4H7KA

Crystal structure of haloalkane dehalogenase linb i253m mutant from sphingobium sp. mi1205
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
294
structure length
294
Chain Sequence
b'SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYTYAEHRDYLDALWEALDLGDRVVLVVHDWGSVLGFDWARRHRERVQGIAYMEAVTMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGHLTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
molecule tags Hydrolase
source organism Sphingobium
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
total genus 114
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h7kA00
5ALWA 3DOIA 2C0PA 2WU3A 5KREA 4FFWA 5AKGA 1ODCA 1AURA 2WUFA 4LIPD 5JIBA 3PI6A 4FHZA 1C7IA 4FTWA 1DT5A 1U8EA 2CZQA 3L1IA 2XMGA 3EQ9A 4G4GA 3K9BA 5FXMA 4UFNA 3ESAA 2DSNA 1B6GA 3C87A 4L9AA 4B0OA 1H2WA 1VXRA 3ZLVA 4TPKA 3L1JA 3EQ8A 2WHPA 1L7RA 4M0EA 4CFSA 4BRSA 1QIMA 4JYPA 1R9NA 2HA4A 3E4DA 3H0CA 1MX1A 1OXMA 1BCRA 4N5IX 2OAEA 2O2IA 2PSJA 1QIIA 4A5SA 2XUHA 1M33A 3O4HA 2WIDA 3MUNA 4UUQA 4GBGA 1QTRA 1K6EA 5EHNA 4AZ0A 3LS2A 3STXA 1GQSA 1WPXA 3I28A 1FFDA 2JIDA 5AK3A 1AX9A 1JJFA 5LZ7A 4Y2YA 3M82A 1AGYA 1H2XA 1XZKA 1CPYA 3AIOA 3F67A 1WHSA 1CUJA 5E4YA 6YASA 1CQZA 1LZLA 1QONA 2VJCA 5HZGA 1LBSA 2HA3A 1XKTA 3M3DA 4J0JA 2XUFA 4PF1A 3PDCA 3R3WA 2ZJFA 1Q0RA 5T4HA 1F0PA 1A88A 3T4UA 3U0VA 2HA5A 3AUKA 4C6HA 5A62A 2H7CA 5LZ4A 2VTVA 4INZA 4HVTA 1QIJA 3WWEA 1DQYA 1EVQA 4S0XA 4UBMA 2PSHA 5AKIA 1W75A 4OB8A 3BJMA 1MT3A 1HLGA 2JEYA 4DSZA 4Q82A 4WDRA 5K3CA 5CXXA 4GXNA 5ISMA 3PF8A 2HADA 2QXTA 4XIIA 3MGAA 4WFIA 4H7DA 5E4TA 1BEZA 1A8QA 3H2JA 2Z3ZA 3S2ZA 1MU0A 5LLSA 5IVDA 1LPOA 5ALGA 1USWA 5JD5A 3WL5A 5D3KA 4QEKA 2PSEA 1TCAA 1WPRA 4QNNA 5CH3A 1CUXA 2Z8XA 1GGVA 3E0XA 4M0FA 4FBMA 3WK8A 3NWOA 2J4CA 2VF2A 3FVTA 3JW8A 4D9JA 5ALDA 1VJ5A 4OB6A 5SYMA 4JYMA 4BE4A 3PF9A 1ZD2P 1UKAA 1MNQA 3ZV7A 3WZMA 5ALSA 1W52X 2V9ZA 3DDUA 4CI9A 4X85A 4OYYA 1UFOA 4MQLA 3WK5A 3ANTA 3K2IA 3C6YA 4FMPA 1WB4A 3AZQA 1XLVA 3VVMA 3I2FA 2WQZA 5IVIA 5DNUA 3VXKA 1CLEA 2HIHA 1MX5A 3G02A 1JJIA 5AKEA 5E4JA 3W04A 5C7YA 1N5RA 1SCKA 4Y2RA 3IIIA 2W6CX 2WIGA 2HHAA 1DT3A 1FFAA 4B85A 3G9ZA 3OURA 3PFBA 3H2GA 5JATA 1Q84A 4G8DA 5D7BA 2CB9A 2GBGA 2RI6A 3C43A 3A2NA 2Z8ZA 5LKRA 1UZAA 2PSFA 1XLWA 2BAGA 2QKYA 3WWOA 4H7EA 2C4HA 4Y2XA 4HZGA 4Q3KA 5HF9A 4DIUA 3DYVA 4MEAA 5ALUA 3QPCA 5DNVA 2DCMA 4CCYA 1QIEA 2GZRA 1TCBA 1DQZA 1TRHA 4GHWA 1HQDA 1CV2A 2J3DA 2QT9A 5A6VA 2XLCA 4MEBA 1EVEA 3IDAA 2ZYHA 5JZBA 4H7FA 1XRMA 3JWEA 3DOHA 2RONA 1VA5A 1XKLA 3RARA 1LPNA 3UMJA 4C88A 3KOOA 5ALZA 3BDIA 4TVKA 4B0PA 4CCYB 3D2CA 1W4LA 3WWCA 2VT6A 3I1IA 3FYUA 4C4ZA 2JGJA 2QJRA 2C5GA 4X6XA 3IA2A 4B6GA 4OCZA 4BAZA 1EK2A 4Y9SA 3BF7A 4BZZA 1XZCA 4NZZA 4OU4A 5AM3A 1CVLA 5AHXA 2H1IA 2ONCA 3A70A 1MTZA 5AK5A 3RK4A 4ZWNA 4E14A 4BRZA 4EY7A 3R41A 5CT4A 4W1QA 3C70A 1JU3A 4J0IA 3U1TA 2JEZA 1AUOA 2HU5A 4IQ4A 4GECA 1QFSA 2X76A 4Y2QA 5YASA 4HXFB 4B9AA 1A7UA 1HL7A 5FOQA 1YAHA 4BTVA 4MXDA 1MN6A 1YB7A 3H2KA 1R9MA 4HRYA 4H7HA 2XMQA 4ZI5A 2ECFA 5CMLA 1QE3A 4IH9A 1UOOA 5DTIA 2BFNA 2OQIA 2GYUA 5C8VA 3STUA 1SCQA 1TIBA 5IVHA 1CRLA 2VJDA 4K6GA 1R50A 4WDQA 1ZJ4A 4K6HA 2QOEA 3G9TA 4GDMA 5JYCA 1LZKA 2OLEA 4KE6A 3G0CA 3C8HA 3FYUC 4G5XA 4NVRA 5DWDA 4KE9A 4B81A 2XQKA 1DWPA 1EXWA 4AMYA 4HAIA 2PU7A 1IUNA 2IIVA 1YS1X 4X97A 2QUBA 1A8SA 2WLSA 1TAHA 4KE8A 1DINA 3TJMA 1X2BA 4H77A 3O4GA 1QO9A 1XZLA 1XZGA 5BWBA 2HDWA 3STTA 1VE7A 4BP9A 2XLBA 2YYSA 4K5QA 4LYEA 1WB5A 3H2HA 3PUHA 5DJ5A 2K2QB 3WIBA 3FSGA 4KRXA 4DMHA 1SOMA 4BCDA 2Y2UA 2OPHA 4X95A 1QIKA 2HM7A 3G9UA 3D4LA 1ZGCA 1F8UA 3DJYA 2QMQA 1QZ3A 1W6RA 5HF8A 4P08A 3IVMA 3VISA 3I6MA 2WTMA 4BYMA 3PFCA 1XZMA 1FSSA 4LXGA 2XUDA 3HACA 1MPXA 3W9UA 1IUOA 2GBFA 3BWXA 4AQDA 5ALJA 3HABA 3LP5A 3W05A 4MWTA 4BBZA 4BAGA 1U4NA 2BCEA 4I3FA 2JBWA 4W1SA 3X3HA 5FDFA 1P0IA 1F0NA 3HEAA 4RNCA 3WQHA 5JD4A 3ZPXA 2J3QA 2XUAA 2JGMA 3WA6A 4XX1A 4QDOA 3FYUB 2Z3WA 2ROQA 2ZJ7A 4X93A 1LBTA 3W06A 2XQFA 1RP1A 3DL7A 3ICWA 4I19A 3ANSA 3LIIA 1DX4A 5ALMA 4J0DA 2O7RA 4YPVA 1DWQA 5HF6A 4DTCA 1GPKA 2RHWA 3O4IA 3AINA 1UXOA 4WFKA 1ODSA 3IULA 1XQYA 1XZIA 2JGLA 1BN7A 3F98A 3G0GA 4KAJA 3KD2A 4G9EA 2WU4A 1CUCA 2HA6A 1CUAA 4UBNA 4BTLA 1CUHA 1J2EA 4C01A 3NGMA 1MJ5A 1MNAA 4PV7A 3I2KA 2WIKA 3QMWA 1ZD3A 1TQHA 4NMWA 1KEZA 3FYTA 2RGUA 1XROA 3BE8A 1IMJA 4H7JA 2W22A 5ALTA 3KWFA 5FRDA 2ZJ6A 5FP0A 3UUFA 1HPLA 3BL8A 4ZV7A 2WJ4A 1VXOA 5AKKA 5I7UA 3R3VA 4BDSA 1WB6A 3V1KA 1XZAA 2D5LA 4EA6A 3QBJA 1XZFA 1K4YA 1T2NA 2P8SA 2WFZA 1F6WA 1CIJA 3O95A 1X70A 3AJAA 5F4ZA 3H17A 4RGYA 4Z49A 2RIPA 5ALQA 3AIMA 3VJMA 3FLAA 3OOSA 4RE5A 7YASA 2YXPX 2JGIA 2OXEA 3AZOA 2WFMA 2I78A 1W76A 4WFJA 2DFPA 3AILA 1P0QA 2EEPA 3WKCA 4BAUA 2RHTA 1G4HA 4BVJA 3WYDA 4ROTA 3ICVA 1OILA 3I1YA 5AI6A 4OU5A 5K5EA 2DHCA 2OCIA 3N2ZB 4U2EA 4AZ3A 4U2FA 4QZVA 1VZ2A 4Y2SA 4EHBA 3MUOA 2XMRA 3A2LA 4X71A 5HFNA 5JAOA 1CFJA 3V1NA 1CUBA 2WUGA 3HI4A 5LZ5A 2XUGA 4FLEA 1AKNA 2O7VA 2WUDA 3GA7A 3ED1A 2C5FA 1QTIA 2HFJA 2HA0A 4ARAA 3C6XA 3DYIA 1WHTA 4YASA 4AX4A 2FUKA 1BU8A 5I8PA 4MJ3A 4RPCA 4B83A 3I2JA 4O08A 4BCCA 1YA4A 3VVLA 5IKXA 3WK9A 2H9YA 5CW2A 4UBJA 3QM1A 3WKAA 1BRTA 4DM7A 