2YV1A

Crystal structure of succinyl-coa synthetase alpha chain from methanocaldococcus jannaschii dsm 2661
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
287
structure length
268
Chain Sequence
MILLDENTKAIVQGITGRQGSFHTKKMLECGTKIVGGVTPGKGGQNVHGVPVFDTVKEAVKETDANASVIFVPAPFAKDAVFEAIDAGIELIVVITEHIPVHDTMEFVNYAEDVGVKIIGPNTPGIASPKVGKLGIIPMEVLKEGSVGMVSRSGTLTYEIAHQIKKAGFGVSTCVGIGGDPIVGLRYKEVLDLFEKDDETEAIVMIGEIGGGAEEEAAKFIEKMKKPVIGYIAGQGTAESKMKALEEAGAYVAKNISDIPKLLAGILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Succinyl-CoA Synthetase Alpha Chain from Methanocaldococcus jannaschii DSM 2661
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
total genus 91
structure length 268
sequence length 287
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2yv1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yv1A01
2GPTA 4NBTA 4EJ0A 4FCCA 1IYZA 3AW9A 5CPBA 1GY8A 1VC2A 3H9UA 4CR7A 1N2SA 1NFQA 3UN1A 3JQ9C 4GX5A 1JLLB 4XR9A 5IF3A 3LYLA 2X0NA 5IDQA 4E5PA 4LW8A 1PQWA 3DDNA 3E5MA 1PIWA 3COSA 3S2IA 3RU9A 2OXIA 2JAHA 4JX8A 4U8GA 1UXHA 2HMTA 2TMDA 3CZMA 1SO8A 3RAJA 4JJFA 2WYUA 4BNIA 1N7GA 3K6JA 1HDCA 1N7HA 2EV9A 1HDZA 2V6GA 4ZN6A 3IC5A 3U4CA 4I9NA 1G0NA 2EERA 1KBZA 4R1UA 1G1AA 2NNLD 3JD2A 1GPDG 4NJOA 4IIUA 3IOYA 2BGLA 3ZV4A 2Y1CA 1WP4A 2Q1SA 2CZCA 3WBFA 2X4GA 2AXQA 4GH5A 1CYDA 3NT4A 3AY7A 2PZLA 1SEVA 5H82A 2Q1WA 4YRDA 3D0OA 4ZQHA 3JYLA 1E7QA 1Q0HA 4M89A 4DMLA 2DFDA 1QYVA 1SCUA 2J5KA 3JQ8B 3NV9A 1PJLA 4GKVA 1XELA 5B1YA 1JWBB 5EQDA 3I9MA 1EUDB 4Q3NA 3QW2A 2QW8A 4NZ9A 3PHIA 4WLNA 3IS3A 2EG9A 3QQPA 2AW5A 3IJPA 3IKTA 2JL1A 2EWMA 4DQUA 4B4UA 1DFIA 4KUHA 4OQZA 3KSUA 1JN0A 2A94A 4MIOA 3ZI0A 1MFZA 4B8ZA 1XCBA 1MB4A 2PD6A 4UVGA 1BDMA 2R00A 5DBGA 1CWUA 2P4QA 3F46A 1Z7BA 4IXWA 4IGEA 3BMOA 4G2NA 5KTKA 5LDHA 3DMTC 1MC4A 1PU2A 3MTJA 4XGNA 4OH1A 3CEAA 3NTQA 3I9OA 1NFRA 3D64A 4OKNA 4XQGA 4I5EA 3FNHA 3JYOA 4CQMB 2XF8A 3UHAA 3OA2A 3MJTA 4YJGB 1GR0A 3C24A 3FWZA 3VH4A 4A0SA 2IYOA 3UXYA 1I33A 2GERA 5DOVA 4U0JA 3F5QA 4FC7A 1HLPA 3L4BC 3A06A 4RDHA 4E12A 3VZPA 3PJDA 3S2GA 3PWSA 1F0YA 4JK3A 3JYNA 3U4HA 4ZRMA 4CM9D 1HSOA 1P0CA 1XHLA 2IXAA 1DC3A 1VSUA 5A9SB 4DC1A 3ZWXA 2C54A 1LDYA 1CJCA 1O9BA 3CMCO 2Q1UA 2D1YA 2RBEA 3G79A 1PTJA 1YOVA 1N1EA 3ZU2A 4DREA 4CMJA 5JYEA 4D0SA 4D41A 4RVUA 1EVJA 4UEKA 3HN7A 3R3JA 2OP0A 1BXGA 1Z73A 1NQAO 1TEHA 1U1IA 3EK2A 4JP3A 4K1LA 4C7JA 4DTIA 5L4NA 5T64A 3ASVA 2NWQA 3QE3A 4PLFA 5IAAA 4XYBA 5IG2A 2DFVA 3M6IA 4ZHSA 1E7MA 5TX7A 3OEWA 3E9QA 2ZCVA 2DLDA 3I23A 4M86A 2ZQYA 3RC9A 5KJFA 1E7YA 4OSPA 1BVUA 1MGOA 3WTBA 3ZH2A 5JS6A 1C14A 4CJXA 1E6EA 4EITA 2WEKA 5JLAA 4HWKA 4I5GA 4II2A 4Z9XA 1T2CA 1U3WA 4KWHA 3D3EA 1IZ9A 4TKLA 5C3MA 5ILGA 4UUNA 1PJ2A 3W8FA 4QX6A 3OJ0A 2NVWA 4TRRA 3LDHA 2HJRA 3FBGA 1PX0A 3W1VA 1D1TA 3DQPA 2NQ8A 5DULA 1Z74A 1GCUA 4EJMA 5KVVA 1D8AA 3K2BA 4E2YA 3WOHA 2JD2A 3FN4A 4U0KA 3EW7A 1NAHA 3GNTA 1AHHA 1V3TA 1ORRA 1H93A 4FJ0A 4FJ2A 1O89A 4LRSB 5JAZA 4W4TA 1XR3A 4CMBA 4CLOB 2YDXA 1Y9AA 2O3UA 4RV9A 1SB8A 5J23A 1WNTA 2YV3A 1SC6A 1GV0A 2ZB3A 5G4KA 3LT2A 3HUDA 1HLDA 2CFCA 2JFFA 1M6WA 1X7GA 5I8ZA 2R2GA 4RVFA 4RL6A 2Y0DA 3E48A 3KRTA 2NM0A 2O4UX 4K6FA 4NU5A 3AY3A 1EVIA 5L4SA 5HBRA 3EHEA 3PXXA 3S1LA 3O26A 2GZ3A 4GWKA 3AWDA 4ND1A 1ISJA 3PHJA 1E3SA 1LC3A 4BMSA 4BO2A 1WAMA 1DFHA 4FJ1A 4AL4A 1EUZA 1ENZA 4ALLA 1C0PA 4DQXA 5B4UA 1YVEI 1Q2XA 1ZW1A 1H6CA 2GD1O 1HDRA 3W8EA 2VWGA 1MV8A 3C1AA 3FBTA 4FGWA 3JD0A 2NUAB 1ZK4A 4GGPA 5KKAA 4P4LA 1BW9A 4D43A 1H9BA 4J16A 2EKQA 1HDGO 1T4DA 2FR8A 1V6AA 2NU7B 1TVEA 5KVQA 4LISA 4CMEA 1LSUA 5C5IA 1J6UA 2PZJA 4Y9DA 1PZGA 1NHWA 1B8VA 5BQFA 1B26A 1Q7BA 3I1JA 4GVXA 4TVOA 4CODB 5JDCA 5IDXA 1KC3A 3ENKA 2J3JA 2J5QA 3UICA 4WNCA 3G3EA 4YB8A 1FDVA 1V0JA 1GCOA 1QYWA 2FR1A 3ZWWA 1QYCA 1H94A 4B3IA 3UFXA 1EQ2A 1Q7GA 4Z0HO 1H2BA 3IL2A 4GSKA 3WSVA 4M54A 1DHRA 2YW9A 1K6XA 4ALNA 3TN7A 1A71A 2Q4EA 2CVQA 2C5EA 1NAIA 4UEJA 3FNFA 1E1NA 4C4OA 1NHGA 3WR5A 2OHXA 1GUYA 4HADA 5DT9A 3IDSA 1T25A 1ZUD1 1ZVMA 1Y1PA 3GMSA 4JCOA 4L8VA 1W0CA 2P68A 4RF2A 2Q50A 1LSJA 5C7LO 1QMGA 3R3SA 2I3AA 1RM3A 1SBYA 1F12A 4MIYA 4MP8A 4LMRA 3QLJA 1YDWA 4BO3A 4OIMA 3JQAD 1EZ4A 3MJ4A 3MJVA 5C37A 1B0AA 2A35A 2JCVA 1KY4A 4IUYA 1IPFA 2GRAA 2WMDA 4DYDA 2B35A 4YRBA 4LVUA 1JA9A 1EVZA 4IXTA 1E7SA 3WMWA 1GYPA 1H6BA 4UUPA 3BYZA 3K92A 4OXYA 1JTVA 2WWRA 2Y68A 3O4RA 2IXBA 4BNWA 5HRUA 2VRBA 1K6IA 3DBLA 1I8TA 3MWDA 4OMUA 2DVMA 4RPJA 1T1RA 2ZB4A 1PGJA 1BRMA 2WYVA 1QYDA 1EUCB 1X0VA 1DFGA 2VZ0A 3PK0A 3C1OA 4IY1A 5TC4A 1TLTA 2FP4B 5COQA 1WXDA 1MUUA 1H6AA 2EW2A 3KOUA 3U49A 4MJLA 4YWJA 3DTYA 1SOWA 1ZH8A 4R68A 4NFHA 4DBVO 3BMOB 2NADA 5L4LA 5A3JA 3H9JA 3PJFA 4NIMA 5KJ6A 3IUPA 4L4SA 3PLNA 3H5AA 4PG5A 5U9CA 3UF0A 4YJHA 4AJ1A 2FPGB 1ONNA 3KVOA 3W4JA 3EDMA 1U3VA 4L74A 2P9EA 2JCYA 2JFGA 3GNQA 4W9NA 1T1SA 1LDBA 4DRYA 3JQGB 5THKA 3HDJA 3VTZA 2I3GA 4YJHB 5B4VA 2HLPA 2YZ7A 3ZW9A 1E3WB 4GKBA 4CM1A 5AYVA 2EP5A 1HE2A 3TFQA 2P9GA 5DP2A 1QLJA 3VPFA 3ZNOA 2PH5A 5KJCA 3GRKA 2HU2A 1ZKMA 4XGKA 3AOEC 4IQ0A 2NTJA 1ZXBA 4J1TA 1ZBQA 2VYVD 4WASA 2OUIA 1GTMA 4BGIA 4FR5A 4XGIA 5A05A 3ZWPA 3BTSA 2EJWA 3VTFA 4WOJA 3OFSA 1BG6A 3RROA 4BKQA 3I52A 