9FA 2O0HA 2B3TA 3LDGA 5C1PA 4CYMA 1ZI6A 5FV4A 3AIOA 3QVUA 1NF9A 4PSDA 3U9SA 3ORHA 4KK4A 2P1RA 5JW6A 4OY3A 1FA9A 1DBRA 2HBQA 1M75A 3GGJA 3KQMA 1YB7A 2OECA 2V8OA 3GZNB 3ZLVA 4ACAA 3VU9B 1NX9A 3EA5A 1RHJA 5A2GA 1F48A 5D3ZA 3BXHA 2GZSA 3GD5A 5EHQA 2VJLA 5A0TA 5A0FA 3AHDA 5CM9C 4ZAVA 2IELA 3BMCB 1XU4A 3UC9A 1ZSYA 4RCYA 5A04A 2BGJA 3LWZA 4RF4A 5FOXA 821PA 4EHBA 1VE7A 5FR1A 1XZKA 1A50B 1C1DA 3VZDA 1Y7IA 1SD2A 3AXSA 3IQDB 5I7OA 1JEJA 3WDSA 1ABFA 1E32A 4GP7A 4G4SP 1ZUD1 2HC9A 2OV2A 1UM9B 1Y37A 3LXXA 4DM4A 1F2UB 2N1MA 3HCEA 3H9GA 3PDIB 4KC0A 3B3GA 4I4TB 1CRWG 3WSTA 2D2FA 5HFJA 5CYFA 1R12A 1MZPA 1KC1A 3S2ZA 1OGIA 2PUAA 5CNJA 4D9KA 5C35A 4IJQA 3K4QA 2ADFA 4P3PA 3QW4B 4ERXA 3ZQ4A 1RBQA 1K9SA 1W4ZA 4FNGA 3DLPX 3OSUA 4OK5A 3FXAA 2ZUSA 4O2AB 1NUAA 4N8SA 2VQFB 2ETXA 2C3PA 2VNJA 1J21A 2W0MA 3CZRA 4QOEA 4RE5A 4I5IA 1PGQA 1Z8NA 2JJ1A 4BDSA 4ED9A 4IAOA 3I83A 3S1AB 1UP7A 2BTEA 1GQ2A 4EYOA 2WSMA 1IAVA 1Q1GA 4Q47A 2OYSA 1TK3A 3U3MA 3UANA 1AGNA 2AE2A 5KYVA 4PPYA 2HAEA 1A5AB 2AE1A 2WZBA 1WKCA 2JBAB 1KSHA 4LDZA 4GKJB 3KALA 1WULS 2FV8A 1LJLA 5KYXA 4LBVA 4P36A 3WYFA 4UAVA 5K8CA 2PL3A 4BLVA 2OZVA 1SUEA 4N9QA 1H3FA 1KY2A 2WU0A 3NMUF 1MEJA 1WD7A 1QP4A 3DEKA 3VHLB 3WQQA 4CMIB 2ZI4A 3KSAC 3KOMA 2QJOA 1ZGJA 2MSNA 1U2DA 2W11A 4F72A 3MWFA 3CVXA 5AUNB 3OM8A 5FBQB 1L5ZA 2ZI6A 2K7FA 2IS6A 4ZDKA 3LCUA 4L57A 2FPOA 2XBMA 3UUGA 3KJNA 4XGQA 1OZAA 1JDPA 4KDCA 4RH3A 2O8NA 5CA1B 4RTSA 1I01A 1DQYA 1K4KA 1OAOA 2CFTA 3FNIA 2H7CA 3R3ZA 1N2XA 4RX1A 4RESA 1LC3A 2BBSA 3RVKA 2Q3EA 2R5NA 2VF4X 2ZQ5A 2ODQA 3MAGA 4ND5A 4J0QA 4WMLA 1K2WA 3RYIA 5BW5A 1MAVA 1DV2A 1OX5A 3OTIA 4B40A 1ZCFA 1LDYA 4CKEA 1ESNA 1I4TD 1M6NA 5L7YA 3IQWA 4KPUA 1EMDA 5HKKA 1U4NA 2UYOA 4IDPA 1X6VA 1KO8A 3OQIA 1JX6A 5DSTA 1HOTA 3R6WA 1HDCA 1XNJA 1NUPA 1ZD3A 2ZK7A 3K6KA 