2YV1A

Crystal structure of succinyl-coa synthetase alpha chain from methanocaldococcus jannaschii dsm 2661
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
287
structure length
268
Chain Sequence
MILLDENTKAIVQGITGRQGSFHTKKMLECGTKIVGGVTPGKGGQNVHGVPVFDTVKEAVKETDANASVIFVPAPFAKDAVFEAIDAGIELIVVITEHIPVHDTMEFVNYAEDVGVKIIGPNTPGIASPKVGKLGIIPMEVLKEGSVGMVSRSGTLTYEIAHQIKKAGFGVSTCVGIGGDPIVGLRYKEVLDLFEKDDETEAIVMIGEIGGGAEEEAAKFIEKMKKPVIGYIAGQGTAESKMKALEEAGAYVAKNISDIPKLLAGILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
publication title Crystal Structure of Succinyl-CoA Synthetase Alpha Chain from Methanocaldococcus jannaschii DSM 2661
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ligase
total genus 91
structure length 268
sequence length 287
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2yv1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yv1A01
1Z82A 2AHRA 3E9QA 4ZRMA 5BSHA 3AOGA 1R4NA 1XEAA 2LDXA 4O63O 4R54A 2NQTA 2V6GA 4ILKA 2GN6A 1P0FA 4CM8B 4Q3EA 4AJOA 4J7XA 3TOZA 1T2EA 1ZW1A 3WGIA 2JCXA 4PRLA 3FR7A 2JHGA 1DJQA 2X22A 3H9JA 5B4VA 2GUGA 3BIOA 3MJVA 4BO7A 2RH8A 1QYVA 2O3UA 2NLOA 4GVXA 5CDGA 4CMCA 2BGKA 2W2LD 1ORRA 4M54A 2VCYA 4E5MA 3K31A 4E5KA 1I3NA 3ZV3A 3DTYA 1QKIA 3A9WA 4P38A 4IJUA 3ZNQA 1RWBA 2BFMA 2YQ5A 1E3WA 4XA8A 1LC0A 1Y9AA 5EERA 3DONA 4CM3A 9LDBA 3HUDA 4NBUA 4OKIA 1UZLA 3I5MA 1ONNA 2EEZA 2VN8A 3ASVA 4TQGA 2D5AA 1ZK0A 4F46A 2NUAB 2P9GA 5IF3A 4H15A 4MPDA 4DGSA 1ZEMA 1YOVB 2IRWA 3W4IA 3AY7A 1R0SA 3DQPA 3ENKA 3K73O 3QVOA 3WGQA 3WXBA 2BGLA 4FC6A 4B4OA 1L1FA 4LK3A 4UVHA 1ISMA 4J90A 2UUPA 1NHGA 1AE1A 3I9MA 4J16A 2Q4EA 1F0YA 4G65A 4RZIA 2P5YA 5C37A 4TSKA 3MEQA 2PV7A 3UF0A 3OF2A 4J0FA 2NADA 5BSFA 1PGOA 4WLOA 3OFSA 4I5EA 4MVJM 1DEHA 2I5PO 3IIEA 2ZATA 1IYZA 1BVUA 3ZV4A 3ZV6A 4B4WA 2J6IA 4AJKA 1YQXA 2VWQA 1RM3A 3QSGA 5EJ2A 3G0OA 3G17A 1VL0A 2G0TA 3C3XA 2FY8A 2O48X 3H2SA 4K26A 4Q3DA 3NDIA 4M8SA 4U6SA 2VTDA 2WE8A 3QQPA 4LCJA 3QJ5A 4QFDA 2DTDA 3L4SO 3JYOA 4RV9A 3A1NA 4XR4A 2UUOA 3HB5X 4R1UA 4E6PA 5EPOA 2GZ2A 5DCUA 2C59A 5I8ZA 3DO5A 1NASA 2TMGA 3GH3A 3PWZA 4L0QA 1B0AA 1DRVA 4YT4A 3QWFA 4P4GA 3C7AA 3SEFA 3HE3A 4FIZA 3PLNA 3ZH2A 4QEDA 2X0JA 4AJPA 4KP7A 3DAGA 3DTTA 3FI9A 1X0XA 2UYYA 3ONFA 2OP1A 1IHYA 5AVOA 4CLOA 4QT0A 1U5AA 1MC5A 3D64A 4ONEA 1HETA 1IE3A 1ZK3A 1E1NA 3DFZA 2VUTA 4BNXA 2NU9B 4FBGA 1XQ6A 2C7VA 4XDZA 1PEDA 1X1EA 4BNFA 2PNFA 4FS3A 1I3MA 1RM0A 4LRTB 1X0VA 3LF2A 3RKRA 2NVWA 2IYOA 5L95A 4CLDA 3HDYA 1GU7A 1MXFA 4IIVA 4CMEC 4E2YA 3GC6A 3BMOA 5AYVA 3H4VA 2D8AA 4QTZA 4KWHA 1YB5A 4NFYA 2PH3A 2VOJA 4J2OA 1RJWA 2PA3A 2QRKA 3GVXA 4L8VA 1ZKMA 1U28A 3M1AA 2RHCA 4WJZA 3IAHA 3LC7O 4RQTA 1VL6A 1WXDA 3C7CB 4HXYA 3FD8A 1WLYA 5EQDA 1PX0A 2FWMX 1UXKA 1GDHA 2D0IA 2Q50A 4R1SA 2AG5A 4URFA 4HFRA 1PSDA 5JYEA 1D1SA 2A92A 1S7CA 3DAPA 2PZJA 3CZMA 3UAGA 3PYMA 4IQGA 2BMAA 4PG6A 1KERA 4DBVO 2EERA 2Q45A 2PFGA 4BGUA 2J5KA 4PN3A 3EAGA 1VSUA 1X13A 3O38A 4BIIA 2YJZA 3V2HA 2W2KB 1TT5B 1MUUA 1RPNA 4KUHA 1FXSA 2FPGA 5BT9A 4TVOA 3FCOA 4YAEA 5A06A 3F4LA 3TZKA 3ZW9A 1V3TA 4J1QA 4PG7A 3K6JA 2J3JA 5GZ6A 2GERA 1A9ZA 3GK3A 3UH1A 1IULA 3RC2A 4NIMA 4TRRA 3PQFA 5A05A 1O89A 1UXGA 1P1KA 5G0TA 4WOKA 1SCUB 2H6EA 3F4BA 1MFZA 3KSUA 2PH5A 3OP4A 3KRTA 4Y6RA 5COQA 4AJJA 5JBIA 2X8LA 1WVGA 2CVQA 3RUDA 1CYDA 3GVCA 4JK3A 4CM6A 1GV1A 2Q46A 4KDFA 4P4NA 4C4OA 2E82A 3WGGA 1E3LA 2R6JA 3W8DA 4UVIA 2O50A 1FDVA 4TMFA 1YWGO 1JQBA 4Y98A 3PDUA 4ZICA 1CQIA 4XJSA 4BQPA 2W2LA 1GAEO 4ZQEA 3DWFA 1BG6A 3K8ZA 3R3JA 4UEKA 4BO9A 4MIYA 2VZ0A 3OJLA 4LVUA 3DZKA 2OBYA 1YONA 4TKMA 1E5LA 1H9AA 4BNLA 5KJ1A 3UFXB 2BD0A 1MG5A 3R3SA 4O0LA 1JAYA 3NGLA 4WCFB 4YRBA 4ZGWA 1TI7A 3UKOA 5A9RA 1HEUA 1GCUA 1UZNA 3G3EA 3PVZA 5CHEA 1JU9A 1E6WA 2VWPA 3H9EO 3BMCB 4ZU3A 1OAAA 3FSRA 1VLLA 5L7WA 3GN1A 2Y0EA 2Q99A 5HS6A 1DXYA 1GYPA 3UCFA 4DPLA 3TFOA 4IJKA 4U8GA 1LDYA 2AE2A 2H5LA 4CQMB 2NU7B 4PLVA 4CUZA 1JVBA 4XGIA 1DAOA 1M2WA 2FZWA 3RFVA 4KTTE 4Y8VA 1CWUA 4BKUA 4YJHA 4CMJA 1YS4A 3EYWA 3F3SA 1ONOA 3DMTA 3QLJA 5A1TA 1KVRA 1C0LA 1PGQA 2O4UX 5L4SA 3O26A 4CL3A 5TSDA 5LC1A 1XKQA 1HSZA 4A10A 1GYQA 3RJ9A 1E5QA 1ISGA 2RIRA 4DIOA 2Z1NA 3HFGA 3GDGA 1A27A 3I9KA 4JCOA 2VWHA 2QX7A 2UDPA 2PKQP 4AJEA 1OMOA 3FPLA 3MWDA 5DNAA 3WGYA 3L4BC 2CSUA 4YQZA 3G49A 4XQEA 3WFIA 3RFXA 3WOHA 1H5QA 2DTXA 5THKA 4QXMA 1EUCB 5ER9A 3V1YA 1HYGA 1N7HA 5ICSA 5MGBA 3O03A 4B8WA 3QVXA 4LRSB 3RQSA 1Z7BA 2EKPA 1A4IA 5CDYA 5B37A 1X7DA 2DQ4A 3WR5A 4RPGA 3M6IA 1X1TA 4IS3A 2VZ9A 5HBRA 5DF1A 5JW6A 1KEVA 3BAZA 3IKVA 3QHAA 1IL0A 3OH8A 5JCJD 4PG4A 3WNVA 3E82A 4C7JA 3JYLA 2Y1GA 4GGPA 3I9OA 4BKPA 2DUWA 5CEJA 1VJ1A 5KJ6A 1E6EA 4Y9DA 4D45A 2XOXA 1SMKA 2IDZA 1E7MA 4DBZA 3PYLA 3MZ0A 3H8VA 4YT5A 2J5RA 1A4UA 2AEMA 2BI7A 4L73A 3JQAD 3P7MA 4YEDA 4JJIA 4BNHA 3OHSX 4CV3A 4WNCA 4YWJA 3VDRA 5BR7A 4NJMB 1BDBA 1TB4A 4Z9XA 1DIAA 2CNBA 4LSWA 2DBQA 1N92A 4UULA 3S2IA 1B3BA 4D0RA 4OAQA 3GVPA 1J4AA 3ENNA 1Q2XA 3CH6A 3D5TA 4GI2A 4RF5A 4XDYA 4ROSA 4YCAA 4D41A 3I1JA 5CAEA 4L75A 4FJ0A 4Q39A 1MV8A 3GMDA 2LDBA 1VL8A 1O94A 3NTQA 1O8CA 5KVSA 4BNJA 3VPHA 2WE7A 2GASA 2VUUA 4RORA 4OL9A 3ULKA 4EEXA 3ZI0A 4DL9A 1RYDA 1JWAB 4NH4A 2VT2A 4N5NA 