2YV1A

Crystal structure of succinyl-coa synthetase alpha chain from methanocaldococcus jannaschii dsm 2661
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
287
structure length
268
Chain Sequence
MILLDENTKAIVQGITGRQGSFHTKKMLECGTKIVGGVTPGKGGQNVHGVPVFDTVKEAVKETDANASVIFVPAPFAKDAVFEAIDAGIELIVVITEHIPVHDTMEFVNYAEDVGVKIIGPNTPGIASPKVGKLGIIPMEVLKEGSVGMVSRSGTLTYEIAHQIKKAGFGVSTCVGIGGDPIVGLRYKEVLDLFEKDDETEAIVMIGEIGGGAEEEAAKFIEKMKKPVIGYIAGQGTAESKMKALEEAGAYVAKNISDIPKLLAGILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Succinyl-CoA Synthetase Alpha Chain from Methanocaldococcus jannaschii DSM 2661
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
total genus 91
structure length 268
sequence length 287
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2yv1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yv1A01
3JYQA 4DREA 2GGSA 2PGDA 4GMGA 4LW8A 2AHRA 2RIRA 4NI5A 4BMVA 2O3JA 4BNKA 5IAAA 3D3EA 3MTGA 1C1DB 1PGOA 2DUUA 3OP4A 2X1HA 4M54A 4TVBA 5T5QA 3I9NA 3Q9UA 1U4SA 2PFGA 4Z3DA 3GRPA 3RVDA 3DMTC 3GHYA 3NEPX 2EERA 3KYCA 4IJKA 5EINA 3WMXA 4LVCA 5HA5A 1IYZA 1HDXA 2PY6A 3A28A 3KSDO 2VHVA 4QFDA 3ZNNA 3CH6A 1HXHA 3GEDA 1Q7GA 3IJPA 2YHIB 5JCJD 3QWIA 3ROPA 3CEAA 1BTOA 4MVJH 3GDGA 4W9NA 2JD2A 5IDYA 5T64A 1UZNA 3WLEA 4PLVA 2FMUA 2VTDA 2CVOA 2P5YA 1H2HA 3U9LA 3ZWBA 2Y1FA 4R3NA 2IEDA 1YS4A 2BFMA 5BSHA 1ADCA 2OO5A 2P9CA 3RI3A 4BGUA 1H2BA 4XRRA 2WTBA 1Y8RB 1ZEJA 2I3AA 3AWDA 4XDYA 1LDMA 4GX2A 3DZKA 1RJWA 1G0NA 4AL4A 5A06A 3WFJA 4BO4A 1JWBB 2EG9A 3ZWNA 4CPDA 3GFGA 3N7UA 2GR9A 4I9UA 4CMEA 1A9YA 3O4RA 5U4QA 5ITVA 3IDSA 2G76A 5DN9A 3RWBA 3IMFA 1NAIA 2Q1UA 3C3XA 3JD1A 4PRLA 2D1YA 3ZCXA 1IPEA 1U2GA 1Z7EA 2RAFA 5L95A 2VZ9A 1XDWA 4EJMA 2YV3A 1OMOA 4ND3A 4A73A 3F9IA 2IEBA 2G5CA 3OECA 3GNQA 1MC5A 2GO1A 3E5RA 4CUJA 3DZFA 3GHHA 2BF7A 4NFHA 1SNYA 1ADBA 1QLJA 3MCVA 1N92A 3PWSA 4BL5A 4DQUA 3L6DA 3OQBA 1UXJA 3MJSA 1DC4A 4LVUA 2O50A 1GY8A 2B5WA 1Z7BA 1E7QA 2B4RO 2ZJ0A 4OAQA 2VZ8A 1ZXLA 3AK4A 1P33A 4B4WA 4BMSA 1E7RA 5G0UA 4DRYA 2JAHA 2DT5A 1B8UA 3PDUA 1PS0A 4PLWA 1HDRA 2OMEA 4JIGA 4E6PA 1ZKMA 3S2GA 2FP4B 3QLJA 5JXWA 3I9LA 4JBGA 3WS7A 1BGVA 4C4OA 4JXKA 4BO0A 1KBZA 3RIHA 4Z6KA 1R15A 2VCYA 3NV9A 1E0DA 3GVCA 4MPDA 3RUFA 3HG7A 4WPGA 1YBVA 2VRCD 3WMWA 1E1NA 4J0FA 2JJYA 4HFJA 4BO8A 1DHRA 3JYOA 3VZPA 2WWRA 3EZLA 4H16A 3H2ZA 4O6VA 2WYUA 3DO5A 3WOHA 5KTKA 2IRWA 5JO0A 1ZK3A 4ROSA 1BMDA 2DVMA 4XIYA 4IM7A 3KZVA 5IDXA 4CQMD 5L4NA 5DZSA 3MJEA 4BKUA 2CF6A 4P22A 2J3KA 1H0KA 4RDIA 1Y5MA 4E2ZA 5CEFA 3L6EA 4E5PA 3HQ4O 2NACA 1NR7A 4D79A 3HN7A 1GQ2A 4WKGA 5TX7A 3ZWWA 1CRWG 3N74A 3RC9A 2FPGA 2J5RA 2QYTA 4CLXA 1UXHA 4IZIA 1YB5A 2E6UX 4R16A 4NG5A 3LDHA 4PGFA 1B2LA 5CFZA 1WDKA 4KWIA 4F3YA 4D46A 3WSVA 4IJWA 3NT4A 1SC6A 2DPHA 2R6JA 3GGOA 4UEKA 1LX6A 1X0XA 2I67A 4OKIA 1D1TA 5L4SA 4AJ4A 5TIIA 1X1TA 3AOEA 4RF4A 3D5TA 2NVWA 3LF2A 1P45A 4J4TA 3ZWXA 1K5HA 3ZDFA 5L45A 2J3JA 2BFAA 4DWVA 1E77A 5T8KC 2TMGA 2VYVA 1JKIA 4BO1A 1V9LA 1LTHR 1VL6A 3AI3A 1FJHA 3JQBC 2GN4A 1EE9A 1NWCA 4L76A 1A4UA 2GYYA 4XB1A 5CPBA 1V3VA 3BXXA 3E8XA 1RM0A 2OHXA 3PI7A 4KUGA 4CQLB 1KEUA 2OFPA 4YT5A 4MOWA 3E9NA 4L75A 2NTNA 1QP8A 1MXFA 1DB3A 1NP3A 1U3VA 3DZJA 4JNKA 3INGA 4NFSA 3KUXA 1IZ9A 1GPJA 3Q0EA 4YCAA 5IXYA 2V7PA 1I3LA 3WSWA 5ICSA 3OJFA 3GAZA 1T2EA 1RKXA 3BMCB 3R3SA 4Y6RA 2WE7A 5A9TA 4QECA 3R1IA 2C7GA 1L7DA 3EUWA 1KY5A 3R6DA 3V1TC 1EFLA 2PKQO 4RORA 3GZ4A 1BXGA 2P5UA 1OFGA 2DTDA 3DTYA 1V3TA 2ZTLA 2Y93A 3GZNA 5DCUA 4J90A 1RWBA 1QV6A 3K92A 2FR0A 2BFOA 2CY0A 3ZW8A 1QYXA 3QVTA 5KOIA 1BW9B 1PU2A 4M89A 1E6WA 2A9FA 4Q3EA 5IFLA 4J7CA 2HU2A 3U09A 3PJFA 3FTNA 1GQYA 1EVZA 2AQHA 1HSZA 1R0SA 1P1FA 3JQGA 4U8GA 1N9GA 2F1KA 4UVDA 4ZU3A 4ALJA 1LLCA 1RPNA 2P68A 4XQEA 2HAEA 4BKRA 5THKA 3ZHBA 5GZ3A 3KRTA 5IN4A 1NQTA 3GA0A 3GF4A 3NJ4A 4O5OA 4DMLA 3VPGA 4DLBA 3K30A 4Y6SA 5JMPA 3X2FA 4UUMA 1YQDA 1JWAB 2A92A 2ZK7A 4GKBA 1XGKA 2BKAA 3PJGA 1FDVA 1B14A 5A9SA 3RBVA 3T7CA 1PQUA 3DMTA 5HBRA 1UXIA 4B8WA 3WDSA 4II3A 4QFCA 2HDHA 4CMIA 5U9CA 5L9AA 1T4DA 1ISJA 4GMFA 2HK8A 1QYWA 2SCUA 3GMSA 4DLAA 1ZMTA 3TZHA 2Y1CA 1YKFA 3FHLA 4QO8A 4L74A 4EEXA 3KV3O 5JYDA 1I32A 2FP4A 4G65A 3K2EA 4E21A 1K2WA 3LF1A 2ZB7A 3ITKA 4CLDA 4ID9A 4GL4A 5JYEA 5EQDA 4JLWA 1JQBA 1TVEA 4IDAA 1YOVA 4HV4A 1LDBA 2C29D 3L9XA 1YVEI 4R9RA 5G4LA 4CV3A 1UXKA 3JQAA 3X2EA 3ZWPA 3L77A 3QWAA 4AJ1A 5KVQA 1UAGA 4YYZA 3DOJA 1XKQA 1XU7A 2CUKA 2V6BA 4UVEA 3UKOA 1MFPA 1I8TA 1V3UA 3AU9A 2Z1MA 5ENVA 4YRAA 3NTRA 2V65A 3DC2A 4OIMA 2UUOA 3RUEA 3NJ8A 3WGHA 4R5HA 2Q1WA 4NH4A 2DPGA 1LU9A 3ZZNA 3U5TA 2X9VA 1PR3A 4NMHA 5DCWA 1KIFA 1FMCA 4G5HA 4ZQGA 1PGNA 1P77A 4WGGA 4WCFC 3A14A 2H1SA 4EJ0A 4WK6A 5JCJA 4CM8A 4AJHA 3H65A 4HUJA 3PTZA 3OSUA 1UP4A 4O59O 2Q4BA 2P4HX 2PA3A 1TT7A 3S1LA 3TZ6A 4YQYA 3W6UA 4E4YA 2AE1A 2V6MA 3FR7A 2QX7A 3RAJA 3OMLA 5CAEB 2TMDA 3F4BA 3MEQA 3WBFA 2Q46A 2BLLA 2AW5A 3EYWA 4CJXA 3DWFA 1LQTA 2O2YA 3TWOA 5F1KA 5CDGA 1LDNA 3Q11A 3NRCA 4BNIA 4JCOA 4BNHA 4ND1A 4J9VA 4YAJA 1Y6JA 4U0KA 4EGFA 5BQFA 2ZKLA 4NBWA 4E2XA 5ICMA 1C0IA 2GD1O 3Q1LA 4JX8A 1O0SA 3FPLA 4NBTA 5K6AA 1VKOA 5A5EA 4A03A 1SB8A 2QRKA 2I66A 1HLPA 3L9WA 4DIBA 5CEEA 3F1KA 