2YV1A

Crystal structure of succinyl-coa synthetase alpha chain from methanocaldococcus jannaschii dsm 2661
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
287
structure length
268
Chain Sequence
MILLDENTKAIVQGITGRQGSFHTKKMLECGTKIVGGVTPGKGGQNVHGVPVFDTVKEAVKETDANASVIFVPAPFAKDAVFEAIDAGIELIVVITEHIPVHDTMEFVNYAEDVGVKIIGPNTPGIASPKVGKLGIIPMEVLKEGSVGMVSRSGTLTYEIAHQIKKAGFGVSTCVGIGGDPIVGLRYKEVLDLFEKDDETEAIVMIGEIGGGAEEEAAKFIEKMKKPVIGYIAGQGTAESKMKALEEAGAYVAKNISDIPKLLAGILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Succinyl-CoA Synthetase Alpha Chain from Methanocaldococcus jannaschii DSM 2661
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
total genus 91
structure length 268
sequence length 287
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2yv1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yv1A01
3VPFA 4Y6PA 1HE2A 1E3SA 3PLRA 2X5JO 2Q50A 4I5EA 4KWHA 1JU9A 3NX4A 2RIRA 3DMTA 1B2LA 4M89A 1O5IA 1X1TA 2ZJ0A 2WYUA 5CEFA 1E5QA 1WW8A 3MJVA 2HK7A 4RVDA 4RO0A 1JLLA 5IFLA 2DKNA 1YJ8A 4BNLA 2HUNA 5HTOA 5TS3A 2FPGA 2ZJ1A 1A72A 4NNJA 3UCEA 2CY0A 1DAPA 3RKRA 3VAZA 4GGOA 3DC2A 5ICMA 3KYDB 3RU9A 4IXWA 1RM3A 3PPIA 3GEDA 1T2AA 2C5AA 3E5MA 3EGOA 2QW8A 3CMCO 4IGFA 5LDHA 4A5OA 5CG2A 2DVMA 1J4AA 4WASA 2WEKA 1ADCA 5A4DA 4IDEA 3L6OO 2Z1MA 1NYTA 1GU7A 1PWXA 1TT5A 1T2EA 2DBRA 4WNIA 2X5OA 1N9GA 4RLSA 3NT2A 1A5ZA 1PR3A 1DHRA 4YJGA 4EEZA 5AQ1A 2YV1A 1F0YA 1TT5B 1TXGA 2O7SA 5C5IA 3ROPA 1EUCB 4LGVA 4P8RA 4FOOA 4R68A 2Y05A 5GMOA 3ENNA 4NU5A 2JCYA 1PJ2A 2ZKLA 1ENPA 3PQDA 3BMCA 2Q1UA 3I9JA 3PQFA 4M55A 1O89A 4XIJA 3SC6A 1B8UA 3ORFA 5KTKA 1LEHA 3FI9A 3NUGA 4Q3EA 3C7DB 1NPDA 2NV6A 2O48X 4PLTA 1Y8QB 2VN8A 4YDRA 3S2IA 1EUDA 4B3JA 3IKTA 3ZV5A 3EHEA 2FHSA 3EC7A 3LT4A 2EWMA 1PX0A 2A92A 1GCUA 4JCOA 4ALIA 4YBZA 2EV9A 3CPSA 4Z0HO 2OL4A 1J49A 1E7WA 3HFSA 1CIVA 5EESA 4WCDA 3O4RA 4Z6KA 3B6ZA 2GLXA 3I3OA 3KSDO 1XDWA 1BMDA 2PA3A 3D5QA 2EJVA 4J1QA 4OYRA 4PLHA 4Q9NA 3L0DA 2VNSA 3CZRA 1TVEA 1XA0A 2E4AA 3U9LA 3JQAA 3LLSA 1PEDA 3ETEA 4PG8A 4FFRA 2VTDA 3JQ8B 4ZQGA 2SCUA 2P9GA 5JC1A 1I36A 3GK3A 4R01A 4W7IA 1HSOA 3KZVA 3C1OA 3QWIA 3KUXA 3HSKA 2VHZA 5A06A 3PYLA 1ML3A 2LDXA 3GHHA 4WLNA 4IS3A 4UULA 1XU9A 3UOGA 3FNGA 2ZTMA 4I5GA 4L73A 5DP1A 2NQ8A 2GNAA 3AY7A 5JAIA 5TQVA 1DHTA 3V2HA 1EK5A 5I9MA 3RUCA 2NU7B 3HN2A 4QO7A 2X9NA 1I2ZA 2EKLA 1F8FA 4W6ZA 1NX6A 2VRCD 4JP3A 4XRGA 1X0VA 3GRKA 2HMVA 4FD3A 1JWAB 4R3WA 4I9HA 4D43A 4JNKA 3NJ8A 1LLDA 3H5AA 3ZH2A 1F8GA 1IHXA 4IJKA 3ZWVA 1ISIA 4MVJM 2HMUA 4A2CA 4FFMA 4H7PA 5A04A 2BMAA 3QVOA 1SZJG 5AOVA 4CQLA 3KEQA 1FF9A 3GVCA 4YT4A 5EQFA 3BA1A 4E13A 5L51A 4CR6A 4DQUA 3P7MA 4QFCA 1HRDA 1HEUA 2DFVA 3O03A 3I5MA 4J2OA 4GX2A 1HDCA 3TPCA 4ZRNA 4ZGWA 1CJCA 4AG3A 3IUPA 3AOEC 1LRKA 4RQTA 4CMJA 4YT8A 3IIEA 2FR1A 2W2LA 3NGXA 1R6DA 2FN7A 3OIDA 2AE1A 1WLYA 4JROA 3JYOA 3PIDA 4GSLA 1RM4A 3UKOA 4ZJUA 2H63A 4WJZA 1B8PA 1GUYA 1LBEA 2PGDA 4OJNA 5B4VA 4I08A 1DIRA 2QZZA 1OC2A 4HX5A 4XD2A 4BL5A 2ZCVA 2VYND 1YONA 1UZLA 1BG6A 4S3MA 2UV8A 1X7DA 3H65A 2Q99A 4D0RA 4NK5A 1DPGA 3K30A 2XAAA 1YJQA 4YRBA 1E3WA 4B3HA 2SCUB 5CDSA 1QYCA 3IJRA 4UREA 1EBUA 1I3NA 2WSBA 1CETA 3EMKA 4PLPA 1ZEJA 1GAEO 3QWFA 5KVVA 3OEYA 1RJWA 1MV8A 1HE3A 1NQ5A 3PIIA 4DLBA 2JL1A 4IDFA 3GHYA 3ENKA 3GEMA 4II2A 4KZPA 3W8EA 3ZV4A 1RKXA 2CDAA 1X7HA 2JFHA 4AJ2A 1ZK3A 4TZKA 5EMHA 4BO3A 2GPTA 5CDTA 2YFHA 1WAMA 2NLOA 2I67A 1BDBA 3BYZA 3NT4A 3UXYA 3AM3A 3KXDA 1H6DA 4BNXA 4DVJA 3UN1A 3Q9UA 5TJHA 2NU6B 4ALJA 5KJ1A 4TWRA 2PKRA 2FMUA 3DAFA 1ZKMA 1O0SA 1R16A 3DR3A 1CEQA 3L77A 2EW2A 2TMDA 3OQBA 3IJPA 5COBA 2VRCA 3GDGA 2YV2A 2NVWA 3AU9A 5KJEA 2D59A 2GN6A 2Y0EA 4GKVA 2J5RA 3WQSB 2HU2A 3DL2A 4FC6A 1YB4A 3OQ6A 1CERA 1VI2A 1H9AA 3D3WB 3GLQA 4YJHA 5EQDA 1U1IA 4DA9A 4X54A 3ETDA 3GUCA 5U1PA 4J0FA 2WE7A 4F45A 4BO9A 2P68A 3UF0A 1YVEI 3GGGA 2H1SA 1GEEA 1HTBA 1QYDA 4L4SA 1LNQA 3LVFO 2DUUA 4IZHA 3HZZA 4DC0A 4D41A 4IDBA 2RBEA 1Q0LA 1T4DA 3ULKA 1E6UA 4IQGA 4R3NA 1WVGA 3C24A 3KV3O 3JQEA 4GMGA 4XZ3A 3E9MA 3SEFA 1HDZA 4BNMA 3WGYA 1KYQA 1T26A 4IXTA 4PCVA 3MTJA 5IN5A 3K73O 2X8LA 1MGOA 4FB5A 5A5FA 1GV0A 2DBVO 1PJLA 2BRUA 2A35A 4IIUA 1DLJA 4B4UA 5G0TA 5IJZA 1KEUA 1PZGA 1QP8A 5EINA 3RSHA 5B4TA 3MCVA 4FIZA 1VRWA 4JGBA 2VHVA 2BFMA 4KP7A 1IZ0A 1UDAA 4RDHA 2O3QA 2F1KA 1JAXA 2IODA 3ZWCA 3CMMA 4J7CA 2PZMA 4E2XA 4FGWA 4JBHA 4CM5A 3ZHYA 3QJ5A 3H6KA 2VUTA 4OIMA 5A9RA 3G79A 9LDTA 4CJXA 1XGKA 3VPGA 3I23A 4QO8A 2BD0A 2QG4A 4YAGA 3WGZA 5GY7A 5L3ZA 2B0JA 2Y1EA 5G4KA 3O9ZA 4Z3DA 4AICA 1O94A 1LDMA 3DHNA 3Q11A 2EJWA 3QA9A 4CM6A 4QQRA 1LC0A 4O0LA 2C0CA 3HDYA 4WLUA 1K0UA 3U4CA 4Y98A 5TNXA 4HKTA 1B26A 4W7HA 5IF3A 3R1IA 3GG2A 5JCXA 2BFAA 1MX3A 1DIAA 3R0IA 2I5PO 1TI7A 2C2XA 4MVJD 4R1UA 3FD8A 4BNKA 2HJRA 5KKCA 4BKPA 3S8MA 3WMXA 1TB4A 1HETA 4KQWA 2HLPA 5B12A 3VOSA 3WWYA 2BKAA 4F3YA 1KY5A 1QYWA 2HO5A 2ZB8A 1BXKA 1L7EA 1HYGA 3JQBA 4QUKA 3R3JA 1HKUA 4AJEA 2V6GA 4NHEA 3WGQA 4LSWA 2O3UA 5DP2A 4KUGA 2VYVD 3SJUA 1OOEA 3PFWO 3NEPX 1HF3A 1U8FO 4BB5A 2CUKA 2FZWA 3JQGA 4WEQA 1LSSA 2YV3A 1P45A 4RF2A 3ZZNA 5CPBA 4BQRA 2J3JA 2X86A 3WQQA 2PZJA 3L6EA 1SCUB 1PWZA 3QW2A 1ZJYA 3KHUA 2X9VA 1QG6A 3RJ9A 2PV7A 