4LE0A

Crystal structure of the receiver domain of desr in complex with beryllofluoride and magnesium
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
132
structure length
132
Chain Sequence
MISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Dna binding protein
molecule keywords Transcriptional regulatory protein DesR
total genus 47
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4le0A00
2CHFA 3IP7A 3NHMA 4XARA 1W25A 2FW0A 2X7XA 2IPNA 3LUFA 2WY2D 3SNKA 4PEVA 4LX8A 4IF4A 5BRJA 4DN6A 1DJMA 4YGXB 1PNTA 3GBPA 5ABPA 3EQZA 2QV0A 4RK4A 4EVRA 2FXIA 2NT4A 3H5LA 3O1JC 4KQCA 4GNRA 2R25B 4RK1A 3SG0A 1R8JA 3SY8A 3C6QA 3Q41A 4LDAA 4N0PA 5FWYB 3C97A 1M2EA 1JF8A 4DQDA 2M1ZA 1P6QA 5IX8A 1XHFA 2FSPA 3HDGA 2HQBA 3RVKA 2IOYA 5JS2A 1JYFA 2FMHA 4ETNA 3G1WA 5I4CA 3F73A 2FMKA 2HQOA 2ID9A 2FTKE 4PZ0A 2RGYA 1MAVA 1JFSA 1QP0A 1U2PA 3MA0A 3HS3A 4IRXA 4MQFA 4RK5A 4KMRA 3OO0A 4OLAA 3A3KA 3LKBA 4S05A 1ABEA 4Z4IA 5CNKA 5GQSA 2F8TA 2A9OA 2FQYA 4F8JA 1C4WA 1ZGZA 4RK0A 3KYIB 2JBAB 4LE0A 5TQ0B 4ZYLA 1QQAA 3GL9A 3LUKA 3UUGA 1P2FA 3OQMA 2PUAA 1Z2EA 1QO0D 2LPMA 4YR7A 1LK0A 5B3JC 1JHZA 1KRWA 1Z13A 5KQGA 3HM9A 3T6KA 3KJXA 1YIOA 2LBPA 3IPCA 3I45A 1ZDMA 5B3JA 3TO5A 4OTZA 1MB0A 4RXTA 4RY8A 5KWSA 1JDPA 3KSMA 4H60A 3VNAA 1Z2DA 1L5ZA 3MYYA 1SXIA 4MGEA 2NT3A 4OBBA 1FFSA 4KNYA 2IPLA 4KRFA 1U04A 3M9WA 3C3WA 3GRCA 3H5WA 3GT7A 1QO0A 1YS6A 2MSLA 1JDNA 3H5IA 4Z9AA 4D6XA 1YK1A 2WRZA 3BRSA 1NXOA 1PNRA 3DGEC 1RPJA 3OLXA 4L85A 5PNTA 1DC7A 3RVNA 3LTEA 1GUDA 3SM9A 3H6HA 7ABPA 3CZ5A 5IUJC 3RVLA 3NHZA 1DBPA 2PL1A 4OATA 4JB0A 1ZY2A 3ILHA 4WT7A 1APBA 2LUOA 3NNDA 3EULA 1AB5A 1JL3A 4E7PA 4G0ZA 4FB4A 2JK1A 2PKXA 2WB4A 4YO7A 1OXKB 5FWYA 2MYTA 3QLTA 9ABPA 4Z4EA 3F7NA 3Q9SA 3HO1A 2VUIB 3OQOA 4F3TA 2FQWA 3CNBA 5F64A 5HQJA 3RVSA 3FFXA 3GYBA 1ZH4A 4Q6WA 1D1QA 2VUHB 1QP4A 2GBPA 4LRQA 2Q5CA 4N03A 5D2CA 2PE5A 2PUGA 4QYMA 1E6LA 1E6KA 5DCLA 4KPYA 3JY6A 3QLUA 3L49A 2CWDA 1FFGA 3JVIA 4RZSA 4ETMA 1K68A 2QSJA 3O2JA 2L18A 1NXPA 4MR7B 3HV2A 4KVFA 4PYRA 4G0QA 1LBIA 4KK3A 1JLKA 4YV7A 2RJNA 4DADA 5CNIA 3JTEA 1YVUA 4N0QA 4JB2A 3N0RA 3UKJA 3ILYA 3A0RB 4UHJA 1NY5A 3CKMA 3QX9A 2FLKA 4JOQA 1DRJA 1EWTA 3IDOA 3BREA 3M9XA 3QLUC 3O2QB 2JBAA 5DKFA 4H3HB 3BILA 1DP4A 3QK7A 4JAVC 4Q6BA 5DLEA 3LOPA 3O2SB 2J48A 4MQFB 4EYGA 4D74A 2JVIA 3MIZA 4B09A 1W9HA 4PE5B 4O1HA 2PUBA 1TVMA 1UDRA 4MAAA 2VK2A 1E2BA 1FQWA 4MS4A 3EQ2A 3OMXA 1S8NA 4PICA 3LUDA 5KQPA 1D2AA 3EAFA 4RV5A 5ED4A 2GKGA 3H6GA 5EWLA 1QP7A 4KREA 5T3YA 3T38A 3I42A 3LUGA 2A9QA 1GLGA 4MQEB 2AYZA 4JP1A 2A9PA 4W5NA 2P4UA 1NATA 4KK4A 3Q15C 5BQ3A 2JVJA 1C0EA 4EGSA 3RH0A 1YMVA 2QVGA 3RVQA 3LKVA 2GI4A 3FGZA 1PEAA 5FWXB 4N47A 4RK7A 1ZH2A 2FMIA 2IDMA 3TMYA 1ZGGA 4YWHA 4ML3A 1J56A 1ZN2A 6ABPA 1Z26A 1JYEA 3HXMA 1U2QA 4XLTA 3I5AA 2ZAYA 2PUCA 3LMKA 1I3CA 5EWJA 3GV0A 3RVJA 4F12A 5JNTA 3H1FA 4MR9A 1QQBA 4G0XA 2RDMA 2YHBA 4TLLB 4XFKA 5EWMA 3G85A 5CNJA 4Z9BA 1SD5A 3RQIA 4YCSA 3OLYA 1OXBB 1QPZA 1B00A 3NNSA 2NZUG 1DCMA 3FDFA 3C3KA 4QYWA 1LJUA 1Z18A 2B4AA 2LP4Y 5IBQA 4IILA 1DBWA 3EGCA 2E4VA 1RXIA 2QU7A 3TD9A 4W5RA 4NCBA 2PJUA 4TLMB 5CNMA 3H5OA 1USGA 4MS1A 5TQ2A 3CFYA 3LUHA 2P9HA 1A04A 2WJWA 1DC8A 3HUTA 3KLNA 4RSMA 2FEKA 3E61A 4MS3A 5TPWB 5JNSA 3JPWA 3N53A 3P9YA 4WXMA 4ZJPA 3OLZA 4RKQA 3H5VA 1VRVA 3QELA 1NTRA 1A2OA 1JH9A 4HNQA 4MS1B 1NXVA 3QEMB 1JWLA 3C3MA 2LIVA 3A10A 3BBLA 4WWHA 2IKSA 4P98A 1BDJA 3O74A 5IC5A 1Z17A 1FSPA 1Z25A 1PEYA 2OENG 5IUNC 3F6CA 2B1JA 4KV7A 1RXEA 1ISRA 1VLZA 1GUBA 3CTPA 4JASB 3CU5A 1T34A 1ZAYA 3DBIA 1E6MA 4MR9B 3H1GA 1DCKA 2N9UA 3CS3A 3RVOA 3OM1A 5EWJB 2O20A 1M5TA 1TJYA 1ZESA 3JS5A 4N76A 3EODA 2MYUA 3N0XA 3Q7SA 1PHRA 3B2NA 4Z4GA 3KG2A 2AYXA 2JVKA 4EY3A 2MSKA 4RXMA 1RNLA 1U0SY 4WUTA 2HJ9A 3CLKA 3LUCA 3MM4A 1XWWA 5IULC 2QR3A 4W5OA 2JB9A 3T8YA 1AB6A 3N8IA 2E4UA 