2YV1A

Crystal structure of succinyl-coa synthetase alpha chain from methanocaldococcus jannaschii dsm 2661
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
287
structure length
268
Chain Sequence
MILLDENTKAIVQGITGRQGSFHTKKMLECGTKIVGGVTPGKGGQNVHGVPVFDTVKEAVKETDANASVIFVPAPFAKDAVFEAIDAGIELIVVITEHIPVHDTMEFVNYAEDVGVKIIGPNTPGIASPKVGKLGIIPMEVLKEGSVGMVSRSGTLTYEIAHQIKKAGFGVSTCVGIGGDPIVGLRYKEVLDLFEKDDETEAIVMIGEIGGGAEEEAAKFIEKMKKPVIGYIAGQGTAESKMKALEEAGAYVAKNISDIPKLLAGILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
publication title Crystal Structure of Succinyl-CoA Synthetase Alpha Chain from Methanocaldococcus jannaschii DSM 2661
rcsb
source organism Methanocaldococcus jannaschii
total genus 91
structure length 268
sequence length 287
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2yv1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yv1A01
3ZH2A 4WLUA 1TT5A 1SOWA 2Z5LA 3INRA 1L1FA 1IHXA 1VJTA 2HSDA 2O7SA 4ZQFA 3L77A 3MJTA 5T8KC 1H6BA 5G0WA 4W9NA 2P5YA 2Q2WA 3PHLA 2AQIA 3E48A 2AEFA 3DONA 3DMTC 3QJ5A 2ZATA 4XYGA 2JKVA 2HUNA 1LNQA 4GX0A 5DN9A 3KEOA 4BNNA 5FWNA 1PJTA 3LDHA 9LDBA 5KWEA 4RZIA 3H3JA 4BKQA 1EE2A 2QW8A 2HRBA 1JVBA 2W4QA 2P9GA 4HKTA 4RORA 3ROKA 3FNEA 3PJDA 4W7HA 5LDHA 4N18A 5KKAA 5IDXA 5G0VA 4GKVA 2G1UA 3LC2O 1EQ2A 1JKFA 3ZHBA 2WSBA 1DOHA 2VUTA 4GSLA 1EMDA 4CV3A 4IXTA 5A9TA 4Y6SA 3LVFO 4P22A 4KZPA 5AVOA 4CODB 3BMNA 3GDOA 1E1KA 3AY7A 1B0AA 2PFGA 1JAXA 5I7SA 1VKOA 1PGNA 1Z45A 2VWGA 3H7AA 2ZK7A 1LDYA 3H3FA 1I36A 2G0TA 2PKQP 2GSDA 5IDWA 5IDYA 4BMNA 3HNPA 5L7YA 1CETA 4BO5A 1P1KA 4GWGA 3WIDA 5JBIA 3DHEA 5K6AA 2VHWA 2Q99A 3EK2A 3FBGA 3FNGA 3UVEA 5C7IO 3HG7A 3TOZA 3GMDA 2PZLA 1DJQA 1UZMA 1V9LA 2W2LD 1ZMOA 4UVDA 1XA0A 1MC5A 1NQOA 1ZK4A 3D64A 5A03A 2O3SA 1A4IA 1PGQA 4YAJA 1DC5A 2PY6A 4J16A 4CMHA 5TLSA 1MP0A 2P4QA 1Q7CA 1VM6A 3AM3A 1NHGA 3GPIA 1EQUA 4R4JA 1B2LA 4ZQGA 3D3EA 1SNYA 4RVGA 3EYWA 2J3KA 1GQYA 1RM0A 1UZLA 2HMTA 1HDYA 1J5PA 4E5NA 1VC2A 2Q45A 3TZ6A 4IQ0A 3RAJA 1ZSYA 2JFGA 1EUZA 1AN9A 3JQEA 2IYPA 4QECA 1B7GO 1EDOA 1GU7A 3SBOA 2JJYA 2WD7A 1PJ4A 1U3UA 1O95A 1I01A 4L9RA 1D1SA 2WD8A 3NJ4A 2I76A 1XLTA 1N5DA 1DHTA 2O3TA 4XQ9A 3VTFA 5K0ZA 2OHXA 5TT1A 4ILKA 1EEHA 1O5IA 5KJEA 3LC1O 4EDFA 1NHWA 3KEQA 4PLHA 3DZIA 4PG5A 4MOWA 2VYVD 4LISA 4CUKA 2D0IA 3LLVA 2EGHA 4MVJG 5DF1A 1I2ZA 4JK3A 5K6AC 1H9AA 2V6GA 3AM5A 1MX3A 2H1SA 1LDMA 4BO8A 2OL4A 3N74A 1GCUA 3PVZA 4DIFA 1MG5A 3NDJA 4U6QA 5HM8A 1FDUA 5JE8A 3V1TC 3UHAA 3U09A 2IRWA 4JNKA 2X7HA 1Q7BA 3I9MA 1HZZA 3KYBA 4IUYA 2Q2QA 2GLXA 3H9EO 1HYEA 1KEPA 2VHVA 3AK4A 4IJUA 4E3ZA 1ZCJA 3LT0A 3LLSA 1KBZA 3GNSA 3TPCA 3RUHA 2R00A 4P4GA 1LQUA 3WJAA 4MVJA 4RQUA 5C5IA 2QRLA 4N7RA 3ROQA 4AJ2A 3BMOB 3AU8A 2GN9A 4NDNE 4KQXA 2CNBA 1YL7A 4QFDA 2AHRA 2AE1A 2EIHA 1QLJA 4PLWA 1GUZA 1VKNA 5BNIA 3KSDO 1O8CA 3F1KA 4YWJA 3D5QA 2Q1SA 3LT4A 3OEYA 5B37A 3S1LA 3VHRA 1G6KA 1YWGO 5COBA 3E6AA 3WQRA 1H0KA 1ULSA 4K9DA 1UP4A 4NMHA 1E7RA 4BOYA 1WP4A 1B8VA 2WE7A 4U0JA 3KYCB 4RPGA 1P77A 3Q0EA 4J4HA 3GVHA 3WICA 3ZW8A 5L7WA 3PZRA 3WBFA 1SMKA 3U4HA 4H7PA 4UVGA 4X54A 4B7CA 3U9LA 5BSFA 3BMCA 4A10A 1QG6A 2IEDA 4DPLA 1LJ8A 2W98A 3IS3A 2QHXA 2YQ4A 3F46A 2E6UX 4H3VA 4CM3A 1XELA 2ZCVA 4QX6A 3BZUA 3H9JA 4WCFB 2Y1OA 3JD1A 4FJ2A 4BKOA 3I23A 4OMUA 2VUSA 2VTDA 1HETA 4RVSA 3T4XA 5I9LA 4LMRA 1KEVA 2JD0A 1YJQA 1OAAA 2R00C 2UYYA 4IDEA 5U1PA 3FHLA 3GK3A 5HWSA 4YAKA 2WE8A 2AA3A 2PH3A 1P31A 5JCJD 2HMUA 2OGUA 1O9BA 5B1YA 2DBZA 1E7WA 2VUUA 1NVGA 3DFUA 4ZRMA 3KYCA 4WKGA 1W0CA 4HFMA 4M87A 1V3UA 3AUUA 4Q39A 5GY7A 1K6JA 3H5AA 5A3VA 4FS3A 4K1LA 4B4WA 5JYEA 1UXKA 2C5EA 2ZYAA 2JHFA 3ANNA 5G2OA 3RD5A 2GGSA 5CAEB 5ICMA 1VE9A 2Q1WA 3GGPA 4II2A 1P0CA 2GF2A 4CLDA 4ESOA 1WXDA 5A9SB 2YV3A 3RFVA 1V35A 2Y68A 4B3HA 2O3UA 4RPKA 1LSJA 4YJDA 5L4SA 1B16A 1CYDA 3C85A 4NR0A 4YB8A 5BSEA 2C5AA 3F4BA 4D43A 4RF2A 5BNFA 3PFWO 4J1TA 4BO3A 3RUDA 3I52A 1U4SA 1NM5A 2ZTMA 4YAGA 4GX1A 4GVXA 3WNVA 1NPDA 3Q11A 4L8VA 4D7AA 1E1NA 5ILGA 3Q6IA 4ID9A 1QORA 5AYVA 3G79A 3PLNA 2ZKLA 1EK5A 3ST7A 5B4VA 1ENYA 3QWBA 4U8GA 4BKRA 2C0CA 4W7IA 1WMBA 4KUGA 4J91A 1MXFA 5CAEA 4QEDA 3BYZA 4R41A 4WOJA 4XQEA 2NVUB 2EP5A 1ZEJA 2CZCA 4E13A 2C7VA 3WWZA 3JQCA 3WDSA 1QV7A 2FY8A 2DPHA 1CERA 4TWRA 3QHAA 1N2SA 2WYUA 5IZ4A 1LLQA 4DBZA 1A7AA 2YFHA 2X9NA 3C3XA 5CPBA 2WJPA 2PGDA 3NAQA 4I1IA 2NU6B 2OMEA 3TF5A 1ZUD1 4IDAA 1ARZA 4OIMA 1TLTA 3LZ6A 4PRLA 4XGIA 3CKYA 3UAGA 3H9GA 3W1VA 4E33A 1TA4A 1GTMA 1PL7A 4WCFC 2P2SA 3GDFA 2P5UA 1JAYA 2CD9A 1KY4A 3K2EA 1UUFA 2JFFA 4DPKA 4CMGA 2EHDA 2QQ5A 1F8FA 3CIFA 3I9JA 4P4NA 6ADHA 2AMFA 4BMSA 1D4FA 1F0YA 3ZGYA 4NBRA 2UUOA 1BXZA 4DREA 1I3KA 2CVZA 4FBGA 1U3TA 2RHRA 3JQAD 4ALMA 2FR0A 5G4LA 1HSZA 1TVEA 5TC4A 1FJHA 3B1KA 3F3SA 4NH4A 1ONNA 2P9EA 3C1TA 2DAPA 5JAQA 3TN7A 3W6UA 1YXMA 4CR7A 3RUEA 4BO0A 4UUNA 1VL8A 3EGOA 1NVTA 2XOXA 3O03A 1X14A 3V8BA 4YRAA 2D2IA 2Y1EA 4CUJA 1H2BA 4CLXA 1LRLA 4RO0A 1MA0A 2NU6A 1QSGA 2OFPA 2HMWA 2GN8A 3VDRA 3ZWYA 1ZXLA 3GPDG 2HCTA 4J7CA 4E2ZA 4YCAA 4O0LA 3QVOA 1LLUA 4RQTA 1A27A 2GN6A 4LSMA 3ZWBA 2UDPA 1ENPA 5DOZA 3K5PA 1I24A 4GMFA 3VPGA 3U5TA 4CM6A 3M2PA 1R0SA 3BHMA 2QRKA 3PJEA 2BFPA 3DL2A 1EVIA 