1WWKA 2B5WA 4DUPA 1RM5A 2DPHA 1H5QA 4PLFA 1SCUA 1E1KA 2ZTUA 5CEEA 5IN4A 4XYBA 4AJ1A 4L75A 4J91A 3DAPA 4DQVA 2Q1WA 3MOGA 4OM8A 5JYEA 1JAYA 2GZ2A 4GL4A 2D4AA 2E82A 2UVDA 3V2UA 3LC7O 5CDYA 5EJ2A 4O59O 3FNFA 1UUFA 2PGLA 1Z82A 4HBGA 4JP2A 4OOFA 3WBBA 1ADGA 3RUDA 3FRJA 3G1TA 3D4OA 4E2WA 2NM0A 4BOYA 3IP1A 4BMNA 1WXDA 1ZSVA 2HMSA 2JJYA 4GSKA 3E9NA 5DULA 1VL6A 4DYDA 3TFQA 2DU8A 5DT9A 4CM9D 4BNVA 1BXGA 3AOEA 4CR7A 1ENZA 3ZWAA 3H7AA 2D8AA 1ZZEA 7ADHA 1N5DA 3L4BC 4TRNA 3EYWA 3RI3A 4RPKA 1XYGA 4CUZA 1M2WA 2NACA 4XA8A 4CUKA 1QLJA 1KEVA 1QRRA 3P2OA 5KNLA 2ZCUA 2IZ0A 4ESOA 4HFMA 4LK3A 2YW9A 4CUJA 2CMDA 3I4CA 3IAHA 1XKQA 5LCXA 4KDEA 5ILGA 2IRWA 3INRA 5U4QA 3GNQA 4OH1A 4FBGA 1JQBA 3VTFA 2A4KA 3WSWA 3TZKA 3UH1A 3ZGYA 3EUWA 1BHSA 2AQIA 6LDHA 4LCJA 2Q2WA 4JJGA 1YOVA 1EQUA 4OO3A 1PTJA 4GKBA 5L7WA 4D79A 3KYDA 3RC9A 1DFIA 2VUSA 4R16A 4TRMA 3PHJA 3WGHA 3CINA 1XHLA 3QVWA 4A0SA 4UVIA 3RC1A 2J3IA 4RF3A 3JQFC 1LQUA 2VOJA 3GMDA 4TROA 3K2BA 4NI5A 1YGYA 3ICPA 4HWKA 2ZTVA 5A9SA 1AHIA 4YJGB 3UAGA 3OJFA 1YE3A 2AA3A 2P4QA 1ONNA 2O3SA 2YQ4A 1LX6A 1AXGA 2YHIA 1DC5A 1NWCA 3DFUA 2I3GA 3WB9A 4PZCA 4BB6A 3GZNA 5FF9A 5AXCA 3OP4A 3PTZA 4J1SA 2DM6A 3QLJA 3STHA 5TSDA 2VNAA 5HS4A 1PJ4A 1EMDA 1GFSA 2VHYA 4FJ0A 4JJFA 3WYEA 2D1YA 2P4HX 2Z5LA 3GY0A 3JV7A 4J3FA 1CQIA 5A3JA 5K6AC 4BNIA 1V3VA 4HNGA 3VH3A 1HDOA 1CYDA 3IDSA 2AEFA 2AQ8A 6ADHA 4MIYA 4MVJI 3VZSA 3S1LA 1ULUA 1MFZA 3OF2A 3QHAA 4NJMA 4LVCA 3Q1LA 4EITA 2IZ1A 4OXYA 5JE8A 4GX0A 5L40A 5ENVA 4E6PA 4HFJA 4CR8A 4N5MA 3RUHA 1H94A 2WJPA 5TT0A 1N9GB 3OJLA 2G5CA 3M1AA 2HRZA 4IIVA 3HB5X 2DBQA 4AJLA 4MVJG 4CMCA 1P33A 2P9EA 1G6KA 4J9VA 1JKJB 3HB4X 4E5NA 1T1RA 3COSA 4D3SA 2RAFA 1JKIA 5H83A 3IUSA 2ZATA 1FK8A 4CQMB 4CV3A 4GX1A 3FTPA 5DZSA 3O38A 3F5QA 3FWNA 5A9TA 2JAHA 3OIFA 5ER6A 3DBRB 5TC4A 2GZ1A 3I6IA 1QKIA 3FCOA 1G1AA 1VE9A 2CVOA 1KVTA 1R37A 4R69A 1KC3A 1Z7BA 2NVUB 2GN4A 4IGEA 4LSMA 4IQ8A 1E6EA 2O3JA 2C7GA 1K3TA 4B8ZA 2VQ3A 1BXGB 3KSZO 1J5PA 3G3EA 2ZIZA 4BIIA 5GZ3A 4MKRA 4XQ9A 3VC7A 1A4IA 1HE5A 1A4UA 3PJGA 1FMCA 1ORRA 4CL8A 4UAGA 1T1SA 3DMYA 1LSUA 2X0NA 1J6UA 2JD0A 2G0TA 4YCAA 1WP4A 1XQ6A 2CDCA 4M86A 2YYYA 1MC4A 3GZNB 1ZXBA 2DT5A 3GFBA 5B1YA 4I5FA 1Z7EA 2WTBA 1UXJA 3OJ0A 3WS7A 1QXSA 1P9LA 3INTA 5COAA 3R6DA 2NVBA 2IE0A 5TT1A 3ITKA 3LT0A 3UHAA 1B0AA 3ZHXA 3BAZA 1GYPA 4B4OA 5JCJD 3BMOB 3WGTA 5CDGA 1PS8A 4E21A 1DJQA 3TZQA 4BNFA 2HCTA 3LU1A 3H3JA 4YAIA 3MTGA 3QSGA 4DWVA 3TSCA 4BV9A 2IXBA 4U7WA 4WGGA 3PI7A 4JX8A 5JXWA 4KDFA 3PHIA 3JYPA 3D7LA 5FFFA 4DXHA 1NFFA 2UAGA 4DIOA 4H3VA 4YPOA 2VZ9A 1NHWA 3TL3A 4DBZA 3WR5A 1PGNA 4QEDA 3PXXA 3ZV3A 3FR7A 2ZQYA 3GOHA 1I33A 3CSDA 1H6CA 1BXZA 3JQ7A 1E3WB 4OKNA 2RH4A 1GR0A 3JQAB 1EE9A 4UUNA 1R0SA 2PLAA 4LW8A 3X2EA 3U09A 2J8ZA 4MVJH 2X4GA 3G0OA 2JFFA 1GPDG 1I30A 4M87A 4GMFA 3DFZA 3FSRA 1EEHA 1L7DA 1UP7A 3LZ6A 3F9IA 5GZ6A 1ZJZA 3GVHA 3V1YA 1PL8A 1T4BA 1JWBB 4BNYA 4J6FA 2CVQA 5IZCA 1Z75A 3RROA 2H5LA 3QY9A 4A03A 1IB6A 5JDIA 1W73A 2EP5A 4NZ9A 1FXSA 3DAGA 3Q2IA 4MINA 4IPTA 4FQ8A 2DUWA 1V3TA 3OM9A 1LRJA 3IC5A 1BW9B 3WOHA 3PHHA 4JBIA 1U3TA 5COQA 1UAGA 1R0KA 1HZJA 1YBVA 1I8TA 4NFHA 2Y1GA 4WK6A 1A7AA 3GPDG 4EI2A 3NAQA 1FDWA 1U3VA 1ID1A 5AXDA 4INAA 4XIYA 5HA5A 4O5OA 4YJDA 3EW7A 2LDBA 1LDYA 3FN4A 1I3MA 5IDWA 3NDJA 2FSVA 3JQDA 2ZYGA 2Q2QA 2IEBA 3N58A 4IS2A 5F1KA 4ITUA 2E48A 2D5AA 2NNLD 2OBNA 4DBVO 4BGUA 3ONDA 5LDGA 1B16A 1R12A 3IQDB 1N8KA 1NQOA 3H2ZA 3W6UA 2NU7A 3WYBA 2VZ0A 4JIGA 5THQA 3M1LA 2YUTA 4P38A 3KYCB 4Y6RA 3KM0A 4RQUA 2W98A 3IMFA 4BNGA 1U7HA 3DZJA 1E0DA 3FNHA 1EDZA 2TMGA 4BNJA 2Y1FA 3ADPA 1QSGA 3NTQA 4QTZA 3CZMA 4L74A 4MVJF 3U4DA 1EFLA 4E33A 3M6IA 3A1NA 1T2CA 3LC2O 2D5CA 4FOSA 4NR0A 1B8VA 2EHDA 1U3UA 3B20A 4R9RA 2VT2A 1MXFA 1XR3A 3HUDA 4CM1A 1XEAA 3D1LA 2XPCA 5DBIA 4XGKA 3LC1O 2P2SA 4II3A 4D44A 1V35A 2OMEA 1LLCA 2EKPA 2PD3A 1KOLA 5T5QA 4LMPA 4QXMA 4ZN6A 1QYXA 1CWUA 1PQPA 4QX6A 3DMTC 3DXFA 4BQPA 1C1DA 3PDJA 3RBZA 2FP4B 2AEMA 4E4YA 3WICA 5TX7A 3E48A 1VKNA 5B37A 1E3JA 1J0XO 3QE3A 2CSUA 4MJLA 1SOVA 4D46A 2Y1OA 3IKVA 1ZCJA 3GVIA 4OQYA 1ISJA 3UFXB 1HE4A 3DTYA 3M2TA 1E1NA 3JTMA 5TF4A 4P4NA 3BMNA 3E9QA 3GRPA 3E82A 2RHCA 5A3VA 1W6UA 1HDRA 1FDUA 1YH3A 3PRJA 3ROQA 4CLXA 2VYVA 1VSUA 1NWHA 1QYVA 2W2LD 2UDPA 2VHXA 1D4FA 3GDFA 3WG9A 3QP9A 4R54A 1Q1NA 1NBOA 1KY4A 1I2BA 2GASA 1XU7A 1YKFA 2WWRA 2V65A 4A7PA 5TLSA 2D0IA 1A7KA 2VWPA 2NU8A 4N54A 2AG8A 3NDRA 3BIOA 1BTOA 2VYNA 4IDDA 4XB1A 3ZU3A 1LXCA 4BHTA 4H16A 4J9UE 4YAEA 1QORA 4J1TA 2WD8A 4XQCA 3ABIA 1NM5A 3L4SO 4EW6A 5ES3A 1TLTA 2R00A 5L9AA 3DZKA 3K92A 3KRTA 5C7IO 3KETA 3I1JA 1ZSYA 1NXQA 1Q7CA 3DHYA 1LDGA 3RFVA 1C14A 1PQUA 3F1LA 4K9DA 1T24A 4BMSA 3P5SA 2Q1TA 3HHPA 2H9IA 4JN6B 1M6WA 4U6SA 3E18A 3QRWA 2O2YA 4PLYA 1ZFNA 4N5LA 1T2DA 2X23A 3OJOA 2V7PA 4UUOA 3KB6A 4PVDA 5F3RA 1O8CA 1G0NA 2I3AA 3PYMA 1H6BA 4OQZA 1DJNA 4PG6A 4GPD1 3TDKA 2NUAB 2G76A 4TRJA 5G4LA 4F46A 5G0WA 1SAYA 3O8QB 1OC4A 2GO1A 1U5CA 1UH5A 1Z73A 3C85A 2DBZA 3PWSA 5JCJA 4PZEA 1BVUA 3RASA 4MKZA 3ZNOA 3DOOA 1WMBA 3L6DA 1YDEA 1PZEA 2BF7A 5ADHA 4IM7A 3AU8A 1VM6A 1Q0QA 1M76A 4E0BA 3K5PA 1ISHA 3GR6A 5DCYA 3RQSA 2CVZA 3JQAD 4R41A 4UVDA 5G2OA 2V6MA 2AMFA 3AUUA 1NVTA 