3RFXA 4KZPA 3VKVA 3HZZA 4BNKA 1L7EA 4HNGA 4E5YA 1ID1A 1WZEA 5JSFA 4DPMA 4XEHA 3BHIA 4NBWA 3DZJA 3GG9A 4R3NA 3ANNA 1IHXA 4RF3A 1M66A 3LT1A 3SVTA 2H6EA 3E82A 5JDCC 8LDHA 2YV1A 3HQ4O 3GVPA 5GZ3A 3E9NA 1XLTA 4WUVA 3BTUA 3INTA 3P2YA 4LGVA 3DBVO 2OMEA 4OYRA 3OHSX 4I08A 2PZMA 3GRPA 1O8CA 1C1XA 3TRIA 3JD3A 3TOXA 1NQ5A 3AUTA 4IJUA 1WZIA 1HE3A 1ISHA 3MWDB 4IJVA 1A4UA 4AFNA 5JMPA 2Z1MA 3DHEA 5I7SA 4YAJA 3F1KA 1U2GA 2GASA 3O8QB 4GPD1 2GYYA 2X7HA 2HRBA 4L4XA 3D1LA 5TT1A 1XQ1A 4PRKA 3PQEA 4BNHA 3GN2A 1GZ4A 5BSHA 1UZNA 5ENVA 4IBOA 1GYQA 3OQ6A 4CLXA 3L4BA 3AOGA 3H5RA 4FFMA 1BWSA 1ZK1A 4M8SA 2V6FA 1PS8A 2OO5A 3SLKA 4EYEA 1GADO 3H3JA 3EAGA 2J8ZA 4HXYA 1CQJA 2BD0A 3E8XA 2C5AA 3JD1A 4R3WA 4YJFB 3RSHA 1KS9A 4EGFA 1LA2A 5DDIP 4AG3A 2CD9A 4DLBA 3SBOA 1EQUA 3WG9A 1YO6A 3KYCB 4Q39A 4NNJA 3NDRA 2CDAA 3KM0A 4K26A 4XDYA 3GEGA 5G0SA 3UCFA 4PLTA 3ZWBA 4UUOA 2H1SA 2C82A 3RVDA 3WIEA 2PA3A 3DBRA 1FXSA 1PQUA 4A7PA 4FGSA 4MVJH 4Z3KA 3Q3CA 1QV6A 1UR5A 1PQPA 4DQVA 4KQXA 3X2FA 2NV6A 1UP4A 1GZ6A 2PGDA 3F5SA 3P7MA 4NK5A 4W7HA 5CP8A 5BT9A 3SLGA 4BHTA 3ZWAA 3L6EA 4RORA 3JQ8A 2E48A 1X1TA 3KZVA 3OICA 4NPCA 2CNBA 3F4BA 3GVIA 3QWFA 3PPIA 2J6IA 4CL3A 2GO1A 3DZBA 5L3ZA 4EUEA 2B4RO 2CMDA 4J9UE 1EEHA 3GZNA 2NVUB 4AJEA 5JNLA 1P1RA 1G6KA 2DTXA 5EESA 2WD7A 3FHLA 2PGJA 1KEPA 2W2LD 4YVFA 3O9ZA 3V2GA 4PN3A 4E30A 3C3XA 1T2DA 2Z5LA 2VYVA 1X15A 3HWRA 1WWKA 4OO3A 1I01A 1I5RA 2B5VA 3WBBA 3ZV5A 4D46A 3JTMA 1SNYA 4QUKA 3WS7A 1DIRA 3K73O 3OQ1A 1K6JA 1ZNQO 4XX0A 3D3WA 3GFGA 1B14A 2Y0EA 5CEFA 3JQAA 1PEDA 5JY6A 5BNIA 3AU8A 3DWFA 2BGKA 4KUEA 2V6BA 5AXCA 5FEUA 5JC1A 3WYEA 2NSDA 4PRLA 2VWHA 3RJ9A 3JQ9A 5HS6A 4BO6A 4NQZA 1EBUA 3DHNA 4A2CA 5ICSA 4RLSA 5C7OO 2P4HX 1ISGA 1PR9A 5ILOA 3IP3A 3H4VA 5THQA 2QX7A 3MJEA 3DOOA 1B8UA 1C0LA 4CQMD 3G1UA 2OL4A 1T4BA 4B79A 2HDHA 3PDUA 4CR8A 3H65A 2VOJA 4YT2A 4WLEA 2ZYGA 2WM3A 5AQ1A 1IUKA 3KYBA 2NU9B 4WCFA 4XCVA 5TS3A 2X6TA 3FRJA 3UH1A 1P9LA 1Q7CA 4NK4A 3JYPA 4BQPA 2E6UX 3H9GA 4B3HA 4EEZA 2Q99A 3HFGA 3ADPA 2BELA 4BO0A 3DAGA 4JXKA 3FSRA 3V2HA 1LTHR 1GL3A 1N9GB 4A27A 1YONA 1ZSYA 1I2BA 4I5FA 1JDJA 4XRRA 1DSSG 1UUFA 4D42A 4BGUA 5CDUA 1OI7A 4KMSA 4DVJA 4DA9A 4CUJA 1WVGA 2HMWA 1G0OA 1ZK2A 4HUJA 4JBGA 1I2ZA 2YQ5A 1DRWA 1I3MA 3VPXA 4WOKA 1C1XB 5T6BA 4CV2A 5ITVA 5DBIA 1V3VA 5TNXA 2PD4A 3B1KA 4DIBA 2NU9A 2O7SA 2DKNA 4A10A 2PZKA 4JNKA 1CETA 1N9GA 3N74A 1FMCA 4L4RA 5G0TA 4AJ4A 5JY1A 2IEDA 5FFFA 1FDUA 4QFDA 5IZ4A 1HDOA 4P22A 1IPEA 3IIEA 2HK8A 4E31A 2D2IA 4J4BA 3G1TA 3I9JA 3RC1A 3MZ0A 5COBA 3H2SA 3LT0A 3A28A 4O5OA 3ZNNA 4F6CA 1ENPA 1TB4A 5T8KA 1KEUA 5HM8A 1ULSA 4YDRA 5L7YA 3JQEA 4I9HA 1ZMOA 3RUCA 3ZV6A 5H81A 3IKVA 4MDHA 1LLDA 2DC1A 3IP1A 2O2YA 4UVIA 3RC2A 3SC4A 3QA9A 4PLHA 3DR3A 1D3AA 1DC4A 2IZ1A 3FNGA 4BNJA 4IZIA 1D1SA 3MJSA 3SJ7A 4INAA 3A9WA 1YWGO 2X5JO 4GGOA 3PVZA 5BNTA 1YH3A 4BS9A 1VKOA 1NYTA 1CDOA 4RVDA 2ZTMA 4ALJA 3ZGYA 3D4OA 1DJQA 3RUEA 3ZHBA 4EEXA 3A14A 3D4PA 2O3JA 4GX1A 2FRDA 5TJHA 4ZVVA 1L1FA 4K9DA 4PLCA 2QRLA 4IINA 4BKOA 4RVHA 4XRGA 4GMGA 3EVTA 4RPHA 1DJNA 3TF5A 2RIRA 4NMHA 5IDWA 2OORA 1OFGA 1PGPA 1UAYA 1V8BA 5EPOA 2O4CA 4CQLA 3Q6IA 4FFRA 4EW6A 1PR3A 4CM9A 3M2PA 3I6QA 3L0DA 3TNLA 3TFOA 4CMHA 1M75A 1S6YA 4PLZA 3WFIA 1E6WA 1PGQA 2VZ8A 3LC7O 5A9RA 1BXZA 2AE2A 3LQFA 3RUHA 2VUSA 1EK5A 1NP3A 3ZV3A 3V1UA 2D0IA 4D79A 2BH9A 1F17A 4J6FA 4OXNA 5BR7A 4MKRA 4MVJG 4CLRB 2CVOA 2WE8A 4U7WA 1Y8QA 4BOYA 3HJAA 1Y6JA 2E37A 2BLLA 2O23A 4Q3EA 4YACA 4XWYA 3NDJA 4TVBA 3RD5A 2GF2A 2D3TA 4YRAA 4HFJA 4CLRA 4R51A 5HS4A 4TRJA 4W6ZA 1LEHA 3GNSA 2NLOA 4D44A 4AICA 3GUYA 2A92A 2GLXA 3L77A 1R15A 1VLLA 1DXYA 3ETGA 3E03A 2X0RA 2Q4BA 4XJSA 4LSWA 4XQ9A 2BFMA 4F46A 1A5ZA 1VL6A 1XU9A 2AMFA 3OSUA 1QYXA 5GZ6A 1QV7A 3ZWOA 1GEEA 3KLPX 4B7CA 3NKLA 1BW9B 2E4AA 2PLAA 3NEPX 2ZK7A 2PK3A 4ONEA 3LZ6A 5IFLA 3DAPA 2FPIB 1H0KA 1BMDA 2V65A 5LC1A 4GI2A 2ZKLA 3GK3A 3B70A 4CLEA 1DBVO 4YJDA 3GG2A 1UXIA 1P1FA 4ZQEA 1PJTA 2V7PA 2PWZA 4D0RA 2C20A 2NVUA 2RAFA 3ROQA 2I66A 2HKIA 1YE3A 1ZIDA 2HMVA 3NJ4A 4CUZA 4R9SA 2J3IA 1PS0A 3W6UA 3VDQA 1NX6A 2P2SA 4FD3A 1NVGA 2VQ3A 5DF1A 5KVSA 3S55A 1U7HA 2C29D 2C07A 3DEYX 1U3UA 1W8DA 3CH6A 4Q3CA 4CM5A 3U62A 3WLEA 4E33A 1RM0A 4KDEA 5ER9A 4KOAA 1A7AA 3ZCXA 2VHWA 2VTEA 3PGXA 4UULA 4BKRA 3WNQA 4ALIA 3GEMA 3UOGA 4RPLA 1RYDA 1I10A 3OECA 2Q46A 3DZIA 1LDEA 4WPGA 1J4AA 1LBEA 3LLVA 3ZZNA 1R6DA 2Y1EA 1AXGA 4WCDA 2C2XA 5G2OA 4QT0A 1N5DA 3GN1A 3OJOA 3K9QO 4E2ZA 4LCJA 1U4SA 1EDZA 2HQ1A 4U6QA 4DGSA 2DBZA 3DBHA 3ZU4A 3I4FA 1NM5A 1T24A 4YAKA 2EKLA 1EE2A 1JKJA 1X7HA 3WNVA 4BB6A 1DRUA 3PHGA 3V1TC 2SCUB 1IZ0A 4D3DA 4FS3A 3F4LA 1YL7A 3N58A 1KEVA 4HFMA 4MVJD 3WYCA 6ADHA 3ONEA 4BO9A 3MOIA 2B5WA 1SAYA 1MLDA 3K31A 2X86A 5T8KC 3HFSA 1JKJB 1GFSA 2OZPA 1T2AA 3DZFA 4PLPA 1LQTA 1BGVA 4DC0A 4OOEA 2Y1GA 1DIGA 1JLLA 1GU7A 1ZXLA 2A4KA 4PLVA 2EXXA 4YT8A 2RCYA 3PFWO 3ZNPA 5A5EA 2GSDA 3C7CB 1TA4A 3JQBA 3CXRA 2C7VA 2C7GA 3KV3O 3WGOA 1UDAA 1UZLA 2Y1DA 1AN9A 4YBZA 1Y9EA 1KVTA 4R4JA 1GDHA 2FN7A 5U4QA 4A26A 1WDKA 1YKFA 4RQUA 1HE5A 1HYGA 2DAPA 4G65A 3MCVA 4QFCA 1E5LA 1DOHA 1RM5A 2ILTA 4AJLA 5JAIA 3DMYA 1I3LA 1NVTA 3EZYA 3WWYA 1XKQA 2VYNA 3F9IA 4O63O 2PNFA 2XXJA 3WJAA 1DLIA 