1AQLA 2LIPA 2OAGA 1TK3A 4MWSA 4X6UA 5EHQA 5AOAA 1LPAB 4Q3OA 1ZJ5A 1MAAA 2XMCA 4M0MA 5T4FA 1IVYA 3WKBA 3R3ZA 5BOVA 4HTAA 5E2IA 4GLBA 4ZREA 2Y1KA 1N5MA 3F96A 2YH2A 3H18A 3OC0A 4B9EA 2ES4A 2VEOA 1XRNA 3HXKA 1B41A 4UBOA 3WIOA 2V96A 1KU6A 3SX4A 2J4FA 1WCYA 2B4KA 4PSDA 3WMRA 3STYA 2ZVDA 4MQMA 1JFRA 4CIBA 5AK6A 2XQGA 5ALLA 1CUDA 1SC9A 2WG1A 3DKKA 4UBKA 3D2AA 1EX9A 3E3AA 4FOLA 2WHQA 4KAAA 1TKRA 4JH0A 5FPPA 1YB6A 2ACEA 3BXPA 2PM8A 2QXUA 2E3JA 4EY4A 2BGNA 1BEEA 5AJHA 4AN0A 4F21A 3G7NA 5CT9A 4H7IA 4L0CA 1XRRA 5HK8A 4V2IA 5JALA 4QDTA 2XUKA 1THGA 4J7AA 1E8NA 5ALKA 3D2BA 4UHHA 5LZ2A 1FJ2A 1E89A 1UKCA 1CUVA 1EDBA 4AN1A 3BDVA 4QA9A 1YASA 1UT6A 5I9IA 5K3BA 4G9GA 4LYDA 1LPMA 2YASA 3G0DA 3CCBA 4BC0A 1Y37A 3D0KA 3FCYA 4DNOA 4H35A 4BATA 1EB9A 4HXGA 2XMBA 2WUEA 4WJLA 3IUJA 1CUYA 5EIAA 1EHYA 1XQVA 4DSAA 1Q0ZA 5HCUA 1ZICA 4YX9A 1GZ7A 5EIEA 4U2BA 2XUIA 4AO6A 5J3JA 1BS9A 2Z5GA 1QJ4A 3STVA 2QR5A 1MAHA 4CG1A 3SC2A 5HKAA 4PO3X 1UKBA 3A2MA 1MO2A 5CBKA 5JASA 4F5ZA 4A23A 4EY6A 5AM0A 1XQWA 3G8YA 5HK9A 5JADA 1H22A 4UHEA 1PFQA 1ZIXA 3DS8A 3QMVA 4XWGA 5FPQA 4GEGA 2JGEA 2Y6VA 4DLNA 3B3QA 3V9AA 5JANA 3RM3A 5K3DA 4PSCA 3FWHA 2VA9A 4OSEA 3R3UA 5DYWA 2JGFA 3PE6A 1Z68A 1P0PA 4PQEA 1XRLA 1L7AA 2DQZA 4CG3A 4BVKA 4UHBA 5AIAA 2PU5A 2WM2A 4Y2JA 5HFAA 2DHEA 1ZGBA 1CEXA 4LXIA 4DGQA 3ILSA 4GW3A 1WOMA 3WK4A 1ZI8A 4JUIA 4P93A 5AKXA 1R1DA 3HC7A 4L72A 1ZI6A 3NUZA 3WK6A 2ZSHA 5JZ9A 3PUIA 3L1HA 5H3HA 4AO8A 5KBYA 3QMMA 1U65A 2CMFA 3D7RA 4G4JA 5C8ZA 1G66A 3WL7A 1LLFA 1JMKC 5JAUA 3W9BA 3C8DA 3O4JA 1XZEA 1GPNA 5D3ZA 1K5PA 5AKHA 5CURA 1HDEA 2HRQA 1I6WA 2XUJA 2V98A 2GYWA 5T4BA 2GZSA 4JEIA 1IUPA 3D59A 1H2YA 4LXHA 1HKHA 5LKAA 3H2IA 3VKFA 3DKRA 5DYTA 3QH4A 1PJAA 3E1GA 2OG1A 5AKLA 2G63A 4WCVA 3JYHA 4QDXA 5AI8A 4X92A 1CQWA 1E3QA 2VJAA 1GKLA 2B9VA 2O2GA 3F97A 3EBLA 2XT0A 1RWQA 1ZD4A 1CUIA 1CUSA 4J03A 3AZPA 4EY5A 4BE9A 1N8SA 1FFCA 1UOQA 3OTQA 2QUAA 4KE7A 4LHEA 1LPSA 5EIHA 3EQ7A 2OCKA 4FLMA 2OCLA 1EI9A 4FNGA 4YK7A 3WWDA 5AK4A 1JT2A 1R4ZA 2ZYRA 5A7GA 4Q34A 5CH5A 1H23A 1H2ZA 4DMKA 1N1MA 2QZPA 1XRQA 3R3YA 3SWWA 3AIKA 3R3XA 1E66A 1DU4A 2I3ZA 3KXPA 3LLCA 4FWBA 2OGSA 2VATA 4AXBA 5EFZA 3M83A 1UK9A 4X90A 3TEJA 1XZBA 5EI5A 4GI1A 1ZD5A 3KSRA 5FLKA 2B20A 2PX6A 4H0CA 3WKEA 5DLPA 3HZOA 4DNFA 4U2GA 4CIAA 3HYSA 2EDCA 4CG2A 2WJ6A 2CUTA 3SK0A 3P2MA 4P9NA 4EUSA 3DLTA 1VLQA 3ZLTA 4N8DA 2ZYSA 4J3JA 4QLAA 1A8UA 3WYNA 1THTA 1UK6A 1TCCA 1G5FA 3FBWA 4HRXA 5ALPA 1JKMA 2G5PA 1YAJA 3B5EA 2BGRA 4OB7A 1J07A 3WLAA 1LNSA 4WY5A 4KACA 5CTAA 3VDXA 1JI3A 2X5XA 4BC1A 2OGZA 3FAKA 4IH1A 3DL4A 4RE6A 4J0GA 1XFDA 4Y2TA 1FFBA 3I2GA 5LP1A 3G9XA 1VOTA 4QLOA 3O0DA 2HRRA 1GQRA 2OCGA 4I4CA 3B12A 1C7JA 3WI7A 5AIBA 4FLFA 4FFVA 1T4MA 5D6OA 5JARA 2H7XA 4FKBA 3UUEA 2PPLA 5SYNA 1HBJA 4NS4A 2CJPA 3GBSA 1CUZA 1XQXA 2QJWA 2NW6A 3IUMA 5K3AA 3IUQA 1XZJA 3KDAA 1EH5A 1DWOA 5DYYA 4Q3LA 4B80A 1Y7HA 5K3FA 4KJXA 2I3DA 4Y2UA 4UHCA 3C5WP 1E8DA 3QZUA 4UBLA 3RKSA 4DMCA 4X94A 2DHDA 4BVLA 1CUEA 1JJBA 3GROA 2JGKA 4B82A 1MX9A 5A71A 5ALEA 4UFOA 3O9VA 1Y7IA 3DCNA 4QWMA 3WL6A 3QITA 3OM8A 1QOZA 4W9RA 5JAPA 4FDMA 1BN6A 2VAVA 1QO7A 2IITA 2WKWA 5EHZA 3I2HA 1ETHA 4EB0A 1JU4A 1S8OA 3BF8A 4B84A 3OPMA 2Q0XA 3R0VA 1NX9A 2Y2VA 3TRDA 3KWJA 5FV4A 2ZSIA 3STWA 4GWLA 1EA5A 3ZI7A 2XMDA 1AZWA 2WFLA 2BJHA 4OUKX 1E5TA 4E11A 4PNZA 1QIHA 5ALYA 1JMYA 2FJPA 5FKJA 4IHAA 5ALFA 2EDAA 4KAFA 5ALRA 3WK7A 2GYVA 4UPDA 1EB8A 3QPDA 3EIOA 1YSCA 4OPMA 2HL6A 3FNBA 2WTNA 2XMZA 3DEAA 5AH0A 3Q8WA 3HRHA 4HS9A 3TGLA 5FUMA 4FBLA 3WA7A 1BCSA 3I2IA 2VSQA 1CUWA 1XZDA 1DX6A 4AB1A 1R88A 1EDEA 4X00A 4C89A 1VA4A 2WFLB 2BUAA 3V1LA 5CT5A 3VJKA 1EDDA 4X7BA 1BE0A 2ACKA 4KYVA 5AM5A 4C4XA 1GPLA 4UBIA 1IZ8A 5LIPA 3WL8A 3D5EA 1VKHA 4U2DA 4J0HA 2ZYIA 2GBIA 4N8SA 1BROA 4G1FA 1CR6A 1ZIYA 2G4LA 1D07A 1UK8A 1GKKA 1EINA 3N0TA 4DYHA 1J06A 2QVBA 3GFFA 4BP8A 5EHXA 3DQZA 3C45A 1YR2A 4G8BA 4Y2PA 1ACJA 3CCCA 1ZOIA 3WWPA 4K6KA 5AKZA 2HU8A 5ALOA 1R3DA 3K6KA 2XB6A 4E15A 1UK7A 4ETWA 4KEAA 1EK1A 4PW0A 2VAXA 2WIFA 2R8BA 1O6FA 3LCRA 1ACLA 2WG0A 2XI4A 5ALVA 2OGTA 4PSUA 3Q0TA 3FOBA 3H1AA 3I6ZA 5HQ3B 5AOCA 3GUUA 5CH8A 1ODTC 3F8SA 4Y2VA 3IBTA 1QLWA 4Y7DA 4Q1VA 4EY8A 1CUUA 3V1MA 4UHDA 4BZWA 4E46A 3BIWA 3CN7A 4B7ZA 1IZ7A 1UWCA 3QVMA 4ITVA 5AI5A 3ZWQA 3S8YA 2R11A 4DMFA 1AMNA 4K2AA 4JNCA 1L7QA 5CRIA 2C0QA 3G0IA 3IB3A 2BKLA 4QDUA 3R40A 1XLUA 4X3CA 3A6ZA 2RAUA 4LKOA 2QS9A 3IURA 5ALHA 2XUPA 2UZ0A 4C4YA 4IH4A 2XDWA 5IH7A 4N5HX 5AI9A 5C81A 5ALXA 3HLKA 1O6GA 3H04A 3FVRA 5ALNA 3C6BA 1XZHA 1LPBB 5A7HA 1GT6A 3LIPA 1K8QA 5K3FB 4W1PA 2O2HA 2WHPB 3QPAA 3FLEA 1QIDA 4TGLA 5ALIA 2AJ8A 3BJRA 5HKBA 4ARBA 3WJ1A 5AO9A 5K3EA 1YCDA 1LPPA 2WIJA 4X6YA 4CCWA 3AFIA 2FX5A 4P92A 5AI4A 3C5VA 5AM4A 2BUCA 3FSGD 3QYJA 1ORVA 3HJUA 2HU7A 2CEKA 2CKMA 1G42A 1W1IA 5AICA 4KR0A 4QE3A 5A2GA 5HQ3A 5AKYA 2PL5A 4XJVA 1AC5A 1NU8A 5KWIA 4WY8A 4A16A 3WZLA 1C4XA 2PUJA 3WJ2A 3OG9A 3T52A 3G0BA 2DR0A 2WJ3A 1FFEA 4U2CA 2AXEA 5EGNA 2C58A 4H18A 2FJ0A 5CXUA 5ESRA 4UFPA 3DD5A 3EF3A 4L3WA 5DNWA 2PSDA 2WHRA 3H19A 2JF0A 1K63A 4AO7A 4F60A 1KU0A 2HFKA 3FCXA 5JZSA 4HXEB 4EZIA 4FNMA 1QFMA 2XUOA 5BWCA 1VE6A 5IVKA 2GBCA 