2AE2A 1QYDA 3RSHA 2GN6A 2FR8A 3OIFA 4DPMA 3K31A 2W2KA 4E5MA 4GWKA 2NWQA 3GT0A 3LZ6A 4YRDA 3KSZO 4E5NA 3WBBA 4RJTA 2PV7A 4TKLA 1YB1A 1EEHA 3GUCA 3AUAA 3UCXA 1LLDA 1HLDA 1Y8RA 1M75A 1IUKA 3TOZA 3IC5A 1N7GA 2PR2A 4CMHA 5JY1A 3I83A 4ZN6A 2FR1A 2H63A 1WLYA 5L53A 1GZ3A 1DSSG 5BR7A 1VM6A 1U5AA 3BMQA 2X5OA 4JN6B 2YV1A 5DOVA 2RHCA 2OORA 3A06A 4UEJA 3RC2A 2VNSA 5EN4A 1YOVB 4FGWA 5GY7A 1EVIA 1T26A 1U9JA 1J0XO 5HRUA 3MWDB 1EBUA 4M55A 1MX3A 3SC6A 3G3EA 1LDEA 3KBOA 3E82A 5DOZA 4IDEA 1NFRA 2C82A 1DLIA 1KERA 4QUKA 1ZK0A 4O63O 2VWHA 1YE3A 2O7QA 4WOKA 1E6UA 1Y9EA 3ZWMA 5I9NA 3IS3A 3WR5A 4RF5A 2W98A 2HSDA 1U3WA 1K6IA 4Y67A 2ILTA 3HZZA 2HRZA 1EE2A 1VPDA 4I5EA 1P1JA 3JD4A 3QVXA 3LK7A 4CM4A 2Y68A 4PLHA 3V1YA 2W4QA 4GKVA 5KJEA 3OJLA 3UN1A 4JBHA 3D4PA 4HADA 4M8SA 5U1PA 4E2WA 5TNXA 5KIAA 4WLNA 4PFJA 3P5SA 2CVQA 1EDZA 2CD9A 2EP5A 3JQFC 3NTQA 3QSGA 4RF3A 4IDFA 4TKMA 3ZWVA 4BNXA 4RLSA 4PLZA 1BXKA 5KJ1A 1H9BA 3H3JA 3STHA 3DBLB 2D4AA 3OM9A 4PG4A 1XSEA 2C59A 1MUUA 2HK7A 4NJMB 5KNLA 2YDXA 3WB9A 1UDBA 2Y66A 3TL3A 4WJZA 2O23A 5H82A 4R4JA 1PQWA 4DYVA 1A4IA 1LC3A 1LA2A 1GAEO 1U3UA 3P7MA 3NTOA 4WEQA 2QRLA 5DP1A 1JN0A 5KKCA 1MV8A 4CL8A 4DUPA 4G2NA 2I6TA 3BMOB 1PJ2A 4FJ0A 1XCBA 3ZU5A 2H5LA 3VTFA 1NTOA 2ZJ1A 4XYMA 3DEYX 3I6QA 4B7UA 4YT2A 3VZSA 1GQQA 4AJEA 4M49A 3LQFA 4YJFB 1NPDA 1F06A 5JY6A 3E9QA 5F5NA 3ZHXA 4BNUA 3IKVA 1F14A 1WMBA 4J1SA 1XEAA 2C20A 4CLOA 4OOEA 2DU8A 2X9GA 1PR9A 4J1QA 1HYEA 4ONEA 4PLFA 1C1DA 1A27A 4HP8A 3PZRA 2X22A 1YL7A 4CODB 4E13A 1NBOA 2Q4EA 1HDZA 4R68A 5HM8A 2VWPA 4CUKA 2FSSA 2DBQA 2GLXA 2HCTA 2AQKA 2E4AA 4BO7A 5HS4A 1JU9A 3CTMA 1I3MA 2G0TA 2EWMA 4CMJA 3LU1A 1BXZA 2GERA 2X6TA 5JLAA 3BAZA 1DFGA 2CDAA 2WE8A 1BVRA 1GEGA 3O9ZA 4I8XA 1DIBA 4YJDA 3QHAA 4IIUA 2QRJA 4IMPA 3ASUA 5B12A 3H9EO 2QW8A 2XXBA 6ADHA 3EVTA 1O8CA 4GSKA 4A5OA 2NQ8A 2X0JA 4KTTE 1IULA 1OC4A 3C7DB 5A1TA 3HDYA 3OF2A 1HDCA 1KC3A 3INRA 4Q3DA 3RUIA 4ALKA 3KYBA 5IG2A 4XYBA 1N9GB 1JVBA 4KDEA 3WTBA 2WYWA 1ISIA 3U4CA 3WX0A 3KTDA 3JCZA 2AMFA 1ZO8A 2UYYA 3VH2A 3KYDB 1N8KA 1LBEA 4K9DA 1IHYA 1AXGA 1PL7A 2E48A 3WJ7A 3HJAA 2ZCUA 2X4GA 4UVHA 1EMDA 1QXSA 4QXMA 5FWNA 3KHUA 4XB2A 3ZNPA 1E1MA 3WGOA 3GC6A 4JJGA 4EEZA 2YQ4A 3Q6IA 2X86A 3MWDA 3JQ7A 4R01A 3DDNA 2CSUA 3NYWA 4R5MA 4E31A 1ONPA 4XEHA 4OOFA 2PZLA 4QTZA 3DMYA 2A35A 1ZK4A 2XPCA 3PHJA 3S2FA 2FPIA 4IBOA 4KDFA 3UCFA 4D3SA 5C7LO 3AM5A 4YR9A 4TROA 1ZNQO 4J49A 1KS9A 4R69A 1PGJA 2X0RA 4II2A 5C7IO 4CL3A 4E2YA 4KUHA 2UVDA 2DAPA 4FS3A 4ZQFA 1T1RA 1UR5A 5JAZA 2HO5A 1XLTA 3GPDG 1B26A 1VE9A 4R51A 3ROKA 4Q3CA 4WEOA 2ZTVA 3TL2A 3OICA 4ND5A 3LT4A 3TRIA 2P4QA 4RVHA 3ONEA 5ILOA 3ZI0A 3JYLA 4RCVA 1EUDB 1PEDA 5FI3A 3HUDA 4WOJA 1X14A 4F6CA 4EBFA 3HHPA 1Q0QA 3F4LA 2OP1A 4WCDA 1EK6A 1IL0A 4TRNA 3TFQA 3C24A 1P1HA 4BGEA 4HKTA 3WJAA 4IDGA 1SMKA 4LCJA 4XWYA 4QX6A 5ES3A 1DC3A 5EQFA 4AJNA 3D1LA 4PVCA 3MJ4A 4J1TA 2B35A 1UZLA 1QYCA 3OBBA 1KVQA 3WYBA 1QRRA 4XIJA 4LSMA 5I8WA 5COQA 3RUCA 4DC0A 1MB4A 1SBYA 4GVLA 2JL1A 2FWMX 1DPGA 2WEKA 1IZ0A 4DQVA 5COAA 4CR8A 3R3JA 1G0OA 1NPTO 3EW7A 3KO8A 1IB6A 2GZ3A 3O38A 1X7GA 1I01A 3FWNA 2PH3A 4IJVA 4AFNA 4B7CA 2HMUA 2VUSA 1E7YA 2WSBA 4C7JA 3PEFA 4HXYA 1CYDA 4XJSA 2NU7B 4FGSA 4CR6A 4MVJF 3COSA 1LEHA 4Z0HO 4CMCA 1HEUA 1ZCJA 1Z45A 4B4UA 4D43A 5HWSA 4EITA 4OO3A 3WGIA 1EUCB 1GU7A 4BO2A 2O4UX 4CLOB 1WNTA 1V8BA 2EW2A 3PHHA 2BHLA 4CM9D 4J4HA 4CQLA 1R66A 4Q3NA 1YDEA 4HX5A 1DJQA 1DFIA 1NX6A 1RYEA 4CMAA 4ZICA 3BMNB 5CPFA 3CMMA 1EVYA 2LDXA 5T8KA 4IY1A 4MKZA 2VT2A 5ER6A 3G1UA 3HFGA 1YO6A 1HDGO 4HBGA 5G0WA 2YFQA 1OOEA 3LLVA 4M1QA 1NQAO 4RZHA 1F12A 4WE3A 1YBMA 1U7HA 4J7UA 3GLQA 5ADHA 1NXQA 2IZ1A 3JQEA 3PIDA 2RHRA 4E30A 4RPHA 4GGOA 1IPFA 4NNJA 4DPLA 1C14A 3F5QA 3HDHA 4J2HA 1NYTA 4RV9A 3F46A 2EEZA 3L07A 4RPLA 4J9UE 4MKRA 3TF5A 3KEQA 1GDHA 5TT1A 1Y8QB 2FN7A 5K0ZA 3NDIA 2CMDA 1L1FA 2DKNA 3VPXA 4MP8A 3GFBA 1VRWA 3HADA 3E18A 3JQ6A 3VDRA 1E3IA 1MFZA 4J43A 1M6HA 4RL6A 2BGKA 4IPTA 4YJHB 2JHFA 3ZV4A 4DL9A 1I36A 4GPD1 4XGIA 1GCUA 2UUPA 4XRGA 4NBVA 1I24A 1SPXA 2OZPA 4CM7A 1H93A 4MVJP 4RVFA 1Z82A 1Y5RA 1JKJB 3ZNQA 1ONOA 4FR5A 3RC7A 4F46A 1ZSNA 2DBRA 4XCVA 4A27A 1J5PA 4D7AA 4XKJA 2QYSA 1QSGA 3FI9A 4MIOA 4NBRA 4HFMA 3TOXA 3RKRA 5ER9A 4RVSA 4PLYA 3RU7A 3CXRA 4RZIA 1DIGA 5T6BA 3I4FA 4IIVA 3PLNA 3OETA 1B0AA 2X58A 3FBTA 3C85A 1S7CA 4I5DA 4DPKA 3GDFA 3DB2A 3RU9A 3F6YA 5LC1A 4QEDA 3C7AA 3OH8A 3HWRA 2NU9B 3BMCA 3NGXA 4DBZA 3NGLA 1CQJB 2AQIA 3AY6A 4GX5A 5A4DA 3WIEA 2G17A 2NSDA 1CIVA 4U6SA 5L7WA 3RUHA 1O5IA 2Y1DA 2IODA 1PS9A 1NHWA 1SAYA 3C8MA 4GX0A 4RPKA 4EUHA 5TJHA 2GN8A 1XIVA 3K6JA 4FFRA 4RDHA 4K1LA 1OAAA 3G49A 3B1FA 2PD6A 4RLHA 4DTIA 3QV1A 1AE1A 2GRAA 3WIDA 3P19A 5B37A 1E3WB 3BTVA 3TDKA 4NZ9A 4IS2A 1M6WA 1ZXBA 3ZU2A 5KKAA 2PGLA 3UICA 1K3TA 5JDIA 4JP3A 3RKUA 3RFXA 5F5LA 4Z0PA 3VTZA 1AN9A 1F0YA 1W6UA 3PYXA 4BUCA 2VYNA 3S8MA 1RYDA 4GX1A 2GPTA 4J91A 4PVDA 4BKQA 1YONA 4I08A 3O8QB 4YDRA 3B1KA 1NR1A 4BB6A 4FD3A 1KYQA 5C5IA 3LC1O 2LDBA 4HFNA 1P74A 1R4NB 3BMNA 1R4MB 3GVIA 3RUDA 2GDZA 5H83A 5I9LA 3ONDA 4AJPA 3V2GA 1G1AA 1P1IA 3GN2A 3E48A 2PD3A 4CM3A 1UZMA 3L6OO 4LMRA 4RQUA 4XQCA 1PJBA 1N2SA 2FZWA 3F5SA 4XA8A 4AJJA 1ISHA 4CQMA 