4NDNE 2BI7A 2XXBA 5A03A 5EL0A 1ISFA 2UUPA 2IE0A 2AEJA 2W98A 3EVNA 4M49A 4CM7A 1GYRA 3DB2A 3PZBA 1QRRA 4EDFA 4R1TA 3PP8A 5JBIA 4ZQFA 5GMOA 1Y5RA 3K2EA 2VHVA 3PFFA 2XAAA 4Q3DA 5TGDA 3TZCA 3LF1A 1NWHA 3PRJA 4FFLA 1U3TA 4UVDA 4MVJF 1DHTA 2Z95A 1VL8A 4PVDA 1NASA 4WCFB 5H83A 2O50A 2NQTA 3KB6A 3KBOA 1TT5A 1Z45A 1NR1A 1B15A 2QQ5A 3ROMA 4CM4B 1NVMB 4XQCA 3C7AA 3BMCB 2BGMA 3OM9A 2EF1A 3DMTA 3W6ZA 1MXHA 1LSOA 1YB5A 3L07A 4IZHA 4NU6A 4WECA 1HE4A 2ZYAA 3PEFA 4LVCA 4FBGA 4BO5A 4PG4A 3VZSA 1AUPA 4L0QA 4XR4A 2HRZA 2DQ4A 3JQGA 5JCXA 1PJ4A 2X22A 1QKIA 1U4OA 1YJQA 4S3MA 3BTVA 5TF4A 3G49A 4B7UA 2FZEA 5LCXA 3GLQA 4R54A 3DAFA 4WE3A 3VVCA 2C0CA 3N7UA 4HX5A 3KHUA 3BMCA 4PZDA 4WK6A 3NGXA 4NR0A 3KUXA 3WSWA 4WCFC 3LSYA 2NU6B 2B0JA 2O2SA 3NRCA 3PYXA 3WYBA 2P9CA 4LN1A 1VM6A 3L6OO 3H7AA 4MKXA 4TQGA 3JCZA 3PWKA 1R0KA 3GHYA 4CM6A 2YV2A 3U4IA 1O0SA 2UUOA 5TJ9A 3WB9A 1ZCJA 4S1VA 5JDIA 5K0ZA 3INGA 5HTOA 1LLCA 2DUWA 3F6YA 4YEDA 1BTOA 1HSZA 3SX2A 1B2LA 5FF9A 4RF4A 4D3FA 2YHIB 1GUFA 3QVSA 3BMNB 3E5RA 2DBRA 1XEAA 2CSUA 2IZ0A 4UREA 2PKRA 3W4IA 1NBOA 3V2UA 3DHYA 3DXFA 3HNPA 4J4HA 5CDTA 5CEJA 1ADGA 1ZJYA 3LVFO 3GGPA 2WJPA 5B12A 2ZJ0A 4EI2A 1D4FA 3H2ZA 4FQ8A 5K6AC 1SEPA 4J0EA 1O94A 1KIFA 1Z6ZA 3FCOA 1UP7A 2W8ZA 3VVBA 3WFJA 3U09A 3KLMX 5IZCC 3GVCA 4ND3A 4WNIA 1TT5B 1Z82A 5TT0A 3MOGA 5L45A 3CKYA 3F47A 4WLVA 5I7EA 1E1MA 2GN4A 5MGBA 3CPSA 4UUMA 1XU7A 3LK7A 4FW8A 4TSKA 5G4KB 1F8GA 2Y1FA 4FFNA 1ISIA 3ITKA 1HKUA 2DBVO 4M87A 2ZIZA 3HDHA 4MVJE 3DZGA 1GD1O 4P4NA 3TPCA 3UAGA 3UGKA 3OETA 1M76A 1LNQA 4IDFA 1HT0A 4D3SA 4M1QA 4R5MA 1P1JA 3VZQA 4BO7A 5JCJA 2HUNA 3GPIA 3H9EO 5T57A 4XA8A 4E0BA 3CTMA 4D7AA 2WTBA 1P31A 5CDGA 1ADCA 1B3RA 4FOOA 2G76A 3TQHA 2GZ2A 2EKPA 2X5KO 1FDWA 4DLAA 2P5YA 2IYPA 3QIVA 3GY0A 2PFGA 5FI5A 1AE1A 3UCXA 1R0LA 2ZB7A 4WLUA 3ON5A 2X9VA 1LXCA 1EBFA 1R4NA 1PGNA 5JE8A 1P33A 2NACA 1SOVA 2NUAA 1LC0A 3AI3A 1P44A 3TWOA 4BNTA 4PVCA 3OF2A 3HN2A 1U8FO 1XA0A 4KDFA 4LSMA 3U9LA 4FIZA 1E3JA 4XJTA 3ZWMA 5ADHA 2C59A 2DUUA 5ICMA 1ENYA 4NBUA 5CAEA 1OBFO 4ZD6A 2BFAA 4OSOA 3HG7A 2NTNA 2Q3EA 4AJKA 4K28A 2Y05A 2TMGA 4ND2A 4GX0A 1X13A 4AJ2A 1E6UA 5CFZA 2VNSA 3PZRA 1HYEA 2GGSA 2I6TA 2R6JA 4IDAA 1QG6A 2J3HA 3WLFA 1J49A 4OL9A 2W4QA 4IJKA 3KEQA 3T4EA 2B4TO 1U9JA 5AXDA 2VHZA 4PG7A 4CLHA 1JW9B 3O38A 1GV1A 3BHJA 2CY0A 5ENDA 3BTOA 2HO5A 3DBHB 4ND5A 2OFPA 3DOCA 1PL7A 3AI1A 4IJWA 1ZO8A 4TROA 3AUUA 3O03A 3WDSA 1I24A 3WICA 5KWEA 2EIHA 1H5QA 7MDHA 5A9SA 4E5NA 4PLYA 3FPLA 1PGOA 3NJ8A 5EQFA 2NU8B 2BFOA 2AEMA 5KKCA 5MDHA 3L6DA 4J1SA 4ZJUA 2W90A 3UW3A 1ADFA 2OOSA 2UVDA 2X9NA 4RCVA 2QZZA 4I8XA 4XDZA 4QXMA 3BMQA 1I32A 2YFQA 4RO0A 4IGFA 4MP3A 5HWSA 2ZATA 2E82A 1DC6A 3DZHA 3NAQA 1OC2A 1E3WA 2V6MA 2Y67A 3NX4A 3ITDA 3NT2A 3GT0A 1WLYA 1UZMA 1LUAA 3I83A 2D5AA 3VZRA 3OA0A 3GVXA 4B3JA 3ROPA 2NVBA 4NJMB 4Z0TA 1TT7A 1ZK0A 2DPHA 4Z0PA 4KTVE 2I67A 2O48X 4O59O 1BSVA 3QP9A 3A1NA 4BNFA 3ADOA 1T2FA 4J49A 4PGFA 3WGGA 5JW6A 2D59A 4UEOA 4II3A 3PHLA 3RUFA 3TL2A 4MINA 1ULUA 4YPOA 4M55A 1YL6A 3ONFA 4LMPA 5DP1A 1DDOA 2VUUA 2IODA 3GHHA 4DMMA 3GDGA 1RJWA 3WXBA 2JD1A 4ZA2A 4PCVA 3GA0A 2Q2QA 2FP4A 4FFOA 4Q3AA 3KEOA 2JD0A 4BKPA 3AFMA 3QVOA 3OIGA 4EZBA 4IS3A 1MP0A 5IDYA 4NHEA 4F45A 1SCUB 3STHA 4L9RA 2X0IA 3NTRA 2IEBA 1YBMA 3K8ZA 3RFVA 3I5MA 4DBZA 2YHUA 5IXYA 1VE9A 3WGQA 1K3TA 3RJ5A 3DO5A 4P4GA 4A03A 3BMNA 5AXBA 4KTTE 3KXDA 1I3KA 4B8WA 1JVSA 4WJZA 4BKUA 5KIAA 1VRWA 1E0DA 2VT2A 5K9ZA 3ZWNA 3S2EA 5KOIA 3DOJA 3RCBA 1YGYA 3QSGA 4JROA 2CVZA 2XPCA 1DLJA 4CMIB 1K2WA 3KYDA 1R37A 1NFFA 5L95A 1KEWA 1BVRA 3ICPA 1A9YA 4KWIA 4Y6SA 1C3VA 3MTGA 1E3LA 4HFRA 1JAYA 3RU7A 1ZSNA 5ES3A 2AEFA 1F14A 4BGVA 3IJRA 3TDKA 1EUCA 2GUGA 4ALKA 3U3XA 1Y7TA 4BNLA 1BDBA 4GLLA 1R66A 1QR6A 4BO4A 3DFZA 4WEOA 3GVHA 4W9NC 3RASA 4E13A 1HL3A 4CMGA 1RPNA 1UXGA 3VH3A 2BMAA 1E77A 5IXSA 1QXSA 4HFNA 3O8QA 2IZZA 3JQDA 4WLOA 3B1FA 1Y8QB 1UDCA 4CR6A 1KETA 3HDYA 2FPGA 3ZWVA 1KVUA 4IS2A 4DLLA 3VC7A 2QG4A 2ZTLA 3LC1O 3M1AA 1ZJZA 2EGGA 3RUAA 4MO2A 4PLWA 4H16A 3FTPA 3D4NA 1PJQA 1P77A 4DUPA 4QQRA 1GQ2A 3SC6A 3H8VA 1YQGA 3WGIA 2Y93A 2CUKA 5B4TA 1ZSVA 1DIAA 3W8DA 1GZ3A 3CUKA 4RF5A 3ABIA 5F5LA 5AVOA 2DBQA 5JPIA 1AGNA 1ADBA 1H9AA 1PJCA 3ANLA 3ENNA 2WDZA 4HP8A 4KP7A 3RBXA 1E92A 4H7PA 1Q1NA 3H6KA 3KYCA 1R12A 3OQBA 2F00A 4F3YA 5IN4A 3I3OA 2A9FA 2X9GA 1R0SA 2HMSA 3PGJA 3C85A 1ONPA 1PJ3A 3BIOA 3HB5X 4WGGA 3WGHA 2WYWA 4N5LA 2DTDA 4MVJI 1E7WA 2W2KB 1C1DA 3JQ6A 3VPSA 5JC8A 2PGLA 1BHSA 2NU6A 5BNFA 1JWAB 2DM6A 3TJRA 2AA3A 2I9PA 4JGBA 3KSDO 4GLOA 5EIOA 5DCUA 3OIFA 2Q49A 3K30A 5CHEA 1H2HA 2AQIA 1FDTA 4G81A 4GQAA 5KCZA 2NU7A 2W2KA 3U0BA 3RKUA 2ZB8A 4Y8VA 3CIFA 4XKJA 1GUZA 4OHUA 2OGUA 1PZFA 3TOZA 5JO0A 1ENOA 4J90A 1NNUA 2BKAA 3E9MA 2OBNA 4DIOA 2YHIA 2BF7A 5EINA 2ZTUA 3OJLA 3UKOA 4IPTA 1NQTA 1YB4A 4ZU3A 3EYWA 3AOEA 3ROKA 5KJ1A 4CM8A 4RJTA 8ADHA 1Z75A 4YT5A 3FNEA 3ZHXA 3ONDA 4IDEA 3DFUA 4CV1A 4RPGA 2Y66A 5A5FA 2ZYDA 3RI3A 5F1OA 1LI4A 3BA1A 3JQBC 3QVTA 3WMXA 5F5NA 1A9ZA 4FFPA 1IL0A 3M1LA 1IOLA 4GWGA 1X7DA 3EZLA 2LDBA 2JCXA 4IDDA 1IHYA 3PIIA 3ASUA 1ARZA 3JD4A 3INRA 3KETA 2VCYA 1YJ8A 5DN9A 4NH4A 1CQIA 1ZMTA 3JQ7A 3WGZA 5L51A 5G0VA 1A4IA 4E6PA 