3MQ4A 4HNRA 4KFCA 2FN8A 1YS7A 2PMCA 3L6UA 5JS1A 1CEYA 3QX8A 4EVQA 4G97A 4WXEA 5JNRA 4G0MA 4HYEA 5EWLB 1EHCA 2I6FA 2ID7A 4CBVA 3HUUA 2NUBA 5IUKC 4YP9A 5KQLA 5KI6A 1DZ3A 2HSGA 2JCGA 3GA5A 4YLEA 4LE1A 4NV3A 3SAJA 1D1PA 4MR8B 4MS3B 4MR8A 1FFWA 1BA2A 4IMJB 2ZWMA 1BDIA 2FMFA 3KS9A 3LUJA 1EWKA 2R4QA 3OM0A 2E4XA 4H3KB 4RXUA 1ZVVA 3BRQA 1TLFA 2VYCA 2FQXA 2WWVD 4FE4A 5TE9A 2XDYA 8ABPA 1TMYA 1KRXA 3H5TA 1MB3A 2IPMA 3A0UA 4QICA 4E7OA 2WMYA 5FBHA 4ETIA 3KCNA 5BRAA 1JX6A 1HEYA 2M98A 2PL9A 1F4VA 2HPHA 3MMNA 2F8SA 5TPZD 4XASA 1F51E 5T7BA 1VPWA 4MR7A 4MLCA 3CG4A 5IEJA 4IMIB 4WZZA 3CHYA 4D6YA 5DTEA 3F6PA 3O75A 1USKA 1Y1LA 3LFTA 4MRMB 3LUAA 2QXYA 4JA2A 3H1EA 1A0OA 3GWGA 1DG9A 3IPAA 4MRMA 2FN9A 4QPJC 1LJLA 1NXSA 5E3JA 3O1IC 1K66A 1XHEA 1GCGA 5C5CA 3R0JA 1U8TA 2WJAA 2IPAB 1NXTA 5TPZA 3D02A 4ZMRA 3QLVC 2E4YA 1L5YA 1VKRA 1WETA 4Z99A 3NBMA 3ROFA 4TN5A 1DBQA 3I09A 4XAQA 3FFTA 2MYPA 1SXHA 1ZHHA 1NXXA 2A9RA 4W5QA 4KZKA 3ROTA 3OLVA 3HK2A 2CD7A 1EWVA 1M5UA 2TMYA 3HZHA 1QKKA 3CZCA 2E4WA 1URPA 2IYNA 4MPTA 2FLWA 1YK0A 4NQRA 4S04A 4ZMSA 3QEMA 1Z16A 4EVSA 2MYNA 2KYRA 4MS4B 3RVRA 1NXWA 2OQRA 3CRNA 3FFWA 3N75A 2PUFA 4UHKA 5GOTA 1DRKA 4P1ZA 5JNWA 1JBEA 5TPWA 5DGCA 3CG0A 3H75A 2PUDA 2QVCA 4LDZA 4G0YA 1QNLA 1CHNA 4MYRA 3OMWA 2RJOA 4O5AA 4RY9A 3E3MA 4XXHA 3N6VA 1BVHA 4LZLA 6CHYA 1CYEA 4GPAA 1SXGA 3K9CA 4RDCA 4TMYA 1M2FA 2L19A 2GX6A 3OO1A 3DZDA 2MSWA 3W9SA 1LBHA 3KTOA 3RVPA 3TX6A 3O21A 3VNBA 4N41A 3HJFA 3HCWA 1IIBA 3TB6A 5JNUA 3URMA 4EYKA 1EFAA 2FKAA 2E4ZA 1Z12A 4KQ9A 4EYOA 4OLBA 1MIHA 2L2QA 2JRLA 5KC9A 1SRRA 4RU1A 5TQ0A 4YRZA 3OQNA 3OLWA 3JVDA 3N0WA 3HSYA 1QMPA 4F06A 4LE2A 1H9CA 4FE7A 2HQRA 2V0NA 4Z4CA 1KMIY 2FVYA 3FMVA 4EUKA 1JFTA 2FEWB 2NZVG 5HM6A 5FWXA 5BR1A 2PLNA 3HVRA 4RS3A 1BAPA 1Z15A 1ZITA 3M6MD 1RZRD 3IP9A 3KYJB 3UK0A 1TM2A 4NICA 4IGAA 4Q7EA 4YS6A 3NNNA 3QLVA 4MQEA 4RKRA 4EYQA 1ABFA 2PUEA 2L17A 2CHEA 2QW1A 1USIA 3IP5A 3O1HB 4M88A 5TQJA 2BGGA 4ZPJA 3SQNA 4Z0NA 3GBVA 1MVOA 3DGFC 4G86A 1YMUA 3S99A 4NCAA 1RZRA 3QELB 3KHTA 5JNVA 1ISSA 1BDHA 2H0AA 3Q7RA 1D5WA 1YTUA 5C5EA 2W42A 2FEPA 3K4HA 3RVMA 5KC8A 4OG2A 1P8AA 5CHYA 3DLBA 3KLOA 4Z4HA 4L4UA 5HKOA 5TQ2B 1P6UA 5HSGA 2QZJA 2GWRA 3D8UA 3EJWA 1GCAA 1EAYA 1PUXA 4G0OA 4G0PA 1JFVA 3EDCA 3Q7TA 4RK6A 4RY0A 2PAFA 2DRIA 3KKEA 5KQMA 4W5TA 4Y9TA 5FBKA 3HDVA 4Z4FA 3QEKA 1D4ZA 2YHAA 4MLDA 2H3HA 1DCFA 5IEBA 2R48A 3HEBA 3IP6A 1KGSA 5EWMB 4F11A 4O1IA 3JPYA 4RWEA 2R47A 3MF4A 3T95A 3DLHA 4HNSA
chains in the Genus database with same CATH superfamily
2AQKA 3GGSA 2FHSA 3NGXA 5KJFA 2YFHA 1OGYA 5HVNA 1P4SA 3PB3A 1JG7A 1GL7A 2PHZA 4N6NA 1M0WA 3ICOA 4RFSB 3V7UA 2I7VA 1P1RA 1WSBA 3QXCA 1LRKA 1V43A 1G5QA 2OM2A 4MIKA 4XPZA 3A1FA 4F5YA 1L5SA 1T3TA 3NHPA 1UPCA 5LJLA 1EIZA 1Q2XA 3R5HA 2ZSUA 5BT8A 5HHTA 3DYVA 3L7OA 4J0DA 3RSQA 4P92A 1SXJB 3EZ7A 3EWSA 2FGJA 4RF5A 3WDLA 1QFJA 3FRHA 3C97A 5HE9A 1QBGA 2AG8A 2M1ZA 3SJ7A 1MO2A 1NP6A 1UMBA 1YQ9A 1JJAA 3HDGA 2C4WA 2YYSA 3GJ5A 4PCVA 3LUPA 4DA9A 2XMGA 3PC6A 1RC1A 1T8TA 1PG0A 3FY4A 4URYR 4Y1FA 3M5DA 3QPVA 2WWWA 1HE4A 3KTAB 1ZMXA 2NV0A 2HA7A 3C4JA 1SKYE 1Y3IA 2FTKE 2IDZA 4A16A 4HDKB 4W5WA 3W05A 4EG3A 3S7TA 4BRSA 4D79A 4BX8A 1T10A 4DKXA 4ZDJA 1PAUA 3NAGA 5ESDA 2AJDA 3KAPA 4GMDA 2B7LA 2PBFA 3OH8A 5GQSA 2GM5A 1UC8A 3L8MA 2AR7A 2OCYC 3EUFA 1JTEA 1J5XA 3LOQA 4HMQA 4WJKB 2Y68A 1LWOA 3E7DA 4UBLA 3JD0A 3EXG1 1QQAA 4E3WA 4G67A 4EG5A 4ZOEA 1P9WA 2CJXA 2Q5JA 2E0IA 2RHBA 3AR4A 3ZVMA 1DEOA 1RABA 4MX8A 1Z0SA 3AHFA 5H16A 3UOGA 3O8QB 2DBYA 3BMNA 2VQFB 1EH5A 1O97C 4H0NA 2I1VB 1ADYA 1YS9A 3AHDA 3O82A 4KH1A 2QN1A 3ZY3A 3DB2A 2OQVA 4ARZA 1W6RA 4EEZA 5CCBA 1S89A 1Z6ZA 2G25A 1JA9A 3MYYA 4UMVA 4V0OA 4O33A 3K1YA 2D4AA 1ZRNA 4UW9A 2WE7A 1WQ1R 2IXDA 1BE8A 3IAM1 2BF4A 2MSLA 3GGDA 2PDAA 2GN8A 3RAFC 3LQRA 2BFNA 3ORYA 3T4PA 2GEDA 3QEAZ 