4O6VA 4CMKA 1P1IA 4ZHSA 4R4JA 1D1SA 4N7RA 5L45A 4RVUA 3U0BA 3PWZA 4NDNE 4BVAA 3V5NA 4XYGA 1XIVA 1YQDA 3HJAA 3NV9A 1Q7GA 4Q3DA 2HRBA 5AXAA 4G2NA 1GV1A 3K96A 4YJHB 3U4HA 3WJ7A 3JYNA 3WIEA 5DCUA 1YB1A 3ONEA 2X7HA 1PJTA 2ZB3A 4K1LA 4ZD6A 4AJIA 5ITVA 3ON5A 4Z9XA 1PR9A 2B69A 3MEQA 1X14A 4CODB 3ZW9A 1ARZA 1OBFO 1ZNQO 2R6JA 3MJ4A 2VT3A 3PJEA 4YRDA 2ZB4A 4CM7A 1Y8QA 3Q2KA 4CMIA 4RJTA 3UVEA 3WLEA 3Q3CA 2PKQO 2G17A 4IMPA 4CV2A 2Y1DA 4ALLA 4NK4A 5G0SA 2ZTLA 1A71A 1B3BA 1PGPA 4ILKA 3DZHA 1H0KA 3TQHA 3DDNA 5F5LA 5CAEA 1O6ZA 2PD6A 3KOUA 3ETGA 3EZLA 3H3FA 3TRIA 4XYEA 2I6TA 3D4PA 4OSPA 2DTEA 4YAKA 4ND4A 3I9KA 2PKQP 2YY7A 3RD5A 3RFTA 4BKOA 4UVHA 5A1TA 5JO9A 3DTTA 4OXNA 5CEJA 2HK8A 4XDZA 5ICSA 3FF4A 3E6AA 3L9XA 3QWAA 2ZK7A 4XCVA 4XX0A 4IQ0A 5AYVA 1NAHA 4N5NA 3C1TA 3U5TA 2Y1CA 1VJ1A 3QWBA 1EVJA 4U8GA 4XRRA 3H9JA 3LF1A 4U0JA 4BS9A 3QVTA 3SLGA 4CLOB 4P4LA 2G82A 1F14A 4YAJA 5C37A 3HADA 4IY1A 3KO8A 4TVBA 4EBFA 1HDGO 2Q2VA 3GH3A 4DYVA 1B15A 4AJ4A 3CIFA 4XYMA 2PGJA 5I7EA 1GQYA 3PP8A 4CQMD 2DTXA 2HSDA 1C3VA 1W0CA 1VSVA 3M2PA 4IJUA 2NU9A 3H9QA 3PYXA 3SXPA 5KJCA 4UEJA 2PR2A 1P44A 5TJ9A 1SMKA 4RLHA 1JVBA 3PK0A 1I2CA 2NU9B 2Q1SA 2GN8A 1FDTA 2CZCA 4DMLA 1P1FA 2QX7A 1GQQA 1IZ9A 1HDXA 3L4BA 1NPTO 2I99A 4UVGA 4CLDA 5DF1A 3AM4A 3BTUA 4OSOA 3MWDA 4ND3A 1E3IA 3TNLA 4PLCA 2IYOA 5JAMA 3LT1A 3AK4A 2DC1A 1C1XA 3JQCA 3ZW8A 4U6QA 1WNTA 5JS6A 2C2YA 4IDGA 1BVRA 2GN9A 5JDIC 4TKLA 2POQX 1LA2A 4NBRA 1U8XX 3GA0A 1PGOA 1NPYA 3ZWXA 1N1EA 2R2GA 1P77A 1YBAA 1MP0A 1K6JA 2VWHA 1UP4A 2ZYAA 4YR9A 3JYQA 3JD2A 4Z9YA 4BKUA 1MXHA 4YB8A 1DC4A 1SC6A 2X22A 1U4OA 2AW5A 1R15A 4Y67A 2FZEA 4CLRB 3C1AA 3RC7A 1Y8RB 1MFPA 4CQMA 2NSDA 3GF4A 4GX5A 1K89A 1K6IA 1T2FA 3BHMA 2OO5A 3VPXA 3VZRA 5JBIA 1ZBQA 4FFNA 1X1EA 5L53A 4Q3NA 1DFGA 2CF5A 4MO2A 4LCEA 3EDMA 3DBRA 4W9NC 1H6AA 4CM8B 3W1VA 4AJPA 3LYLA 3NGLA 3NJ4A 3VDQA 2GDZA 1YS4A 2HKIA 4WLFA 2VRBA 4BKQA 2GR9A 4CM8A 3GVXA 1DIHA 1EK6A 1LRLA 4RV9A 3LT2A 3AFNA 2AG5A 5BR7A 1VJTA 5HBRA 3X2FA 5FWNA 3MWEA 2FR8A 2UUPA 4PLGA 1UXGA 1LSOA 4B7XA 3KSUA 3ZWYA 3GC6A 2AQKA 1PIWA 3ANLA 4DPKA 1NQAO 1Y81A 4YRAA 2JD2A 4FFLA 4GGPA 1HT0A 1E5LA 4RORA 3ZHZA 4BNUA 4DPLA 1IPEA 1ZH8A 4OGWA 2JCVA 4ROSA 3GT0A 2GCGA 1H9BA 2OP0A 3KTDA 4RVSA 2F00A 1LU9A 3SBOA 2WM3A 4BO0A 2FPPA 2YHIB 5IZ4A 3PZBA 3F3SA 3DWFA 1DFHA 1CF2O 3K9QO 3JD3A 3U3XA 4E3ZA 3CXRA 4KTTE 4NG5A 3ROKA 3TZ6A 1SNYA 3WJAA 4M54A 1GCOA 5KJFA 5KVSA 3F5SA 4B7CA 5H81A 5KCZA 1Y7TA 5DDIP 4YEDA 3DBLA 1GEGA 1Y9EA 4PRLA 2OZPA 1PL6A 1UAYA 2JHFA 2EF1A 3DBHB 1E7RA 5A5EA 4D3DA 1CQJA 4BO1A 4U0KA 5HRUA 2J6IA 4Z0TA 4B4VA 1DSSG 2O4UX 4YQYA 4MVJA 1EVIA 4DQXA 1Z74A 3RFXA 1UR5A 4K6FA 1U4SA 4OOEA 1NFQA 3BHJA 1U5AA 5BSEA 3VDRA 3PZRA 3IS3A 2CD9A 5IDQA 1ENOA 3MJSA 1FJHA 5T64A 5JW6A 1OZAA 3JQ7B 5ILOA 3IP3A 1YXMA 3PVZA 1L1FA 4DGSA 4HADA 3ZI0A 3HN7A 1E92A 1VPDA 1EVYA 5DOVA 4DLLA 4DTIA 4R51A 1G0OA 1DXYA 3GN1A 2EKQA 3U4IA 4TZTA 1W8DA 2E37A 5F21A 4EZBA 5JAZA 3OMLA 3QIVA 4KOAA 3JCZA 4RPHA 4Y9DA 5J23A 1GZ6A 3JYLA 4JBGA 1GZ3A 3ZNPA 2VCYA 1ZO8A 3A9WA 2UYYA 2OBYA 3PQEA 3T7CA 4KTVE 4C7KA 1I3LA 2GGSA 5DBGA 4DLAA 1MB4A 4QECA 5T8KC 3ICCA 3NTRA 1K2WA 1NP3A 2AHRA 5EPOA 4YACA 4EDFA 5BSFA 1UZNA 2W8ZA 1JTVA 2EXXA 1H2HA 1BW9A 1DRUA 3NKLA 4FC7A 3H9GA 2CNBA 1C0PA 3ADOA 3H5NA 1DC3A 4ONEA 3HE3A 4E30A 3GNTA 3RJ5A 4D0SA 5JNLA 1BRMA 4BV8A 4NFSA 4FCCA 3RBVA 3ZU5A 5ER9A 4BO4A 4OXKA 4BNHA 3PJFA 4R9SA 4A73A 4Y6SA 1B3RA 4DC1A 3QVSA 2PTGA 1ISGA 2BGMA 2B35A 4MIOA 1D3AA 1ONOA 5F1OA 1SEPA 1JKFA 1MC5A 3CH6A 3L9WA 1KVSA 3D0OA 1ZSNA 1IOLA 1Y5MA 1VKOA 1C0IA 1KVRA 1BSVA 1YQXA 4BO5A 3DZGA 3JD0A 3AI3A 3PWKA 2I66A 4XDYA 2NU6A 3GQVA 1UJMA 1PZFA 4UEKA 5JMPA 3VZPA 3TZHA 4XB2A 4MDHA 3GAFA 4B4WA 2HK9A 4EJ6A 1E7SA 1NAIA 1U9JA 4W82A 1DC6A 4CMGA 4RDIA 1ISFA 1HZZA 4CMHA 1NNUA 1LC3A 1Y6JA 4NH4A 4MP6A 3UW3A 3VH4A 5I7SA 1GY8A 4TQGA 4ND2A 3VKVA 3ZWWA 1KVUA 1P1RA 2BELA 1DLIA 4HXYA 2GUGA 2HDHA 4BO6A 4WEOA 3AY3A 1N7HA 3W6ZA 3OBBA 3WQRA 1LTHR 2IDZA 5IG2A 2YJZA 3RAJA 2Y99A 1DRWA 3QV1A 3V2GA 2FPIA 1WDKA 2IEDA 1NR7A 3GG9A 1GD1O 5DBFA 3S55A 4EEXA 3WIDA 4DIBA 1RYDA 4E12A 4G81A 3WMWA 3CTMA 3Q0EA 4MP8A 5TIIA 4GAEA 5JDCA 1MA0A 2OHXA 1P1HA 3KVOA 4A26A 2B83A 3AW9A 3HQ4O 3LDHA 3V1UA 4BO2A 5JLAA 1ZK4A 5KKAA 1JN0A 5THKA 1PS0A 3INGA 4HP8A 4BGVA 2C29D 1XCBA 4FN4A 2QRLA 2ZQZA 3BMNB 3GDOA 3MJCA 3W4JA 4BUCA 4CL3A 2P5YA 2P9CA 4CMBA 1X13A 4L0QA 5DN9A 3AJRA 2X1HA 5FI5A 3SJ7A 3ZV6A 2ZYDA 5DNAA 1GYRA 4IMRA 1V0JA 1TT7A 3K2EA 2C07A 3DQPA 3OETA 4J90A 4OL9A 5A03A 4F6CA 1EQ2A 4L8VA 3TL2A 1NHGA 3H2SA 5CFZA 1XSEA 2VWGA 4PVCA 4PN3A 4GWGA 3SC4A 1HSZA 4CMIB 2R00C 4LRTB 4B79A 4RPLA 2BLLA 3ANNA 2B4TO 3NDIA 3F46A 1BWSA 5I9NA 3JSAA 1Z45A 4BNTA 2Q46A 3BMQA 4XWYA 1YDWA 4RPGA 5HS6A 2WYVA 3HFGA 2ZB7A 3ZWNA 3BMQB 3PDUA 2YDYA 2JHGA 1RM0A 1I24A 2BHLA 5BNFA 4CPDA 1MG0A 3OFSA 2RHRA 4HFRA 4WPGA 3OJEA 2Q4BA 2PK3A 5K9ZA 5L4SA 4AL4A 1XQ1A 2WYWA 4A27A 3RCBA 3HWRA 1LSJA 2O50A 4XJSA 5C7OO 4NJOA 2FY8A 3PHGA 2HJSA 4FGSA 2B36A 1KC1A 4YYZA 1D8AA 2WMDA 3E1KA 2VHWA 1CQIB 3JQFA 4I9NA 4KMSA 4ZQHA 3I4FA 2V6FA 2EG9A 2NUAA 3RWBA 2NU8B 3WWZA 1E3EA 4CM4B 3AFMA 3Q6IA 4HFNA 4TSKA 1A27A 1E6WA 5F1PA 3AUAA 3DONA 