4LE0A

Crystal structure of the receiver domain of desr in complex with beryllofluoride and magnesium
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
132
structure length
132
Chain Sequence
MISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Dna binding protein
molecule keywords Transcriptional regulatory protein DesR
total genus 47
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4le0A00
1YK0A 3QLUA 5IX8A 3O21A 2HQBA 4MRMA 3FGZA 1BAPA 3OMWA 1CEYA 1RPJA 1YK1A 3RVKA 5TQJA 4NICA 1JF8A 1KRWA 1U8TA 3MF4A 3RQIA 4ZYLA 4QPJC 4WWHA 3RVJA 1APBA 2ID7A 3O1HB 1DG9A 2E4YA 1L5YA 1QQAA 4IF4A 4M88A 2WY2D 2VUHB 3NBMA 1GCGA 4TLLB 2RJNA 3KJXA 3M6MD 3UK0A 1PNTA 3LKVA 5TPZA 1D4ZA 3EODA 2PUDA 2FVYA 1FFGA 1GCAA 3H1EA 5C5EA 2MSLA 4RK6A 3O1JC 2FLWA 2TMYA 5FBKA 3VNBA 3QX8A 1RNLA 3OM0A 1USIA 2CD7A 2E4XA 1M2EA 3GL9A 2QSJA 4XARA 3EAFA 2N9UA 4XASA 4Z4IA 2L2QA 2PUCA 5EWJA 2FTKE 3FFWA 3K9CA 3T6KA 1USGA 1JLKA 4F8JA 2A9QA 1K66A 3CG0A 3T38A 4L4UA 1ISSA 4Z4FA 5B3JC 2R48A 2L17A 1SXHA 4LZLA 4W5QA 3ROTA 1Z15A 3LUDA 4YS6A 2E4WA 4IMIB 4ETNA 4YCSA 3SAJA 3KG2A 4KV7A 4F12A 1QMPA 3GV0A 1YIOA 3JPWA 2KYRA 5PNTA 1QO0D 2PJUA 3DZDA 3KCNA 1JFVA 1U2PA 1RZRD 1ZN2A 4G0ZA 1XHEA 4UHKA 1EWKA 2WRZA 1D5WA 3HUUA 4S04A 3G85A 1CHNA 1K68A 1ZAYA 4MR8B 5JNVA 1KGSA 2MYTA 3Q41A 1F4VA 1YMVA 3QLUC 4KQCA 1Z16A 2CWDA 4G0PA 4Z4HA 2JBAB 2L18A 1Z2DA 5CHYA 2QW1A 1CYEA 4FB4A 2NT4A 2FKAA 3I09A 3QELB 4RWEA 2RGYA 3RVPA 5E3JA 4YP9A 1ABFA 1DRJA 1YS6A 2IPLA 3HV2A 5DGCA 3SQNA 4PZ0A 5BR1A 3DGFC 3IDOA 1DRKA 1R8JA 3H5LA 4ZMRA 1GUDA 3KS9A 4OATA 5CNJA 1XHFA 1ZESA 4HYEA 2V0NA 3D02A 1QPZA 4PYRA 3HVRA 3O2QB 4E7PA 1I3CA 5KQPA 4KNYA 5CNMA 4ETMA 1EWTA 3RH0A 1DCKA 3IP9A 5FWYA 2JRLA 4N03A 5TPZD 2AYXA 2FXIA 1OXBB 4YLEA 2FLKA 2RDMA 3FFXA 3KKEA 5ABPA 5FWXB 3OQNA 3N6VA 5DKFA 1BA2A 3CZ5A 5EWLA 2O20A 1JHZA 2FMHA 2PE5A 4MS4B 4XAQA 4OG2A 1C4WA 4HNRA 4EYKA 4RY8A 4FE4A 4MR7A 1EFAA 1USKA 3F73A 4N76A 4HNQA 1TVMA 4MQEB 4W5RA 2NZVG 3LUFA 5IEJA 3BREA 2GI4A 5B3JA 1UDRA 4RXUA 5EWLB 1TLFA 2FEPA 1NATA 1E6LA 3IP7A 5FWXA 1JH9A 4RKRA 4KPYA 5TQ0B 2MSWA 2JVKA 3RVOA 4N47A 3E3MA 3RVQA 2WJAA 3W9SA 1AB5A 4EGSA 3L49A 3DBIA 2WJWA 4XLTA 3KYJB 3N8IA 3QEMB 4NV3A 3HXMA 2PL1A 3IPCA 4WZZA 5GQSA 1P6UA 1RXIA 3C3KA 1ZGGA 3OLXA 4KK4A 1A2OA 4G0MA 4MS3A 4RS3A 5KQLA 4MS1B 3LFTA 2CHFA 3QLVA 1NY5A 1ZH4A 4F11A 3H75A 4KZKA 2WWVD 1VLZA 5IUJC 4Z4GA 1H9CA 2HSGA 4O5AA 2JVIA 5EWJB 1E6KA 4LE2A 1U04A 1JDPA 1PEAA 4KRFA 2FMKA 3C6QA 3F6PA 5KC9A 1BVHA 1M5UA 3TO5A 3EGCA 5DTEA 2PUEA 1FFSA 1LBIA 3CRNA 3QEMA 4MPTA 4MQFA 2IDMA 4EVSA 4KFCA 4YWHA 3IP5A 5TPWB 1MIHA 4RY0A 4TMYA 3GRCA 1SXGA 2YHBA 3JS5A 4F06A 3NNDA 2IKSA 4EY3A 4MAAA 2ID9A 3C3WA 2FMFA 3GWGA 3LUAA 1U2QA 4OLBA 5JS2A 3O75A 3N75A 5I4CA 1DC8A 2JCGA 3A10A 4XXHA 3RVNA 4FE7A 2DRIA 3I5AA 1HEYA 3GT7A 2XDYA 2J48A 2E4UA 2FEKA 4YGXB 5BRAA 1FFWA 2NUBA 4D74A 1IIBA 1E2BA 4RY9A 2P9HA 4TLMB 1U0SY 1F51E 1D2AA 1BDIA 2FQXA 3OMXA 5D2CA 4Z99A 3H5WA 1M2FA 4H60A 4RKQA 5KWSA 2NT3A 3H1FA 2A9RA 5JNWA 2E4ZA 3CKMA 3T8YA 2FN9A 2JVJA 3QELA 3JVDA 1GUBA 3LMKA 1SD5A 4GPAA 4HNSA 4WT7A 5CNKA 3NHMA 3JY6A 1Z18A 3BILA 3CTPA 3QLTA 2PLNA 4TN5A 1ZHHA 2VUIB 4RSMA 4E7OA 2MYNA 4RK4A 2R47A 1S8NA 3OLVA 2LIVA 3A3KA 4MR8A 2QU7A 3C3MA 2Q5CA 1YMUA 2PUBA 3LUHA 3E61A 3KTOA 1OXKB 1AB6A 3MM4A 5EWMA 4F3TA 2CHEA 3CS3A 4KMRA 1P6QA 1Z12A 3B2NA 3H5IA 3OLYA 1Y1LA 4JB2A 6CHYA 4OBBA 3QLVC 2JK1A 5TPWA 1JFTA 1NXOA 3MMNA 5JNSA 3NNNA 4MS1A 1YTUA 1Z13A 4LRQA 4RK0A 4JASB 2GWRA 4RXTA 3EULA 1EAYA 1QP0A 5TE9A 1PNRA 1WETA 3KSMA 2LUOA 4YR7A 1TM2A 4MRMB 3T95A 4DADA 4EYGA 2A9PA 3HCWA 5HM6A 1DJMA 1Z25A 1LJLA 3OO1A 3P9YA 4ZJPA 2PUAA 3DGEC 1VPWA 5JNUA 3K4HA 1P2FA 4NCBA 3RVRA 5JNRA 3N0WA 3DLHA 4OTZA 1KMIY 1ABEA 2FQYA 4QYWA 4PICA 3HS3A 5HKOA 4EYOA 3VNAA 2E4VA 5TQ2A 1RZRA 4LE1A 2NZUG 5FWYB 3OO0A 1ZY2A 3FDFA 1PUXA 4N41A 1E6MA 4IRXA 3F6CA 4EUKA 3MA0A 4MYRA 1XWWA 1VKRA 1T34A 2H0AA 4RDCA 4LE0A 2F8SA 2L19A 4WXMA 1NXPA 3GYBA 4IGAA 3OM1A 3UUGA 2HQOA 7ABPA 4EYQA 4W5NA 4Y9TA 2MYUA 1MB3A 3HK2A 5IULC 1RXEA 2IPNA 3EDCA 3OLZA 4JAVC 3TB6A 1DP4A 1NXXA 1QO0A 1J56A 2H3HA 4MR9B 3FMVA 3H6GA 1L5ZA 3HEBA 4MS3B 4MQFB 2ZAYA 3CFYA 5KI6A 4P1ZA 3NHZA 3ROFA 1NXWA 3EQ2A 3IP6A 8ABPA 4W5TA 2FSPA 3N0XA 2FQWA 2FN8A 1JL3A 3ILYA 3M9WA 5T7BA 2QXYA 5KQMA 2AYZA 4Z9AA 1DCFA 1PHRA 3EQZA 3F7NA 3MQ4A 4NQRA 4JP1A 3N53A 3CZCA 4PEVA 3BBLA 3L6UA 1A0OA 2LPMA 1GLGA 3SNKA 1QP7A 3QK7A 4MQEA 3HJFA 4YO7A 3Q7SA 4Z4CA 5HQJA 3GBPA 4Z0NA 2VYCA 3HM9A 3I42A 2I6FA 3LKBA 3M9XA 4B09A 2LBPA 2P4UA 2IYNA 3HDVA 1JDNA 3I45A 1QNLA 4RU1A 9ABPA 2FMIA 1LK0A 3FFTA 1YS7A 5IBQA 3RVMA 5JS1A 4G0QA 3O2SB 3HDGA 3H1GA 4Q6WA 4D6XA 2PUGA 3QEKA 3TD9A 1QQBA 2HJ9A 3S99A 4MLCA 1ZITA 4ZMSA 4GNRA 1JWLA 4IILA 1B00A 1Z17A 1W9HA 3OQOA 4S05A 3H5VA 2QVCA 4MR7B 4L85A 4W5OA 4LDAA 1MAVA 5TQ0A 5FBHA 3TMYA 3QX9A 2OENG 3HO1A 2YHAA 4G0OA 5KQGA 3GBVA 1LJUA 5DCLA 4N0QA 3CHYA 4D6YA 1M5TA 3NNSA 4G97A 5KC8A 4UHJA 2IPAB 4G0XA 2GKGA 3LTEA 3ILHA 4MR9A 1TMYA 4MGEA 4DQDA 4KREA 5CNIA 4H3HB 3LUCA 5DLEA 1ZGZA 3KLNA 1DZ3A 1QKKA 2QZJA 1DBPA 4G86A 3MIZA 4Z9BA 5JNTA 1DBWA 2PMCA 1JYFA 