2H1CA 4NSNA 3EQ9A 3KKPA 4B5KA 5L45A 1F8XA 1ZZGA 1RVV1 2VRCD 1G38A 2JFGA 3ZQJA 4I1UA 4Q93A 3AF4A 2Q2OA 4EG4A 4I1IA 3PRYA 2B2CA 3OZUA 4IH1A 3WMRA 5EIOA 1NBHA 1HLPA 4ZV9A 1M34A 4RV4A 3GROA 3ILHA 4F72A 1JXMA 1PFVA 2ZIUB 3EULA 5D8DA 4FB4A 1Z36A 3AO0B 2R96A 3E81A 4OSEA 5BWMA 1OXKB 1YB4A 4ALJA 2W2PA 4FBGA 2NM0A 4MWCA 4RPCA 5KJEA 3RTCA 4M0LA 3RLFA 3WLSA 1F8YA 1UFRA 1SQ5A 4RTQA 3TLJA 3TK1A 3UBMA 6AT1A 1YBHA 2OM6A 5B7NA 1QP4A 1VBNA 2DPHA 1RPTA 1BHQ1 1E2QA 3QQ5A 1NYRA 4RPJA 1CEXA 1EG2A 2B99A 3MD0A 5E2BA 1XBTA 3BXHA 4Q4JB 2R85A 1R9GA 1YBVA 2K5UA 1J0CA 2BH9A 3TSYA 4QGHA 1BEZA 2VOJA 4IGIA 4RZSA 3D3EA 1J97A 4D80A 1HLGA 2HJGA 4P54A 3BF8A 5ALUA 2YJNA 3PDUA 4N5MA 2RGUA 4YIHA 3T1TA 2XLCA 1W5SA 3DNMA 1MUUA 1LBIA 2AWNA 4JGGA 1XU7A 3I9FA 2VAPA 5C18A 5IASA 4JR1A 1UODA 1WXIA 2CXSA 3ED1A 3L84A 3LPMA 3N05A 3TBKA 5JTTA 5T67A 4J0EA 5GGYA 3OOYA 3PIIA 3B1JA 3PC3A 4WHMA 1P3JA 2DFLA 4HD8A 5ALDA 4JXXA 1NY5A 3R5KA 4HP8A 1I0IA 3CKMA 1Z2PX 3D7SA 3JATA 4YRMA 3CBQA 3PKZA 2ETVA 5JSKA 2VJOA 4X7RA 4E12A 3CPJB 1QK3A 2YMLA 3G8YA 1LPBB 1SVNA 1WPRA 2FZKA 2IFTA 4RJ2A 5K4GA 2QQEA 4JAVC 2AVNA 4M89A 4B40A 2EATA 2A5DA 3GEHA 3MOGA 2HA4A 2JI6A 4RZ3A 3MTJA 5CUQA 3UAOA 3OTWA 1U2ZA 4QTUB 2JH8A 4B09A 4BO7A 3X1JA 4O1HA 5D7NA 1RYNA 5AIBA 1TVMA 3DTTA 5DCYA 3H18A 1N34B 4CM4B 1BCRB 4TUYA 3LQQA 3O3MB 4E4TA 4H1HA 1TU0A 2WSLA 3T3MB 3T54A 5KQPA 4HKTA 3MJCA 1G7TA 5EWLA 2F43A 5B58T 1XT6A 4L4XA 1I4TD 3FROA 2WG0A 3C3PA 3FCEA 5BQPA 1Q74A 1I1OA 4WN9B 1PR5A 1JJIA 1QTIA 2IEDA 1NATA 4II3A 4W7SA 1DEAA 5EZYB 5EPEA 4CUZA 4PHFA 3RIEA 1AF7A 1FYEA 3ZHYA 1JIKA 2ONCA 2RAPA 3EG9B 4WTOA 5JASA 2WZBA 3GH1A 1SKQA 2DX7A 4H7DA 3V42A 4GLJA 1NPTO 3NIGB 2E55A 1J00A 3ESQA 1EK2A 3LX8A 3GIDA 1VBMA 2HEGA 1UADA 3C70A 1UWLA 5DH9A 3ACCA 1VI6A 2GK3A 2W2VA 2OUIA 1RHUA 3M8KA 5CYOA 1S2OA 5EWJA 3WJ2A 4BQEA 5JNTA 3CPSA 4WOJA 4AYWA 4QVGA 4C78A 2ZI7A 1TGYA 4P4UA 2WSYB 4D46A 3CH6A 1GTJ1 1NXQA 2UYOA 2GN2A 3PNMA 1R8XA 2FR1A 4K46A 3LNTA 4IIJF 2DC1A 4KYUA 3L41A 3L8HA 3I2HA 3V2HA 4NS4A 4OO3A 2ZKIA 5IVPA 1LRJA 4P22A 1JALA 1XEXA 2HUNA 3EVEA 3HJAA 4IILA 4Z7NB 3DL7A 1RXIA 3FMIA 4D9IA 4X3OA 1Q1AA 5K0JA 2HJVA 1PK8A 1PLKA 2O8DA 2PBZA 4JP5A 1H8HD 4OYHA 3U7JA 4FHCA 2HA5A 4MS1A 4WOPA 2VBFA 3OWOA 4KEAA 4QODA 2O1SA 5JHHB 1GTSA 2CDBA 4GEGA 2FEKA 4XDGA 1JR6A 3RJMA 1OI2A 1OWLA 4K0RA 3I9MA 3BQNB 3PEUA 3UFXB 5EIXA 3R6GA 3RTAA 4RTMA 1NTRA 1NRWA 1FDVA 2CLFB 3E70C 3HEMA 3LPLA 5D00A 1DDIA 1K7FB 5EKUA 5I5EA 1TF5A 2H0QA 3QEMB 3HN6A 5FR1A 1QIEA 4BB5A 1GXSA 3ET4A 4G0WA 3PNLA 3VAYA 2A59A 3HDYA 1T9ZA 3Q3EA 2RAVA 4X5OA 4IVRA 2ZRMA 1BDJA 5EUQB 1FYFA 1VHWA 4O4JB 1GGVA 3EPKA 4GGOA 3ZJUA 4UUAA 1YOVB 1OUMA 1FSPA 3TZLA 2FPIA 3HCOA 4HLQB 3MS2A 4ROSA 5C3UA 3HKCB 4HFRA 4UTZA 2BJVA 2NUAB 1T6YA 2UVPA 4E14A 4ZCRA 3ER8A 3CU5A 3IQXA 3TSOA 3AIMA 2Q6KA 3SICE 4DR4B 4FB5A 1ZLYA 2ZRJA 2HCJB 1E6MA 3W1WA 1DCKA 1Y1RA 4BV8A 4ZJYA 4EDHA 5LN1A 5ENZA 1J2YA 4P3KA 2OV2A 3JAWA 4WKBA 5KOJB 3O8NA 4D56A 4BU0A 5DV9A 4Q01A 3COZA 3C7TA 1TOAA 1L7MA 1I0LA 2AOUB 1V4BA 5AO9A 2EV9A 1EDZA 1NKVA 3ZW7A 2QR3A 1DAKA 2JB9A 3B82A 5GONF 3A27A 1C1DB 1EUDB 3R3YA 2NUPA 2IEAA 4KXLA 1AQ6A 1OU4A 3OZGA 2FN8A 5BOVA 3TBFA 5BQFA 3QW4B 3AGPA 1G3IA 4UFNA 3OZ7A 4PANA 1YJAA 3PXBA 3OTOB 2P5TB 2N75A 3K6RA 1C80A 1ZN9A 2LE0A 2ZAGA 3DAGA 3TZCA 1CUBA 5ALPA 4DKJA 4A10A 4PTLA 2AQIA 3NBKA 2G1AA 3FSEA 4ZT6A 5F35A 4EELA 5B5SA 2HIGA 4KODA 3VH3A 2ZRHA 3NWJA 4HVLA 4FYXA 1IBRA 2D1RA 1J2UA 3KOUA 3ONNA 4XM0A 1HT2E 2FG7C 1RACA 1G2QA 2XHEA 3BWMA 5AFSA 5HKKA 5CGQB 5IDYA 4H6XA 1KARA 4QE3A 3WAJA 5ALSA 3PJRA 1ILEA 3PNSA 1F0NA 4BQOA 3HMKA 4DLWA 2PMFA 1U0TA 3AR2A 1WEHA 2ISSD 2WLTA 3L9WA 5DYNA 1ZJ6A 2WYIA 3CGGA 3G9QA 3RK1A 4CXMA 3AEYA 2PZKA 2WYWA 2EU8A 2EEPA 4DL9A 3JZFA 3NUGA 1QWSA 2O23A 2D1SA 3LDFA 4DA7A 3AVVA 3ASZA 3U44B 3STXA 3UGTA 3W5HA 3IR5A 4EUEA 