1ZI9A 4QDZA 4Q05A 2AJLI 1UOPA 4OD0A 2HA7A 1PV1A 3ZLUA 1SFRA 2XQJA 5AP9A 3PICA 2DQYA 5LZ9A 1YS2X 3ESBA 5HF5A 1WM1A 4BCBA 2IX9A 3V48A 4QWWA 3I6YA 2ORYA 5LZ8A 2OQVA 4ZGBA 3H1BA 3GZJA 1ORWA 1NU6A 4BDTA 4J0CA 1J1IA 4X91A 2XUQA 2VT7A 2CBGA 1E8MA 2AJCA 2PBLA 3HSSA 1YA8A 4W63A 1ISPA 5DTJA 4DNQA 4J0KA 5JD6A 5AKJA 3DNMA 3CN9A 2XMSA 3ESCA 3WKDA 3W2TA 4IO0A 5CT6A 4EBBA 3ESDA 1Q83A 2I03A 2C7BA 5JAHA 2D0DA 3BIXA 5BV7A 2X8BA 2QTBA 2PVSA 1RYYA 2AJDA 2B61A 4ZRDA 4F0JA 1P0MA 2V97A 3YASA 2QM0A 1LGYA 4N8EA 1X2EA 4UHFA 3O9MA 4ZXFA 2VQ6A 2WG2A 2H7YA 1SCIA 2PKYX 2QRUA 2AJBA 4G8CA 4G4IA 4BB0A 3GELA 5C8XA 5AOBA 2WILA 2XQIA 4W1RA 3RLIA 2G5TA 3NOXA 4KRYA 1QGED 5KWJA 1U2EA 2VJBA 3F9CA 2HA2A 5A7FA 4XVCA 3IUNA 1QIFA 4ZV9A 1GXSA 1QIGA 1DTEA 5AI0A 4MYSA 4C87A 4AMZA 4DNPA 3M81A 3CXUA 3D3NA 4OYLA 2XE4A 5AM1A 3MVEA 5T4EA 1CUGA 2WSLA 1OCEA 1VZ3A 2Y6UA 1XRPA 5AM2A 1CUFA 5CT8A 3FLBA 4MYDA 2PUHA 5LYYA 3VJLA 2BUBA 3C6ZA 4H7KA
chains in the Genus database with same CATH superfamily
3L7MA 1JIKA 5ALWA 4XQ0A 1IWOA 1E9CA 2C0PA 2XWQA 2ZJ8A 1U1GA 4YJ2F 1X39A 4EKYA 5INTA 5CDTA 4U2KA 5EG5A 3FJOA 5JROA 1GNTA 4JB2A 4EGAA 1SPBS 5AKGA 4LG1A 4GYKA 3UJ8A 1AURA 3G2HA 1KSGA 1FNNA 4LIPD 1QPBA 1T5LA 2QLMA 3FKSD 3GFBA 5DFAA 1EBFA 1NPTO 3LGXA 1YJXA 5HQTA 1XMXA 2Z56A 1QNLA 2OZKA 4FP9A 4F97A 3PT5A 4R3NA 1NXQA 5C1BA 5ERXA 1U8EA 3GLIE 2WDZA 3A1TA 3GMTA 3LP6A 1T6XA 4FDVA 4L2IB 2V7GA 2XMGA 3WLRA 1SVWA 4M89A 3EQ9A 5CA0F 3PNBA 3KLMX 4DUPA 2F3UA 1L4UA 2ZWMA 3BH6A 3T8YA 1BGWA 1Y7LA 2VPYA 2E2WA 1ONBA 3L4EA 2BM8A 2CBXA 5FNVF 1P7WA 3THWB 3A1VA 2NU7A 1Z82A 1K6XA 5A5DA 5JMWA 4JITA 2DH5A 3EVTA 4LEIA 5FL7D 3ROQA 2GVDC 1XJ5A 3KIPA 3UWOA 4L9AA 2FWNA 5AD1A 2V3CC 3DOEA 4C4RA 5KKNB 3RSQA 4C2BA 4CCSA 3ZOKA 3CVUA 1L5FA 1ECPA 1RAIA 4MUYA 2I2WA 1VXRA 3OCUA 1D09A 4NU0A 4MQBA 1M2KA 2P4HX 3DE0X 1UJ4A 4RZSA 1OH8A 3MS4A 3BG5A 2WHPA 3LY5A 3GGSA 3L7BA 1QRTA 2REOA 3DZCA 4L6AA 1E2LA 1RTKA 2C4KA 3NUQA 2ZUDA 4I66A 3P1JA 2I2XB 3WGTA 1R0WA 2I4RA 3ABSB 3J7AC 2ZDGA 4YRTA 2IXAA 2A94A 4JYPA 4BQSA 3M9XA 1R9NA 3A1WA 4II3A 3E4DA 5DYGA 2FEPA 3BL6A 1MA0A 1WY5A 4KUEA 4R8KA 1E2IA 1EVJA 2B4YA 1QGUB 3NHMA 5EPOA 4YJ2A 4FFNA 1FTGA 1K8ZB 4XDHA 1BCRA 2HSJA 1N9GB 5ECDA 4JL5A 4BBJA 5CUQA 1MABB 1NM5C 2ODTX 2PSJA 4MZXA 2P90A 1OQAA 4W4TA 2D7DA 1M33A 1NQ5A 2ZANA 3QKWA 4ARUA 2X9GA 1SEVA 1E1RD 3NBQA 4TSFD 1QZUA 3QLJA 2DQKA 3P8ZA 4IFEA 5JY1A 3GWZA 1ZUIA 2Q49A 1COZA 2UVDA 3ENZA 3VSEA 4TS9A 5TS3A 1K6JA 3STXA 5KOHA 4JI4B 4K9QA 1R7RA 3RAGA 1JJFA 2B92A 1EVYA 1CD5A 1X80A 2QX8A 3DLPX 1A9ZA 4KKVA 4RMNA 3DLBA 3IBCA 1KAOA 2IOHA 1NC1A 2GVZC 3D1VA 2QRPA 1H2XA 1TD9A 3GLHA 3HVIA 3LA6A 3QIAA 3ZZUA 5EL0A 5H4HA 1HG0A 3ML1A 4EITA 2FPPA 4LX8A 2WRZA 1SCUB 4K9MA 4WA7A 1SXQA 1U0TA 2YWHA 2AZMA 2ZR8A 1MAWA 2ZWOA 3EY4A 4L4ZA 3DT8A 2E49A 4BGEA 2QTZA 1U7TA 5FPYA 4N5LA 3IQWA 4RPJA 3WNBA 4F3KA 2GFHA 1M3SA 1JR2A 4JT4A 4QHYA 5L3SB 1HEYA 5TS2A 5C7IO 2E85A 2PMCA 3GPIA 1ZGJA 2R8PA 3NC1C 4XCQA 5JH7B 2QZJA 1CQZA 1X1DA 2C5SA 4E7OA 1X1BA 2XWSA 1H9BA 1G1AA 4G9BA 3CNNA 2GZDA 4RU1A 1OTXA 2ZTSA 1LBSA 2BSQA 5ARBA 2RGNC 2MR6A 3C41J 4YMHA 4HDNA 1G20A 3ZJ4A 4B71A 1T0IA 1CRZA 1Q15A 4CM8B 3PDCA 5FNVA 3TB4A 3SXUB 1CJTC 1S96A 2B36A 4AJ4A 2BFMA 4DLXA 1E1CA 3RV3A 1FQWA 4ABTA 1T6NA 1E1RA 5T4HA 2Q1XA 4ID9A 1F0PA 1ND6A 1TLLA 1Y3FE 2F4NA 3H2BA 3LNCA 3NWBA 1A88A 3TFOA 1DCMA 3T4UA 1HOTA 2B35A 1QCZA 1KPIA 1RWKA 1S3FA 5GPBA 4ZHQB 1Q6ZA 3ADBA 3TSZA 2HSWA 4Q7EA 3V8PA 4KXVA 3HO8A 3CEHA 4B7UA 5HE8A 1Y1QA 1V16B 2MU1A 3BORA 4M54A 2BKXA 3WNCA 1F6DA 4HVTA 3LT0A 4K7JA 1TT7A 4ND8A 3CUVA 2C77A 4WQMA 3SG0A 3K9NA 5H70A 4HDCA 4S0XA 2PXAA 3E81A 5KJ1A 5BUSA 4JYCA 2VK2A 3ER8A 1IQRA 3DB2A 3QHAA 3JATB 3MUFA 3NB0A 2BCJQ 4EEXA 2JJ8A 4OB8A 4JI8B 3PNYA 2QSYA 1MT3A 4U7HA 1HLGA 3ENWA 1IN1A 3OVMA 3D3JA 1E98A 4QGSA 3RSLA 3UJ6A 4WDRA 5CXXA 4AYWA 1PBTA 2LP4Y 4J4HA 3D6AA 1KYVA 4IILA 2QN6A 1KERA 1KZGB 1XMJA 2I2DA 2RCYA 2JFYA 4MV8A 4U7PB 3B1FA 3THSA 1DBSA 4WFIA 2A5GA 1YOVB 1KGDA 4FVTA 2YWCA 5K0SA 4A03A 1ZW1A 4OKNA 3LUFA 1I4WA 3AR5A 3CZAA 3N8GA 4HG2A 2P40A 3RVNA 4LXXA 4LRWA 4X8LA 4EK9A 621PA 2Z3ZA 3PWZA 1Y1SA 2I3GA 4P5DA 4RHUA 4LDJA 2B4TO 4BYGA 4EB6A 1Z2EA 1FBNA 3RFFA 2C78A 1Q0PA 3N05A 1XIVA 4ZJZA 5AHRA 2E4WA 1RMYA 3UQZA 2XVZA 3EODA 3UFBA 5ALGA 3C74A 4QPPA 4BO6A 4E12A 1YR9A 2FGKA 2CJWB 3DBOB 3LX4A 2PSEA 1TCAA 4A0GA 1TMGE 1WPRA 4IF4A 2W6NA 5AJYA 3UMVA 1IZYA 1RQRA 1ZCBA 3CINA 4OKSA 3OUUA 5JCJD 1Z56C 1E9SA 1QRRA 3EQZA 3T9AA 4D26A 4QULA 1LBIA 1GGVA 2GZ3A 1IONA 2JI6A 2I1WA 3O1JC 5B1DA 1PFUA 2C84A 3EG5A 3S1LA 2P41A 4FBMA 4QM6A 3BERA 1FVOA 2QQ0A 4LV5B 3WR5A 4URVR 4PLWA 1KNXA 3D6JA 3JW8A 3K92A 4YCDA 3WDLA 4EHDA 1EFTA 1N4DA 2EU8A 5ALDA 3QUAA 2DRIA 4F3RA 4EIWA 4HMOA 3P0HA 2R1VA 2BY4A 3CKMA 3GB9A 4G1EB 3LQFA 3CNEA 3DMRA 2PDAA 5E3JA 5J9FA 1KDZA 3UXHA 1DJLA 1HSZA 3R5TA 4KSYA 1NNI1 1ZD2P 2ZEJA 3RYTC 4C7JA 1UKAA 3LFHA 2HF7A 3MD9A 2FPGB 2JFPA 3RO7A 4TXHA 5ALSA 2A58A 1TM5E 4L8FA 3LC2O 4A1OA 2V9ZA 5FYQA 4CI9A 4PGAA 4G89A 1KOFA 2IW3A 5EP3A 5AQEA 1KGSA 2Q3JA 3ETCA 1PGOA 2GNAA 3E5RA 3C6YA 1SCAA 2XZLA 2YBEA 5CDHA 3LDAA 1VL6A 2QPAA 3L8GA 1JJVA 1ODLA 1SK8A 4G09A 1RCUA 1WTAA 