2PV7A 5I9NA 2BRUA 4BIIA 3RBZA 1A27A 1X0XA 4RZIA 5BSFA 3V8BA 1LDMA 1OC4A 1HF3A 3S2FA 5A04A 4YQYA 1KY5A 1UXKA 3EC7A 3CSDA 5TQVA 1YBAA 3LF2A 3FR8A 4XX0B 3D3WB 3MWEB 1T2EA 3SEFA 1IE3A 4GSLA 2Q45A 1C1DB 1C0KA 1H6DA 2D8AA 3FPCA 4IDBA 4J7CA 3AUAA 5CDSA 4PFJA 4BNYA 1LRKA 2JJYA 5IZCA 2ZQZA 3OEYA 5A4DA 4XB1A 3JQ7B 4BV9A 2CF5A 1YS4A 3B20A 1XYGA 1B8PA 2GN6A 3JYQA 2HK9A 4CM3A 5CAEB 5COAA 3GMDA 2B4QA 3Q0EA 3FD8A 4PZCA 9LDBA 2JFHA 3GFBA 3L4SO 4GX2A 4K6CA 4BGEA 3QVXA 3AI2A 4P38A 4FC6A 1R16A 1B7GO 3QWHA 5LDGA 2LDXA 5U1PA 3VKUA 1FK8A 3GZNB 4BNVA 3JV7A 2RHRA 5KVCA 1IULA 2J5RA 2CDBA 1DRVA 2POQX 3LU1A 4RVSA 4HNHA 4DPLA 2WD8A 2H63A 4C7KA 1LJ8A 3OJFA 1DPGA 3MWEA 4BL5A 3ULKA 1XIVA 1YDEA 3BXXA 2YY7A 1XDWA 1LRLA 4GBJA 4XZ3A 3WGTA 1HTBA 2G0TA 3WQSB 2W2LA 1W4ZA 3AFNA 2FSVA 3VHRA 4MVJM 2HSDA 2NU8A 3DBRB 5G0UA 5GY7A 3OBBA 3I9LA 4IDGA 2I65A 4ZQGA 1Q0QA 4EJ6A 4YYZA 2JAPA 3GZ4A 3GOHA 2EGHA 5A06A 4DPKA 3PHHA 1XG5A 1PZEA 3DTTA 2OP1A 4R9RA 4YTEA 1HXHA 3E18A 4JN6B 2P91A 4U5QA 5JAQA 2WE7A 1YRLA 4JBHA 1FF9A 2H5LA 4J3FA 2FPPB 3GC6A 1VSVA 1I30A 3JQFC 4RGBA 2HCTA 1HEUA 1VJ0A 3HE3A 4XIJA 4BO8A 3OMLA 4W82A 3GUCA 4A73A 4N54A 1YB1A 4NFYA 4CMEC 1QP8A 4AJNA 2VOEA 2AG5A 2FMUA 4BNNA 1K89A 4CUKA 3UVEA 2DTEA 4CV3A 2R00C 5F1KA 4PG8A 3K96A 2PH3A 1CRWG 4AJIA 1Y5MA 1OOEA 3QVWA 3OJEA 1P3DA 1OMOA 5CEEA 1PL6A 1GPJA 3OIDA 4E3ZA 3GEDA 4MP6A 5L9AA 4B7XA 4JBIA 1AXEA 1DO8A 3HADA 1J5PA 2FR0A 3AUSA 5IN5A 2GZ1A 4MIEA 1JKFA 3Q1LA 3WWZA 2X58A 2VT3A 2AQ8A 2CF6A 3G0OA 4N18A 3FF4A 4GVLA 2QRKA 2XOXA 1NPTO 1XGKA 1ONOA 5CPFA 3PYLA 3IUSA 2GN9A 4ZICA 4O1MA 2FSSA 4HKTA 3AY6A 3NUGA 5I7VA 3KSZO 4R16A 4X54A 5A9TA 1HDYA 4OJNA 2EHDA 1YQDA 4E2XA 1PWZA 2RH4A 2G17A 1Q0LA 4W99A 1IY8A 5DOZA 4J43A 4NI5A 4OQYA 4FDAA 3WX0A 1ZZEA 4J7XA 3ZWCA 1LDNA 4E5KA 4NBVA 3FWNA 2I99A 4CPDA 1FDSA 5A3VA 4YAIA 3EMKA 3IAHA 4E2WA 4YXFA 2X8LA 4LK3A 1U5AA 4DWVA 4U6SA 4L76A 2ZJ1A 2J3KA 1N1GA 2DPGA 4PZEA 2VWPA 3I9KA 1I0ZA 1XQ6A 2OBYA 2QHXA 5T67A 3ANMA 2YQ4A 2Y99A 4I5DA 1YBVA 2Y0CA 4FSHA 3L9XA 4J0FA 1SPXA 4R69A 3M2TA 5DCYA 4CM4A 2VNAA 5ITWA 1YOVB 1SMKA 3PJGA 1JVBA 5K6AA 1UDBA 2QIOA 1CF2O 1YQXA 4N5MA 3AM3A 5A1TA 1W73A 1ZK3A 2UDPA 2X1HA 3D5QA 1MG5A 9LDTA 5JXWA 4O6VA 1CQIB 3ZHZA 1OZAA 5GZ1A 1QLHA 1CEQA 4Y98A 3TZHA 2VHYA 2UAGA 3T7CA 4AJHA 4Q3BA 3EY4A 2WSBA 3GPDG 3DC2A 3JQCA 3PDJA 3D5TA 4LRTB 1I2CA 3WQRA 1XSEA 1P45A 2ET6A 5JDIC 1JKIA 3ICCA 4CQMA 3OP4A 3I4CA 2UYYA 4FPXA 3HHPA 1MFPA 1CQJB 3CE6A 3TL3A 1P1IA 4DIFA 6LDHA 4JJGA 1P1KA 2YUTA 3UUWA 1KVQA 1F8FA 4J1QA 4ROSA 4TMFA 4OM8A 1M2WA 4FB5A 3QWIA 1E3EA 3P2OA 3PLRA 2BFPA 4J2OA 3RC7A 3P5SA 4ALMA 3AM5A 1S7CA 1YL5A 3RFTA 3C1TA 3PI7A 4N7RA 4NG5A 1O5IA 4Y67A 3A4VA 1KYQA 4XYLA 1GQYA 3D7LA 1WPQA 1RM4A 2B36A 4J4TA 3NTOA 1MX3A 1EMDA 1OAAA 3QJ5A 4L75A 1NQOA 5CDYA 1NPDA 3ORFA 1HZZA 3HSKA 2E49A 1PS9A 5DNAA 5IJZA 1NWCA 4P8RA 4PG6A 1RYEA 4RZHA 5JMWA 1GQQA 1WMBA 3H5NA 3ST7A 3SJUA 2JHGA 5ER6A 1SZJG 3Q11A 1MG0A 2IRWA 2O3TA 3TZQA 3KO8A 3QWAA 4ND4A 4OAQA 5EMHA 3RWBA 1K5HA 4E32A 3WQQA 1L7DA 1DC5A 2JKVA 3BHMA 4KQWA 4YCAA 1D7OA 1NTOA 3JQFA 3ZHYA 2QYTA 2O7QA 3ZNQA 5JCJD 1U8XX 5TIIA 2FOIA 4OOFA 3TSCA 5I9LA 5FWNA 3RQSA 4TKMA 2WD7B 1E3IA 4PLGA 3H3FA 2Q1TA 3NDIA 4TWRA 2GDZA 2HAEA 2BHLA 4ID9A 4Z9FA 3WTCA 1B3BA 2Z1NA 3TZKA 2FPIA 3I9NA 3GGOA 1MC5A 1O95A 1TI7A 1UJMA 4YA6A 4NJMA 1LX6A 4RDIA 1EK6A 3MEQA 3QRWA 1A72A 1DB3A 1HRDA 1PL8A 4RVGA 3RUIA 4JQCA 4HBGA 1LSSA 2F1KA 4RQTA 4HY3A 1PZHA 2FPPA 4XB2A 3B6ZA 1PJBA 4EUFA 3AK4A 1NR7A 3V5NA 2Y1OA 3I6IA 3FR7A 1M67A 3DBLB 4WEQA 1E7RA 2VRCD 3W4KA 1U7TA 1VPDA 4EBFA 3IMFA 2JHFA 4UVHA 3QV1A 5L53A 4ZQBA 1ML3A 1V3UA 2X23A 1HYHA 1C0IA 5CG2A 3GH3A 1R4NB 2VWQA 5FI3A 3LLSA 1GEGA 3E6AA 1EE9A 2GN8A 1VJTA 2B69A 3QWBA 4BNUA 2CDCA 4Z9YA 3H9QA 4UVEA 2FY8A 3UFXB 1DIBA 3LT4A 4YT4A 2B83A 4MOWA 4AVYA 4XIYA 1EFKA 1DEHA 3WIDA 2X5OA 4IIVA 1UXJA 5F3RA 1U28A 1E1LA 1HDXA 4ITUA 4KUGA 1UAGA 1RKXA 1TXGA 3GDFA 4HV4A 1YXMA 5EN4A 4Y6PA 4CQLB 2VHXA 3G17A 1DAOA 1BXKA 4B4VA 1U5CA 3QY9A 4MKZA 1LRJA 3NYWA 3ZU3A 1M6HA 4E21A 4A5OA 2HMUA 2X0JA 4CM8B 3MJCA 1KC1A 5AOVA 3PQFA 4UAGA 4BNXA 2AHRA 1ZEMA 2RH8A 4L73A 4IMRA 4DXHA 4OGWA 5CG1A 4AJOA 4H3VA 1EDOA 1LU9A 2G1UA 1X14A 3LC2O 1QSGA 1IB6A 3GAFA 3EUWA 3L9WA 3NT5A 4TZTA 1HETA 3GAZA 1CERA 4AJPA 2YFHA 4TRNA 4Q9NA 3P19A 4R1SA 4WKGA 3RIHA 3JQAB 1WDLA 5TLSA 1QORA 3DONA 1JAXA 2C2YA 5C7IO 1U2DA 4BVAA 4IQ8A 4BV8A 5TSDA 4B4OA 1Y81A 1HZJA 3UCEA 2AG8A 2AQHA 3IQDB 1UH5A 3WGYA 1KERA 4NFSA 1LLUA 4JLWA 4R1NA 4B4WA 5L7WA 1N8KA 3S8MA 4GL4A 4BUCA 2O3QA 4WLFA 3VAZA 3NGLA 3ZDFA 4CL8A 3VH1A 3GGGA 5JFOA 1RWBA 4CMIA 5FYDA 4YQZA 4H15A 3FI9A 4XQEA 2FHSA 2GR9A 3GQVA 2BI8A 4BMVA 5DBFA 5HA5A 4AJJA 2G82A 2NTVA 1LQUA 2AQKA 1F06A 1R4MB 5BSGA 4QO8A 1DIHA 1NXQA 3F3SA 3X2EA 2FZWA 1VJ1A 1ZFNA 4W7IA 3F1LA 1EUDA 3C8MA 2QYSA 1BXGB 4QTZA 3ZN2A 2VN8A 2UV8A 2EP7A 5G4LA 5T5QA 4BNGA 2Q2WA 2VZ9A 4N5NA 3CZRA 3BAZA 1HWYA 2G5CA 1VI2A 1X1EA 4G5HA 4ILKA 2DT5A 3HDQA 4IMPA 4J2HA 2IDZA 4XYGA 3VOSA 2GNAA 1Y8RB 3R6DA 4FN4A 1KVRA 3VDRA 1E1KA 2FWMX 3PWZA 1ZEJA 5I7FA 3R0IA 5KJEA 4JP2A 2PD3A 4F6LA 3BZUA 3GDOA 2YJZA 4I9UA 2PKQP 1E5QA 2O3SA 2RHCA 1P0FA 1EVYA 4Y6RA 3QHAA 4CLDA 4J7UA 