1SKUA 4HDMA 4HL6A 1FFXA 5B53A 3DJYA 3EIOA 3NTXA 1RSZA 1DC3A 3NTQA 5JNLA 2COKA 2B0JA 2F1KA 4BMPB 4UXHA 2VP2A 4MJLA 5BUQA 3VPSA 4AMYA 4JIMA 4F4DA 5DTQA 1V2HE 4DILA 4C6TA 3NUZA 3TCXB 3KE9A 1K98A 1KPGA 5HF9A 4BNKA 1EPUA 3GFTA 1P60A 4JJ7A 5JH7A 3UBTA 2FN9A 3OHMA 4GZ3A 2P6OA 3B5EA 3FSJX 2GZ1A 4J49A 4MPPA 4NCIA 4PS1A 4ZZ0A 5IHXA 1GCGA 1KVSA 3ESAA 3IAFA 1FVHA 2VHTA 3PHJA 1U8TA 4UBKA 3CLRD 5TPZA 2E89A 1M83A 3RYIB 3K0SA 4RFVA 3FMGA 1VKRA 1N6NA 1SBQA 4NCNA 3PUJA 4PAGA 1WHTB 2X2EA 4LF4B 3DEKA 4FGSA 4BLWA 2NV2B 4GGMX 4W5QA 3WRVA 3O91A 4EUNA 4X0EA 2LKCA 4CT4B 1U1FA 4R1NA 5JY1A 4BKPA 4RTPA 1GPLA 1PR4A 1V4NA 10MHA 2VDWB 2VO1A 3QWBA 3BAFA 2XMBA 4MPTA 4F1WA 5FAXA 4EECA 1JDBB 3ONVA 1ZRHA 4Q7LA 4UC0A 1EBBA 5EE1A 1GUZA 2YIVX 1UOOA 4LFAB 3L0CA 2AEEA 2DLDA 1MQSA 4RKEA 2WTUA 4H3SA 5ICEA 3WQBA 1LI4A 2BPOA 1ZD4A 4C07A 2ODBA 4XPIB 1Q84A 4ZA2A 4AJKA 1T9KA 5TPWA 4LFCB 1AU9A 3E7WA 2PT6A 1QFZA 3UA3A 1FP1D 3ZI4A 4XKJA 3IA7A 5C1OA 4LRTB 1Y33E 5TGZA 5T57A 3EXG2 2IRWA 3N6VA 4RH3A 2XD4A 1CKEA 2PLRA 3HRHA 1KEZA 2ZLBA 1SK9A 1DVRA 1T4BA 1TCAA 4LOKA 1U8XX 2FPXA 5C8YA 3VQTA 4XQGA 3RWBA 1RADA 2OFPA 1QZ3A 2BUCA 3L7KA 1ZJJA 1JYSA 4MGYR 4MV7A 5EP2A 3M81A 4G4IA 4CYMA 1WX1A 4TVOA 2OQIA 3EXEB 4N41A 3IVRA 3MLEA 1KO4A 1N7IA 2NTEA 2XWQA 3HCWA 4PG8A 3ZWQA 4DV1B 1VFPA 3I4FA 4WD3A 3USES 5FYQA 4KQ9A 4UHCA 3DEIA 4FKMA 1YQDA 2AW3A 3F7OA 5HF8A 3I9V1 4YRPA 5FTWA 5AW8A 5M34A 2QVYX 4LISA 2DQZA 1O3YA 3O84A 5BWBA 5KTRA 2RCYA 5LL6P 1I2MA 1A69A 4EUKA 4POOA 3GLHB 4V0KA 2GMWA 2BKXA 2CUZA 4R2IA 4RHUA 2OXIA 1KVQA 3IV9A 2HU2A 3LGAA 5FWXA 1KOGA 3D7NA 1V1MA 1UJ6A 2ZWIA 3FVTA 4JWKA 4DYHA 5JJIA 2PH1A 2VJDA 4RA6A 1KZ9A 3IUSA 3LBAA 3SZLA 5AVQA 4ER3A 1SU4A 1YZTA 1XJCA 4J9VA 4A6EA 5BVHB 5JI2E 5J1SB 1DV1A 2AD5A 4WUVA 1Z34A 4OMUA 4UAJA 3VV3A 4UTPA 2R6FA 2GASA 4HN9A 1XMOB 4PRZA 1YKFA 1XKQA 3Q8XB 4RX1A 3U0BA 4QU9A 3WWOA 1QBKC 1YFKA 1ZAKA 2W6ZA 3RSGA 4RYDA 1SJ9A 3CYFA 1BN7A 4PX9A 2AD1A 4G26A 2IU0A 4PYMA 1T4CB 1BWRA 3E9NA 3HU1A 4IAOA 4JUFA 3MNFA 2ZOSA 1NF8A 4U5QA 1RBYA 3JQEA 3OJWA 4KSCA 3USZA 1G4AE 1ZHOA 2X76A 4NBKA 2ZRKA 1TE2A 3ESZA 1TA0A 1X2EA 1V1RA 3EZ2A 1UDAA 1YI0A 2JA2A 5C9ZA 1RCTE 2I33A 3KTDA 4V0NA 1RDFA 1CVRA 5EKTA 3UJ3X 4V0QA 3H2JA 5SY6A 1G8FA 1F2TB 3HSKA 4DJ5X 3IUJA 1Z6YA 4FE3A 1C7QA 2CGEA 3V1NA 1L1RA 4K26A 1OV4A 1ENZA 2XVAA 3NATA 1CFJA 1KQFA 1YFJA 1RQGA 1B0PA 3PUXA 3BJMA 1ODJA 3QU5A 1A9OA 2AG5A 2SBTA 4CU2A 4QEZA 4ZVRA 4L51A 1N2IA 1P5FA 3QPWA 2O7SA 5LA6F 1BKDR 3JSAA 1GPMA 2NW6A 3BD7A 3DR3A 1PFUA 2WYOA 3M6UA 2Q99A 5J2UB 5B1EA 4YACA 2J0EA 5IP5A 3RYTC 1B0ZA 4XUCA 2AX3A 3EZ6A 5LXTF 4IKOA 4EG0A 2XRYA 4IQ0A 1I36A 1L7XA 4CQLA 2EGHA 3MCZA 4M1YA 5L3QA 2G8NA 3BJIC 2PV0A 3HNRA 4JLNA 4IFBA 3B2EA 1PJAA 1GQSA 1AO3A 1YO6A 4RUKA 2YXLA 2GPNA 1J06A 4ALNA 3ZVRA 1EP9A 4BBAA 2N1BA 3K70C 2ZVJA 3T7CA 4LDAA 1EQ2A 4N0PA 4UDYX 1NNEA 3OC0A 3LLMA 1XAJA 3PQEA 5IX8A 3NYQA 4CIBA 1IEVA 1XQWA 5AVKA 5ALLA 3EIXA 3U4MA 1PS0A 2IOYA 5AOCA 3TLKA 5HR5A 3T5PA 1W5AA 4QG3A 1F4PA 1MAWA 2VYQA 4S3MA 3FPGA 4X6LA 2YBDA 3QOYA 2QPOA 4KKVA 2F3PA 4R0NA 4V39A 3G17A 2HMWA 3FSRA 3MC1A 4LWQA 4RHFA 5AJYA 5ANRB 1PV4A 3BJEA 3DS8A 3LXMA 1U0OC 2HRQA 5B1DA 5CDGA 2ODWA 4ZAZA 3K1AA 3FCSB 4FZ3A 3KKMA 3AJRA 3CVOA 3S29A 4ARSA 1MN6A 3KYIB 1ZKDA 4R01A 3LX4A 2VHEA 1QCZA 2DT5A 1GSHA 2P90A 1XDBA 5JXGA 1X39A 1ZP6A 1UK6A 3UMJA 1Z13A 3QXSA 1E1RD 4Q9AA 4WNCA 1DUVG 3ZGZA 1FOEB 3L1HA 4ZVQA 1ZI6A 4V0MA 1NRIA 1X1DA 1N78A 5IVIA 3IPCA 4ARUA 4BMOB 5EJ5A 1TLLA 2BEVA 3AUKA 1JDPA 3LJKA 3DMNA 2B6HA 1WKVA 2YXDA 3EFOB 4P7FA 1KKMA 2EFYA 2RGGA 3MAGA 3DQPA 2NT3A 4B6QA 2C0QA 2PK3A 4ISBA 3V46A 1ORWA 4PLVA 1N0UA 4QWMA 1XLWA 3AIIA 3UY4A 1OFIA 4G4SP 3CUVA 1M8GA 4DCGA 4OYYA 5K5EA 2HA0A 3FPHA 1N1MA 4D8UA 1DKOA 2VT6A 5IZCA 3K71B 1YR2A 1KY4A 4M7PA 4NR0A 2O8EA 3NGMA 2WJIA 3KFVA 4EHKA 4HGPA 5IAKA 