2AR9A 4GMHA 3WBBA 3ZWCA 4DR3B 3VVMA 3I2FA 1E1DA 4JLKA 5K6AA 5DNUA 1YB2A 1CLEA 3KL4A 2C9CA 4ML3A 1NN0A 1MX5A 3G02A 3F4BA 5C7YA 1GL6A 3U17A 5KOIA 2ZVQX 4MQEA 2NU6B 2VP0A 3DM9B 3IBFA 3MWLA 5DXAA 3V4LA 1J09A 1RCTE 2WIGA 1NVAA 5IEBA 3IELA 3UH0A 1MIHA 3X1MA 4JB0A 1JBEA 3QWIA 4Z0HO 5K6RA 3U09A 4Y6GB 2J41A 2PGDA 1VBFA 3CB4A 1L5OA 5EP1A 1DPGA 4WACA 3BB4A 3R7FA 1Q17A 4HDRA 4LVUA 1J0CA 5I3CA 3DO6A 4LZNA 3TPZA 4C6TA 5IXJA 3SYTA 2ZVJA 1Z0ZA 1V8DA 3ETEA 1XF9A 1YZLA 1XP5A 2IHVA 2C2ZA 5HM8A 1DCFA 2DLDA 3FY4A 2CB9A 4R01A 3C43A 5LLTA 2OBBA 4IJWA 3PXXA 5A06A 4XX0A 4GF5A 4GOKA 3TM4A 4FXOA 3K20A 2IV2X 2QVXX 3U3KA 2G77B 4C3UA 1YHNA 4B43A 1UZAA 2A9JA 3FCAA 4XYGA 2P62A 5REQB 1XLWA 2GFIA 2H29A 1PWXA 1O94A 3QJGA 5U1PA 2BHTA 3VNAA 1M2VB 2PWZA 4R83A 1J1UA 5EHIA 3Q40A 1LXCA 3BQ9A 5HF9A 5LB2A 3S2FA 4DIUA 3OSUA 5ALUA 3RHZA 1TKBA 1GITA 2DCMA 4PONA 4BRWA 3WGVA 3TBKA 3MLBA 1ZMBA 1XCGB 3GMSA 2WJYA 1RBYA 3KT6A 5DCUA 1T2VA 3R77A 1PR9A 2GZRA 1FTQA 1TF2A 2HJRA 3DV2A 1TCBA 1L5RA 2O1SA 1TRHA 3TSOA 5MFPA 2J3DA 4MLZA 1V6CA 3FCSB 4ESEA 1BHSA 1SVIA 1BCRB 3WGJA 5J5VA 5C5IA 2F1JA 1FP1D 2HNAA 1L5QA 3MTBA 4MEBA 4EG4A 3Q6NA 3AVPA 2E5LB 4QGHA 4X65B 2BI4A 2REXB 2VZLA 2P91A 2QMZA 4OOFA 4PC1A 2I91A 4NTZA 4C0BA 1A98A 1ZRHA 2IKQA 1SVUA 1ISRA 2QL7A 1UJCA 1VL1A 1XC7A 3U61B 3HA2A 4KXXA 3QPWA 5BRNA 3GLFE 1M6VA 1WDTA 2PQ2A 5F77A 2FMKA 1QUFA 2OXIA 4JEHA 3RARA 1RWMA 2OOKA 2OK7A 2XCLA 2ZRMA 1HL3A 1TU4A 3E3MA 4MUMA 1RKXA 3L0ZA 2W6MA 4YAUA 3JWHA 1HURA 1MG5A 2OHHA 1Y34E 2R48A 1JR3E 3E58A 4QXRA 1CNMA 4CCYB 1JBQA 5I4BA 4M83A 4IZ6A 2J9FB 4JVNA 4EYOA 4A26A 1UBKS 1ULTA 3TRKA 4WASA 2BDEA 1SB8A 1SUBA 1RKBA 2HW8A 3PLAE 3K1JA 3AG5A 4GE0A 4TYPA 1I30A 1DAOA 1SBCA 2JGJA 3B78A 2AN5A 2CSUA 4QT0A 4L07A 4S1VA 1SXIA 4XGRA 3GW8A 5GOTA 4ZHQA 2BJVA 3CNOA 3Q5DA 4URUR 5I4IA 2QAGA 2BEVA 2HQBA 3CRNA 4OF4A 4AJNA 3FDJA 3AXSA 3P9PA 5IM4A 1T0UA 1YK0A 1UM8A 2V0NA 1XXHE 1BEUB 1CIVA 1QVAA 1UBEA 3BGDA 3HCDA 3MJHA 4WCDA 4QUAA 4A1FA 2DLCX 2VJKA 1RI5A 4OU4A 4B3DA 5H9WA 4BLOA 1MQ8B 1TJNA 1U0LA 3M4XA 4OI1A 4MARA 5KTKA 5JTUA 1UBNA 5C9ZA 2JFNA 4LPKA 2EIHA 4EG0A 2GCOB 1C2TA 2N9UA 4BMYA 4U39A 3KUDA 1R5BA 4J0IA 4RF5A 3TQHA 1BS1A 4G8JA 2IUFA 2O5VA 3F3MA 1AUOA 4ZVMA 4D8YA 4Q16A 1M0WA 4NHEA 4AJPA 2DFLA 2R3SA 4GECA 4AF6A 4JP8A 3K9FC 4EYGA 2X76A 1MB2A 3EX7C 4Y2QA 5K0TA 2QTGA 4HB2A 1A7UA 1BXZA 2B82A 3L9WA 1MAVA 1XN1A 5TY0A 1SXJB 4YBRA 2OV2A 4I9FA 4JP2A 4JT9A 1IY8A 1WXXA 4KFSA 2WTEA 1YAHA 2QSUA 3BGWA 3DV0B 4G0OA 4LGMA 1WXIA 2BVNA 4MDHA 2EP5A 4MXDA 4QASA 2FMFA 1CY8A 3I4FA 4U6NA 3EVBA 4F6LA 3IMEA 3LUDA 1VI6A 3FNQA 3L4BA 4EDFA 2BGWA 4RHFA 4DA7A 1Z0DA 1CJCA 2VYFA 4LSZA 4U1RA 3SE0A 4DLTA 2HHHB 5C8YA 4QU0A 1QYCA 4W9MC 4CL8A 3TD6A 2I6SA 4F93B 5D5PA 2ECFA 3MHPA 5CMLA 4LBYA 3IIKA 1JHQA 3W6UA 2BFNA 3OCYA 4IO1A 4X61A 1X94A 2OQIA 3ZV4A 1A76A 3KTFA 4BWYA 5J2TB 2EBFX 1TTPB 3O8NA 4WLEA 1JWAB 2VHYA 2EBHX 3LT2A 2GCIA 1CRLA 1Z2CA 1SD2A 2C2MA 1Z6AA 3I64A 4BFCA 3IP6A 3OZAA 3RSGA 4DMMA 4EPRA 2YYZA 2NSLA 3B2QA 2L82A 4FQ8A 4MUKA 1YJAA 4IHKA 4MGIR 5IASA 5LWHA 2NAPA 5JWHA 3OFJA 4DOMA 3K5WA 2IVFA 2P75A 4PX3A 3OCXA 3UAXA 1H5UA 2Z2XA 2F3SA 3UMRA 1LZKA 3T7TA 1VSQA 3NC0C 4KE6A 1U28C 3KZXA 4IXNA 5FFMA 1G3UA 1V41E 1R6VA 3NM4A 3WP1B 5HZHA 4LNAA 3LCJA 3FYUC 3U31A 5BSWA 1X9HA 4ZMSA 1IK4A 1AO3A 5DO9A 1UEIA 2COUA 3VOSA 4EFNA 4EJMA 3OZXA 1QTQA 2MDTA 1MCZA 2FSSA 4ZDIA 1CZLA 1PAUA 4B81A 2HDNB 3OQVA 1XAGA 1DWPA 1YB4A 2RH5A 4DBLE 2AN4A 1NY6A 3V8RA 1SU7A 1OX4B 3G6KA 3HZRA 4HAIA 4DJJA 1UBCA 2AG6A 1KYQA 1AHIA 1HA3A 2AS0A 1YS1X 3KS9A 5EP4A 2WLSA 4M8SA 2ZIXB 5DU2A 2AZ4A 1RE0A 2R6DA 2NV6A 4ENUA 3C3XA 4KODA 3TE7A 3J81k 1ICEA 2B1GA 3AY3A 5SZJA 3MCTA 3TLMA 1LLCA 2JLXA 3TJMA 1VCMA 1GVHA 4B40A 4L22A 3ZVRA 1CKEA 3B1JA 4CI0B 3K53A 4IGKA 4NZPA 1O97D 5BWBA 2J8ZA 4JDPA 1K5GA 2BWJA 2XLBA 3FOCA 4QUHA 1NL3A 3GA0A 3OZBA 3WTBA 4R6XA 1WB5A 2Y1CA 3N5CA 4HY3A 3K0FA 3ZU4A 5DJ5A 2WI8A 1NIJA 1VFNA 4S3MA 2JJQA 1ZA1A 2HH9A 3ZEIA 4CPDA 1YOVA 4X60A 4D9BA 4ETMA 4DMHA 5B2FA 3EW9A 2J0UA 4HDKA 3B7GA 1JKIA 5G53C 3FRJA 4IWXA 4UXJA 2B8TA 1ANKA 2G9NA 3VHRA 1ISJA 1WDLA 2OLKA 2QU7A 3G9UA 3D4LA 3EVAA 1TTHA 1RWXA 1UFKA 1F4PA 3M33A 2JAWA 4LA4A 1B16A 1FP4B 3IPXA 3N3BC 2HC9A 2A1IA 4M49A 3S1AA 3SEFA 3U7FB 4UMEA 1HDRA 4B3BA 4M9CA 1PSWA 3HUEA 3T7CA 2W4IA 4P08A 1OH7A 4KWIA 3IVMA 3M6FA 4V1CA 1NNLA 1CE8B 3I6MA 4FGSA 2VZ9A 1Z22A 1B1CA 5DTEA 3NOOA 4J2OA 2GM5A 4PU0A 4DIFA 4RPLA 1Z7GA 3NH6A 5J58A 1YCHA 4OX9B 1A5SB 4EL0A 5HM6A 2QR2A 4B35A 3MJDA 3AJ8A 2A2ZA 4U8HA 5AW3A 2XAAA 4NCHA 4TLMB 1V48A 3O8OB 3T3MB 3WLSA 1GL7A 2Q0QA 3OBIA 4IUBS 3KJXA 5DLQC 1MPXA 5LBIA 4B1FA 3AEXA 5CYFA 5CA1B 5HW0A 1MA3A 2BGMA 3ZWBA 3ZHUA 5FL7A 4C5BA 1QHIA 3ZZNA 2O2XA 2J9RA 3EQ2A 3DMDA 3WLHA 2PX3A 1E77A 2OXTA 3H2SA 5EOVA 3RWOA 4JZYA 2DQ4A 1LTQA 2O8CB 5C52B 1TM4E 4FCCA 2B8EA 2D2IA 1N2GA 2JATA 2A1TS 3F47A 3LQ1A 4I55B 3QUBA 4BBZA 4AG3A 1NUTA 5ADVA 4KQ9A 4PGHA 4F2GA 5DM70 3JAMA 2YC4C 2VL7A 2VUHB 4JVMA 1NW9B 4JUDX 4YUVA 3UJNA 3CPHA 4RFSB 3L77A 2QD5A 3IALA 4I3FA 4RAQA 5A0FA 4CM9A 2B1RA 2VLIA 4W1SA 1NBHA 3X3HA 3E8XA 3JQBC 3JYLA 3KBOA 4V0NA 2WR8A 1GGMA 3HUTA 3HEAA 3UAGA 3LUCA 2AMJA 