1B14A 3LT1A 2AEJA 4NDNE 5U9CA 1I36A 1XIVA 1DIHA 2RCYA 3ANNA 4BUCA 2FPPB 1VE9A 2W8ZA 2B35A 1KEPA 2PR2A 5KWEA 3Q9NA 3E18A 3ZWWA 5A9TA 3RASA 4UREA 4A03A 3EK2A 1GUYA 5F21A 1P44A 3COSA 4GSLA 4JQCA 4W7HA 3WYBA 2SCUB 4HP8A 4NFHA 1IHXA 8LDHA 4L4RA 1LXCA 3S2GA 1EUDB 3ZW8A 1GEEA 3JQCA 3AM3A 1HE4A 5H82A 3IUPA 1HXHA 4CMIA 3ZU4A 3RU7A 1BWSA 4F45A 2B4QA 3DOCA 4XQ9A 4EI2A 3H6KA 3WMWA 1XWFA 1T2FA 3ADPA 4W6ZA 1W0CA 3OJOA 1NPTO 4BNKA 5ES3A 4N5LA 4BKQA 1KEWA 1DIGA 4KOAA 1H93A 1Y8RB 3GEGA 3PK0A 3X2EA 4BO1A 3JYNA 1XG5A 1PL8A 4CLRA 2BRUA 4FPXA 4QQRA 4JROA 4XWYA 3TL2A 5HRUA 2ZB4A 4WOJA 4WUVA 3ZDFA 4CQLA 3DDNA 4MINA 4HY3A 1XGKA 1NHWA 1P9LA 4OHUA 4PLTA 6ADHA 1HYEA 3UN1A 3HWRA 3JQ9C 4JBGA 3VTZA 5IZCA 1XSEA 1P77A 3VDQA 1U3VA 4NBRA 1H6CA 4RPLA 3JV7A 3EGOA 4B7XA 1K5HA 1DC3A 4CM5A 1K2WA 3WIEA 2XXBA 5HS4A 2DPHA 5KJFA 1I33A 2OBNA 3D3WA 2C0CA 3F47A 1C1DA 5DDIP 3WYEA 5IDQA 1V3VA 2GRAA 4J4BA 5GY7A 1U8FO 2GF2A 4CUJA 2IXAA 1KVTA 4CLHA 2Q49A 2ZQZA 4GQAA 1YO6A 3NGXA 3JQ8B 2DFVA 3O8QA 3TZCA 2QG4A 4ESOA 2JJYA 4P4LA 2VNSA 4CL8A 4B3IA 3GZNB 4CM8A 4Q9NA 5KCZA 1PL6A 3LZ6A 4BNIA 3QVSA 1X7GA 4E32A 1D8AA 4BGEA 2IODA 4E30A 1E3JA 2G82A 2CVZA 2O7SA 4CM7A 4RQUA 4I5DA 1GPDG 1W6UA 4H16A 1R0KA 3H5RA 3TRIA 1C1XB 3DHEA 4IJWA 1E6UA 4FGSA 4FJ1A 1VC2A 2C07A 3PFFA 1ZSVA 1HL3A 3F1KA 4R9RA 6LDHA 5K0ZA 5BQFA 1JLLB 3SJ7A 3VOSA 3D4OA 4EYEA 1YDEA 3GNQA 4IDDA 4UUMA 4EEZA 1E7YA 1GUFA 4O5OA 2CDBA 4WCDA 4BO3A 4CMHA 4CR7A 2AQIA 2Q1WA 3JQGB 2ZCUA 5A4DA 1P33A 2EGHA 3PHJA 3KYCB 2NUAA 3NAQA 4MKXA 1PZHA 4YJGB 3ZV5A 1MP0A 1YOVA 1K6IA 4BQRA 2AA3A 2GSDA 1SOVA 2E4AA 1U9JA 4OQYA 3WSWA 1QYWA 1HDGO 1IOLA 3PIIA 1NX6A 4DWVA 4CQMD 1YKFA 3DBRB 1PZFA 4EGFA 3NX4A 3QVTA 3VPGA 1LQUA 5IFLA 5DCWA 2BELA 4IGEA 3GNSA 1K6JA 2PGLA 2WYUA 1GFSA 2ZIZA 3F5SA 1LUAA 4RF2A 4XQGA 1UP4A 4DPKA 1BTOA 1XU9A 4QECA 1EDZA 1EUZA 1KOLA 5JE8A 2ZTLA 4WEQA 4DLAA 1KYQA 2G5CA 2D5CA 1WDLA 3QA9A 4AG3A 4CMGA 3VVCA 1SNYA 3S1LA 1T26A 4CR8A 4Z3KA 1GV0A 2XPCA 4CV0A 5CEEA 2QHXA 3ROKA 3TL3A 3QRWA 4MVJI 3ETGA 3NV9A 4OXNA 4LW8A 3HG7A 4XYBA 5JLAA 5CPBA 3K96A 2Z5LA 5IAAA 4EJMA 4PZDA 1YXMA 1HYHA 2HMTA 1EFKA 4P8RA 3V1TC 1H2BA 2P4HX 3DBLB 3DFUA 4FC7A 3W8EA 3C8MA 3QVWA 4BHTA 1B8UA 2Y66A 3HN2A 2VHYA 2Q1SA 4J3FA 4DLLA 2I65A 4KZPA 4Z0HO 3BMNB 3KZVA 4KTVE 4E2ZA 2GCGA 2ZJ1A 4EUHA 1DPGA 1CDOA 1WPQA 3MJTA 4YJFA 3C1TA 2NU9A 3TFQA 1YBAA 3F46A 3WGOA 4ND2A 2G76A 1NAHA 2OL4A 3I4CA 4EITA 2VHWA 1J6UA 2H9IA 3D4NA 3H7AA 1P74A 1R16A 4II3A 3E03A 2A94A 1VKOA 1UH5A 3RUIA 1P31A 3X2FA 3N7UA 1M76A 1E77A 4J0EA 1XR3A 2B36A 3RUEA 3PJEA 3BZUA 1T2AA 4J1TA 3GDOA 4FQ8A 4GL4A 3RUAA 4NHEA 2GN8A 4RLSA 2NVUB 2RAFA 4J9VA 1GD1O 2V6BA 2UAGA 1WWKA 4OM8A 4BOYA 1KY5A 4AL4A 3GRKA 3BXXA 4XKJA 5I7SA 3RSHA 3L6DA 1SEPA 2HAEA 3UXYA 1N2SA 1T2CA 4FFRA 3LDHA 4J43A 3JD1A 2A9FA 4PCVA 2OFPA 3IOYA 4WLEA 5HA5A 4AJ2A 4W82A 4J9UE 3DZFA 1A72A 1TT5A 2W2KA 5EINA 1SB9A 3OSUA 5COBA 3WBBA 1I32A 2G17A 7MDHA 1QMGA 4CM9A 1W73A 1PJ2A 2Y05A 4WGGA 1QYCA 4Z0TA 2B69A 4CODB 4GX0A 1Z73A 3P5SA 5DOZA 5F5LA 3ZWYA 5T67A 1D4FA 4BGVA 3TF5A 1H2HA 4ALJA 4GVLA 3CKYA 1ZFNA 5JAQA 4PLWA 2JCVA 3GEMA 4B4UA 2YYYA 1ZXLA 1JA9A 1K3TA 1SCUA 3ITKA 5T5QA 2X5OA 4J7CA 3HHPA 4NZ9A 3K5PA 2A35A 4RPHA 4DC1A 3D1LA 1MG0A 5B12A 1VPDA 1E7QA 1EVJA 5DT9A 1DC4A 1ZSNA 2D2IA 5TT1A 1ENOA 1GR0A 3L07A 3Q2IA 4ZHSA 3JQ7B 3LT0A 1UP6A 2G1UA 1ID1A 2CF5A 5F5NA 1MXHA 4K6FA 1PJLA 4BB5A 5C7OO 4LMPA 2RHRA 4IDAA 5B4UA 4WE3A 1EEHA 3W8FA 5I7EA 3UFXA 2ZTVA 2NSDA 2AEFA 1AGNA 5CP8A 2IZ0A 2OO5A 3B20A 1T1SA 2DUUA 3T7CA 5FFFA 4JJFA 3FNGA 3K9QO 4E3ZA 3AWDA 2P5UA 2VOEA 3ZWCA 4LCEA 5EESA 3BMCA 1H9BA 4A0SA 1PR3A 4BNZA 1EVIA 2V65A 1ENYA 4ZQBA 3UHAA 3ZZNA 1ZMOA 4OXKA 3EY4A 4CQMA 2NU7A 2JHFA 3I4FA 4DIBA 3UW3A 3AFMA 4GMFA 3BTOA 2FR8A 4J2HA 3I23A 1Y6JA 1PJQA 4AJIA 3JD4A 3WQRA 3M2PA 3QWIA 3GG2A 2NV6A 4R51A 4I5GA 4R5MA 3KYBA 1GZ6A 4OXYA 3PGXA 4JXKA 1DJNA 1CQJB 1Q7CA 3FRJA 1J5PA 3LLSA 4J1NA 4RGBA 5T64A 3JD3A 4EUEA 3C24A 3U4DA 4CV2A 4FN4A 1Z74A 3OJ0A 2QRLA 4YRAA 1KIFA 1YB1A 5EMHA 2R00A 4YAKA 4W4TA 1ISIA 5JC1A 1EUCA 3PHHA 1B16A 4WNIA 3RROA 2JFGA 4YPOA 5G0VA 1M75A 2OGUA 4BNWA 4DA9A 1KVUA 2WWRA 5L45A 4KWIA 4M89A 3DEYX 3GGPA 2HRZA 2O3RA 2YDYA 1I0ZA 3CMMA 2PD4A 8ADHA 3ROMA 1N1GA 4A5OA 1U2DA 4CPDA 3VZPA 4K6CA 5G2OA 1QSGA 3RBXA 1DAPA 1MGOA 4AJHA 4M87A 4NG5A 5A3VA 4F6LA 2CZCA 4XD2A 2PKRA 1NPYA 2CFCA 4FFLA 3TN7A 5A04A 4NJMA 1A9YA 2Q4BA 4DQVA 4HWKA 2P9EA 3KLPX 1NM5A 1PJ3A 3OA2A 4BO5A 1FJHA 2EP7A 4IZIA 4YA6A 3ROQA 3ICCA 4FDAA 4BKRA 4BO6A 4RPKA 1F12A 4IDCA 3WWYA 1V3UA 3W4JA 1JN0A 1QR6A 3EZLA 2FN7A 3NDRA 4JLWA 1PJTA 4RDIA 4ALMA 4DC0A 1P1HA 4DMLA 2GPTA 1G1AA 1DC5A 2PK3A 2ZB3A 4NBVA 1G6KA 1YE3A 1RM4A 3DZGA 4JNKA 4K1LA 3HDQA 1ZJZA 2X0IA 2HO5A 2HKIA 1UXJA 2FPPA 1PS8A 5KKAA 1TLTA 2PD6A 4A7PA 1I01A 2UV8A 3PWKA 2NU6A 5C3MA 4LGVA 3MJ4A 4Q3NA 3QWBA 4MP6A 4MVJG 1N7GA 5A5EA 1U1IA 2SCUA 2JD0A 5CG2A 4OH1A 5ILOA 3AM4A 3KUXA 2OORA 3KTDA 1EUDA 2I76A 4HUJA 3E9NA 4XZ3A 2B4TO 2DC1A 4IDEA 4I9UA 1QYXA 4HV4A 3B6ZA 4OYRA 4QO7A 1ADFA 1ISJA 3RU9A 2J5QA 3WJ7A 2O3SA 4E5PA 1YL6A 3PDJA 3L9XA 2CD9A 1Y9EA 3I9JA 1EZ4A 2ZCVA 1E1LA 1EE9A 3SJUA 1UP7A 4RVUA 2Y1DA 2X6TA 2R00C 3FTPA 4MVJP 