3HKBB 1AUXA 2C9BA 1SZPA 3MCUA 1F2DA 5F23A 2P3OA 1DOAA 3UYLA 4L8LA 5K3OA 2QD2A 4MA5A 3WLTA 1JL3A 1AV6A 1XGKA 1RHKA 5GJCA 4JUCA 1Y9ZA 4AYXA 4AS3A 3HBNA 1IG0A 1Z5VA 2C59A 2ZIZA 3DA8A 4MV1A 4LVNA 2ZSBA 3NCTA 3VR0A 2DPLA 5D6OA 5CB4B 1Y6GA 1WM1A 3OM8A 4XVRA 3E23A 3NFYA 4OHBA 1KI1A 3DZHA 2DB3A 4P3XA 3O0TA 3O8LA 2HR1A 1H2YA 2XUFA 2ZJYA 4OK3A 3RVSA 2I71A 5JZVA 3DDUA 2XUIA 4WXHA 1TCCA 4K6MA 4OA8A 3OUTA 1YCGA 4N03A 3I2YX 2XQFA 3ZCXA 4E30A 1EEHA 3HR7A 1GTRA 4HH3C 4CKXA 1RI5A 2BEKA 1XMSA 3KT6A 3PI7A 1GRCA 4WFIA 4UCQA 4ZT3A 1GQRA 4QBIA 2NU8B 4N3NA 1KU6A 1A9XB 5J1TB 1IJEA 2WWFA 3P8ZA 5I7FA 1MX3A 1NNLA 3U3RA 4EB6A 9LDBA 2C98A 3CSSA 1AIPA 1F38A 1Q83A 3MD9A 2WPNA 4GOLD 3GRVA 4KVFA 2I8LA 1DV2A 3I2KA 2JF0A 3VR6A 4C7MA 2OHIA 5KJ1A 3RUFA 2JDIA 1CUHA 2H2WA 2XGOA 1QVWA 4PYQA 3MEQA 2CMGA 1J21A 2B9EA 1BMQA 3UKJA 3FYUB 2O2HA 3GA7A 4C1BA 3UT0A 3AY7A 4QDXA 3ONDA 4MWZA 3S7ZA 3T3GA 4X63A 1DIBA 4XE5A 4JFAA 1A4RA 4LJRA 1JIQA 2FUNB 2JAWA 4MO9A 5FORA 2CYAA 1ISIA 1X8XA 1ZS9A 2ZREA 1IHXA 4IHAA 2EP7A 1NYQA 4W7IA 4ZEMA 3TE7A 4OX9Y 3DZIA 1YUMA 4K87A 3WLAA 3VKFA 4IKEA 4YRLA 4FQ8A 4I55F 1GILA 4YCJA 3QFFA 4TZ0A 5SZIA 2A5JA 5JARA 1A98A 1U5BB 3FJ1A 3AYZB 5AW3A 4G4SO 3RHZA 1KJ9A 3V4RA 1P72A 1BS9A 1Y9DA 3EQ2A 5JLAA 3NOXA 3ZXIA 2WSMA 4QDOA 4QO7A 3SIWA 4N0DA 3THXB 2GKGA 2AKEA 1UC5B 1R27A 1H8ED 5EE5B 3ZHBA 1QSGA 4PQGA 1PGOA 4JYPA 1L5RA 1VG1A 3KVRA 3WDSA 2I03A 2ZTMA 3QEBZ 1CV2A 1E1QA 3SKXA 4XYEA 4EI9A 4EPTA 3Q15C 4XCXA 4NYIQ 4YDSA 4LUCA 5HJ7A 1R0WA 1GAJA 1PUJA 3OJEA 4L3VA 3EOBI 1VYTA 4PU0A 3LBNA 1TK9A 5FWXB 2B8WA 1C7RA 1R5NA 2Q1YA 1MNQA 2VAWA 3GJYA 1N6PA 4MJXA 4ZOQI 2VHZA 1A5TA 4WLVA 2J85A 5JAQA 2PKYX 4AZ0B 2IY7A 6ABPA 1STOA 4JUAA 1XNJA 3FSGA 1J07A 5CX1A 1GPJA 3Q6NA 1UFOA 2IIQA 2YQ4A 5EHZA 1QGOA 4QXPA 1NVKA 2I1LA 1KYVA 4ZAFA 2X4GA 1WBDA 4A03A 1Y89A 4XUDA 3ZCRA 1OJ7A 4ZT2A 3U1TA 1NW5A 3DO8A 1OXBB 2GXQA 3I83A 1G19A 4IUBS 2OHGA 2A0WA 1LF5A 3TFQA 4ZGWA 2XYPA 3NR2A 4PZCA 1SKBA 4C0BA 2IYOA 4MCAA 1VECA 2V3CC 2Z3VA 2LP4Y 3HBJA 4BIMA 4B83A 1ENYA 3C0KA 3FCAA 1YF3A 5JU6A 3PNBA 3KB2A 3NBAA 1E3SA 2FP3A 2DFKB 4FXPA 2H6EA 4RZXA 3VX3A 5A4FS 3U7FB 1USGA 1HEIA 2DM6A 3FHCB 5AK5A 1JEQA 3HUTA 3TOZA 2H1FA 3U7GA 2ZZNA 4KWEA 4K6KA 2C7VA 4H77A 1H2XA 5TPWB 4LHSA 1CB7A 1RVDA 1LPMA 2AN3A 4WZBE 4LZNA 3C5EA 2OYSA 1NN5A 5AK6A 4ABYA 4LFBB 4WBSA 1AQIA 121PA 5CLHA 3THOA 2OZEA 1UWCA 4TMVA 1KQOA 5E6UB 3FTEA 5AHKA 2QGNA 5HKAA 3O1LA 2ZIVB 3OP4A 2VDWA 1MJHA 5HCUA 1PR1A 1VHLA 2WIAA 1LSUA 1M3SA 3RU9A 3PQ2A 2IUUA 1FRVA 1KIAA 4LC0A 3RHTA 3QA9A 3B6MA 3BCUA 3OICA 2G9NA 3TIXB 4BYMA 2WVAA 3H9GA 1ECBA 1OVGA 5ENDA 1WHTA 1IY9A 1KOLA 2PNJA 5JMOA 3AETA 1C1YA 2PUTA 4Y8VA 5EXPA 2CVOA 4MI6A 1PKEA 1T8WA 2WJHA 3RYIA 4Y9UA 4L08A 1U7DA 1AUQA 4FSDA 4CV2A 4NMMA 2WJ6A 3Q9NA 3R7DA 221PA 3WL4A 3OZBA 1DAMA 4R8LA 1K7CA 3TSCA 2GZAA 4QBTA 3UXHA 4D9FA 1ULZA 1V11B 2P9YA 2UKDA 3AI7A 3X2SA 4DIDA 4HAVA 1QP8A 1E7MA 5F1YA 3Q7SA 3SBDA 1ZU5A 4Z7OB 1PFYA 1W4CA 3OTQA 3E84A 4EY3A 2MSKA 1GRNA 1GGNA 3D4OA 4RXMA 2GPAA 4PC1A 5LA6B 1OX6A 4K03A 4KR9A 3VZPA 5A2QA 5IULC 1GAEO 5TDHA 3OCVA 2B1QA 2B8JA 2WKWA 7REQB 2OB2A 4BO4A 3ANSA 4YMIA 4NOKA 1AA6A 1FDOA 2C61A 4EITA 1AQNA 3K9LA 4ZVVA 4I1PA 4ZEWA 1OZFA 2OXFA 2DZDA 4G97A 5DSTA 4DPKA 1HOXA 1U3TA 4S0XA 5U9CA 3QVUA 4AP9A 4Y2YA 3N8KA 5CEJA 4OA5A 4MPDA 1QYDA 1J20A 1YB2A 1CD5A 2HH9A 5DVZA 4BVFA 4F92B 3DTVD 3BZWA 3PXEA 3C14C 3HVJA 2DPGA 1MIOA 4LE1A 1QRAA 4PSKA 1KEEA 2VI5A 1CWUA 4RMIA 4BO9A 1EM8B 4R98A 1AO0A 2H1SA 1KL7A 1VPTA 1SBZA 3CLUD 4RC9A 3E2PA 3V00A 3G0GA 1KBOA 5D3QA 1I7QB 1WUYA 1IVYA 4I19A 5AHWA 2ZB2A 2ZRCA 3KQSA 4JSYA 3TFOA 1PT9A 3BRQA 3NIFB 3JQFC 4RVNA 4Y1RA 3SZOA 2JLUA 1SC4A 4GM0A 2WOOA 1MC5A 1A2QA 2ZI4A 3EOAI 1XR3A 4I46A 4I4LA 1LVGA 2Z1NA 1D2RA 3D1JA 3T9AA 1LTQA 3V5NA 2QI9F 3WYAA 5BWCA 4URXR 1CUFA 1R5JA 3EXIA 1C1XA 