1XKLA 4NICA 5ICFA 3TM4A 4ARZB 3A0UA 4LVNA 3T4PA 1FOEB 1XWWA 3IEIA 3PDJA 2SECE 3H2KA 1VGQA 3KU1A 3IB3A 4NS4A 3G9TA 1WNFA 5K99A 4EJMA 2JASA 1P3DA 2FA9A 4KWHA 4IQGA 3U17A 2ZXFA 1RWBA 3UFXB 1CQJA 1VCIA 1TKCA 3ACBA 1SKYE 4P7GA 2QLNA 1NBOA 3PD1A 4LZOA 4UEQA 1K75A 5BSHA 1FP2A 2QSZA 4DUPA 2A14A 4GZLA 1TD1A 1O5IA 2D5IA 4G56A 4Z54A 1RXVA 5FTWA 1QZXA 3R5TA 4V2IA 4X95A 3VOSA 3P7MA 4Y6OA 2JIMA 5KC9A 4A8TA 3THSA 5FNVB 3M6FA 4L95C 1VYHA 1ULTA 4FDTA 3C85A 4TXNA 2FLWA 3CBQA 4IR7A 4JZYA 5B5SA 5AVVA 4NBVA 4U0KA 1EWKA 4J8PA 3TX6A 2BYTA 3GJ5A 4U8HA 3QFCA 5KQRA 3UG7A 1WL8A 1ECFA 3M2PA 4JODA 4MW0A 1CERA 2Q1WA 1EK0A 2NGRA 3GT7A 1QVZA 3WC4A 5C1IA 1VIAA 1VPEA 3NHBA 1JKIA 3G0GA 4GNKA 3OU2A 4QRDA 2ERYA 1UBHS 1Z4MA 2EW2A 2QPOA 1DCMA 1M10A 2J4FA 2OGSA 1VCHA 3AKYA 3JPYA 3OZVA 1RWVA 3QIVA 4LRSB 4MH0R 4Q0MA 1NE2A 5JD3A 1UJ5A 4A2PA 3SS8A 5I9IA 3L84A 3U19A 4C7KA 2O2SA 2E4ZA 2XWJI 3ECAA 2PYIA 2IDKA 3KDAA 1IMJA 2IXDA 2HWYA 4K6FA 4D4KA 2ZIUB 2W2KB 3N86A 4YAJA 3I5YA 3N58A 2EF1A 4LS3A 3P2OA 5JWHA 3V97A 5KPDA 1G2OA 3CG0A 3FRJA 1D09A 2BFCB 3G1TA 4IVRA 1Z22A 5K3AA 4EKYA 3AU8A 1HEIA 3DEJA 4L02A 1X42A 4Z4GA 2JIZD 7MHTA 1T2UA 1C2TA 4J0CA 1ISGA 3B13B 4J7XA 3FYTA 4ALMA 1GNVA 1G8KA 2GPJA 3RTGA 4HB2A 1UWVA 4FHCA 1FFYA 1GUZA 3I3OA 1VTKA 2J0UB 4Z6KA 3ZGYA 1BD4A 1PJ4A 3DQPA 3ZV6A 3ILVA 3WIVA 4BUZA 2IUEA 4HSEA 3RG2A 1Y7LA 2PX2A 4MWGA 3V1YA 3R8XA 3SEFA 1E2DA 3R23A 4OMFG 3DDZX 4A0SA 1DC3A 2QP4A 3X2SA 3T7CA 1KYXA 5F7JA 2KI5A 2I54A 3JQFA 4D8UA 1NV8A 1PW5A 5KU1A 2C83A 2B94A 5L3SB 5KQSA 3NBAA 3P5BA 3NC0C 3I0MA 1UOOA 3ED5A 1SBHA 3NEPX 5D00A 5DZSA 2QXYA 3UQYS 1KQPA 2OM6A 5A03A 2RKOA 3A58B 1LX7A 4G4GA 3K1AA 2F3TA 4DLUA 4X64B 1B4DA 5HJ2A 1GNPA 5CDFA 1DZ3A 3IKVA 1JG4A 3MM4A 3AVUA 1GR0A 2R7NA 2WA2A 4HWOA 3VR3A 5LXTB 5I7WA 3KKLA 3QHPA 5BN4B 3HB5X 