3DZHA 2Z1NA 2HRBA 2P2SA 4WECA 5ENDA 2WMDA 2HJSA 4PG8A 2ZYAA 5IZCC 4IS3A 1WMAA 3A1NA 4BNLA 1V0JA 5EJ2A 3EAGA 5ITWA 1R4NA 1PJQA 3GGGA 2NV6A 3ABIA 1Q7CA 9LDBA 1O89A 4BHTA 1HE4A 5CAEA 1EDOA 4I9HA 4E3ZA 4D44A 5DF1A 4CV2A 2OOSA 3GEGA 1K89A 2VTEA 3JQBA 4YPOA 2VYVD 4Q3BA 4ALNA 1Z73A 2X0NA 3HDQA 1A72A 3FD8A 4GAEA 4R54A 3GY0A 4Z9YA 4CLRA 5L40A 4WUVA 1TT5B 2VHYA 3M1LA 1UAYA 4M87A 2POQX 3E9MA 4XR4A 3KLMX 8ADHA 3I9OA 3G0OA 4LRTB 2HKIA 3UXYA 1GYQA 4NU6A 4YJGA 1KVTA 4F6LA 1B8PA 3FF4A 3TPCA 5AQ1A 5LDGA 1ISMA 4W7IA 3ZNOA 1MA0A 4E12A 1K6XA 2EKLA 3CZMA 2Z5LA 3FR8A 4A0SA 1DBVO 2NVUA 2PKQP 4K26A 2B0JA 1KVRA 4IQGA 5FFFA 3GOHA 2NTVA 4UUOA 3ETEA 3SX2A 4EUEA 4ND2A 3N58A 2Y05A 3B6ZA 2NNLD 1ENZA 4DGSA 1UJMA 5DBIA 1TT5A 3GVXA 4XYEA 3WICA 2HMTA 4AVYA 1VJTA 4MP3A 2D0IA 1YQGA 1XQ1A 3K96A 2NM0A 1T2FA 1HKUA 1X1EA 2WM3A 3LC7O 5GZ1A 3Q9NA 5G0TA 4YJHA 1R6DA 2DBVO 2YY7A 1OI7A 4URFA 3D4NA 1QKIA 3VPSA 2NVBA 2NU9A 4ILKA 1MP0A 1AHHA 5T57A 3U4DA 3TN7A 2GASA 3BHJA 2C2XA 2SCUB 3IOYA 3OA2A 3RCBA 4XD2A 3DBRA 5KCZA 1HE2A 3SJ7A 1PJTA 1HETA 1DAOA 3GZNB 4FW8A 3ZW9A 5IZ4A 3F47A 4P4LA 3QVSA 3C1TA 5A05A 1HSOA 3FNGA 4EZBA 3ENNA 3OJ0A 5CDYA 4BVAA 1UUFA 3SBOA 4BNGA 2B4TO 2PZKA 2DTEA 1IHXA 5EESA 3RD5A 4BNZA 2D2IA 4GI2A 4GQAA 1E5QA 3WQRA 5EERA 4RGBA 1CQIA 4NIMA 3RC1A 3LVFO 2FOIA 1VSUA 4PLCA 4HFRA 2EGHA 3NT5A 3V5NA 2NQTA 4CUZA 1I2ZA 1DIHA 3O26A 2FHSA 4YA6A 1ZIDA 3LSYA 1YH3A 4G81A 5BSEA 2JFGA 4B3JA 2JFFA 1J49A 3QE3A 4MIEA 1Z74A 4JK3A 1OZAA 4ZQEA 3ASVA 4IDBA 2GZ1A 1P44A 1T24A 1ORRA 4MVJM 5A03A 1QG6A 3O8QA 3U49A 2C7VA 5G2OA 1EVJA 1HDYA 2GNAA 2C07A 4FC7A 5KJCA 1B3RA 4PZEA 1DLJA 1DC5A 5FF9A 1JLLA 4YB8A 1EK5A 4CM6A 1T25A 3DHEA 2UV8A 3K2BA 5JS6A 1N7HA 3M2PA 3UFXA 1M66A 3KLPX 2FZEA 4PG5A 4QSMA 1IE3A 3B70A 3VKVA 5TSDA 3SLGA 5JW6A 3OJEA 1VJ0A 4BO3A 3PRJA 4OSOA 2QZZA 4UVGA 1CF2O 4LN1A 4WLOA 5B4TA 3DFZA 5TT0A 2B4QA 3HSKA 3ZV5A 4ALLA 4FBGA 5L7TA 1BSVA 1YL5A 4CM5A 4KZPA 5TJ9A 4ZHSA 4RVDA 1VL0A 4L8VA 4ZA2A 4MIYA 4O1MA 1H5QA 2Q2WA 4R1NA 2WJPA 3HE3A 3UGKA 1CEQA 3BMOA 3INTA 5CG1A 2BGMA 4YT8A 3AFMA 1EQUA 4WLFA 1UDCA 4LK3A 5JE8A 1I33A 3SLKA 5AVOA 2HMVA 4NHEA 1FDUA 4ALMA 3KETA 2WD7A 5JMWA 4J16A 4FC6A 4MVJD 1ML3A 1GYPA 3GEMA 1I3NA 3AI2A 1R0LA 3B20A 3JQ9A 4CM1A 3DZBA 1FDSA 2YYYA 3IKTA 2PK3A 1AHIA 1RM3A 3M6IA 5K6AC 3Q2IA 4RPJA 1U3TA 2YW9A 1YRLA 1F17A 3ZWAA 2GUGA 1WWKA 2YHIA 3S55A 5F3RA 1PJLA 4BNJA 5DBGA 3W4IA 4DIOA 1ZH8A 3D3WA 4GH5A 2EGGA 4YACA 2GCGA 4F45A 3UH1A 1W8DA 1WW8A 3IAHA 4ESOA 4OXKA 1PSDA 3BTSA 5BNFA 2XAAA 1JKJA 3H7AA 1HZJA 3UCEA 1NAHA 5HS6A 1P9LA 1YL6A 4FCCA 4Y9DA 2B5VA 1JA9A 4B3HA 3ADOA 3H8VA 5G0VA 2Y1OA 1MXHA 4RO0A 4J1NA 3AJRA 1PJ3A 4KQWA 4AJ2A 1E3JA 1KVUA 2VUTA 3IUSA 5I7SA 3L4SO 3ZWCA 3MJTA 1PJ4A 1WXDA 2VYND 2ZYDA 2Y1GA 4BIIA 1X7HA 4UUNA 2D5CA 3E5MA 4PLTA 3WWZA 1BDMA 2I65A 4RPGA 4FFMA 2ZIZA 1NFQA 3PVZA 3ZH2A 3IIEA 4AJOA 2PD4A 2Y67A 1SCUA 4NU5A 3TSCA 3A9WA 4TVOA 3U3XA 2IZZA 1M2WA 2AG5A 2HMWA 5BNIA 1ZSVA 5L4LA 3VOSA 1DAPA 4IDCA 1PWXA 2GF2A 2VRBA 3GPIA 1F8GA 1P3DA 1Q0HA 2C5EA 2EF1A 3I4CA 2W90A 1E7SA 2OBYA 1NASA 1EBFA 3PQEA 4IXTA 3KSUA 1I0ZA 3T7EA 2EV9A 2FPIB 1PIWA 3WGZA 4YXFA 3W4KA 3RQSA 3DBVO 4BS9A 1DRUA 4IXWA 4GVXA 2AEMA 3GQVA 2O2SA 4MO2A 2O3UA 4PN3A 1HWYA 4XX0A 4DC1A 3K5PA 3VVCA 4J2OA 5KJ6A 4FPXA 4OQYA 3IP3A 2D3TA 3VH3A 4XGKA 3ICPA 2JCVA 3RASA 1PZFA 4RVGA 1NFFA 1YGYA 4JROA 1U2DA 4FOOA 3Q3CA 4IINA 1IY8A 3PYMA 4L73A 3JSAA 2Y0DA 5TQVA 1VKNA 3AM4A 1VJ1A 5GMOA 1H94A 4N18A 3P2OA 4PZDA 1KEVA 2Z95A 3FTPA 4QT0A 1AXEA 2Q50A 4UVIA 3VPFA 3MWEB 3MZ0A 3H6KA 4NQZA 3E1KA 1V6AA 1V35A 1E3EA 1EZ4A 4J7XA 3WWYA 2NU8B 3SJUA 1QR6A 1X7DA 1M76A 5IXSA 3KEOA 3AI1A 1DFHA 4TMFA 3WYEA 1T2DA 1CQIB 4E33A 1NQOA 3LT0A 2BFPA 2O3SA 2UDPA 1GD1O 1I10A 5ILGA 4XZ3A 3QA9A 2NU7A 4JP2A 3PFFA 5TRTA 1MG0A 4MVJI 4HNGA 3ROQA 3PFWO 2OP0A 4DBVO 4FOSA 1WVGA 2JD0A 3WYCA 5AOVA 5DULA 3H9GA 2ZB8A 4YTEA 3NDRA 4PRKA 5JBIA 3E03A 4H7PA 1WZEA 4ZRNA 2DC1A 2X7HA 2O4CA 1W4ZA 2OL4A 3WGQA 4D42A 2DUWA 4MJLA 1LXCA 3UW3A 1LSOA 3R0IA 5I7EA 2X0IA 4RF2A 3RROA 4EYEA 4MP6A 3DAGA 4OM8A 4BNVA 2Y0EA 1XWFA 2XOXA 4EDFA 5KVSA 1NNUA 3I9JA 2AQ8A 3GG9A 3VZQA 3RJ9A 3G79A 1HL3A 1SEVA 1E5LA 4N54A 3G17A 5AXAA 4AJIA 3HB5X 3WGTA 1RM4A 1GV0A 2GZ2A 1DEHA 4GGPA 4W9NC 2JD1A 4FDAA 4BKOA 3VAZA 6LDHA 3RFVA 2EJWA 4OGWA 5B4UA 5A5FA 2WDZA 2FY8A 3NX4A 1NVMB 4WLEA 3IUPA 4TRRA 3WQQA 3ZN2A 3JYPA 4PLPA 2JFHA 1CDOA 1H6CA 3DBRB 1YQXA 4L4XA 3VDQA 1H9AA 1FXSA 1PGPA 3QRWA 4NPCA 1E92A 2IE0A 2O3TA 4NDNE 4W99A 1X0VA 5L3ZA 4Z9FA 3JD2A 4NFYA 3DZGA 1CJCA 1Z75A 3ZU3A 5COBA 2HLPA 1HRDA 1JDJA 3LT1A 3QWBA 4BGVA 5MDHA 4AJKA 1H6BA 1SB9A 3D7LA 5DBFA 2Y99A 5TGDA 4A2CA 5DCYA 5A02A 1PWZA 3WXBA 1HF3A 2RBEA 4TZTA 2IDZA 2W2LD 4YAIA 1ZUD1 1UH5A 4GBJA 2JCYA 3TZKA 1H6AA 4DQXA 3RFTA 1ULSA 4Y8VA 1GTMA 1LUAA 4LCEA 4TZKA 4BNWA 2YDYA 4R1TA 5B4VA 2J3HA 5FEUA 1VSVA 3UUWA 2ET6A 4YRBA 4KWHA 2B83A 1VI2A 1YXMA 2EKQA 1YJ8A 2H9IA 3CPSA 3AW9A 4FFNA 3DAPA 3ITDA 4GWGA 2GSDA 2JCXA 4NK4A 5AXDA 2J8ZA 3EC7A 3QP9A 4WCFB 4P38A 4D45A 5BSGA 4R3WA 1I2BA 3WG9A 3BMQB 1DXYA 3JV7A 1LDYA 3QVWA 1GL3A 1B7GO 3PHGA 3OHSX 1GUFA 4FN4A 3BTOA 4Q39A 3CMCO 4CM4B 5MGBA 3DL2A 3PPIA 3ZV6A 4YVFA 