4G37A 4DAEA 1MB3A 1LA2A 2NYRA 2WIDA 2ZBGA 3WKDA 4B3JA 4E7OA 3DXXA 2ZDGA 3D8SA 1J09A 1MP0A 5FBHA 4DWWA 1JXQA 3UWMA 1HEYA 3I9JA 2B78A 3NKLA 4FDMA 4LRYA 1IQ0A 2IXBA 1YZGA 4XASA 5KOYA 3U4DA 4MR7A 1EQUA 1G6Q1 1TKCA 5JWHA 5DHTA 3E18A 2JC3A 4DSZA 2H2DA 2PKCA 3ZDFA 1G20E 5CAEB 3ET5A 4KAAA 5A2GA 2WSSD 3GFGA 3LSYA 4D45A 1HFJA 2JLXA 3U13A 4JA2A 2JGFA 3F5MA 4PQEA 3JAWB 4QPJC 4B3TB 1BKSB 3NX4A 1MAUA 1J8QA 1SCIA 3DLCA 2EHJA 3G7NA 1P9LA 1GA6A 1SPXA 2J30A 2L82A 3PGVA 3PTLA 4ND7A 5AHXA 3VYRB 5IJWA 1FMFA 1KO5A 2G40A 2ILTA 2GBCA 1RQ7A 3D02A 3MAJA 3DZKA 2G72A 2V58A 4GI7A 3C1TA 4IR7A 3E4DA 4XTRA 1BWPA 4F84A 4L50A 4P4GA 3LP8A 1SUFA 1AQYA 1OY1A 4ER5A 1YGYA 1FMTA 4BPBA 2AFIE 2J4DA 3UIEA 5JQGF 1P5RA 2XNSA 3T5GA 2WFMA 1NDUA 4TWAA 2E4WA 4BTLA 2CXHA 3K7EA 2ASVA 5IAJA 1DAFA 2IYNA 3ZZTA 5JZSA 5C32A 1YA4A 3N2ZB 2UZ1A 2ZU0C 4IDQA 5AJZA 2OO5C 3KFLA 1GKKA 4NE7A 1NXWA 2WM2A 1AK9A 2G1PA 3ASUA 3NKVA 2R11A 2O06A 2ZULA 3GUUA 3P5BA 4E4YA 1PDVA 1V6SA 2AH5A 1E2HA 2QF7A 2ZJ6A 1X7YA 4L9WA 4AMUA 3ZHSA 2EC5A 3STWA 4BNUA 4YASA 2C4KA 1L7QA 1Q3KA 4HDSB 1OIXA 1OZHA 2P2YA 2X42A 2XYVA 3OMWA 4K1LA 4PZLA 4R51A 5I7WA 1FQOA 4MUBA 2O8DB 2ENWA 2E6UX 1VA5A 2FUEA 1NG9A 4Z51A 1GEGA 2QJWA 1JILA 1PWHA 2BZ1A 3W34A 1KYTA 2I91A 3HJFA 4EZEA 5DLPA 2AUMA 3IULA 2GAJA 3WFZA 4GMKA 1TUGA 1PQUA 3VPCA 4MYUA 3RRFA 4CETA 1ZNQO 3H0CA 4L95C 5FFMA 1C7FA 3FNRA 4JI1B 2DHDA 3OUUA 2F2TA 1Z6PA 1W4BA 2XNHA 5CCEA 1IAVA 5AM0A 1KP2A 1TU3A 3EHDA 4GG1A 3HSYA 2GWHA 4RV9A 1JHMA 1NMZA 4FE7A 1JLSA 1LLUA 5DYYA 1G291 1HK7A 2JATA 1KMIY 1KE2A 4BWVA 3DKKA 3IV7A 4L8VA 2ZJ5A 3TGWA 3WTBA 2VXCA 2PTGA 2ZJ8A 3FPJA 4NBRA 3PDHA 5BR1A 5FCDA 3GPIA 5JW6A 2J6HA 4I9FA 5KSPA 2GXSA 3HA7A 3L7MA 3RV4A 1KI3A 5JDIA 1TM2A 1QHIA 1T9BA 3D7MA 3OM9A 4YI5A 3ZS8A 4F97A 2VATA 3A1EA 3OSZA 4WN9A 3NPAA 1CUWA 2LTAA 1ABFA 4DIKA 2H4XA 4M9XA 1DKMA 3FOAA 3CVUA 2CVZA 3ILXA 4QUIA 5DI9A 3IP5A 3O1HB 4ZQGA 3QPCA 2W6ID 5LOVB 1E1MA 1XCJA 2BHLA 2XECA 3PVZA 4EZIA 4NMLA 4TMTA 3GBVA 1I4OA 3SXPA 3T3EA 1IC6A 1KTVA 5LP1A 3MLBA 3OPMA 4CM4A 4NAVA 5E9WA 4EJSA 1W0CA 1TIBA 4M1ZA 2YHUA 3IUNA 3DBRB 4ZKEA 4EBBA 1Z6TA 2XOKA 5JSZB 1OFVA 2JIRA 1D5WA 4O63O 5E7MA 1P73A 1ZUIA 1G3RA 2J9FA 2JCSA 2XE7A 5C5EA 1NIJA 1ACJA 5DM1A 3RVMA 5KC8A 1VSQA 3I8SA 4OM8A 3SXJA 1AQUA 4NYMQ 5BQ5A 3P2JA 1PEKE 2BELA 5ARBA 4CEHB 4TYMA 1DNPA 1XG5A 5T3UA 2XWJI 3FVQA 3UMRA 4BVHA 1EWYA 4UNRA 4ZPXA 3W9YA 1C5KA 3DUFB 2JHGA 5AI0A 1P1IA 3ZIAA 3VNVA 2GM3A 1DOZA 1XZCA 3I2GA 3WWPA 4EKGA 4Y9TA 1L7DA 3HDVA 2YW2A 4Y6OA 4ALLA 4M87A 5ITVA 2P2ZA 2ZM6B 1ZIDA 4X1KA 5ALGA 2ZITA 1XL1A 3I9NA 1I5OA 4JY7A 1DBIA 3FPCA 5E3IA 1F5NA 1N3LA 5IF9A 3HG7A 3C6XA 3ETCA 1GPAA 2BFBA 2HF8A 2Z57A 3PBKA 4K6OA 3CUEF 4C88A 2HK9A 4I0WB 4HZUA 4ZN6A 4BKOA 4YBRA 2PX4A 3N8DA 2BP7A 4Z8YA 2M6SA 4AZ0A 2HPZA 4BMSA 3PU6A 1O2DA 2H5LA 3FF4A 3U6KA 1SG9A 2IEIA 4YGXB 2VOEA 4OHUA 4ZO9A 1PZHA 3GMIA 3UB2A 2PKQO 4J0CA 3ND9A 5MN5A 3BH7A 3PP8A 4CM8A 5DNWA 5LLDA 4WLOA 2KPOA 2HA2A 3EXHA 4HR7A 1PE0A 3PXAA 1HF3A 5IABA 2PVCA 5AR1A 2I3BA 2VJPA 3E03A 1WPXA 2FMHA 1YZYA 1IUNA 2P8JA 2V8BA 4G1UC 4K2HA 3K9QO 5FUMA 1M75A 5CEFA 1ONOA 2OBMA 5JROA 2YWJA 3R7SA 2YV3A 3BXZA 5FHRA 4EGQA 1ISMA 3USCS 1SVWA 1NBME 2KHZA 1EK1A 4QEDA 2RGYA 2BMEA 4FMCB 2GAFA 2CY0A 3EQ7A 1IOZA 1W36D 1E89A 1N6KA 1IK6A 3MPUA 4JH0A 4XH9B 4RK5A 3NV9A 1YD7A 4S05A 1E60A 3JW8A 1UBTS 5HJ5A 1CF9A 3F5FA 4NATA 4KX3A 3GUYA 4C2BA 3V7FA 2I4TA 4R16A 1QB7A 5A5FA 4G2TA 3BE8A 5IYZF 1YMQA 3W7VA 4XVQA 5BN4B 1M6WA 3WOHA 1DG3A 1A4IA 4MUFA 1DGQA 3RUDA 4DYDA 4R2KA 2LBPA 1NWCA 4P82A 3T0GA 4IVNA 2GPSA 1RS0A 2QI9C 2OZVA 1W2WB 3CSUA 4XFDA 3WAGA 3I3OA 1H3EA 4JJAA 1ZW1A 4UHHA 2RC5A 4PHCA 1EP1B 2R6R1 1OH6A 4MGEA 1FP7A 4V1CA 2BRUC 4KE7A 4EB6B 2VDMB 2QZSA 2I1WA 4IG4A 5JXJA 3LCVB 1A9XA 4CF5A 3H5WA 4Q3LA 3BGDA 1YS6A 4NHOA 1JDNA 3D6AA 1YK1A 3F3YA 