1ISMA 3ETDA 3FTNA 4YJFA 1VKNA 4OKIA 3E1KA 2GCGA 2PY6A 3T4XA 2B37A 4OXKA 3ZWYA 5B37A 3WJ7A 4D45A 3GR6A 2SCUA 4MVJA 4ESOA 3U4DA 4YAGA 1PWXA 5F1PA 1J0XO 3Q2IA 3Q9NA 3PYMA 3KYDB 4NBRA 4BO1A 1UP6A 2EJVA 2H9IA 3V1YA 2VUTA 4BNZA 4I1IA 5I8WA 3PQDA 3DL2A 4DYVA 4ZRNA 1Y8RA 5BSEA 2YYYA 1DAPA 1EFLA 3B1JA 3CINA 1N92A 4IM7A 1O6ZA 4YAEA 4DL9A 1MA0A 1NPYA 1WW8A 4GMFA 4JJIA 4R41A 4BQRA 4E4YA 5L40A 5L7TA 5G0WA 4IQGA 2PR2A 4JIGA 2I5PO 4EUHA 3VPGA 3CMMA 3BMQB 4Z3DA 4CV0A 2HK7A 3AU9A 1PSDA 1V35A 1JU9A 4LCEA 3RBVA 2VYND 2PKQO 3AJRA 1XWFA 1R4MA 4QO7A 1GAEO 1V9LA 5F21A 2EEZA 2P5UA 4GAEA 5DZSA 3OH8A 3ZW8A 1VL0A 4YR9A 1LLQA 4QSMA 3JSAA 3RKRA 1I36A 1WMAA 4BB5A 5KNLA 7ADHA 4CLOA 4XYEA 4QECA 1WDMA 4J91A 3U5TA 4XYMA 1A7KA 4MVJP 1SB9A 3KTDA 2PTGA 5JAMA 3K5PA 3DZKA 4CMCA 2D4AA 3SXPA 3T7EA 1MXFA 3ZU5A 2HJSA 5JYDA 3VPHA 4J9VA 3PJEA 1CIVA 5A02A 1PJSA 1KVSA 4QEDA 3EGOA 5EERA 2I76A 4TRMA 3R1IA 3RUDA 3C7DB 1K0UA 3TZ6A 2AE1A 2VRCA 1FJHA 2EW8A 4XD2A 3ETEA 4PIVA 2ZTVA 5JO9A 5TRTA 5EJ2A 3VH2A 3AM4A 2QZ9A 4E5MA 2VTDA 4MPDA 2Q2VA 4Z6KA 1T26A 3Q9UA 3PIDA 4CMKA 4YJGA 4BMNA 1JQBA 4BNMA 4J1NA 1B16A 4FOSA 2YDYA 2DU8A 3PTZA 4R5HA 4R01A 1P74A 1LDGA 4TZKA 2ZCUA 1W6UA 1AHIA 4O0LA 3GF4A 4CMAA 3HB4X 3Q2KA 4URFA 1Z7EA 5DCWA 1I3NA 1KOLA 4IDCA 4RPKA 2D5CA 5I9MA 5AXAA 4RLHA 4ZGWA 1P1HA 2QRJA 2O3RA
chains in the Genus database with same CATH superfamily
1UC9A 1B6SA 1NXWA 1IYZA 1NE7A 2D1QA 2D7CA 3OP1A 4G89A 4PQGA 4CR7A 1KI3A 1WPXA 1MTOA 3GLVA 1N2SA 4S1WA 5FJJA 5BSWA 1HOXA 4BNDB 4R2WA 4FFWA 4GX5A 4PHCA 1APBA 4L6AA 5AW9A 1LFAA 1UBGA 3OU7A 4AN0A 2J5XA 4E5PA 3QLVC 3W8RA 2FPUA 4HN4B 1PFVA 2ZIFA 4A8PA 3E5MA 5LXTA 9GPBA 4WXYB 1Q7EA 1PIWA 4WADA 1PT5A 4GKAA 2WF9A 3RU9A 4Y6QA 1K9VF 2YWRA 4YP7A 4JX8A 5FV7A 1MIOA 2TMDA 4HK4A 2D00A 3Q98A 2V8BA 3PG5A 2BP7A 2ZBFA 4UQLA 3U7GA 3K6JA 4RIEA 1HDCA 4DJFC 2PX5A 3I2KA 2HJGA 4I9NA 3GD5A 4EABA 2ODWA 1ODKA 4NKRA 1Z0ZA 1XOIA 1C2YA 2OR3A 2Z2ZA 4KVGA 4S2EA 5ICFA 3W04A 3SF8A 2NNLD 1L8XA 5E7QA 2O7VA 5EXEA 3C2QA 1E5VA 4PC6A 3G88A 2OZKA 4XSGA 3LNTA 3NHBA 3PA6A 1U63A 3UATA 3ZV4A 1WQ1R 1WP4A 1WBJB 4G6ZA 5FBQB 3MFYA 5IMSA 4GH5A 1BO6A 2BN4A 2ZR0A 3TGPA 2W11A 3B36A 2PZLA 1R6UA 1TU3A 3IAAA 3LKVA 4BFCA 2Q1WA 3P4YA 5FTWA 2V5UA 3ZVKA 1XEWY 3JYLA 4JFRA 3C97A 2HPVA 4BGDA 1YA8A 5T4FA 2J5KA 3CNLA 3JWPA 1PJLA 3GJYA 3MFQA 3V1NA 5EQDA 2E4XA 2JGDB 2CNDA 3T54A 1N2CE 4N8EA 1UJ4A 1FQOA 3NW9A 4HTFA 1XD8A 2QW8A 3UJPA 3LIIA 3GW8A 2QN8A 2JC3A 1I1HA 3CH7A 3FKSA 3IODA 3KVYA 2XKKA 3IS3A 4OSEA 5JRZA 3IAM6 1OZFA 3P2EA 3IKTA 4MKFA 3EG9A 3L04A 4B4UA 2BBTA 1ODSA 2F6RA 2MSLA 2Q5OA 2RAUA 4OQZA 4F12A 3KQMA 1JN0A 2A94A 1IUPA 1LH0A 2R6GA 4MIOA 4KXFB 1MFZA 4DXAA 1LBHA 1XCBA 2PD6A 3F8TA 1IRXA 4MS3B 5DBGA 1CWUA 2PKEA 4RETA 2XRZA 3IIKA 5CDFA 1BS9A 1RZVA 3BWDD 2GH1A 3BMOA 4HH3C 4IGEA 5LDHA 3DMTC 1A97A 3AY0A 3ZVRA 1PU2A 3MTJA 3UA4A 5KU1A 3SVZA 4IW3B 4M9RA 1JSZA 3GBPA 3QE2A 1IZ8A 3D7RA 4E2FA 3ZDCA 4AG6A 1IBSA 2H0QA 3SXUB 4XQGA 4CCAA 2WP8J 4I5EA 3LMKA 2R86A 2CL5A 1QB7A 5FL7A 3UHAA 2GZHA 3ZIAD 4X95A 4E5SA 3OA2A 3NC4A 1PDVA 1RKBA 1DL5A 4A0SA 1H22A 2XOEA 2VPWA 1FTNA 1I33A 1EAYA 2BFDA 2H4YA 3EMVA 4M60A 4U8HA 5JJIA 3UFBA 1IXSB 3LQ2A 2ID8A 1BJRE 2VJMA 2DX7A 4IIGA 2UZ1B 3FAZA 3GYBA 3IPYA 1YS7A 2QLNA 3PWSA 1NGSA 4JK3A 4M0LA 1T6YA 1QIHA 2IXAA 3B6MA 1DC3A 3ZWXA 2WJVA 1O9BA 3RS3A 5K0FA 2YYZA 1K97A 2R7LA 3HP1A 1O96A 2Q1UA 3OY7A 4J07A 4JUBA 3U3RA 3G68A 3G79A 3UW1A 1YFKA 2PEZA 1NOIA 3R3XA 1MB9A 4DHEA 3OEED 4TLAA 5CT4A 1DQSA 4D41A 4RVUA 4C6HA 3HN7A 2OP0A 4KBYA 2QZSA 2OCLA 1ZNYA 1L8QA 2HA3A 3AJ9A 4QL3A 4XUCA 1U1IA 4C7JA 4AYTA 3RE1A 4DTIA 5L4NA 4QXQA 4JA0A 1P61B 1BE0A 4XYBA 2JHPA 3M6IA 3VO1A 1UBRS 2QLJA 3MJRA 1CP3A 1TM2A 5HG0A 3NM4A 3CH4B 4H4EA 3RABA 3ZWKA 1U04A 3MGGA 3C6MA 3D8SA 121PA 2NO9A 3LXUX 3RC9A 2XDAA 1NJ5A 1TUGA 1DELA 3LZDA 1PT7A 1NVVQ 2HA7A 4OSPA 2R6CA 1JAHA 3C3YA 3JALB 3K05A 4PZYA 4QYIB 3WTBA 3ZGOA 2GCNA 2OFWA 5JS6A 1M5RA 4RNCA 4CJXA 3M49A 2F90A 4IILA 2WEKA 1K8RA 3F6PA 2R7KA 5ADVA 3WJ2A 5JECA 3FA2A 1E60A 3WB0A 2LD4A 1IZ9A 2IP1A 3VAYA 1TW2A 2EBFX 1O87A 3COZA 3NS7A 4TKLA 5ALLA 5ILGA 1Y82A 2OSVA 5C3MA 2QRZA 2IUSA 2P6PA 3W8FA 5LLTA 1UM8A 4EKEA 5LMCA 2C4TA 3EPRA 5KAMA 3ISVA 2HJRA 1KNXA 3FBGA 4RK1A 3CLHA 5SV2A 1PX0A 2CWDA 2Z5FA 1JYEA 1UBLS 5JJBA 5FOXA 1I6LA 2I7DA 3DQPA 4R2HA 1DT3A 1GGKA 3BRCA 5K09A 3ICWA 4QEZA 2VYQA 4WK0B 2FWIA 1YB6A 4URYR 5KVVA 2ODBA 2OD9A 1VXOA 3HSSA 4JLDA 4ZALA 2QN7A 1W19A 3KQOA 3PXUA 4IHQA 4U0KA 3WJ1A 3GNTA 1N36B 1V3TA 4LRSB 5JAZA 4FJ2A 3BILA 1R6TA 3I34X 1JI0A 2PS0A 2QAGC 1XR3A 1Y6GA 4CLOB 1SK9A 4LOLA 5JNWA 1G7CA 4PYRA 4QQ8A 2CFOA 1NVUQ 1XNQB 1Z4PX 2JGDA 1WNTA 3AHHA 4MQ6A 5B53A 4EGQA 5J23A 3KQKA 1SC6A 3FPSA 4V0KA 3F97A 3I2HA 1IY9A 2ZB3A 4OI2A 1SCKA 3M5DA 1UEIA 3LT2A 3E27A 1NRIA 2PUGA 3V6LA 3UMGA 2JFFA 5DW3A 3UEOA 2Z3WA 1C4KA 4DKJA 4B7CA 5CT9A 5ULLA 5DM2A 2H5IA 4JKOA 3KRTA 1N6IA 3GLTA 2O4UX 2EFEB 4K6FA 4AB1A 2GPAA 3AY3A 1YJCA 4Q3KA 2ZYRA 4Q9KA 1SQ6A 2GZ3A 2WF8A 2VF4X 1ISJA 3WLMA 3PHJA 4MV0A 5EP4A 4XJVA 2QSZA 1NLZA 1U0TA 2C1EA 4D4HA 1EUZA 4G1CA 2XTNA 4OBBA 2XGMA 3TB6A 1C0PA 4ALLA 5EWMA 1YVEI 1ZW1A 3Q88A 4N39A 1DX4A 1JFTA 1OV6A 4FGWA 3JD0A 