4PCVA 4QO7A 2B36A 4CMBA 4JQCA 4PZCA 4IMRA 1M67A 4UREA 5L51A 4R9SA 1BDBA 3I1JA 4NR0A 2J5QA 2NU8A 1ENOA 1GV1A 3FNFA 4CM9A 2ZQZA 1J6UA 1P1KA 5BT9A 2C0CA 3W1VA 3FPCA 1OBFO 3QIVA 4BQRA 1CETA 5FYDA 4OL9A 1FK8A 4AJLA 4DA9A 1R0KA 3JQFA 3UFXB 1OC2A 1ARZA 1L7EA 2NU6A 4KUEA 2O3QA 4ND4A 2G82A 3UHAA 2C5AA 3PGXA 3V1UA 1D1SA 5JAMA 5JDIC 2Q3EA 3ANMA 1B16A 4BKPA 4BO9A 1WPQA 3DHNA 3ICCA 1TA4A 2EHDA 4D0RA 1HYHA 1ONNA 1ZK2A 5DDIP 1ISFA 1T1SA 4S3MA 3JQAD 1YBAA 1D7OA 2VRCA 3OFSA 1CERA 3BYZA 4BNNA 5JC1A 4UAGA 3H9UA 3EY4A 1X13A 1D3AA 3PJEA 1XA0A 3VPHA 2BI7A 3PGJA 1JAXA 5KVVA 5C3MA 4JBIA 1LSUA 3BZUA 3NKLA 4ITUA 3QQPA 1UP7A 1JVSA 3OEWA 3EK2A 2V6FA 4OSPA 8LDHA 4IGEA 1K0UA 4BQPA 2VOEA 5IJZA 1XR3A 3DAFA 3ORFA 1KEPA 3ZV3A 1MLDA 3FRJA 5CG2A 1DIRA 2PH5A 4IDDA 1QYVA 3LC2O 4CMGA 1E1KA 1LDGA 5IDQA 3EDMA 1C1XA 3KOUA 3H5NA 1QLHA 1Y9AA 3GR6A 1BG6A 2ZTMA 1TLTA 2Q2VA 4GSLA 4L9RA 2PNFA 3U4HA 1NM5A 2NVUB 3UF0A 1TEHA 1ZVMA 4B3IA 1C1XB 2G1UA 4K28A 3RBZA 2X9NA 3AM3A 3M1AA 1DC6A 2I99A 1ADFA 5EL0A 1A7KA 1SEPA 4YJFA 3VZRA 1YB4A 4L4RA 2YHUA 1LRLA 1MGOA 5JNLA 2JKVA 4JJFA 1JAYA 4TQGA 1GR0A 4TSKA 3D0OA 1U8XX 1P0CA 3EZYA 1BW9A 3JD0A 3QW2A 1Y1PA 1ENPA 2BI8A 1E1LA 5CHEA 4YAKA 4FJ1A 4KP7A 2FPPB 3RJ5A 4PIVA 3B1JA 3LYLA 5LCXA 4KQXA 3SEFA 3CZRA 2CNBA 5FI5A 1GUYA 1W0CA 2VHWA 3W8EA 1NVTA 1O94A 2W8ZA 3SC4A 1HDOA 2VN8A 3H5RA 1BXGB 1ZK1A 1HE5A 4FSHA 1PQPA 3PDJA 3OEYA 4HY3A 4UUPA 3TJRA 3ROMA 3W8FA 1S6YA 4D0SA 3KXDA 3W4JA 5JO9A 3OIDA 1NVGA 2EKPA 3HB4X 4P4GA 5A3VA 3GVPA 3D5QA 1LSSA 1LC0A 4RVUA 2PZJA 4FFOA 4FFLA 3L4BC 4TWRA 2PGJA 5G0SA 4LGVA 4N5LA 3ZHZA 1VLLA 1C0PA 5IN5A 3JQ7B 2CF5A 1ZJYA 2Q99A 2HUNA 3GDOA 5JFOA 3PJDA 4ALIA 2W2KB 4LMPA 4EUFA 4BB5A 3FWZA 1NHGA 2EIHA 3DBHB 1XG5A 5TLSA 2ZCVA 3OJOA 1CWUA 1NQ5A 4YJGB 2IXAA 3WLFA 3FSRA 1ZW1A 2DFDA 3ZHYA 2I9PA 4MVJA 4OJNA 4DVJA 3PHLA 3JD3A 3BHMA 5DT9A 4U0JA 2P9GA 3DBHA 5F1PA 1T2AA 1Y81A 1PJCA 4UULA 3WQSB 3V2UA 1DJNA 2R2GA 1XHLA 1GPDG 4M86A 4CMIB 1Z6ZA 4ZGWA 3TNLA 4BNYA 1ENYA 1LNQA 5H81A 4AICA 4P4NA 4U7WA 4ZD6A 3EMKA 3GH3A 1MG5A 3GNSA 1SO8A 4W82A 3U0BA 1XU9A 4XQ9A 3UOGA 4W6ZA 1Q7BA 2VWQA 1ZZEA 3NT2A 3MJCA 4BMNA 2CDBA 1EUCA 3CIFA 2OXIA 5JAIA 3QJ5A 2RH8A 4IJUA 2ZQYA 3PIIA 3WGGA 2QIOA 2OGUA 2PZMA 1JLLB 3OIGA 3T4EA 4LISA 3GNTA 1QV7A 2RCYA 4FB5A 2BRUA 3JQDA 3ZWYA 3EHEA 2VZ0A 1O6ZA 1C0LA 4Z3KA 5K9ZA 2C54A 1GZ6A 2E49A 1GFSA 1U1IA 3C1AA 3DQPA 4FIZA 5JAQA 5JPIA 2FPGB 2X8LA 1G6KA 1W73A 5G4KB 3KYCB 3LLSA 4EI2A 3DFUA 4WLVA 1I3KA 5CDSA 1ID1A 1E7MA 1JW9B 3ETDA 5KVCA 2O48X 2YV2A 2IYPA 5TS3A 4W7HA 3VC7A 1E7WA 3JQ8B 2I5PO 1U7TA 3W6ZA 2X5JO 1LRJA 1DDOA 3AUTA 3ULKA 2FSVA 3H3FA 2EXXA 4L0QA 1ADGA 1P31A 2W2LA 3CSDA 4Z9XA 4QQRA 1HE3A 4XJTA 2A94A 4B4VA 7ADHA 3AUUA 2VQ3A 3S2IA 3BIOA 4IQ0A 2VT3A 3UAGA 2OUIA 1PL6A 2NADA 5I9MA 2YFHA 4IZHA 2EW8A 3RBXA 2YQ5A 1O95A 3VH1A 1C0KA 3PQFA 1J4AA 2J6IA 2P9EA 4N5NA 4CV0A 5I7VA 1XQ6A 4OH1A 3IJRA 4R1SA 3K9QO 3TZQA 2CZCA 3PP8A 3QWFA 2DBZA 3AY7A 2Q1TA 4S1VA 2O3RA 2O7SA 4XR9A 4ZVVA 3IP1A 4BGIA 4CV1A 3RUAA 5T67A 1O9BA 1SZJG 4IUYA 1HZZA 2Q49A 3QVOA 3P2YA 2BELA 5A9RA 1QMGA 3MTJA 1E3SA 4J4BA 2QQ5A 3VVBA 5LDHA 4OQZA 3D3WB 1ZBQA 3AOEC 4XX0B 2DQ4A 3L4BA 3E6AA 4MVJG 4MVJE 4NK5A 2J3IA 2X23A 1WDMA 2BGLA 2C2YA 4DYDA 4E5YA 4OYRA 1WP4A 2AG8A 1N5DA 4NJOA 1GZ4A 4XYLA 3GAFA 3DOCA 4U5QA 1EFKA 1LQUA 4CR7A 4FJ2A 1KEWA 4XGNA 3F3SA 3KM0A 2JHGA 1YDWA 4K6CA 4EJ6A 5CEJA 4HNHA 4ZQHA 3Q2KA 3I5MA 4CMKA 2NU6B 1PZEA 3DHYA 3QY9A 5TC4A 3TZCA 2H6EA 3I9KA 4OXNA 3QWHA 3GVHA 1YJQA 1H6DA 1EQ2A 3FNEA 1TB4A 1KOLA 1E3WA 1T4BA 4L4SA 2HMSA 1Q0LA 4PLGA 3KB6A 3MOIA 1LLUA 2D5AA 2QG4A 2R00A 2I76A 3I6IA 1U5CA 4TRJA 4C7KA 2B69A 3PWKA 4OHUA 3V2HA 3SVTA 2WYVA 1E3LA 2AEJA 5JSFA 4YQZA 2HQ1A 1YWGO 1PS8A 3SXPA 3S2EA 2DM6A 4DMMA 3DOOA 5CDUA 3ANNA 4Q3AA 4RQTA 3GUYA 5B1YA 2AEFA 3H2SA 3CE6A 5JDCC 1C3VA 4D41A 1R16A 2XXJA 5JDCA 1PTJA 3AUSA 1FDTA 3AFNA 5DP2A 4YWJA 4GLOA 4BO6A 1U28A 1U4OA 1B15A 2AA3A 4MKXA 3BA1A 3VKUA 2HK9A 3GK3A 1Y7TA 3GGPA 4WASA 5I7FA 5EMHA 3BHIA 2PWZA 5CP8A 1EUDA 3WGYA 1R12A 2GN9A 1ULUA 4CLHA 1LJ8A 4B4OA 3ENKA 5A04A 4OKNA 4YAEA 2Q45A 1PZGA 1JKFA 3FCOA 3OQ1A 3U4IA 4YAGA 3IQDB 2WD7B 1A71A 2Q2QA 1TXGA 1UP6A 3H5AA 1LSJA 2V6GA 2UAGA 3KVOA 2YUTA 3PZBA 1QORA 2P91A 4X54A 3PXXA 4XDZA 9LDTA 2CFCA 2B37A 3L0DA 5AXCA 3ZU4A 4LRSB 5L7YA 2VUUA 4U6QA 4AG3A 4KTVE 3D4OA 5G4KA 2VNAA 4Q9NA 1TI7A 4WNIA 5C37A 3DBLA 1P1RA 3MJVA 4J0EA 4I9NA 4R41A 2FPPA 1X15A 1Q2XA 1BVUA 5F1OA 4A26A 3JQCA 2BMAA 5AYVA 1XELA 4DXHA 3C1OA 3I9MA 1DOHA 5EIOA 2OBNA 1DRWA 5F21A 1SOWA 2WD8A 3FN4A 4CQMB 1E6EA 1GYRA 4FQ8A 1B3BA 3NDJA 3ZGYA 1T2CA 2NUAB 3I3OA 4BV9A 3WTCA 3DTTA 1UXGA 1LLQA 3ST7A 3HNPA 4CLRB 1WAMA 1BWSA 2BH9A 3HN2A 5JCXA 1SOVA 5I8ZA 3TQHA 2Q1SA 4YBZA 5GZ6A 3D64A 1N1GA 2DFVA 2D8AA 1I2CA 4DLLA 5JC8A 2CDCA 5EPOA 1FF9A 4IGFA 3T4XA 3BTUA 1SCUB 2R00C 1F8FA 3V8BA 2Y0CA 4XQGA 5J23A 4Y98A 2PTGA 1IOLA 3GN1A 1RM5A 2X5KO 3F1LA 3VHRA 3HDJA 1HT0A 3U62A 3LT2A 4E5KA 1GUZA 4A7PA 1JTVA 1FDWA 1MC4A 4ZJUA 4I1IA 5BNTA 1I5RA 4A10A 2E37A 4N7RA 4CM8B 3PWZA 3TFOA 3DXFA 2PLAA 4D3DA 1PJSA 1ZFNA 4O0LA 4UEOA 3ZWOA 5A3JA 3AOGA 4PG6A 4Z0TA 1A7AA 4CMEC 3JQGB 2PKRA 3OA0A 4W4TA 3M2TA 4TRMA 2VWGA 