3IEXA 1B8VA 1QZTA 1K3TA 1E18A 1IOWA 1WL8A 2BBWA 3JQCA 3NH9A 1DAHA 4HH4A 4A2WA 1DC7A 2E18A 1VZ3A 4ETWA 1R8YA 3LHIA 4J2TA 3U31A 5JS7A 1JWBB 2WIFA 4WN3A 3ZQ6A 4TKUA 4YCMA 5IUJC 1I4EB 4X65B 3P27A 1IWBB 1KSHA 1XVIA 3WGTA 2QROA 4JI7B 3NNDA 1EU1A 1YBFA 1YT5A 1F0YA 1RJ9A 3I9OA 3KB6A 3C85A 1ZN7A 1E99A 5C5IA 2C2OA 1Q20A 3F7NA 4C4TA 4B6JA 4CIVA 1R66A 3DSRA 2IBMA 4BU1A 5LIPA 2H4HA 2NU7A 3ZGLA 4QNNA 2V5UA 2XOXA 5C46F 2C29D 2IE0A 5F64A 5HQJA 4ILKA 3K2BA 2O8EB 1QYIA 1JJ7A 4NMWA 4OKSA 4U2GA 3EF0A 1XQYA 3OD5A 2B69A 4PPFA 3QKWA 4EF4A 3OECA 3DLAA 5B6IA 3D8HA 4P31A 3EUEA 4LWZA 2GEUA 3GDGA 4ND2A 1CRZA 3HDJA 2NADA 1BXGA 1NVEA 2C03A 3H99A 3UV3A 1GQFA 4DMCA 4LJ9A 3JYQA 1I1HA 2CYCA 5I7EA 2IZOA 5K8VA 1NNI1 5FOXA 3FNHA 4B4WA 1JQEA 2PO5A 1E1YA 1V3TA 3SEAA 2ZP1A 4L07A 5C8DA 4XSGA 2Y1CA 2BMJA 4UREA 2Z0MA 2VCYA 3ZU6A 4ZO8A 1GG8A 3RSLA 1I6LA 2O2XA 4JB2A 4LNHA 3TNJA 3V2UA 3A14A 1KAGA 3VYUB 2PGIA 3F97A 2QLNA 3ND5A 4CKYA 2OHHA 2FWJA 2V7BA 3PPWA 4FSHA 3WLMA 4S12A 2ATIA 2RGRA 1K75A 4P3NA 3PX3A 1Z0JA 1Z82A 2ACVA 2EERA 5ALIA 5L4NA 1M8FA 1Z68A 1XF1A 2RG7A 3BG5A 4AJ9A 2D2XA 1D4OA 2ZRPA 1B74A 1CG6A 3WL3A 5K0EA 2Q5FA 4E11A 4DMRA 4EYGA 3SC2B 3DHVA 3OU2A 4HMOA 1L8XA 1R6VA 3PQ6A 5HRAA 4OHYA 1EG7A 3O7MA 4J8PA 4LSZA 5BRNA 4MAAA 4F0JA 4G8DA 5F3RA 4MS4A 3PNOA 4X8OA 4PICA 4CGYA 4E46A 2D00A 1NIPA 6Q21A 2Y8EA 1OLXA 5DF1A 2O48X 4YUXA 3SZUA 1AH2A 2SKDA 3F5QA 1UPBA 5FLEX 2JJ1A 5F3DA 4JT4A 2J7PD 1P9OA 3QNUA 4UVGA 1GNSA 1OLUB 4YECA 2GK4A 5EINA 3BXFA 1J0EA 3HP7A 4JP1A 2OBFA 1M2KA 2OXRA 3HKDB 4GOXA 4KGZA 4DM3A 2D1FA 3G7UA 2JRCA 3DMDA 4PYOA 1AGNA 4UTOA 5BSFA 5BQ3A 2IHZA 2LD4A 2DBQA 2J9GA 5CDFA 3MS4A 2FSVC 1RXUA 4EW2A 4C3OB 2FDRA 3LW8A 1PEAA 1A9RA 3DAPA 1D9XA 3BRWA 4CHGA 1A8IA 5HDQA 2ZM5A 4GX5A 1SHJA 1N5DA 3DL0A 3GUCA 3LSTA 1D0VA 2AKAB 1CTQA 4GPIB 2Y0PA 3VPXA 1RIIA 4G5FA 3LMKA 2AFRA 3ISJA 1RYZA 3ACDA 3ZZ1A 1HLDA 3LBHA 3Q2IA 4C7JA 3F6YA 4FOSA 4Q05A 4RD3A 4Y6QA 4YT2A 1RKQA 4R68A 2BCEA 1L5VA 4TQ9A 5AK4A 2I6QA 2N42A 1B00A 2VZEA 2VP3A 3RNLA 1CUIA 2Q46A 3A58B 3FYUC 1U3FA 3LCRA 4QFDA 2X0DA 4CHTA 3ZQ4A 2IGBA 3V8RA 5AKJA 1BHO1 1KMMA 4RH0A 1U7HA 5G1PA 2C00A 3QKUA 5JIBA 1J8DA 3TD9A 3VKHA 2VG8A 2HV9A 2V7TA 2C9YA 1X1EA 2Q8PA 2EBHX 2QT1A 3LLUA 1RWNA 3N2GB 2CHQA 1YULA 4FLMA 3RJTA 4DCPA 2PO7A 2NTYC 2A14A 1BQ4A 5EKDA 2OMKA 3VJRA 3M4ZA 1OA1A 2QTRA 4B73A 4BWGA 2O54A 1QJ4A 4OQMA 3K0KA 1PTKA 5DN6D 3TG8A 3KHKA 3BL5A 2KBFA 3ITKA 5AKLA 1B41A 3FHOA 4GGPA 4JSTA 4O2AF 1HEUA 2C83A 3ZV3A 4D42A 5K03A 5KNBD 3C5HA 4Z0HO 5KYTA 2JGNA 4MARA 4TXHA 1KH3A 2M1XA 5EAIA 4EKNB 1NXVA 3NOQA 3VU8A 2XE6A 3R4VA 1KI2A 2HJWA 3N1UA 1REQA 3RB8A 1QXSA 3WLOA 3I92A 4BC0A 4WWHA 4WOCA 3S5JA 4BFSA 4EDFA 4G1EB 2L69A 3D0KA 3KV3O 1W35A 4QNRA 4ENVA 1KEPA 3DNFA 3I5UA 3Q87B 3J81A 5CVCA 5I9TA 1BN6A 1N2JA 1A77A 4PPYA 4QYTA 1J2JA 2J9XB 4RA6B 3UMVA 2FPOA 4KHPB 1A8PA 1K8QA 1QAQA 2HRBA 4MDFA 2D2EA 1GNQA 5BQOA 1NKTA 1SBYA 2DULA 2JZOA 1HQYE 3DBIA 1THMA 2DWPA 2WYUA 4IXWA 4NZPA 5CP8A 2CFCA 3OM1A 1M5TA 3KAJA 3M5CA 1QRDA 3THYA 1U02A 2P9JA 1I5RA 3A37A 1T5SA 2QMUA 3KWMA 2RFLA 1MH1A 3N86A 4I3HA 3WG9A 2MYUA 4Q1CA 1PI3A 1NQVA 3RKSA 3V55A 3GDWA 4J7XA 4E32A 3RC9A 1Y3BE 1YE3A 1MW8X 1EGHA 1IBMB 3D31A 4WUTA 3BGSA 5ALNA 2QR2A 4AWBA 1E0JA 1AMOA 2JNWA 3QITA 3UJHA 1ODFA 1P4RA 4C7KA 2JIZD 4LX0A 3TMAA 2HTFA 1X7ZA 3IT2A 3HN7A 2C3UA 3S68A 4M9UA 1L8AA 2BRUA 4LRXA 3BJRA 2CHVA 4XR4A 3RK4A 4K8OA 1GYRA 1KYZA 5K20A 1J9GA 1YR6A 3M6XA 4CTOA 1YJQA 3RJZA 5IDXA 4OI2A 3IR7A 3KVOA 3X1YA 1MOSA 3ZEIA 1HBJA 1GLVA 1AHNA 3T4EA 3DO5A 3KKOA 1XEWX 4N6GA 4QBHA 2CN1A 5AKGA 4YLEA 4IQGA 3BXOA 3K8OE 1LNQA 5EMNA 1D1PA 3PDIA 2GEFA 2G7ZA 3W7BA 3ROGA 4NHEA 2ODAA 1C4XA 2NNWB 1AUVA 1B76A 1E9CA 4KRGA 2Q7OE 1GPKA 4E4RA 1GTZA 1QVZA 1SHTX 1G9SA 3QHAA 5FNZA 4HUTA 4LYYA 4Q7MB 3BWVA 4ATNA 1XPOA 2P9GA 2PSHA 1UKEA 2FLVA 