1R0LA 1ADFA 3HG7A 3JQ6A 1DDOA 1Q0HA 1AHHA 1LLUA 1E3LA 1R66A 5JY1A 9LDBA 1ZXLA 4WKGA 4NIMA 2OOSA 1GPJA 3GEGA 1SEVA 3DOJA 3ZWMA 2B5VA 2CDBA 1GUZA 3OECA 4CM9A 4EUEA 4BKRA 1ISMA 4LMRA 1YWGO 3PLNA 2QRKA 3VVCA 2EERA 2X0IA 2BI7A 3I9OA 3MWDB 4L4RA 1EVZA 2DLDA 2NWQA 2ET6A 4QSMA 1UXIA 1PJSA 4IINA 5L7YA 3VH1A 1YL6A 2AEJA 3AY6A 4Y8VA 4BGIA 4QT0A 2X0JA 3HDHA 4DRYA 5DOZA 4WLEA 3OEWA 4WE3A 1M6HA 3BTSA 1C1DB 4UUMA 4PLWA 2JCXA 2PFGA 3BTVA 3VHRA 1E7MA 4TKMA 5T8KA 1NVMB 3ZWPA 3QWHA 3D4NA 1YBMA 4KUEA 4NQZA 1VJ0A 3C3XA 2VZ8A 3DO5A 3MJEA 1YB5A 4WNCA 5KOIA 4J7XA 4KQXA 2C20A 5MGBA 5T67A 5I7VA 1ZVMA 4TMFA 4FJ1A 3RIHA 3QQPA 4J0EA 1P74A 3RUEA 1WPQA 2C54A 4XGIA 1PGQA 3OA0A 1IPFA 2BFOA 3OQ1A 5ITWA 4XEHA 1HYEA 3WGOA 4HUJA 4RCVA 3B1JA 3FBGA 3AI1A 3EZYA 4PG4A 1V8BA 3VVBA 3CUKA 4JQCA 3ZCXA 1AN9A 4QFDA 3FNEA 5IDXA 1ZK1A 1UDBA 3N7UA 1DO8A 4YJFB 4EJ0A 1KETA 4S1VA 4FFOA 4ND5A 2BI8A 4L4XA 4R1TA 2B37A 3WX0A 2NADA 3GGPA 4AJKA 4I9UA 5CHEA 4YA6A 3SX2A 3MOIA 2QQ5A 2W2KA 1LDNA 1R4MA 5K6AA 3B70A 4XGNA 1GADO 2ILTA 5IZCC 3JQ9A 3RU7A 5JY6A 4J43A 2O4CA 3EK2A 4RVHA 1ULSA 4GWKA 3D3EA 5T6BA 2O3RA 2QYTA 1VL0A 2D3TA 2FSSA 4I5DA 1GZ4A 3A06A 1IHYA 1JVSA 4NBUA 3WNVA 4J1NA 3ZNNA 4K26A 4WUVA 4YTEA 4PLZA 3ZU2A 4A10A 3B1KA 3GZ4A 5JFOA 4ZRMA 3GNSA 5EL0A 5KJ6A 3JD1A 2PZKA 1OMOA 2EEZA 4HY3A 4XQGA 3D5TA 1E77A 3ASUA 1P1JA 1E7QA 2X0RA 3GUYA 5JDCC 2EGHA 2YDXA 5HWSA 5A02A 2GD1O 5I8WA 4I1IA 3T4XA 1YOVB 3A14A 4YJFA 3PJDA 1N92A 2OGUA 1BGVA 5K0ZA 1E1LA 3WYCA 2HQ1A 4EGFA 1F06A 3AOGA 4E2ZA 4Q3CA 1Z6ZA 2FR0A 2OORA 2Y0DA 4ID9A 2X58A 3WSVA 3PHLA 4DMMA 2O3TA 4GVLA 5EERA 4JXKA 4KUHA 1U7TA 4P4GA 3KEOA 2XOXA 1I5RA 3IOYA 4O1MA 1LI4A 1EUCA 5IAAA 5I8ZA 1JW9B 3ASVA 3JQ8A 1EZ4A 3DOCA 1D1TA 1SO8A 2YQ5A 4D7AA 4PRKA 1RYEA 4R1SA 4RF5A 5C3MA 1P0CA 1ZEMA 3BTOA 3GFGA 3T4EA 1IY8A 2WD7B 1U2DA 3O26A 1U28A 1LUAA 4RF4A 5KVQA 4FS3A 3NYWA 5CP8A 3H8VA 1DB3A 5JC8A 3MWEB 1B7GO 1ADBA 4IBOA 5BSGA 1C1XB 3UCXA 4E32A 1O95A 1WDLA 3TF5A 1OAAA 4RGBA 5A05A 2Q49A 2QHXA 5CPFA 4XQEA 1BDMA 3H5RA 3TOXA 2W2KB 4NBTA 5L4NA 5EN4A 3S2GA 4C7JA 3GGOA 3V8BA 4BO8A 5L4LA 3UICA 5H82A 1PQWA 1QMGA 2GF2A 2Q4EA 3CE6A 4PGFA 2A94A 4W9NA 3TWOA 3VZQA 1PZHA 3ITDA 2GSDA 1GUFA 2X9GA 4ZQEA 2OFPA 1WDMA 2YZ7A 5I7FA 3C7AA 3FPCA 1ZMTA 4E5MA 3DHEA 1R4NB 1YRLA 2J5QA 1PJQA 1DRVA 3BMOA 3WGIA 4K6CA 4EJMA 3FPLA 2WD7A 3KLPX 3H4VA 4OAQA 2AE2A 3ZDFA 1YO6A 1KIFA 2OP1A 4NBVA 5IDYA 1GDHA 1JA9A 2PD4A 5FYDA 1TEHA 2BFPA 4ZA2A 3UGKA 4Q3AA 2GERA 2NVUA 5BQFA 1QR6A 2D2IA 3V1TC 1PSDA 5IXSA 1Y5RA 2AQHA 2CF6A 4CM3A 3DBHA 4LRSB 1CDOA 2EIHA 3KBOA 4MVJP 1I32A 3ZHBA 4YXFA 1K6XA 4CMAA 2O23A 5BT9A 2JKVA 1H2BA 2NTVA 3DEYX 2B4RO 1LDEA 3DZFA 4H15A 4O63O 5DCWA 2EW8A 3T7EA 1HDYA 5EIOA 3W8DA 3OICA 1B14A 4RZHA 1Y8RA 3UFXA 4ALMA 4J4HA 2X5KO 2VUUA 1PL7A 1SB8A 4FJ2A 4CLHA 3Q9NA 4XR4A 3TN7A 4GVXA 3DB2A 2Y93A 1XELA 4WLOA 1M75A 2Y0CA 2DTDA 4GLOA 3DZBA 4B8WA 1JLLB 3FWZA 3HDJA 5G0VA 2FPGB 2RH8A 2HMTA 2XXJA 1VL8A 2BGKA 3QVXA 4JLWA 4WECA 4ZQBA 4L76A 1HLDA 1DEHA 1PJBA 2WDZA 1C0LA 1MUUA 3WBFA 1EUDB 3AUSA 3DBLB 1AE1A 3E5RA 2FP4A 3PFFA 2QRJA 3JQBC 4RVGA 4ZICA 1EE2A 4FW8A 4EUFA 4NJMB 5TGDA 2O2SA 3KYCA 4LISA 3ONFA 2NTJA 2VWQA 2W4QA 2B4QA 3RUFA 3SVTA 5U9CA 4FFPA 1IL0A 3OHSX 1QLHA 4EUHA 4E2YA 3S2FA 3CKYA 3G1UA 4ALNA 4NPCA 1HLPA 4ZU3A 1P31A 3D64A 3RVDA 4CLRA 2NQTA 1IULA 1E7YA 4YWJA 1UDCA 2HAEA 1F12A 2C7VA 1P3DA 3ST7A 2FPPB 3AWDA 5B4UA 1NTOA 8LDHA 3TJRA 1YL5A 4RVFA 4B7UA 1FDVA 5T57A 4PZDA 1ZW1A 3G17A 5JMWA 3BZUA 1R4NA 3H9UA 5TRTA 1PJCA 3UUWA 1TA4A 1XG5A 3H9EO 4IJVA 5GZ1A 4KWIA 3FR8A 1WZIA 2Y67A 3I6QA 3I52A 2DPGA 4B3IA 4MIEA 3TFOA 1Q7BA 2Z95A 5AVOA 4W99A 1WZEA 4LN1A 3ANMA 2Q3EA 1E1MA 4DPMA 4U5QA 5FEUA 4J49A 1OFGA 4FR5A 1NFRA 1P1KA 1Q2XA 2VOEA 1LQTA 4TVOA 3K31A 3FTNA 4M1QA 1UP6A 1ENYA 4RZIA 2A9FA 4BMVA 5I9LA 2FOIA 1FDSA 4GI2A 2G1UA 1AGNA 1C0KA 4IDAA 5AXBA 3C7CB 4M8SA 1M67A 2JAPA 3FHLA 1LJ8A 1KEPA 4XR9A 2NTNA 3A4VA 3ROMA 1V9LA 2VTEA 1Y9AA 3E03A 4J4BA 5IXYA 2I9PA 4MVJE 2I76A 3TZCA 1DOHA 1OI7A 4NBWA 2PWZA 3MZ0A 3EY4A 4G65A 4CQLB 1O9BA 4J2HA 1ONPA 1ZIDA 1KEWA 4WCFB 3I9LA 1GQ2A 2PZLA 3IL2A 1UXHA 4W4TA 1Y1PA 2GZ3A 3LQFA 4MKXA 5KVCA 2QIOA 5BNTA 1EBFA 4GQAA 1A9YA 1H93A 4Z0PA 5G4KB 2GYYA 1VC2A 3BXXA 4D42A 3VKUA 4BNWA 3P19A 3JQGB 2E6UX 4MP3A 3TOZA 4I8XA 3LK7A 4MPDA 4RPJA 4GLLA 1MG5A 1T25A 4R1NA 2J3KA 2E49A 4J4TA 4WLVA 4AJNA 3GMSA 1PS9A 3E8XA 2OXIA 1U3WA 1XWFA 1ZK2A 4WCFC 2JD1A 5CG1A 3VPHA 4E5KA 2C5EA 4JK3A 1U2GA 2Y66A 2IXAA 1DIBA 1K5HA 4RL6A 1HWYA 2GRAA 3ZN2A 5CDUA 3EVNA 4NU6A 1N7GA 3F4BA 4GH5A 1HXHA 4J7UA 4D3FA 2IZZA 4PG7A 2IYPA 3AI2A 3WFIA 3G49A 3RBXA 3OIGA 3WTCA 4OKIA 1PU2A 3JD4A 4ALKA 1IE3A 3RUAA 3ZNQA 3O8QA 3WFJA 4PLVA 2DQ4A 1GL3A 4JJIA 4L9RA 4NMHA 4R5MA 4CM4A 1PGJA 4CV0A 2HMWA 4ND1A 3WGGA 5MDHA 1LLQA 1CRWG 3F47A 1F17A 3WTBA 1D7OA 4UVEA 5ENDA 1KBZA 3I9NA 2CFCA 8ADHA 1R4MB 1ZMOA 4IZIA 1N2SA 1JDJA 1NASA 3A28A 3R3SA 5JO0A 1MLDA 4GBJA 2H6EA 2C82A 3K6JA 3DBVO 3SLKA 2P5UA 1KVQA 4XYLA 4EYEA 4E5YA 2YHUA 3VH2A 4WOKA 4AJOA 4BNZA 4YT2A 1IYZA 4DREA 4PIVA 3K8ZA 1N1GA 4ZQFA 5JSFA 1P0FA 5HM8A 4K28A 1UZMA 4G5HA 3UCFA 3PEFA 4AFNA 2C59A 4ZVVA 1I0ZA 4XX0B 2BGLA 3I83A 2PNFA 4BNNA 3LLVA 