3RPEA 4YUYA 3EAFA 2NUAB 3R9XB 3OU2A 1W76A 3UTCA 2JAQA 3JAKB 4Z0NA 4O2AA 5LP6F 3TLBA 5CH5A 4YS6A 1JR2A 4D43A 2NSLA 4BX0A 1JEDA 1HDGO 5EQJB 2FR8A 1Z4KA 2YINC 2NU7B 4LISA 4ZRDA 3A1DA 2ADOA 5EE3A 1X1DA 3E7WA 3I5UA 1Z36A 4L07A 5CJ2A 1J6UA 2PZJA 2JDID 3ILHA 4HDQB 3R20A 1F0KA 4P4UA 4MI9A 4Y9DA 4IYJA 4J03A 5EUQB 1AA6A 2JFVA 4LOKA 3S5UA 3WHKA 5BQFA 2PRJA 3I1JA 3AVVA 2X2PA 4UTZA 1L1QA 1KC3A 1CZKA 3RWMB 3JVEA 3JU3A 3JRXA 3W1WA 4XPIB 2ZYWX 3TD6A 4YB8A 5C8YB 4HNVA 1WUJS 3MPUA 2BE9A 2NYRA 2NUTA 2O8FA 5KYVA 3ZWWA 3PQ3A 1ZPDA 3WDMA 1H94A 1WHTB 1D6NA 1OU4A 1TZMA 3QVGA 3WSVA 1SCAA 4M54A 1TM1E 3RRFA 4BLSA 1O94D 4M8KA 1QQBA 2QRMA 3E2IA 5K3FB 1E1NA 1S2NA 1G55A 4YFYA 1V1JA 2VDPB 4C4OA 1XDBA 4Z7QB 1ZBDA 1BGWA 4HADA 5DT9A 1ZUD1 3NETA 5JU6A 5F9FA 1Y33E 1PG5A 3IPXA 4MK4A 3MTQA 4D9KA 5JG7A 5PGMA 1J2RA 3OCVA 3R09A 3GJSA 3BDIA 4JCOA 2B3TA 4L8VA 2P68A 3ZHRA 4B6JA 1U9CA 4RF2A 4YPFA 1W44A 3N05A 5C7LO 2FGKA 2N1MA 3PHCA 4NOLA 3QVJA 1HFJA 2WVHA 4XVQA 1EI9A 4OSOA 2P6RA 1EZ4A 3MJ4A 5I48A 3QX8A 3O8LA 3MJVA 2JFZA 1FVHA 1FNCA 3C0KA 3F5MA 3DLTA 4OQLA 4MI6A 5G1PA 4ADSG 4PO9A 4ENTA 1IPFA 1JKMA 2FDRA 5TB5A 5DM60 4LVUA 2GRUA 4UE2A 1EVZA 2G6BA 4DR3B 4L6IA 3BXFA 4I50B 2HD4A 3QE0A 1V5GA 2BR5A 5HF9A 1F4LA 4R8VA 4OXYA 3WMWA 4KNYA 1JTVA 2FH5B 5HRUA 2VRBA 1VP3A 2BF4A 2O57A 3IA2A 3ZLUA 3FFTA 3MWDA 3SBXA 1VIYA 2ZB4A 4G8CA 5JBQA 3A1SA 3FYCA 1QYDA 1EUCB 3P96A 4EL5A 2VZ0A 4P0PB 3GT7A 3PK0A 1WY5A 4UQOA 3ROGA 1ZN9A 1TLTA 3R7AA 1F48A 3DB1A 2M9MA 5COQA 1WXDA 1H6AA 3UV6A 4MJLA 2R8EA 2PWPA 3PFIA 3IT2A 4K9PA 3E9DA 4UZEA 4WZBB 5TPWA 2R1VA 1BEEA 2MMGA 3CLRD 2FPSA 4W8HA 3MMPA 2NADA 3ZWDA 5L4LA 1XQWA 3TQSA 3A6DA 4UNSA 3H9JA 4IH1A 1R9JA 3ORQA 2RFLA 4IZ6A 2AUMA 3NR2A 1KEEB 1G6OA 4L4SA 4E5VA 3A1TA 1WQ3A 2BBOA 5EPUA 4YJHA 4DJTA 2GXAA 3O2QB 3IUYA 1BFDA 1XHFA 4I8DA 3W4JA 4AC9A 4MITA 1U3VA 2W2OA 4DMHA 4Q24A 4W9NA 3TW8B 3MJFA 1BXRA 4DRYA 3FUWA 4A82A 1DJPA 4EG4A 2X3YA 2Q4OA 2H08A 3VTZA 3LHKA 1HV8A 3NIDB 4P0TA 3VR0A 5HJ5A 1RWMA 1MEJA 1LY1A 3IJ5A 3CF6R 5FPQA 1RAEA 1U0HC 3C3WA 3Q3IA 1O4WA 5AYVA 1JH9A 4B84A 1BQ3A 1HE2A 3G82C 3RKSA 5KJCA 3I76A 4ZO4A 1YDMA 4YLEA 2HU2A 1ZKMA 1RMTA 4XGKA 4MV3A 5J2UA 3BBPA 4E07A 5BR4A 3VO8A 2Z6UA 2C8LA 4GRIA 4J1TA 1ZBQA 4RKEA 3LWZA 4PSUA 5FHRA 4OYHA 1ECGA 1UPXA 2EJWA 3M0EA 3MWGA 1BG6A 3K1ZA 5C8DA 3VKVA 3I0NA 3K70B 4S1NA 1RAFA 4E5YA 3BWEA 4P3YA 4I19A 2VH2A 5JSFA 5JXJA 2IYRA 3BHIA 2OV3A 1E5XA 1QF9A 3QXGA 5HQTA 3PD1A 3QPBA 2DWPA 4LWQA 3ANNA 2JLBA 4WESA 4ZI7A 4B73A 1M66A 1RPJA 3LT1A 2QE7A 3U6KA 2CUTA 2G25A 1KA9H 8ABPA 1QQ6A 2QYHA 2VF7A 4EUKA 2GK3A 3IDFA 4JQOA 1IHPA 4WXEA 1XLTA 3UK2A 1USWA 3D2LA 3EB9A 1GLVA 1GLNA 2ODAA 4ZXPA 3OHSX 5ICSA 2MYNA 1N2CB 3DPIA 1E6KA 3AIIA 3GRPA 3MAGA 1I2MA 1VHDA 1DDGA 5LD2B 5E4JA 1JLMA 2GD6A 4N01A 5H3CA 2J0EA 1WZIA 3UQYS 1DMRA 4IJVA 1IM2A 1CNFA 1D2GA 1Z33A 4ECAA 3O95A 4G5XA 4KXYA 1TIKA 3ZXUB 3GJ6A 2MOKA 1V5FA 1X7WB 3LPAA 2EBWA 4PX2A 5EP3A 1CIPA 1ZRHA 2QUBA 3O8QB 5FTLA 3F73A 2X7HA 1B74A 1RC0A 1SVIA 2XYGA 2CLKB 2DJ5A 3D1LA 1IC6A 5TT1A 1XMSA 1XQ1A 4A8HA 1POWA 1XZIA 3EZ9A 3FB1A 2XHZA 4QRIA 4BNHA 3QLVA 4Y6OA 3W78A 2CYAA 1BE6A 3K71B 4D9EA 1BMTA 2CV2A 4DCNA 2HSGA 4OHWA 2I6QA 1CS0A 3KWMA 1GA1A 3RRNA 1RQGA 5KYYB 1ZQ9A 4FFMA 5K0SA 4ZAYA 4B3XA 2EWVA 3PFGA 3SE0A 2QSUA 4CG3A 1OH8A 2C5BA 2XMZA 3L7MA 1WB4A 1GADO 2QBYB 1BQEA 4TSRA 3EAGA 4ZCTA 4HXYA 4ANFA 2L82A 2BD0A 2MSWA 3JD1A 1K98A 1GTVA 3NHLA 3RSHA 3FAKA 1Y3HA 3BQMB 3FZQA 3R3HA 3UT0A 1P0MA 3HU5A 4AG3A 5E7MA 3R7SA 1BMFA 2X76A 5CFLA 3SBOA 4W9RA 4ECEA 1EQUA 5IKEA 3THYB 3WG9A 3P8ZA 4Q39A 3H19A 4ZK2A 1A9OA 4NS1A 1VGQA 1E98A 1KR5A 4YJ3F 1E1DA 1UCFA 1SH7A 4F92B 3FOEC 3AONB 3LKBA 1HURA 3GEGA 5CR9A 3N8NA 3AKCA 3NDBB 4UHFA 2NUPB 1DCTA 1QHGA 2QTMA 3LBYA 5IMBA 3WIEA 1DEAA 4RTJA 1QUEA 4B46A 2FVYA 1OAKA 4MVJH 4YRRA 2IZ7A 1ZA2A 1TM4E 4QJBA 3SQNA 1CRZA 1JG3A 1PQPA 3D6HA 4KQXA 1WKVA 1ZI9A 3RLIA 2GEFA 3P7MA 2ASVA 1GZ6A 4RLFA 3X2FA 2OSBA 2ONYA 3O5AA 1PSZA 2VJQA 4D9IA 1QRSA 3NAZA 4KR3A 3ILYA 1KZ6A 2BHNA 2E48A 1X1TA 2J85A 2QGZA 3OICA 4NPCA 5CLFA 3SNHA 3PEYA 1ZM7A 4DDVA 1SUPA 1OROA 2QLTA 3GVIA 4EG7A 5CYOA 1MBZA 3PPIA 2DQYA 1Z5WA 2J6IA 3AEXA 4FR2A 4L5AA 3TZLA 4BQEA 2VXOA 4TYNA 3DDCA 1UFVA 3DZBA 3F2IA 4QG3A 5K45A 4IQFA 2ATVA 4G09A 1R5BA 3HV2A 2J1LA 1GILA 4J9UE 1FS5A 3UG7A 4CCSA 4NCXA 1Y6RA 3T7AA 1Z2OX 5JNLA 5D8DA 1TQ6A 4ZC1A 4BQFA 3OTOB 3GJ8A 1FRNA 1P1RA 1TF5A 2DTXA 1OXTA 3AB7A 5EESA 5F35A 3GIDA 3EFBA 3GEPA 5EHQA 3FHLA 1JBEA 5EFOA 3RSLA 1R6VA 4LDJA 3T99A 2A57A 1SHZA 5EJ5A 4GO1A 4EI8A 1XQXA 1H1TA 4YVFA 1RKUA 2P9ZA 3V2GA 1X7YB 1QIEA 2QIPA 3PNSA 4PN3A 4PGGA 1U9ZA 1Q1BA 4ZYXA 4DV6B 1T2DA 1KHTA 2Z5LA 3L1IA 4KI0A 1H2FA 1MT0A 1WWKA 4OO3A 4F3CA 4E4RA 2B5VA 3WBBA 2WQZA 1E2GA 4V0OA 3ZV5A 4HVLA 5HEKA 1DCFA 1SKAA 4UHBA 1DIRA 3TCNA 3KPYA 1NG1A 2OZVA 3MT7A 1IU9A 1EB9A 1UBOS 1XL1A 1B14A 4EVSA 4CU5A 3A7EA 3TKYA 1WOMA 3HA3A 3COYA 3KX2A 3DMDA 5BNIA 2OGZA 4ER3A 1OH5A 5K3CA 2JA1A 5AXCA 3N76A 5JC1A 4MYUA 3WRXA 3BREA 5JHGB 3WYEA 2CNWA 4PRLA 1VIDA 1Z38A 4N47A 4EENA 3VYSB 1YFLA 4R7TA 3SLRA 3DHNA 3V4PB 4GZLA 3U16A 3OZ7A 3PE3A 1PYOA 4RLSA 4NCNA 5EP2A 4ZVOA 4ZDIA 3NO4A 2P4HX 2X4LA 1ISGA 3ORHA 4Z4FA 2O8BA 