4OLAA 2GBPA 3SY8A 4KK3A 4EVQA 2R4QA 5BQ3A 3CLKA 3H5OA 1NXTA 4O1HA 5IC5A 1NXSA 1FQWA 1YVUA 1P8AA 1Z26A 3LUGA 3JVIA 4RK1A 2PAFA 2QV0A 2M1ZA 4Q7EA 3SG0A 3EJWA 5HSGA 1FSPA 2HQRA 4H3KB 2PL9A 3KHTA 3JTEA 4O1IA 4EVRA 2JBAA 3O1IC 3CU5A 2M98A 3LUKA 4QYMA 2HPHA 5TQ2B 3C97A 1URPA 3OLWA 4KVFA 3DLBA 1VRVA 5GOTA 1ZVVA 3TX6A 4ETIA 3BRQA 3URMA 5IUNC 3MYYA 2IOYA 3OQMA 5ED4A 1JFSA 2BGGA 4N0PA 3Q7RA 2X7XA 3H5TA 5C5CA 2PKXA 1EWVA 3H6HA 4YRZA 3SM9A 3JPYA 3N0RA 4G0YA 3RVSA 4KQ9A 4LX8A 4PE5B 4RXMA 4P98A 1W25A 2QR3A 3O2JA 4Q6BA 1ZH2A 1BDHA 1NXVA 1DBQA 3BRSA 1LBHA 1SRRA 4MLDA 5IEBA 5BRJA 4MS4A 2VK2A 3RVLA 2MSKA 3G1WA 4RV5A 5T3YA 2PUFA 3KLOA 3A0UA 3LOPA 4LDZA 2OQRA 1ISRA 1QP4A 2JB9A 4RK7A 1DC7A 4Z4EA 4QICA 4NCAA 2B1JA 3CNBA 3Q15C 4DN6A 3HZHA 4JOQA 2A9OA 3HSYA 1D1PA 1DCMA 2ZWMA 4YV7A 3Q9SA 3R0JA 2WMYA 1MB0A 1ZDMA 3GA5A 4RZSA 3UKJA 2GX6A 4RK5A 1SXIA 3HUTA 1PEYA 1JYEA 1C0EA 2LP4Y 4XFKA 3CG4A 1MVOA 2MYPA 3KYIB 4JA2A 2FEWB 2R25B 1JX6A 2RJOA 3Q7TA 1D1QA 2FW0A 6ABPA 4WXEA 4ZPJA 5EWMB 2IPMA 4CBVA 3D8UA 2B4AA 5F64A 4ML3A 3LUJA 3O74A 1TJYA 1JBEA 1A04A 1KRXA 2QVGA 1BDJA 2W42A 4IMJB 1NTRA 2WB4A 1EHCA 4JB0A 4WUTA 5IUKC 2F8TA 3IPAA 1Z2EA 3A0RB
chains in the Genus database with same CATH superfamily
4Q15A 1NWHA 3CN7A 5IX8A 5CXSA 5LQNA 2CUTA 2FUKA 4JUIA 4BMZA 2HSEA 4HXEB 2IUFA 4CR8A 1XA0A 1QR6A 1YNOA 2A5GA 4OAQA 3NHFA 1P80A 1QYCA 1RPJA 3CR7A 4XEUA 3GPIA 2K5UA 5LPNA 3KB2A 4L7QA 2HA3A 2J7KA 3TGLA 3FTFA 3SKVA 1VHLA 3X2SA 4W1RA 3W4JA 5HS4A 2II6A 4JBIA 1KDTA 4HEHA 4FOLA 1OI2A 1RU3A 4TWJA 1XXHA 1D04A 1E9EA 3MGBA 1XZAA 4QXQA 3X1JA 1PGPA 3HC7A 3BXXA 5C3UA 1Y5NA 6CHYA 2JLCA 2RHLA 3EODA 4PCVA 3RBAA 5B36A 4OGLA 4LV8B 3VKVA 1FNCA 1G8AA 1PR6A 4N7JA 1NMZA 1PJ2A 3EVCA 1SWVA 1XSEA 2GLXA 3N7AA 4DEXA 4TN1A 3VR3A 2HEIA 1QO9A 3HYRA 4GXQA 1NVMB 2E4XA 4FYJA 1HG1A 2QSJA 1ZMRA 4I1UA 1AO0A 4F9EA 2XRFA 3AIOA 1BOOA 1GGFA 1PO7A 4BFSA 1H2YA 4OB6A 4EZIA 1SIWA 1DI0A 5G40A 2R8XA 4CEIB 3BL6A 1SCKA 4FIZA 4DJTA 3K70D 3DO8A 4BAUA 1SCJA 1THTA 2JFWA 5KHOC 4LBYA 4Q5IA 4V2IA 2GN6A 4DRYA 4X93A 4ER3A 4OI4A 4EY5A 1M8JA 2R6JA 4BBZA 3WRXA 1M74A 5EP4A 4DIEA 5A0VA 5J2UF 3ZHZA 2D4HA 1P44A 4MUMA 1JAXA 4R2HA 3SICE 5B7PA 3L7IA 3ROZA 5EHXA 5JD6A 3FPJA 2VYND 4JYMA 3ILVA 4QZVA 2PKCA 3B78A 5GJBA 4XZ3A 5CYFA 5I9BA 3KFVA 3DMFA 3PPYA 5G0VA 4C0HA 1Y3IA 1OXVA 1W96A 3B6KA 3CRZA 1HYQA 4HX9A 3C8HA 4F4IA 2CXTA 4JROA 5A7FA 2CK3A 3NXKA 3ZS8A 5EGSA 3UMCA 2VIIA 1QRTA 4TXNA 3TW4A 3E5RA 2WIBA 2Z2KA 3MB5A 3PSAA 4RCZA 2R5NA 1PFKA 3OOWA 1DUIA 3K30A 4I4TA 2CEAA 4LZOA 4MW7A 3HRHA 4PYKA 1U2DC 2OB2A 3ESAA 3HU5A 2L69A 2WJGA 3EG5A 4HZIA 4NG4A 1F4VA 1D2HA 3V7UA 4ND1A 3QLUC 5CR9A 5ALFA 4XLLA 3RCBA 4MUBA 4FP9A 2EW1A 4OP1A 1P0CA 2WT4A 2PJRA 2L18A 3CMCO 2MIIA 1R0CA 4RZHA 4B81A 3TMKA 1PW7A 2X0NA 4N12A 1WUTA 4UBJA 5F98A 4RWEA 1B16A 1YVRA 2Z2IA 4WESA 1RM5A 2D7DA 3HV2A 1VKOA 1PTJA 5IJAA 5EXXA 4QWMA 1PL7A 2YTZA 1E1RA 1YB4A 1DTEA 4FHCA 4O59O 4UEKA 2EQ5A 3ZNOA 2OGTA 4EGFA 2AWOA 4JZYA 2IPXA 5D7BA 5A9SA 1RI5A 1SOMA 2LVBA 4Y9DA 2IA5A 3CJRA 2GEUA 3DEAA 1C9MA 1RYBA 2QV7A 3FWNA 4KHPB 5D87A 2HK9A 3P2IA 3AESB 1S02A 4A2PA 1PR2A 3NP9A 2AYXA 4S1VA 1OXBB 1QIHA 3K6KA 4OHYA 2OSBA 3VH2A 2ZRLA 4NZZA 1UM9B 5HPYB 1N8SA 5EWLA 1YB5A 4K6FA 5FI5A 3SHVA 3BMQB 2DX7A 4CN8A 4MQMA 1EP3B 3B1XA 4PRKA 5U1PA 4DS3A 1LPSA 3KZVA 1QU3A 2VPWA 1E8MA 3KYDB 4G8JA 4XOUA 3GDOA 5C7IO 3H1PA 4JUCA 1U0NA 1NW9B 3L1VA 1T1RA 3RS7A 1FDIA 2G1UA 3RWOA 4ZGGA 3T1HB 1TRKA 1V4VA 1QWOA 3C98A 3HB9A 4FXOA 4RA9B 1TLFA 1OFUX 1JJFA 2OV2A 4M53A 3IP7A 5EQFA 5FWXA 4RKRA 3UK7A 3SK0A 3U6BA 1WVMA 4IDBA 2GYVA 4JYPA 3ENVA 3FA2A 6ADHA 3CXUA 3SMVA 1U2ZA 5DLPA 3PPWA 1Q1BA 1UCFA 4U7PB 3SJBA 3UHOA 5IT4A 2JJ8A 1YQTA 2C3MA 2WJWA 5ITVA 4CLRA 1E7QA 1Q15A 1UXHA 3LDHA 4CLOB 4K88A 4MVJH 4DWJA 5H81A 3Q9LA 3A1SA 1KY2A 3OIVA 3ESXA 4S0XA 3TVTA 3KQMA 5F4BA 5J5CA 3FB1A 1H22A 4FINA 4IHKA 2O1EA 4RA6A 3FRIA 3HJRA 3PC6A 5J4YA 3MLEA 4OLFA 5A2QA 2NYRA 4N49A 2BZ0A 3GC6A 4YRQA 1EG2A 1YONA 3FSRA 5IT0A 4OSEA 1C8LA 3CH4B 4IH9A 2ATIA 4L6IA 3T54A 4KR2A 4D26A 3CLVA 1UOQA 1MIOB 5GONB 1HDEA 3PQ7A 3GZNB 5EVCA 2PUEA 2YXDA 1OXXK 3ZY6A 5GZ6A 4FMDF 3TFWA 4HNHA 1A9RA 2VDWA 3MN1A 3FPAA 1PL6A 3GRCA 1YZYA 3D7MA 3DDCA 3E3LA 3QUBA 4K9SA 4QO7A 3NNDA 5D00A 4QYIB 2PSDA 3WLSA 3IL2A 2O8BB 4MAAA 4DMLA 3TNDA 1W87A 3X3HA 3ZY2A 1XTVA 2EBWA 3TJZA 2C7OA 4OLBA 3CZRA 3MIZA 4GMXA 1BFKA 1PG2A 1RM0A 1SOVA 1A27A 2JCGA 5I4CA 3NOOA 2UUOA 3DMDA 4JX9A 4P2GA 5DHSA 1LC0A 3THXA 3TR0A 1P39A 1VJ1A 2FXVA 4UNSA 2Z6UA 2BCEA 3HN6A 2J9FA 4IDHA 3REOA 3SBDA 3G2LA 2RC6A 3WGNA 1PV4A 2QTFA 5A3JA 2C92A 3B52X 3OTQA 5KOJB 5I5GA 3E4CA 5J1TB 5E95A 5GIPE 1ZZEA 2AEFA 3E2MA 1SUWA 2F1RA 4YA6A 4Z99A 4GX0A 1DX4A 3KQTA 2O0LA 4KQ1A 4XH9B 3CPJB 1D2GA 3MPUA 4HDCA 3C2QA 3OT1B 2JVJA 3C5WP 4HRYA 5FNVB 1W5TA 1OILA 3STUA 1SD5A 4WT7A 3IOYA 3DD1A 4I50B 4WA7A 4K86A 1E3WA 3TAHA 3WFJA 1O0BA 2GNPA 3HWX1 3BILA 3QLTA 4HLDA 1RWPA 4DIUA 1D2NA 1GXSB 2Y1WA 1KZGB 2GEBA 4FDVA 2BCJQ 2GXUA 4HB0A 3ND7A 3U1VA 3HZZA 2HUPA 1GNRA 1GCOA 2VDVE 2Y9PB 1JVBA 1NLYA 2AQKA 3CNLA 1XOIA 2BFCB 3EDRA 4M89A 1ZJJA 2O1XA 3HPQA 5JARA 4PZEA 2HDOA 