1KERA 4HV4A 1I3KA 1HYHA 3RKUA 4FDAA 4AVYA 3DZIA 3C8MA 2Z1NA 3NRCA 3EVTA 3P2YA 3HNPA 4DIFA 1X0XA 3OA2A 1RWBA 3B1FA 3F1KA 4AJHA 1V6AA 2XXBA 1YQGA 3PGXA 1I01A 4OMUA 3HDQA 4YQZA 2PH5A 1I10A 2OUIA 5BNIA 3F6YA 3GVPA 4D45A 1GYQA 3LSYA 1EDOA 1NR1A 3L07A 5FI3A 3ZWOA 1WMAA 1ZK0A 3AM5A 4FPXA 2FWMX 3D3WA 3LF2A 5JPIA 1RPNA 3WNQA 3RC2A 1M66A 4YVFA 4WCFA 3EAGA 1PJ3A 4XJTA 4PFJA 4TRRA 4C4OA 4CMEC 3GAZA 4MOWA 5BSHA 1SPXA 1SBYA 3BMCB 1X15A 2J5KA 3GN2A 1V3UA 1AUPA 3PGJA 2PH3A 4BGEA 2WE8A 4CLEA 1UXKA 4IDCA 4UEOA 4N18A 1AXEA 3CEAA 2FPIB 4M49A 2UUOA 3WLFA 4IJWA 1SB9A 5G0UA 3FBTA 5LC1A 4Q39A 3MJTA 5JYDA 1IUKA 2V6BA 3KYBA 4Q3BA 2W90A 3F4LA 2O7QA 3VTZA 5A9SB 3W8FA 2FRDA 2Y68A 3NTOA 2X6TA 3GPIA 5L7TA 1LDBA 2P91A 2QZ9A 5KWEA 4R5HA 1VLLA 2XF8A 3NT5A 4CMEA 1EFKA 1XLTA 1DBVO 2BH9A 1S6YA 2DFDA 4AJJA 2PY6A 3JQ9C 4NFYA 2JFGA 4WOJA 4E31A 4LVUA 3AUTA 1NVGA 3KLMX 2I65A 4XKJA 4DL9A 1KS9A 4P22A 2AXQA 3U49A 1EUZA 1DIGA 4E5PA 3OSUA 5JAQA 1GTMA 3S2EA 1QV6A 4CV1A 4F6LA 1YL7A 1ZUD1 2Q45A 3WDSA 3RUIA 4CLOA 3W4KA 3I9MA 4OHUA 4Z9FA 3WXBA 3VPSA 1QV7A 1DAOA 4HNHA 2QYSA 5F5NA 3ZU4A 4URFA 2YFQA 1S7CA 1W4ZA 1X7GA 2EGGA 3BHIA 4J16A 2EP7A 2DAPA 4PG5A 3OH8A 4IUYA 3U62A 1CQJB 3W4IA 4YT5A 4Z3KA 1NQTA 1SOWA 4BO7A 1A9ZA 5CAEB 1HL3A 1JKJA 3N74A 5KIAA 3ZWBA 5C7LO 2J3HA 7MDHA 5L95A 4UUPA 2RCYA 4FSHA
chains in the Genus database with same CATH superfamily
4FSXA 3O8BA 3VPFA 4Y6PA 1HE2A 2QG9A 4PX5A 4YLYA 4XQ0A 2Q50A 3BDVA 4I5EA 1NZJA 3NX4A 4KWHA 3EZFA 1M8GA 1PFWA 4PHTA 4DEXA 4GKJB 3VSDA 1KBQA 1B2LA 1IEWA 4NY1A 4B2LA 4PZLA 4DDVA 1MVNA 1PZMA 3LWNA 2GWHA 4G0MA 5LUBA 1MOQA 3F6BX 4HQLA 3AF6A 3DT9A 4Y2RA 5B55A 3G5AA 1WVMA 2DKNA 2VP0A 1Y6RA 3U17A 3U7QB 4BNWA 3PDHA 1A8UA 3WLJA 4NNJA 4Q7LA 3TD9A 3AVTA 1DAPA 1MZPA 4RJLA 2R6AA 2NAFA 2WNIA 4GGOA 1P0PA 1ZJ6A 4BP8A 5ICMA 4X20A 4GYKA 1T1IA 3I58A 4OHCA 4MYHA 3JVUA 1LFDB 1M6NA 3R7SA 2V3WA 3E5MA 5D3MB 2Q9AA 1U1CA 1T8WA 1L1QA 1XXLA 2WOJA 3CMCO 3L5KA 3LHSA 4LRXA 1YRWA 2IVFA 1IEVA 4Q00A 1J4AA 4WASA 4DA6A 2WEKA 4PN7A 5EE1A 5AD1A 3V33A 1PWXA 2EATA 3RVSA 2D7DA 3PFHA 1BN7A 4D5EA 4KR6A 4RLSA 3IA7A 3NT2A 1NXXA 4YJGA 2MSCB 1PL0A 4JT2A 2YV1A 1TXGA 5H3HA 1SBZA 2H11A 2IYSA 1G2PA 4JR0A 1EUCB 3ROPA 2AYZA 1SVIA 3ENNA 3RK4A 4KRFA 4L3VA 3FFWA 4IEIA 3PFGA 2JCYA 4J3JA 2D0PB 3PQDA 4PX9A 4DCGA 2A67A 4A92A 4PTLA 2VHCA 4M55A 4M76B 1IWPB 1O89A 2BFBA 1HC7A 2O2DA 1GARA 1OASA 4II7A 3SYMA 5E9AA 1CS0B 1WIWA 3MS7A 5DI3B 3SC6A 3BB4A 3PBKA 3L8EA 5LYJB 1IHPA 2WLTA 2UYHA 2G4VA 2YC4C 2BAGA 3FI9A 4Q3EA 1Y8QB 3SHVA 3A2NA 4BLQA 5BQ5A 1UK6A 5DISB 1X7WA 5FULA 1V95A 3EHEA 4ZVMA 5D51S 5LQNA 4B32A 4ENRA 2IDJA 1W75A 3QW4B 4EG1A 4YBZA 2EV9A 2R6FA 2BGWA 1J49A 2HIMA 3HFSA 4B2PA 4XM0A 3PDIA 3BDIA 2BISA 4Z6KA 3I3OA 4EYOA 4FFVA 1BMDA 1U6JA 1P7CA 4Q9NA 4Z86A 2C92A 2VNSA 3G9XA 2BTOA 2WUWE 4LHVA 1ZU4A 3JQAA 4A1OA 2X4LA 2XNHA 3LLSA 3P9XA 3ETEA 3Q0IA 2VHEA 4ZQGA 2P9GA 1QCYA 2B6HA 1I36A 1NIPA 3HRHA 3ZLTA 4W7IA 3KZVA 3OCJA 1K66A 2G71A 3JZMA 3IILA 2FMXA 3HI6A 4ETWA 2JLSA 1ML3A 1PBTA 1ZUNB 4JKIA 2X4DA 4RMIA 1XU9A 3UOGA 5KMGA 3FNGA 1J8DA 3GFOA 2AFRA 3JS5A 4I5GA 4LWZA 4P3NA 4LGYA 1L7RA 4M0DA 1SULA 4AKEA 1AV7A 4HN9A 4J0QA 2EFEB 4YO8A 1N2ZA 4C9BA 5FBVB 4DKJA 4LDZA 1M8PA 1LVUA 3N8KA 4NTZA 4O4JB 3THRA 5JAIA 4RA9B 3KQTA 3O8DA 1I6WA 1L5SA 3LY5A 1EK5A 2LNDA 2QN1A 3OKAA 3LFUA 3RUCA 1USGA 1TMKA 1F8FA 3O4VA 4P7FA 2B5OA 2VRCD 3DLPX 4N1AA 4JP3A 4XRGA 1H4SA 3E53A 2AI2A 3GRKA 4PAQA 3ZE8A 4FD3A 3DV0A 1JWAB 1WB6A 4R3WA 1E9VA 4O3MA 4I9HA 3M5WA 5GWXA 1JPNA 3JQPA 4D43A 2AOUA 2FFJA 3KJQA 3SJAA 4QXQA 3QITA 1LLDA 2XNCA 4WWHA 4BEBA 1IHXA 2F64A 4IJKA 3LA6A 3UV3A 3ZWVA 4MVJM 5SYNA 4Q34A 4M37A 5A3SA 1BX1A 2XWSA 1WU7A 4A2CA 2RAPA 5A04A 2H1FA 1ZVJA 2L42A 5A7GA 4MRRA 3T9CA 4BFTA 1YZFA 2F8MA 4H6XA 1RKQA 3KZCA 4KHPB 1D4ZA 2I6GA 3BIWA 2IT1A 3P7MA 4QFCA 4PFKA 5E0OA 3DOIA 1EHYA 1HEUA 1XKTA 3FSEA 2DFVA 5B3JA 3W5IA 1UPAA 2I7TA 3I5MA 4BQOA 4WV3A 1RMTA 3H1EA 1Y98A 1G7CA 4GX2A 4K9SA 1M1XB 1E9DA 3TPCA 4ZGWA 3U44B 4UNRA 5LQAA 1EA7A 3IUPA 3AOEC 4RQTA 1YR7A 1CRQA 3ORYA 3RG8A 4YT8A 3P4YA 5JRDS 4MUJA 2XNDD 2XZTA 3OIDA 3PIRA 5DRYA 4AWBA 2AE1A 5FO0A 2OORC 4ZCLA 4DAOA 2H7XA 4WA8A 1RM4A 4WKPA 4EAAA 2HDOA 4B3TB 4R8MA 3ADKA 1YBHA 4M1MA 2J5BA 3OPYB 2PFKA 3DWEX 1BHJA 1U8UA 1XXHB 2H3EA 2XB8A 3HGMA 2FEAA 3KQOA 3UAXA 2E55A 4E1VA 1EZZA 4UTRA 4XD2A 3L1JA 3O31A 4MV8A 4QUAA 1TUBA 5K2OA 3RS7A 1WX1A 3ZYZA 3E5HA 1JZQA 2UV8A 5BN4A 4D0RA 3D6TB 3LYUA 5LA6F 1Z2DA 4CN9A 1GP2A 2XAAA 2JRCA 2WZDA 4NXNB 1UC8A 1QYCA 2AN9A 3NOVA 3L7KA 4FHFA 2HPHA 1OLUB 1EBUA 4UREA 1ECGA 5CW1A 4DUGA 1YTUA 1ZEJA 3TI7A 2O2JA 1Q74A 3P2JA 5H59A 1LLFA 1RWVA 1Y3CE 3H16A 3KD2A 4L4YA 5FTKA 3SDZA 5CFPA 2AZXA 1KF0A 3N1UA 1JXQA 3QBVA 5AKKA 1NG1A 3ZY2A 3AUXA 4OQDA 3O2JA 3OZEA 1XTZA 1H2XA 4TLEA 4US0R 1J25A 5CBPB 4KZPA 1A2QA 2JFHA 3EEQA 1ZK3A 3M1YA 2QIPA 4BO3A 5CDTA 1ZZGA 1HE8B 1NXWA 5BR1A 2YFHA 1VCIA 1NP6A 2H8KA 1YE8A 4PYKA 4PAMA 3WL5A 5DYYA 3W34A 1M9NA 2PKRA 4TWRA 2XYRA 4OQXA 3L0YA 2EW2A 1CR4A 1DMSA 1PSWA 5DLPA 2Q2NA 5GJVC 4HAVA 4KYUA 3HBNA 4X61A 3GDGA 4PINA 1EB9A 4WSOA 5KJEA 4KO4S 1V8ZA 2D59A 2GN6A 2Y0EA 4GKVA 5F1YA 4OI1A 2HU2A 5BOVA 2O8EB 1CERA 1HFWA 