2EWVA 3WO1A 4XUEA 1O58A 4MUIA 4PYQA 4AMVA 3ZY6A 3EVEA 4QEDA 1XHLA 1TT5A 1P0CA 4EGCB 2DT5A 2JGMA 4PBRA 1KYYA 1PX2A 2GZMA 3PHBE 5CM9C 5JS1A 1P1CA 4TXLA 1H6BA 3I39X 3S1AB 3BK7A 4TKUB 3WZ2A 5IEJA 4RM2A 1BDHA 2HCFA 3FYUB 3HB4X 4Z9FA 4IKOA 4PZPA 1NW7A 3ZKAA 7ABPA 1ZL2A 5CAEB 1GCAA 5IDYA 3H5TA 4YRNA 1FXUA 4QU5A 2ZJ7A 2VH2A 3O91A 4NRDA 1F0KA 2VKTA 4X93A 2LV8A 1DC5A 1IU9A 2XT9A 5CDFE 3J7TA 4ZDKA 5IHPA 3PKIA 2HHCA 2HMVA 2VWQA 1W73A 2ZUCA 3FN4A 3G68A 1UXHA 4H59A 3W06A 3UMJA 3W2HA 4A8HA 4D57A 3CLHA 3ANSA 4OH7A 5AJVB 4NBSA 3GRPA 5DCYA 3OESA 1CHDA 3A9UA 2WSBA 1X6VA 2ZAIA 3LQYA 3NXSA 1YD7A 5KX5B 1A9RA 5COBA 4DIDA 1R4NB 4J0DA 2QW8A 3GXBA 1EMDA 2IS4A 3WDKA 3IP1A 4QOSA 4DTCA 5J1SB 1Z0UA 1Z38A 5EZ5A 3OEED 4ZVLA 2FUEA 4PQGA 3TI7A 5DP2A 5ER9A 3U60B 3EDQA 3IULA 1LBEA 3P7MA 1QDUA 1NMYA 2XKAA 2ORWA 4LMRA 1O77A 4H6PA 2EX1A 4N3BA 4XYEA 1I10A 3IBYA 3K1AB 4RPIA 3TVDA 1NTOA 3G0GA 3ZWMA 3DBRB 3CFYA 1ZRNA 1MP0A 3M1YA 3QOFA 1XTTA 2QTVA 4IUCS 4NI5A 4UU1A 2CDNA 3AH8A 4RTQA 5LFAA 3BWDD 3NP9A 1RQPA 2AL7A 1HFWA 2B99A 1CUCA 3RT1A 3T9FA 5KVSA 2OZLA 3T1HB 1M66A 4LHZA 3QBVA 4ZHSA 2PH7A 3COJA 1ZONA 3A2KA 4Z0TA 1W36D 4BLSA 3L7JA 3PQ6A 1GFZA 4KLZA 4ZEWA 3WSVA 4Z4QA 1V1RB 3RHTA 1XTBA 2ZU6A 3RH0A 3EA0A 1HT1E 3IQGX 3ZNQA 4KPEC 4YUYA 3FNFA 3M4ZA 3AUTA 2FV8A 2WIKA 2C97A 3I2KA 3JVVA 5DYIA 3VMFA 1Y1TA 1D2GA 4U6SA 1L8XA 1XR3A 4HXYA 4NMWA 3BEOA 3D0OA 4Y67A 1X1CA 3FYTA 3C3PA 4Z53A 2RGUA 1NZDA 3HDYA 3BE8A 4BWFB 1HNXB 5JWRA 4EM6A 1K68A 1PN3A 2VHVA 4H7JA 3JSAA 3ZYZA 4ENTA 3NRBA 1NYTA 2DQSA 5CPBA 4ZQBA 1ST2A 4AVYA 5KQPA 3TUIC 5ALTA 4QBKA 5CFRA 4Q1FA 1MC1A 3PUWA 4ZZ0A 10MHA 4EPYA 2P9CA 2ZJ6A 1Z36A 3H42B 4PX2A 3JQGA 1X19A 4FCTA 3JYQA 2G36A 1IFXA 3CC8A 2EZ9A 1IXZA 2VIIA 4HKTA 4N6OA 4YRDA 5PNTA 3O4FA 5TJ9A 5BWOA 2PWAA 1BWPA 1AZSC 2AI3A 2H0RA 3EEBA 3F5FA 3NALA 2CNKA 4NIMA 1JHUA 4KIGA 1A9XA 4F72A 4LS3A 3TZQA 1OXSC 2FSPA 2VDWA 1D2CA 2WJ4A 2NZYA 1NC3A 3I9JA 1Z0KA 3BCUA 2XWPA 1VXOA 4Q9HA 2X9VA 1UBFA 3TW8A 4M88A 3DO5A 3PNPA 4ZEOA 5I7UA 1X8KA 1N8KA 2ZB7A 4M37A 2L2QA 4IG9A 4P33A 4B2YA 4RFVA 1XTRA 4BDSA 5JPCA 2A9QA 2FRXA 1JZTA 1ZJ6A 3ZHCA 4URZR 2D5LA 5GV8A 4XFKA 3QBJA 2HRCA 4JJIA 4XPZA 3PFWO 3RBXA 4AKGA 2XSZA 3AQ4A 1GUBA 4I1PA 4KIUA 3KQOA 3F6BX 2JFGA 4DPMA 5IDWA 2DFKB 4ZT7A 3J81A 1Y81A 1P9LA 1AA9A 3WSWA 3NIWA 3ZGXA 2RGRA 3PPIA 4LYFA 3PS9A 4LE2A 3CGGA 3SOZA 4H3SA 3O95A 3VTFA 1X70A 3AJAA 5F4ZA 1ZUWA 4MV6A 3EGXB 2B37A 2VP4A 4KKXB 4D4HA 2NVUA 2EJCA 1P1JA 3PXBA 4BO9A 2RIPA 3K8YA 1U90A 5BMOA 5LD2B 3NHKA 1GG9A 4E7PA 1XCPA 3OOSA 2WF7A 1LSSA 3HLTA 2Q3EA 2YXPX 3OIVA 3KT3A 4LXQA 1GCUA 3MCVA 3ZDRA 4DBLC 3EYAA 3M1LA 2CBZA 2WFMA 3I8OA 1DAPA 2FFHA 3HQ4O 1Q92A 3TAUA 1U6KA 1FQKA 2FE1A 1MLDA 3W5CA 2ID8A 4WFJA 5E0OA 1OZGA 4GC9A 1L1RA 2WM8A 5B36A 1P0QA 1T3GA 4MIEA 4R2IA 5KTYA 2EEPA 1PR2A 2YHBA 5FD8A 1U7WA 4YWHA 1FA9A 4EYKA 1QYDA 3TDKA 1DZ3A 2RHTA 1Z08A 2EJVA 4BVJA 5G40A 5K8JB 3V34A 1ZXXA 2VQ3A 3IV7A 5AI6A 1I32A 2AK2A 4FUQA 4U0JA 5DOZA 3R7DA 1HM5A 4TZKA 3QLUC 4UMVA 3WGOA 1XMOB 3VYTB 3LBNA 1FL9A 1V9CA 2OCIA 3N2ZB 4U2EA 1PS8A 4JI5B 4DAEA 3T3OA 1ETUA 3CO0S 2OO7A 3PNQA 2CV1A 1SCBA 3BA1A 4MW7A 4ENQA 2XMRA 5FV7A 4GOOD 3U2QA 1C4OA 5GMOA 4R71A 3LA8A 3RFTA 3ACDA 5HFNA 3E5HA 5JAOA 1T0HB 1JFVA 1CG6A 1CUBA 5HBRA 3KPUA 3JY6A 4WA8A 3TOZA 5LZ5A 2OOSA 2ZIFA 3FGPA 4A73A 1OI4A 1RZVA 5THQA 1XTVA 2IHNA 2IHJA 3BUSA 5H0IA 1ST3A 1A7JA 3H8VA 4PX5A 5JE8A 1F3OA 3AW8A 1E1NA 3NOQA 3GA7A 1KC1A 3MJEA 1RVDA 3EOBI 2C5FA 4QYWA 4RZ3A 2VRCA 3KUXA 5EERA 5LIRA 4CEJB 4GKKB 4RUKA 1QRAA 1YDGA 5LUBA 2IK8A 1Z73A 2JFHA 2PJUA 3KLBA 4O2BF 1WHTA 3FPSA 4G0PA 5FADA 1W1WA 5I8PA 2GK6A 4HN2A 4HGOA 4MJ3A 2LPMA 4RQAA 4UEKA 5LA6F 1P1KA 3TFQA 1GL9B 4QAJA 2WOJA 4Q9LA 2R7NA 4O08A 3BREA 2BFOA 1YA4A 3UT6A 2J0SA 4KSCA 3GJ8A 3A6PC 4GL2A 3EXAA 3A3NA 2EFHB 3DZDA 4B17A 1Q2XA 1DLJA 1BE8A 2L42A 4NECA 3WK9A 3K70C 3DBIA 3PNVA 3TECE 1QYXA 2E4UA 3TS1A 1U3GA 2PUWA 3MNFA 4ZI3A 3QM1A 4RO0A 3BFKA 4DRZA 3LNTA 3A1UA 5BY2A 2PLAA 4DM7A 4XE5A 1SD1A 3G5LA 3IP7A 3M2PA 3NYQA 1GR0A 5HFJA 1NJFA 4TMFA 2PXHA 3QNUA 4XTCS 1N0UA 1NYLA 2P1ZA 2EIXA 2WIAA 5IJAA 1JPVA 4G1UC 4M1EA 1L5KA 5JS6A 1F12A 3H9EO 3DKVA 1IDOA 2G04A 2HPAA 3DVAA 4IXWA 1F8GA 3BGIA 4X6UA 4WZAA 4RK5A 3KOWA 4F6RA 1HI9A 5AOAA 5IJ0A 2VCYA 4L5AA 2HUNA 3FFBA 3G2LA 6GPBA 3O2NA 4U3JB 1TLFA 2GF0A 1DHRA 2YFKA 7MHTA 4J43A 2NU9A 4DABA 4RGBA 1L5NA 2J6CA 4AS2A 4DLKA 3B48A 4KH0A 3L49A 4TKUA 3LWBA 1XP8A 3QFCA 3L06A 2Q99A 3THWA 1NI4A 1PL7A 3OMWA 3L4KA 4B2IA 1GG2A 2C03A 4NDZA 5BOVA 2E4AA 3FOWA 4ZODA 3ZCUA 3OJOA 2YCBA 1YULA 5TPWA 5TPZD 1DMRA 1DEOA 4Q93A 3FNHA 3LWNA 3R23A 3BK2A 4JP1A 1OXUA 5FUVA 3TTTA 4E0BA 3U4QA 3PR1A 4P53A 3TMKA 4E94A 3OJEA 1IM5A 2C2XA 3NBFA 3PFHA 2AFIE 3ETGA 2AFIA 1U4SA 4GOJA 4DVJA 4ZFNA 4X6LA 5JTTA 5E1MA 3D8BA 3T7IA 3F96A 1UDRA 1VHJA 3N74A 2Q5HA 1G17A 1UP7A 5GGXA 1PS0A 3OC0A 4IX9A 5EY5B 1H2AS 3B70A 4FILA 4G37A 2ESRA 4CLHA 2WP8J 4GGMX 2ES4A 2VEOA 5EA2A 5IAGA 4I5FA 2YV5A 1RHQA 3UJ3X 1V1RA 1C8KA 1XRNA 1KDPA 4WTOA 4DCCA 1IM8A 3HCPA 3KXLA 3KZVA 1Z2NX 3FE2A 4L9SA 4CU5A 3B9QA 3ZTYA 4MLCA 5ENVA 4R9UC 4UBOA 3AEQB 4PNEA 5LPNA 1T8SA 2DPXA 5HDQA 4P4LA 5IWAB 4I81A 