1Y8RA 5ILGA 2DBZA 2HK9A 4AVYA 4BGIA 4QX6A 4ZQFA 3PZRA 3HDHA 3F9IA 3GT0A 3NDJA 5IN5A 4DIFA 1M66A 2AMFA 2FSSA 3WGHA 3OETA 3GHYA 1H0KA 1N9GB 3DOOA 1R4MB 3P19A 4NK5A 2IEBA 1NNUA 2BGMA 3PHGA 3U4IA 1GL3A 2NNLD 3B1KA 3FNFA 1E3WB 3I3OA 1LSJA 2BFPA 5JMWA 3K92A 2OOSA 1UXHA 3WS7A 1IPEA 1LNQA 2WMDA 2CVOA 2FR1A 4JP3A 2FRDA 2QIOA 1I2ZA 4EZBA 5DN9A 1BXZA 1VI2A 3JTMA 1SZJG 5THQA 2B4RO 4WK6A 2W98A 4PVCA 3ZNOA 1LLDA 1LDNA 3GFBA 5FEUA 1Q1NA 4XQCA 4M86A 4PLCA 5L40A 5TLSA 2VHZA 5ER6A 1L7DA 3KETA 3BHJA 3GZNA 5F1KA 3IP1A 3I9LA 3NUGA 1I2BA 3DL2A 3DAFA 1D7OA 3JQEA 5JO0A 1VM6A 4KMSA 3GQVA 3AUAA 3VKUA 3LQFA 5U4QA 4BV8A 1CF2O 2EJWA 1P3DA 1C1XA 3JQDA 3TZ6A 1PGPA 5A03A 1OC2A 1N5DA 4YXFA 3FHLA 1XA0A 1KC1A 3S55A 3ADOA 1JLLA 2GGSA 1Y1PA 3UGKA 4IIUA 1GYRA 4BO8A 5I7FA 5CDUA 1B8VA 1ZIDA 3NJ4A 3NYWA 3WMXA 5JY6A 1PWXA 1S6YA 4XR9A 1U3TA 1EQUA 1VJ0A 4IXTA 3JQGA 5G0SA 4HKTA 3SXPA 4E33A 5L7YA 3GLQA 4OQZA 3D4PA 1BMDA 3RD5A 1H6AA 4GKVA 4XYMA 2X7HA 2HMVA 1O0SA 1T4DA 3TZQA 1HDOA 1Q7GA 1DDOA 4NMHA 2OP0A 5KTKA 1GQQA 4R9SA 1MB4A 2PLAA 3WGTA 3KVOA 1NYTA 4RVSA 3DBRA 5TNXA 1JKJB 4WLVA 2QZZA 3ZWOA 1J0XO 4D3DA 3CZRA 2HRBA 3GFGA 2PKQO 3GZ4A 4MP8A 3OIFA 4D46A 2C29D 4ND3A 1YDWA 5LDHA 3ANLA 3DZHA 3QWAA 4IUYA 2HSDA 2ZTMA 3Q6IA 3CE6A 4BMNA 1OC4A 1CIVA 2YQ4A 1WDKA 4ITUA 4DMMA 5MDHA 1O5IA 2PZKA 1T1RA 2VYVA 4FW8A 3BA1A 1CRWG 3GOHA 1E7RA 4BB6A 3KEQA 4OO3A 2HDHA 1XU7A 5K6AA 4ZQGA 1NP3A 4B3JA 1NPDA 3OJFA 5ENDA 5I8WA 1B7GO 1IZ9A 5L4NA 3RVDA 4IMRA 4IZHA 3AW9A 3E1KA 1KBZA 3PLRA 1CETA 2HU2A 4TWRA 1LJ8A 1C14A 4RF3A 2VHVA 5GZ1A 2NU8A 3BTUA 3N58A 5DCYA 1HE5A 1P1FA 3JSAA 1DRUA 2H63A 3QWHA 4ND4A 4XYGA 3TWOA 3OICA 2E37A 3ROPA 3V8BA 3ZNPA 4CM4B 1XYGA 5JAIA 1Q0HA 2IZ1A 3DZBA 3TOXA 3UICA 1U2GA 1LLUA 1H6DA 3DMTC 5KNLA 3Q9UA 3BMNA 4YYZA 1BXKA 3CSDA 4I08A 4L9RA 2E48A 5F3RA 3VKVA 4CLXA 3OQ6A 3JD0A 4U0JA 2FR0A 1RKXA 4W99A 2Y0CA 3I9NA 2WDZA 3JD2A 5IDWA 1ZK2A 4BNUA 1AHHA 1YH3A 1NR7A 2HUNA 2VNAA 1WMAA 1NQTA 1ZH8A 4PLPA 4QFCA 5CDTA 2HK7A 4QSMA 1LSOA 4Z3DA 1XCBA 4PZCA 4RVDA 3U5TA 2TMDA 2X23A 1R66A 2VYND 5DOVA 4MIOA 3D7LA 4OIMA 1P1JA 2EKLA 4UVDA 3BHIA 1UAGA 2BH9A 4BO0A 1H94A 4RZHA 1HF3A 4AJLA 3T4EA 3WICA 5I7VA 1AUPA 2B37A 2I67A 1GTMA 5IDXA 3G1TA 3P2OA 3ASUA 1GQ2A 1NR1A 2NVUA 4BO4A 1FF9A 2GNAA 3INRA 1V35A 2PGJA 3F5QA 4OSOA 1PU2A 3GEDA 3PWSA 1LU9A 4WLUA 1PJ4A 4ALKA 4HX5A 1E7SA 1LQTA 4B79A 3SBOA 3U62A 2YHIA 1ZXBA 3FBTA 4CM9D 1LBEA 1E3EA 2YFQA 1ZUD1 4RVFA 3Q3CA 1VSVA 4XRGA 3P2YA 3KB6A 2OZPA 4GX2A 2OHXA 2NVBA 3MTJA 4XRRA 4YVFA 3WDSA 1ZCJA 2CUKA 4A73A 5DP2A 1MX3A 3FF4A 2GO1A 3EHEA 1R12A 5CEFA 4L76A 1BDMA 3PXXA 1AHIA 3LF1A 4TRMA 4HFNA 1UR5A 3GY0A 3PRJA 1BHSA 2FHSA 4U7WA 5JNLA 2AXQA 3AJRA 2WD8A 2X9NA 4PLYA 5DBFA 4HFJA 3A06A 1KETA 1HZJA 3EMKA 3WWZA 5K6AC 3U49A 4DYVA 4FFOA 4YJHB 2FPIB 3HDJA 4F3YA 5I9LA 3MJEA 3KLMX 4MKZA 4RVHA 1U3UA 4GGOA 3TNLA 1LRKA 4IGFA 2DTEA 3H9GA 4DQUA 1E92A 3STHA 5K9ZA 1JVSA 3SX2A 4TRJA 3JQ7A 5TJ9A 1HT0A 1NFQA 5ADHA 1UXIA 2D4AA 1LDEA 2I3AA 3PP8A 4E0BA 4R3NA 4FB5A 3JQBA 1YJ8A 1EVYA 4NK4A 3PHIA 3U0BA 3EC7A 1LC3A 4FSHA 4R16A 1MLDA 3QW2A 1E7WA 4MJLA 4JBIA 2Q2QA 1K0UA 2B5VA 4I8XA 2EW2A 2VUSA 1TVEA 5G4LA 5JC8A 2RBEA 1YQGA 2X0RA 2PZLA 1DB3A 3CUKA 5T6BA 4YJDA 1QP8A 1KVSA 3IDSA 3TDKA 3ZU2A 3HNPA 3S2FA 4MVJE 1Z7EA 2Y1OA 3E6AA 1NWHA 4L4XA 1D1TA 1PR9A 1PQWA 1BXGB 2DPGA 4ID9A 4OMUA 1ZBQA 4RPJA 1LI4A 5TGDA 3UUWA 1Z75A 3VH4A 3FBGA 3KYDB 2P91A 3DHNA 5IZCC 3KHUA 3B1FA 1BW9B 1ONPA 3B70A 3ZN2A 3K2BA 3ZWPA 2Y67A 4CMKA 1GQYA 4UUPA 5KVCA 2HMUA 2GR9A 1O6ZA 1G0NA 3GF4A 3VAZA 1DFHA 1CQJA 5EN4A 2HQ1A 5KVVA 3QV1A 1U3WA 5AXCA 1MC4A 1UJMA 2NQ8A 4P22A 3ZNNA 3ANMA 3DBHB 3AY6A 1ML3A 4Q3BA 3WGZA 1JW9B 3V2GA 3DR3A 1U7HA 4M49A 1F14A 1DOHA 1U8XX 4XGKA 1PQUA 2ZB8A 3K30A 3UOGA 2X9VA 1PL7A 2Z1MA 4GH5A 4NQZA 2WTBA 3GHHA 3JQFA 3S2EA 3ZWNA 1RM5A 2NWQA 1NAIA 1KS9A 1HDXA 1YBVA 1FDTA 4RL6A 1GY8A 4PLZA 4EDFA 5JO9A 3UCXA 1V6AA 3EVNA 3KSZO 2JFHA 1NQAO 2GZ1A 4OGWA 3KOUA 5JMPA 1UAYA 2YHUA 4LN1A 4GPD1 5KJEA 4B7CA 4YDRA 2P2SA 2YY7A 3D0OA 1ISHA 4BMVA 5KJCA 2QRJA 3Q2KA 3I52A 3RUHA 2NM0A 2X5JO 3CEAA 4YAGA 1IPFA 3EUWA 4NBTA 3FNEA 1AXEA 3ORFA 3PJDA 2DKNA 4NPCA 1HE2A 5LCXA 4E31A 2Q1UA 2XAAA 3PYXA 4MIEA 4I9NA 5GZ3A 1IUKA 2VYNA 4YB8A 1U4SA 2HJRA 1LSUA 2HMSA 1EMDA 3AM5A 5I9MA 3WQSB 3NT4A 4ZJUA 3ZWBA 4IJVA 1I2CA 5A3JA 5FWNA 1GADO 5CG1A 4G2NA 4E4YA 2Y93A 2FMUA 5AQ1A 1EBUA 4N18A 4DTIA 4XCVA 3NJ8A 2ZJ0A 2YZ7A 4GWKA 2X1HA 1PJSA 3GR6A 5JFOA 3GNTA 4A27A 4E2XA 3NEPX 2WD7B 2EHDA 1LDGA 2ZYAA 1DHRA 3L6OO 3EDMA 2O3QA 3CXRA 2B83A 2DM6A 1SO8A 1WW8A 3BTSA 5COAA 5TQVA 1ENPA 5HWSA 3DBVO 2EJVA 1BRMA 4FOOA 1HZZA 5G4KB 3I83A 1ZO8A 1I3LA 1XELA 3IP3A 1MFPA 2GD1O 1C1DB 3GGOA 1QRRA 1XDWA 5A02A 1QYDA 3FNHA 3MWEB 4MVJF 2WSBA 1BSVA 3NTOA 4CV1A 2VRBA 4Z6KA 1ULSA 3UCEA 3ZU5A 5IXYA 3WTBA 2EF1A 3TJRA 4II2A 3KXDA 5L7TA 3V1UA 1EK5A 4CM1A 2EIHA 1PTJA 3L9WA 4AJ1A 1NWCA 4Y6PA 5DBIA 4ALLA 2Y1EA 1YRLA 3QY9A 1PJBA 3VC7A 1VKNA 5C5IA 4NR0A 3Q0EA 1CEQA 4TZKA 2DT5A 2P68A 2VRCA 2XF8A 3FTNA 1DSSG 3MJSA 4S1VA 1D3AA 4DRYA 3TZHA 3KO8A 2PZMA 4NU6A 3ZHXA 2IYPA 3JQFC 1XQ1A 2QZ9A 4RLHA 1N9GA 3ICPA 2D3TA 1R4MA 1ADGA 4CMEA 2ZB7A 3RBZA 4WCFA 1GPJA 4B7UA 4RJTA 