2V45A 1MW8X 1H9AA 3D3WB 1J8YF 3P2IA 4YJHA 4I81A 5ALMA 2EJUA 4CEJA 4DA9A 1BEZA 3KXLA 2KX7A 4X54A 3D54D 1K7FB 1DZIA 2CEAA 2FQQA 5U1PA 3PI6A 3KWFA 4BO9A 2F1RA 2XOKA 1YVEI 4OGKA 5LU8A 1EM8A 2H1SA 3ECCA 4QREA 4N5DA 1LPBB 1NRJB 4DLPA 3UGJA 1DQZA 3E4DA 5IYZA 1G21A 1YC5A 3PNQA 4UHFA 2QMOA 3WRXC 1EQAA 2DUUA 4Q9IA 3V32A 4RYLA 3T4PA 3USZA 1Q6ZA 1YU6A 4HQNA 4M6WA 1V6CA 5ERXA 2AZTA 4IDBA 3RS2A 5BUQA 3VDNB 1ULHA 2IYZA 2A84A 4F6RB 4IQGA 3RSGA 5JMTA 3OZBA 2YMPA 1MX5A 4XZ3A 4DR1B 3RHZA 4QBIA 4NMWA 1OAKA 4HVTA 4PCVA 1UMCA 3WGYA 3HPQA 1QTRA 2BMVA 3IEUA 1YZHA 5B1EA 1V1MB 2BRUA 1XFDA 1XP5A 2ARKA 2IY7A 3LVBA 5G0TA 4B4UA 3RSHA 2O7RA 1E2QA 2W9XA 3VC2A 1L0BA 5NLLA 5B4TA 1KO4A 4KP7A 2D1FA 2A2ZA 1Y1QA 2XD9A 1O9HA 1WLSA 2O3QA 2BYTA 1BOFA 2F1KA 3HY4A 4AYXA 2R7MA 3QVJA 3K5HA 4LBYA 5FA8A 2W2OA 4I46A 2ZIXA 3E23A 4FMCF 1FP2A 4C4TA 3FSGA 1O7JA 3H6KA 1XAGA 3QJ5A 2KB0A 3L8YA 5A9RA 3P4UA 4NJEA 4ESHA 3LPNA 1J9GA 2PXHA 3A1VA 4M3NA 9LDTA 2IS1A 1TM2A 3FHCB 4TV9F 3VPGA 3J80A 3OAAA 1Z38A 3ICEA 1QIGA 1SUEA 3QYPA 2W2QA 2UU9B 1ZIYA 5IEJA 2B0JA 3C7KA 1ZLXA 2HU8A 1VKRA 2ETVA 2B2XA 1KMCA 4HD8A 3AQIA 1LDMA 3DHNA 3Q11A 2EJWA 3NI2A 1RIFA 4QQRA 4MRAA 1UEJA 4CI9A 3GLGA 4YCBA 4O0LA 4CIBA 2XUJA 4RFSA 1RW4A 4J0CA 3P9SA 3U4CA 1A9SA 1CY1A 3CS3A 4O3FA 5TNXA 4Q3KA 3WI7A 1SY7A 5KOJB 3OQOA 3GG2A 2PBRA 3DMFA 2I5PO 4R1UA 2HCJB 4MVJD 1U81A 4U5XA 5K3OA 2AD1A 4FHZA 4ZT3A 4S1OA 4DJFC 1C2TA 1S7GA 2HDNB 2G6TA 3QYJA 4KQWA 1Z5PA 1ILWA 4FGZA 4N3AA 4ODIA 5AVKA 4QYWA 1ZGGA 4C6TB 1WB5A 2BKAA 4F3YA 4Z8YA 5KTYA 3CISA 2R8OA 2XE6A 4OHVA 2O0KA 1L5HA 3T3PB 1NN1A 4F5YA 4ZK2A 3JQBA 5JHHB 4QUKA 1ID8A 4PQEA 1YULA 4PZ9A 3FDXA 1SHJA 1UWCA 4F9TA 1AKMA 3WGQA 4LSWA 3DWGA 4C14A 4GM0A 2OD2A 2EOAA 6ABPA 3HYRA 2IHJA 5IAEA 1KI2A 5JISA 1H2YA 3CLUD 1OOEA 4W1PA 1W4CA 4LJLA 3ZGNA 4IIXA 3DKKA 4B2YA 1TJ4A 5A5VA 4DR3B 1CT9A 3E3MA 1TZBA 2CE7A 5A2QA 4YP5A 1ISPA 1RBQA 4MV6A 4GZLA 1D9XA 2POCA 2YV3A 2ZEJA 5CPBA 4BBAA 2J3JA 2GSWA 1U2PA 2X86A 2PZJA 3L6EA 3W2TA 3ZEIA 1Y1SA 3IE0A 1CSEE 1K06A 1ZJYA 3KHUA 4BP9A 4W8OA 1WWKA 5GINE 1VRCA 1RM5A 1G38A 1H3FA 2C2OA 1H5QA 2PJDA 4RL4A 4NP6A 4UMFA 3UHPA 3PS9A 3IXMA 5EP2A 5BW8A 5CEEA 5AVYA 5IN4A 1SXIA 4TV8B 2H2GA 3NASA 3NW9A 2QM7A 1ZNZA 4BPBA 2Q1WA 3HXPA 3AVPA 3FVWA 1WSBA 5LZ8A 4U02A 3VOBA 4ZXFA 2ZBPA 3SHQA 4GL4A 1F7VA 1FTNA 2YJGA 4FNAA 2WV9A 3EE6A 4X90A 3V2UA 5EJ2A 1QC5B 3FNFA 3MOSA 3C5EA 5F9MA 3TL6A 4OOFA 3ZWDA 4LF5B 5MN4A 3RYTC 4G0NA 4AS3A 2CK3A 3OI7A 2YIMA 1XX6A 3D4OA 2NM0A 2YXLA 1THZA 1U8CB 3NHLA 2Q6LA 3GIWA 3HYCA 4WFIA 5HFJA 3NNSA 4UCQA 4UMEA 2JJYA 4JAVC 2CLOB 1YS7A 1K86A 2RSLA 1VL6A 3FRHA 1S2MA 5DO9A 3RRZA 2QLNA 2AOWA 2MMGA 2WAMA 3CVJA 3S7TA 4CM9D 5KREA 3SYNA 2XCIA 3H7AA 2ASEA 4OREX 3D3NA 7ADHA 4MHTA 1G8JA 2FK8A 3D8UA 3L4BC 2YXNA 3VR2D 4D9IA 1P73A 2OHOA 2Q41A 1NF9A 1U90A 1Z33A 3SDBA 4CUZA 4IHJF 1CE8B 2NACA 4R84A 1KEVA 4ARSA 3P2OA 5KNLA 2BH2A 4MICA 1XMPA 2K5UA 3LHKA 3S5UA 3JQRA 5KDLA 5BRAA 3EG5A 1Z0IA 4CUJA 1Z4KA 4XFKA 2QF7A 3IAHA 4HGYA 3TFWA 5ILGA 3VU8A 1G8AA 4FUTA 5EZQA 1Q7TA 1Z4LA 2OVFA 3RC8A 5K3CA 4OBBA 4OH1A 1RBMA 5FBKA 3VTFA 1EB8A 2A4KA 4L16A 4Q9AA 3WSWA 2R44A 4K87A 3UH1A 3T52A 4YRSA 3EPHA 2HV9A 5D01A 4LCJA 3W79A 5CR9A 1SRQA 3HL4A 4OO3A 1EQUA 1OX4A 3NWEA 2QN7A 3GU3A 4DB2A 2QL6A 1PTJA 4JZKA 2PRIA 1BQ4A 4TS4A 4D79A 1DFIA 5BVHA 4JUDX 4R16A 1VG9B 3K20A 1S89A 3PHJA 4IGAA 2YWRA 4TMZA 4WXRA 4A0SA 3RC1A 4PF1A 4IIBA 2J3IA 2G1KA 1IEQA 3G1WA 3JQFC 1D2AA 2Z9DA 3EXG1 3AUFA 4RCYA 3C6KA 3F5FA 2G80A 1CPYA 5T6MA 3QEBZ 2PWPA 5HKKA 2A1UA 1F3OA 2A88A 3O21A 3ZE1B 1YGYA 4AZ0B 3G9UA 3MTEA 4JS0A 4WTOA 2ZTVA 4YGXB 4A6DA 3LL7A 4IOJA 4PO1A 2V7XA 1LFAA 4M83A 4YJGB 3OJFA 1USUA 2BEKA 1EFPA 4B81A 1PJRA 3MM4A 3Q8KA 3ZGXA 2YQ4A 1LX6A 1AXGA 1NV9A 1SUWA 1YRQA 1GPAA 1XZGA 2CLMB 2I3GA 2ZITA 2F43B 2QMYA 3K0CA 4IOLA 3T8YA 3TYXA 4AUEA 1VBFA 3ILXA 2BBWA 1FMFA 4I50A 4JJAA 4OQEA 3OP4A 2RHBA 1EXDA 3WKBA 5LFAA 3PTZA 2PRYA 4F4DA 2DM6A 3GEEA 3STHA 2ZFUA 5TSDA 5C53B 2J4CA 1KMQA 3O0TA 3QPUA 4XOUA 3LIIA 4KXUA 4K5QA 3Q7PA 3H19A 5EQJB 4B4DA 1NG9A 4JJFA 3WYEA 1LTKA 5EWLA 4ZYLA 1QP4A 1YUNA 1GA1A 3D7SA 1AZSC 3GY0A 1O5TA 1T0UA 5KQRA 1UADA 1KHHA 4IV0A 5K6AC 3IOMA 9ABPA 5KWVA 3B7PA 1V3VA 4HNGA 2D13A 1S9DA 1CYDA 1N5OX 1PKEA 1UT8A 2AEFA 3IDSA 4KZKA 3TLBA 2BBSA 2V8BA 4B1FA 4DHWA 5CDFA 4FUQA 4RE6A 4OP3A 4XWGA 5E6SA 1MFZA 3OF2A 2Z8XA 4X5OA 4D4MA 3EODA 3TQRA 2QVZX 4EITA 2H18A 1YCHA 5JE8A 5B6JA 4WDRA 4E6PA 4OYLA 2UXBB 4RMNA 4N5MA 1DZ3A 1C29B 3M1AA 4RSHA 1PYGA 3TM4A 3H18A 3SS9X 4AJLA 4B5LA 4CMCA 4R05A 1UL1X 1GG8A 4CCSA 1RTKA 2P9EA 4QWMA 1Q7EA 4HF7A 4E5NA 3I62A 4H0CA 1QP7A 3EXG2 3IUSA 4EAQA 2NYAA 1Y3FE 1FBNA 4GX1A 5KAPA 3TMAA 1S96A 2OHGA 5A6SB 3FWNA 2PMWB 2W0MA 2ZM5A 1NBAA 1OU0A 4WH0A 1NVAA 4N5HX 2R3SA 4IUBS 4ENVA 3WB1A 3LUFA 1OH8A 4KNWA 2GZ1A 1A4RA 1A8HA 2VI5A 3B60A 2I3ZA 3FGPA 5AJYA 2JLUA 3FZNA 2O5RA 2WHXA 4HLNA 5LDHA 3SYRA 2ZUSA 1SD2A 4IF4A 4NDAA 4R69A 5ESWA 1Z7BA 5I51A 1PT6A 2B4KA 2ZJBA 2X0DA 1CZUA 2CBZA 4X94A 1U7WA 2CXHA 2OYSA 2WYIA 1EWKA 3L0ZA 3FB4A 3ECSA 2C7GA 2Z6VA 1L4MA 1K3TA 1UZUA 3WLTA 4B8ZA 221PA 3KSZO 5J5CA 2BFDB 5GZ3A 3Q7QA 5FBWB 2NXNA 1CRZA 2J41A 3VC7A 5HG0A 1G7RA 1HE5A 1XZFA 