4R1NA 1UXJA 4KMRA 3FCXA 5E2AA 2BR3A 4IUCS 4K0RA 1C14A 4LCBA 4YCNA 3NHWA 2P9BA 3QLVC 4TV8A 1AMUA 2JAXA 2I3AA 1PJRA 3OVMA 2OV6A 4KE6A 3VH3A 1BX0A 2BAGA 1WPXA 2XGOA 3FDIA 4LRQA 4BQSA 4BEWA 2ZB2A 1OB2A 1FE8A 2P5SA 1W0JD 1WBJB 3BAZA 4G41A 1VECA 4LZNA 2HM7A 2YJ4A 4XGRA 2GYWA 3BE6A 3IEUA 4LXGA 5AKZA 5GADl 3HA5A 1LTKA 4UU1A 4J94A 3FPEA 1B8PA 3RIMA 4CMHA 2FRDA 2Z2ZA 1KSJA 4AY4A 2AVDA 3RS0A 1I2MA 3AVPA 3UWPA 2P3QA 2ZIFA 4YB8A 1P77A 5F3WB 4WZBE 3CRMA 1QR2A 3IVRA 3N0WA 2BDUA 5E4TA 3AL0C 3HYSA 1VGRA 2O3SA 3PRHA 4N5NA 3CZ4A 1SQGA 5E4YA 4GL4A 2QX6A 3AIKA 2ZS7A 4A2CA 3P9SA 1CDEA 3ZX5A 4AKHA 1KAEA 3PNLA 3VPHA 1I2AA 1BMDA 1E62A 4B6EA 3JAMA 2UVDA 3ABOB 4JHLA 4Y18A 1B8VA 4V39A 2I2AA 4RPHA 4GPZA 2DPLA 4LNUB 2ENUA 5F3RA 3DDOA 1Y5RA 3HO6A 1MAUA 4EB0A 4FGLA 3BKXA 2YZMA 4HS9A 2WDZA 4UNIA 1D0VA 1Q11A 1UOEA 3R5KA 1HQKA 3RUEA 3UW1A 5IULC 3FHOA 3OEED 3L1KA 2I1QA 3DG9A 5GONF 2PMEA 5IM5A 5AM2A 2JGFA 4RNDB 4XYLA 1TNDA 5KSYA 4D8VA 2H08A 3HEBA 3I6MA 5JSFA 2YWFA 4WCFB 4XD2A 2A84A 3IELA 4CL8A 2CDRA 5DNVA 4E33A 3F6SA 4LHZA 3BL8A 3L0ZA 4QIHA 3SS7X 4AMUA 1GWNA 3PGLA 5IT5A 3ZU4A 1DEXA 3N0XA 4GD3Q 2YWDA 2H4HA 5JVDF 5AOCA 1T26A 2GHRA 1WLYA 2V03A 2WU1A 3KB6A 1E2JA 2ERYA 8GPBA 3HU1A 4M9RA 1O94C 2WSIA 4QEDA 3PE3A 1W2GA 1NVDA 4I50F 4QFDA 1A0OA 2OC9A 1IUNA 4NENA 4AO6A 3H5NA 1ULSA 3TNJA 4ZEVA 4P0QB 1FY2A 3MIIA 3NC0C 4LRXA 2HXGA 4UCXA 2D06A 4Z0NA 5DX8A 4MMXB 2F67A 1HX7A 1P31A 4RVHA 2X9NA 3LKBA 1A9TA 1KZ1A 3LA6A 5AWFC 4PIPA 4DA7A 4RHYA 2W7TA 3K2QA 3M70A 5B12A 1KOJA 4D4HA 4YCBA 3ZU5A 2HV9A 5KX5B 4G0QA 2XA2A 4PAWA 3GPBA 3O8DA 1E98A 3LYLA 4NBSA 5CB4F 2K2WA 4M8NE 1U4SA 4MLCA 4EA9A 1JUDA 1UBKS 2P7IA 3Q72A 1CVRA 3KZ1E 3MJHA 2XB2A 1ZGAA 1N3BA 3WWCA 1J9GA 1SCNE 3CONA 4L4XA 5KVAA 4TKUB 1QF6A 5HUQA 2J30A 3T7RA 4NDZA 1FU8A 2YS6A 4RAOA 4YJ3A 4ZT3A 1FP7A 5HEKA 3JZFA 4H15A 1E1RD 1KMHB 2FWJA 1CUFA 2GSWA 2LZ0A 2W2VA 2VH5R 5IBCA 5MFZA 1DC6A 2OENG 3H1AA 3ZHCA 2QRQA 5JCPA 3PWZA 3MQFA 1K2VN 2ZJFA 1PJ4A 3AEUA 1GGNA 2PD3A 3P2MA 1S2LA 4ND5A 4UUBA 5C1DA 4X45A 3D3NA 3RUHA 4CXMA 4ZT6A 3MJTA 1L7DA 2JCVA 2YCLA 3GJXC 1H23A 4BLQA 2B4QA 2ZJ2A 4Q4HB 1JNXX 2BM8A 1CQXA 2BEUA 1Y9ZA 2AR9A 2DY0A 2WUEA 3KQQA 3M6VA 3MB8A 1X8JA 1H8ED 1P9RA 3HABA 4QTTB 4LUCA 2V7UA 1OJ7A 5CK5A 4ZJUA 2V6IA 2PGLA 3CLKA 3E9ZA 3QVSA 3GG2A 1HFEL 1XU7A 4O1HA 5BSRA 2BD0A 4XD7D 1YVUA 1WQ3A 1HZZA 2VQEB 3ESBA 2NSDA 1G3IA 2BMWA 3CPHA 1SWWA 1ZC3A 1H94A 2BVNA 4MDYA 4PSKA 4WERA 3ORRA 4YRTA 2JDID 5EFZA 2PXHA 2CFTA 5AI4A 4GEKA 2BJHA 3G79A 4MI1A 1O9GA 1EJ2A 3IIEA 1TM4E 1R0KA 1TA9A 3F67A 1XCOA 1UC4B 2KI5A 4OJMX 2WIKA 1J4AA 4YDRA 1KEVA 5FKJA 3HJUA 4HNVA 2QROA 4TYMA 4KDFA 4KGZA 3P9CA 1WPRA 2C3UA 3IP8A 3P4YA 3PXXA 1HT3A 2Q99A 2JFXA 1QYDA 5TJ9A 4D96A 2ZYUX 4WKPA 4PYMA 2JAQA 2EDCA 4ISBA 4ZZ3A 3H0CA 3NM4A 1EMDA 1N2BA 4NBLA 4OHZA 1NX6A 1P4SA 3LIIA 1SELA 3QF4A 3QE0A 2X4IA 4OI1A 2VBIA 4EKEA 4J76A 1ZM4A 1P7PA 1VDZA 1XQVA 1V47A 1L5RA 1L4HA 2LIPA 2VK4A 3K53A 4JBLA 3NYWA 4WCFA 1YQGA 3Q1LA 4NYIR 2DAPA 1C3EA 1QYWA 2E37A 4QU0A 4WCVA 2Q8PA 2VT2A 1CUGA 2XUJA 4CMIA 4F8YA 4PO3X 1AC5A 3L40A 5T8KC 1DBQA 1RWMA 2OV3A 1EZ1A 2PIDA 3BRSA 3OFND 2R0QC 1H2HA 5K09A 3W9UA 1AXEA 2ZRIA 5HRAA 3NALA 2AR7A 3A0UA 3HBAA 2WWTA 3KLOA 3WYBA 4B6OA 1EHIA 4XM0A 4DA0A 4BY9E 1Z6ZA 5D3MA 3LTNC 1ZM7A 1T9KA 2EJCA 1J2JA 4ACAA 1JG4A 2FHSA 2X40A 2NXWA 1T25A 3L01A 4FNGA 3K70C 2RK3A 1OGYA 1WKCA 2LRHA 2OCGA 2GBGA 4IIFA 2K6GA 3Q9SA 5JD4A 4ESVA 3FCEA 2H29A 1PJQA 5J40A 3GU3A 1K92A 1IY1A 3UPUA 4GZ6A 1F8GA 4JA0A 5JBNA 4CLXA 1ND5A 3ENNA 3AOGA 2RD2A 1V9CA 3SM3A 1DV1A 4R1PA 1WSDA 2J1LA 3IIKA 1EXVA 1XAHA 2QRZA 5HJEA 1JDTA 1P2TA 1MVOA 2MYPA 4IZ6A 3WP1B 2K7FA 2QUJA 4AROA 5FUQA 3FXAA 4E1AA 5ERYA 3VV2A 1HQDA 2FW0A 5A4JA 1UPBA 2X2OA 4CBVA 3CX7A 3BH0A 4YT4A 2XUHA 1ZI8A 4F3CA 1N1EA 4POOA 3LRPA 2PL5A 1N2ZA 5ARBA 1Q22A 4K40A 3PQDA 3QHAA 4KUEA 3F7OA 3K09C 4LN1A 4QOHA 2C07A 2C3YA 3I2YX 4IICA 1ACMA 3UB3A 4DCCA 3DPUA 3MOIA 2D6FA 2OZVA 3FF1A 3A1EA 3DL7A 2APJA 1KMNA 1WTCA 3BMXA 2YHUA 1GILA 1R6VA 3GY0A 3JATB 3QVKA 1SKUA 4NMWA 5L4NA 1FPQA 2HQBA 2B92A 3KWLA 4ESHA 5LD2B 5CEFA 1JQAA 2BKLA 2VTVA 3R4VA 3VOAA 1C1HA 1TT5B 2A1UB 4RVSA 2HKIA 1PK7A 3BF7A 4QOSA 4X90A 3U9SA 5HKKD 2UU9B 2I6UA 3ELBA 3BC1A 3UWSA 2BY4A 4CEJA 2HAEA 4WQMA 3CR3C 1VIVA 4HFNA 1N6PA 1SC4A 3IP3A 4JLDA 3WBBA 1HF3A 4BNYA 4NEHB 5CX1B 4UEQA 1PFVA 2PKYX 3EARA 5JAHA 2P5YA 1R0LA 2PT5A 4IKOA 2VK1A 1O03A 4IS3A 2Q1XA 3M6MD 2PBRA 2Q2OA 2AT1A 2G83A 2QSZA 3AXTA 2I76A 4WDRA 1RRKA 4ECEA 4HXGA 1PWXA 1SCAA 1U7TA 1C9YA 4FHEA 5LQJA 1ZN7A 3G0BA 2DHRA 2JIMA 3PPVA 2LV8A 3WP0A 1AF7A 1N5DA 4KMSA 1DWUA 3O1JC 5SYMA 4LJ5A 4NS1A 2PMWB 1VDMA 2JI8A 3IR6A 3Q87B 2E5LB 3FVVA 5CAEA 1Z4MA 3CUKA 4OHPA 4XARA 1SBQA 5ICEA 4ZCRA 3THYA 3O4IA 5FLYA 1Y9EA 4ZOEA 1L5NA 3EUAA 3KELA 4S24A 4BLVA 4F92B 2RGNA 1SZDA 1E4EB 3CMMA 3FFWA 1TF2A 4CODB 4EK9A 4UTPA 1PKXA 2WV9A 1ULTA 1NZFA 3DAPA 5LLSA 3IXLA 3RIYA 3UATA 1DS6A 4Z2AA 1KO8A 3CR8A 4E6EA 4EX6A 5JAQA 4CZ2A 3RUIA 4Z4FA 5AK0A 2R48A 3Q2IA 2Z2XA 4LZLA 5EPEA 4F6CA 3A3PA 1SVSA 3OCJA 3ESQA 1KARA 4KPFC 3TSAA 5JFOA 4KOAA 5HMLA 3PUZA 3PHHA 4RD3A 4M9UA 1TW2A 1YSCA 