2CY0A 4IM7A 4E2WA 1YONA 4I8XA 2Q4BA 4BGVA 2VYNA 2NTVA 3NTRA 2ZTVA 5DULA 1HRDA 4J1QA 3AOGA 2HAEA 3WWYA 3L9WA 2VRCD 1DO8A 4CV1A 5HTOA 1PQWA 5A3JA 3O4RA 3RUAA 3OMLA 4CLRB 4O6VA 1AE1A 1DRVA 3UFXB 4J1SA 2ZTUA 4I5FA 4KP7A 1DPGA 3OH8A 4JLWA 4F6CA 1EUCB 1FDTA 1SEPA 5IN4A 1RWBA 4A03A 3GFGA 3B6ZA 1HE2A 5TGDA 4WGGA 1T1SA 1P3DA 1HYHA 2FP4B 3ROPA 1DC3A 2W2KB 4Q3BA 2NTNA 2B5WA 2CDBA 4L73A 3JQDA 3VKVA 4DLBA 1IL0A 4GSKA 3HDJA 3VAZA 4B8WA 3TZCA 2GPTA 2Y99A 4JQCA 4R51A 3GA0A 2JCXA 4CM7A 2DPGA 4E6PA 4M89A 2J3IA 5MGBA 4DVJA 3AFMA 4NBWA 4YBZA 2P68A 1M6HA 1YL5A 2EJWA 4Q3CA 3FR7A 3PYLA 4BO6A 4WECA 4CUZA 4CLRA 1QRRA 4J49A 5KVVA 1I3NA 3UFXA 2HDHA 4ND2A 5U4QA 4BKPA 5EMHA 4GI2A 4RL6A 4BO7A 1VL6A 1C1XA 2AG5A 3D4PA 3KOUA 2FHSA 4K6CA 4AJPA 1ENZA 4U7WA 5KVQA 3IC5A 3STHA 4YEDA 3ASUA 4GL4A 5DCUA 4EEXA 3C7DB 2LDBA 4JBHA 1EFLA 2EERA 4I9NA 3E18A 4IDBA 4U6SA 3RWBA 1EZ4A 3GQVA 1F14A 5ES3A 2OP0A 3EAGA 4BMVA 2FP4A 1JA9A 3DQPA 4FFRA 1C1DA 2G76A 2W2KA 1MFZA 2XF8A 4RV9A 2GR9A 2PNFA 3D5TA 5G0UA 2PKQO 3X2EA 4YRDA 3ZWWA 4CLOB 2AW5A 5TQVA 2YV2A 1PJ3A 3P2YA 3SXPA 1PGOA 3A14A 3NT4A 2Q2VA 2X5OA 4TMFA 1ENOA 2DBVO 2Y66A 1PZFA 4PLPA 1F8GA 5DDIP 4AJKA 4MP3A 4PZDA 4R5MA 1AHIA 1U8XX 2NNLD 2X0RA 5JSFA 4Y8VA 3TJRA 3QW2A 5AXAA 4ITUA 3GUYA 1X7HA 1P1IA 1U3VA 1NPYA 4L0QA 4XYEA 2RBEA 1PJ2A 3KM0A 3ENNA 4DLLA 3GH3A 4RVHA 3WLFA 4CQMD 4CV0A 1GV0A 4EI2A 1BXGB 1TEHA 4GQAA 3OFSA 4ONEA 3CINA 1F06A 1ISIA 4CLEA 4WLOA 1SZJG 1T2EA 1XSEA 2PD6A 4A5OA 3LK7A 5JDCA 1LU9A 4K6FA 2GO1A 3PZBA 4MO2A 4BVAA 4OSPA 1D7OA 4IJKA 4HFNA 2NV6A 2CVOA 1MFPA 4YXFA 3L9XA 5GMOA 2NU7B 2UUPA 3UCXA 3GZNB 3PIDA 4GLOA 5JCXA 2FMUA 5L7TA 1M75A 2HK7A 4IJWA 1OOEA 4FFOA 1X15A 1ZBQA 4EITA 1NFRA 1QP8A 5BSGA 3TL3A 2NSDA 2BELA 1U7TA 1UXHA 3WMXA 4D46A 5IG2A 1RM5A 3RUCA 1GUYA 3NYWA 1IULA 3AUSA 3ZW9A 4Q3DA 4RZHA 2H5LA 1HDRA 4NFSA 4NBTA 5TNXA 3JQ9A 1FXSA 3RC1A 1E7MA 3ZNOA 1E0DA 2IXAA 1E3EA 1H6AA 3HB5X 1YB4A 3HDHA 1ADFA 1LSOA 4A2CA 3PP8A 1GZ4A 3L6EA 4JJIA 1TT5B 1ORRA 3TNLA 5A04A 1QXSA 1U28A 2W8ZA 2ZTLA 2IZ0A 1EBFA 1XU7A 3WQQA 1G1AA 2VT3A 3GC6A 1AGNA 3E5MA 3BTUA 4CLHA 4ZGWA 2PKRA 2YUTA 3KRTA 1X13A 1IYZA 1P74A 4NJOA 2GD1O 1RM3A 5TX7A 1IY8A 2VWHA 2B5VA 3V2HA 4DA9A 5JDCC 3GVCA 3INGA 2VOJA 1GADO 1LDNA 5JO0A 3GG9A 3R1IA 1T4DA 2SCUB 4QO8A 4R1SA 4WLNA 1XQ1A 4YVFA 4BO2A 1P45A 4XX0A 1FMCA 2Z95A 4F45A 1K6XA 3GLQA 1I32A 2D1YA 3NDRA 4XZ3A 3I6QA 3WB9A 3BMNB 3JTMA 3V1UA 3MOGA 4E0BA 3PTZA 4HXYA 5COQA 1KS9A 1IUKA 1Q1NA 1B8UA 3M1LA 4NPCA 3BIOA 3TWOA 4BNFA 4JROA 4ZQHA 3ZHYA 1RYDA 4BO1A 1DXYA 3VPHA 4GPD1 3L4BA 4HP8A 1SPXA 2GYYA 3HN2A 4R1TA 3GFBA 3FNHA 1HLPA 1DJNA 4IS2A 3KO8A 3JSAA 4KTVE 4PLVA 1PJSA 3QWAA 1Y8QB 1E3SA 2OORA 2Y1DA 3GVXA 2IXBA 1KEWA 1BMDA 1UXGA 3ITDA 3T7CA 1HF3A 3PXXA 3LF1A 1YOVB 4KWHA 4OM8A 1ZFNA 1BSVA 1BVUA 1JN0A 4HWKA 3PK0A 3NV9A 5KJ6A 5KJFA 3KXDA 2SCUA 3DBRB 4M55A 1E6EA 3ICCA 2CMDA 1QYVA 5EPOA 3V1YA 1PJLA 3D3WB 2PLAA 2ZYDA 5EL0A 2AEJA 2FOIA 4J0FA 2J3JA 3QQPA 3H6KA 1GUFA 1K89A 1ZIDA 3OA2A 3PYXA 3WG9A 1A9ZA 2EWMA 2F00A 1P1FA 1UDCA 3WR5A 2NQ8A 4B3JA 1S7CA 3T4EA 4TZKA 4XGKA 2E49A 1B3RA 2C07A 2WD7B 3JQFA 3R3JA 1MC4A 3PYMA 3W8FA 4UVEA 4IZHA 4GLLA 4XWYA 1ZO8A 3GF4A 3WGZA 2O4CA 1D1TA 2D5CA 2VN8A 5C7OO 2WMDA 3OIFA 1PWZA 2I67A 1I10A 2B4RO 4AJOA 2DU8A 5KJCA 1VSVA 3S2FA 1H2HA 1HYGA 1P33A 8LDHA 2NLOA 1Y8QA 1YQGA 2PK3A 1T26A 3QVSA 3L4BC 4E21A 3E03A 1I2BA 3ZNPA 4PG7A 1YOVA 3WGGA 3KTDA 5EQFA 1L7EA 2DUWA 4FC7A 4FJ1A 4YQYA 4ALIA 2O3QA 4DQVA 1IB6A 1LRKA 2Q1TA 3OJFA 4JIGA 3DBRA 2PGJA 4W9NC 1NYTA 4IMPA 1VJ1A 2H63A 5EERA 2V7PA 1Q0QA 3D3WA 1H9BA 1V3TA 3H9UA 3AI3A 4IXWA 4J43A 4XDZA 2YV1A 1ZSVA 1YVEI 2WM3A 5I9MA 3WS7A 1GFSA 1QMGA 1KVRA 4Y6RA 3ZV3A 5HRUA 4CM9D 4CJXA 2D5AA 3F5QA 1ONOA 4XCVA 5CEEA 2DM6A 2X58A 4Z0TA 4JP2A 3QWFA 5IDQA 1NFQA 3ETGA 1XYGA 3ZV6A 4PRKA 5A1TA 3UGKA 3EUWA 1VI2A 3DOOA 4JX8A 3SLKA 4M8SA 1N1EA 2ZB8A 4N5LA 1UDAA 2IDZA 4OKIA 2NU8B 3E5RA 5G4KA 3DWFA 4E5PA 3LC7O 3JYLA 1YDEA 1R12A 1NWHA 1PS8A 1WVGA 2YHUA 1YQXA 5F5LA 1DIAA 3ZZNA 8ADHA 4PLZA 4PG6A 1DC6A 1YGYA 3JQFC 3R6DA 1VRWA 4IQ8A 3TRIA 2RAFA 3S55A 5FI3A 1K6IA 4UREA 1FDVA 3IMFA 4GWKA 4DIOA 4O59O 3RI3A 1UAGA 1H6CA 1R6DA 4M86A 3SLGA 3VC7A 3W4JA 1LC0A 2JCVA 4Q3NA 1HE3A 1NBOA 4AICA 3PGXA 4E4YA 4MVJD 1Z74A 3SJ7A 2Y1FA 2VWQA 4NFYA 5I8WA 1HT0A 1HEUA 1G0OA 1U9JA 1UP7A 3CH6A 3F47A 3FPCA 4J6FA 4WEOA 2DTEA 4WASA 4INAA 1T2DA 4W82A 3BMCB 4IDFA 1M6WA 3LF2A 4UAGA 5JYDA 3CE6A 1N92A 3COSA 3FR8A 3RCBA 2LDXA 3K6JA 3DR3A 3DZBA 3WSVA 5JS6A 1NWCA 2OBNA 5I7VA 3N58A 4XKJA 3ICPA 3CUKA 1BGVA 1OFGA 1PZHA 4WE3A 2Y0EA 2VYVA 2NU8A 1UH5A 3ROMA 2UVDA 4DTIA 1SEVA 1I2CA 3AU9A 1YL6A 3OM9A 2X22A 2B36A 4NK4A 3RASA 5JMWA 1W6UA 2D59A 1DBVO 1X1EA 4BNYA 3VZQA 2W90A 2BFAA 2Y1CA 4BIIA 3U62A 3OJEA 2GCGA 4R69A 2QYTA 3HN7A 3UOGA 2VRBA 3DBVO 3OBBA 1LA2A 2FRDA 3NDIA 2X86A 3K92A 1EVYA 2H9IA 4CL3A 4CM4B 4QQRA 1UAYA 2NVWA 1NAHA 1YO6A 3JQBA 3RC7A 1ZJZA 4TKMA 4DYVA 2EW8A 3U0BA 3O9ZA 1RJWA 1PEDA 1O6ZA 3F6YA 2IZZA 2Y93A 1XHLA 2FR8A 5B12A 2EEZA 3CXRA 5TJHA 5KNLA 1KVSA 2DBQA 4TZTA 2DQ4A 3BA1A 4FQ8A 1WWKA 5JC1A 1I8TA 1VPDA 4TRNA 4BNXA 2B37A 3RQSA 3CSDA 2YW9A 4C4OA 3IP3A 4DQUA 1SB8A 4RPJA 3F4LA 3PIIA 