3A70A 3PJGA 1ICIA 4YPFA 1HNWB 3CX8A 2CLFB 3OT1A 2FRVA 2RHTA 4UAGA 4ZYUA 2J07A 1T1SA 3IT1A 3KZKA 2XUIA 1MKYA 1T1JA 1EKXA 4YO7A 1QANA 1J6UA 3L7YA 2JLWA 5KNDD 1IXKA 1WP4A 1XQ6A 3NYIA 5AJUA 3MIIA 2O07A 1NE7A 4GR5A 3G2JA 1QE0A 3GFBA 4X1IB 1RIIA 2G1PA 3MQFA 1TKAA 1XZCA 1Z7EA 2WTBA 4IX1A 1OD6A 4W7SA 4F5WA 1QXSA 1BJTA 2W6QA 1A95A 1BGXT 1K97A 1DQRA 2L2QA 3AILA 5E6RB 1I7DA 2CLSA 2IE0A 5TT1A 2GNPA 5GOTA 1WCV1 2C58A 2NT4A 2OGTA 2TYSB 4HSGA 4MEBA 1GTRA 2GAJA 3M6MD 4B4OA 5JCJD 1GPLA 4HJXA 5H3LA 4DE5A 2BCGY 3C45A 2HCTA 1DXHA 5F7XA 3I2KA 3GP8A 5AO9A 1IC6A 2VPQA 2O2ZA 3MTGA 1A7JA 2Q3HA 2ZGVA 3H8WA 3TUZC 1YV9A 3MT8A 3JYPA 521PA 4REQA 1P4RA 2WA2A 2E4ZA 4DBLE 1RQ2A 4BZPA 3A04A 1XTUA 4RPCA 2HXGA 5AKJA 2VBCA 3UKJA 1EXMA 3PXDA 2I54A 4YHBA 1JG4A 1RWPA 2GJ4A 2QUBA 3NTUA 2I8CA 2R97A 3OMXA 5FUBA 3SVLA 5CCBA 3PXXA 4UEQA 4KQ6A 1P72A 2VF2A 3C6ZA 3CSDA 4TKVB 3TUJC 2QTFA 4Z4QA 1Z0SA 2UYOA 4B6FA 4W8GA 4EFNA 5JPDA 3CQ9A 4MWOA 2IWHA 4ZZIA 1PE0A 2BUCA 1LGYA 2OXTA 3FGOA 3BK7A 3S4YA 5GIPE 3IBCA 3FTCA 3Q3GE 3S28A 1K0FA 4MVJH 2X4GA 1E4VA 5HVNA 4QBHA 2IX9A 5F98A 4UBJA 1T3HA 4GMFA 4YCSA 4OEHA 3T7KA 2ADFA 2Q1XA 5JXHA 1E2EA 3EIXA 3LZ6A 4QFMA 2R1VB 1JT9A 2ZRAA 1A9PA 3U4MA 3GVHA 4WUTA 2SNIE 3U37A 4EGJA 4EHJA 1A0OA 1PL8A 1FVXA 3GCZA 1R0ZA 1D6SA 1TUIA 2CVQA 2VJKA 2V74B 4J6FA 1NT2A 2HF7A 4A03A 1D0VA 4O29A 1LI5A 3F98A 2Q27A 5EZYA 5JDIA 3DT6A 3FX2A 3DAGA 1FXWA 1YFJA 3VZBA 2Y4NA 4MINA 4QDZA 2FLKA 1Z2PX 2CNDA 4RTOA 1O97D 4BVGA 2D74A 5AVZA 4JJKA 3WLKX 1AKQA 1ZIXA 2GEBA 4EVSA 1H4QA 1NVDA 1Q5PA 1VYUA 1S02A 1LRJA 3IC5A 1BW9B 1IZ7A 2HTFA 2NXWA 4JBIA 3HFRA 1U3TA 5FR1A 3D7KA 3LUPA 1KYVA 1N2CE 4QUIA 4LPKA 4YS6A 1PFUA 3Q85A 2OHVA 1JSLA 4FNOA 1HZJA 3C3MA 5H68A 4OX9Y 1I1QB 4LYDA 1I8TA 3DFFA 4NFHA 3DEJA 3UIEA 4TT8A 3G59A 4AI6A 2ODNA 5DGHA 3H4IA 2PZGA 2QZ4A 3EFBA 3GPDG 2BFEA 5AK4A 3FYUB 1FDWA 4K2HA 4PHHA 4DYHA 2BGTA 1QRTA 4HGRA 4O5OA 3U1BA 1NDHA 1Z6QA 1BE6A 2X41A 2YHSA 2JVIA 3IAUA 4JC5A 4A9AA 3LGAA 3UAVA 1VLQA 3NDJA 4JSRA 2ZR8A 2I4NA 4YIHA 4H1VA 3I2FA 2Q2QA 1U9CA 3IMGA 2Z5VA 2Q3JA 1QQ7A 3DMDA 3VTKA 2E48A 2OBNA 5EIFA 2WWWA 1CS4C 1NJFA 2ZE6A 3ONDA 4L4ZA 4AZSA 1K4MA 2XJ4A 3SCZA 2UYCA 1N8KA 1NQOA 3BZWA 2CNWD 3N0WA 5THQA 1JYFA 4DAEA 5FUXA 4P38A 1CNEA 4JODA 2VNKA 2W98A 3IMFA 4MI3A 3OX1A 5AJTA 5HFAA 4W9RA 2XTAA 3TLMA 2JB9A 3WYDA 1EJ0A 4BNGA 2TMGA 3IGFA 1RAGA 4MK4A 5YASA 3T3NA 3GJXC 1NVEA 2Z6QA 4QZVA 5JSZB 4E14A 4Y2XA 3EA0A 3ROEA 3A1SA 4G36A 5AOBA 2NO9A 3CUWA 1XE3A 2CKMA 2GILA 2I3DA 3HKEB 3U4DA 2P40A 4L5BA 2OV8A 5IC6A 3SD7A 2QD3A 2NMVA 2QORA 1XDSA 2WVJA 1IDN1 2D5CA 1Q0SA 3QPAA 1WZNA 1XZLA 2OV1A 3B3GA 4PZUA 4B75A 3I39X 1N0IA 1U3UA 4AY5A 2R65A 4K6KA 3HUDA 4DBLC 3D1LA 2F17A 2G9ZA 3AETA 2OFXA 3MD9A 5DBIA 2FZ4A 5DNWA 5E1BA 4C7VA 4DABA 2GK3A 5I7HA 2IS4A 1V35A 4Z0NA 4ZDJA 2OMEA 4CIWA 1MTZA 1P4HA 5CCDA 5FPPA 3JATB 3LOQA 5J4YA 5JNSA 2C4MA 1QYXA 3PC4A 4J0GA 1CD5A 2J48A 4QX6A 3TW8B 2YOHA 1W35A 4A6PA 3IP7A 4LY9A 2WUFA 3OY2A 3O4GA 5C5EA 1B4DA 2GARA 2QGNA 3FCXA 4CM7A 3A9VA 1J2JA 2KLHA 3RS4A 4EGQA 2J6CA 3JAWA 5IJWA 3SQXA 1KP3A 1SBIA 3RRNA 3T41A 1E3JA 1J0XO 5FR2A 4C7MA 3MTQA 4Q5IA 3NGMA 3BWXA 1SOVA 3JU3A 4MJLA 2Y1OA 3BWYA 5FJJA 4WXPA 3ZK9A 3FPHA 1KY2A 4M1OA 3EUAA 3V7NA 4LE0A 4LFBB 1HE4A 2VEDA 1XV5A 2LP4Y 3IUEA 1ZD1A 3WLQA 3MAJA 3LXUX 3DO6A 3JTMA 3W1EA 5TGTA 4P4NA 1W25A 1LK0A 3BMNA 3BSYA 2RHCA 2FOXA 3CUEF 2GO7A 3GRPA 3IIJA 4A0RA 3R7FA 1IBMB 3RC3A 4V1CI 2MINB 1SIOA 1XC7A 5FTMA 3WKCA 4BV2A 2IKQA 3RE1A 1Q15A 4CLXA 2VYVA 3A4IA 1IZ8A 1NWHA 2W2LD 4BJHB 1ZD5A 2W2PA 1D4FA 4TUYA 3QP9A 4PC3A 4I4TA 1XROA 2H1HA 3ND5A 5HCIA 4D0GA 5JZ9A 4MQMA 1JUDA 1T9BA 1I2BA 3D6UA 1YKFA 2IS2A 2V65A 5TLSA 4ZDWA 2XKKA 3HM9A 3GZJA 3BB3A 5JEEA 2RJOA 1PUXA 2MSLA 2Y6VA 4MLDA 4RZUA 1ZN7A 2YIDA 1P8AA 2VYNA 3BBPA 3MT9A 4XB1A 4H16A 4J9UE 4YAEA 3V7YA 3JWJA 2WD8A 2YWXA 2ZRGA 1MO5A 4FKZA 3N8GA 1NM5A 2A0FA 4XQCA 3UB4A 1CC1S 3VBEA 1MO2A 3F8SA 5ES3A 4CU2A 4EW6A 2C5HA 3B89A 3DV9A 3K0HA 5I9SA 5CM2Z 2DT8A 2ZVPX 4BX3A 4G1MB 4MUFA 2GB4A 4QJ3A 3SQOA 3EXHC 1A5BB 2WIAA 1ZSYA 1NXQA 2J3QA 4YDSA 2J9XB 1RMYA 5K8LA 5SZJA 3TM5A 4GI7A 3BRCA 4MPTA 1PFVA 1W4LA 1WUKS 2BKVA 2FW9A 4U6SA 5J59A 2CGEA 3J81A 2JG3A 4GLBA 1XL0A 4OYHA 3V7FA 1ZFNA 4Y6OA 3ZOZA 3OPMA 3CT6A 2OQIA 1NJ5A 3WLNA 5IT5A 1TZKA 2HQBA 3A11A 2KS6A 3I28A 4PVDA 1U11A 1ZRHA 2D1RA 1F4LA 1EI9A 3DTNA 5K2MA 3T34A 4OQZA 2XY4A 3UV7A 4QULA 1DJNA 2VC2B 1PR4A 3GFRA 2NUAB 3TDKA 1UQTA 2WTAA 4F46A 4ATNA 2Z4SA 1UKEA 4H7KA 1XDDA 1P7PA 1KK0A 2IU4A 2O7NA 2YR0A 3AZPA 4JBYA 4JKOA 3Q41A 4LJSA 1QO7A 3LUJA 1RRPA 3HRKA 3Q0TA 3ZNOA 3RASA 1BVUA 3RJTA 4MWDA 2DHEA 2YVKA 3KUKA 3ZTWA 4R1MA 2IUEA 3E27A 3F6EX 1G8GA 3L6DA 4KN6A 3OTHA 5DK6A 1YDEA 4MA0A 2BF7A 1JZSA 4JC4A 4UEWA 2FE4A 3WBJA 5ADHA 3AU8A 2WUGA 1VM6A 1YZLA 1M76A 4IRMA 4X45A 5ELXA 4GUDA 4HJRA 2F9FA 3NORA 1NYLA 1ESDA 4PBSA 2AMFA 1BD4A 1UBCA 3AUUA 3HLYA 3QELA 4EGCB 3E9EA 2WG0A 5DYWA 1SC4A 5L45A 1KMNA 1N0WA 1BMTA 1NW7A 1UFKA 4G5YA 4NDNE 4RVUA 1L7VC 3CRW1 4BB0A 4TWAA 5BSUA 2HRBA 1U94A 4G2NA 3EIFA 4YJHB 4QPZA 3U4HA 4R6WA 5KI6A 2P6RA 5KNDH 3ONEA 1KMHA 2V9CA 1PJTA 1VJDA 1X7YB 3EVFA 5J4HA 1L5VA 5AW3A 2C04A 4Y2SA 1P2DA 3ON5A 4EG7A 