2NTJA 3GG2A 4H3VA 1D8AA 3H9JA 1D4FA 3PQDA 1ZEMA 4INAA 1WZIA 1K6JA 2F00A 2YZ7A 4IQ8A 3JYNA 3WFIA 1GCOA 1PL8A 3K8ZA 4R1UA 4EW6A 1BRMA 1PGQA 1KVSA 3WNVA 5HTOA 4FFPA 3JQ9C 1EUZA 1Y8QA 3ON5A 4JGBA 3EGOA 1AUPA 3K73O 3OQ6A 3NUGA 3PHIA 3EVNA 1KY4A 5IDWA 2XF8A 4ZQBA 2IZ0A 3KYDA 2ZB3A 1CQJA 2E82A 2ZTUA 3I52A 4NBUA 1BHSA 4GLLA 1DO8A 2EP7A 3H9QA 2FRDA 3VH4A 3MOGA 1UDAA 1VC2A 3DZIA 3A4VA 4HWKA 4WCFA 3AY3A 1P0FA 4J3FA 4WLUA 4PG7A 2IXBA 2HJRA 1NPYA 2QZ9A 4XYGA 7MDHA 1I30A 4DIFA 4CLEA 1DRVA 4I5FA 3ADPA 2EJVA 3DR3A 4B8ZA 2YJZA 4P8RA 1GADO 1HYGA 1Q1NA 3CINA 5BSFA 2VHXA 3JTMA 4J6FA 4I5GA 1A5ZA 4YT4A 1PX0A 5IZCA 4E0BA 4ZRMA 1A9ZA 3JQ8A 4BOYA 1XYGA 1DIAA 1KC1A 1DHTA 2DLDA 2VOJA 3I23A 1ZMOA 2NUAA 2VHZA 3FBGA 3W8DA 2D59A 1PZHA 3GMDA 3DONA 4BO5A 2A4KA 3O03A 2IYOA 2NLOA 3CKYA 4KMSA 1ISGA 2QHXA 4D3FA 4YEDA 4NJMA 2DTXA 5A9SB 4K6FA 4MDHA 2RH4A 4N5MA 3NAQA 4B7XA 1HTBA 3C7CB 3AU8A 2Y1EA 3PYLA 4OXYA 3WNQA 1U8FO 4BV8A 1LI4A 5KJFA 2I3GA 3JQAB 5IF3A 3UVEA 1LRKA 4BNTA 5THQA 4Y6PA 3IL2A 2ZATA 3PK0A 4WNCA 1VL8A 5CDTA 5AXBA 5C7OO 2AXQA 5DNAA 3H4VA 3HFSA 1GEEA 2ZYGA 4B79A 2JAPA 2ZB4A 3CUKA 4BNMA 2BD0A 4KOAA 1R4MA 4LSWA 3ETGA 1ZSYA 1KETA 3PLRA 1ZJZA 1WDLA 5TF4A 4E32A 2CVZA 3GRKA 1N1EA 3ONFA 4H15A 3MWEA 3G1TA 2J5KA 5KWEA 3ANLA 4OMUA 1B8VA 4BNFA 1AGNA 1R37A 4JJIA 4MINA 3FNHA 1NWHA
chains in the Genus database with same CATH superfamily
4FMDF 4DREA 4YMLA 2P3SA 3DXXA 3UJAA 3Q9LA 4JI7B 5DI9A 3KBBA 4O2BB 3V7UA 2O3JA 4AN0A 3PA8A 1NG9A 4D25A 3MTGA 4OHMA 1PGOA 2DUUA 2QTBA 4CQJA 4RK6A 3Q9UA 3GEBA 4G4IA 3I6BA 1TZ2A 2X5NA 3GRPA 1T5OA 1ZM4A 1X2EA 3RVDA 2DJ5A 4G5XA 4DV4B 3GHYA 1AGPA 1JS1X 1IBSA 3EDQA 4IJKA 1NP7A 3HYLA 1IYZA 3GYBA 4AXXA 2FPLA 2XLCA 4MR9B 3SXJA 1KEZA 1PUIA 4PHHA 4CGZA 2AZ4A 2WRZA 3RHFA 3P52A 2MOKA 2WJ3A 4TUYF 5JCJD 1YIOA 4R9NA 5B1EA 4PE5B 3ZDEA 4NZZA 1O87A 1G8SA 1XUOA 2CXTA 3DEIA 3WL4A 4BJ5A 4GEKA 2GFHA 2RJOA 2Z6UA 1GT6A 1RHJA 5JZMA 2CXRA 4AQ7A 1VMDA 2Z04A 4NZYA 3NNSA 2DP4E 5DYNA 2CV0A 2RGNA 4XIIA 2V7UA 2XE7A 2B7CA 5K2OA 3N0TA 2P5YA 1DOZA 1H2HA 3NBYC 3IEMA 1PFWA 1CLUA 4IIHA 2EDCA 4H1TA 5JH7A 4AI6A 2XSZA 4R3NA 3EIWA 4ZFNA 1O6BA 3AJ8A 3ZDXB 4BV2A 3M9WA 2ETXA 2P30A 1N2XA 1JT9A 1X1RA 1CUUA 2XGJA 2HFKA 2FPMA 1H2BA 4R2IA 1ZEJA 2I3AA 1RWXA 3AWDA 5F7OA 1L1QA 1Z56C 1CB0A 1AT1A 5AHKA 1PT9A 4MCJA 5LD2C 1FFSA 4Z1MA 4AL4A 3ZVNA 3G9QA 3KWLA 1E2DA 2WV7A 4O2RA 1J7JA 3TQOA 4U63A 1WUJS 2J4FA 1VG9B 3E23A 2C9ZA 3HWX1 1DC7A 3ZKAA 1LZLA 2X14A 1A9YA 1RW4A 1FP7A 1P3Y1 2GAFA 2XCLA 4I1YA 4K6OA 5U4QA 5ITVA 2A6PA 5JNUA 3L4JA 4HZGA 4PSAA 4WESA 3RWBA 3D4IA 5KSYA 1XTIA 5M34A 2OBBA 4QUBA 2IQ5A 4NYIR 3TTSA 1KI2A 1Z2OX 4NBNA 3ZG6A 3JD1A 4PRLA 4BP8A 3ZCXA 3EQ7A 1U2GA 4PGGA 5EJFA 5E4YA 2RAFA 1DTEA 4QGAA 3NHBA 5CM9C 1IMOA 5ETJA 2XTMA 1OMOA 1U7WA 2G5CA 3PXAA 3WWEA 4BJ3A 3FOBA 1CJBA 1CQPA 2GO1A 5HJ7A 1JAZA 3PGVA 1RC1A 4GMKA 4RK0A 3SZGA 2BR4A 1T5SA 2BF7A 4NFHA 3CUEF 4DHWA 1ADBA 1QLJA 4V39A 3SOPA 3KQKA 1EXNA 1N92A 1S2MA 2H57A 1J2RA 2PKCA 2VSYA 3PWSA 3QVKA 4KBFA 4XWTA 3TEMA 4BL5A 5HKOA 1YUMA 2ZJFA 3OQBA 1UXJA 3MJSA 1DC4A 1ETHA 2MDTA 3ZHQA 4OQDA 3BF8A 2P6NA 4XX1A 1V8FA 3DFKA 1E7QA 1TYCA 4UCXA 1IK6A 4ARAA 2QSYA 3GL9A 2PQ2A 1AGXA 4S1PA 1GVNB 3K3PA 4BMSA 5G0UA 4DRYA 4O33A 3CISA 4OKSA 3I42A 2DT5A 1B8UA 1Q22A 2H8GA 5IC5A 2PM8A 3EUAA 2O14A 1TPZA 1Y7LA 3GLFA 4E6PA 1T3GA 2FMTA 3S2GA 4D9BA 2FP4B 2IWRA 3RO7A 5JXWA 2Q5HA 4QL3A 4B73A 4Z6KA 3R77A 2A7XA 3RIHA 1U1GA 4EY6A 4V0NA 2WPNA 2XTNA 3GVCA 4GKAA 1EPUA 4ENPA 1YVPA 3RUFA 3HG7A 1I7NA 2ZBEA 3LCJA 4NAVA 1KPIA 1YBVA 3WMWA 1M8GA 3TKYA 2F64A 1D04A 1KGSA 1H9CA 4BO8A 1VPVA 4KVFA 5LA6F 4JFRA 4N3CA 1N6RA 2YZGA 3ZLBA 4W5OA 1HI9A 1GAQA 2WJ4A 3NBZC 1AVTA 4JD5A 2AOTB 3VR5A 1LFAA 2MHCA 5M5BA 5BWMA 1NW4A 3AHIA 2IRWA 4WX2B 1F4PA 2RMKA 4Q03A 5E8RA 4AECA 4EABA 2DVMA 3SYKA 2N9UA 3BB1A 1IY1A 3BXPA 3NAMA 4KU4A 2O8FA 3M34A 2IYEA 1HDEA 5L4NA 3Q8KA 1P6UA 3MJEA 2XJ9A 2G5GX 5JNVA 4NV0A 1GZVA 3AUXA 2P2DA 3BBLA 4RETA 3AJ9A 4ZVLA 2MSDB 4HATA 1R8YA 4EJ2A 2F3UA 2W2PA 4KMOA 1NR7A 2AOVA 4D79A 1HX7A 5TX7A 1GQ2A 4OMCA 5CVDA 1ZH6A 1I9GA 2ENUA 1VG8A 1W4AA 3H86A 3KJZA 2QM0A 5EE0A 2X15A 3QKWA 4TTIA 3RC9A 4G8BA 2QYTA 4QPPA 3QUCA 3CBQA 2EFCB 1GPH1 4R16A 5ED4A 2I4NA 5KYUA 1IRIA 1WDKA 4KWIA 3O92A 3DDOA 4D46A 2V5UA 2JVIA 3RBAA 2FPXA 2QIPA 4IJWA 1U5BB 4ZO8A 3HI4A 3AC0A 1LX6A 1A04A 1X0XA 4FYYA 4OKIA 1D1TA 3P9SA 1X1TA 3AOEA 4RF4A 1XCOA 2J4DA 1H2YA 3LRTA 3N53A 4AY4A 4EY7A 5BYBA 4CKCB 3WGMA 2LIPA 1UFKA 2J3JA 3PT5A 5DNEA 5F33A 5SICE 1O94C 2XYRA 4YPFA 5HF9A 5T8KC 3T0IA 1TAQA 4E3WA 4KK4A 5C32A 5IJ9A 4HGOA 4JODA 1SVUA 3MT0A 3HUEA 3AI3A 3JQBC 3L7LA 3PX3A 1VE6A 3PUVA 4LGCA 5EWLA 4JXZA 2EDAA 2BEUB 2NO4A 1ONBA 1A4UA 1CY4A 2J0UB 2XUIA 3AGQA 3TBKA 3BXXA 2ZUFA 3SVZA 3LD9A 4ZCTA 1FJXA 1RMTA 4EFLA 5CB4A 2WIFA 1X7XB 4O25A 1KRWA 1H05A 2DYKA 3PI7A 3PQ5A 4CQLB 2F90A 2CBZA 3AWIA 2YVAA 2CJPA 3TAHA 1QP8A 1DB3A 3QJGA 2DJIA 3KTFA 3DZJA 1AZTA 1FYXA 4JNKA 2P9BA 3S44A 2GXAA 1KO1A 1KKUA 1SKUA 3IVCA 3KUXA 4N48A 4JVOA 3VOAA 1DXHA 1OFTA 1IZ9A 1WL8A 2YVLA 3LKZA 3TLMA 2V7PA 1I3LA 1XRQA 2ZB2A 3GJ4A 1EP2B 3FPFA 2OECA 3OJFA 2NXWA 1XWWA 3GAZA 2OLJA 4F8JA 1HR0B 1LPSA 2AOUB 3EQ6A 2QMUA 