4UUPA 2D8AA 4HV4A 2WDZA 1XWFA 4QT0A 4BNWA 3MWEA 3W8EA 2X5KO 4UUMA 2J3HA 4RF5A 4IDGA 3W4KA 2QYSA 3M1AA 5H83A 5JLAA 1YKFA 3L6DA 4S1VA 3U49A 5GZ6A 3PHJA 2A92A 3KSUA 2A35A 5KVSA 1ISFA 1LDGA 5JNLA 3BMQB 1QR6A 3FSRA 3BAZA 1JVSA 1OC4A 1ZH8A 1C0KA 3ZWAA 1O94A 1EUDB 3VDQA 5TRTA 4CM4A 1AXEA 4TROA 1BVRA 2QZZA 3FF4A 3W6ZA 3GEDA 2PV7A 1ADCA 3SC6A 4NJMA 3I9LA 2BI7A 3Q9UA 1OMOA 4MKXA 4OQZA 3KHUA 2D3TA 4OSOA 2BKAA 2YYYA 3L4SO 2ZQYA 4XIJA 2YFQA 3OQ6A 2JD1A 1E3WB 4YRBA 1E5LA 1E3JA 5JAMA 5CEJA 2FSVA 2PD3A 3JQBC 4U0KA 2AE2A 2PZKA 1CWUA 4NG5A 1JDJA 4ZHSA 3U4CA 2EKLA 3A4VA 2B83A 5JCJA 1IPEA 4A0SA 3AI2A 4BB5A 4BS9A 3DZGA 2NUAA 4OOEA 2ZB7A 3ZU4A 1GEEA 3MWDA 2RIRA 3IQDB 4BO9A 2Y0CA 4BUCA 3BTOA 4RF3A 1DLJA 4HFRA 1U2DA 4HFJA 1JQBA 4CMKA 5DCYA 3VH2A 5EJ2A 2I3GA 3BMQA 2PD4A 3DFZA 4HNGA 1NP3A 4RDHA 4BB6A 1IPFA 4G2NA 5DBGA 5T64A 1EUDA 4GKBA 3WGTA 4AJLA 2C2XA 1HXHA 2NTJA 3FWZA 4DPMA 1J4AA 1D8AA 3FN4A 4JBIA 2HMVA 4WLEA 3PRJA 3KETA 2Q4EA 3JD0A 4QTZA 4D45A 1KEUA 1ZK2A 2GNAA 1CDOA 4GGPA 2CDCA 3QIVA 3NJ8A 3PQFA 4DC1A 4EEZA 1A5ZA 5KIAA 4FIZA 3WNQA 5ITVA 3ZV4A 4EW6A 3LT2A 1E3WA 5L3ZA 2BLLA 4ALKA 4GH5A 5L53A 1GD1O 3EY4A 4DGSA 1EDZA 3DBLB 3O38A 2H6EA 4KDFA 4DUPA 2NU9A 4PFJA 1XGKA 1SBYA 4LMPA 4YACA 2PZJA 1B14A 1Z73A 4XYMA 2GZ2A 5L45A 4FOOA 5F3RA 3ZWNA 1YB5A 2GUGA 5ILOA 2HK9A 5CDSA 1ZZEA 4IINA 1LQTA 5C7LO 3G1TA 2C2YA 4PGFA 3O26A 3JV7A 1GY8A 2ZCUA 4W6ZA 1SCUB 2A4KA 3E8XA 2P9CA 1Y5RA 4XYLA 4BL5A 5LC1A 3EZLA 3GNTA 1EVJA 3Q3CA 2CFCA 3JQAB 2X0NA 4UEJA 3ZI0A 3MOIA 5DP2A 4PG8A 5K9ZA 4F46A 3OETA 1BDMA 3ZU5A 1YRLA 4EGFA 1DDOA 1KETA 5G0TA 1Q2XA 4D44A 1GYPA 3CZRA 4DYDA 4E2YA 1PL6A 4B4OA 1GYQA 1K3TA 1E1MA 1E7SA 2ET6A 1ZW1A 1C14A 3IDSA 1J0XO 4W99A 4BNKA 2A94A 3DC2A 1E3LA 2JL1A 3I9KA 1BG6A 3NTQA 1JU9A 3F5SA 5CG2A 3CZMA 4CMCA 4WNCA 5THKA 2JAPA 4JP3A 3KLPX 4OGWA 3GUCA 1Y81A 4KOAA 3P19A 4OO3A 3DBLA 4L4RA 5L4LA 2PTGA 3DTYA 3QV1A 5BR7A 1ISMA 4XGNA 1HDGO 3BTVA 2BD0A 4LRSB 3PWKA 5I9NA 4CPDA 2O7QA 2NQTA 3TZQA 4BNIA 2CUKA 3K31A 4JCOA 3WYBA 3DZHA 3ZWOA 1PTJA 2BFMA 2G17A 3Q9NA 1R0LA 3ZDFA 3I83A 4LK3A 3GOHA 3AUAA 1SCUA 1KYQA 3I9NA 1ZSNA 3PI7A 4NFHA 1J6UA 1LXCA 3AWDA 4BGEA 4DXHA 3DEYX 4UVIA 3JQAA 4ALNA 4FOSA 5HS4A 3TZHA 2DKNA 4CM8A 4EUHA 4MINA 3U4DA 2YY7A 3K9QO 1ID1A 2RHCA 2DTDA 4R16A 4XQCA 3H5RA 1R66A 3GEMA 3MJCA 4E5YA 4Q3EA 4D41A 5CDTA 1GPDG 4LGVA 2R6JA 4I9UA 2AQHA 1A71A 3RBXA 3CPSA 3QP9A 3GEGA 1E7QA 4GBJA 1C1XB 3DHYA 3IL2A 3IKVA 5KJ1A 6LDHA 5ICSA 3DMYA 1GCOA 3UH1A 1LRJA 5KCZA 3OHSX 4PLFA 1C1DB 4TRMA 1WAMA 4DBVO 3OIDA 5JC8A 1YBVA 4DMMA 4J4TA 1E7YA 1U1IA 4EYEA 2ILTA 2POQX 4BQRA 1CQJA 1ULUA 3KBOA 2ZJ0A 3BXXA 4XD2A 3WSWA 4MKRA 1NTOA 1U8FO 2RH4A 4PVDA 2GZ3A 1Y7TA 5IXSA 4YJHB 4QO7A 3VZPA 3GY0A 4E5KA 1CQIB 4IBOA 4R3NA 4Y98A 3EVNA 3QWHA 4CMEA 1UXJA 2C29D 3E9NA 4A7PA 1Z82A 4R5HA 4LSWA 1YBMA 4HUJA 1FDSA 2FPIB 3RBZA 4XB2A 4ZQBA 1YDWA 2JD2A 3MJ4A 3TSCA 1M67A 4FN4A 1V6AA 5FF9A 2V6MA 1NX6A 5FFFA 2YZ7A 1HDOA 4Q3AA 1T1RA 3U4IA 4C7JA 3C24A 4J7UA 2OP1A 1KVUA 1PQUA 5CEFA 1DHRA 2GASA 4AJEA 1WW8A 1N9GA 3MJSA 1K5HA 2OUIA 3OEWA 5ITWA 1XU9A 3H65A 3V5NA 1PJBA 2O4UX 2Q46A 1LTHR 4MVJP 1E1LA 1PJQA 1ZMTA 3WGQA 5KKCA 3U3XA 3V2UA 2GERA 4BNHA 4YJHA 5TSDA 1P1RA 2X9GA 4JJGA 1CQIA 4CQMB 5DT9A 1GPJA 3GAZA 5GZ3A 1C0PA 3NKLA 3Q1LA 4L74A 4MKZA 1LSSA 4Z9YA 4BQPA 3ZCXA 4YR9A 4D79A 3GR6A 5TT0A 7ADHA 2FPIA 1I3LA 2ZB3A 4W4TA 4A27A 4UVHA 4BV8A 1LLDA 1PR3A 2BFOA 4MPDA 3OSUA 3PEFA 1X7GA 4ROSA 4CMEC 4IGFA 4MIOA 1SC6A 1QKIA 2WYVA 1OC2A 1MG0A 1PS0A 3A9WA 1C0IA 4WLVA 3WQSB 4AJNA 3OQBA 1Y8RB 3RU9A 1QYCA 4IQGA 2FN7A 4MJLA 3WYEA 3HQ4O 1ZK0A 3VVCA 2P4HX 3ANMA 3F1LA 3ZHXA 2AXQA 4TKLA 4BNMA 2O50A 3SX2A 2O3JA 4H15A 1E92A 3DZFA 2HJSA 4XIYA 5JDIA 1VLLA 2J6IA 3GDGA 5L9AA 1LC3A 1N7GA 4I5GA 4AJ4A 4Y9DA 4CV2A 4FD3A 4EJMA 3I6IA 4XX0B 4LVCA 4BNUA 2G82A 3L07A 2PR2A 5DZSA 3PGJA 3UXYA 4IPTA 2DTXA 3BHIA 4CQMA 4YJFB 2FZWA 5H81A 1CRWG 1B15A 1WZEA 5FEUA 1WDMA 1DIHA 3S2GA 1DRUA 3I1JA 3D4OA 3MTJA 4XYBA 4L76A 4URFA 3VPFA 3VPXA 3CMCO 3O8QA 5F1KA 4CQLB 2QG4A 3T7EA 1R4NB 3DZJA 4IS3A 2TMDA 5DP1A 3B1JA 2P91A 1RPNA 1FF9A 5A05A 3VH1A 4PN3A 1LDBA 3JYOA 3Q2KA 1TXGA 1TT7A 3OICA 4R01A 3WJ7A 3I5MA 1WMAA 3SVTA 1Y8RA 4GGOA 4LN1A 1SOVA 4KMSA 3ZWMA 4J0EA 4Y67A 4E31A 2Y05A 4YT4A 2JAHA 2YHIB 4YDRA 4XEHA 4G5HA 3E9MA 2BH9A 5JXWA 4XB1A 3NGXA 1MV8A 1HZJA 3DMTA 2PH5A 4J3FA 1RYEA 5EN4A 2Q3EA 4HADA 1C0LA 2UAGA 3E82A 4F3YA 1B26A 3RUIA 3WGIA 1GQQA 2IYOA 3RVDA 2RH8A 4MVJF 2F1KA 4O63O 1NR1A 3DTTA 4HY3A 3F9IA 4YJFA 4Z9FA 4AJHA 1GAEO 4ND5A 3WBBA 3IJPA 5JPIA 5A5FA 4CR8A 1NQTA 2C59A 4FSHA 3P7MA 2HU2A 1MUUA 1XKQA 5JY1A 4B7UA 4FFPA 4CQLA 5TS3A 4Z0PA 1R4NA 3CMMA 2X6TA 1WNTA 2Y1GA 5L40A 1P44A 1UP6A 3JQ9C 2QZ9A 4IIUA 3NRCA 4ND1A 3PQDA 2CDAA 3IUSA 4XRGA 4L75A 3RBVA 1UDBA 3AJRA 3N7UA 3QVWA 4IJVA 5H82A 3D4NA 1I5RA 5IXYA 3OQ1A 5IAAA 1NFFA 3PDUA 2YHIA 3E1KA 2B69A 3ITKA 3K30A 3QVTA 1DFIA 2CSUA 3NX4A 4XJSA 4Z3DA 1EVZA 4P8RA 3ZNQA 3I9OA 1O0SA 3C1OA 3D7LA 1H93A 1Z7BA 3EMKA 2ZB4A 2BHLA 4ND3A 3WLEA 1PJCA 1KC1A 1SO8A 3WTBA 4MVJE 2X9VA 3KUXA 3GHHA 4AFNA 1N8KA 5T57A 4Z0HO 1KY5A 3GRPA 4M54A 4AG3A 1KOLA 4CMBA 3AUTA 2EKPA 2J5QA 1VL0A 2DT5A 4WLFA 2BGMA 4MDHA 2C20A 