4GMDA 4B2YA 1G20A 2FZ4A 4XQ9A 2W83A 1E9SA 1ZN2A 1KTVA 1P3DA 1O57A 1Z06A 3EASA 1OFHA 4XQGA 4U7DA 1KETA 1DX6A 1ZR2A 2QAJA 4LPKA 3BTUA 1RKQA 4DQVA 4JJ8A 1QHNA 2DPYA 1OFIA 2R6FA 3QXCA 1ECCA 2FRDC 3W6PA 1X15A 3GJ6A 4WNYA 1POWA 3IPYA 3RYCB 4F4UA 5IFKA 3OHSX 4ND7A 2BP7A 2DHEA 3D6FA 1Z0AA 4XWTA 1IBRA 4C88A 2BM0A 1HTWA 1S0UA 2O4CA 3PFFA 4RLSA 4ZOCA 1KFCB 1YH3A 1PAUA 3AVQA 3FNQA 3IOMA 3O94A 4QTYA 1ABFA 1K0FA 3F4KA 1J97A 4YACA 1Z62A 3ETGA 4YJ3F 4UC0A 1LPAB 4KLAA 4AJKA 1C3VA 1WUKS 5EIHA 1NI3A 4GGPA 5DTIA 1KS9A 5FV7A 2YY5A 1BJTA 2QZSA 1QHHB 1TI7A 1U7ZA 1MGOA 3AIIA 4PYRA 2C4VA 5CB4A 1A2BA 3FTNA 2HO5A 1LF0A 3HFJA 2B25A 1Z5WA 3L8FA 5SYNA 1E1LA 1Q6YA 1MO2A 3PVZA 1NJ2A 2JRLA 2QTBA 1VMEA 1FP1D 2QSUA 4R01A 1KL7A 4ZRNA 5SICE 3TCXB 4H2DA 2W6PA 3RABA 4D5GA 1T6BY 1GR1A 2ZYSA 2VHWA 1KYVA 4WSOA 1XZLA 4TWAA 2HLDD 3UG7A 3A25A 2VDJA 3D0QA 3OBIA 4CG3A 5MN5A 3CF4G 1KZ4A 1WD7A 1IXKA 1CUBA 2IUEA 4IDPA 1W4BA 2PX4A 4GR4A 3ZE1B 1QH0A 1ZGHA 1Q57A 1UBTS 2AZDA 3W3ZB 3P5BA 4HNQA 5LU9A 4GH5A 1SU7A 3TZ6A 2CL6X 1RHUA 3SPXA 4DB2A 3OKCA 1MXFA 4BNZA 5EWLB 1ZD3A 1IQ0A 2ZWIA 1SUDA 5KHAA 1JKMA 2WUGA 5TQ0B 4OCZA 2GVDC 1XNRB 3VR5D 2H2DA 1MAWA 3S4YA 1I7QB 4TRMA 1CR4A 4ZJZA 3U40A 3RS4A 3EPPA 2PSFA 3C8UA 5EINA 4FB5A 1DHTA 3UENA 1L4GA 3FMPB 1IIRA 1E2MA 1T4DA 2PX6A 2VPZA 3ZR4B 4KI0A 5GQSA 1GZ5A 3L8HA 5JH7F 4J0IA 5LYYA 4AKIA 4EHAA 2ADOA 2B98A 2F1JA 4C0WA 4MS3A 3FR8A 1BXZA 3C45A 3TIIA 1MVLA 4DY4A 4IKPA 1M1YB 4S1WA 5KKCA 3ZTTA 1J2EA 3RB8A 2WKQA 3JATA 2A58A 4IEFB 3OT5A 2D1TA 1A98A 2FJUA 1A4UA 1MX9A 5KWEA 1Z82A 5AK6A 4XVQA 5FFNA 1H9CA 4NFHA 1JWBB 2OM6A 2I2WA 2PCJA 2PKWA 2ZUCA 3T9FA 5IAAA 5JJCA 3GQBA 4HWGA 2X0RA 4UMFA 4ES6A 3H11B 2CCKA 3N2GB 3IALA 5DLQC 1KTIA 3EEBA 2ZT8A 4KFCA 1IZ0A 3GVCA 3EG9A 3C1UA 1PE0A 2J3IA 4J7CA 4YDSA 4YUAA 4JC8A 3KQUA 1OH7A 4HLQB 3PC4A 1CS4C 4ZA2A 3DOCA 4KVAA 3GPCA 4ZDJA 1FB5A 3JS5A 1ENPA 5NLLA 4UPEA 1O95C 4I19A 1K97A 1ZBDA 4G65A 3SIXA 1DV2A 4K1LA 2XGJA 3FR7A 2C7QA 2WIJA 1NDQA 1QV6A 2A92A 2DRIA 4XX0B 1A7AA 2AH5A 3R6TA 5JCOA 1M6VB 1RBQA 4JQYA 1LLCA 5DT9A 3V32A 3UV6A 2PWYA 3A31A 3FRHA 4X8HA 2C7RA 2FDCA 1HKUA 2RCNA 1M6YA 2RCYA 3IR7A 4HBGA 1TPZA 4X8OA 3ETJA 1OZFA 421PA 2A5JA 4GC5A 2QE7D 2VBFA 3BCRA 3RFUA 4A5OA 3THYB 3T8YA 1GL7A 3FYUA 4I9GA 4Q9LA 3WLHA 1MOZA 3EZ7A 3E8XA 2GD6A 5TMDA 5L3SB 3HKBB 2AZTA 3PC3A 4O4IB 2W98A 4GPAA 4N5LA 2A7QA 2R2AA 2C58A 3K0KA 4KO2S 5HFJA 5C18A 4FCWA 3C8DA 2PLNA 4M7PA 5MGNA 5FO0A 1H3EA 3DHEA 2YFQA 4ZXPA 4DT1A 1Q1NA 3KDAA 1KO7A 3BWBA 4IWYA 4FZ3A 1X0VA 4XVHA 1DAPA 4YECA 5T67A 1SAYA 1WEHA 3TLYA 4A0QA 4AWBA 3S1SA 3GO4A 2ATXA 2VS1A 2P0YA 5IP5A 1AB6A 2PWBA 2X6QA 5C7LO 2W2LA 5EJ9A 3UMYA 1LPBB 3AB8A 4PCUA 3GYGA 1CBUA 3KZCA 1QAMA 2FWAA 5TF0A 5TPWA 3ABSB 1YL6A 1YFZA 4UUAA 1Q20A 5TIIA 2CJPA 5I7AA 4DAEA 3SX2A 2EBFX 5DRTA 4AZVA 3ETDA 3VSDA 1Z7BA 4IJVA 3RT1A 4B6QA 1LDBA 1U0JA 1Q16A 3Q3VA 4Q4AB 4U39A 3L1HA 4G85A 5T8KA 4CKCA 3JRNA 3RANA 4AMYA 3PI6A 1KH2A 4WIAA 2OXEA 4M2LA 2QT9A 5K3BA 4BGIA 1KEEB 1AUQA 2NLOA 5CP8A 5IDXA 1H3NA 1EGMB 1Z22A 2J9ZB 4M7RA 3TRJA 4RTSA 2EDAA 5IC6A 4TTSA 2XGGA 4HRXA 4B4KA 2XCQA 5DU2A 4RUKA 2QQFA 1YZQA 2FG5A 3IT1A 3AY3A 3VNAA 4V1CB 4IIEA 3CVYA 1GKYA 3RYIB 3HMQA 3RT7A 4MOWA 3WNDA 2YZ2A 2YYAA 3JAKA 1PUXA 1XA4A 3T1NA 3MILA 3O8OA 4IRXA 4D2IA 5CB4B 1VMAA 3QW4B 3TRFA 2ZJ0A 1E3TA 2Q7OE 4YT8A 1MO6A 3WMRA 5ERXA 2ZYDA 3GGSA 3OCXA 4CKXA 4D44A 5TMPA 5DW0A 4HX5A 4WKOA 5IDVA 1QAOA 3ROEA 2AD5A 2C00A 3DL0A 1S9HA 4CIBA 4WI1A 2Q3FA 4PYOA 3WDLA 4UE2A 3WGLA 3FGPA 2JFVA 5G4LA 1S2IA 3BCUA 1VB3A 4I14A 1E2QA 4I5IA 3W1VA 2CNBA 5CFMA 1U7PA 1VPEA 5T64A 1XDSA 1HT0A 1D2CA 1NVWQ 2H8GA 4B8WA 1RWOA 1XMIA 4DTCA 5BY2A 1RHRA 4QG3A 5JVDB 5KDOA 5ES4B 2TECE 5MFPA 1UJNA 3RSHA 4WADA 1OMOA 3QFSA 3K0CC 4WLNA 1R88A 3SQMA 1VBMA 2FN8A 4ZAWA 2OBMA 3IP1A 1JQKA 1V71A 4ILEA 4Z9AA 3PGVA 4CCAA 1PHRA 3NKLA 1NDUA 3A36A 4IGIA 3JZIA 5DO9A 2WF8A 1CW2B 5EE3A 2RI6A 1JAHA 1KEWA 1YI8A 5CT8A 1GLGA 1NP3A 2R7AA 4LDQA 4BJ1A 1LV7A 2E5FA 3RFXA 2ZYTX 2OKCA 1FDVA 5LOVB 1OU0A 5FBZA 1YB1A 4G4JA 4XDYA 1TFUA 3CKKA 4BAGA 3Q8MA 3HKBA 1N1MA 4GKBA 1FYXA 2OYSA 1IMJA 1CQJB 2OV1A 3L7CA 3FUXA 1NZJA 4UXHA 2IITA 2BGLA 2XGMA 3RVBA 3ACBA 3X1WA 1FJGB 4LJ6A 3O2SB 4O2BF 1DAGA 1RLUA 3WK9A 5JWRA 2A1IA 1P9LA 2X8WA 3ANYB 3PQFA 1WHTA 4TVBA 1BXKA 5I3CA 4H16A 5KYWA 4IH4A 3FSEA 1BMQA 1ML4A 1I94B 4RMIA 2QNBA 5HILA 2HY7A 3ZK8A 2GRAA 4BNIA 1FUYB 4CKWA 1JEYA 2YBEA 3MTJA 3WGOA 5JLAA 1IFXA 2F1HA 3DW1X 4HQ6A 1ZPDA 3OCVA 4M76B 3EGOA 3AG5A 4PTZA 1IQRA 4RO0A 2AL7A 3REQA 5IG2A 5DOVA 3RU3A 1IVSA 1BQEA 1I5OA 1R74A 1PR3A 2G67A 3JWIA 5CNIA 3LM8A 3JQBA 4AULA 3GFVA 5HTOA 4UEOA 1EINA 2EJWA 5A3RA 5JNTA 1QVZA 5BWMA 1DBWA 1OCEA 3T7KA 3OECA 4CM4B 1H1LB 5EIFA 2WABA 2R4QA 5DYTA 4F71A 3FCYA 2ZUTA 4NRDA 4WZAE 4R84A 4QXRA 1G19A 3V4SA 4DR5B 4QKQA 3VX3A 4A26A 4PSVA 1V95A 5AUNB 1GADO 3FHCB 5IHPA 1CZOA 5LWQA 1YA4A 1FTGA 2BBTA 1NLFA 3GLQA 3WB9A 4GZ3A 2JFPA 4YMGA 3LUKA 1L5HA 4BMNA 4BNDA 4X6XA 5B57C 2RAPA 1ZUIA 3PTZA 1NZDA 4MKFA 1W7AA 3L4BA 4KH0A 4E03A 1TVCA 4LI3X 1CZLA 3C3XA 4WOBA 1TCVA 3FBTA 4XWGA 3RU7A 2IXEA 3PP8A 1RHQA 2IYWA 3I73A 5AI6A 1GAJA 