3L04A 5KSPA 2ZYRA 4DWJA 4BQSA 2WT4A 3TI9A 1ACJA 3IUYA 4IMPA 4BZPA 5K5EA 1GGMA 4PYKA 4GX1A 4KPUB 2DM6A 3KT0A 1Z6TA 2OD7A 1V3VA 1I1OA 4IDBA 3KT6A 4ZDIA 2WSSA 1Y48E 3ZCUA 4ETWA 4Y2HA 2AC2A 3OCYA 4M1YA 4RK0A 3KPJA 4CI0B 5AVQA 2BKEA 2XQVA 3PJGA 2RGGA 3F2VA 1C14A 3IPAA 2CFSA 2PH1A 1SPBS 2Y76A 3B6JA 3ETLA 4RJTA 2KWIA 4DR7B 4B3RB 2X1VA 1ZJ5A 4LHZA 5JCPA 2Q0HA 4U63A 4K9RA 2HHJA 1XMQB 1HE8B 1YULA 5M34A 5KTYA 4MKFA 3A6KA 3KS9A 2BP7A 2RGRA 2XZLA 1KOLA 3W1EA 221PA 3M6VA 1E5TA 5J5AA 3WBJA 5JJLA 1ZW6A 4WZAB 3UJ9A 3W9UA 1T9AA 1P1CA 3GBSA 5ALRA 4YJ2B 1PJZA 1P2BA 1WQ3A 4Y0AA 4CWAA 2PBRA 2C3YA 2I9KA 3KKEA 4MP6A 1N6KA 2VUUA 4F9FA 3S2FA 3F5SA 3ILXA 3PNYA 1HNXB 1DPGA 1F0NA 1JKJB 1M2HA 2JH9A 4GLOA 4LTDA 4MWSA 2ZUEA 3MOSA 3PQFA 2FOLA 4RO0A 1P2SA 1G2QA 1MAHA 1PWEA 3MN1A 4OMDA 5F64A 3ZQKA 5SZJA 3ZX5A 2QN1A 1YWGO 3LSTA 1RW4A 4PRZA 3A25A 2D3WA 3QPDA 3C3KA 3ZEIA 4DXAA 4AI6A 5C51B 4O2AA 4KYTA 3DULA 3MRXA 4HZIA 3GFPA 3TLGA 1E0SA 4R2KA 3IKLA 3ZEAA 3GQBB 4C20A 1D7OA 1KF0A 3CGWA 4MWEA 4B43A 1BVYF 3TXAA 3I2KA 4B3SB 5GWXA 3VVBA 3E5MA 4M9UA 1VI6A 1UPFA 1F9AA 3I9MA 5CT9A 4GL4A 1MC8A 1U2RA 1BXZA 1XYYA 3C74A 1R00A 3FUUA 2GJ4A 3FUTA 2R8RA 4GPEA 5K8LA 4NU8X 4XWWA 5KHOC 4C0BA 1JEYB 1XLTA 5LYYA 2P9EA 4I8DA 1WRBA 5FOVA 3ZHUA 3JASA 3RVSA 4YP6A 3W8RA 2XTZA 1B3RA 3VYWA 1DI0A 3G79A 3KG2A 3T61A 1XD8A 1YBHA 4O1HA 4OG2A 3MT7A 2ZYAA 4E5KA 2G1AA 1GG8A 3L0DA 3RSCA 4RKQA 2EEPA 3FKQA 3GEEA 5DBEX 3OETA 1CW2B 1GAQA 1T5HX 1Z74A 3QSGA 4JXXA 1U99A 3QLJA 4K9DA 2R4UA 4PG4A 1MO4A 4OLBA 2O3UA 4A0FA 2BZSA 2CMFA 3L1HA 3HQ4O 3TW8A 1O0SA 2QN8A 2YQZA 4IJ5A 4UDOA 2ZRFA 4IRUB 1AKWA 2VXOA 1YZNA 2RHLA 1DARA 3PA8A 1ZJWA 2E6KA 2YHBA 3IX7A 4PZDA 3R74A 1QKJA 2GPSA 3UJ3X 1DX9A 4AB1A 4ZEXA 4MR7B 1ZHFA 1DRKA 4Z4EA 4A4DA 4V02A 2WWRA 1L5HA 4L7QA 4NAUA 5LBIA 