2C82A 2FPGB 1LLCA 3JQGB 1Z7EA 4FJ0A 4HX5A 4PCVA 3A28A 1BXKA 5AOVA 1PZGA 4D0RA 2A9FA 4DQXA 2HMSA 3IAHA 3RSHA 4D3FA 4EBFA 1R37A 3W8DA 4RGBA 3V2GA 4OXNA 4AVYA 2JHGA 5IJZA 2BMAA 3WGOA 4MIYA 5G4KB 2FWMX 4OHUA 1PIWA 3JD2A 4EJ0A 2EJVA 3MZ0A 3KB6A 3VTZA 1HKUA 5JAZA 4EUFA 3G3EA 3MEQA 3H8VA 4YAEA 4IDDA 1E6WA 2EXXA 3GHYA 4D3DA 2I9PA 1NNUA 1PU2A 3QLJA 1W8DA 1AHHA 1BWSA 5EINA 5U9CA 3EVTA 4NQZA 4ZQEA 4Z9XA 4C7KA 1ONPA 4UEOA 2DUUA 4ZD6A 4LVUA 4YT8A 5IZCA 3HHPA 1JLLB 1KVTA 2TMGA 3GNQA 4G81A 4M1QA 3HFGA 1DAPA 4WNIA 4BNGA 3DAPA 5CFZA 2PA3A 5F1OA 1Y5MA 4MVJM 3B20A 2XAAA 1IOLA 1PQPA 1DFGA 1GV1A 4AJIA 3VZRA 4RVUA 1P1JA 1NPTO 3IUPA 2FPGA 3JQGA 3GG2A 3GGGA 4NHEA 2OZPA 4OYRA 1TI7A 1Q0LA 4E2XA 4OH1A 2QRJA 3QSGA 2W2LA 3ETDA 5AQ1A 3X2FA 1O89A 1DIGA 3R0IA 4KQWA 2V6BA 1JWBB 3DAFA 3H4VA 1ZXBA 4YYZA 4ZA2A 1GQ2A 4J7XA 1ADBA 1WDLA 3LU1A 1Y1PA 3FPLA 5BNTA 1ZJYA 3VH3A 1T4BA 1WLYA 1WPQA 1JLLA 4CM9A 3MJVA 2O2YA 5MDHA 4K28A 1DRWA 4XR4A 3Q2IA 3L0DA 5EIOA 4QSMA 3FRJA 5BQFA 5KVCA 1B3BA 4II3A 3UKOA 3PHHA 1G0NA 5IZCC 1BHSA 3GRKA 3ZHZA 1JTVA 2NWQA 4LCJA 4BV9A 1H6DA 3RIHA 4QUKA 2VNSA 3GGOA 1VJ0A 1ZKMA 5A5EA 4EZBA 4KUHA 2DVMA 4RLSA 2X0IA 1PZEA 4J2OA 1HE5A 4J1NA 5HBRA 3MWEB 4R54A 1JKJB 4AJ1A 3KZVA 1AUPA 3PPIA 5B4UA 3GAFA 4D3SA 1EBUA 1J49A 1A72A 1LX6A 1NR7A 4GX2A 1DC4A 1E6UA 1NQAO 3VZSA 4XQGA 3LT1A 1HE4A 4OJNA 5F5NA 1OI7A 3UUWA 4J90A 2JCYA 4TVBA 3ZWXA 1Q7GA 1FK8A 2ZIZA 4ZJUA 4BNLA 3NT5A 1ADGA 3HADA 4OOFA 2CVQA 4IGEA 2VHXA 3S8MA 1HLDA 2NADA 3DAGA 4NJMB 4PLYA 1GZ6A 4JN6B 4Q9NA 1GR0A 1U3WA 4WPGA 3KLMX 4BNTA 1X0VA 5DCWA 1YS4A 3EZYA 3KYDB 2I6TA 3JQ7B 4Z3KA 2AQKA 5EESA 4IMRA 3HB4X 3JYPA 4JXKA 5ENDA 1UXIA 9LDTA 3DB2A 1BW9B 3PQEA 2DFDA 1HDXA 3ZNNA 4B4VA 2DBRA 4HNHA 4NU6A 2VT2A 2EKQA 3R3SA 2E48A 4R1UA 2FR1A 4PVCA 3C7AA 3QY9A 4OXKA 1CEQA 3GT0A 4JBGA 5CDGA 2E37A 2X23A 4PLGA 5DOVA 4YT2A 4YQZA 1JKJA 3ZU2A 2NUAB 5BT9A 1NXQA 3MWDB 1YQDA 5L95A 4Z6KA 3WX0A 1A9YA 3M6IA 2BRUA 2OBYA 2AEMA 3L6OO 1OZAA 1XEAA 2IEBA 4YJGB 4LRTB 3UW3A 4IZIA 1LI4A 7MDHA 4WEQA 5A9RA 5CPFA 4B4UA 1T2AA 5C37A 4FR5A 4QXMA 4AL4A 1C3VA 4E32A 5JFOA 3ETEA 3BMOA 1K0UA 1HL3A 1QLHA 3PDJA 4NK5A 3IKTA 1YBAA 3LSYA 2YDYA 3CEAA 4FPXA 3HJAA 3WGHA 4FB5A 3C1AA 4BNVA 3WIEA 1FDWA 5ER6A 4MP8A 3KYDA 4O1MA 5I7FA 1GDHA 1DAOA 3JQ7A 4ZU3A 1P1HA 1E3IA 3AY3A 5F21A 4TQGA 4KTTE 3PWSA 1BW9A 4NIMA 3OF2A 2CF5A 2WEKA 1IHYA 4BGUA 2NU9B 2X4GA 4TRRA 5JO9A 5JAIA 5FYDA 1X1TA 4FGSA 3VVBA 3ASVA 4R1NA 3UCEA 1PGJA 3MCVA 3OJOA 4NZ9A 3SJUA 3DBHB 4CM5A 1R0KA 3P2OA 1N7HA 4ZVVA 1DB3A 1GL3A 2I99A 4RLHA 4YJGA 1PR9A 3ZWCA 3PHIA 1ISHA 3G1UA 1YJ8A 1R4MB 2FZEA 1DIRA 4FFNA 5CG1A 4YTEA 4IDCA 2HO5A 1V8BA 2Q1UA 4WCFA 4CM1A 3DHNA 4LW8A 4N5NA 2VNAA 4I5DA 1Z75A 3SC4A 2R2GA 4MP6A 1F17A 4BKUA 4K26A 1HDCA 2HK8A 4WJZA 1LBEA 2OOSA 5FI5A 5JY6A 1KC3A 3PWZA 3OIGA 3S2EA 1T24A 1ZK1A 4I5EA 2OXIA 1M66A 1ZNQO 4OQYA 3FCOA 4PIVA 2YJZA 4YA6A 3WOHA 3HUDA 4CR6A 2VCYA 1SAYA 3IOYA 4S3MA 2V65A 3PFFA 3G0OA 1ISJA 1HSOA 4NNJA 4A73A 5LDGA 3QWIA 5CDYA 3HZZA 2Z1NA 3RKUA 1QYDA 3AI1A 4R68A 3ORFA 5I8ZA 3DBHA 1PX0A 2GRAA 1XCBA 2O2SA 1DEHA 1XG5A 2EP7A 2VZ0A 2UV8A 4WK6A 2HKIA 3UN1A 4E12A 2J5RA 1HTBA 2G5CA 4P38A 3FNFA 4BNJA 3RROA 5AXCA 5A9SA 4PZEA 1R4MA 5A06A 4FGWA 3TFQA 3H9QA 4OXYA 4FCCA 3TZKA 2IZ1A 1E5QA 4DLAA 3GVIA 3AFNA 4RCVA 4DWVA 2O48X 3M2TA 1RM4A 3AOEA 4B3IA 3TOXA 1UJMA 5AXDA 4CM8B 2XXBA 2FPPB 1IZ9A 3ONFA 1ZK3A 3EC7A 1YB1A 4B7XA 2J8ZA 4RPHA 5IN5A 4O5OA 3JQ8B 2VHYA 3GZ4A 4LCEA 1T25A 4NU5A 1U7HA 3BTSA 4YT5A 1L7DA 4N54A 2HRZA 1XQ6A 2XXJA 4PLCA 3AM4A 4IIVA 1M76A 2AQ8A 5GZ1A 3RFXA 3DDNA 4R3WA 3RU7A 3UICA 3QA9A 2PGLA 3H2ZA 2XPCA 3OJLA 1Y9EA 1U5AA 2Q49A 1UZNA 3ONEA 3TL2A 4H16A 3RFTA 1W73A 1QV6A 2AG8A 3HWRA 5TJ9A 3AW9A 3AY6A 1TB4A 1I33A 2Y0DA 2B0JA 2VZ8A 3PLRA 4GMGA 3VPSA 1OBFO 3HE3A 3K2BA 3FTPA 2NVUA 2VYND 2B4QA 4UULA 1NASA 2O23A 2RCYA 3I3OA 3NTOA 1CQJB 3OJ0A 1YH3A 4ZN6A 1KIFA 4NBUA 4ALJA 4RVFA 3D0OA 1S6YA 3I4CA 4P4LA 4JGBA 3RC9A 1H94A 1NVMB 2FPPA 2BGLA 2ZQZA 1HWYA 3JQ8A 3DZKA 1ZVMA 5JW6A 2E82A 4WOKA 2O3RA 1JKIA 1MXHA 3P5SA 3AOEC 5JMPA 4BHTA 2PZMA 3PJFA 3DOCA 3I4FA 4Y6PA 3GVPA 3ZU3A 3G17A 4M49A 1EE9A 5G0SA 3LQFA 2NM0A 3ON5A 1I3MA 2Y67A 5ENVA 1N9GB 5CDUA 3GN1A 1I0ZA 1ML3A 5COAA 3UCFA 5KTKA 3K8ZA 1I30A 4CMJA 2VZ9A 2DFVA 3H5NA 2NACA 1HDZA 3A06A 4R9SA 2WWRA 4YAIA 1LEHA 3ONDA 4OKNA 5B4TA 3TQHA 1MGOA 5L51A 3QRWA 3FWNA 1XIVA 3EHEA 4PZCA 5LCXA 1X0XA 3NT2A 5DNAA 2VRCA 4ZICA 4DMLA 3B70A 2Z1MA 4FDAA 2EW2A 1A4UA 1GZ3A 2QIOA 4TVOA 5IF3A 2JFHA 1MLDA 3HSKA 3MTGA 1DIBA 3NGLA 4J9VA 2X0JA 2E4AA 4RJTA 5KOIA 1UR5A 3GN2A 1EFKA 1AXGA 1Z6ZA 3FD8A 3PJGA 1H5QA 3B1FA 4MVJH 4ND4A 4E30A 4YPOA 4RVDA 2BF7A 3E9QA 4HBGA 3CTMA 1BDBA 3LYLA 2GZ1A 3WFIA 3D1LA 4GVLA 2HQ1A 3ZWVA 1DSSG 2BGKA 4CMIB 1NQ5A 3KVOA 4DC0A 4L4SA 3RKRA 3EW7A 4D42A 1ISGA 4CL8A 2V6FA 3ENKA 1P9LA 1GYRA 4BO4A 5I7EA 4AJJA 4R9RA 4XJTA 3IP1A 5T5QA 5T6BA 1EUCA 2YQ5A 3G49A 3ADOA 4DIBA 4E5MA 3K96A 5A4DA 2PWZA 3ADPA 3INTA 2WTBA 3A1NA 3HDYA 4MIEA 4KWIA 1WDKA 4DL9A 3OP4A 1R15A 4XRRA 1CJCA 4XR9A 1KERA 5THQA 3NUGA 3OA0A 4IY1A 3O8QB 3IJRA 4WUVA 4I08A 5TIIA 1T2FA 4B79A 3RJ9A 3JD4A 4MVJI 1Y9AA 1U4OA 4J4BA 2DLDA 3TDKA 4UUOA 4WCDA 