1B15A 4XX0B 1EFLA 3VTFA 3I6IA 4DPMA 3PPIA 4AICA 3U4CA 3O9ZA 4EW6A 4F6CA 2A4KA 4KQWA 4UUNA 1WZEA 4ZVVA 5AXAA 1LA2A 3PJGA 4BL5A 2W90A 4KQXA 4BV9A 1HE3A 1BGVA 1EK6A 1F8GA 2JCYA 5EIOA 3OEWA 1NTOA 3LU1A 5F1OA 1U7TA 4J7UA 3O4RA 3WB9A 3D5QA 4DUPA 1DC6A 2WM3A 2IEDA 1WMBA 3PJFA 1DHTA 1EVZA 3PGJA 2FOIA 5IXSA 4TKLA 1LX6A 4JN6B 4B4VA 3ONEA 4ALNA 5AOVA 3Q11A 5L9AA 1XHLA 3CMCO 1ADBA 3RUCA 3W4KA 1IB6A 2WEKA 1B2LA 5LDGA 3AI2A 3DOJA 5DZSA 5T8KA 4PVDA 1E1MA 3JQAB 3ZWXA 4BKOA 1IZ0A 4KUEA 3ZHZA 1ZJYA 4BNGA 2V7PA 3IL2A 2Y99A 2JKVA 1K89A 3VPSA 1ULUA 2O2SA 1KVQA 3H3FA 4EBFA 5L4LA 1C0KA 2P4QA 2Y0DA 5FI3A 2GLXA 4M1QA 2ZKLA 2GN9A 1NVTA 1I30A 1PZEA 4GBJA 4DLBA 1B26A 5I9NA 5GMOA 4TRNA 1W4ZA 4Z9FA 3ZHBA 5L3ZA 1UZMA 1I10A 4NBWA 1Y8QB 3PTZA 4TVBA 4ZA2A 3VZSA 3RUFA 2CF6A 2ZTUA 3ETEA 1HDYA 3OIGA 4HADA 1F06A 4E21A 1DLJA 4PG5A 1YL7A 2Q2WA 3QP9A 4J49A 5A9SB 1JKJA 4IMPA 2FZEA 2H1SA 4W7IA 3OM9A 1H6BA 1FDSA 4UAGA 3QIVA 5G0UA 7ADHA 1QLHA 3LT4A 2WJPA 2DAPA 1YBMA 2VYVD 3AY3A 3WQQA 4GLLA 4ZRNA 5JDIA 4H3VA 1A71A 3OA0A 4YBZA 1VRWA 4HFMA 2UVDA 1EE2A 4J91A 4YJFB 5B4TA 3LK7A 3WBFA 5IN4A 5J23A 3KEOA 1RYEA 3D3EA 3LT2A 3HZZA 4JBHA 1TA4A 5CPFA 1N8KA 1I24A 1Y5RA 2Y1CA 3DHYA 5DP1A 3V5NA 1A7KA 1DIRA 1P45A 1PS0A 2PY6A 3OBBA 2E6UX 3E48A 2JD2A 3NT2A 5L53A 1LRLA 4BVAA 1B3RA 4WCFC 9LDTA 1I5RA 3MOGA 1E3SA 5C7LO 3ZGYA 2QQ5A 3OJEA 1CJCA 1LEHA 3HFSA 1YJQA 2C2YA 1Q0LA 3BMQB 4WKGA 4DQXA 4XB2A 2DBRA 4EJ0A 1ZZEA 4E2WA 4MO2A 3MJCA 3DMYA 5IJZA 4CM4A 2FP4B 4IXWA 3ZU3A 4IINA 4TZTA 5JDCA 3NKLA 2J3KA 4D43A 3LSYA 1JKFA 4PRKA 4LMRA 3ZWAA 2J3IA 2VTEA 4FOSA 4L74A 2I9PA 4CJXA 1SPXA 4UEJA 3T7EA 2Q2VA 3EZYA 3L4BA 2BLLA 3PQEA 1G0OA 4I5FA 3ZHYA 4KUGA 4LSMA 1GEGA 2PWZA 2OMEA 2ZYDA 4WECA 4FGWA 4WLNA 1ZK1A 3L6EA 1FMCA 1AN9A 4WEOA 2R2GA 2WYWA 1L7EA 5T8KC 3WLFA 5KOIA 4QUKA 3RC9A 3IKTA 4E13A 1R4NB 2GN4A 2CDCA 4E5YA 2POQX 4U5QA 3WSVA 2C5AA 2BHLA 4ALIA 4HNHA 4IS2A 3CTMA 1ZK4A 4D3SA 1ISFA 1YL5A 3GPIA 3I6QA 1ARZA 4WLFA 1YQDA 3AOEA 4EJ6A 1WZIA 1EBFA 3R6DA 3VH2A 5JAZA 1X14A 2YV2A 2O23A 3H2ZA 1GZ4A 3PIDA 3SC4A 5CFZA 2VWGA 1LLQA 1YVEI 1QXSA 1GUZA 2EKQA 2Z95A 1E3IA 1NQ5A 2NTJA 3SLGA 4MVJH 5CDSA 3HSKA 1Z6ZA 3HB4X 1FK8A 1R0LA 1LLCA 3H5AA 4WPGA 1WAMA 1SB8A 1P1RA 2X4GA 1JDJA 3SVTA 1TXGA 4R68A 4J1SA 1PGNA 3S8MA 2AQ8A 3INGA 3WLEA 4IBOA 5JDIC 3JQ8A 2PGDA 2I66A 3VH1A 1P1IA 3PFWO 1NVGA 3LLVA 4FFPA 4C7KA 4XYEA 2C2XA 4JIGA 1HDCA 4MOWA 1O95A 3VHRA 4QO8A 3PZBA 2I99A 2JL1A 3KV3O 3IJRA 3CINA 2I3GA 4BO2A 5L51A 3NT5A 3NTRA 4Q3AA 4DREA 5TC4A 3LYLA 5H81A 4J4HA 4CR6A 2IE0A 4GX1A 2D1YA 4XEHA 4INAA 3GVHA 2I6TA 1GCOA 4B3HA 2FPIA 3GVIA 2VT3A 1E0DA 4U0KA 1SEVA 3B1JA 4M55A 4CMAA 3LVFO 4IY1A 3T4XA 3ZWVA 3C1AA 5JSFA 3C85A 4BS9A 4D42A 4YQYA 4R3WA 5B1YA 2AW5A 3AI1A 3WYCA 5JDCC 5JCXA 1UDAA 3OQ1A 2F00A 3KYCA 2YW9A 1HDRA 2EG9A 3H5NA 3OQBA 1HSOA 4NNJA 3E9MA 4YJGA 1T24A 2B0JA 3SC6A 1HLPA 5FF9A 3AI3A 2ZK7A 1DBVO 4GSKA 4Z9YA 3U4HA 4E12A 1W8DA 4G81A 2AG8A 1PIWA 4K28A 1IY8A 1T25A 4RF4A 3RCBA 5JXWA 4XGNA 3VZRA 4EUFA 2IZZA 4IPTA 4D3FA 3UVEA 2AQKA 2D59A 2NTVA 5DBGA 4BMSA 3E8XA 3JQ9A 3HADA 4CLOB 3GAFA 4LISA 4N54A 1OZAA 3H3JA 3V2UA 4Y67A 4NI5A 3BTVA 4YR9A 1Z45A 1BXGA 2GDZA 3WJAA 3AUTA 5AXBA 1HTBA 4FD3A 3AOEC 1JKIA 3N74A 1OFGA 2DVMA 4Z0PA 3KYDA 4R4JA 2HK8A 1R37A 2HMWA 2B5WA 3KM0A 4BNNA 4MVJD 1FDUA 2YDXA 3VPXA 1BW9A 3R0IA 3BMOB 3OMLA 2DU8A 1SC6A 3INTA 3RWBA 3VPFA 3RKUA 3AFNA 4A26A 2IXBA 1DLIA 4W9NA 3Q1LA 5BSGA 3IC5A 4NU5A 1UDCA 3AU9A 3JCZA 1JAXA 3PHLA 4IQ0A 3WTCA 3DBHA 4D79A 2F1KA 1I8TA 3ABIA 3GUCA 5JY1A 5HTOA 1VJTA 3FWZA 1QG6A 1A7AA 2NTNA 4AJ4A 2BFOA 5U1PA 3GAZA 4OOEA 1LRJA 1U5CA 3DBLA 3H9QA 2O4CA 3JYPA 3IMFA 3KBOA 2NACA 1XLTA 1Y5MA 4OKNA 2EGGA 3RIHA 3OECA 3RI3A 3E5MA 3E5RA 4Q3CA 3L0DA 4N7RA 4GLOA 1LTHR 1DIBA 3R1IA 5A5FA 4U6QA 2FPGB 1DRWA 1T2DA 2C20A 1CERA 4NFSA 3GA0A 4R1NA 5FI5A 3VZQA 2HLPA 2NU6B 4PLGA 3WIDA 3WNQA 3LC1O 4GWGA 4UEOA 4YACA 4PGFA 1V8BA 4OSPA 3SLKA 1WP4A 4I9HA 2AE1A 5BNTA 1U4OA 1NBOA 3TQHA 3ITDA 4GX5A 1JWBB 4O59O 4YAJA 3AUSA 1TEHA 2YV3A 1KEUA 1HLDA 2C54A 3RC1A 3PI7A 5DULA 1LSSA 1KC3A 1M6WA 4O1MA 1LDMA 5C7IO 3WX0A 1X15A 2CMDA 2EWMA 3ETDA 2YUTA 5KKCA 1CQIB 1DO8A 2GZ3A 4Y6SA 1C3VA 3FPCA 1JTVA 3TSCA 2RH4A 5H83A 2X86A 4ND5A 1PZGA 3BHMA 1V0JA 1OBFO 3IS3A 1NFFA 4PLFA 1GZ3A 3GG9A 3ST7A 3WG9A 2FSVA 3CIFA 2WD7A 2OUIA 3G79A 1OI7A 1Y81A 3F6YA 4GMGA 1BVRA 2AQHA 1E1KA 4D7AA 3FWNA 1SAYA 3M1LA 2VZ8A 4XIYA 5JAMA 5TT0A 2ZQYA 4MP3A 4R1TA 1QV7A 1PJCA 2JD1A 5G4KA 3CPSA 4RCVA 4D44A 3GMSA 2BFAA 1ZEJA 1Y7TA 4BNYA 3DC2A 5HM8A 3W6UA 1TT7A 5T57A 1C0PA 3MWEA 4MKRA 2BI8A 3GUYA 3HQ4O 5TRTA 1MA0A 2C82A 4W9NC 4UVEA 2VRCD 3BYZA 2BF7A 1R15A 5TIIA 4HBGA 3VVBA 1R6DA 2O3JA 3U9LA 1LDBA 3VH3A 4ZN6A 2BKAA 2GYYA 5ENVA 5FYDA 1ZMTA 3H65A 1N1EA 4G5HA 3IQDB 4ZQHA 2C7GA 5EL0A 1J49A 4B8ZA 1I3KA 2PTGA 2XXJA 3K2EA 4BNTA 4PIVA 3OIDA 4AJNA 4A2CA 3MCVA 2CDAA 2EP5A 5JYDA 3DB2A 3GGGA 4BNVA 3MWDB 4PG8A 4FJ2A 5KVQA 2JFFA 1B8PA 4R01A 4RVGA 5AXDA 4L4SA 2O3TA 3MTGA 4XX0A 1UDBA 2X9GA 2DLDA 4YT2A 3IUSA 5ICMA 3A28A 4RO0A 1M6HA 4JGBA 4OJNA 4R69A 3FR8A 5BNIA 5IDYA 5JS6A 4BNMA 1PGJA 2WYVA 4XB1A 4PZEA 1Q0QA 1DFIA 4IQ8A 1PWZA 2O7QA 2V6MA 4HNGA 1PS9A 4AFNA 