2IV7A 2VWGA 4K9PA 2V96A 5ENDA 3ZU6A 1F8FA 4OI4A 3VR2D 2Z95A 4KWHA 1PQ4A 1T5BA 2J4FA 2ERYA 1K5HA 4M9RA 2JVIA 3WMRA 2EG5A 5H8WA 4ZYZA 2YVUA 3H4MA 4XIGS 5C37A 2YWDA 1KAHA 4P4TA 3S70A 5A6SA 2V45A 1JFRA 2WSIA 3QVTA 2XQGA 3OPQA 3EH1A 2ON6A 3IHKA 3OBBA 2ZWVA 3UG7A 3AI7A 4EGSA 1BIFA 3MLEA 2BT4A 1X86B 1EVKA 1KAEA 3SXUA 3DKKA 2AWOA 2DPYA 1KY2A 1IOZA 3LSTA 3KUUA 2JIOA 3M6VA 5LDHA 4I1YA 3ANLA 1X38A 4BV3A 2QRZA 3E3AA 4XUCA 1ND5A 4ZAZA 4KAAA 3WIEA 1TKRA 1QHXA 1KETA 3HJHA 3RBVA 4FE3A 4TTIA 5FPPA 1EFRD 3S8EA 1HTTA 1QFJA 3BD9A 3BXPA 4MVJF 2PM8A 2QXUA 2E3JA 2G88A 2CYAA 2AVNA 3PIRA 2QRKA 4MV3A 3ULKA 1T1RA 3BRCA 5L3SA 1GZ5A 1C81A 1J2UA 5AJHA 2QGZA 4YAGA 3QFTA 4AN0A 5IULC 1L6RA 3ZDCA 4HTFB 3ZIAA 4H7IA 4DADA 3IUEA 1WWKA 1ONSA 3AI3A 4C7XA 4OJYA 2A7XA 2BP7A 1GLGA 3TJRA 3H4VA 4FGWA 4E2XA 1J0EA 1PLLA 3F2VA 1GAQA 4N9QA 1R8YA 2E18A 4RD6A 2OLJA 4X8HA 4QDTA 2GARA 4URHA 4PG7A 2K87A 4S24A 3VMMA 4WW0A 2FG6C 2WTBA 2XUKA 1R6AA 3TLAA 3UK2A 2Q6KA 3RVDA 4RNDB 4YI5A 4DN6A 3D2BA 1TYEB 2PT9A 2HK6A 1D4ZA 2X0KA 3PA8A 1UKCA 3C4QA 1CUVA 5BQ5A 2EEZA 1PJCA 3L8HA 3ZI0A 5IVPA 2ZRPA 5K4GA 1UPUA 2LTAA 4DIBA 5K3BA 3LRXA 4J16C 1LPMA 1V16A 3G2IA 1JHYA 3VR5A 4A3SA 3FCYA 2Y1FA 3B82A 4DNOA 1KTVA 1SKAA 1T4DA 4ETIA 1UMDA 2SKEA 3UATA 2A9FA 4FD2A 3OQ6A 4JSYA 5JJCA 2NIPA 1J8QA 3HJAA 3R76A 2XMBA 2VHWA 3IUJA 1SM4A 4R3UC 3I9MA 3MN1A 1CBUA 2ZUVA 2ENWA 4M4SA 2ZAMA 4YP7A 3NTLA 1VFPA 4DSAA 1E32A 3A6FA 4WK6A 3H9JA 2QRVA 3ILVA 4AUNA 1YZHA 2R66A 5EXTA 2JLVA 1NN1A 3NGXA 3OPVA 1BHO1 4U2BA 1RAGA 2CXPA 3HKEA 2W58A 3NV7A 4GR9A 4WZBE 4M3NA 3UENA 5SZHB 3R6WA 1HC7A 5JBIA 4DB4A 3NH9A 4J1SA 4OQXA 3JWGA 4K05A 3SJBA 2QN9A 4A6EA 2XUIA 4AO6A 1E0AA 4R9RA 2RGAA 4DCPA 4YMTA 4RVSA 3QVOA 1M1YB 3HGTA 1EG7A 1JHAA 2QR5A 3IRVA 2FZWA 1MAHA 4WIAA 2QIOA 1T2EA 2SCUA 2JKZA 1QKIA 3SC2A 4CTKA 3QXGA 1UKBA 4JEUA 2JLUA 3UAVA 4X1IA 2KI5A 1F1BA 1KKLA 3IDFA 3OIWA 4R5HA 3N07A 3TL3A 5CCBA 3QEAZ 1MO2A 1Z34A 2FWJA 2ETVA 2IBSA 2D59A 2E4YA 1KEEB 2YZMA 2ZIGA 3IGFA 4FFPA 5DKFA 3ZJYA 3DAOA 3DG9A 3GLGE 1JA0A 2QENA 3KKMA 3B8HA 4BO5A 3VO1A 4F5ZA 4HZIA 1KY3A 3QLTA 3T0IA 5AM0A 9LDBA 1M74A 1NBMA 1ZEMA 3G8YA 4I1UA 4EYSA 2PUAA 2ATEA 1NW4A 4CTNA 1SIBE 3GIDA 3AUJB 3FDZA 4O4JA 4UDOA 4RDHA 3ITKA 2VYNA 3OEHA 3QENA 3DS8A 1P5ZB 3QMVA 4UHEA 5COAA 3PXGA 4MWGA 2RH4A 4GI7A 3TIIA 2RBKA 3BEDA 4UNRA 2I6FA 1I5EA 1Z6XA 2MSCB 4ZI2A 3ZVKA 3S7TA 4DLNA 3H05A 5J4VA 1O7JA 1TJ3A 4HDOB 1JKJA 1JXAA 5LOVF 4LTDA 3GAZA 5K3DA 2YFQA 3FWHA 4OSEA 1FSFA 1Q7TA 1XO1A 2H57A 4O4LB 1UAGA 3R3UA 1KQFA 1CZOA 2J87A 2G28A 3P0EA 4HGQA 4HLUA 1Y3IA 1T1IA 1PZFA 1FXWA 4RHYA 5LJIA 1XTZA 1TJ5A 4HGYA 2GPNA 2Y1LA 2Y1EA 1VSVA 5LLDA 2NT3A 4KQ2A 4M8LA 5DLEA 3U39A 1L5LA 1L7AA 5JCOC 1BQEA 4MUNA 1G5IA 2WJZB 1QE0A 2ZTHA 4PFSA 5G4LA 4NCIA 4L6CA 3DQQA 4S04A 4GRAA 2M98A 4MVJH 4BU0A 4IX1A 3GRVA 3MS7A 2C2BA 4CZ2A 4N4AA 4MEJA 4DIEA 1V7CA 3V00A 2CUKA 3LDUA 2FKNA 2VDUE 1XCBA 4TTQA 1AZTA 3E2IA 4I4LA 2BHSA 1X8XA 4GW3A 3HYRA 4L9RA 4I08A 2RHGB 4JUIA 4JBHA 5ARDA 1KO8A 3EG9A 1FOEB 2QVLA 3HC7A 1LRLA 3LG2A 4L72A 3WK6A 4YMUA 3WDMA 3B51X 1F5SA 4MINA 1RZRD 2CE2X 1MD9A 1RRCA 1WG8A 5H3HA 3KU4A 5KBYA 1UBRS 2O8BA 1Z4OA 1U65A 2FN7A 2YMMA 3GUHA 1Q2UA 4BMZA 1TB4A 3L6BA 2FE4A 5FUQA 4JBYA 2MJLA 4G23A 3OKAA 4HLDA 3AKZA 1G66A 3BRQA 4N7RA 5KJCA 1VB3A 3HM9A 5H3CA 1M6YA 5KNDA 4J9UE 1L7XA 5JAUA 2CLKB 4B3JA 3W9BA 1ZESA 3O4JA 3OIGA 1JUDA 4HRAA 4WJKB 5FBZA 3A11A 1VYHA 3U81A 5ESDA 4H2DA 2LZ0A 2R1TB 3H6HA 1K5PA 5HA5A 5KTPA 8MHTA 1IAQA 4Q48A 1C3OA 4GIBA 4IIJA 4RD1A 5MN6A 4L9WA 3ICPA 4BO7A 3M4JA 4NCBA 5JU6A 3QFFA 3IMKA 4G0VA 3GAAA 2QAJA 2ZTMA 1BQ3A 1NKVA 3K4PA 1T3TA 1PBNA 5C0OE 1Z0AA 2XUJA 3GZNA 4EHLA 2A5DA 5KYXA 5FFFA 2EBWA 4MRSA 5HMLA 3FMGA 2QN1A 5I3ZA 2QQGA 2GYWA 3PK0A 1DO0A 2ERCA 1K2WA 1ENPA 3R6GA 3TZBA 2PX2A 3L79A 4NDAA 3HCRA 1BE1A 1NBOA 3SLKA 4GLOA 5IYZF 4QTXA 3ROFA 3TEFA 4D8WA 1RCFA 2PS1A 1E20A 1GP2A 2VRNA 2BFDA 3DOOA 3KZ1E 5DWVA 3N0XA 1QSGA 2V9PA 4L8LA 4ZVQA 3AWIA 4DPKA 1KQGA 3ZG6A 2B1IA 1CS4C 1Q74A 3QU5A 1OBFO 1QGDA 2MSLA 1OXVA 1Q5PA 1FRQA 3EEIA 6REQB 2G63A 1Z29A 2Q4BA 1TO2E 2O8EB 4OHFA 3HCEA 2VPTA 2O2YA 1Q0TA 3RC3A 1TQ4A 1AXEA 1I33A 2I4NA 2OTCA 1DJNA 1C0KA 2UYYA 1RYHA 4TS4A 1Y5IA 2J67A 4NARA 2QMEA 1P74A 2VJAA 1PUXA 3EB9A 2QLTA 3PCRB 1K75A 4R1PA 5CFPA 5ED4A 2FZGA 2BD0A 1XXHB 4X8MA 5JG7A 2Y71A 1DIRA 3JS5A 2YNMC 1NVTA 3EBLA 2VF8A 1D0SA 5CLLA 1VKOA 1EPUA 5DULA 2XT0A 3W2GA 2PTHA 4DY4A 1RWQA 1ZD4A 1WPGA 1Z37A 1Z5VA 3I5YA 3UYKA 4LY3A 1GFSA 2XNSA 5FWYB 2FB9A 1QQ6A 4OYHA 2DTEA 1DTSA 3V9PA 2RI0A 4BE9A 4DSNA 5AVRA 4MQ4A 3DFKA 1M5TA 1NMEA 3KSUA 5A4AA 3ND8A 3OTQA 4Y9UA 1C4KA 3C48A 3PHHA 1GARA 2OK8A 3L0DA 3BMNA 2LIVA 4HWRA 2EZ8A 2C3MA 4KE7A 4LHEA 4BIIA 1A27A 1DTWA 1NDQA 4I55A 3TK1A 5A1TA 4LE0A 2W00A 5DASA 4CL3A 1B0AA 5TMPA 1W5FA 5KYNA 2O9JA 4M76B 3FGZA 3IP9A 4P0PB 1VP9A 2YWRA 1YI1A 3V4ZA 3BSWA 1BFUA 1ZISA 2P9YA 3ADOA 3GPBA 2PGIA 3F6SA 5IU6A 3WWDA 1IHPA 3AVXA 3IR6A 3AUSA 5KQMA 2HLDA 2N75A 3P9IA 4BJ6A 1J39A 5C2JB 1G5TA 1V6AA 4DILA 5K0NA 5A7GA 2BFCB 4YRGA 1UJ6A 1IL0A 5CYOA 4I50A 3EXHB 3JX9A 4JIMA 4N0EA 2NP7A 4DMKA 1P3DA 4IGFA 1N1MA 2GAIA 3I1JA 4LC9A 1XTKA 4KTTE 