3TFOA 1A7KA 2FSSA 5A02A 4JJFA 3JD3A 4J2HA 1XDWA 4GX5A 3C8MA 3JCZA 3EDMA 2I5PO 2YDXA 3DOJA 1WZIA 2C7GA 2ZYGA 1LDEA 5F1PA 3IIEA 3MJEA 4I9HA 4CMIA 3FI9A 1IE3A 2NVBA 1RKXA 5TF4A 3RUFA 2VWPA 3FBTA 1JW9B 3ZN2A 3BHJA 3WFJA 1N1GA 1PL8A 4ZRNA 1R16A 3VOSA 5ADHA 4D0SA 5IFLA 4F6LA 4PLTA 1BRMA 4FC6A 4A26A 4FFLA 4FFMA 2EF1A 2IODA 4BNZA 1VSUA 4QFCA 4U5QA 1D3AA 2HLPA 4TSKA 2Q50A 2I65A 3RC2A 1U5CA 3DO5A 5CHEA 5CP8A 1ZEMA 1DLIA 2OO5A 5EQDA 3SEFA 1F12A 1K2WA 4CLOA 4CMAA 1SB9A 5T67A 1CF2O 4DRYA 3HFSA 1X7DA 3WGYA 4OL9A 1B8PA 2QX7A 2X1HA 4GAEA 4UEKA 4FW8A 3C7CB 4N5MA 1GEGA 2I3AA 2X8LA 3WXBA 4EJ6A 1PWXA 4L4XA 1KVQA 2EV9A 2DC1A 4XDYA 2EGGA 4TRJA 3JYNA 2X5JO 4B8ZA 1U2GA 3FTNA 3WTCA 5BSHA 2VQ3A 3KSZO 3NEPX 4XA8A 1P0FA 5T8KA 3VKUA 3DXFA 1BXGA 2VTEA 3K73O 4RPLA 1XR3A 4G65A 3H2SA 2HJRA 5L4NA 1T2CA 1LSUA 2GDZA 1IZ0A 4PG4A 2I66A 3UF0A 3ULKA 1Q0HA 1LUAA 2VOEA 5C3MA 3ZV5A 4EUEA 2NU7A 5DBIA 2ZJ1A 4NBVA 3GZNA 5JDIC 1PSDA 2CF6A 1Y6JA 1EK6A 3GMSA 2J5KA 2WYWA 2IE0A 3JYQA 2B35A 3OECA 4KDEA 5HA5A 2D4AA 1BTOA 3RJ5A 1W4ZA 1V0JA 1QYXA 4NI5A 2EG9A 4ALLA 4BGIA 3QE3A 3ANLA 3JQ6A 4RDIA 2C54A 3S2IA 3QVXA 1CIVA 1V3VA 1M2WA 1NAIA 4RF4A 4KUEA 2B4TO 1YE3A 2GN4A 5ER9A 1JWAB 1QYWA 4J9UE 1DFHA 1MB4A 3ABIA 2BI8A 3WMWA 3ZWPA 5J23A 4OAQA 1PGPA 5HS6A 1PS9A 5DBFA 5AXBA 3W4IA 3KV3O 3HDQA 3PHGA 3VH4A 1E77A 2VHZA 3WYCA
chains in the Genus database with same CATH superfamily
2IVZA 4HDNA 4A91A 1V11A 3QOXA 1SOWA 1Z6GA 2C5BA 2Z5LA 1L4YA 2IGTA 1QTNA 3INRA 4DE5A 3KKLA 5H9VA 1PRYA 4ZQFA 521PA 5E6UA 1F6WA 2BT4A 3CZ5A 3L77A 1EXWA 4NBKA 5EIBD 3RSFA 4AY5A 2FK7A 1L5HA 3WYFA 5EE0A 3E48A 1CZNA 2WIJA 3FFAA 3DONA 3KKEA 4G0UA 4MRSA 2TRSB 2JKVA 2Q3LA 1B8NA 4L16A 4JYCA 4MSUA 2IYAA 5ALFA 5PGMA 4EWLA 4AX4A 1XPUA 1JFLA 4GX0A 1COWA 2NZYA 1I5EA 1PJTA 1FRQA 3LDHA 1O4VA 9LDBA 5KWEA 1H4SA 4MGKR 2B20A 2W4QA 3HO6A 5FPHA 4BJ5A 1P1CA 3FNEA 3DDZX 3A2NA 4HPJB 4BTEA 5KOJB 1XNJA 1D0IA 1OKKD 2WWXA 3JW8A 1ZHHA 3NWEA 1QYIA 4G9EA 4GKVA 4JB8A 2WZCA 4LTMA 2WSBA 5DX8A 3TRJA 4CV3A 1EMDA 4PYJA 2DX7A 3GRYA 4Y6SA 3LVFO 1KI4A 1IRXA 1L7XA 3L8EA 4LDZA 5E7JA 5SZJA 4WRRA 2B4YA 2HNBA 3GDOA 3M3DA 1DE0A 5EE9A 4YJKA 4AZ3B 2G04A 1G5RA 1VKOA 1VGQA 4EJSA 3HN6A 3H7AA 2ZK7A 4OPMA 3M6UA 3PUWA 4Y2HA 1LDYA 1T36A 2V9PA 2VNHA 4QXPA 3WXMA 4C6RA 4BC0A 5BNZA 4BMNA 3HNPA 2I78A 3BD7A 3A6LA 4V0MA 2RONA 3B7GA 4JJKA 4O4HB 4AWBA 4ML3A 1DDIA 3MQ4A 3EAFA 4LHZA 1W34A 4GWGA 5CLQA 3UWDA 1TO6A 3NI2A 1CR1A 2COKA 4CGZA 3FBGA 3FNGA 2JIBA 2M9MA 2UZ3A 5TX7A 2OLJA 4WGFA 3D8SA 1S2MA 3A4YA 1EEXB 5E2IA 2Q8NA 1GNLA 4G0PA 1NUUA 1UZMA 2FQ1A 2ISQA 4GM4A 4UVDA 4QUDA 1X1SA 1XA0A 5SZIA 1MC5A 3UMFA 4IH9A 3FOEC 2J3MA 3E4DA 1PGQA 4DLKA 1DC5A 4RL4A 4J16A 5E6SA 5B2FA 3C3KA 1Q7CA 3PGKA 4CHTA 5IHPA 3AKZA 2X13A 5SICE 3FAZA 1JDBC 4EO4A 5KO2A 2CLFB 4FFWA 1FZTA 3GPIA 3IPXA 4R4JA 1QONA 5E4FA 2VEDA 3SJAA 1QG4A 5HF5A 4RC9A 3D3EA 4MPRA 2ZRJA 3Q9SA 1JXMA 4WSOA 5DSZA 1RCUA 1TMYA 1UZLA 2CBZA 1HDYA 2HMTA 2P65A 2HRRA 3M34A 3L8MA 2INGX 1OBOA 4HDQB 4IQ0A 2QEQA 5JYBA 1CVLA 2OBMA 4LV8B 5K3EA 1EUZA 3H0CA 3JR7A 3BB4A 2JA1A 3JQEA 1CW2B 4QECA 4FD2A 4Y0VA 1B7GO 1EDOA 3SBOA 3VR5D 2DEUA 1TYDE 1XU4A 3ET5A 4EQ6B 1D1SA 1OI2A 1RYBA 2WD8A 5JG7A 3B5IA 3NJ4A 2I76A 1XLTA 2SHKA 2ZYVX 4JLBA 4NEGA 1SCQA 1TEXA 1XBTA 4RETA 3SF8B 4R40A 4EJSC 3C74A 5DH9A 4LWOA 1C8LA 1Q83A 2I2BA 2AWNA 2B2XA 2BIFA 2Q5HA 2Z2ZA 4L50A 3WRYC 3Q6NA 1KDTA 9ATCA 1UOOA 3B1VA 3KEQA 3DZIA 1M8GA 5MN6A 1CJSA 4QE3A 4CU2A 2VYVD 4LJ6A 3KEFA 1DKUA 5KDLA 4ZZ0A 1B6GA 4BE9A 4MVJG 3CU5A 1MH9A 1M72A 1SBZA 1XEWY 5CA1A 1GZ5A 1YR1A 1XRNA 4KXNA 3F67A 3AM5A 3U5ZB 4FB4A 3K94A 5HDQA 4K86A 4TSFD 3WK8A 5KQMA 2JFZA 4DIFA 4U6QA 5J2TA 4YPFA 1F8UA 2HRQA 1M7HA 4JNKA 4OFXA 3IQZA 4QBKA 1Q7BA 1WPGA 2QD5A 1HZZA 1JE0A 3R9KA 1EX6A 1GPKA 1M0TA 3T1HB 2GLXA 3H9EO 1A77A 4PGHA 2C4MA 4RJKA 4J16C 4JENA 2E7ZA 4DJFC 5KYVA 3LLSA 3E4CA 3ZE2B 1TAGA 4U2EA 4N01A 1KP9A 2V98A 3GNSA 3RO7A 2PXAA 1M2KA 1OH8A 2V7TA 2R8XA 5LXTB 1LQUA 5DEIA 1H3NA 5SY6A 3RYTC 3MWYW 4BB0A 5C5IA 2PO5A 1SCNE 3DCNA 3AUYA 1W5EA 3BK2A 4GO1A 4AJ2A 1N1DA 4PZZA 4NBSA 3B3FA 3UMSA 2V5UA 2A9VA 3A3YA 2VDMB 3OCVA 4JC0A 1CR4A 4P58A 5DT2A 1FDRA 4BE7B 4ECAA 3HTXA 5A4FS 1YL7A 3CISA 2ODBA 2VATA 3OX3A 1SR8A 3B85A 3TINA 1FUYB 3SEZA 3PGMA 4PYKA 1ZD3A 5FYQA 3TVYA 3COVA 4GMXA 4HATA 1VKNA 3C8UA 3WVNA 2I71A 1WV0A 3O0DA 3L02A 2JCGA 4NH0A 4EQZA 1B1CA 1XLTC 1ZW6A 2IHBA 4EMBA 3KSDO 4YWJA 2PSDA 4BUJA 2ZVJA 3D5QA 2ZJ4A 1YWGO 3VR2A 3E6AA 1RWQA 1NG9A 1DEXA 4NMHA 4L78A 4YV7A 5K7SA 3KXLA 3AILA 5F9MA 1WP4A 2VF2A 4BOYA 4X85A 1B8VA 2WE7A 3GLVA 3ZW8A 4DW8A 1EFTA 3O3NB 3Q0EA 3WICA 4EPYA 1Q0RA 2QVCA 2OQRA 5DN6D 3ND6A 2BWJA 3C87A 3PEEA 3QKRA 3M4JA 3WBFA 3MUOA 1O94D 3BE8A 5CX1B 1NR5A 2HSJA 3U4HA 3V7NA 2XRZA 4YUYA 4EDHA 2RAVA 3PNBA 4H7PA 4DWOA 3U31A 2GVZC 4TKUA 4YJ3A 3BMCA 3FJ1A 3A2MA 2QLTA 4IZ6A 4DPLA 3UK0A 1AVTA 3OKCA 1KR5A 1XTPA 5J58A 2QHXA 1HZZC 2BSXA 2YQ4A 3HRIA 3HVKA 1BCRA 2O2EA 3Q7IA 4RMGA 3H97A 1DAKA 4WBSA 2E4YA 2ZCVA 5AW6A 3BKWA 1ZWKA 1ECGA 2GRUA 4BCCA 1N75A 3I23A 4FLFA 4BATA 4OV6B 2AN4A 3VR4A 4QVIA 3KWLA 4RVSA 4BGDA 1A2OA 4RQBA 4C0KA 2JD0A 4M1KA 5FPQA 3IV6A 5D01A 1TGYA 1JJFA 1U7XA 3CF0A 3Q0IA 4IIYA 