4GKBA 4JJGA 3A14A 3GDFA 5JCJA 1SBYA 3GN2A 3W1VA 3QE3A 2CY0A 2Q3EA 2DFDA 2Y68A 5IZ4A 3ON5A 1NFRA 2VQ3A 5F1PA 1WDMA 4YRDA 3A4VA 1EQ2A 3M2TA 4KDEA 2EW8A 5BNFA 1YB4A 3JQAA 4DVJA 5TF4A 4MVJA 4CUKA 2ZYGA 5CAEB 2O2YA 1OOEA 4CLEA 3AK4A 4K9DA 4O6VA 1NXQA 3U09A 5TJHA 3HJAA 4FR5A 2HCTA 2Y1FA 4ZD6A 3GRPA 3PEFA 3AU8A 1C0IA 3LC2O 4PFJA 2HJSA 2ET6A 4IDGA 4DXHA 4IDBA 4IM7A 4YT8A 4JX8A 1SOWA 2Q1TA 3C1OA 1EDOA 1HWYA 2QYTA 4I1IA 5TX7A 4X54A 3GPDG 2VHXA 2P9CA 1FDWA 4ND1A 3WFJA 3IJPA 3AUUA 4UVGA 1V9LA 2J8ZA 2YV1A 1Y8QA 2EXXA 1A5ZA 3W6ZA 2NU8B 5BSEA 1WNTA 3DXFA 4RDHA 3TPCA 4E5NA 2PD3A 5A9SA 3OEYA 1NVMB 4FFMA 4YAIA 3RAJA 1ENZA 1O9BA 5KIAA 1QORA 3ZWMA 2JAHA 3RBVA 5G0WA 3H9UA 1QLJA 1ZNQO 4MDHA 3EW7A 4N5MA 1Q7BA 1QV6A 2QW8A 4CMIB 3EVTA 1AXGA 3G1UA 1ZVMA 1X7HA 5IG2A 2DBVO 4J6FA 3F1LA 1HDZA 2YFHA 4H7PA 4PLHA 4UUOA 4YTEA 2QYSA 1P0CA 1T4BA 4XYLA 3JQBC 3MOIA 2ILTA 1DFGA 5TS3A 3KSDO 1HKUA 2X0NA 3DZJA 4J4TA 4OOFA 4JP2A 4CLRB 4S3MA 1UUFA 4WASA 5JPIA 3FN4A 3ZCXA 2X5KO 4DYDA 1F17A 3HN7A 4CQLB 2X58A 5ITVA 1PQPA 1M67A 4CMBA 3ONDA 5ITWA 2E49A 4LVCA 4NJOA 4R41A 3JYQA 2C5EA 4XIJA 3BMQA 4TROA 2V6FA 2W4QA 3RFTA 1HRDA 2EV9A 3L77A 2FP4A 1NQOA 3RJ5A 3DZIA 1YGYA 2OXIA 2YHIB 2J3HA 3C7DB 3D3WB 5EQFA 3PQDA 4FCCA 4D0SA 3JQ6A 3NRCA 4GAEA 3U3XA 4FFNA 1KY4A 3RC7A 4R5HA 2JAPA 1F8FA 1ADCA 4XJTA 4IDFA 1ZSYA 1K6XA 3O8QB
chains in the Genus database with same CATH superfamily
3KPVA 5BW8A 5L3SA 2AHRA 2X2FA 3AOGA 3MT0A 4R54A 1LS1A 2NQTA 1JDPA 5F12A 3AVVA 5CIQA 1P2SA 1Z8HA 2A9OA 3R74A 2YVLA 3IALA 4NOMA 4PPNA 4Q3EA 4AYXA 3LY9A 1DTEA 3REFA 2QVCA 1DJQA 1KI4A 1SUPA 2B6NA 3HY6A 1DC8A 3LZCA 4J0CA 4KC0A 5B4VA 3RS2A 1LK5A 4X92A 2I4OA 4UBKA 3VO2A 2Q1YA 4N4AA 5REQB 1WSDA 3TBHA 2Q6VA 1WR8A 2AOUA 3OWXA 1I3NA 4E5MA 1Y7PA 3DTYA 4I9FA 4OBBA 3SHOA 1XDGA 5IM5A 1T9HA 2CD7A 1L8LA 2RFLA 3BEOA 4IJUA 4JC8A 4KL8S 3SM3A 1RWBA 4HNUA 1QAMA 2C2KA 1SELA 3C43A 3HUDA 1VIVA 1SM4A 2X6RA 4YUWA 1DQSA 4DM7A 4IGIA 1O95D 3ASVA 4OFWA 1FP1D 4P53A 2YRXA 1VTKA 3QUBA 1ZK0A 2P9GA 2W2XA 4MUHA 4XM1A 1RMQA 2JFPA 3MSXA 5K01A 5E2BA 1DUVG 2VKQA 4M1YA 1IHOA 4LI0A 1AUOA 2IU3A 5BY2A 3V7UA 4JT2A 1JJFA 1KRHA 3U60B 4B4OA 3WAGA 4Q47A 4UVHA 5PGMA 4BP1A 1ISPA 3WQBA 2XHEA 3AV0B 4OTZA 1Y4SA 3HO8A 2C7OA 3TD2A 4J16A 5C34B 6GPBA 1C30B 1F0YA 3RIYA 5C37A 4TSKA 1RLTA 1Z6YA 3UF0A 4QNMA 3OF2A 2F6RA 2ZULA 3B53X 1C9JA 4INZA 1YS2X 4HYTA 4QASA 1JBEA 2OXCA 1UBHS 4I5EA 1XCOA 5ILQA 4TZ6A 4UFNA 2ZATA 4BRSA 1W1IA 2I2WA 3C16C 3ONWA 3ZV6A 1WO8A 2CHVA 4MDEA 3CZPA 1QTNA 2MMGA 2SKCA 1RM3A 4C03A 1DNPA 1TZ2A 3A58B 1FMLA 3DAYA 5BV8A 1VL0A 5KQMA 2G0TA 3C3XA 2FY8A 1XE3A 3GFVA 5J43A 3A9CA 3NDIA 1SKYB 3QUQA 1Q0PA 4M8SA 4NESA 4DUGD 3KTOA 3NVAA 5A2QA 5JS8A 3CONA 4F4DA 1AK2A 3QQPA 5JECA 2E18A 3QJ5A 3VR6A 5LU9A 3WWPA 3RJZA 4XLZA 3AHFA 2AJ8A 3HB7A 1Q7RA 1AKYA 3JYOA 3L4SO 5IC5A 4YUAA 3DE6X 3FDXA 2UUOA 1JDNA 3FSEA 4HNAA 4FVTA 2BGJA 1B0PA 1T5SA 2APJA 2PQ2A 2QG6A 4GPEA 4QOGA 4XFJA 4XIIA 3RSSA 4XXHA 4S1NA 5DCUA 3V4SA 4X8HA 1AU9A 1UBRS 3ZIUA 2IIBA 4PEVA 4DKJA 1R27A 1L7AA 1J25A 5J59A 3KQLA 1OT3A 4KVGA 4OXRA 4BLRA 2ZR7A 3B6JA 3GH3A 4UATA 3NANA 3T9DA 2BJWA 1ZBDA 2EVWX 3MS2A 1DRVA 3HLYA 3KQTA 2ZRIA 1W59A 3C7AA 4RXTA 1CBUA 3K09A 1MAVA 2LTAA 2WHYA 5J2TB 2CMFA 3HE3A 3RABA 2BY4A 1WKCA 1IAVA 2WLTA 4K8RB 4OG2A 4QEDA 4AJPA 4KP7A 4LQDA 1FLNA 3OQIB 5MN6A 2FPKA 2O59A 1NN3A 1KTVA 2WINI 2Q9BA 1TJ4A 3KYIB 1QC5B 1IHYA 4QYXA 1JE1A 2JJQA 4B33A 3URKA 3ZTWA 1U5AA 4BUZA 4Z3OA 3N2LA 3WRYC 3ZTYA 3D64A 3KXKA 1ZK3A 2P7IA 2NZVG 5AOCA 2NU9B 5EA2A 1P7YA 3CISA 1ZG3A 1PEDA 1X1EA 4ZV7A 2PBRA 3OQNA 3H5TA 4FS3A 4MLPA 5IMBA 1QK5A 5H8WA 3LF2A 1GDDA 2C2BA 2NVWA 4WOCA 4UAJA 1HG1A 2IYOA 5KYXB 4KI0A 4Q03A 4G3XA 1KZ1A 3G5TA 3W1EA 2Q5QA 3HDYA 1MXFA 4G5XA 5B3JA 2CNWA 1L5ZA 2ABWA 2VEOA 1OKKA 2XTNA 4E2YA 4DV6B 1EFVB 4DR3B 3H4VA 3N2ZB 2PUGA 1USKA 1ST2A 1YB5A 2PS0A 2ZBVA 3ZDBA 3K1YA 1ZKMA 1QIGA 2VJMA 3FPEA 3DKIA 1Q6YA 3R3HA 1VJGA 4RK6A 3LK6A 3M6FA 3C7CB 3KFVA 3U40A 4S2UA 4MH0R 1YR2A 3JWGA 1PX0A 1SCNE 4GP6A 2RI1A 5BURA 2VPPA 3HV0A 1GDHA 2ODPA 2PH7A 4Q9JA 3WBKA 1VA4A 1ZCFA 2WKQA 4HFRA 5JYEA 3B1YA 5EHNA 2DEUA 2D7DA 4DEXA 1T3HA 5AIBA 1QIEA 2IP1A 2JFWA 2OMKA 1UBJS 4M99A 2PZJA 3S8EA 5SZIA 2VPTA 3GL9A 5T41A 3UAGA 2EBFX 1QTIA 2DPMA 3EC1A 4TN5A 1MOQA 2YCLA 5CNMA 5BSVA 4YHHB 3W5AA 2OWDA 5G53C 2FDCA 1ZNZA 2QN3A 3IMGA 1GT91 1WXGA 3DE1X 2Y77A 3PD1A 4O4HB 1K7SN 2QTVB 1GTZA 1VI6A 4O2BF 4D8UA 1TF7A 3EOAI 3LO8A 1PFYA 2FP3A 2W2KB 4GI5A 4CU5A 2K5UA 4CEJA 2IYWA 5EKXA 5CJ2A 5ITSA 2ATCA 2A78A 1OVGA 2OD7A 4IV0A 4YAEA 3P4UA 3F4LA 2BF4A 2Q5FA 3UJHA 2JRCA 5CDHA 3NEAA 2XKJE 5JS1A 3DCNA 3DMGA 1G8HA 3GK3A 1N6LA 3UH1A 2IT1A 4C20A 5KREA 4ZOCA 3K6RA 5I48A 1DQRA 4Y2HA 1V11B 1HT2E 2BDEA 4NIMA 2R47A 3PQFA 4K9KA 4UPDA 1BA2A 4GYJA 2DT8A 5G0TA 1V4VA 1SCUB 2H6EA 2OCKA 3E23A 1JXOA 1NU8A 3RTDA 2WKPA 1XHEA 2J9FA 7AT1A 2Q3BA 4GU5A 1DKPA 1AGYA 3KEGA 4LECA 3VVMA 2Q8QA 2PQMA 2X8LA 3A6LA 4WZZA 3KPYA 4H4EA 1CYDA 3GVCA 3H75A 4JK3A 2YR0A 3I04A 4H17A 5JFGA 2CBZA 5LSAA 5KQRA 4P34A 4TMFA 2QPAA 3PB3A 3BKWA 3KZNA 3PDUA 1GAEO 3B38A 1DARA 2YL2A 3OUTA 1B93A 1TMYA 4V0KA 3SEAA 1QPZA 1GCIA 4MQEA 4ZDWA 5HMLA 2PKEA 4BO9A 4NV1A 5JNLA 