3KV1A 1CS0A 2O3RA 3F71A 3TMAA 4HDMB 5TMBA 1X1SA 4PO9A 2X1LA 3A0RB 3K1ZA 2Z1NA 4QTTB 3N5KA 2GPTA 3OPXA 2I3ZA 5BMVA 5JJKA 1O8BA 2I4OA 3H8WA 4YJ3F 4F4IA 1QQAA 2PBZA 4CHGA 1TM1E 4QFDA 5FEUA 5A6SB 1BX3A 4V0MA 1JPJA 1UK9A 3I5MA 3JALB 1H8HD 3NPAA 3THXA 2REQA 1XZBA 5EI5A 2HRBA 3KSDO 4GI1A 5K0LA 3EVNA 2GNPA 1PZEA 2LKDA 3BMCA 5K6AC 3QVLA 1BXKA 2B20A 4DA6A 1Y3AA 2HK9A 2PX6A 1ULSA 3DDZX 4FJ2A 1J8YF 3LLVA 1RYBA 2VBFA 4UEOA 5KKAA 1B8NA 1O96B 5E9WA 2OA0A 2Q29A 3HZOA 2CE7A 4RIIA 3EVZA 2EJWA 4PGGA 4OFZA 1DBWA 2G9RA 3FSJX 4AP5A 2W2PA 4CIAA 1SBYA 4K9LA 5CCXA 3ED5A 2II6A 5CFOA 3OTOB 1JJ7A 2EDCA 1R5OA 2WJ6A 1OMOA 2NXNA 3TUJC 3KR0A 2JANA 3ZDFA 4EUSA 1LS1A 1VLQA 2XOEA 4TTJA 3WLJA 4KR6A 3BJZA 4ZKDA 2R68A 4N8DA 2ZIXA 1Z9BA 5DZSA 4UPEA 4FHGA 1PCXA 4J3JA 4KPYA 4OXRA 1MO4A 1WP9A 1V2HE 3WYNA 4F06A 3I04M 4BMVA 1EP9A 2GD2A 2ZYDA 1F2UB 1IUKA 2PYDA 2OV6A 3DTTA 1RPTA 3KTAA 5AT1A 3RFVA 3OLCX 2IYTA 1D1SA 3NRJA 4BX9A 5EXXA 3EPKA 2Q27A 3TLKA 2QRQA 1M1XB 1WVIA 1JKMA 4XOIA 4BEJA 3MB8A 4AG5A 3INRA 2NQ8A 4EAAA 4M6WA 2IF2A 2FN4A 1NLFA 1E9FA 1TF7A 1X7XB 2NU7B 1JNYA 1XZNA 5C3UA 5TVKA 1KZHA 1AB5A 1M2VA 5EEGA 4RLFA 1JLRA 2QTMA 3RYHB 2D3TA 4R3WA 4WKGA 2O20A 4MMZB 2D5CA 5JNTA 1QH1B 4BQFA 2LCIA 4FFBB 1DEHA 4AJIA 1JI3A 2X5XA 1J4AA 1YIDA 5CCEA 1UH5A 4TRMA 2ZRGA 3FAKA 4CXMA 1TOAA 5CB4B 3LWZA 1TZKA 2ZFUA 3A1NA 4QYIA 5EE5B 5CD1A 1W6UA 4ZU6X 1NJ6A 2WM3A 4UZFA 3SEQA 1XEAA 1ZITA 1ZUHA 2IW1A 2PXCA 2ZWPA 4NG5A 4Y2TA 5IN5A 5K0EA 3LVRE 5EQDA 1CY4A 1Z06A 2J59A 3LH5A 1VOTA 4RA6B 2GH1A 3C24A 1BG6A 2RMKA 1DJOA 4EHHA 1XU4A 3F3KA 1PFYA 3GPLA 5KAPA 5HVNA 2EFGA 4MWZA 4R2HA 4U0KA 1ENYA 1J20A 5J63A 1IBMB 2H3HA 1P81A 1O2DA 2AOVA 2KB0A 3OFKA 4FFLA 2FZVA 4IJMA 3RR2A 4DS3A 3FDIA 4I14A 1TZMA 4RK4A 2EVWX 1PR0A 2QUHA 4I0WB 2H7XA 4MUGA 3UUEA 3G2MA 3QELA 3BSFA 5D3QA 4MVJP 3CSSA 5IC5A 5DN6D 2JAOA 5J5CA 1TVKB 1Y42X 2X6QA 2QJWA 3G49A 5K3AA 3ERCA 2UXCB 2Z0MA 3KDAA 1G64A 3IRUA 1C3VA 2X5KO 4EFDA 4BOYA 3QF4A 3MT0A 5HTOA 1M8KA 2WIBA 1DWOA 3BZWA 3C0KA 5E4FA 1DMSA 1Y8AA 1EHIA 1Y7HA 3JAWA 4MO9A 3KTOA 1DFIA 3AETB 2J9GA 5EIBD 1OIXA 1VL0A 4D3DA 4BY9E 4R1TA 2I3DA 4ZOLB 3UJ7A 4YCMA 1W4ZA 2BPOA 2AMLA 2BDUA 1GSOA 2V55B 4MNTA 1ICIA 1WOYA 3GEPA 3A37A 1AOXA 1P4JA 2ZAGA 4TVOA 5KIAA 1OV6A 4KPGA 2Y1DA 3U4CA 3VOTA 5L95A 4BVLA 3VC3A 4JXJA 4DIMA 1VJ1A 3TW0A 3Q2OA 4NONA 1JJBA 4HDSB 4B46A 5F5XA 2FF7A 2FW7A 1Q7CA 1PNOA 2GCNA 2ZYGA 3JQEA 3GROA 3RVBA 5FYDA 4TMKA 3IOYA 1HTWA 2RH9B 2VPQA 2Q07A 2GCEA 1USUA 5TE9A 1NDHA 9ABPA 4UFOA 1JR3A 3RTGA 3A6LA 3WFIA 4RABA 1GGHA 1W0CA 4NQRA 5HE9A 3DO8A 3V33A 2ZSUA 4D4JA 3GDOA 4YV1A 3VPCA 1EFPA 3CONA 1TC2A 3M7IA 3M0EA 3P2KA 2FQWA 1QOZA 2PKQO 1AK2A 2POQX 4I1OA 1VHWA 5BW5A 1E2DA 4FDMA 4F45A 3DMNA 2IY7A 4ZKEA 1NOKA 2IITA 2OILA 2WKWA 1OLXA 1E2HA 1HYEA 1L8QA 2FUCA 3I2HA 3KZNA 5EZYF 1WCXA 1BU5A 3UWMA 3W5BA 4IQGA 3L4BC 4WLUA 1I2BA 5FBKA 3N8IA 2GRJA 3WJAA 2OHFA 3GC6A 2Q0XA 1G7SA 1U6JA 2C5HA 3OZCA 4IFBA 3IP5A 4ARVA 4JL6A 3TH5A 3C5HA 4WCFC 1MR3F 1PJ8A 1ZBDA 1MB3A 2Y2VA 3GF4A 3BAZA 3PNLA 4D8XA 3KWJA 1A96A 4DZRA 2R2AA 3FB4A 3STWA 2B6HA 3ZI7A 4UUMA 1T36B 1YS9A 1JRLA 2XMDA 3L02A 3CLRD 3EIQA 4H9GA 5KMGB 2BJHA 3NT4A 3W90A 5AW2A 3ORFA 4P58A 1YE3A 3B1YA 3TAXA 3ZTWA 5C5EA 4BN4A 4P54A 4PNZA 5LQJA 1D2NA 4L50A 4PFQA 4WVFA 2FWIA 3LPCA 2FR1A 2J3EA 2WZQA 2AEEA 4F2PA 4IHAA 2PG3A 3HYCA 3PFGA 4YV7A 1O5IA 1S2MA 3CH7A 1QRSA 5JXJA 1N34B 5IDXA 2HK8A 1FEZA 3KSMA 5CHYA 5EIBC 1M1UA 3DEFA 4DJDC 1OSNA 1EB8A 2O8DA 3EY9A 4YAOA 2BFPA 1FNCA 4A92A 3Q8LA 1K9SA 2QT0A 2WDPA 1WW3A 3CUYA 2R8YA 3IS3A 1H8EA 4JWTA 2HL6A 3ND6A 4PQRA 3CUWA 5DEOA 2G08A 5AVJA 3UN1A 5E95A 4A4DA 4BL5A 5CA0B 2XMZA 3SC3A 1VI5A 5JQGF 3KFVA 4GBJA 1Z33A 4KQHA 4FDTA 4DY6A 3RTAA 3CNHA 3Q8WA 1G7TA 2X9QA 5FNVB 4MK4A 1IG3A 3Q9NA 4IJ6A 4RMJA 3T7JA 3WGYA 1EXDA 2Y9PB 4A0FA 2PS0A 1RHMA 3K0SA 4FYPA 2F3PA 1SQGA 3JQRA 4TLAA 1T9DA 1VL5A 1ZK4A 2ZULA 2R2GA 4ZOEA 4N76A 2NWQA 1LY1A 2VSQA 3GV0A 4BFZA 4PZ9A 4Z1MD 4M0CA 2GOYA 2GJKA 3D7KA 3FCUB 4C76A 1CUWA 1L6IA 2AQKA 2BLNA 3F6RA 4MB0A 2JLWA 1GV0A 5GONF 1PS9A 1G2OA 2GN9A 2P4UA 3DAFA 4RGQA 4X00A 4C89A 4NENA 3AO0B 3N87A 1LDMA 2BUAA 3CPEA 4FDAA 3L5OA 1OAAA 4I5GA 2VPPA 2Z1MA 1PG0A 1XEXB 5DPMA 3WL4A 1M2OA 2FY8A 5EJ4A 4DDUA 2WU8A 1EDDA 1YRBA 4XGNA 4EPXA 5C1PA 1BE0A 4WEQA 1Z15A 2Q3FA 4BFYA 1OVMA 2L17A 4TZ0A 4Z54A 1F2UA 1GPLA 2OUKA 4UBIA 4D82A 4QGBA 2GLXA 4HNUA 1PX0A 5LIPA 2P69A 3DULA 5KHLB 1BWQA 3RAFC 1CZUA 2OQRA 4U2DA 1NJ5A 2ZUUA 3L8YA 3A4MA 1JFFB 2N46A 4N8SA 5LC1A 1CR6A 3RE1A 3UJPA 4U7FA 3FMIA 4PN7A 3IAUA 1ZIYA 2C7QA 2V74B 2X1MA 1P0FA 3KEMA 4A0RA 1DC8A 5GWXA 3U1VA 1E1QA 4KLAA 4M0PA 4MR7A 1NN3A 1MABA 4W5HA 3N0TA 4PCAA 3S4YA 5K09A 3GWGA 3PSAA 4IQFA 1U9JA 4KYIB 1J23A 2HO5A 3L5KA 2ZR7A 2UZIR 3QHPA 1WD5A 3VNUA 2XCIA 1J06A 1PW5A 3A4YA 4M60A 3GFFA 1G2IA 5CPFA 1AB6A 3RUEA 2ICAA 2KHZA 3DQZA 4FGJA 4Y2PA 5DX8A 3W5JA 1ACJA 2FI1A 3GEIA 5DRYA 1KF0A 5ANRB 2AQHA 3I53A 3RSZA 3DMYA 2X0JA 2HU8A 5CBPB 1UKVY 3C1OA 3RASA 4M8IA 2Q2NA 3NW9A 1K08A 2B7LA 1R3DA 1PYOA 5T3YA 4KR2A 2DY1A 2FN9A 1IJKA 2PYIA 3K73O 3GG9A 2PR2A 4WUVA 2IZ7A 5NULA 3VO8A 1SOAA 2HCRA 1YZYA 3PFKA 2C4UA 4OREX 2IOQA 2FN8A 