4FYXA 3UMBA 4YUZA 2LD4A 4IG9A 1Z47A 2A3RA 5BT9A 1I1NA 1QE3A 5G53C 3BK1A 1F3LA 4OQDA 1I0IA 3K35A 4W8OA 2VP9A 1W59A 2RHRA 3KU4A 5CNMA 2NUTA 1HWYA 3N8HA 1BU8A 2X9VA 2GK3A 3K0FB 4RV9A 1O87A 4BNHA 1TCAA 4H18A 4KBYA 1K66A 2I3GA 1ODJA 3EGXA 4XIJA 4F5ZA 1UKVY 1PE0A 5LUBA 1MAWA 3AESB 4LBZA 2V6BA 3CPSA 4POAA 1XZJA 5DK6A 5JJCA 2QVGA 4XQEA 4L8LA 5KKAA 1X13A 2ZOSA 1OXBB 2C7QA 1ZM4A 4ZRNA 5H70A 5J1TB 4Z7JA 3DB2A 3H1EA 1RVV1 3Q5DA 4GI2A 4W1SA 4B3TB 4NQZA 1QHIA 3OZ7A 4R2HA 1OZHA 2IA5A 3BKXA 2BEVB 4FHGA 2H4ZA 3PGJA 4JHXA 5ESRA 4UUMA 2QZSA 1SBIA 1EBBA 3OC0A 4X41A 4UUQA 5DF1A 4DLKA 1OTYA 3Q7SA 3QPWA 5DSXA 4LY3A 2QUHA 4N6OA 4BKMA 4Q3KA 1YDGA 2FJ0A 2V6JA 3BAZA 4TM8A 3HJRA 1N57A 3KD3A 1QDLB 4FR5A 3ICOA 1Y5RA 4WZAE 2EWMA 3LFUA 1GRQA 3IDOA 5AOAA 4DZTA 5HP4A 5JPCA 1Z7BA 4OUDB 1P0MA 2CYCA 5FXMA 3IT3A 2JAQA 4U2CA 1SO8A 4MW5A 1D0SA 5JCOA 4DA8A 4Y1GA 4K0KB 2JEZA 4W9MC 1SIBE 4ARUA 1UK7A 3M6XA 4V0QA 8GPBA 3OF2A 4TTTS 4Y2QA 1H0HA 2XB8A 4ZOLB 1LDEA 2FG5A 1EX7A 1QH1B 1L7EA 2GJKA 2YS6A 1OBHA 4ICIA 4ZYXA 2EKLA 2QG4A 1W5TA 3ZPXA 1NNUA 5ALDA 1I80A 1PGOA 3U3RA 3EXFA 1AKRA 2VPZA 4Q7QA 4Z49A 4K2AA 1JVBA 1UUFA 2WKWA 2FQQA 1L5OA 4NCJA 2F3SA 1OJ7A 1P8JA 5ETJA 3PEVA 2PEZA 2OMKA 5KTOA 3GJ6A 4D4GA 1KZ1A 4HG2A 1RQXA 2WTBA 1L2TA 1X0VA 2PD4A 2TECE 3OQBA 4OI4A 4EG5A 3EG9B 3U44A 1ZNXA 3C4JA 1T6BY 3PVZA 2H07A 2QS9A 2PRIA 3O4JA 3DE5X 1ONPA 4N76A 4CEIB 5IZCA 1HFKA 3SHFA 1E9CA 4X1YA 5I4IA 4UNQA 3TUJC 2NNWB 3NW9A 2R87A 5LFAA 3LUFA 1OIWA 4BQRA 1HDEA 1LS1A 1M9NA 2ODTX 3WMGA 4XJXA 3G0CA 1A5SB 3UMMA 5KOHB 1KI1A 2PGAA 2Q0SA 3I73A 4NARA 5GM2A 3UJHA 3QU5A 3VSEA 2G0TA 1SC9A 2FPUA 4YRQA 4K26A 3I6QA 3AB7A 5H02A 3VPHA 4PEVA 4AXBA 5DM4A 4D8TA 2CF5A 5JS2A 4KOAA 4I5EA 2TS1A 1R8QA 1EVKA 4FQ8A 3LZDA 4EUHA 1N2SA 2CB0A 2DH5A 3V2GA 2VF5X 3UJNA 4WK4B 2CVOA