3U7IA 2HDWA 3G0DA 1TAUA 2AA3A 4KQGA 3UJCA 2VHTA 2A2ZA 1UJ2A 2X6QA 4ARVA 3X43A 1L7BA 3JZMA 4YX9A 4KFSA 2TECE 1O58A 3QFSA 4L5JA 2VUUA 1KFKB 1Z33A 5AK6A 2BEUA 3RG2A 5KWSA 4WKGA 1W0CA 1KEEB 1C2YA 4HFMA 4PIPA 1VYVA 1IXSB 4ND8A 1HC7A 3EXAA 5A3VA 1K6JA 3DPUA 2CXPA 3R5HA 5KNCH 3JWGA 1U81A 3V1MA 1HNXB 2DWOA 5TQ0A 5HF6A 3UOWA 2ZYAA 2W11A 1XZPA 5CAEB 2H1WA 1RXYA 3HYLA 3WB2A 1FVXA 2EZTA 2KHZA 1P0CA 2YINC 5A3QA 4AMYA 5IN4A 3RVNA 5LM3A 4M7WA 5A9SB 1J2TA 2WMYA 3RSSA 2BN4A 1FFXB 3L1HA 3TQIA 4E94A 3EZNA 5JECA 4PC3A 3SQLA 3WWEA 3P9IA 2YV3A 1OTYA 2QK4A 2ZKIA 1XPJA 4H9GA 2XSZA 3RFVA 4EP1A 2IXFA 2ENWA 3NH6A 3T99A 2Y68A 4U9UA 2OYSA 2O3UA 4FDVA 4BU1A 2P1DA 3KNZA 4D6XA 2QN7A 1LSJA 1B16A 1CYDA 4PYRA 3W9UA 4F9FA 5JS1A 1RYYA 2XMRA 5F5XA 4K88A 2XCSB 2C5AA 1D09A 3FPSA 4H0NA 4D43A 1XNHA 4O2AA 2JLXA 1AZTA 3PFWO 4DNPA 4J1TA 2XMCA 4EKNB 5KWJA 4OMDA 1U4SA 1GAXA 1EX1A 3LUAA 2HA7A 3MS2A 4MARA 4YDHB 4F5EA 4YAGA 5C1DA 3GT3A 5FD8A 2P41A 1CFJA 2C4WA 2EZ9A 2OXEA 3RSZA 3TLAA 5KREA 1U90A 1E8MA 3BX1A 4L8VA 3T5PA 1E1NA 1GFWA 2CUTA 4N47A 3DE7X 4ACBA 1N8TA 4F1WA 4H1VA 3OCCA 1GO2A 1N2ZA 5KQSA 3FUUA 5B4VA 4O4IB 4BKRA 3M33A 4QGGA 2C0CA 1Z4OA 5AVXA 1CFZA 4J91A 1Z5UA 3KP1A 2QN3A 2D7CA 3AGQA 3FDXA 1C0EA 2WI8A 4HAOA 3VYRB 3GFVA 4C4XA 1QCDA 3SJCA 3TLKA 2XUGA 3TNDA 4M6WA 1IZYA 1ZA2A 3HKDB 3TH5A 5ALZA 1EP2B 4LDNA 3WDSA 2CVFA 1QV7A 4KPEC 1D7AA 4TWRA 3QHAA 2H92A 2WYUA 1CE8A 1NBIA 1P0MA 3WK5A 4DBZA 4AF8A 2PGDA 2XOKA 1YRHA 2QMEA 3HCCA 4IP0A 5F76A 3I42A 3WK7A 3M81A 2JG3A 2FH5B 3TF5A 3DE4X 1LS6A 1TECE 3U7GA 1Q44A 2FMKA 1RHQA 1TLTA 1U2PA 3UAGA 1FQOA 3H9GA 3EH2A 3GRRA 1TA4A 1TX4B 3IELA 1PL7A 3MT8A 4PYQA 4Q00A 2OLEA 4OFWA 3FG9A 3BZWA 2P5UA 2CD9A 4KMMA 5YASA 1EP1B 1N5OX 1EG7A 4EB8A 3NWBA 2JFFA 2ADFA 4DPKA 5IBPA 4ER0A 5C8XA 2WU8A 6ADHA 3PT5A 1L6RA 3L6CA 5IJ9A 4BMSA 3CV3A 3RV4A 1FUIA 3ZGYA 1YACA 3L41A 5ANRB 5DMXA 4NL4H 1I3KA 5CUQA 2CVZA 1SIOA 2DGDA 5ALGA 3JQAD 1ORDA 4O08A 5LOVF 1L3IA 1LK7A 1I6MA 3RF7A 3WV4A 5CCXA 3CVVA 1A4RA 1SXIA 1TYZA 3AT1A 5EHZA 1PV1A 5JAQA 3TN7A 5EKTA 3AR3A 2A7XA 2ONKA 4NF2A 1NVTA 3QNWA 1OWMA 1NVBA 2X2FA 5IH3A 3VYWA 3ZXUB 4C0QC 2NZ2A 3OLZA 3I1FA 3QFHA 3QE9Y 1XMOB 1PJAA 4A6PA 1WKCA 2QUJA 2R96A 4L4ZA 1H2BA 4NMMA 1LRLA 3I0ZA 5EXTA 3OHPA 4CLXA 4DN6A 2R7NA 3NLLA 2DFNA 2C5LA 1T91A 2PLWA 4IV0A 4PBRA 5CXXA 5ALTA 2OD2A 2OFPA 4M1WA 2R9VA 2Y8EA 2GN8A 2XNDD 1GPH1 2C7PA 3LBNA 3GPDG 2HCTA 3QLUA 3ZZTA 4DJJA 5KYWB 2YJTD 2O0HA 2J6BA 821PA 1XTUA 2FUG1 2JFQA 3CF2A 1V39A 2O7RA 4RQTA 4WY8A 4BN0A 3QHQA 1YHNA 1ENPA 3K1AA 1AKWA 2FW1A 4GMFA 3VPGA 2CB9A 3D4IA 4KO2S 2O06A 3NOQA 1V4VA 1VCHA 3BHMA 3EGXA 4I4LA 2BEKA 2J32A 2CY0A 2VT7A 3A1EA 2EWWA 1QFJA 4IM7A 3ZDAA 1KQOA 2JZOA 2X1VA 5K3FB 1QHIA 3M4NA 4Q7KA 1X7ZB 3O8RA 4YJ2F 5CIYA 2VYNA 2NTVA 4KN5A 1MQSA 1V2GA 2FB9A 1A9PA 2ZTVA 3K9CA 3R41A 4KACA 3AHHA 3MB5A 5DULA 3AOGA 1KR2A 5J5AA 3WLNA 4JUAA 2VRCD 3M3PA 3CWQA 3P9KA 3PDWA 4CV1A 1HE8B 1PQWA 2A9OA 4BWGA 4EG8A 5A3JA 3CUSA 3O4RA 5LMUB 1Z0SA 1FVOA 2AJBA 3V7FA 4ARCA 3IIMA 3QTBA 4PSAA 3K6SA 2ZTUA 3EFOB 3ZHUA 1WW2A 3W5CA 2PX5A 4O1HA 2OGSA 1E58A 3OE7A 4KP7A 2P7HA 4EG3A 3OH8A 2VSFA 1EB9A 3CRRA 3QELB 3AVYA 3U13A 2EDCA 4QQ8A 1FDTA 1RKVA 1SEPA 1XL0A 5F78A 1RWBA 4KYIB 1UJNA 3GFGA 3O9MA 4OQ4A 1DAHA 1HE2A 3A05A 4BPBA 4WGGA 4ZDWA 1DWOA 4GOMD 2G1JA 4UHBA 4XVQA 3KSMA 3QA3E 3CC8A 4P4SB 3VR5H 3KOOA 1T2NA 1DCKA 3BGSA 1BHQ1 3JQDA 3VKVA 4DCCA 1TKRA 1IL0A 2ZWIA 4G0OA 2QT0A 3VAZA 1W36D 3LAWA 2GPTA 1C5KA 4FQ5A 1REQB 1YMUA 2CK3D 5GV8A 2QDKA 3QVKA 4HEA6 1CZUA 3NCTA 2FEOA 2IPOA 2ZBFA 3O83A 1NBWB 4HZUA 3OIYA 3BJZA 3JAWA 3M49A 3SNHA 3QLUC 2FW9A 1GUAA 2XNKA 2ZPTX 3PKJA 5ALHA 4DVJA 4B34A 2Q62A 1BEZA 1T3GA 3UAXA 4NBWA 4JR1A 5KZMB 3OUUA 2O0MA 5LU9A 1KOGA 4J94A 3GO4A 2M6LA 4BO6A 2YBEA 3TXAA 4CUZA 1QRRA 5DHFA 1XXHA 3RVRA 4J49A 5U4QA 1QIEA 4GOOD 4JQSA 3SFTA 4BKPA 4XSHA 4GI2A 2Z3VA 5LA6B 4BO7A 5EJ5A 3KOUA 2BGIA 2FHSA 3QX3A 1YZYA 3Q88A 3WA6A 4EYKA 3DPIA 4DLPA 4JBYA 3LNTA 3T9EA 1RRGA 2VYFA 4YEDA 2PKWA 4EEXA 2DH5A 1A04A 1M73E 2XF2A 4JBHA 1EFLA 4EL5A 2EERA 1HV8A 2I6QA 2NW6A 4I9NA 3E70C 3LS2A 3K71B 2OP0A 2FP4A 4WOCA 3DQPA 4OXQA 1C1DA 2W2KA 4GI7A 2BL4A 5G0UA 3D5TA 4MUYA 4EW2A 1EK2A 1NN3A 4KH0A 3TZEA 1KI3A 5FBRB 1RLMA 4ZEOA 3P2YA 1USUA 4AG6A 3AKDA 3V55A 1GU1A 4YIHA 4YCLA 5AT1A 2IBSA 4MWGA 1F8GA 4P5DA 4X8LA 5FAKA 1XTQA 4PZDA 4YN3A 3CG4A 4RSRA 1P17A 2V7VA 1U8YA 3ETLA 3H2IA 1YDFA 3T5CA 3TJRA 2XGGA 5BYJA 1Q17A 1K5DA 2DPLA 3QW2A 4QGSA 5LMCA 4P2GA 4AYTA 1GVNB 1P1IA 3E81A 4P54A 5ALVA 1C8BA 1DARA 2IU6A 1CG6A 2NZXA 4L0QA 4X94A 2RBEA 4AD8A 2D7DA 1JMKC 1TE2A 2GEVA 1X1QA 1DX9A 3EMDA 3PCRB 4RVHA 4CQMD 4ENVA 1IJKA 1BXGB 1TEHA 2WV7A 3OFSA 1KSGA 2OECA 2H2IA 2UVPA 3WLQA 4HXEB 4MB6A 1V7ZA 2JF0A 3IOBA 3T0IA 1T2EA 3LK7A 3RGGA 1KZ7B 3ABQB 5TEVA 4HF7A 3R7NA 2GO1A 3PZBA 4JYZA 4KE7A 1JS1X 4RHYA 1XQXA 4HFNA 1Y5NA 3D3NA 4UBOA 2GETA 1QOPB 2CVOA 2ZS7A 3IJEB 3L9XA 1ORHA 5GMOA 4YCCA 2NU7B 2UUPA 2XIQA 1HDEA 2H2HA 3A1VA 3PIDA 3L7JA 5GV7A 1O1YA 2Z43A 1Z2OX 2YXNA 4UNIA 4D96A 5FL7A 3QX9A 5JWHA 1QG2A 2BH2A 1QP8A 1UPXA 2B92A 2PRYA 5D3MA 3TL3A 4J0DA 2H9YA 1IBSA 2BELA 2NSDA 4KGZA 5DIZA 4C3UA 1U7TA 3KQSA 4FDMA 5K2MA 3SFZA 5IG2A 