4EJSA 4M0MA 3PNYA 3GCZA 3KUKA 1VL2A 2X58A 2Y2UA 3KZNA 3BWVA 2BMDA 2WIGA 4RA6B 5JJIA 1HZZC 2FOLA 1LFAA 2OBXA 3VJMA 3JASB 1L8AA 2QAGB 4YBZA 3ZI0A 1VC2A 2QN8A 2GO1A 3AEXA 1YS2X 3LHKA 4KFRA 1KJNA 4CCWA 1VKNA 2P78A 4ZI5A 4KQMA 1SFRA 2WWGA 2EGGA 4F0JA 3IDAA 1EWYA 1Q6ZA 5BQXA 3RAPR 4D97A 1XKXA 1DO8A 3M33A 3NYRA 1BVYF 4ZCSA 5IEBA 3NLLA 4XPZA 2ZXUA 2WD8A 2PKEA 1KI8A 1PR5A 3G1WA 4LJLA 1GZSA 4Z8XA 5T3YA 2W6JD 4ZCIA 1QTIA 3CSSA 5ICSA 3IQXA 1N0UA 3NHSA 1C7EA 4IHAA 1RAGA 3CO5A 2IY9A 4WY8A 3GEEA 3AUAA 4CMJA 5IYZA 3RTDA 1FUKA 4DN6A 2OLEA 4P4GA 4AZTA 4RCYA 5EZ6B 2FI1A 2QR5A 3F97A 3MBOA 1RYMA 5CA1F 2MSEB 1T13A 4WDQA 4YI5A 3RD5A 3TD2A 4F91B 5BR8B 4ZWNA 1JI0A 3I61A 2AS0A 2HREA 3TIFA 3NMUF 2UDPA 4TUYA 5ESRA 1IRXA 1LPNA 5LZ8A 3R9IA 2J6HA 3UA4A 1KQFA 2Q2NA 2R00A 3S2SA 5EZYF 3LPDA 3NKVA 4RV9A 1XZFA 2OFWA 2A4KA 3TKAA 4DMUB 3L92A 1JLMA 4TKVB 1Z4IA 1DAFA 4GX5A 1N5JA 4A1OA 1BH6A 2FEMA 1ZFNA 3NTXA 4XD7A 3A05A 4F46A 3KPJA 5EWMB 3TIGA 3QVXA 1KJWA 4EI9A 1LSJA 3CRVA 4ML3A 1ZUNA 1PW5A 3YASA 2CHGA 1JBEA 2VHYA 3AM3A 1Z0DA 5IJ9B 5C7YA 2HU8A 3N28A 2FZEA 1KVSA 1MJFA 3GQVA 5FHQA 3FZGA 5I9TA 3PFGA 2OCXA 2OO5C 2WWWA 3DV9A 4I9FA 4OXIA 3BMNA 1O8CA 1RP1A 1TF5A 1Y6ZA 1F17A 2IGBA 4KIFA 3BWYA 1J9ZA 4ZREA 2WLTA 3F90A 4DCOA 2R68A 3M89A 3Q3GE 1R12A 5JRJA 1TQHA 2ZM5A 2ZVQX 1TQ4A 1ESZA 3EVDA 4R2JA 4GLJA 1KEUA 1Z36A 4P5DA 4IJMA 5KTSA 5JMOA 2G4CA 2HDWA 4I36A 5ESDA 1U8TA 4PYNA 3SJCA 3VDMA 3UT5B 4QPJC 2CF6A 2YVQA 4ALIA 4EQ6A 2DZDA 2E3JA 5ALTA 1FLNA 3U5TA 2SKEA 3W06A 1GGKA 5K1ZA 4KIWA 1TDJA 4IFBA 4OOFA 4C7MA 4W5HA 1V16A 1RMTA 5BV0A 2DKNA 2JFHA 3G2MA 3A9VA 4KQEA 4LRWA 5AK4A 4L9WA 1W9MA 2HT1A 2VJLA 3PWSA 4FFSA 4QGBA 3LRTA 4PQYA 1EVJA 2BHTA 1D5CA 3HA2A 3GBSA 3NIFB 4KO8A 1T10A 1RI2A 1U2SA 1JBQA 3BFJA 1WMEA 3CLRD 3H5RA 2CK3D 3DDHA 9ATCA 2D3TA 1GRNA 5AVVA 1QLHA 2JLSA 4OHMA 2EFJA 3TVDA 3RTGA 4WINA 3ULKA 1IAVA 1X7ZB 2HNKA 3COYA 4XASA 5F1KA 4YRJA 5JMTA 4AY2A 4J91A 4AQDA 1I2BA 2CXOA 4US0R 1UPFA 4IY1A 1UZMA 1K6JA 3E9DA 2FPRA 3U4HA 3FB4A 4EH1A 4BJ3A 2J0VA 3IMFA 3D3KA 5G4KB 1Q0PA 3H42B 4ZVNA 1JZSA 4UVEA 5JH7B 3OE5A 5JROA 1JTVA 4LF8B 1T8YA 3USES 2J6CA 1M8PA 1L8XA 3M2PA 1ORHA 4M9QA 4TL7A 4AF8A 5DNYB 2XBMA 1NVXQ 4PR3A 4IVRA 4CLEA 4G9EA 2JKZA 2PGJA 1C1YA 2V7TA 2ZROA 4GXTA 4YS6A 4BUZA 5DBOA 3N8GA 2GF9A 1GPJA 5AHXA 4R7ZA 1AKWA 3NWEA 1OBHA 3JPWA 5K99A 3HCAA 5I9LA 2FVXA 1QO0D 3IVCA 3MCZA 1I7LA 1U2PA 1ZRNA 4M46A 1XZEA 2G88A 1IZ8A 2A0WA 1GPUA 2QRJA 3JU3A 3LPLA 4JODA 4AB1A 3VOTA 3ZJYA 4JJ4A 5FR1A 5LZ7A 1TECE 1GTZA 2WSSD 3P1JA 1W4RA 3DHVA 3M1IA 4D0RA 4OHRA 2REOA 1GQQA 1Y0BA 2CJFA 3WRWA 4H1WA 3H6KA 1P33A 9MHTA 1ONNA 5HK8A 1V26A 4WY5A 2H2HA 4DKXA 2QM8A 1AN0A 3K9HA 4FLEA 1YU9A 4RABA 4EECA 2RHRA 1I1NA 2Y8EA 5IMBA 5K0BA 4N40A 1OAAA 5AHKA 3C3EA 1XEAA 1FXWF 2FKAA 3KQLA 4EKNB 5BP7A 4X65B 1YDEA 1J8MF 2GJ8A 5DFAA 4GQIA 1DRJA 4L74A 2V3WA 1UBNA 4EPXA 4IW3B 4ZVRA 5J4KA 4PZ0A 2VSOA 4YP0A 1YJAA 4ZMRA 2JA2A 2XXJA 1D2RA 2OZPA 1ZESA 4ZDKA 4CM5A 3OFNA 2JJMA 4NPAA 3PHIA 4PZUA 621PA 1BE8A 4TTQA 3H65A 2JIBA 4YWJA 2VSNA 3UAXA 3Q8XB 4HUQB 1PP4A 4Q03A 5FPQA 4LSZA 1SHTX 2GKSA 2XHZA 4TXLA 5JAZA 4LYAA 4RJ2A 1DKLA 2R8PA 3FCCA 1CRZA 3KKEA 4LOIA 1N0HA 4Q21A 4Q3BA 2IW3A 5BNZA 1IN7A 2Y05A 1RWKA 3BGIA 1NVAA 3P2JA 3UJBA 1YZLA 2XVAA 2EEPA 2R9VA 3OJXA 3LY8A 1T2VA 3H9UA 2CUKA 1CNFA 2FJPA 2RHDA 4RLQA 4KUGA 4EFDA 1N2OA 1E2GA 2RH4A 3JD2A 2RC5A 4HLNA 1GZ7A 2R84A 4C4PA 3I8XA 1FMJA 1UANA 1PT7A 2RAVA 3F0TA 5JADA 1TYDE 3LQYA 4BFTA 1MZVA 2N0SA 3AT1A 5E38A 3RRYA 4ZHQB 2PLRA 3TCKA 3ZWVA 2CVHA 4L5CA 4TLEA 3ASVA 4RJLA 3RFCA 5EESA 4B3BA 4Q4LA 4R2XA 4AF7A 3UICA 3VVLA 2GCOB 4NPCA 1XEXB 1FK8A 1PT6A 2PKRA 1XVUA 1B6RA 2WFZA 4L15A 1O6BA 3BH6A 3EG9B 3L49A 1HYBA 1EUZA 1WF6A 3LXMA 1E2LA 1AO3A 1OASA 4M22A 1GRRA 1OROA 2O2GA 3QEMB 2JCXA 3DAHA 4D57A 2PL1A 1XN1A 3KR9A 1VIDA 1ZUNB 1UJMA 3SC6A 1KIAA 1OFUA 3DLIA 5B1HA 4I1YA 1E7SA 2PX5A 3CQ9A 2QDXA 3PFKA 1WY5A 3OPYA 4FBMA 4N5IX 5AKEA 5FOUA 4FD3A 2XQGA 5ECDA 1Q1GA 1ZISA 5C5DA 3CYFA 1KMCA 4NYMR 2ZI4A 4IHQA 2G71A 4B4OA 3R23A 3ITDA 1U0LA 5AM4A 3WWOA 4OB7A 3K5IA 1K9SA 3R3SA 4GRIA 1JALA 4ZAGA 3L4EA 5M2QA 1FTQA 1VG1A 1PBTA 4KQJA 2DETA 5BOSB 4ZVPA 1CWUA 3DSRA 1Z8HA 4IHJB 5E6SA 4RY0A 4U6SA 3LW8A 1F2TA 3NWPA 3RWMB 1JEJA 1X2EA 2ALJA 1X92A 3ZCUA 2Q62A 4IJWA 1GTL1 3ZGVA 2UXBB 4ZCMA 1W94A 2C1ZA 3HJTA 2ID9A 2RGNC 4UZFA 1IY0A 3DFMA 4F84A 2AX4A 3P52A 3DVQX 1D09A 1NNLA 4OGGA 2IZ1A 5E6RA 3U7QB 2W6ID 1WNTA 1QJ4A 2ZRPA 4MA5A 4L2IA 1EI9A 2PD4A 1KAMA 1EDOA 3K2IA 1L5KA 4DQXA 1NT4A 3SC4A 1C3JA 3SZ3A 3HXLA 1A3CA 1Q0HA 3COJA 1NI4A 1MW9X 1WA5A 2G1AA 4GSKA 3ST7A 3GJRA 3DXZA 3QBJA 2G9UA 5U9CA 3K8YA 1LNQA 1YACA 2FA9A 1NF3A 1T8SA 1NOJA 1JU4A 3IO5A 2QOEA 3LQ2A 5DYNA 4ZTBA 1XU9A 2E4ZA 3TLMA 1GL6A 2ZXFA 1KJYA 3OEYA 4MW6A 5LMNB 4HLUA 2WE7A 1JQJC 2ZBVA 2QMEA 3C70A 1ECLA 3A3YA 4QJ4A 2EW8A 3G17A 4LJ8A 2QJFA 5G3YA 2R6AA 2XUAA 1ISMA 3AGQA 3G5MA 4HMQA 4NEQA 5EIBC 3CCBA 1Z3CA 1X38A 2IXGA 4E7OA 1MA0A 3UAWA 5GONA 3SSMA 4O2AA 3WNVA 2XT0A 2P6RA 1TL7C 5AJWA 4BFVA 1Q0LA 4C7OB 4OL0A 1T2AA 4FBLA 4H6WA 2ZJYA 3DKRA 1M33A 2C1XA 3FJOA 4CMBA 4U7HA 4B4UA 3OEEA 1AUVA 3AP1A 