1LF0A 2HEIA 5J2TB 5EJFA 1EP2B 1LWOA 3AB8A 1TZJA 2RI0A 2RH5A 2XUDA 3PU6A 2R4TA 3BPSA 3HABA 1Z37A 4X3OA 3GELA 1MX1A 3DOOA 3D7NA 4K03A 1B8UA 1T35A 4ER5A 1QC5A 2EJCA 1XRPA 2HFJA 2OL4A 1T4BA 3G1UA 3KDAA 4MGHA 4B79A 2HDHA 3MTDA 4CR8A 1SG9A 5ESXA 1JF8A 2KMLA 1N7JA 2GD2A 2C84A 2GM5A 2WM3A 4WLEA 5DYIA 3SYTA 4YT2A 5AQ1A 5B5SA 1TJPB 3V3KA 2NU9B 3FE2A 1I1QB 3C6YA 5TS3A 3ZKAA 5MN5A 3DA8A 2PL1A 4IVRA 1RXSA 1QRTA 1QC5B 3OE1A 5LMZA 2Z3VA 4A8TA 2RMKA 4RD4A 2B2XA 3QEJA 2W71A 4H7KA 5HMLA 4B3HA 5JJ5A 4C1BA 4MQFB 7MHTA 4IDQA 2RJOA 4EJSC 3KCNA 4BO0A 4JXKA 4K8OA 3OC0A 3C5EA 3ME5A 5DK4A 4FCWA 1LTHR 1QVVA 5C8ZA 2FSVC 3EARA 3DSRA 3SCZA 2PA0A 5CDUA 2GHRA 4MQEB 4DVJA 2A84A 3EUEA 3PQ5A 1R0RE 1WVGA 3D7KA 2PXHA 3A37A 1G0OA 3K1YA 4BFSA 4FYIA 1I2ZA 3NCHA 4NYMR 3WLQA 1I3MA 1EGMB 2Q4RA 4TXHA 5T6BA 5ITVA 1CUGA 3FHCB 4UTVA 2FPKA 3QVMA 3IHTA 4LOAA 1HFKA 2WY2D 3VR3A 3U80A 2GEUA 3DDWA 4Y3UA 4ZGGA 2F8TA 2MDTA 1L7QA 3PENA 3PC6A 1R0CA 4JNKA 2OO5C 3NWBA 3HKBA 1DARA 4K0RA 2DE0X 3UT6A 4D74A 4ZYYA 1WB5A 2IS1A 4MAFA 5G0TA 3GIWA 3GQBA 5FFFA 1CEXA 2JGRA 2YVQA 1SXJC 4J3JA 2DR3A 4OB8A 5DYNA 4OQFA 4P22A 1OLUA 2HV9A 1CJBA 4XOUA 3OT1A 4M7PA 1TD9A 4E31A 4O4JA 4DLKA 5LQAA 1SQSA 4M0CA 1U98A 2I22A 5COBA 4C04A 3LT0A 3MCZA 3A28A 4O5OA 3O2NA 4GXQA 4ERNA 2XUPA 4HAZA 3VV2A 1TB4A 4JCCA 3NEAA 3CB4A 2HBZA 4OVKA 5HM8A 3BB1A 3N7AA 4DDTA 6ABPA 4KMOA 1EJ2A 3ZV6A 4D8YA 4RACA 4EARA 3IKVA 3IP1A 4UVIA 4EI9A 4RTNA 1A8UA 4OHYA 3L06A 1IXRC 4QNRA 3NV7A 4OMCA 3GLRA 1DC4A 2ORWA 4TV8A 2IZ1A 2RAVA 1K75A 3PF9A 1D1SA 3MJSA 4BDSA 2FCAA 3AIOA 4INAA 2ACWA 4Y2XA 2P2DA 4UU0A 3H0EA 5F2EA 3OAAD 5P8WA 4NBKA 4P7JA 4OJTA 2PUWA 4MKGA 1U31A 3QOWA 4BAZA 1AC5A 4CKEA 3F6CA 1HMYA 4HVAA 3D4OA 4ZPJA 1SFRA 1SHJA 2GCEA 3FLEA 5DTEA 3D4PA 3PNLA 2O3JA 5ARDA 1NF2A 1N32B 1Z5OA 3F7NA 1KMIY 2FRDA 4ZVVA 5TJHA 1L1FA 4PLCA 5KX5B 2ZJ8A 4BKOA 4RVHA 4GMGA 16PKA 2QUKA 3EVTA 1SHTX 5C3UA 5TQJA 4EY5A 1EEXB 1QNFA 5I9BA 1R00A 1PGPA 2QMOA 1IY1A 5LKRA 4XD7D 1XDDA 2X42A 4CQLA 1WCWA 3BUSA 1AKTA 3IHKA 4Y18A 2VAVA 4CM9A 2FFHA 4LV6A 5D51S 3TNLA 3PX2A 4O2BB 3WFIA 1X8JA 1PGQA 4HQOA 1BZYA 3PS9A 1ECFA 1XYYA 1ZH2A 2C9BA 2J67A 2KBFA 1BXZA 4IHJB 4MPJA 2ZSIA 4DDHA 3RUHA 3RADC 1DTSA 3G0DA 4G1BA 1NP3A 2JIRA 3ZV3A 4U7PB 4D79A 1F17A 1NBMA 4OXNA 1KE1A 4GOND 4BLWA 2PRYA 4MUIA 2YUIA 1Y8QA 5DCLA 2HLHA 4B3CA 4ITVA 3GQBB 3HJAA 1Y6JA 3NZEA 3PUJA 5AW8A 4NRDA 4MI1A 1NULA 2QRPA 3I09A 5AI0A 4BXOA 1VMAA 4YACA 4C5BA 2PMEA 4DCJA 2GAOA 1KQPA 1EHCA 4QBKA 2WVGA 4BQSA 4HFJA 4RZXA 5HS4A 2ZJBA 4WD3A 2WHRA 5GVSA 4D44A 4MYDA 4OYLA 5KPDA 3U4GA 1Z0IA 5HHTA 3L77A 2A92A 2GLXA 1JZQA 1R15A 1VLLA 3E03A 3LUCA 1R9GA 3UC5A 3TGLA 3M9WA 2IYXA 4LSWA 1AM4D 3QVUA 3TRKA 1XU9A 1A5ZA 1VL6A 4LZAA 3W6PA 2ZDQA 3ZWOA 2PKYX 4UOZA 5KBYA 5EJ8A 1BW9B 5ARCA 2E4AA 4RVCA 1D5WA 4R2KA 3QA3E 2FR8C 4JI6B 4Y2JA 4YCLA 1QP4A 1B8NA 3G2PA 2IITA 4R9NA 5IFLA 3DAPA 5JSYA 4JI2B 1H0KA 1BMDA 2FLVA 2JCGA 3L40A 3NHYA 5LC1A 5BSMA 2Y3IA 3PLAE 1U8UA 3NNDA 2ZI7A 3H9CA 4LY9A 2ZKLA 3A1VA 4LPSA 4JQYA 3GK3A 4L2IA 2YOHA 1JEJA 5EMKA 3ZI7A 3TG2A 3GG2A 3BK7A 4BMXA 4UM9D 4ZQEA 2ECFA 3D1VA 1DG1G 1EWQA 4M1EA 5EJ7A 4CU2A 3ROQA 2QTAA 4O4IB 3NJ4A 1YE3A 2G06A 3JARB 5FNVB 1KBOA 4CUZA 1N0IA 1W49A 2SNIE 4YMLA 3VJKA 3E4DA 3KWJA 3OKCA 2NTYC 3EXAA 1DQYA 2VQ3A 5DF1A 1Z7GA 5KVSA 4G37A 4RMJA 1U7HA 3ZOZA 5K8LA 3SHVA 2YY5A 5LA6B 1Q83A 1HL7A 3G8CA 3U62A 1AGXA 4KOAA 1MRSA 4PTZA 4KPFC 3BSWA 2VTEA 3IEXA 4HQKA 4U2FA 3ZCXA 2X7XA 2Q3DA 1LD3A 2JJ2D 2QVLA 4J3NA 3IE2A 4G4GA 4ALIA 5MN6A 1RTKA 3BWYA 3GEMA 3WNDA 3OOWA 1I10A 2Q46A 1AKMA 2XMCA 3DZIA 4WPGA 2WICA 3IELA 1R6DA 2Y1EA 1YFJA 1AXGA 2ZJ6A 3W1EA 5KQLA 1P7YA 4JOQA 1AQ6A 3QUAA 5DGXA 2DY1A 1D0VA 1UMDB 2CHUA 3NBAA 1N5DA 5GQSA 3ELBA 4B6GA 5I7UA 2DUNA 2XBUA 3CBGA 3K9QO 3OJOA 1N2ZA 1O7JA 1U4SA 2HQ1A 1I5EA 2IFTA 3DBHA 2MCFA 2VSYA 1Z07A 4NYJQ 1KAHA 1IBLB 2OXFA 3LQ1A 1EE2A 4CKBA 2B4YA 1JKJA 4PF1A 3U48A 2HQOA 6PFKA 2WKQA 3M6WA 3PHGA 3LXXA 2SCUB 4ML3A 3V1TC 4JLJA 1P2UA 3IH5A 4OBEA 1ZONA 4JP5A 5AHXA 2IXEA 4D3DA 3F4LA 1YL7A 1O1YA 3LCRA 1CY2A 4XWAA 4GL2A 5AW2A 2K7ZA 3N58A 2F3RA 2QOEA 1G42A 3ONEA 1RFLA 2V4ZA 4KIFA 4Q1DA 4BO9A 2I78A 2IHBA 3GDWA 2YIVX 3TOCA 4B45A 1MLDA 2P69A 3EIOA 4URXR 5HRAA 2OZPA 4OP2A 4R83A 1HKHA 1T2AA 3HO8A 3FZEA 3QIAA 4PLPA 1KFKB 1LQTA 2GN1A 4RPIA 3SU8A 2Y1GA 6GPBA 1DIGA 1NQXA 4JOBA 5BOSB 4COKA 1GU7A 2A4KA 5FFNA 1DRJA 2W2TA 4MPRA 2W9XA 2O8BB 4G25A 1IBKB 2RCYA 2EZTA 3KT8A 3PFWO 4C0AC 2HNAA 3LLUA 5JH7A 1E79D 3O47A 1SN7A 1KE2A 3GEIA 4P08A 1TA4A 2AZMA 4R0NA 2YWJA 1I7QB 4QUHA 4C3ZA 3WGOA 1G7RA 1UDAA 3OFVA 1QZZA 4RM3A 4YBZA 4I4TF 3MB5A 4B8YA 1Y9EA 2G08A 1KVTA 4JLMA 1VTKA 4OJMX 5LXTF 3VR4H 3V7FA 4HTAA 1XTKA 1WZCA 1C9DB 1HYGA 1SQ0A 4BTLA 2FNAA 4G65A 1J5XA 3AETB 4FU0A 4MROA 1E5LA 1DOHA 1RM5A 4PY2A 4F71A 1UJBA 1F0NA 4LC9A 3UMVA 3W2GA 1Q1ZA 1JEEA 1O6CA 5KNBA 1VCHA 3NOXA 3RIXA 3V2IA 3WWYA 4RJIA 1WHSA 3L5OA 1WUTA 2IDKA 2REOA 4HMPA 4M0KA 1C7RA 2XJ4A 4RVNA 3S81A 4G85A 1SCNE 4MW4A 2NMVA 3KJNA 1YDGA 3PSHA 3TM5A 4M49A 2BSQA 3EVNA 4D92A 4CM7A 1GYRA 3PZBA 3AEZA 3EGEA 3PWTA 2QP3A 1FMJA 5KX5A 2C61A 2IU4A 3D0QA 5D5HA 4ZV4A 2OTCA 5IM4F 1PFYA 3DZDA 2ZBUA 4X90A 3T06B 1UKAA 