4EKNB 4INJA 1N4AA 1NNSA 4Y6RA 3D6VA 1KFCB 1UMDB 3IKJA 4QECA 1UT6A 3ORYA 4A2QA 4QHYA 1FRQA 1C29B 1KY5A 1H66A 2UUAB 1TQ4A 1OFGA 1YZNA 2CVHA 2WR8A 4PRYA 5LOVB 3DTYA 1V3TA 2WUDA 3IVMA 2ZTLA 3GZNA 3SYTA 5IABA 3C3AA 1GNSA 3CR8A 4ETMA 4AUNA 3ZE0B 4KRFA 2CY0A 3QVTA 3T5AA 2X19A 1BW9B 1PU2A 4MDEA 1FZQA 2O5VA 4M89A 2A9FA 1P6QA 3LPMA 3OCZA 4J7CA 1MV5A 4HDKB 4QDUA 5ESWA 3U09A 3EIHA 3FTNA 1DX9A 3KVYA 3DW1X 1K7CA 1EVZA 4M3NA 5CMLA 4U02A 4M21A 1R0SA 1P1FA 2ODTX 3JQGA 4K87A 2FEOA 4U8GA 3PQ8A 3QEMA 4ALJA 5CIWA 5B6PA 3PPYA 1LLCA 1SRQA 5AW7A 2DLNA 2HAEA 2E4WA 4JUBA 1QO7A 4OIFA 1O96A 2CNNA 2H48A 3FVQA 3KRTA 4HCJA 1S3FA 1JG2A 2JIZD 1W6RA 3GF4A 4O08A 1JXQA 5HF8A 4DABA 2FAXA 1YRQA 2BSXA 3X2FA 2IE8A 4DMFA 1MJ5A 1JWAB 2A92A 4CKEA 1WV1A 5AI0A 4GYYA 1OX4A 3RU2A 2QQFA 4HNQA 1B14A 1NBIA 3PNVA 1JIVA 4TLBA 3Q87B 3IQXA 3UENA 1EAYA 1PQUA 1WQ1R 1R88A 2R1ZA 3G0GA 1T1GA 2UZ1B 5U9CA 3R0XA 1OB5A 1BROA 1DUIA 1ISJA 4BDSA 1ZG3A 1TD1A 4K05A 1DQRA 3ZX4A 3T5BA 3HBNA 4CDGA 3G68A 3TZHA 1YKFA 3FHLA 3BDVA 2X9QA 4UHBA 1J9EA 4E22A 2HDOA 1WDWB 2Q5OA 3K2EA 1FS6A 1BEZA 3T5CA 4E21A 1QE0A 3I2FA 3CN9A 1ZD8A 3VR6A 1WG8A 4ID9A 3AEKA 3M89A 4JUDX 3T8YA 1TVEA 1G8KA 1QE5A 4HV4A 1SD5A 2YJNA 4XD7D 3FUTA 4PWZA 4CKYA 3PI6A 1H3FA 3T3MB 4GUDA 1TZKA 3IBYA 2WHRA 4KVZA 1UAGA 4C43A 1P61B 2G7ZA 1V45E 3CRVA 2WB4A 3Q5EA 4UVEA 2WWXA 1MORA 1V3UA 4G01B 2CJWB 3SQXA 4CWAA 1AKUA 5DHAA 3Q9SA 3W05A 3B3AA 3HABA 4EW3A 3HR7A 1U1EA 1OYVA 3RUEA 3W5DA 2OT3B 4BZZA 1IQRA 2Q1WA 4R5HA 2E4UA 4QIHA 5KX5F 2JFUA 1B6RA 3WHPA 2N47A 1PR3A 4BFSA 3QE9Y 2ANCA 4R0VA 4PS0A 4GPEA 1JHZA 1IEVA 1N3YA 4PXYA 5DI3B 3H6HA 1K6EA 4ZXFA 2V8OA 3CVUA 2QV0A 1FPMA 3FH0A 4R83A 4IIJB 4M0EA 5EP2A 5IUKC 5BPHA 5AVTA 5LWQA 4FMPA 2ISQA 1VI6A 2P4HX 2PQ0A 2PA3A 4YQYA 3BEDA 4EAQA 4E4YA 4ZZ2A 2AE1A 4C5CA 3N70A 3W0LB 2VNIA 3O8NA 3ONNA 1E1DA 3OMLA 3BIJA 2DHQA 3DOIA 3G5AA 3GRVA 4U1RA 4GI1A 3NG1A 4L6IA 5CXSA 5CAEB 5EUCA 2W58A 4AS1A 1RYFA 3LDAA 2BLLA 3ABQB 4W5HA 1E2MA 2VA8A 2X40A 3EYWA 4V3CA 2IHVA 4YJ2F 2VPWA 4YMSA 1LQTA 4CJXA 2YKGA 3TWOA 1KI9A 4PC7A 4P3YA 1UDWA 4D3ZA 4RMNA 3CB2A 3Q11A 4PGHA 2CFSA 3NRCA 3N0XA 3OHPA 4BNIA 1YHNA 2J4CA 4ND1A 4U0KA 1Y6JA 4YAJA 5F7XA 2WFZA 2H4JA 4IDQA 2ZKLA 3FUCA 4XEUA 4E2XA 1C0IA 5KYXB 5FNVF 4QELA 4MLDA 1G291 3IKMB 1O0SA 1R0CA 4V0KA 5K6AA 4UEQA 1KGDA 1KJ9A 3EOBI 5A5EA 5JHHB 2Y6UA 4A03A 3KR0A 3EZNA 5KREA 5F73A 1H4VB 1JHRA 2UZ4A 1HLPA 1SC3A 4DIBA 4MJ7A 2J3MA 1P4RA 1SUDA 4DV7B 4GGMX 2IBSA 3S28A 2AE2A 3DO6A 3WK5A 3KT3A 4DPMA 3K31A 4X66B 2EATA 3AEUB 4BP3A 3RHTA 1E1CB 1MVOA 2GVNA 2DKOA 2VQFB 3EB9A 1UIMA 5IKEA 4Z4GA 1QOQB 3C8ZA 2QBYB 3H83A 3D7MA 1U2TA 1YB1A 1CUAA 1FTSA 1VA5A 3H4IA 3D6NB 3PUYA 1Y8RA 5FLKA 3U7FB 4O2AF 1N7GA 4C9BA 3QJYA 2AJDA 2BFBB 3GT7A 4MHOA 5BN4B 1DSSG 3MWJA 3U39A 2JW5A 5JVDF 3BMQA 5I7AA 3P1JA 5DHTA 4JN6B 3UAVA 5C18A 4LBZA 4BFVA 4FS8A 4DN6A 2DB3A 1R0XA 2PYDA 3F6PA 3A06A 3MGKA 3N2NA 3RC2A 1E1RD 3NTUA 1MJGA 5EN4A 1DT5A 3TFWA 4DV0B 5BNZA 4WSOA 3K35A 1YBFA 1T26A 3P4UA 3R3VA 1IXKA 1U9JA 3MWYW 5LA6B 1AF7A 1N9KA 2QTMA 3ASZA 3V1NA 1EBUA 2IP1A 4KSBA 4YRKA 1MX3A 1Z2CA 1P8AA 1NW6A 5DOZA 2CXXA 3VNQA 3M5CA 2C4WA 1D0VA 1DLIA 2DBYA 5EWMA 1NNEA 2BKEA 1PR6A 2PVSA 2AJ8A 2QN1A 4I8IA 2VWHA 4W8OA 3SICE 2ERXA 2IPLA 3U4QB 1X19A 3HNOA 4H08A 4ARUA 1LPNA 4RQAA 2I6FA 4UM5A 2OLEA 3ZWMA 1CUDA 4HUTA 4IW3B 3WO1A 1Y6FA 1CBUA 5T3UA 2HSDA 1KXZA 2OBLA 3AL2A 3S8YA 3LUGA 1DI0A 1QF7A 1SXIA 5PNTA 1VPDA 2BH2A 3QHPA 3ROGA 2KB0A 3LK7A 2E5FA 4OLBA 4K9QA 4E03A 5A5DA 3SDSA 3VU9B 4FOTA 4ER5A 3V1YA 2PL9A 1Q77A 3EG5A 1DG3A 3U40A 5KJEA 3URKA 3RWMB 2G9QA 4TV9B 5K0BA 3OJLA 1V9SA 2QRPA 2LV8A 3D4PA 4JZYA 2XDQB 5U1PA 1GVHA 2FUG6 3WB0A 4E2WA 4LYGA 4GMHA 1MHPA 2CVQA 1EDZA 3CRZA 4JQYA 2G83A 3ZWVA 3JQFC 1WO8A 2HMAA 2I22A 2QPAA 4IDFA 3K9FC 3OKFA 3FG9A 3QFFA 1CUFA 5CHYA 1ZI9A 3S99A 1H9BA 1TMYA 2GD0A 4XXHA 1M2JA 2ZRDA 3OM9A 2D4AA 4HVAA 3STHA 4YUZA 4XQ0A 1ZKDA 2C59A 1MUUA 1YI8A 2WAXA 3EVCA 1W49A 3U44A 1H8EA 5H82A 4BQOA 4BMPB 2QTVB 4DYVA 3HO8A 2OFFA 2CHUA 2LWIA 3TLGB 1LC3A 1LA2A 1P2DA 1GAEO 4MVWA 1U3UA 1WE2A 2I33A 1VGVA 4WEQA 2QRLA 3G89A 5DP1A 2W0MA 2QWXA 3I12A 2XBUA 3CGGA 4KKXB 3R0VA 1JN0A 1KMNA 2E2WA 4MJ3A 1BH6A 1DCKA 1MV8A 5KKCA 4AIIA 4LYHA 1OYYA 3KKKA 3BMOB 1PJ2A 2HJVA 2OGWA 3JAKB 2H5LA 4G2NA 5KTPA 3CC8A 1YDGA 4FEYA 4BCCA 3CR3C 3OF5A 1GQQA 4LQCA 3AEKB 1P0IA 1YE8A 1PT5A 3EDOA 4HHEA 2RFLA 1RKUA 3LQFA 4NV3A 4EHJA 2EU8A 3UV7A 4NZPA 3FYDA 3P0FA 3SWWA 3VGJA 5I48A 1SC4A 3ZHXA 1F14A 2W70A 1OIVA 1W5TA 1XEAA 1Z68A 2KLBA 3GD5A 4UCWA 5BN3B 1NURA 3CTPA 1PR9A 1N0VC 3DYVA 1YE5A 5FT9A 3TW8B 1M0TA 2Q4EA 3EGDA 3IAUA 4FGJA 3I5AA 1SD2A 4MKIA 4NSNA 3MW8A 4R68A 4H4CA 3KV1A 4Y7CA 2HCTA 3IT1A 4BWVA 2NTEA 1BN7A 2QORA 5LXTF 3LU1A 2QF7A 3EVGA 5DI3A 2E87A 3BAZA 3WKCA 2WE8A 1BVRA 1GEGA 4I8XA 3KFXA 4EG5A 4WZZA 1N2EA 1T3SA 1X9GA 3ASUA 3H9EO 2X2PA 4G1UC 1SIWA 1RRCA 1OQAA 3VI3B 1FLNA 3L43A 4MZDA 3ZTWA 1TK2A 2XGSA 3EVTA 4H60A 5C8YA 1GZSA 3N2KB 4JDPA 2FZ4A 4GSKA 1TCBA 2GBGA 2V9PA 2ACVA 3JALA 4EQZA 1IULA 3V33A 3FGOA 1A2QA 1FVFA 1HDCA 1GRVA 2VQDA 5JNTA 2Z4TA 2WJZB 4U7JA 3NOQA 1X2BA 4W5QA 4MHTA 2CMFA 2DFPA 1IEWA 4P3KA 1Q16A 5IG2A 3VA7A 1QHHB 4M8IA 2X2FA 