2BGJA 2ZSHA 3L9WA 1ESMA 1SCBA 1VHQA 2AZMA 2FPWA 1DOAA 2OCKA 4O4IA 4ZVMA 2JK1A 3ZZ0A 2B37A 3NWOA 1SOWA 4DA8A 4A73A 1EVEA 3FKJA 4HAUA 1VQ1A 1D6SA 5CMLA 4ANFA 2C9ZA 2QM3A 3E7DA 3D59A 3CWQA 1MO5A 2QLMA 3KSMA 2LUOA 2V59A 3FETA 3MGKA 4UMVA 3A14A 2F43A 2EZ9A 2W8ZA 1ESCA 1NAHA 4QA9A 4RY2A 3ZWDA 4A0HA 1SPBS 4DZTA 4ZFNA 1IE3A 1SB8A 1Z25A 4JGIA 3DBVO 4GW3A 2C1EA 4CJXA 4TSKA 2AW3A 4J4BA 3RVRA 1PZXA 1KVRA 2YZKA 3DTYA 3VUFA 2LDXA 2XMPA 2JAUA 3T7TA 3VYWA 2P1ZA 2FQYA 4MWDA 3WV4A 4X5OA 4L57A 1C2YA 1KERA 2PZLA 5FWYB 5LA6B 3AMVA 5D5QA 3ZYCA 4BX2A 2XUQA 2JGDB 3KUXA 1SMKA 2WKRA 3AX6A 1XEWX 3NM5A 3QJ5A 4MUKA 3REGA 1CTQA 2A2ZA 2DFLA 4F4FA 2D0IA 1H42A 1TJPB 1XWWA 5G1PA 5JATA 2YJGA 1T34A 5BXQC 2CY0A 4NP6A 1F60A 5C8YB 3DZCA 3TQTA 5C80A 5T3UA 3GH3A 3QVLA 2HQOA 5AP9A 4OLHA 3JQGA 2MT9A 4U9UA 3Q5GA 7ABPA 3C41J 4Y9TA 5EIWA 2AW5A 2OTCA 4RFSA 4Q4JB 1XMSA 2B2XA 1RXEA 4LGYA 5LQDA 4JAVC 4PPNA 1IOVA 3LCJA 2VQ6A 3TSZA 2AJTA 3GUVA 1MF7A 4MGYR 4OHXA 2ZU0C 5E1DA 1RTTA 1GL9B 4HDOB 3ZZNA 5HIAA 4LF9B 4TROA 1PJBA 3B5EA 3FZEA 1E6CA 2O07A 1CERA 3BCSA 4M9CA 4YUXA 3K6RA 3HPRA 3UJ7A 5E6UB 1U80A 5HCNA 2K4MA 4W5TA 4RULA 1XQXA 3ZE7A 4YCMA 2I3GA 1BGVA 2PZEA 2XYVA 1JL3A 4JQCA 5LZ4A 2DPMA 3IKJA 3RTAA 5LIRA 2WJ6A 4ALJA 2IIBA 1SQ5A 4Q7LA 2AUNA 4JP1A 3N53A 4KR3A 5K8IA 3VBCA 3B2EA 1GDDA 1NW3A 4ZU6X 1O94D 3WHLA 4F72A 3PHLA 3PIIA 4L27A 4QDTA 2CJWB 2CFCA 4C08A 3TB4A 3WNQA 5LN1A 3R6DA 3HJFA 4OY3A 2CVZA 2H18A 3GZ4A 5AK3A 2FE1A 1XCJA 1NJ8A 3UJ8A 2XUOA 2YMLA 5D3ZA 2OESA 4NU6A 1QE0A 3AEYA 3JQ9C 3LL7A 4IL5A 3LC1O 3EXFA 2O06A 4GC9A 2AJBA 2D5IA 1P9WA 2ZR0A 1ZIXA 5JQGF 1HYEA 1P1CA 3OT4A 4J0KA 1H1LA 2IVZA 5CAEB 4KFSA 4BFCA 1TTQB 5EJ6A 3H2YA 1BKYA 4TTVA 4EUNA 5LQRA 3HRKA 1DFHA 4G01B 4ZT2A 3SX4A 1BS9A 1OYWA 4W5OA 2DUMA 3BGDA 2F7SA 1MAVA 3KL4A 1ETUA 3GUZA 2GT1A 1NQAO 3QM1A 4NPHA 3ONEA 4XYMA 3P0HA 1N8TA 1T2UA 1ZK4A 3UAVA 4JQSA 2C0CA 3AEQB 3R7SA 3AFMA 3MSXA 3QFHA 4HQLA 5MF6A 3LS2A 2AHOA 3WRVA 3N2LA 2V7VA 1BE6A 4H1HA 4WBNF 4JZKA 2RAUA 2W8BB 5IT9A 1CYDA 4MR9A 1TMYA 3MRSA 4J43A 2FRVA 4KSYA 4MVJI 2J09A 3JQQA 5DLEA 1VJCA 1TM7E 1YIAA 2I2BA 1TUBA 2M1XA 3E5HA 1NPYA 2E2WA 1BO6A 2G25A 2YFYA 3E7FA 4J1TC 2JA1A 3U19A 1KDPA 2BTOA 3BZBA 3CC8A 3H11A 1NVEA 3N2GA 4QSHA 3WFZA 4V1CI 4JLJA 3SLKA 1K98A 1U63A 3HXTA 3JWPA 5J2TA 5LNK6 5HF6A 3CRQA 5FLXA 1I14A 2I4TA 2HF9A 3PRKE 2DJ5A 1Z6YA 2G0NA 3EIHA 3V8NA 3TZEA 3DVRX 5AW2A 2H1CA 3ZTWA 4BNNA 1HDGO 1JT9A 2QLNA 1Y7HA 3T3IA 3EZGA 1PGNA 2BFMA 4ZU3A 3O1IC 4R3NA 3B7WA 3OPQA 3KSAC 2JIRA 3C97A 4MX8A 1GPLA 5CJJA 1SBIA 5JMWA 4OP3A 3BL5A 1WAMA 4EB6B 3DLBA 1A8HA 4ND3A 4IIDA 4L5IA 2DE0X 1VMDA 3DDWA 2JS7A 1R4MA 2NZXA 5TLSA 1L7XA 2IELA 5KUTA 5KZMB 3V1UA 2LD4A 3O3MB 4REOA 1U9ZA 1W88A 4H31A 2A5DA 2YS7A 1JIKA 1Z8DA 2I1WA 2XCSB 4OMUA 2XNDD 1L4BA 3L7OA 2WUDA 4Z8YA 1R6TA 2EGUA 3VRHA 3O90A 3W8EA 1RE1A 3BK1A 3SM9A 1Z0JA 1L5QA 4OQPA 2EP7A 1LSOA 1K7CA 1D6NA 3E2PA 4QLOA 2CN1A 3L04A 4RXMA 4TS3A 2GFHA 2Q0SA 5EUMA 2AMYA 3GUUA 4P4LA 2AMJA 1MA3A 4JUFA 4D9KA 3Q0TA 5C5IA 5KCZA 2A67A 4GG1A 3UUEA 5BRJA 2BFFA 4GZMA 3FTCA 3ME5A 3EBPA 2UXDB 3R74A 2H0QA 2KHZA 1RBMA 2V7QD 4PZAA 2PUFA 4CFSA 2IUTA 4C22A 2GILA 2NPIA 1JQEA 3L1JA 4PLHA 1P17A 3WB0A 3HWWA 1G64A 3DC7A 4QM6A 3VPBA 3QVTA 1L4YA 3AM5A 4EBFA 1D4OA 5JYCA 3O9ZA 4LI0A 3HCCA 4YV7A 1XRMA 2BMVA 2H48A 2P9FA 3Q3IA 4Q4AA 1L6IA 5JO9A 4EI8A 5AVXA 3QE9Y 3PJFA 1SUBA 1G6Q1 2ZFUA 5BVHB 1WXQA 1MTZA 3ANNA 3ZXYA 5IRCD 4AUMA 1VE9A 1R9GA 3EZXA 4CM7A 1SU4A 3QA9A 2HN9A 4E30A 4CGZA 1PJTA 1W4LA 4EITA 4DDUA 3THSA 1AIPA 2PO7A 2ZUUA 3M82A 1MP0A 4GQBA 4JNKA 4YT2A 4RTQA 1Q19A 1AQIA 1Z2PX 3UT5A 2B1RA 2WJZB 4WXEA 2EIHA 2G82A 4ZCTA 3H8SA 5F64A 1YOVB 1MQSA 2RH5A 4V38A 5ALDA 2Q4BA 2C0QA 2VDKB 2C4UA 1HE1C 2WTMA 3RYFB 3O8LA 3DOEA 1QQTA 1WHSB 1VXRA 3FPHA 1WCV1 2FSUA 3LG2A 1JR2A 3VR5H 1FF9A 5EOVA 3RK4A 3T3GA 3OM8A 2QT0A 2WB4A 4QNNA 1EJ0A 2O3UA 3DH0A 2VT3A 2R6CA 1XPOA 4QXPA 3OY7A 4W1QA 1IZZA 3BHMA 3DE2X 2E18A 1YK0A 3FVTA 1G1MA 3KKNA 2EX1A 2QAIA 1HNXB 3UQZA 1BAPA 2W9XA 2NU7A 4ZT4A 1NSYA 4BGVA 2Z9BA 4QT0A 2SCUB 3TI9A 3QBDA 4F2HA 1QIJA 4TSFA 5EPUA 2WVHA 1SCUB 3IE2A 2XOKA 1V8OA 2F48A 2YXNA 4FI3C 4PPGA 4REMA 4E11A 1ZICA 3KZOA 5EN4A 2ST1A 4EEXA 4LGMA 1EUCB 1Y5MA 4YH1A 3HRIA 3EA4A 2YJNA 4ZI7B 2GAOA 1RZUA 3CW2A 2QN2A 4M88A 1M6VA 3N0VA 4IFIA 4O4HB 4TQGA 3OZXA 3PXGA 2P2YA 1CJCA 4NMLA 1ENZA 1FUEA 4N0DA 3UK0A 2XCTB 3GN2A 4DTIA 1XXHE 3BXEA 4CQNA 2XWSA 3VNVA 1AQUA 2PUDA 2O6LA 4AM8A 1UKYA 4BN0A 3V4RA 3HBMA 4I55B 4RGQA 4HUTA 1JSRA 3IEPA 3T9CA 4UM9B 3QSYA 3U1BA 1UKEA 3BERA 1ZA2A 4BO4A 4DUPA 2FLWA 1XZDA 4MCJA 3P2EA 2Y0EA 1N0WA 2NVWA 3HKDA 2AX3A 4JFRA 4NMMA 3GRFA 3OM0A 3RYIA 5KJ6A 3KJQA 4PHHA 3HMKA 2WIDA 3NP7A 3FVWA 4DEVA 1Z74A 4YCJA 2GLUA 4MKXA 1N7JA 2ORED 2QI9F 2XXBA 2YWGA 3AFOA 1QIDA 2H2WA 4RC9A 4RYDA 4U4AA 2ERCA 5AKJA 1BTOA 1S2GA 4CKBA 3AKZA 1RXUA 2ZRQA 1LV8A 2PS3A 2VKTA 4EY8A 3GCGA 4UNRA 1TM3E 2ZB4A 3NJ8A 3M5CA 4Q1VA 5JQGA 4YPOA 4HNAB 3P2OA 3UOAB 4CKYA 2QRLA 2UVPB 5DM2A 2BKVA 4IUBS 4EATA 5A5VA 2V3CC 2G1JA 2C59A 5KINB 1Z15A 1G4UR 1UT8A 5IS2A 2XSZA 2H1WA 3W3AH 5IDWA 2XDQA 1JSLA 2ZETA 4GT1A 5JSYA 3ZG6A 