3G1WA 3DZKA 2OBYA 1YONA 2V9ZA 2VJLA 3FCAA 4TKMA 1XVLA 3W2EA 5KJ1A 3BXZA 4I1UA 2BD0A 3QOYA 2XRMA 2VP4A 1MG5A 3LKVA 3R3SA 4O0LA 3UATA 3NGLA 4NYMR 3PUXA 4XSHA 3WKDA 1ZWKA 2Q28A 2BTQA 3CLTD 1GKLA 3L04A 1HEUA 1VJ5A 1UZNA 3PVZA 1NY5A 4BQOA 4LWQA 2OPHA 5IYZA 1GGNA 1GNTA 1SXJC 5K3CA 2C2MA 1E6WA 5MN4A 1ST3A 3LUBA 5DW3A 5DE3A 4JYZA 3H9EO 3ZBQA 4ZU3A 5AM4A 1OAAA 5KKNB 1W4LA 1VLLA 5AI6A 4DCOA 3TR6A 1G20A 1VHJA 4PSAA 1PT7A 1XC7A 5DLYA 5EZYF 1BVHA 5EJEA 4PLVA 4HSEA 4ZT3A 4XGIA 2XQKA 3HKDB 4CUZA 2VIIA 1M8KA 1P1BA 2FZWA 2XE6A 4I4CA 1CWUA 1L4KA 4MKGA 4Y8VA 3WRWA 3L8MA 1W52X 1T9ZA 5AHWA 3EYWA 3QLJA 1ONOA 1FXWA 2FSPA 1FFCA 2J3MA 5A1TA 1RXEA 4R81A 3LHIA 4CZ2A 3O26A 4I1YA 1QCCA 1WCWA 3R0ZA 4CL3A 2B7BA 5LC1A 4ZCQA 4HQOA 4CT4B 3DM5A 4IKEA 1ISGA 1KR5A 1NUUA 1KAMA 2Z1NA 3S28A 3T3EA 4YMWA 3S1AA 5LP6A 2WPNA 1EFRA 5F73A 1Y7LA 5IANA 1JHUA 1Y7HA 1YIAA 3SXUA 5JWRA 3ND7A 1F1JA 1OMOA 3BICA 2W6MA 3MWDA 4I50B 4MSUA 2AV6A 4RIFA 5DNAA 2ZIUB 3IMEA 2CSUA 1JJVA 1KMQA 3F78A 3HI4A 4XQEA 5EY5B 4YS6A 1HYQA 3WFIA 5THKA 1H8ED 1RJEA 4LY0A 1N7HA 3HEBA 1ZGGA 4LE2A 5ER9A 2A9VA 4LRSB 4UOQA 5FNZA 3LCJA 4A8PA 4B8WA 5B37A 2EP8A 2J67A 3M6IA 5BN5A 2VZ9A 1O8BA 1BE8A 3HKEA 3SU8A 2CCKA 2VF4X 2PWPA 2DPYA 3UANA 2PU7A 3B8HA 2IYUA 3E82A 3JYLA 1CC1S 4AECA 3AIMA 5K0BA 2WYOA 2DZDA 4BKPA 2DUWA 2ZS9A 5CEJA 4QBKA 3TEJA 2REQB 1E6CA 3MJFA 2WTUA 1S3SA 1SMKA 1JXQA 1TQ4A 3CN9A 4DIMA 3CA8A 1SHZA 1T36A 1X7YA 2ZVJA 3GJ6A 1ZU5A 4GZ6A 4KK3A 2IU0A 3SYLA 2BI7A 3P7MA 1WSAA 1VHLA 1Z2OX 4JJIA 1C9NA 2A0XA 3C6BA 1NT4A 4RU1A 3TIXB 3TTWA 1YDMA 1YJCA 2UVPB 2GD6A 3MERA 2DFLA 2HQBA 3OTWA 4KN6A 3S2IA 4CKEB 4LSWA 4D0RA 4UBOA 1SVIA 5E38A 3FBWA 3GVPA 3UB2A 4PU0A 1PFKA 3UWDA 5HUJA 4FFSA 1OAOA 2H3EA 3CH6A 1YJAA 2ZYUX 4ROSA 2CJWA 4B43A 2AI1A 4G5SA 2XTJA 4QXAA 3I1JA 3B1ZA 3BCHA 3LYAA 1RQPA 1XT6A 4GDFA 1BGWA 3HHEA 1R7RA 1VJCA 3CO5A 2VLIA 4A5SA 5EJAA 5HW0A 1O94A 5DM2A 4ZALA 2WE7A 5DI3B 2F1RA 3RC3A 1UBFA 4JR2A 1RYDA 1UEXC 3AR9A 4NH4A 3H87A 1VIYA 5IKPA 1R4ZA 3HO6A 2V8OA 3LT1A 1ULZA 4REMA 4NDNE 3HB1A 5JATA 3F6CA 4Y3UA 4PHGA 3EVFA 1DIHA 3ANNA 5CFQA 3GH1A 5TPWA 2FPPB 1EG7A 3A9TA 1GDTA 1GQRA 5A3SA 2HYIC 4MEAA 1OGIA 2A0UA 3UK6A 2OCXA 2IPNA 4LFCB 1YIOA 5KWEA 3K1TA 1O87A 3BWYA 2QD1A 3H5LA 5A9TA 4RE5A 1SC3A 2K4MA 4TT8A 4FN5A 2WQ7A 1UBMS 3SFVA 3QJGA 1P44A 2ZWMA 4LTNA 3CCFA 3NIWA 2VVTA 2CV0A 4L4RA 1G60A 3S2GA 3EAFA 5KS2A 1PLJA 4BZWA 4ETIA 2A30A 2UZ1B 4PYMA 1HE4A 3JATA 3OE4A 2ZCJA 1SVNA 3DC7A 1HXHA 3IUPA 3GLHE 4XWKA 2Z2XA 1CK4A 2JGFA 4F45A 4OYHA 1CUFA 2B4QA 4XQ9A 4ZHQA 3UG6A 4I46A 3C70A 1GZ5A 4G0VA 5KAPA 2BFFA 3H2IA 3ADPA 4W6ZA 5LMZA 4KSBA 2WF9A 4DKXA 3OJOA 1WY5A 2ZIGA 5ES3A 3DF7A 3TE6A 5IH3A 3CJTA 4OQMA 4XD7D 4O0MA 3MPOA 1TZCA 2FGJA 1KO1A 1MTZA 2PFKA 2PX0A 3JYNA 3AUKA 1YKSA 3HKCB 4I55A 1KZ7B 3EQ6A 4RC9A 2BRUA 5IJ0B 1J2RA 1X2EA 2I1QA 4FPXA 2OHOA 4QQRA 3TL2A 3TQIA 4DE5A 1HOTA 4WOJA 2ZE8A 4CI0B 5G1PA 3OZWA 4HY3A 6ADHA 3O2JA 1IB0A 3KTFA 1Y3CE 5IJWA 3DOEA 2PJDA 4DV3B 1NDQA 2E1RA 3HWRA 2PWBA 5AJHA 1YJXA 3UN1A 3VTZA 4ZJPA 2IKQA 3WO0A 1XSEA 1P77A 3VDQA 5FIUA 5JBQA 5BR4A 1Y0BA 1U3VA 1WOMA 2HX1A 3GAAA 4LA4A 4NFLA 5FUYA 4LJ5A 4B7XA 2QTMA 4FCWA 3RG2A 4NYMQ 7REQA 2XXBA 4L50A 2JLWA 3V4VB 3R40A 5KJFA 2BKEA 3D3WA 2C0CA 1PD1A 3F47A 3FVVA 3M6MD 3TJMA 2P0YA 4NBNA 3WYEA 3G8DA 5I5EA 1SURA 4C21A 5IDQA 5IU6A 2INGX 4AP6A 5GY7A 1U8FO 2QV7A 2FF7A 2R8YA 2QN1A 5F23A 2VEDA 1DMRA 3L18A 1BH2A 4Y0VA 1CIJA 3AB7A 4A8HA 1I6MA 1W76A 4GZ5A 3B85A 3TZCA 1E0SA 2QG4A 3FMPB 5K51A 1GTSA 4P4LA 2XY4A 1OI4A 1JJ7A 2CE7A 1PYGA 1PL6A 1ZIOA 3Q98A 1D9XA 1RYFA 1YJBA 3AHEA 1D8AA 3GWGA 5DSZA 4E32A 4EELA 8ATCA 3E9DA 1E3JA 4P83A 4LJSA 3I8SA 3EBPA 3IUMA 1I4TD 2CVZA 3HXTA 4XWOA 4CM7A 4RQUA 2EGUA 2IZOA 4I5DA 1IHUA 1H4QA 2IS1A 421PA 1CEYA 1R0KA 4Y2YA 3TRIA 3KFXA 3S27A 1GCGA 3AMVA 3PCTA 4R6XA 3GB9A 4ENPA 4FJ1A 4IJ6A 1E9VA 1J8DA 3AR3A 1ZSVA 4R9RA 4URUR 5J9FA 1GO2A 4FGZA 1IIRA 2ZR8A 4QQKA 3FGZA 2XI4A 4B9AA 3SN6A 1N3IA 4GPIB 1VBKA 2J7PA 4XB6B 6REQB 1UM8A 1H2WA 4JHLA 1GUFA 2I3BA 1WV0A 2CDBA 3DS8A 4IH4A 3DQQA 4S1OA 4CMHA 5CX4A 4LY3A 4RD3A 1TEXA 1P33A 3JPWA 1SU7A 2DOKA 5DEIA 2NUAA 3JWHA 3OF5A 3QMPA 3R8FA 1MH9A 1M8PA 3QQ5A 4KVFA 4A0RA 3AEZA 4FZ3A 4IDOA 1MP0A 1Q14A 1YOVA 3HL4A 1KI8A 3WK9A 5B57C 4TMXA 3GXBA 1DJMA 2MINB 3A31A 3FW1A 2VP5A 4PBTA 3HRKA 1YGPA 4Z86A 1UKCA 3WSWA 2VHJA 1POWA 2R8BA 1IOLA 2EQBA 1NX6A 2BFDB 2PCLA 3KOOA 1M1YA 4RHEA 4CQMD 4DWVA 4ZYWA 3Q7PA 2GCOA 1XMVA 2P4UA 1I3OA 1P2GA 3NX4A 2AFVA 4HZGA 4TQAA 4OUDA 2EFDB 5DCWA 4LWZA 4KR0A 1CEXA 3ZEIA 5LQMA 2PGLA 1GGVA 2FW0A 3MAJA 4BXOB 1MABA 3F5SA 4FOLA 3KL4A 3RYTC 2AFHB 2UYOA 2WVJA 1TMOA 2O05A 4L9SA 2I6UA 3UJ9A 1AHNA 4Q9IA 1KOLA 1SQ6A 4TV8A 5JE8A 1IRIA 2BKLA 2ZTLA 5GINE 1U8YA 2RGGA 3VR1A 1J2YA 4HQLA 4C3OB 2BE7A 2VDPB 2G5CA 4JL8A 3LFUA 2GPYA 3QA9A 2ZAGA 2MWMA 4AG3A 4CMGA 2H1WA 2JJ2D 2XGJA 3Q88A 1NLYA 3WLQA 4EGJA 3FLBA 2IOQA 3QRWA 1ACMA 2QP9X 5KC9A 5KBYA 3ZU6A 2HA2A 2QQEA 3JY6A 2ZJOA 4TLLB 4ZGGA 4IUCS 3NV9A 4DY6A 3EZ9A 2R7LA 3EZFA 4QM7A 4XYBA 4KQKA 1IXZA 5K1ZA 1HMPA 5CNIA 4URXR 2MSNA 1R50A 5CPBA 2WJGA 4JUIA 1W2GA 2Z5LA 1XNRB 2BGRA 1T3LA 3GJTA 1G2PA 2QUZA 2TSYB 1JNYA 2HMTA 3JVVA 2IBSA 4TVSA 2G6TA 