1RM5A 3AHGA 5BUCA 1P5JA 1RVV1 3ZW9A 4ESHA 4Q3DA 4RZHA 2H5LA 2Y0PA 2FNAA 2PMWB 3QE2A 4FVTA 1G21B 2AFHE 3DNFA 1FXSA 1JKMA 3AVOA 2FSPA 4ZV9A 2Y1LA 2Z6QA 4M0CA 1Q22A 5JD3A 4PPGA 3EPJA 1E0DA 1OJ7A 3HLYA 2IXAA 2IGBA 3UV7A 1I4WA 1ADFA 1FYDA 3ER6A 2P1ZA 5BRJA 4A2CA 3CW2A 3UGTA 2IZ7A 3PP8A 4DEXA 4Q16A 1XRSB 2O52A 1TT5B 2JARA 3LGSA 3Q8LA 1EJ0A 4G4SP 2V96A 1ZHFA 4H7IA 16PKA 3RU2A 3ZPXA 5F2OA 2W8ZA 2ZTLA 3KWFA 3AMVA 5EE5B 1CJKC 2IZ0A 1DKPA 1EBFA 2A1UB 1S0UA 3GC6A 4H4CA 4OI2A 4CLHA 4DA4A 3FLEA 2GPNA 2PKRA 3EVAA 3GLIA 4GM0A 4BMZA 1ZIOA 3OCXA 3M0EA 5EUBA 4UTNA 3DXXA 2DY1A 3H1PA 4B6FA 1YS6A 1FB5A 5EFOA 1OLSB 4IOJA 3V2HA 5AIBA 2VOJA 1LDNA 3IPYA 2WK1A 3KQWA 3ZZ0A 4AZWA 4GZ6A 3AKEA 4P3PA 5ICCA 3MW8A 4LDJA 1LH0A 3WIOA 4BX3A 5IS2A 4TLDA 3WZLA 2KQUA 4YVFA 1E2DA 2Z5GA 4XX0A 1FMCA 1Z4KA 5F23A 1EAYA 2R6DA 5H3CA 2C7OA 3EUFA 2XUPA 5JD6A 1EWQA 4X3CA 2QX4A 3V4VB 4BQSA 1AS0A 1J8MF 3TLGB 3V1UA 1SN7A 3UA4A 4K6MA 3NCHA 3WIBA 2ORYA 5JBQA 1XEXB 4LOJA 3LDAA 3D6VA 1Q6YA 5HVNA 1R5OA 4PYNA 1KQNA 2VK4A 1IUKA 1Q1NA 4G1EB 2C2HA 3H8SA 4HGOA 4I3GA 3TWOA 3TVTA 4BX9A 1S4MA 4UJ5A 3AVPA 5JNUA 4UMEA 1JU4A 4NRDA 5IVKA 4P0QB 3E2MA 3X0DA 3HN2A 4DLVA 3SKYA 5C8DA 3KQKA 2WWTA 5DIFA 4MRPA 5GGXA 2NXEA 4F12A 1CUXA 3BXHA 1IM2A 3PI6A 5LP6F 4C2AA 5I9BA 3IVMA 2KBFA 1U4NA 3T54A 3TOSA 2BE9A 4GRAA 1ZIXA 1KEWA 3ELBA 1WUTA 5DK6A 1ULTA 4B3SB 3C3DA 5FR1A 1X77A 4UDYX 3E3OA 1ZFNA 2G40A 4JJ7A 4N6OA 4ZI7B 1JN0A 4FFBA 2W6JD 3Q7PA 5KJ6A 1GHTA 5ADWA 3Q8MA 4D8VA 3EVBA 4U8HA 4N8EA 4NP6A 3K1ZA 3GLFB 2C8KA 3LSTA 3AETB 1Q12A 1QYVA 3V1YA 5IVPA 1ODTC 1PJLA 4LA4A 2NO6A 1R8YA 3VBEA 1V4BA 1NKTA 2PLAA 3DFIA 2AEJA 5EL0A 1MW8X 3PQ7A 4G5GA 4GICA 4ZVTA 5IVHA 1V5WA 2J3JA 2ZE8A 3WL6A 4DMGA 1WCXA 2GYUA 3SBDA 2OENG 2VZLA 4OMFG 5TB5A 2EWMA 2F00A 1DX4A 4IHJB 1P1FA 1UDCA 2HOQA 1RSZA 4LYJA 1Z63A 4B3JA 3EZ9A 3DL0A 3NIWA 1S7CA 3T4EA 2R6HA 3GAAA 2E49A 1B3RA 1GCAA 2B1IA 1JG7A 2C07A 1YNOA 3HCEA 2NQ2C 4JSRA 3OM1A 2ZZNA 3FFTA 3PYMA 3VYSB 1NKSA 1SBQA 4UVEA 2ODEA 5BPHA 3GF4A 2D5CA 1SCJA 3UG6A 5C7OO 1GGKA 1E2GA 5BMVA 4XLLA 2BCGY 3M5CA 1MH1A 3O2NA 3O8DA 5JTUA 3N2YA 4AJOA 2I8AA 3K70B 2ZIVB 3IXLA 5LL6P 3L05A 4C6SA 2RKBA 2F9LA 2I55A 2DPXA 1ZUWA 2NLOA 5K3SA 2WRZA 5FWYB 1JQKA 1PK8A 1Y8QA 2H4HA 3WGMA 1SQSA 1F1JA 3QVSA 4HMQA 4IIJB 2WAXA 2H54A 1U9ZA 4FMCF 1YCDA 2F8LA 3CH4B 1B42A 4TTTS 1I2BA 2E1RA 1YOVA 3WGGA 3KTDA 3K5WA 4MH0R 4F9TA 1XZDA 2WIAA 3ADKA 3GRVA 4DQVA 3AF1A 4HNQA 4GZ3A 3OJFA 2Q1TA 3GMIA 3ZEIA 1YS2X 2X19A 2VP6A 3ZZMA 3GT7A 2R6AA 4QYXA 1YJBA 5E3HA 4J43A 4KLAA 3AI3A 1MB9A 3GZTB 4XDZA 4EL0A 4EBBA 2OCAA 1JEDA 2AZMA 2WM3A 3FCUB 4RA9A 2BFDA 2PAAA 1GFSA 1QMGA 4RKFA 3WS7A 4B0OA 5JNSA 3S40A 2RGEA 3R6TA 2IIVA 3OMWA 2D5AA 2CHEA 1ZICA 2QM8A 2CJPA 4GBED 5EJMA 4GI5A 3WLHA 3QWFA 5IDQA 2CWWA 4FWTA 1Z5NA 2QR2A 4B3BA 1OWPA 3QUCA 1FXWA 3EIXA 1NVAA 4DA7A 3C4QA 1E2PA 2QP4A 3DOOA 4EPXA 4MHTA 3FBWA 1N1EA 2BEWB 3T52A 4BRWA 2ZB8A 2AJLI 3KZOA 1K4MA 4Q19A 3CLRC 1UDAA 3BFJA 3TCKA 1NBMA 3TR6A 3BA6A 4E5PA 2XH8A 4QVKA 1J0DA 2R97A 1VZ2A 3ND5A 4LF6B 1YDEA 1OYYA 1PS8A 4ARAA 5JAUA 4DTCA 2O54A 5F5LA 8ADHA 4G8BA 1YGYA 2BAGA 4GKKB 1E1QA 4AX8A 1QHFA 3S2ZA 1BGXT 3BM5A 5DBEX 3UB3A 1BNCA 3CRW1 3TRIA 3A11A 4G24A 2PLNA 2O14A 2FMTA 1J9EA 1RWKA 3S55A 4D4HA 5FI3A 4WQMA 2HT1A 1P7WA 3L01A 1E2QA 2JAOA 1PD0A 4O59O 3Q15C 2CMGA 4GNKA 3RRYA 4UM9D 2OAEA 3IQFA 4DV4B 4AICA 3PGXA 4E4YA 4Z7JA 4Q47A 1KDPA 2CV2A 2Y1FA 3KTOA 2W2MA 7MHTA 1FLVA 4MUHA 3V4OA 1Z4PX 2JAXA 1YK1A 1HEUA 1U9JA 5H4HA 1CEYA 3UANA 3FKSA 3G2HA 4KR6A 5LLTA 1PE0A 1P1BA 1Q57A 4IDFA 3WHIA 5L6LB 4A36A 1USVA 2XMDA 3LF2A 3R5FA 1N92A 5IH7A 3HXQA 3CVUA 1QG0A 1GN8A 1U2RA 2IOYA 4NKRA 2R751 2Q6LA 3DZBA 1CT9A 1QNLA 3NWJA 3IP7A 2OBNA 4U7TB 1SKUA 3GJ5A 2B7BA 3AINA 5G1OA 5G41A 3SG0A 4N48A 1P4JA 2QXTA 4JLMA 1ST2A 1NDQA 3IP9A 5HJEA 1OXVA 3VR2D 1M6EX 2ZVDA 1UIRA 2MWMA 3AHCA 3FETA 4JSTA 1W6UA 2D59A 1DBVO 2JZNA 2ZJFA 1OFUA 4G36A 2AJ8A 2XE4A 2HYDA 4MYHA 3VZQA 5HKKD 2BFAA 2Y1CA 4P5PA 1SUPA 4QBGB 1KJ9A 3U62A 1K1EA 3NO4A 3ZW7A 4BIIA 4NV0A 4R69A 4UBJA 3UOGA 1GNTA 2QE7A 1LA2A 2F64A 3U16A 1EUQA 4X63A 3SR4A 1XQYA 2DUMA 3A1TA 3IQWA 3O7WA 4Q1CA 3VPDA 2AZ4A 4DY6A 1TUIA 4QQRA 4V2IA 4I4NA 2ZI4A 4HX9A 5AVTA 3BGIA 2QLNA 5DNWA 5H7XA 1EZZA 3RNLA 2PH1A 3VDNB 3O9ZA 4JDPA 4FBMA 2RHBA 2IZZA 4IFEA 4RZQA 4AN0A 1XQVA 3L7CA 1YRYE 1R0ZA 4U5XA 3PDIA 1L5KA 2DQ4A 3E27A 3K0AB 5JJIA 3WLMA 2HPHA 2JH8A 1RBQA 2OO3A 2E4WA 1MPTA 1NXXA 1U0RA 4X8HA 2OEPA 3CSDA 2YW9A 3T9DA 4S0ZA 4C4OA 2Y6VA 4LX0A 4M76B 3OKPA 4BBPA 3OC0A 4LXIA 7AT1A 3Q8XB 4KO8A 1JQJC 4RWEA 2VPTA 1WUKS 3W8EA 3SIRA 1E4VA 1K3UB 2D2XA 1SUEA 3MCWA 4RF5A 3I12A 4AXXA 1IEQA 4C89A 5GZ6A 4FOLA 3PHJA 1JHMA 1OU0A 5JNLA 3BMQB 1QR6A 4MUJA 4IHKA 2H5JA 3IDAA 1M8FA 1JFSA 3BDAA 3WE7A 1JVSA 1OC4A 2C98A 4JI7B 5FOWA 4W5NA 3F8SA 5BOSA 2RB4A 4MQFB 2ZWVA 1A9QA 4JC5A 3QX7A 3VDQA 5J2UF 3WQBA 3G5TA 2WV9A 1JV2B 3JSXA 3O92A 1YZ3A 2VQ6A 5KYUB 1GSHA 3WB0A 3ABRB 4I1PA 1O7JA 3GEDA 5EP2A 3VZCA 4ARZB 3L8FA 3WAGA 3I9LA 2CLOB 1J7KA 1AKNA 2BI7A 1W7AA 4DLZA 1T3LA 1JIIA 4MKXA 4OQZA 1DO2A 4JQYA 4EMUA 1K5PA 3MJFA 4OSOA 2BKAA 1IAVA 3I64A 3PU6A 2WF7A 4G8CA 3OQ6A 2FYTA 3VNVA 1E3WB 2FSGA 2PYIA 1E3JA 5CEJA 