4EB6B 3GUZA 4TTJA 3KVVA 1TF7A 2B69A 2A6PA 3MERA 2E7ZA 3K0KA 1OBFO 3CKKA 2A0XA 2R6JA 4W1QA 1T29A 2ZB4A 1Y8QA 4CMIA 5MFZA 2RBKA 4UOEA 3Q3CA 1S01A 2G17A 2PKQO 4IMPA 4BEVA 4WBNA 1QU2A 3THSA 5DNVA 1BWRA 5TEVA 2IWRA 1B3BA 3KSBC 3QVUA 2ZYVX 3MMXA 3GELA 3DZHA 1DO0A 3HVKA 1FQOA 1L5KA 1W30A 3K53A 3T4UA 1DKNA 3WK9A 3A1UA 4DFDA 2WVHA 1JTEA 5D5HA 3AUKA 3TE6A 5K45A 3TRIA 1GAQA 1J8QA 5AJWA 4EQ6B 1E3TA 3N6VA 4QAQA 3WK5A 3WGVA 4KV7A 5JXIA 3V8MA 1UODA 4G24A 2B21A 4KH0A 2VJQA 4ND4A 4NCAA 3RD5A 2YY7A 4FNGA 3TJZA 4BKOA 3UG7A 5A1TA 3TOCA 2PZEA 2Q3DA 1SUCA 2HK8A 4RFVA 5ICSA 3E6AA 3AB3A 2ZK7A 1UMBA 4FM9A 3PEUA 4XX0A 4N5NA 4EVQA 5KNCD 3BB1A 3JZDA 4AMBA 3RYFB 4ND7A 1X2BA 4OL0A 1EVJA 1ZI9A 4G0YA 2EKBA 4FFBA 5BSTA 3OOWA 1BWPA 3Q8LA 3LF1A 3AEKB 2F67A 3JSXA 4N4AA 1FFCA 3SQLA 3T7DA 4K40A 4OM7A 3HCRA 3W7VA 3SQDA 3GLHB 4DQDA 1UK9A 1TZMA 5CT9A 2BSXA 2PXAA 4N3NA 3HADA 2R9VA 2PRSA 4HRAA 4OLBA 2ECOA 4REQB 2Z9BA 4TV9B 4AJ4A 2FEOA 3CIFA 4TWIA 2XMGA 1YQTA 2HSDA 1C3VA 7GPBA 4CG3A 1TRKA 2LKCA 1NXSA 2ZVDA 5K8CA 3M2PA 4Q1AA 4KYVA 2NU9A 4LGCA 4UEJA 2IYNA 3AIMA 5LQDA 5B7QA 3CZAA 2REOA 1JVBA 4GM1A 1I2CA 2NU9B 2FUEA 3RQIA 3OEED 3A6PC 4ZPJA 1D2RA 1HDXA 2QTAA 1NPTO 2I99A 4QPNA 3UAYA 3I61A 2HWUA 2XB4A 3QMPA 4QTTB 1F2VA 4FONA 3BTUA 4KYIB 1CHDA 4OSOA 1E3IA 3TNLA 4PLCA 2IYOA 3OQJA 2QN8A 1ZH0A 3K8OE 1MN6A 4N3BA 5JS6A 4U6QA 4LHEA 2ASVA 3GD5A 5LMNB 1LA2A 4J94A 4NBRA 2HO4A 1YR2A 1AUQA 1NM5C 4JLBA 4BY9E 1PGOA 2NV2B 2QTVA 1NPYA 3ZWXA 1YI8A 2A14A 3OZVA 2PG3A 1C5KA 2XI4A 5BQXA 2R2GA 1P77A 2BFDA 4JB3A 1YUBA 2ZI3A 5IVIA 5CK5A 1MP0A 3QMMA 4B3GA 3C5CA 1T5BA 4FGKA 4X3OA 1SM4A 2VWHA 2ZYAA 3RVBA 2BVNA 3V34A 1N6RA 3GA5A 4Z9YA 1MXHA 1MOSA 3C98A 3E4CA 1DKLA 1SC6A 1YMQA 2FPKA 2HDWA 4CDGA 3IAFA 3R6GA 3T35A 4LZJA 3RLIA 3WK8A 3AP3A 5ELLA 1ICEA 1NUSA 3DOEA 3AKZA 4CLRB 3C1AA 4KX3A 1RNLA 2VDWA 4CQMA 5AICA 3I2YX 1YB7A 2A58A 3P26A 1IIBA 1K89A 2OD9A 1U8YA 1R0WA 3JWPA 3DG9A 3BHMA 3VPXA 5CJJA 4DNOA 5LP6F 4LWQA 3ZZ0A 1JXAA 2A86A 2DZDA 3KJGA 5L53A 3AVWA 4UQLA 4Q3NA 4UTNA 1DFGA 1JDZA 1M8KA 2BFBB 3AGPA 4MO2A 1UQRA 3EDMA 4LCEA 1J1UA 3NWBA 4BZZA 1SGWA 4AJPA 4B71A 2OHIA 3NGLA 4YUAA 5FTNA 1GA6A 1OZ0A 4GM4A 4R0NA 1KDVA 4BKQA 4OFWA 3L7CA 2WAXA 4D80A 2GR9A 1VQ1A 3K0CC 2B1RA 2H0RA 3KR2A 4WJLA 1ZR2A 1X94A 2J3LA 4D25A 1LV7A 2DY0A 2EIXA 3QKRA 4WZ6A 1VJTA 1TJNA 5K20A 1Z56C 5LVAA 2M6LA 2DQSA 4PLGA 3DLTA 2IC5A 3SYTA 3BXEA 3DDSA 3GC6A 1PIWA 4EELA 2SBTA 1NOJA 1Y81A 4PCAA 4GGPA 4FFLA 2QZPA 4MGZR 1LPOA 1JX6A 1E5LA 2NYUA 3AFIA 3B3FA 5BV8A 3VNVA 4HWSA 1FIUA 2JCVA 3CZPA 2DHQA 1TVMA 2WU1A 5FCDA 3DL4A 2VDQB 3GRCA 2V0NA 4LBWA 4Y9RA 1LU9A 4MCHA 1CEYA 4I4CA 1Y80A 2G9VA 4KXYA 4EX7A 2OWDA 1AHPA 4QOSA 1YZVA 1W85A 3ZXSA 4AKSA 4OLJA 2WFLB 2H4HA 4S24A 4UQPA 2B2NA 4M88A 1DFHA 1CF2O 3ZZUA 3NBXX 3TZLA 1Q11A 1UKZA 3CXRA 3ROKA 3ZXIA 5CVVA 4MQFA 4HLUC 3Q8MA 3THYA 3CRRA 4GPEA 2G8NA 5KJFA 2SKDA 3E2PA 3PL1A 5KVSA 5H81A 2XA9A 4IHKA 4JUAA 3D7NA 2UZ1A 3A2LA 2GKOA 2XV1A 3KLBA 3OZCA 3HA7A 3PITA 2ZE5A 5CNKA 1A1SA 3LT5A 2V6JA 1IG3A 3D1VA 4PRLA 1JMKC 4UUQA 3BK2A 3Q4GA 3ZIUA 2NZWA 3K7EA 1UAYA 3A58B 4OU5A 2ANBA 3DBHB 4ZGBA 2XGGA 1JDUA 1DTWB 3IIMA 1U31A 4DSOA 5A5EA 3V46A 2DX7A 5B58T 1XUOA 3R3UA 1PDWA 3FTQA 4BO1A 4U0KA 1C3OB 4B4VA 4DRXA 2RIPA 2WHEA 3OG9A 2H2FA 3RFXA 1U4SA 3HCPA 4ISCA 1ECBA 3EG9B 4RK4A 1YRYE 2Z5GA 1JF8A 3GFPA 1D6JA 3D1JA 3IS3A 5IDQA 3P0RA 3SF0A 2AMVA 3SXJA 1U1GA 1NMSA 4ZCRA 1IXYA 1HDEA 3EZ2A 4D5GA 1OZAA 4RTNA 3OKPA 4UM9B 3BWCA 3H83A 4RELA 4LZWA 4DGSA 4DDTA 5JQGA 4HADA 3EPRA 3HN7A 1E92A 1G20B 2VJMB 4KWTA 4HR7A 5ISMA 4X7RA 3Q5EA 5DSXA 4RFLA 3EXAA 4NENB 2H2IA 4HN4B 3FVVA 2QN6A 1OU4A 1RQGA 4FYVA 3T38A 1KZ4A 3OMLA 3T1HB 4HDRA 2D1SA 1T9HA 3Q7IA 4ZEWA 4Y9DA 5CFOA 1E1YA 2CLHB 1S4MA 3ENWA 1ZOLA 4JBGA 4MYUA 5AW5A 1D8TA 3RF6A 3RVQA 3TTSA 5BN3B 2UYYA 1KKLA 2VAPA 2OBYA 1EFVB 1QCCA 1K1EA 4FYKA 2YVAA 2CNWA 3WSTA 1YIDA 4LOIA 4G1VA 1BCRB 4F3TA 2YXEA 4UZEA 5BSKA 5K0CA 2FN3A 2CCGA 1Z3IX 4EDFA 5KYGA 2CXPA 2R84A 1VIMA 1XTPA 4KCGA 5TVKA 5BP7A 4MSUA 1H2HA 1MAHA 2JC3A 1HT3A 4IHJB 5DASA 4FC7A 4JY7A 3H9GA 3WMEA 1HURA 1N2OA 4LZZA 2ZSBA 2QJWA 5K0GA 5KWJA 1DC3A 1T5OA 4KQ2A 5DB4A 2RGGA 2QUJA 3O4HA 4ONEA 3HE3A 1V8FA 4D99A 5DMHA 4UTPA 4FIDA 1ODLA 4D0SA 2PCLA 4FCCA 1CNFA 3ZU5A 1NY6A 1BFKA 4OXKA 5ECWA 4LOJA 4WIAA 1B3RA 5JSKA 1L7NA 3QVSA 2PTGA 2BGMA 2HA5A 2IXDA 4QGAA 2QX9A 1AC5A 1XMIA 621PA 1KSHA 4D9FA 5K5EA 2VHUA 3QX7A 3FBWA 4Q4JB 5KNBD 1NBME 2ZBRA 3L79A 3A6ZA 3CH6A 5C4MA 2C9BA 3TKAA 5FNVB 4UXIA 2HF8A 2JARA 4B6OA 1S8NA 2GKSA 3E35A 2VKQA 2XD4A 2PX2A 4H4DA 1CQPA 4YC7A 5EUQB 1KVRA 4S05A 3FUUA 1U0FA 1GUAA 3PQ8A 5TF0A 4RJJA 1KYWA 2ZYUX 4PEVA 1NW6A 4PYMA 1DKPA 4FEEA 3JARA 1PTJC 2I66A 5E38A 3UMVA 1FE8A 4XDYA 5BURA 2UZ3A 3EEOA 1JG7A 1L4YA 4UEKA 3RHSA 4R9NA 4Z51A 3ZHRA 3CV3A 4OB8A 4N7MA 3SF8B 3HJUA 3GAFA 2WUDA 5GV7A 2FZVA 4B4WA 2G88A 3LA8A 3OFVA 4EJ6A 1P0QA 1U9JA 5G3ZA 2ODWA 2VDNB 2YOGA 1ISFA 3MQ4A 4G1UC 2QR5A 4CKBB 1LC3A 1Y6JA 3HJBA 3P9ZA 4LKRA 5AKGA 4MWGA 3VZDA 2JA2A 1KP9A 1GY8A 4CT4B 4EI9A 4XLZA 3E1SA 2OV3A 5GADl 3HLKA 5K0TA 1NRWA 1XZBA 2BELA 3K9LA 4MYRA 2MYUA 5E8JA 1TK9A 3CCFA 2G09A 2GUGA 3AETB 3ETJA 1IG0A 2FEPA 2WM9B 3AY3A