3K4QA 5IFKA 3ME5A 3W8EA 2ZW9A 1CR4A 1W1WA 4WY8A 3VR2D 2Y66A 4F71A 3HN2A 3LQQA 1W30A 4G07A 4CN8A 4UXIA 5KTPA 1PJ8A 1ICEA 4MS4A 4E2ZA 3WNBA 3GP3A 2N1MA 1OE0A 2NYUA 3FTEA 2O0KA 2QYHA 2WHPB 3E61A 1XB2A 1WPQA 1NVDA 3MJTA 4L2IB 3RSZA 4HVLA 3L8ZA 2JLYA 3WGOA 1V4NA 1XMOB 4YJKA 3CE9A 3UMMA 1XQVA 4ND2A 2G76A 4E22A 3V8VA 4LHEA 3FE2A 3PNMA 4DC0A 3LUGA 4L4ZA 1SA0B 3C5HA 4HZUA 4IIFA 2I7XA 3PQ2A 1P74A 4II3A 3ZLVA 5D5QA 1E3DA 1VKOA 3ZZ1A 1NBWB 1P31A 2JPDA 1BNCA 1O2DA 3D8SA 1JH9A 3W34A 3WYNA 4RTRA 2AFIE 1XJWA 1A7UA 3OQJA 3BZUA 4NATA 1T2AA 3KJXA 2AJLI 2B4YA 3MXOA 5TE9A 2XMPA 1L8XA 4G4GA 3RUAA 2KMLA 1U0SY 3SK0A 1T4CA 2NVUB 5FX2A 1GD1O 1MZPA 2CJFA 2V6BA 4QICA 3AF0A 4QU0A 3KDSE 5JTUA 4ICIA 5I7SA 3GP8A 2ZJ5A 4L7VA 4CE6A 2Q5HA 3GBSA 4NONA 4WA7A 4ZCIA 3P4YA 5EFOA 3VNRA 4RTPA 3MWFA 4FFRA 1OZFA 3MUNA 4J43A 4F1WA 2IXGA 3Q8WA 4G4SO 2FX2A 4TUYB 4BV2A 3IXQA 1RWMA 1Z15A 1EJ2A 5AJZA 4KLAA 4WLEA 5AVRA 3RYIB 2PMKA 3IO5A 1RMTA 4D2IA 1RFLA 4W82A 4C2TA 3N05A 3NVMB 4X91A 4OGKA 4QE3A 4IVPA 1EX7A 5IK2D 3LHDA 2G17A 2FG6C 4HH3C 2Q0SA 3S7ZA 4HQRA 4CETA 3PGKA 3ZHUA 3P8ZA 5K4HA 3M8KA 1Z73A 4QELA 1HQDA 3K5IA 1SUIA 3P5SA 5DOZA 1UMBB 5T67A 5DHRA 1IONA 4HXGA 1ZFNA 5JAQA 2IU4A 1OWOA 4Z9BA 3SZ3A 4IIJB 3LWDA 3QVKA 2VRNA 5FHQA 2YYYA 3U7IA 4B4UA 2HNKA 3ABOB 4Z1MD 4QG3A 3H1GA 4JH0A 1GRVA 2V7QD 4L6IA 2IH2A 5EZQA 1SGWA 3QXHA 5A7GA 3T52A 3W3AD 3WLAA 5AW8A 3PFIA 2VSQA 2VJKA 1S96A 2D1RA 3K5PA 1BKSB 1A5SB 3C5VA 1YVDA 2BFCB 3EBLA 3IV6A 1YE8A 4DC1A 3CR7A 4LC9A 4B6PA 3SQXA 1E7QA 4GKJB 1VJRA 4YC7A 3C5EA 2GHQA 5FQNA 3WKBA 1EGHA 3CUYA 4PPFA 1T3SA 2R6GA 1RP7A 4ZHSA 3SNHA 2LIPA 4X85A 3LT0A 4AAYA 1H1LB 1L4FA 2FGKA 4FI3F 1ID1A 3VO9A 4HTFB 1QQAA 5GIOE 4DIEA 2X5NA 3ZJTA 3KKPA 1YZNA 4G24A 3O2NA 1FJXA 4LMPA 5JPDA 3GLFB 4IDAA 4WE3A 5CIWA 3UFXA 3UO8B 1D5WA 2I7DA 3FETA 2CXUA 1PYOA 2FW7A 2P9BA 1T1SA 2Q2OA 2HF2A 2V55B 1QX3A 3AUYA 4IXMA 4V2UA 5CFOA 1F8YA 2OXRA 1W9HA 3RRBA 3ZH9B 3PTLA 2XQGA 1JLRA 1ESCA 5GM2A 1JILA 4W63A 1OBHA 1BZYA 1YMQA 2VOEA 3QPWA 3U1VA 3EVZA 3ZWCA 4ZGBA 2PZBA 1UPXA 2O2EA 1H9BA 3KBBA 1PR3A 2C95A 1EVIA 4BNZA 3EEQA 1F2UB 1G6OA 1IQRA 1TCUA 2CLSA 1ENYA 2GZHA 4PZUA 5AJXA 4ZQBA 5JAPA 2NXEA 1YHZA 2I8LA 2R5FA 4K9PA 2JHFA 1IWOA 3IIKA 4EHBA 2PUAA 3V42A 1YKGA 3KUCA 3UW3A 4GMFA 1FDIA 5FD8A 4DIBA 2FR8A 2QVXX 4O2BA 3I23A 1Y6JA 4PHTA 1BS2A 2P6NA 4J0IA 3FGNA 3KJEA 5DYWA 3GG2A 1WMSA 2NV6A 5BMOA 2WWWA 4IAOA 1U0RA 3C8ZA 3QKRA 4I5GA 1LB1B 2G1KA 4UJ3A 4HB0A 3REQB 1GZ6A 1MQSA 3PGXA 4EA9A 1TQ6A 1YTLA 3IHLA 3HXQA 3WK5A 1CQJB 3RRZA 3MB8A 2FMTA 1UBNA 4EPTA 3QU9A 3RH0A 3H04A 1U7WA 5LYJB 5T64A 5E3HA 3MINB 2XZOA 5TVKA 1WCYA 4K6OA 2O7VA 3JZFA 1Z74A 3K9FC 1KIFA 3NYIA 1YB1A 4CDGA 4RHCA 2GYUA 1OBOA 1EUCA 1K06A 5GOZA 1BYIA 1CX9B 4M7RA 1SG0A 4KAAA 3D31A 3MT7A 3DG9A 1V7ZA 4BNWA 2YICA 3V80A 1KVUA 4L8LA 5L45A 2XT9A 2H7XA 1Q19A 1OUMA 4LBVA 4P5PA 1Y42X 3CWZA 1W4AA 3U7EB 2HRZA 2NSLA 4KQMA 2Q6LA 5LQJA 2RDMA 4RVNA 4M76B 1ZDMA 1I3CA 1Y4ZA 2QW0X 5E7MA 3T4UA 4EB3A 4YDQA 4A5OA 1L5YA 1VMDA 3ZVMA 4CEIB 5LA6B 3BULA 1JWLA 1U2DA 3AEUB 4MJ7A 4QNRA 4YV0A 4FKBA 1CDDA 1XEXB 2JBAB 2OQRA 2WUDA 1QSGA 1E1CA 4WXMA 3T5PA 1RAGA 4HJRA 4NG5A 4F2DA 2VK1A 1ZA2A 1N6PA 4KN9S 1CQPA 5A3VA 4F6LA 1R0ZA 2IPOA 4JUAA 4WZ6A 1AQJA 3KOYA 2PKRA 1YC5A 4LYEA 4F5EA 4FFLA 4HWSA 3AHHA 3S5JA 4ZI7F 2YCBA 1J2TA 3O8DA 3UH0A 2FPMA 1A9YA 2Q4BA 2VDUE 5IULC 2NO0A 1V5GA 2ZJ2A 4OX9Y 1PZMA 4HWKA 2DSNA 3BZWA 3DMHA 4DSNA 3NM4A 5IVDA 4ZKEA 1JUDA 4BO5A 1CFZA 4HH0A 4IZIA 4YA6A 2A86A 4KXWA 5AHXA 3ROQA 5FDFA 4F4CA 3DDWA 2OZLA 4IIHA 3OE7D 2BHRA 1ORVA 5EZYA 2ZVPX 3QTBA 4Z5XA 1V16A 4RPKA 4Q1CA 4G8CA 4COKA 4HNVA 1V3UA 1JN0A 3EZLA 4JLWA 4O4JF 1P1HA 3T5CA 2XSZA 2OO5C 1DC5A 3MC1A 4DNFA 1DT5A 4ZEWA 4Q9HA 1O58A 3EGIA 1O7JA 1W4BA 1IRXA 3R0QA 4Q37A 1IBSA 2QN6A 5IBRA 1QCDA 3RVNA 3I61A 2F55A 1MEOA 1ZJZA 2X0IA 3HYSA 3DLBA 3OC6A 4NVRA 4US1R 4AC9A 3O92A 2DQKA 2QXTA 5CYGA 1CVIA 1K4YA 4UDXX 3OFVA 1MO2A 3QNUA 2G06A 3C7TA 1QGAA 2P3LA 1BCSA 1A0OA 4N3AA 3PWKA 2NU6A 3NLLA 3QKSB 4LGVA 4Q3NA 1SUAA 2J4CA 1O08A 4P3NA 2FSHA 1AB5A 1ZICA 2JIDA 4A3SA 3IBTA 5ILOA 2O8BA 1N75A 2O9JA 1WULS 3KUXA 3FFTA 1PG5A 2OORA 4G0PA 4TS3A 4CL0A 1EUDA 4YBRA 3WDMA 2YVAA 4OQEA 1Y3DE 3E9NA 3KTAA 1ZJ4A 2JGIA 3N6RA 4RIGA 2PANA 4BVKA 2DWQA 4X1YA 1Z2CA 3TLJA 5BUZA 3DV0A 1OHHA 5FLXA 1ISJA 4ECEA 3RU9A 3WJ7A 3ET5A 5JXGA 3LQ2A 1YL6A 2IIQA 1HLFA 2QUAA 3KZKA 2KJQA 4LHSA 4N5IX 4YIHA 1E9CA 4ZARA 3L9XA 4QDKA 4RA9B 3DVSX 1EHIA 1L4LA 2FN4A 1NBHA 3SF8A 2R00C 5ILGA 1MX9A 2DBZA 2HK9A 5AICA 4ER6A 2ORWA 4UNRA 5KX5B 4C07A 4M9SA 1USVA 3B13B 5IN5A 1E1QD 2J59A 4H7FA 2WMYA 1P7PA 2CFIA 2O1XA 1M66A 2AMFA 3ML1A 1N3BA 2FSSA 2R97A 3HR7A 2GA9A 4I4TB 4JGIA 1S7GA 4Q0MA 4WDRA 4XLTA 1H0KA 3VSCA 1QU3A 3DOOA 5CYPA 1SU6A 1OX6A 3LBNA 2XMCA 4NK5A 1I94B 1H5UA 3U4IA 1GL3A 4PINA 1EUYA 1WDTA 1E3WB 3I3OA 1LSJA 2BFPA 3EWSA 1H2YA 2FETA 2GAJA 3K92A 1CZUA 3IPCA 4C0LA 1EWTA 3WS7A 1GPH1 2XLBA 1LNQA 1RI5A 3IB3A 4JP3A 4F85A 1N5MA 2VQFB 3R9IA 1RWNA 4JS0A 2ROQA 5U4XA 2WAMA 1W29A 2VI5A 5B3JC 2JCGA 1SZJG 5L3QA 3X1MA 4WK6A 5LZ9A 3CH7A 4U2DA 4D9CA 3Q3JB 3KWLA 1M5TA 4EARA 3ZIAA 2PGIA 2Q3CA 3OX1A 4XM2A 4XQCA 2XUDA 2GAIA 2OBXA 1Z37A 4MV0A 