3O3CA 3EY9A 4XVRA 5FJJA 3ZLVA 3DOOA 4HRVA 5K8UA 2YICA 1A96A 3RKRA 1PCXA 4E5DA 3V4FA 5KHLB 3L3BA 4BEBA 1MAAA 3E1KA 1VRWA 5TEWA 5H68A 4C3VA 2BONA 1CHNA 3BJEA 5KYYA 4TMXA 1E6EA 1WS6A 3AEZA 1JWAB 4YAJA 1YUNA 3RJMA 1JJ7A 1BROA 4U2KA 5IFLA 1GLVA 1Q50A 4JOBA 3IPRA 5BN5B 4DSUA 3E3AA 2WQ7A 4Z4HA 3RJ9A 1BX3A 1QTNA 3JARA 3IE0A 4EZEA 2W2KA 3BXFA 3OUTA 4OQEA 3HNOA 2ZTUA 3GUHA 4CL3A 5CHYA 3I2GA 3H2BA 4PG6A 2O4UX 3PU6A 2VP6A 3GNSA 3JYOA 3KU4A 3DZBA 5EAIA 3WNBA 3EX7C 4B4VA 3E0QA 4YP9A 2J0QA 3N6RA 4MQBA 5KYUB 4MRSA 3T7AA 2OHIA 2QGZA 4FFBB 4W5JA 3O4RA 3NIDB 1GUDA 3D3EA 3ANTA 3ON5A 2P40A 3JQAA 3A4NA 4OP2A 3SIPA 4Y1RB 4D42A 4QT4A 2BKEA 2HU5A 4QREA 3VZBA 4H0FA 3UHAA 3E15A 2X6RA 2JGEA 3HVRA 5GGYA 2J7PD 2CV1A 1FRNA 9LDTA 1J22A 1I3CA 1K6EA 5K0CA 4DJJA 3G8AA 1PG5A 3IP9A 3NGMA 2BBSA 5BSEA 2G06A 3LNCA 1ATZA 1U8EA 3I6ZA 4Y2TA 4NH0A 2G3YA 1YJ8A 3N6VA 1SUEA 4HQFA 3KR1A 5C35A 5FBLB 3TXYA 1SU8A 1L5FA 2I78A 3DM9B 3P8ZA 4YR9A 2O59A 3EXEB 1PR4A 1CE8A 4OHOA 4RY8A 1N6OA 2CF5A 2PS9A 1J0CA 3IDFA 4C0JA 2RGEA 3L8MA 2JNWA 2A0KA 2F90A 1RWVA 3DPIA 3OQ1A 3DB1A 1QC5A 2VJBA 1CCWA 4DUZB 3F6RA 2Q5OA 3A6JA 4DE5A 4NWIA 1L4LA 4DJDC 4H35A 2OOSA 4RF4A 4QUDA 4M38A 5DYWA 1A9XB 3IT3A 3EW7A 4TMFA 4OUDB 3ZKWB 4B31A 1KY5A 3AZPA 1CRWG 1YZNA 3EZ6A 3TM4A 3FUVA 3PENA 2E9SA 3W9SA 4AFNA 1IUOA 2OHXA 4I4TF 2ZCUA 4X7BA 5LOVA 3IUPA 2VPYA 4HI0E 4U3JA 1RRCA 1SHLA 4NV3A 4CL0A 3T52A 4ZGBA 3IPCA 3GDWA 2D1YA 2X3YA 3K4QA 4NU0A 2ONJA 4DV4B 1VPWA 4G1CA 4A23A 1A2OA 5BSKA 3U44B 3TI7A 2G09A 1J5EB 3LFTA 1FZTA 4MB6A 5TSDA 3H75A 3OMLA 1XCBA 2UXCB 1RT9A 1Z5GA 3G89A 1BIFA 3GLSA 4OJQA 1LY1A 2HIAA 3LC0A 2JD0A 5EWJB 4Y2JA 5E0KB 2I4IA 3HSSA 2V9PA 2F00A 3G9TA 3ANXA 3IVXA 4QHTA 3VC3A 3S8EA 3IQDB 3E27A 4PQRA 4X54A 4DV6B 1LBIA 1HE2A 1NFQA 4GR5A 4U2DA 5F5LA 5C31A 4EVSA 4U7WA 5KB3A 4OU4A 5G0TA 4A9AA 3GEBA 4Z4QA 5DBFA 3HB4X 2CVPA 1CUIA 4C2UA 1AV7A 3AR9A 1JXOA 1EXWA 4UBIA 1N5OX 2P11A 4IIGA 3DYVA 3UANA 5ADHA 2QL9A 2PFKA 3WTBA 2YUTA 1JFFA 4WACA 2H00A 1CUAA 1B0ZA 3EAGA 3K70B 3LDAA 1ZEJA 5I9IA 5AJZA 1IEWA 2J4DA 2F6RA 3CM0A 1HEYA 2NXCA 2Q5JA 1WMBA 3F7MA 2J48A 1SHZA 3OJOA 3HEMA 1MQ9A 3AERA 5KNDA 3HI4A 2V7PA 4LKOA 4X60A 2X23A 2FPUA 3BWXA 1BD4A 4UFPA 3KNZA 1KY4A 1BDIA 3F2VA 3AEKA 4EFLA 2A5FA 4EVIA 3DLPX 3AFNA 3EF0A 4H60A 5F3DA 2XRMA 4EARA 2P79A 4EG1A 3AI3A 4JGGA 3NAZA 4Y1GA 1SXJB 3RHZA 4GF5A 4HWRA 1GG2A 1A5TA 1NN5A 3KXDA 1KJ8A 5KQSA 5K03A 1LGYA 3RE1A 4U9HS 3D1LA 1RJEA 1JLHA 4CM6A 2IDZA 2VAPA 3A6PC 4F3YA 1WULS 4G5GA 3WL5A 4GOMD 5DCUA 4L0CA 1L7AA 4WGGA 2H5EA 1LPPA 4QVKA 4YRAA 4PX2A 5JT1A 4TV9F 3A7EA 2B9VA 4Q0MA 2J3QA 1A82A 1CUJA 2RHTA 4KJXA 4HGYA 4OIMA 3UO8B 2OQIA 3C3MA 3DT8A 1JQ5A 3MM4A 5EWMA 2AG1A 2JGIA 2CHEA 3LGXA 4I2NA 5B3LA 4B7AA 1E2IA 3OKFA 2Q50A 3FTDA 3NTVA 5K51A 2NZWA 1W4ZA 3G13A 4KLRA 4MLPA 3UMVA 4HLUC 4Q4CA 1W75A 2QLBA 3QVMA 4TMVA 4JASB 5AI8A 4D45A 1L6RA 3EMVA 4RXTA 1EE9A 5H0IA 1WXXA 3EMDA 2B21A 3GDGA 2F4NA 3RS5A 3ZJ4A 3D4NA 3G59A 1KYXA 4PC3A 3Q2KA 3EZ2A 1XCMA 3DAFA 3QRWA 4LG1A 3B89A 4G5HA 2J33A 2G5GX 1PFWA 4EX7A 2YXBA 1N7IA 2YYYA 3HTXA 4L02A 2V97A 3KCQA 3ICWA 4FPXA 2D2IA 3D4BA 3UK6A 4X91A 4G4GA 4FYIA 1A4IA 2WR8A 3DLHA 4IIYA 4PLZA 3R5HA 3NEAA 1CSEE 4EYOA 3SQLA 3OTOB 2DKOA 4IMPA 3BXOA 2ZBEA 4FEEA 3GF4A 5CJ2A 5LQUA 3SVLA 2WMDA 4CDRA 2XUIA 1UPUA 1J0EA 1NVKA 3IHLA 2CLOB 4X1OA 3VTZA 3T5TA 2HPZA 1TCCA 1ECJA 4E3WA 3K31A 8LDHA 4YRMA 1F9AA 5JNLA 2YRFA 3L8GA 3ZPXA 1BVRA 1HEUA 3WGGA 5AO9A 4EYQA 4TTRA 1DG3A 2WIAA 1E1CB 4PPFA 5F2KA 1SZJG 3O8NA 3PEFA 1ETHA 3QKSA 4Q1FA 4C14A 3QPAA 2I4LA 3K0EA 3ZH2A 1SVMA 4FD2A 3B3FA 2W6ZA 3IHWA 4WXHA 4CDMA 1POXA 2OFXA 2QGFA 4IOMA 3AJEA 4KU4A 4JK3A 2C29D 4RFLA 2DQYA 3ILXA 3ROFA 2O0KA 1EWRA 5EERA 5JI3E 2O7SA 1MFPA 2C9YA 2XXAA 2RH8A 1Y6GA 1TAGA 1Y3DE 1IAQA 2BMFA 3H0KA 2C3OA 4TL9A 2BGIA 3WK8A 4OYLA 5BR4A 4HJXA 2P2CA 2Q46A 1KO1A 4XDHA 3MSCA 1ST3A 5KIAA 2ENWA 1YRWA 2IOHA 2OAP1 4G6ZA 3UHPA 1HDRA 4BQFA 4CUJA 2EU8A 1ZWKA 4BS9A 2REQB 1JDBB 1CY6A 1JN0A 1VJGA 4E0BA 4YLYA 1FFYA 3NANA 2R751 4Z4CA 2CW5A 1G20E 1FVXA 1YBMA 2BTQB 1BS2A 1E20A 1RFLA 1XVVA 1E1KA 4UMEA 1FVFA 1PF7E 4F97A 2V1XA 3M9XA 3ZE9A 1WE2A 3MWKA 1YKFA 1FQKA 5EP2A 5FTWA 4HGQA 1QYXA 2A4MA 2DF8A 4B4WA 3A4MA 2I66A 1WOMA 2IX3A 4CWAA 1UBJS 3HM2A 2JZCA 4FMCF 1C0LA 1OH6A 221PA 1ZM2A 1V4BA 2K7ZA 2QF7A 2IBMA 1TMKA 2QTWB 2XLCA 3ZI7A 2Z8XA 3WGQA 4GNRA 3ZXSA 4D5EA 1O95A 3STTA 3HDHA 1NIJA 1G7TA 2XDWA 4RE6A 3Q88A 4TZKA 4ZOLB 4FX2A 4OM7A 4LJRA 5JZSA 2BEWB 5L8VA 5K9ZA 2WF5A 5AMXA 3Q7IA 3ENZA 1YRAA 5CM8B 3DE1X 2ZUDA 1UWCA 1Z37A 3VVBA 4F60A 1PJZA 4GOXA 1LDEA 3BMQA 3KPUA 4MKGA 3QY9A 1DRVA 4KBGA 1NV8A 3TLKA 3W5JA 1LJUA 4N0QA 4AJ2A 4D99A 1VI6A 4EIWA 2P9YA 5K6AA 2GJ4A 1VG0B 4W9MC 2IYSA 2WG2A 4MKRA 4A0RA 5DASA 2FX5A 3KEGA 1XZHA 4B9EA 2VRBA 3COPA 4EAQA 2ZWPA 4KQFA 1KKMA 1MEEA 1RHJA 3AP3A 5DYYA 3IA7A 1W52X 4O4LB 3VJRA 3ET5A 4ZEWA 2PZGA 4CMEA 4DCMA 1I0ZA 3U7RA 2WT8A 3O83A 4G8BA 5EIBD 3SJZA 2RGXA 1T9CA 5ALZA 5ANRB 4S12A 4GI1A 3B1FA 5DGXA 3O93A 3UMSA 1T9AA 1K5GA 3HGTA 1DMRA 3HR7A 3BK2A 3JQ8A 1NJ1A 3OESA 2WYOA 1U1GA 1Z4LA 2R1VA 3F9CA 4JV5B 2DY1A 3OZAA 4JU9A 1NQUA 5TQ2B 