1UBGA 3BB3A 4U0KA 3EZXA 4S1TA 2AE2A 1E2UA 2Y71A 2PZKA 2AV6A 2VXBA 3ZVRA 1ZGCA 4U00A 4D4MA 3KKKA 1G60A 4ZHSA 2F8TA 3JWPA 2EKLA 2J9FB 4DLRA 3A4VA 1SUIA 1XAGA 3ZTYA 4KCGA 1MTZA 1TF5A 1RWNA 1LZLA 1NMQA 1IN7A 4OOEA 1J0AA 4L6IA 3SSNA 4ZC1A 4BO9A 2A0FA 2J30A 3HYSA 3BTOA 4RXTA 1DLJA 1EKXA 2ZSIA 1NT4A 4H2DA 3MLBA 1QAMA 2P5SA 2ZJ6A 1JQBA 1AF7A 3VH2A 4Y2QA 2I3GA 1COZA 5JAPA 2OFWA 4JKIA 4RH0A 2NO4A 5F3DA 1C29B 3CVJA 3L8ZA 3T3EA 4DVGA 5P21A 4RK5A 4RLFA 1GNVA 4C4ZA 3PNLA 1UT8A 4BFLA 2RJ3A 1FSGA 1J4AA 1NE2A 2OBLA 4P98A 4WLEA 721PA 2HMVA 3QFCA 2D2FA 2Q4EA 2AMYA 3JD0A 3WI7A 3EXIA 4MW5A 1KEUA 4C4SA 3HUUA 4IOLA 1UL1X 4B45A 3RRXA 1ICEA 1AM4D 4DC1A 1HYBA 1A5ZA 3TFQA 4EEZA 5KIAA 2UXBB 2WJHA 4HGNA 4EW6A 1XTTA 5L3ZA 1U0EA 2PZEA 2Q5CA 1Y6RA 2Q41A 1Y89A 1PAUA 1QF7A 4BQFA 1RQGA 2O8BB 3J7TA 1TZKA 1CUZA 3LDGA 4OM7A 1CUWA 2I7VA 3MMZA 4PFJA 1SBYA 3RAGA 3UJ3X 5F3RA 3DYBA 1JDPA 1H42A 3A31A 3ZWNA 2GUGA 1J0EA 1R27A 1T34A 1LTQA 2HK9A 2ZYHA 4YMIA 2ID7A 3EF1A 4EA7A 2GYWA 2G5GX 2E89A 1VLMA 3QXXA 1KNQA 1LQTA 3P4XA 4TTAA 5LYJF 5J1SB 3KB1A 2NAFA 4QYSA 2QRUA 5JFGA 2RFLA 1LZKA 1Z0FA 3HU2A 5DEOA 3T3PB 3DCJA 1CY4A 1AGYA 2IPNA 3E8XA 3N7TA 4L6CA 3TW8A 3E9CA 1Z8DA 3IUBA 5EJIA 3EZLA 3GNTA 5B53A 3RDPA 3J7AC 2O05A 2XUDA 3G9XA 2X0NA 4LECA 1RMQA 2A5GA 5K9ZA 5LQCA 5AHOA 2FZLA 4C4YA 2I9KA 4W6QA 1BDMA 1Q1AA 3OWOA 1YRLA 2FEAA 3INYA 1KETA 5G0TA 1Q2XA 1QTRA 1LWOA 1U94A 4ASUA 1NW6A 1TIBA 2HQBA 3FWYA 3FYUA 3V97A 4GWLA 1PL6A 3JARB 4J2TA 4AWAA 1K3TA 1K8YB 4ECEA 3ML1A 3M7IA 4LE1A 1E7SA 1V7PC 1VE3A 2ZI3A 3WNBA 1ZW1A 1C14A 2VNIA 3FX2A 3MCAA 2C78A 3HCPA 4K1XA 4DDHA 4DS3A 2JL1A 2SKDA 2XDAA 4PHTA 2CLHB 2QS9A 5CG2A 2OT3B 4CMCA 2HO4A 1ZC4A 4X7PA 5ISMA 3KLPX 3K9HA 4OGWA 3E2IA 5DV9A 3GUCA 3P94A 3QYFA 3THYB 1Y8CA 1W29A 2VPPA 2FN9A 2V7GA 4OA5A 5LYYA 4H6WA 3W7BA 10MHA 1RPZA 1EGQA 2A1IA 3V4ZA 4XVCA 2BD0A 3PWKA 4CPDA 1XQ9A 5FUWA 1SU4A 1Y5IA 2NQTA 3TZQA 5JJKA 3MF4A 4YGXB 4BNIA 2Y4NA 1F7VA 4QULA 1OTXA 4JCOA 3JWHA 3WYBA 3DZHA 3L49A 5F35A 3FDFA 3QVVA 4FOPA 2E4XA 4KIUA 2QGFA 5DWVA 3NYRA 1TJ5A 4YP1A 2IWHA 3UUFA 2PIDA 4UCQA 4YRFA 5E0OA 5BQ3A 1JAZA 4Z7NB 3AUAA 1SCUA 2B0CA 1XK7A 3I9NA 2PUGA 2X4DA 2CVHA 1LFDB 4ZVLA 3AWDA 1LXCA 4W5HA 4AY6A 4R8KA 3EIUA 3A3KA 2NZUG 1KAQA 1TJYA 1V26A 5BT8A 5M34A 1GXSB 2WIFA 5EWJA 4HH4A 4R8VA 1XWWA 3KKZA 4QDTA 1ISRA 1TM4E 3AHJA 4V0SA 1Q0ZA 4MINA 5AW4A 1KMNA 2C9BA 2YY7A 3ZDEA 1ID1A 1NT2A 2PT7A 2VBFA 4WJKB 1U3DA 1SBNE 2L42A 7YASA 3I2GA 4W1SA 1F8XA 3C3PA 4H18A 5JV5A 2W6ID 4LGVA 4WKOA 1FMTA 1ZGHA 2AQHA 3F6PA 2XX3A 3U4MA 3JPWA 3QP9A 2B94A 1E7QA 3FYUC 5AH0A 2RK3A 2V7QD 1TO2E 1PK9A 2QL5A 3IL2A 4JY7A 1OA1A 2WW8A 2BV3A 4KX3A 1EFHA 4TWJA 5JNVA 3IAAA 3RYCA 2HTFA 3AY0A 1JIXA 1JLSA 4K6HA 1EGAA 1HFWA 4X61A 2CFTA 3LK6A 4AKTA 1GM5A 3TQTA 5B1SA 5EYPB 3EZ7A 3MQFA 5JATA 2HSEA 4QOIA 2YXPX 1RE1A 2I22A 4E11A 3NM4A 4TRMA 4I50F 1S89A 3HJHA 1QCYA 1QGUA 4HLNA 4LY0A 4RS3A 3SFVA 3HXLA 3GL9A 3MGKA 4DBVO 3PNOA 3W1WA 4EG4A 1DXQA 2DHQA 2F1HA 1KAEA 3IUNA 3OUTA 2G8NA 1ULUA 3ZCTA 4YV2A 5KUTA 3WSWA 3K4QA 4ZANA 3SSMA 1Y1LA 1U8FO 2RH4A 4JI6B 3U7QA 2GZ3A 2G77B 3UJPA 5IXSA 5HW0A 1RYFA 2NZ8A 2BFCA 3BF7A 3CZAA 4YJHB 1LD3A 3REQB 3VZPA 3W8RA 4K9LA 5FUQA 4TXNA 1UK8A 4JLKA 1CQIB 1IBCA 5BR8B 1F0PA 1CRZA 4Y98A 3GARA 4IWXA 4CMEA 4V02A 2Q7OE 4ZYUA 3GQBB 1TEVA 1Z82A 4A7PA 4MRMB 1QB7A 3PBKA 4LSWA 1R74A 1V3QE 3WBKA 1Y1SA 1YQ9A 2AR7A 1W19A 3BGDA 3TSZA 5AHXA 3KB8A 1B0ZA 2GM4A 3W5VA 3MJ4A 4NJEB 3A1CA 4MCAA 4BTVA 4OGFA 5FF9A 3EXEB 4YAUA 5HHTA 2B7CA 2YZ7A 3C98A 3G9QA 1ZUHA 4Q3AA 5FFFA 5HMLA 5LB4A 4B84A 1TADA 1L5VA 2M1XA 1GIAA 1KVUA 1PQUA 1WF3A 2V74B 1DHRA 4X6YA 2C57A 4F04A 4PQRA 1GRQA 1T9GS 1N9GA 2YZKA 3DOFA 5DO9A 1K5HA 3OEWA 1M6VB 4Q18A 4HQLA 2JFNA 1JE1A 1OX4B 2CYAA 2X77A 3K1YA 1Z0AA 4ZVOA 1N6PA 5K8TA 1TLFA 1TZMA 2PZAA 2K7ZA 1H8ED 1EFPA 1TF7A 4PCUA 4EHBA 5J59A 1NZJA 3L0PA 1BJTA 4G41A 1R00A 1XXLA 4YQFA 2R25B 2H1FA 4NS1A 2K7FA 4PO3X 3I8XA 3V2UA 2ZEJA 2QUZA 5KNBA 5LOVB 2FFQA 5JHGB 3PG5A 1QAOA 2J41A 4JB3A 3N2IA 2ONCA 5TSDA 1XAJA 3AIMA 3EVGA 2VTBA 4I99A 4IF4A 4EI9A 2X9GA 4RTKA 2CFIA 3CRZA 5FWXB 2GZRA 5DT9A 2QJOA 4OUDA 5A6SB 2CL0X 3GAZA 4UM8B 1C0PA 1RLUA 5JEEA 1K7FB 4L74A 3OIUA 5I7WA 4AP9A 4D6YA 5I4CA 2BM1A 3QX8A 2C83A 1IATA 1KO8A 1I6KA 3GR6A 5TT0A 4M38A 4C6TA 1Y34E 3ZYZA 4A27A 4R7TA 4MPDA 1FNBA 1WSWA 7REQB 3CH7A 3EA5A 1DJOA 1LPNA 2FV8A 2VJLA 4ROSA 5FHRA 4MIOA 4CMEC 1FW6A 4LZPA 3QF4B 1DQZA 2WYVA 1MG0A 4PR3A 4B5LA 4ZZ1A 4AJNA 1TD1A 1E20A 1PWYE 1E2BA 3R3XA 4DLTA 4OQMA 4JXXA 2CCGA 4DSZA 5JASA 2EF0A 1MV5A 2YXDA 3W5JA 2EFCB 4ISCA 1CY6A 3ANMA 3AL0C 1I7NA 3P71T 1EXMA 2ASVA 1RBYA 4MNTA 4LDQA 2O3JA 1E92A 4I6EA 4XIYA 1P0QA 2HQSA 2EX4A 4CDNA 5ITZA 1LC3A 1VYHA 1Z18A 1L8XA 1Z28A 1XVUA 4I5GA 4YJ2B 1WUHS 4FD3A 4AJ4A 3RT7A 4CV2A 5LDDC 2ZP1A 3ZIDA 4KGDA 4UTXA 3UQZA 3KPYA 1ND5A 1TK2A 4LVCA 1EDEA 5H5JA 2G82A 2IIPA 2PR2A 3L07A 1ZXXA 4GBGA 5DZSA 2F3UA 3PGJA 4UTRA 2DTXA 3KXPA 2ZE7A 4G4GA 1YDGA 2R1VB 3AUXA 2IV7A 3LX4A 1O08A 1CRWG 4V0ME 5B6IA 2XAUA 1ZVJA 4ZXPA 1M2FA 1TMOA 5FEUA 5T4BA 1WDMA 1DIHA 2Y2VA 3EGDB 3S2GA 1DRUA 4X00A 1NZFA 2WWVD 2YMLA 1E64A 2I7CA 4IG4A 1JEEA 3RARA 1FNDA 1JMVA 3MMXA 5F1KA 3UHPA 3WL5A