2ZQ5A 4DCSA 2HA5A 4CDRA 3HP1A 4DCGA 2WYWA 3U4CA 4ECEA 3GLFE 1PT7A 3JCZA 4UHJA 3H8SA 4MV5A 3KYDB 3TB6A 2R11A 4LRXA 3T6KA 2EZ4A 2VK2A 1PL7A 1Y6QA 3R7FA 4PSUA 3I5YA 1U63A 3U7QB 1PD0A 1Q2UA 3TL6A 3V32A 4AY6A 1F0KA 2W6MA 3FM9A 1T8UA 4L6AA 3SEZA 4QXMA 3ZIDA 1WSBA 5KSWB 1A8UA 3VBEA 5BWNA 2Z5VA 3HV0A 1SHJA 1OI2A 3H18A 4YHBA 4JLAA 4KW7A 4ZCMA 5HJEA 1SVIA 3JQ7A 3MAJA 1JFVA 3DDNA 1XZQA 3H1GA 1H1DA 1CR1A 1TD9A 1TK3A 2JJ2D 3DR5A 4F9GA 1GLNA 3EARA 2DWOA 1KP3A 3GELA 3UTCA 4U9UA 3WV5A 2PZLA 1ZK4A 2XPCA 3PHJA 1GKKA 1P1BA 1HKHA 5C7LO 3A1TA 4ZVTA 4TROA 4A1OA 1ZNQO 2PLNA 4FXPA 4MAMA 1USWA 3JS5A 1ZM2A 1H65A 3RSGA 5C7IO 3IFSA 1DCTA 5ELXA 4PR0A 4KUHA 2XV1A 1V7CA 3IDZA 3N3BC 3VO9A 5JAZA 4I1SA 2HO5A 1XLTA 4M1EA 3THRA 3NVKI 1X1QA 2P75A 3B3FA 1PQ4A 2HIGA 3ROKA 4WZAB 5D01A 4C2AA 3OICA 4UASA 2CV2A 2W0SA 2BDUA 3ONEA 2XKJE 4RVHA 5ILOA 3ZI0A 4FK8A 4BNDA 4E6EA 1GPMA 3UUFA 3TR5A 2QPTA 2QUJA 1KAQA 1NJ2A 2V7GA 3KHKA 4LRYA 5E9AA 1JQLB 5C52B 2WT9A 3TD2A 4JOBA 1Q1BA 3U7EB 4GD3Q 4EBFA 5LWHA 3WGNA 3HHPA 3ILSA 1Q0QA 3F4LA 1THGA 4WCDA 2OHGA 3IXQA 5FB3A 1A1VA 4JR2A 4TRNA 3CU5A 3TFQA 1P1HA 1T10A 5FTJA 2JIQA 1T2UA 1RKQA 2MSWA 4IHQA 4RZQA 1JALA 3DJYA 3MELA 2ZJYA 4M4SA 1SMKA 1QYIA 3DV0B 4HSEA 2BZ0A 5BWOA 2LE0A 1ZUNB 2H2HA 4QX6A 5ES3A 4N3BA 4ZHQA 3TTWA 4JT2A 1VMKA 1D5CA 1OZ0A 2YMMA 4PWYA 3RM3A 4C6SA 2PLRA 3CSUA 3F49S 4L3VA 4ZGBA 5EUBA 4F12A 3NNDA 1NGSA 2YS6A 3HXQA 5AJUA 4XIJA 4HTFB 3H17A 1UC5B 3KJGA 1E9SA 1KOFA 1NJFA 1J2JA 1LY1A 2R8YA 3HXKA 3VZBA 3KQNA 1NULA 4MWBA 3S2ZA 2WTEA 2WEKA 2B20A 4DQVA 4F06A 5COAA 4CR8A 1KTVA 2W6IA 5EWJB 1T6YA 3NM4A 3D3KA 4NHOA 2XI4A 4PX3A 2WWHA 3KO8A 1Y5IA 3OF3A 1PBNA 1FRFS 2ID9A 4GIBA 3FWNA 1SVOA 3TM5A 4B7CA 2VUSA 4RUKA 3H97A 2WSBA 2JLSA 4HXYA 1RAHA 1Z4LA 3COSA 3IOBA 4FGUA 4Z0HO 4HQFA 1HEUA 1ZCJA 3AHGA 2P7HA 3LBHA 5CLQA 4C4YA 4CMCA 5KYGA 2QUBA 3UK0A 4CEHB 1AQUA 1V8OA 1VA4A 4OO3A 1NW5A 1EUCB 1GU7A 2OFXA 4REQA 4URWR 5GONA 2F4NA 3WGIA 2P2NA 1KEEB 1SM4A 2OR3A 1V8BA 3C2QA 3RSLA 2Q3HA 4PZ0A 3OY2A 2BHLA 3SX0A 3NDBB 3S0JA 4Q3NA 3CLSC 4NU0A 2EJTA 1V1MA 5AVVA 3NR2A 1IZ8A 1OIXA 3ZE7A 2BUCA 4R8VA 5T8KA 1YK0A 3QKSB 2CZQA 3GGSA 5GWXA 2NZVG 4LYAA 1EX9A 3E3MA 3EZ2A 1VCNA 3HFGA 4IFBA 4R2KA 1PF7E 4DUGA 3B3JA 4NMLA 3RK4A 4Q7KA 4MSUA 2J5BA 2ZG6A 4C4SA 1TOAA 1OOEA 3FETA 1JFFA 1F12A 2C9MA 1U7HA 4S1WA 4J7UA 5FBLB 5ADHA 4DR3B 1NXQA 3Q12A 1XAHA 3IBCA 3JQEA 3K72B 4HVTA 4B2LA 1Z38A 3DV2A 1DKUA 3EMDA 3OJXA 4NNJA 4DPLA 3N05A 5KTNA 4ZYLA 3F5QA 3HDHA 3V80A 1WCXA 3ZJUA 2M6KA 1S4MA 1QS0B 4W5TA 1ZOIA 3C15C 4YRLA 3TF5A 1GDHA 5TT1A 2FN7A 4NNPA 2RBGA 1ZL2A 3IEPA 5ALKA 3TW0A 2WLTA 2CMDA 1RCTE 2XTZA 4P53A 5J43A 1A97A 3GFBA 3HADA 2A1UB 4MYHA 3E18A 3JQ6A 5C1BA 4I50F 2PKXA 1PJRA 1SHLA 2QVGA 2AIRA 2ZSIA 2DR3A 3EFEA 4YJHB 5FNVA 3ZZTA 1PW7A 4EDHA 3PEYA 4GPD1 4XGIA 4B3DA 1GCUA 1DCFA 1W0JD 5CM2Z 4JJ7A 4C20A 4NBVA 5AW3A 5A4KA 2OCYC 3ORHA 3T3HA 4F4UA 4AU1A 1O6GA 5CYPA 1Y5RA 5IMBA 3OCVA 5F23A 4FR5A 4WZAE 4U00A 4XGRA 4XCVA 3K71B 2UVQA 1J21A 2Z8ZA 3ABSB 4PICA 5LQRA 4P54A 2DR2A 1Y3CE 1UPXA 2C31A 2QYSA 3TOXA 4A0HA 4HFMA 4EYQA 2C8JA 3ZXXA 5ER9A 2XEDA 3SR0A 1FP6A 2HA3A 4UPVA 8OHMA 1HM5A 1WM1A 3FYHA 3GBPA 4Z86A 3AIOA 4DDVA 5T6BA 1KKMA 4X1KA 4TVSA 3OETA 5JSKA 3EJ6A 1M72A 4EWLA 5MN6A 3OE1A 1OH8A 1R5BA 1YQEA 5F77A 3C3EA 3LPDA 4ZOLF 4MIKA 4QUAA 2ODQA 1AY0A 1V9CA 3U7JA 1KQGA 1XD2A 2WKWA 4I4CA 3TSYA 2MYUA 1AQ6A 3OCYA 3D6FA 2E5WA 4BY9E 3GCWA 3NGXA 4ZOEA 3NGLA 3WYGA 4EG7A 1W88B 4RSHA 5A4DA 1E9AA 4MUAA 3OZXA 5L7WA 1F2VA 5AKZA 4CCWA 5JBQA 2Y1DA 2J9FA 2JZNA 2VIIA 1C1HA 5T3YA 3VO1A 4X5OA 4KACA 1SAYA 1JDTA 4RPKA 2II6A 4QYMA 2KWIA 5FUWA 1AKEA 2YRWA 2CFRA 2ATCA 1JR6A 3KOMA 4F4FA 2R7AA 4PSCA 2BBSA 4Q66C 1XIVA 3C8UA 4OBBA 4F5WA 1K9VF 2Q3DA 4ARZA 5HQ3A 3G49A 4H6PA 1QCCA 1AV7A 4JDUA 3OZAA 5IKXA 3T9BA 1UFVA 3AJAA 4Z4IA 2GRAA 3FTFA 4ER0A 4K9LA 4BWGA 2VF8A 3KJFA 2OCAA 1E3WB 1EJ2A 1XNGA 3BTVA 4JU9A 5B37A 1NNLA 3KT0A 3VPDA 4MQ4A 4NZ9A 4IS2A 4DWOA 4WBNF 3O2SB 2Q1YA 3OJCA 3VYUB 4YMHA 4PAGA 3MCUA 1M7GA 1S1MA 1V4BA 3AZQA 3B85A 4RNDB 3ZWDA 3MLAA 4C2BA 2PANA 4KV9A 2WU8A 5KKAA 3EEQA 3H11B 1K3TA 1K7XB 3KTOA 3QNMA 1GZ5A 1UQTA 3AG5A 4LG1A 1OGIA 2AL7A 3ZWKA 1QO9A 4D4LA 5MGNA 3IAXA 3CX6A 1TAHA 1SURA 1RYDA 4GX1A 5IARA 1KHTA 2GPTA 5LMCA 4US1R 4J91A 4PVDA 3DT9A 2VS1A 2IEIA 2UYCA 4I08A 1J99A 3O8QB 3W06A 2WWFA 2PZ8A 4KQKA 2RGCA 1N3IA 1KNQA 3GO4A 3K0KA 4FD3A 1KYQA 4BB6A 3VR4H 1CU1A 4TN5A 1KU0A 3INNA 4DJ5X 3KK0A 2Y4NA 4MS1A 3GVIA 3RUDA 5H83A 5I9LA 3ESZA 1WF6A 3MRSA 3Q85A 4C0XA 3V2GA 5E3IA 4PW0A 3E48A 2PD3A 1IIBA 3E70C 2HEGA 1F2DA 3LRPA 3DLBA 1UZMA 4JBYA 3TINA 1K8YB 5EKDA 2A4MA 1PJBA 5FPTA 5LJIA 2W6ZA 4QICA 1F38A 1AKMA 3RVRA 1ISHA 1QK3A 2J7PA 2WMNB 3HJRA 1V16B 2NZWA 2Z1NA 2DWPA 4W6QA 5EHNA 2C2HA 1GOTA 5JTUA 1JT2A 3ZDZB 4D80A 4BMXA 4U3JB 1YZQA 2HRBA 3EPKA 5DH9A 4WQMA 2WNSA 3G2KA 4PG8A 2ZYAA 5CH8A 1DQSA 2ZKIA 2CE7A 1A9TA 3ZCTA 4BNLA 5L8VA 1QHSA 2CMKA 1F5SA 1DAFA 2GWHA 3SKXA 3HXOA 3EAGA 2YMLA 4N0PA 1YRBA 4FFWA 1M6VB 3GGGA 3P4YA 2W6QA 2NV6A 4BVLA 1II0A 1PT8A 1XTQA 1FW8A 4EB3A 2ZYRA 5BSMA 5KHLB 1Q7CA 3U81A 3U9SA 4CG0A 4BHTA 1HE4A 1O4VA 4Q1AA 4PYOA 4YMTA 3JASA 2ISCA 5I4KA 1U8CB 1V2GA 