1WHTB 5B6JA 2I7XA 2HX1A 5TGDA 1NUUA 4AG5A 1WSBA 4U2FA 2P1RA 3GFSA 4LJKA 4ZAXA 5FF9A 3EXG2 4FE3A 4TXJA 3F4BA 3ZTYA 1AK1A 1DWPA 2I65A 1KK1A 4QYXA 4RIHA 5KYVA 3VVMA 5JAOA 1CF2O 2YFHA 4IOJA 4G25A 3OQMA 4IFEA 5ENVA 3T9EA 3OPYB 2VLBA 2OHVA 1K4YA 1AV6A 3I1IA 4IAOA 2PKXA 3GFOA 5KJ1A 2HHJA 3VKUA 4G3XA 5IASA 1U8FO 2WAMA 4DJAA 3UMGA 4OHWA 2Y1DA 2BCGY 3FKSA 4O6VA 3UAZA 2QB5A 1EA7A 2G72A 3DZ8A 2AK2A 4J90A 3FLMA 4IP0A 3G7UA 4OAOA 5IF3A 1V5IA 3MVEA 4HDNB 3HADA 2IXTA 2M2IA 5ER6A 1V0JA 1E7WA 1EVLA 5LDDC 3ZNPA 2BHRA 1X6VA 4DXHA 2ZE8A 3MNFA 2R6GA 4R0NA 5JV5A 1BXGB 2OLKA 3OZDA 4L50A 4C0BA 1FXUA 2H1VA 4K8OA 3VO2A 4RTPA 4U63A 2ASEA 3K1AA 2PCLA 4DPMA 3ZD6A 1N9GB 3BZUA 3FWYA 2PX0A 1T9GR 4MUEA 5KNBH 5KTKA 3KOOA 3O1LA 2E6KA 3R5TA 1IZYA 3NO4A 4MV6A 4ZCLA 1R6AA 2M6LA 2SKDA 3ABQB 4TLBA 5T5QA 3VZCA 3K9GA 1K4KA 4L9AA 1XLWA 5JS8A 16PKA 1H8HA 1BQ3A 1IU9A 1CJTC 3VR4D 5J5AA 2FFAA 4C9BA 4GKVA 1V2GA 3NOVA 3GT0A 2NU7B 5DTJA 5K4AA 4EP1A 2QBYB 2AQIA 2NVUA 4EHDA 3CG4A 1A7UA 4P3YA 5CFQA 1VRCA 4JI6B 1GO2A 2HZ7A 3DNPA 4X1YB 3CT6A 1XELA 1IOZA 3B6EA 2OBFA 2V74B 1YB2A 2Y0BA 3NHBA 4XFDA 4WZBB 1KZHA 3EXHA 2B0JA 4HAIA 3RNLA 3TPZA 2H4FA 3W4IA 4YMLA 3UY4A 3QYPA 3T4PA 1OWNA 2O6HA 3AQIA 1MC1A 5MGBA 1JB9A 1F8YA 1K08A 5BMOA 3MT8A 5KNBD 1P1KA 2FR1A 3NHYA 3A8TA 3GG9A 2KM1A 3CUEF 1KP9A 3O31A 4UFNA 4BCDA 1XPRA 3U4GA 1DTWA 1GV0A 3V7WA 3UMMA 4N65A 4IH1A 3FOZA 4GBED 1M3SA 1RIFA 2ZIXA 5TVKA 1OGJA 1C29B 1TO6A 3IGFA 1AGNA 4M99A 4GX1A 4DQ0A 1BE0A 3E9MA 3PJDA 1RWXA 1XEFA 1PYGA 4LJAA 4BTVA 3MTAA 1VA5A 3V7YA 3L0PA 1KI1A 3LH5A 3L84A 4NICA 2I0FA 4N7MA 3W9BA 4YYZA 1YDWA 3INYA 3TM5A 3PNSA 4QRHA 3C3CA 1N9KA 3T0IA 2PZJA 5DM0A 3M4XA 4LC9A 2JHPA 1WUIS 3D5TA 3OU7A 4ZOAA 3PYLA 4ZYWA 2ZRAA 2WWRA 4OVKA 1U8ZA 3QLEA 3W0LB 2N3ZA 1DAEA 2F3SA 4MKIA 4LEIA 4R1LA 2O0MA 2UV8A 1J0AA 5TPZA 3E23A 3ODPA 1GP2A 4QASA 1E7MA 2B8NA 5A5GA 5L7TA 4FMBB 1KEZA 2R87A 2AN9A 4A8JC 2TYSB 5C5EA 3LFHA 1RRGA 4F3RA 2NTYC 5A4IS 4HWSA 3WV5A 3DKIA 1E92A 1PJSA 2OK7A 3SQDA 3OZIA 4KYUA 4BLSA 2Z58A 5EA2A 1GUFA 3DD5A 4G5QA 4QELA 2CD7A 2REBA 2YOHA 3COSA 3GL9A 4GMKA 3GRYA 4TVKA 3WRYC 2J9RA 4UAGA 4ZALA 1WMFA 1HPLA 1NAIA 3RKUA 4PNPA 5EMNA 1M2VB 3VU8A 1AS0A 1KOFA 5JOQA 4AWXA 2J32A 1LDGA 1BN7A 3GVPA 4R2LA 4RMHA 3VR6D 2XYQA 3ZW9A 3BG5A 4QGHA 1GEEA 3UMRA 1RPNA 4KKXB 2VPQA 4Q1AA 4N01A 2GDJA 2I8LA 2ZEJA 3LDUA 2DT8A 3QF4B 4G23A 3IOBA 2H1RA 3O8QB 1JSZA 4LK3A 4M6WA 5L53A 2CHVA 1AX9A 3PPIA 1P2BA 2C7GA 4JP5A 3HVJA 5BUQA 2ZRFA 3JYQA 4Q1BA 4C3ZA 2F43B 1U0GA 2DERA 5CURA 1MDBA 1XCPA 3G85A 2VJMB 1QIFA 3B1VA 3GDHA 1VIMA 3CWZA 2H92A 3Q41A 4GE3A 3GRPA 3BIJA 4W82A 2JAWA 1KVTA 1HQCA 4JB8A 1H4QA 1VCMA 4ZODA 4YAKA 3CX8A 2O2CA 1ZQ9A 5KYNA 4HN2A 3T34A 3BIXA 3DMYA 3JWGA 5FYQA 4BVEA 2GN2A 4Q9HA 2RKWA 5DM1A 1T4BA 2J7PA 3QSGA 3QV2A 1Z6PA 3TTWA 4M8LA 4KXFB 2FGJA 3C4QA 3FOBA 2NPFA 2AZ4A 3UGKA 2FFHA 4F04A 5I8ZA 3ZE2B 4PF1A 3FPFA 1AGYA 2WZDA 3EFOB 3OZSA 2VHUA 2DBQA 3KQWA 4QTXA 4BQIA 5LR6A 4II2A 4E7PA 3WWZA 2VBGA 2ODAA 3IUEA 5CNMA 5ILGA 5K0NA 2VOJA 2D2XA 3COWA 3HWRA 2Q1WA 4OUDA 4AP9A 2ZSUA 1EP1B 1SBYA 4G09A 4KPEC 3KQKA 4V0OA 2ZULA 1E3LA 1DO0A 3FYTA 4MROA 1CZUA 1J7KA 1QYIA 3D1VA 4NS4A 2PE5A 4HMOA 1XTTA 4ZQFA 4OG2A 2Z43A 3FYSA 4GE0A 3WRXC 3KBBA 4X20A 1AXRA 2R3SA 4YQFA 3MXOA 3GJSA 3PNVA 1BWPA 2ZG6A 1RI1A 1K7SN 5DZSA 3W2FA 2W70A 5JZ9A 3TQIA 1XF9A 1OTXA 2YZGA 3O7WA 4DYVA 3ZK7A 2BH2A 1I4OA 4FNAA 1UDXA 3GGGA 1UJ6A 1A9OA 4O4JA 3RT9A 2B99A 4QNMA 1RQ2A 1ZM9A 2YNMA 3D0RA 4IDDA 4TTIA 1XZJA 2NNWB 3DXYA 2AVNA 4O8CA 1R7RA 4PW0A 1QLJA 3SZOA 4BFWA 4D3FA 1R6XA 4UM9D 3GP8A 3I9LA 5D5PA 1KC3A 1IULA 1Y8RA 3DE3X 4KHZA 1GN9A 5DX1A 1B93A 1KYYA 1AY0A 2F8LA 2WK1A 3PKJA 1YRBA 4FCCA 2WYWA 1PZNA 2GNAA 4J9UE 4NNPA 3VGPA 2ROQA 4M1EA 4ZDWA 3NONA 3UA3A 4BO9A 1R0BA 4FIDA 3AK4A 4S2UA 5AXCA 2A0YA 3VZRA 5MN6A 4DQUA 1VG8A 3SEZA 2CHFA 1F9EA 4GKKB 4RWZA 2ZSDA 4A0FA 2W0SA 3CBGA 1MN6A 3BMOA 3RLFA 4DIFA 4PLGA 3R75A 2NWQA 1LCIA 3LOUA 3CNEA 4X3OA 3U09A 1J06A 3OEWA 4OKSA 4MGHA 4RD0A 3F6PA 4HTAA 3CLSD 5BSTA 5H4HA 4BKMA 4ZQBA 4B3FX 5BQPA 1U99A 5B1DA 2OD2A 1E32A 5FTJA 4WD3A 2ZKIA 1DAIA 3FCOA 2XQKA 4K26A 1MIHA 2HRCA 2I55A 5FCDA 3EZFA 1Y3BE 1EFKA 1PS0A 1SA0A 2XOEA 5BWBA 4F1KA 1SGWA 3CB2A 3NEJA 1YKSA 3OOYA 4EY3A 1B0UA 3HY6A 3L4KA 3HZRA 1QOPB 5E4FA 3TZLA 1YUBA 1FP4B 1T3HA 2WMNB 3QFCA 5BO5A 3K8QA 1U6JA 4BFZA 2PYDA 5AW5A 3BT7A 3ESYA 4G4SP 4UE6A 3ROKA 2FETA 2NUBA 1JH8A 3QV1A 5TVGA 1ZSNA 2HCJB 2ORWA 4Y6LA 1T0JB 4TUYF 3K15A 2YIVX 2GPSA 3CSDA 1U0SY 1WZCA 3I2JA 4H7IA 4DSZA 1SCUA 3OMXA 3VU9B 1N2CE 2NQTA 1A4XA 1RLIA 2O50A 2WUVA 3L05A 4JP8A 4PO8A 4PYJA 3ZWKA 2CXQA 3FWKA 1PTKA 2GSDA 2ZBPA 3OQBA 5K0LA 3BSWA 4L28A 1P5JA 2DQZA 3QELA 3A04A 1Y3CE 4O4HA 1GUBA 4XYEA 5PGMA 2QJWA 3CRRA 3AZOA 2RI1A 4KIJA 2OHOA 3FMFA 2QJOA 2BP7B 3WA7A 1H6CA 3JY6A 3Q0EA 4H3SA 1XJ5A 1Z7WA 1TUEA 1GGEA 2IFTA 1T36B 4YNBA 1PJ8A 1S8NA 3Q2OA 2QTNA 3IUMA 1T4CA 2AXEA 3PQCA 4JXKA 2Q5CA 4EI2A 4MB0A 4QLBA 1OW3B 1OXKB 3GVHA 4H4DA 3BHIA 4W8OA 2WJYA 3PDIA 2RBKA 1ES9A 2Y0PA 3EVZA 1AQYA 2C77A 1D9XA 2Q1YA 2O8NA 5F12A 4BBJA 4E5YA 1JFTA 1YR9A 3E82A 1UP6A 5CH8A 1GFIA 3KX2A 3DFUA