3HNOA 4LHXA 3T7KA 1IK6A 1K7XB 3L0IB 2CWWA 3INNA 4IOJA 2ZJBA 4J6FA 5FBRB 3NNSA 3TRJA 4ALIA 1GKUB 4OFXA 4Z51A 1M2OB 1WLYA 4YROA 2Z4RA 1PI3A 1Z5OA 4EHAA 3VNSA 3QYPA 3ZWYA 3M3HA 3W5VA 5H3LA 1A2OA 2ANCA 3FOBA 5AUNB 1RHKA 4JHXA 4X20B 5HQ3B 4A0QA 1O6CA 3IAFA 1TJ4A 2I55A 2HAEA 4L75A 2VJMB 1JQ3A 2A4KA 4S1WA 4GX5A 3F3YA 4L2IA 5B1IA 1P4GA 1V47A 4GX2A 3UUWA 3UWPA 3NNDA 3HPRA 4E5YA 4U7JA 2YICA 1E63A 3OKPA 5CH8A 1KYZA 1XHFA 3EJWA 5AW9A 2G17A 4MAAA 3NKVA 3CQ9A 2UUOA 1YRYE 1JG3A 1ODTC 1QS0B 3PEFA 4GT1A 1JAIA 3F8SA 1Z7WA 1JU9A 2O0JA 1V3VA 1M54A 3KKZA 1Z5PA 3UHPA 2LW7A 2CXUA 4HQOA 5DNCA 2QLBA 1IOWA 1NQVA 2CC2A 4CM6A 1QXSA 5CX1B 4DG8A 3I92A 4C06A 1H5QA 3D8RA 3Q3VA 5JNWA 1U0FA 3R5HA 4ED9A 1PHPA 1Z4JA 3BIWA 3P9RA 4B2PA 4ITVA 4M9UA 3ZWQA 3EVFA 1DOAA 2C8JA 1NQOA 1THZA 2VF7A 2R11A 3S8MA 2CJYA 1VDZA 4KQMA 1WV0A 5JDCA 4EUKA 4JNCA 3HP4A 1PNVA 3EASA 4B3HA 5ERGB 2FWAA 2NSYA 3MBKA 3MUEA 3H5VA 1QK3A 1DBPA 2BC9A 2D1SA 2Z5VA 3O82A 4FQ7A 3RVMA 5A02A 4R05A 3D4NA 4GWGA 1Z7BA 1AN9A 4BLUA 3CG4A 4X3CA 3EF1A 2QD2A 5IJ0B 1QZTA 2Y99A 4TT3A 1FU7A 4CLOB 1EFVA 4WOKA 3DT6A 3F5QA 1LEHA 4DQKA 4WADA 3BTUA 1E2PA 2VUUA 4LKOA 1AKQA 2OM2A 5B7PA 5FCDA 1PJLA 3EGCA 4G56A 1AHNA 4MQFA 4AMBA 5IMSA 1ZNZA 4B44A 1XTUA 3MXOA 4L15A 3ABQB 2HMTA 2BP7B 2UZ0A 2Y1OA 4C4YA 4CMKA 1FNSA 1F9AA 1ISIA 1T9HA 3G17A 4KLNA 5EESA 2V5AA 1OZAA 3OU6A 4N5HX 5EZSA 3DE1X 3K2EA 3MT8A 4CMIB 5AW6A 5HRCA 3JD3A 4EMUA 4F5EA 2FEWB 1RABA 2PD6A 1H2RS 4YGXB 4ASUA 4QVIA 1JAYA 4LBWA 2YWJA 2HNBA 4RMIA 3UFXA 4YP6A 1LUAA 3TKAA 4HNVA 1LPBB 5F4BA 5A7HA 4KN9S 4GOLD 3WMEA 5BMVF 3DFMA 4I2VA 1A2BA 3WL3A 4ZC8A 5A9SB 3MWYW 2QZ4A 5L53A 1AGXA 2W2QA 4AG6A 2XVXA 1GYQA 4JK3A 4PVDA 1FDWA 3FLEA 3FCOA 1WEHA 1SWWA 4E5UA 2OCPA 1FMFA 4J07A 3LBYA 1SBNE 5HKBA 1W93A 2C31A 4C7OA 4O4IB 2GETA 1UADA 3BHMA 4MQ6A 4AIIA 4KPUB 2FSVA 2BKUA 5LA6B 4BGDA 5K3EA 3KB8A 3CMCO 3SF0A 4P2GA 4DR1B 3RYFA 1DIAA 4X6YA 3MJ4A 3JQPA 4RVNA 1XX6A 3C5VA 4HF7A 4URWR 2PKEA 2R85A 4QOEA 5AM4A 3T34A 2ZE8A 4IG4A 2Q4DA 4QOFA 2I7TA 2NV0A 3OI7A 8ABPA 2R6FA 5K0BA 1X7WB 3IQIX 4LQCA 4DHEA 3QYJA 1RPNA 1RRFA 1H1TA 2DWCA 2CFCA 2QUZA 3Q3CA 4Q9AA 2CKMA 1WZ2A 2GEKA 1KC3A 1W1IA 3GH3A 4YHHB 3LGSA 5A2GA 1PFGA 3MIZA 5HQ3A 1ZW6A 3OLYA 2EP8A 2PL5A 3NYIA 1LSJA 4FQ5A 1NASA 3AB3A 4U7WA 4XJVA 3KTAB 4S1TA 3K0AB 1VHTA 1ZN2A 2ZI6A 2CXTA 1DFHA 3D1LA 3EWSA 3WZLA 5A3RA 5DXFA 1M34B 2HSZA 1P7CA 4EX7A 4NR0A 4FYJA 3BKXA 3KELA 4RSHA 5IW8A 3W1VA 4U4AA 4DLYA 4ZVPA 3P9NA 1TQ6A 3J80A 1BRMA 1FFEA 4QHTA 3OTGA 1HDOA 3BMXA 1N1DA 4JSRA 2FFAA 4WOPA 3NTQA 5HJEA 4PRLA 2CXSA 5BSEA 4I36A 2HN9A 3PNKA 2PY6A 2AXEA 1GG8A 2DCUA 4X41A 2DHQA 1H6AA 2R8RA 3VH2A 3IJEB 2ZRJA 5D6NA 3WHPA 4L51A 3BCRA 3FRHA 1KRXA 1KO4A 1L4NA 2O19A 4X66B 2CCGA 5KYYA 1OX5A 3KR9A 3T5TA 1QH0A 4R1OA 2P2YA 4ZT2A 1PWEA 7ADHA 1DGQA 2H5IA 3O3MB 1DO8A 1V1MA 3SXJA 1WULS 4JXKA 4XX0B 2JF0A 1LW7A 4MJLA 3V2IA 1A2QA 2ODWA 4YRRA 1P3JA 2DBQA 3B6MA 3O2JA 4HWPA 1UZLA 2X0NA 4JYBA 1ZWLA 4R9VA 4DV0B 3FCXA 1RMQA 1ATZA 3HCFA 3ROGA 3N2EA 2PS3A 5KYTA 5EIFA 5TB5A 4XFJA 1GPMA 2PMWB 4QC2A 4Q9DA 4Z2YA 3NDBB 3KD3A 2XOKD 5H82A 2X4DA 4FNMA 1CULC 2H2IA 4WZAE 1VE6A 5BWCA 4LUCA 2Z4TA 1ZI9A 3I5UA 3SE7A 4Q05A 1MJNA 3EC7A 2NZJA 1IB0A 2IU3A 3EAQA 4HLUC 4Z99A 1UOPA 4C4AA 4TUYA 4X64B 1N78A 3TKYA 3G1UA 2HA7A 1YZTA 3O3CA 1IRIA 1E9VA 2ZSDA 2XECA 1Q1AA 1NUPA 5C3MA 2XTJA 4WNCA 3U4AA 2XQJA 1YTLA 4LF4B 2HMWA 1FNMA 5IKOA 2OHXA 4TROA 2V6GA 2X3YA 2O3JA 1YS2X 2LGJA 3WNZA 2GAAA 4BCBA 3LBAA 3T0FA 1HE2A 4IUYA 2XCTB 3CCFA 4EB3A 2EF0A 1A5ZA 3I6YA 2ORYA 4O1MA 4BXOB 1T2DA 1VSTA 1S3GA 4EJSB 1OT3A 3DTVA 3LOQA 3WGIA 4J1TA 1N77A 2KE5A 2JJYA 3GZJA 2HU2A 2IXDA 5IAJA 5D5QA 4GVXA 1ORWA 3W3AH 3EEOA 1U0SY 1NU6A 2I4MA 1J1IA 2E6KA 4U9IS 3RYIA 4LDAA 1GPBA 2JAQA 2IIBA 3U4HA 4G07A 2VT7A 1YC5A 2CBGA 4NBRA 3KQHA 3TW4A 1E5DA 1N5DA 1E8MA 3AHDA 3PSHA 4JLJA 1YT5A 1M2HA 2ODEA 3JYNA 5BW8A 1BA2A 4TQGA 2QTVB 4YV0A 1VLJA 1FP7A 2RBGA 4YO8A 1ISPA 4ZIRB 4MVJG 1VLHA 3B89A 5DTJA 4BNUA 3E6AA 3KB1A 2JHGA 3H9BA 3IPYA 4DNQA 4OSPA 4J0KA 5JD6A 2PAAA 1KIMA 2QPTA 5AKJA 4A6XA 3W5DA 1JEYA 1QR2A 4I4TA 1S3IA 1YIAA 3K09C 4NOMA 2GGSA 1U1CA 2JFBA 3PDUA 3PXCX 1QR6A 3OX2A 1BKDR 4ER3A 3LY8A 4PX9A 1QBGA 3KZOA 1E1LA 2AC2A 1T26A 4JBXA 1W36C 4HNRA 1E99A 1UAYA 4P7BA 4RF2A 3W2TA 2FFJA 4ZVOA 2F64A 4LY9A 4KOEC 3HFRA 3PC8C 1KFEB 4QQRA 4A27A 1Z7EA 1Q83A 1YVEI 3ESDA 3I9FA 4GVLA 1SHUX 4NYMQ 3WGQA 5JAHA 3S68A 4JFAA 4EBFA 2D0DA 4IDFA 4N01A 4JYAB 1CF2O 1TEHA 4ZEMA 1SG9A 4YJKA 3I12A 1GGJA 3CO5A 2OFXA 2DYKA 4CIDA 1C5KA 4DR5B 1TX4B 3LDGA 4UM8B 3AKCA 3L01A 3RVQA 2YHIA 1E0KA 3EWNA 4Z7QB 1P0MA 1PJSA 2PL1A 4KIJA 2V97A 3PA6A 1JLHA 2CFTA 4MS3A 4F6CA 1LGYA 4MDFA 3SC2B 4RL6A 3O9MA 2HJ9A 3QVVA 4ZXFA 2V3VA 3EQ6A 2DU8A 2H7YA 4C05A 1EP1B 2GXQA 2XBLA 4AW9A 4DSOA 2Q0SA 5TT1A 2QRUA 4IIDA 2AJBA 3IVRA 4I5EA 3DUFB 1YDHA 3KX2A 2QMYA 2P35A 4DSTA 1Z6PA 2IYNA 2Z2JA 3GELA 4B6EA 4H1WA 5A3VA 4YTEA 1RU3A 5IJWA 2IY8A 2YY7A 4FMCF 2AN1A 2XQIA 4MAMA 3RLIA 3BXXA 3MCWA 2DKFA 2QTWB 4D43A 1D4AA 3TOXA 1TF5A 2O1EA 4IWYA 5KQSA 2Q4EA 5HGJA 4EI7A 4JGBA 2WJWA 3FWZA 4WCFA 5BN3B 4YWJA 1Z3IX 1NYQA 3IQFA 3MOSA 3EJ6A 4GM1A 4LOLA 2BMFA 5F12A