4QIHA 3CGWA 4TS4A 4W5TA 3TZCA 2PL5A 1NWHA 2EJUA 2YJNA 3HKDB 4FFLA 4ARZA 1C3OA 3B89A 2GCIA 3LFUA 4WCFB 2HI0A 5H83A 3HKBB 4BRSA 2C00A 1ZY2A 2O50A 5IUJC 1RZ3A 2OHHA 6CHYA 2JAXA 4TMKA 2P4EA 2QQ5A 1JDUA 4OFZA 1N5MA 1NVMB 4GFDA 5LJLA 2XGJA 4TZ0A 3BMCB 1ETUA 1T5TA 2EF1A 4KGVA 2G9RA 4HLDA 4EA9A 5K3BA 4Z2YA 1SR8A 2XI4A 1R8QA 2PV0A 4K3VA 1AV7A 2OCYC 1MVLA 5T4EA 4KK3A 2V7QD 3VZSA 3B7GA 3NC0C 4PS1A 5IUKC 4C4RA 2DQ4A 1G6HA 2ZS8A 1D0SA 3KTAA 4S3MA 3WGNA 1Z8NA 3BTVA 4NDAA 5EUBA 4MS1A 3G49A 2ZI5A 3MC1A 4B7UA 4TKZA 4QA9A 4TWZA 3IAS1 1PT6A 2R7MA 3AM1A 5JSQA 1AGRA 4OMFG 3HV0A 3GLQA 4R54A 5LBTA 4WE3A 1SA0B 3ZS9A 5A6SA 3VNAA 3QYAA 2V1XA 4X64B 4PZDA 4N0QA 4YJ2A 4YJKA 2PHZA 4QOGA 1I13A 3T0GA 4MDFA 1ATZA 3DLAA 5AKEA 2NU6B 4RZSA 4U6NA 5FNVF 2VP4A 1G2IA 1M1NA 2AOXA 1XBTA 3SSNA 3H7AA 4TQGA 5CNKA 1Z4JA 3G0CA 3DOHA 5I47A 1EFPB 2J9FB 2YV2A 4OK5A 2UUOA 3R23A 1X7XA 5LP6C 1L5YA 3WB9A 4GE0A 1CJVC 4NS4A 1KQOA 3RHFA 1L5LA 3ZXYA 5KSZA 3AF2A 3PC2A 2GS9A 5FBWB 4YEDA 1YRAA 4POAA 1ZQ1A 4EELA 4ZU6X 5KEIA 1B2LA 2KS6A 1MAUA 2OBXA 5FF9A 1NSYA 3NVDA 1A9XB 4CF4A 4HB2A 3AIKA 3KHSA 2JLAA 4ZYWA 4QBFA 1OU0A 1XEAA 3LGXA 4O08A 5ALQA 2A3RA 2RKOA 1R6XA 5K3AA 3K9CA 5C2JB 2XKAA 3I1FA 4IOLA 4PCUA 3KEMA 3DXFA 2VSNA 3HNPA 4ZT6A 2AD5A 2NUBA 2OLKA 3DE5X 2YHAA 5CDTA 5CEJA 4AQ7A 2ZRLA 4KW7A 3I39X 2PUVA 2WJPA 2WHEA 2R11A 3LPNA 1D4FA 2N1BA 1TE2A 5FOUA 3DW3X 3DKRA 3TTSA 1O94A 4HGZA 5LA6A 3O4JA 1D2CA 3C3KA 2AFRA 2V4UA 1N2CA 1E18A 4L02A 1RJ9B 5IZCC 4JYPA 1X1RA 4DA4A 1R74A 2WAMA 4WNIA 4EB0A 2R1ZA 5L45A 5G1NA 3CR7A 4G5YA 4RAQA 2G7ZA 3UAZA 1EVEA 5LUAA 1E4VA 2FWPA 1SD5A 1KZ9A 2GTIA 1XU7A 1Q0RA 3OE4A 3COJA 5G4KB 2N3ZA 2YJTD 4QNMA 4BUJA 1OB2A 5BW5A 2Y1FA 3B6IA 3NUZA 4F4DA 3FDJA 3ITKA 4CCYB 3JVUA 1FQKA 1VBMA 1WR8A 2BRUC 3KZNA 3E1SA 1QH0A 2JEOA 3IUBA 1X3LA 2H8KA 1CT9A 3PDHA 4PZPA 4BEJA 1G9XA 2B1QA 3ZUPA 4WNAB 3UGKA 1P9RA 3SHWA 5E3HA 1LNQA 4IDFA 4TT3A 5FA6A 1KAGA 2ZBPA 4KOEC 3H1TA 4OHVA 3ZJYA 4OEHA 3WYDA 3LDAA 5HXAA 1A2BA 3GPIA 2YKGA 1J0EA 4M7WA 4RUKA 4D7AA 1DQRA 1AUXA 5KVAA 4O02B 1L7AA 5A3QA 1RWXA 2GJAA 3R41A 3OMWA 4MUAA 4ZKDA 1PLJA 5GGXA 3RYFB 4DLAA 2P5YA 2O19A 2TRSB 5TQ2A 1SKYB 3OIWA 1O96B 1H0RA 1KHHA 2LKDA 1SUWA 1AE1A 1IM8A 2PFGA 2R97A 1QCYA 3PGKA 4PBRA 3SJAA 4LY0A 5J4VA 4C6TA 3NRBA 2RE8A 1CBUA 3H2JA 1U8ZA 4S1TA 4CYMA 2HBYA 5JE8A 4IWYA 1UK9A 2WNHA 1SOVA 1LC0A 3AI3A 5JNUA 2VZEA 4C3OB 1XT6A 4BNTA 2PLFA 4QUBA 3OF2A 1CB7A 1U8FO 3M82A 1DKNA 2PX3A 4XJTA 1YHNA 1X74A 2CK3D 4D3YA 5C4IA 1PHRA 4UJ5A 5ALDA 3SDZA 4BX9A 1OGJA 1OBFO 3CO0S 4JA2A 5CAEA 3SQWA 2PLWA 3VYVA 3HG7A 2CEAA 4G07A 2XNHA 1TIBA 1JLSA 1BNCA 2W2NA 4JT8A 2BH2A 2B98A 2QLFA 1GR1A 3OZRA 3CM0A 4G5SA 4GI3A 1X13A 3C74A 3NTUA 3TOVA 4B83A 2VNSA 3A31A 4WY5A 4ZC8A 3DS8A 1YU9A 3DL0A 3ZCTA 2I6TA 2R6JA 1XCMA 4FCTA 2GT1A 2XOKD 4Z99A 3W7BA 2A1UB 3H2IA 4BWGA 1UMBA 2ISCA 2PXXA 3KEFA 4NLLA 3KEQA 2KLBA 3T4EA 3LHFA 5HJEA 5KB3A 3G7UA 4A6PA 2QQ0A 3DVRX 1JW9B 3DHWC 2IOQA 3O38A 3SQOA 4CLHA 1UKYA 1DS6A 2MSDB 1P2SA 2HO5A 3BTOA 3OQHA 2OFPA 4FILA 4ND5A 2YN2A 5LU8A 2O54A 1AQYA 1PL7A 4IJWA 5E2AA 5IEBA 4BAUA 1GNVA 4ZVRA 3UK0A 1NZDA 1ZYUA 3WICA 2EIHA 221PA 1H5QA 1KYWA 4KFRA 4CKWB 5JAPA 3OG9A 3QNMA 2H4HA 3FPLA 1II9A 4F2DA 3QG5A 5ALFA 2V7VA 5MGNA 4WV3A 1L5GB 3H0CA 4BX3A 2BFOA 5F7ZA 5IKOA 2OGTA 1WULS 1LPNA 3L6DA 1KEZA 1T0IA 2W90A 3O8OB 1ADFA 2GJ9A 2OOSA 2QQEA 2UVDA 2X9NA 4LEIA 4RCVA 4YRTA 2DKFA 1V9CA 1EXWA 1DKQA 3RGGA 1ZHHA 3IBYA 3Q8XB 4DS3A 4XGQA 4F5YA 5F2NA 1FSZA 3RVPA 5DN6A 5K0NA 4DSUA 3L79A 4MP3A 5HWSA 1J24A 2E82A 4OFWA 3PXBA 2FPRA 1CZRA 4X8LA 4FYPA 2I7VA 2A5JA 1WLYA 3GT0A 4DMRA 1U7WA 5HCIA 3VZRA 5H0IA 3IQEA 3NKFA 4PAWA 3LC0A 4HRXA 3OSZA 2NVBA 2XQGA 4NJMB 4Z0TA 2YJ5A 1RRMA 3KNZA 4N6NA 4QBTA 1TKBA 4F9EA 3ADOA 4BFWA 2R84A 2OZLA 1TKAA 1OYVA 2P40A 3DE4X 2QW1A 1VYVA 3OCJA 4GT1A 4MLZA 2B1RA 1O6BA 1ND6A 3TL2A 4G9GA 4KR7A 3LYHA 5TVKA 1KXJA 1M10A 2FYTA 1SHUX 2BMWA 3BAFA 3I9V6 4LMBA 1QDEA 2GAAA 2QRHA 4UMEA 3R4VA 1ORVA 3CN9A 4XOIA 5CFMA 2C94A 2ZYHA 2R6FA 3WXBA 1RJWA 2JD1A 2Q2QA 4MIKA 1AZSC 1IG0A 1U4NA 1WG8A 3FOWA 5AOAA 1BFUA 4KIJA 3KEOA 3C41J 1ZXXA 3AFMA 5HKLA 4IDOA 1RT9A 1FMTA 1AQUA 2ERXA 4IS3A 1V11B 3AP3A 4LYAA 5IDYA 3QXHA 5C7OO 1R18A 3PNQA 3UWPA 4JJAA 4TXJA 4MLPA 1XMQB 2IEBA 2ZAMA 2V1UA 4A16A 1T5HX 4DJAA 1QU2A 5HOEA 3AHDA 4G5RA 1VE9A 5IXYA 2QB5A 1JLHA 3BK1A 3IP5A 3NALA 2FEKA 3C8UA 3RJ5A 3Q7PA 3DO5A 1TPZA 4TYPA 2AMLA 1CLUA 2GM3A 3M5PA 5KQSA 1NVDA 1V7PC 1VBNA 3VXKA 5JR3A 1SUBA 4B8WA 5BQPA 4HOYA 1NU6A 2WLSA 1VRWA 4KMRA 5FO1A 5KIAA 1CYEA 1UQRA 3ZY4A 2FMHA 3ZCVA 3GJ4A 1O6FA 2BGUA 4LOJA 2H11A 4KJZA 3S2EA 5JXGA 1JJAA 1UFKA 2AOUA 3QSGA 4JROA 2CVZA 1KJZA 3T3IA 3RHSA 4GMDA 4BVHA 4CMIB 4MUMA 1FZTA 1K2WA 4LTDA 3KYDA 1JSCA 1R37A 2ADMA 3HWSA 4Q12A 1KZHA 5LP1A 5L95A 4BN5A 1KEWA 2I6UA 1BVRA 3ICPA 4KL8S 5AH0A 3T5BA 5BR1A 3EOBI 3DKIA 1T0UA 1U9IC 2EQAA 4XD7A 2CNWD 4IV0A 1V7QA 3CZQA 4H6WA 2P79A 3T4PA 3D59A 4O2LA 1F14A 4IUDS 2CNLA 2UVPB 4BGVA 4H08A 2IBTA 1TA9A 2FEPA 4OLJA 5EMJA 5IYZB 2GUGA 2OHGA 3PBKA 4K6MA 1Y7TA 4RZUA 4JY7A 3VR6H 2CB0A 2VDLB 1ESNA 1E2PA 4GMKA 4LZWA 1Q1GA 2K4MA 1XEXA 1ZD8A 4BO4A 1OTYA 4DCPA 4WEOA 2R4QA 4L0DA 3I12A 3T5DA 3DTVA