4R8VA 5BVGB 2JKYA 3IVMA 3QG5A 5ER6A 1YZHA 4ZYYA 2YZGA 5F1KA 1KZHA 4B4KA 3I9LA 2KLBA 2YZMA 4O2AA 3ZI4A 3DAFA 4O4LB 4C2BA 1PFVA 3RNLA 4A91A 1U0BB 2GZAA 2AVNA 3M34A 2XMBA 4HAUA 4KMSA 4M7OA 3SDZA 3FZNA 2GNOA 5DHPA 1G7CA 3LQFA 4BV8A 1F5SA 1A77A 3BSFA 1C1XA 1I4EB 2JGMA 3EVDA 3AERB 3V32A 2QS9A 1PGPA 3H13A 1NBMA 2H1VA 4WERA 3U7RA 4K7JA 1MDBA 1XA0A 3IP8A 4MUNA 1MVLA 1JLLA 5F7JA 5GOTA 1QGZA 1XN4A 1Y1PA 1CUUA 4UE2A 3H4IA 5I7FA 1WETA 3CEJA 1B8VA 3NJ4A 3LTEA 1KEKA 3ILSA 3S70A 1PWXA 1U0JA 2OFFA 1FS5A 4N3GA 2QX9A 4C22A 4A6PA 4E33A 5L7YA 3GLQA 1QIHA 5A0FA 1GPLA 5EIBC 2IHYA 2OG1A 4C1BA 2RGDA 3CUEF 1A1VA 3B7PA 3LS2A 4X6UA 4AWBA 1T4DA 3TZQA 1Q7GA 1JS1X 4E6PA 4JGGA 1VLZA 2AN9A 4MI3A 3OURA 1NSTA 2AOTA 2PLAA 3FVQA 4FT2A 1OI2A 3FKSD 4EB0A 4AQYB 1NYTA 3HVIA 3DBRA 4KPYA 1AV7A 3HGTA 1UADA 4X97A 1D1QA 1J0XO 4I6GA 1CNFA 3CZRA 2QVBA 1ONBA 4TQ9A 2OK8A 1J7KA 1XQWA 4MPTA 4B7AA 2O8EA 3SQNA 3FPKA 3SZGA 3ANLA 1JQ3A 4PSCA 2IZ6A 2R65A 4IUYA 3LAWA 4DLRA 5I7WA 2HSDA 2ZTMA 4IG4A 3CE6A 3DUWA 1EWVA 1ODIA 1Y4UA 2RH9B 2CXHA 4OJMX 1BXRB 2FEOA 1STOA 4NZNA 2QR5A 2YQ4A 4K6KA 1CD5A 1R9MA 2JDID 5JMOA 4YN3A 2KPOA 3OE1A 3G8AA 1SBNE 2IS6A 1H5NA 4H4CA 3AZPA 1KFKB 1BC5A 3L06A 3L41A 1HFEL 3PEVA 2LIVA 3AR7A 4TYPA 2ZRQA 4FW8A 5KNDA 2N42A 1CRWG 1VQ1A 1CE8B 4C29A 4UZFA 3KEQA 1T8SA 3EMBA 3RWMB 5K6AA 4LYGA 4ZQGA 2PJRA 1NP3A 3CV3A 3S29A 4F21A 6Q21A 2W6CX 3LL7A 2JH8A 2WP8J 4MW7A 5DTQA 3NG1A 2JJMA 4IMRA 4IZHA 1TIPA 5FWYB 4J3JA 4D57A 3HA7A 3SAJA 3ADDA 1M1ZA 4X8LA 4JLBA 1C14A 3WWOA 5JD4A 3ICQB 5EHXA 5ED4A 1BIFA 4H7JA 4YJ2B 1FTQA 5EJ8A 3JSAA 1DO2A 4BQFA 1L9XA 4XYGA 1I4WA 1QJ4A 3B6EA 2D1FA 3GRVA 3UAVA 1YDGA 1T15A 2G63A 4UW9A 2O2JA 4OK3A 4JI2B 4LZPA 2RC6A 1LLUA 5CHYA 2G7MC 2ZI7A 1DDGA 3T5DA 3DXYA 3ROTA 2CLDX 3Q9UA 3ZCRA 2WSMA 1P4SA 2YJ5A 2OCIA 4GFDA 3UUFA 1NU6A 5TMEA 3GLKA 1CJKC 4KV7A 4UCFA 2FB9A 1KJZA 3D5EA 2Q3FA 4Q48A 1Q1BA 5F3RA 2RK6A 4RD4A 4U0JA 4EG7A 2Y0CA 1Z6AA 3JD2A 5IDWA 2OTCA 4X66B 3KKQA 4BNUA 2QT9A 1AHHA 1KKUA 1UOEA 3QEBZ 4EABA 2HUNA 1QGUA 3P52A 4AKGA 2JHCA 1UBCA 1ZVVA 1G3QA 1XCBA 1YA4A 4Q9LA 3KQHA 4HDCA 4LXGA 2VH1A 5B3AA 4NXNB 1I0IA 5DOVA 4E15A 1NRIA 1JG1A 3L1HA 2Q9AA 3EG9B 1P1JA 1KDPA 4AF7A 1IZYA 2X0DA 1RI1A 2ID9A 1EGMB 4IZ6A 2PSDA 5DWQA 5TVGA 2K7FA 3I73A 1JEAA 1XZIA 3IILA 4BLWA 1P0IA 4BO0A 2QRGA 5TEWA 5I7VA 2JK0A 3UK1A 3K1AA 1GTMA 1Z28A 1PLKA 4N8DA 2GTPA 4V02A 3DNFA 2HDWA 4BO4A 1V2GA 3AUJB 3GLHA 4MQ6A 5FTKA 4ZVTA 3QMVA 3L7DA 4WMLA 2PGJA 4BMOB 4D9KA 3K9GA 2YY6A 4G1FA 2FUG1 4PYKA 4CGZA 1GAWA 4WLUA 3T54A 1WB9A 1E7SA 2XUQA 4B81A 1U2PA 2XDQA 2GM9A 1Z5ZA 3KZMA 4U63A 4B79A 5E1BA 4B32A 2FQQA 3G2NA 5LUAA 1E0KA 1I6LA 1ZXBA 2HBRA 3H97A 2HUPA 2QK4A 5FT9A 3FMGA 4GLBA 5KDLA 3RTGA 4HNSA 4GPBA 3UMGA 3UPTA 5KYWA 4Q00A 4MRRA 4DQ0A 1VSVA 2I2DA 2P90A 4DTCA 4DV1B 4GX2A 1OYVA 2L18A 3I1YA 3NETA 4N47A 4XRRA 3HZHA 4F56A 4IO0A 4RADA 3BGIA 1SUCA 2VXBA 2YZ2A 3FF4A 4ZT4A 5NLLA 1FYXA 2ZJ8A 1JE0A 1R12A 3T1OA 3Q3GE 1KQGA 1D0SA 2WUVA 3EULA 3OM8A 2FMIA 1YI1A 5DYIA 3IA2A 3PXXA 4DLZA 1NVFA 2GCPA 2OFOA 2ZJ7A 1AS2A 3WRXA 1KWGA 4MUIA 1L4MA 2OHHA 2GWHA 2VTKA 4WVLA 2V98A 3CO0S 3GY0A 1NXVA 4LZNA 4GLJA 3ABZA 2FHSA 4U7WA 2B9VA 1A8UA 1RJFA 2AXQA 1GXSA 2XMDA 1OXBB 2E4ZA 2PT7A 2X9NA 3AJRA 3KDAA 4AQ7A 4OI0A 3DEFA 1NSYA 4EG1A 5DKFA 2C3MA 3PV0A 1T9BA 1M2EA 3TB6A 3U49A 5D86A 3WI7A 3WWZA 1RRCA 2ZJ4A 1DX9A 4JJAA 5K0EA 2FPIB 4KAFA 3H2YA 1RQ7A 2DYKA 3LLMA 3PXEA 4P6VF 3RODA 3PXBA 8MHTA 2GJAA 2HQOA 3HBAA 4GGOA 5H1YA 3TNLA 3S6JA 3AUXA 1LRKA 3VAAA 2IYYA 5HKOA 3FGOA 6ABPA 1E92A 4ROTA 2QE7D 3V8RA 2IITA 1JVSA 4IGKA 4CIXA 4Q1AA 3AF2A 4G8BA 4TRJA 3OCUA 5C2JB 1MV5A 3BFKA 3IDFA 1NFQA 1U2GC 1UXIA 2PBZA 1EXWA 2QTNA 1HT3A 1WXHA 3OM1A 3PP8A 4M83A 3FHOA 4OHPA 5AVWA 3TW0A 4UUAA 2QPTA 4E94A 1LVGA 2IX9A 5ENZA 1MLDA 4MJLA 4YWHA 1XVIA 3KKLA 3ZPXA 2YRWA 4KMOA 1ND6A 3C8DA 4BX8A 1M10A 2OGWA 4QDZA 1YOBA 2RBEA 3KVVA 4G1VA 1YQGA 1J2EA 1VRVA 2DUNA 5K3SA 2PZLA 4HXEB 5LZ5A 1D9ZA 1Z35A 4YJDA 5IW8A 5HF9A 5T6BA 1VHTA 1QIFA 3P20A 4HH1A 3HNPA 3TDKA 3ZU2A 4RM3A 4B3FX 5DK6A 3FUTA 1NMQA 2Y1OA 4C2UA 3IAM6 4XPIA 1E2PA 2PUFA 1NWHA 5BNWA 3PXDA 4AMVA 4DWWA 1WL8A 3IEKA 2DPGA 2R6CA 4G5RA 4RVOA 5SY6A 3EWNA 1JHQA 5C8YF 1GU0A 1XPJA 4U4AA 1LI4A 5HCUA 3U5ZB 3EQ9A 3VH4A 2XCTB 5CLHA 5AKHA 1PZNA 1U7PA 1U2ZA 1YUNA 2B98A 3A4MA 4RV4A 5LOVB 1V8PA 3C74A 5CA0A 2BBWA 4PR3A 1TM1E 3NHAA 3TW8B 1ONPA 3AR6A 1OZHA 5DRYA 4B6GA 2AG0A 1JMVA 4MR8B 2RGRA 1RI3A 1BAPA 1E94E 2GR9A 1SHKA 4NSNA 4MV7A 1OASA 1YR3A 5FNVB 4YXWD 3LPDA 1NVXQ 2CSXA 2M2IA 2UYQA 3K6SA 3BBPA 4N6GA 2HQ1A 4F9EA 1VG8A 4GKAA 3ROXA 1U3WA 3KU1A 1MC4A 1UJMA 2WIDA 3DFKA 1G4UR 3ANMA 3DBHB 4P80A 1ZIPA 4OMUA 3UYKA 3GCDA 1BJTA 1W0JD 1B1CA 1WHTB 4EHNA 2GBFA 4QIHA 1WEHA 2ANCA 1DOHA 1L6IA 3HU1A 1RHJA 3SKVA 5CIYA 1PQUA 1ZOPA 2DECA 2VUHB 2X9VA 1EM6A 4TTQA 5I7HA 2R6FA 3ODPA 4MTLA 2GAFA 4GH5A 3JQFA 1RXWA 2R68A 5LLSA 5HEKA 2NWQA 2GD2A 3GEIA 3PDCA 4ER3A 2OD2A 2IUEA 1KAOA 5JNTA 4Z99A 5JO9A 3F90A 2ZWVA 4C3VA 3KSZO 2JFHA 2GZ1A 3KOUA 4KAXA 5JMPA 1NC1A 4LN1A 5LM3A 2QSUA 1EG2A 1C9MA 5BV7A 5JNVA 3WLTA 1L8OA 1KOFA 1E79D 1I1QB 1ISHA 1ZRHA 2H11A 4LNUB 4X6XA 3VHXA 4TTRA 4BMVA 1XLVA 4TZ0A 1JEQA 1V39A 1G64A 5ES4B