5DF1A 4JUIA 2G09A 2JIRA 3GEGA 4WY2A 4Q9JA 4EK9A 4YPOA 4JENA 3IR5A 2DHDA 3RANA 3P26A 3UMGA 2YNMD 1PR0A 2COUA 5AO9A 1QGUA 2H1LA 4R54A 3FD8A 4GAEA 1B43A 1Q57A 4G85A 1D0SA 1JU3A 3FTDA 2FSUA 1TT5B 4FKBA 5HW0A 3M1LA 1UAYA 4M87A 4G0OA 121PA 3E9MA 3HHEA 3BFPA 3EFOB 3IUEA 4L4UA 4XR4A 4EIWA 4C7OA 3VJRA 4KBYA 1OPXA 3QKTA 1JG3A 1RYMA 3G0OA 4KNWA 3LFUA 1GYQA 1FDIA 2BWJA 1XF9A 4LRTB 4WXHA 4D4GA 2B4AA 1N32B 4F6LA 1KMHA 4WFQA 3TPCA 5LDGA 1ISMA 1YRYE 2GK3A 4JB8A 3NBXX 2VF7A 5DSZA 3CZMA 4PHCA 5FKJA 2AG0A 4MS4B 2QVZX 3Q41A 1FNCA 4K26A 4XFDA 2XKKA 1EFDN 5DXFA 6Q21A 4IQGA 1H2ZA 2YFYA 5FFFA 3TIGA 4QLBA 4DV1B 2NTVA 4B17A 2ZWPA 3BRQA 5DPMA 3SX2A 1X7WB 3DE5X 4LZPA 3B6ZA 1CTQA 3OC0A 4ND2A 2B9VA 2NNLD 3VHLB 3DCYA 4BP1A 1BHQ1 1PO7A 2HXGA 2XOEA 1UJMA 3CHYA 4C0BA 5J4KA 1IWPB 3HJBA 2UUCB 1TT5A 3WICA 2B4YA 2E9SA 2HMTA 2D0IA 1C7RA 1XQ1A 1YQGA 2IHZA 3EASA 3QEOA 2OD7A 2VCEA 4KV7A 1RPZA 4X1YA 4PQFA 3IE2A 1OFIA 4GM4A 2FOLA 3OCCA 2ZI4A 3EAQA 1GGJA 2GTPA 2V1XA 4GXRA 5JH7F 3FPSA 1QAOA 3QH4A 5AHRA 1QX3A 3IA2A 2NUPA 2MSNA 3MBOA 4PPQA 2AMJA 1WZ2A 1AHHA 5T57A 2C1ZA 2HPZA 2C2XA 1VIYA 1NVXQ 3OA2A 3KX2A 4QDOA 2R6GA 2RGDA 3PNMA 1YU6A 3PUWA 2JGFA 4U4AA 2JH9A 3GZNB 3I01A 4FYJA 3UWOA 1T6BY 3ZW9A 2AZXA 3QVSA 3C1TA 3FNGA 4YUWA 4HMOA 1N2GA 1H8ED 1CUVA 3K1TA 4D82A 1E9DA 4K88A 2J3QA 2EEPA 2B2CA 5EESA 2JIZA 4JMLA 4BNZA 3FIJA 3S81A 4J75A 3H9BA 4H0CA 3CIOA 4OB8A 1E5QA 3HXLA 5E6SB 2IHBA 2QG6A 2Z3WA 5J2TA 1AM4D 1JEYB 3G9XA 4PLCA 4GRIA 3ZY6A 2EGHA 4JUCA 4MAFA 1XVIA 4RKQA 3V5NA 5IRCD 2NO9A 4CUZA 1JHXA 3EUFA 4OAPA 1PBTA 1DIHA 3FHOA 5K6TA 1D7AA 3O26A 3LRXA 1FLDA 2BTQA 4QYTA 4YA6A 4DNQA 4G81A 4TV8A 5HZGA 1TJ5A 3HB7A 4BUZA 2AFHA 1X77A 4MMYB 1ITZA 1L6RA 4YQFA 3HB9A 1J56A 2BZGA 1ABBA 4MIEA 4JK3A 4FDLA 1T3LA 1P44A 1T24A 3VX4A 1P2VA 4MVJM 1BWQA 3CVJA 2LVBA 2GNAA 3EXHC 2C07A 3I8SA 2CLOB 2QA5A 1L1RA 1HFKA 1WA5A 2Q21A 3B9QA 1DC5A 4PZEA 2Y2VA 1WULS 2ENWA 5FUBA 3WNDA 3NMUF 1QIJA 2UV8A 4R8MA 2CB9A 3GZJA 3UFXA 5K0EA 2BJWA 2G1KA 4JL8A 1XLVA 4PG5A 2OV4A 2FEKA 3PPXA 2JI9A 3TQQA 2FJUA 3ORQA 3TW6A 3VKVA 1CZHA 1N8NA 3QUAA 4FKMA 4C7BA 1ZHOA 3TNJA 1G18A 3OJEA 3PRJA 4LQDA 4UVGA 1CQXA 5B4TA 4WLOA 3K0CA 2Q5LA 2BGRA 2YBDA 3ZV5A 1K97A 1N5KA 4B8YA 1BSVA 1I4WA 4I9GA 1GL9B 4ZTBA 3X1XA 4LDRA 1C1YA 4ZHSA 1P91A 1QIFA 4D6YA 4L8VA 1WXIA 2QI9C 2RGXA 2C2MA 2UVPA 1MABB 2J7KA 4ZJPA 1CEQA 1I4OA 2C8VA 2IOQA 3BMOA 2BGMA 4WL0A 1IMJA 1FMTA 3RJMA 4G4GA 4B2IA 5K0TA 2UYHA 5EJ9A 1UDCA 3PNYA 2ATVA 4LK3A 4Y0AA 5CUQA 5JE8A 3AB7A 2HMVA 5AVOA 2Z2YA 3KETA 3OQHA 4JYBA 1J33A 3DWEX 1TKBA 4J16A 5JPCA 3NGMA 1KTIA 2FJPA 3ZDAA 1D4OA 4MVJD 3FFWA 3UC9A 2PSFA 2EBWA 2C57A 4H6XA 3RS5A 4Q4JB 5D5QA 4B6JA 4CM1A 3U44B 1FDSA 2X5XA 4OB6A 4BRZA 1XTPA 3QXCA 1AHIA 1RM3A 3M6IA 2VH2A 3P45A 4K2HA 4KE6A 5HIAA 3QUTA 3ZR4B 4KGXA 4RPJA 1NUHA 2IZ6A 2MYTA 4LJLA 3GJ3A 2HTEA 1COWA 2NUBA 3QKIA 4MEJA 3DO8A 4CCYB 5BSWA 3W4IA 3O83A 1ZH8A 3D3WA 4GH5A 2WI8A 2J9YB 1ZD5A 5CNJA 4FSXA 3FY4A 1WW2A 1V5EA 2JBAB 4DCCA 2HXYA 2IGTA 1W8DA 3IAHA 4ESOA 2FW9A 2IJGX 1Z63A 1JDUA 5BNFA 1NF8A 3LBYA 1ZNXA 3D31A 3RIEA 4IEFB 4U5XA 4XOIA 3NU1A 3T3NA 4BMDA 5HUJA 1FDRA 2H00A 2CL5A 3P32A 2B5VA 4Y9DA 1CD5A 1JA9A 2FZVA 4B3HA 3V8PA 4H4EA 2YJTD 9MHTA 2HJGA 1WXWA 4RO0A 3V3KA 3W5CA 1XQ9A 4J1NA 3B13B 2P6OA 4OHKA 3PC4A 4AJ2A 1E3JA 2VUTA 3QLUA 3MJTA 1KQNA 3A4NA 3U7IA 1WXDA 1RSZA 1AQIA 3IDOA 5E9WA 4A6XA 4AK9A 2FWBA 2C8KA 2RHDA 2D5CA 3A8TA 3E5MA 4Y2TA 4UJ3A 3KXPA 1QFZA 4EG4A 4RPGA 2NXEA 3MAGA 2PNJA 3SXUA 4B84A 3RARA 5C80A 4AJOA 1J5XA 1QH1B 2PD4A 3LG2A 2QGZA 2PO5A 4HUQA 4L8YA 2P77A 2ZAGA 4O1HA 4PONA 9ABPA 5CJ2A 5IKOA 3SNHA 3JVVA 1JJAA 4NWIA 3B6MA 3Q72A 2QT0A 2C2KA 2YWGA 1E66A 3NKFA 2RCNA 4IDCA 5AKHA 5DHUA 4L3WA 1OKKA 4JBLA 2Y0BA 3GPIA 3QU4A 3COPA 5LP6B 3GMIA 5FO0A 2EF1A 3EDRA 4DWJA 3K70D 2W90A 1E7SA 1I0LA 1NASA 1URPA 1HURA 3KSUA 1I0ZA 3PQEA 2XUOA 4FW9A 1DAKA 1RE0A 3GGCA 3NHPA 4RIIA 3WKBA 4BS9A 5JROA 3OZTA 1RR6A 1OHHA 1SBNE 1BE8A 2YYSA 3GQVA 1EFVA 1RHMA 1YZVA 6GPBA 5DBHX 1S3IA 1N5OX 2EZ8A 1HWYA 4PN3A 3K5PA 5B5SA 5FBHA 5A3RA 3URMA 3U4QA 1N6PA 2BFWA 2REBA 4FPXA 3IPYA 1UBFA 5LBTA 3EXG2 4NFLA 2JCVA 4MW4A 4EKDA 3WIUA 3NUZA 1QO0A 3LYAA 1EHYA 1TLFA 4JROA 4FOOA 3QE4A 4IINA 3AVVA 3EZ6A 1IY8A 3GPBA 4UFNA 4QA9A 4CN9A 3EISA 3IAEA 2QUAA 2Y0DA 3Q7QA 1NV8A 5ADWA 3QFSA 3OZSA 5FA6A 3UFBA 1E2QA 1Q21A 4CRWB 1WVMA 2H0AA 3AV0B 2ID4A 1L2TA 2Z95A 5IT5A 1RXUA 5DNWA 2Y0PA 5FPKA 4K6GA 4NCNA 2ZJ6A 1ZISA 1H1TA 4MGYR 5HGXA 1XNRB 1SXQA 4OU4A 1PP4A 4OQNA 3E9ZA 1EWRA 1UKVY 5AKLA 5K3CA 3E1KA 1E3EA 1EZ4A 3IQFA 4B74A 4BTLA 4X0EA 3HVKA 3MTQA 5HYVA 1C9MA 1CC1S 1EZZA 1XV5A 3ETHA 4QU5A 3AR8A 4P5PA 2G1JA 4N6OA 3OOWA 1DG9A 2AV6A 1X7DA 4XH9B 1M76A 5EMNA 1TAGA 3WP0A 5LLTA 3FCEA 1RCUA 2BTQB 2H7CA 4H7EA 1GAXA 1U0FA 2CLSA 3DVQX 3KEOA 4FI3C 1T2DA 4RIEA 3WYEA 4B80A 1DQPA 4JP5A 3A05A 1VLJA 5BRNA 5KTYA 5L3SB 5LOVF 1NQOA 2PL3A 4LJYA 2I54A 3LT0A 5CX1A 3SD7A 2IL1A 1N2CB 1GD1O 3QOFA 1G20A 2GM3A 2I7XA 2QQGA 1ZR2A 3W5BA 1I94B 3BGIA 2TYSB 2QX6A 4MVJI 2AD1A 3FZEA 1IJFA 4HNGA 3MMNA 5IJAA 4CIAA 4YP1A 4ZVKA 4EFKA 1U4NA 2WKPA 2ZT7A 3NHFA 1A8SA 2JD0A 4WRRA 2AC2A 3E4CA 3WYCA 3H9GA 1FRNA 3NDRA 5HK9A 2OTCA 3E03A 3ML1A