5TE9A 1WJGA 3TR5A 1I2ZA 1GQQA 4U2CA 4HGZA 1RCFA 4K9RA 3AVYA 2VJLA 1H0HA 3TNDA 3KQTA 5AW6A 4DA0A 2FZVA 2VNIA 1FFCA 3FNEA 3IUEA 4QICA 4Y2XA 5JFOA 2LRHA 4IP0A 3A6HA 3U17A 1Y81A 3VHLB 1CNEA 3HUFA 1F4VA 4DLXA 3U1BA 1CS0B 1MC4A 3I01A 1O96A 1XQ6A 3N7AA 2HEIA 5CBPA 4TGLA 1TW3A 1O5OA 3AVTA 2D3WA 2C7GA 2VJNA 2C8KA 3ZE2B 3C24A 3TIGA 1JAHA 4OAOA 4WKPA 1Z7GA 4IX9A 1JNXX 1ZJYA 4R2XA 4I1VA 2FW9A 3F2IA 4HAXA 3WXBA 1SBHA 4OIMA 4L4YA 3H2KA 4AJLA 1NUSA 3RSFA 2Z30A 3X1XA 3Q3GE 5C5CA 2JFOA 1Q91A 1NXTA 1BTOA 4FZ5A 1ZD1A 2R8PA 4RHEA 1E5TA 4PINA 2FU5C 1Y3CE 2Q45A 4ZD6A 1SCDA 3DTYA 4EKDA 2GO7A 4WOKA 4YLYA 2O2ZA 2DTDA 4M1WA 3SSAA 1GFWA 3L4EA 3HBMA 4BRWA 1ZHHA 2XTZA 1RWWA 2GB4A 3ZDAA 2OAGA 2V4UA 4GVLA 2HBRA 4ZAXA 4LZAA 4S1OA 4GZ5A 1QKKA 2J07A 3LHSA 3ZEAA 1NUHA 5HCIA 2BFAA 4LF5B 2OSVA 5DNYB 1O6GA 4S04A 3DE4X 4E21A 1BC5A 3OA0A 3TRKA 3UMCA 4D3FA 3LVQE 1XA0A 1KZGB 3EVBA 1UXKA 4C4PA 5JZOA 4UHKA 5TNXA 5GOTA 1DRKA 3ZOZA 1JBEA 1TEVA 3BTSA 4IRUB 1MOPA 5EUCA 1LJ8A 3SZMA 4Q7JB 3NEJA 4MW1A 2OORA 4E5PA 4LDZA 2D0PB 4B2LA 3OZAA 3OZEA 4HQ0A 3ZHZA 2Z4RA 4HAWA 3G2MA 4BMNA 2ISCA 1XEFA 1KI4A 1YKGA 3P2MA 3BHJA 2FZEA 4JODA 4L15A 2IOFK 2DJ5A 2AFHA 1K27A 2IYLD 3L8FA 2VH2A 4GOND 4BFXA 1FSGA 2BC9A 3C3JA 3RRJA 4YO8A 2CCKA 2V5VA 4IFEA 1XCPA 5GMOA 2OYRA 3TX6A 2Q0XA 3VNBA 3JQ6A 1C1DA 1E32A 4V3BA 2XCSB 4IWNA 4Y18A 5F5NA 1OF1A 3MJTA 3NB0A 4KQJA 2AOUA 3IBSA 4UD6A 4DSOA 1I6WA 3OTGA 3FZGA 3GEDA 2PA3A 3KQMA 2Q50A 2ID4A 3MGAA 3ROZA 1TEHA 4RTOA 2OFXA 2R8YA 3Q88A 3SR3A 1AURA 4GXQA 3M6FA 2WMOB 5KOJA 3TTYA 2A9VA 2QVXX 4L5BA 4R1OA 1Z2CA 3OFJA 4ZODA 1R64A 2WUGA 4V02A 4D4HA 3KU4A 5LU8A 3O73A 2ALJA 2OAEA 1SC6A 2QJOA 3GVHA 3K9GA 4UPEA 1MB4A 1BAPA 1UPAA 2OZLB 3R0VA 1RZRD 1HG1A 4E51A 3IP9A 4RW0A 1U81A 1I3KA 1O54A 1JMKC 4YS6A 5LB2A 2XD9A 4PF1A 4WFQA 2ZSJA 3S1LA 3DOIA 3V1MA 2QUHA 4GOJA 2OP0A 4MQEA 1IYZA 3FVWA 4C7OB 4S24A 4I4CA 1NOJA 2DBZA 2YXPX 3NHYA 3DD1A 4HX2A 3TI7A 4E2ZA 3TLCA 1CY1A 1M2WA 4JL6A 3DE3X 1Z62A 3OZVA 4M88A 4P86A 4JC5A 4R5MA 4YHBA 3RTDA 4B34A 5ALFA 4Z0NA 4G0VA 3KOMA 3SIPA 3W79A 1HH4A 4K9MA 1H2EA 3P9XA 3ZXYA 5CG1A 2BGWA 4L6CA 1XRMA 2QHXA 1AXEA 2W4QA 2AJ8A 5E6RA 4YRFA 4DCSA 3GDFA 1X80A 4NJMA 1OXUA 2ZCVA 1N2XA 4NNPA 4P4NA 5THXA 3KHSA 3UQZA 3QVTA 1S3FA 2DFVA 1TEXA 3OE7D 3OPYB 1Z2NX 2QVBA 5HSGA 1P6UA 3K6JA 5FUBA 3RFXA 2XNJA 1PR3A 2VNJA 4CQMD 5GIPE 2Y4NA 1JFRA 4QUJA 1LD3A 5FWDA 2RK4A 2RI6A 3TRFA 5JHGB 4NU6A 5IMBA 5FUWA 1LFDB 2OO5A 2JI8A 4QGBA 2V55B 3KJFA 3S0JA 3JASA 4FUQA 4M7RA 3FKSD 4O3MA 2REQB 5LP6A 3FUCA 3QX7A 3R3UA 1ZUNA 1N2GA 5D5HA 1UT6A 2ZYWX 3CH5A 3E2MA 3H8WA 3AFOA 2IEBA 4QQFA 5DNVA 1NUUA 5KTNA 2X40A 3AM4A 3D81A 1F4LA 4O1IA 3C5VA 1RJFA 2DUNA 2WAAA 3HC7A 1TF7A 2Q1SA 1AXGA 3OJFA 1LPAB 3ISTA 4WBNB 3IL2A 1XXLA 2FUG1 2J3LA 4TZKA 4TTSA 2FYTA 2G71A 1I4WA 1RQ2A 4L73A 4OPMA 1FCJA 1RAGA 1V5IA 2QG4A 4PEVA 1BX1A 1P4GA 2KWIA 4KMOA 2IXFA 2BGRA 3LL7A 2WZDA 3OKFA 3AR5A 1K1EA 4XGRA 1DJMA 1Z5NA 4OXNA 4CQMB 5LKAA 2ZRBA 1PT6A 4WXYB 4DLLA 2PRYA 1EXDA 1H05A 1JNYA 4HDQB 1BS2A 1Q14A 5FOQA 4CUKA 1FEZA 2ZTSA 3IDQA 3NAZA 3Q41A 1C0PA 3ETHA 3OEED 2EWVA 4OVKA 1TCBA 4KLRA 5EHNA 1ZISA 3TAXA 5AH0A 1IM2A 2WTAA 3BGOS 5F2NA 3EWAA 1G7CA 1RAAA 1V9CA 3G2JA 1JYFA 4PC3A 1NI4A 5ULLA 1G5TA 3ANMA 3D6FA 1I4LD 5B57C 2AUNA 2YMQA 1BCRA 2HQOA 1BXRB 2J3EA 4G07A 2O8BA 4HRYA 1BQEA 2GCGA 2JLAA 1H8EA 4GDFA 3K1ZA 5J2UF 4RZQA 2A35A 5BT9A 4O2RA 5LXTB 1MGPA 3G88A 4FX5A 4HWSA 4N5LA 4TN1A 5CRIA 2HLHA 5FPSA 3UPUA 3A3KA 3WRWA 2HO5A 1ABEA 4Z4IA 2F8TA 3VVBA 2A9OA 2FQYA 4UUNA 3TZQA 3IRUA 3NEAA 1Q0TA 1W5FA 1GG2A 3EIFA 2BF7A 1SRQA 4OQYA 2EYQA 1L5QA 4X54A 2YWEA 5DX0A 3RVDA 3WLEA 5KDLA 3PIRA 4FOTA 4MHSA 5LUAA 5AKKA 1EGQA 1QO0D 3LS2A 4MZDA 4ZYTA 2YJ6A 1Q77A 1SCNE 2QZPA 5CPBA 3ASYA 1BRMA 1KJQA 5FTMA 2ZXFA 4PFKA 3IMFA 3KZ1E 2MR5A 4X64B 4HN4B 4X66B 1A96A 1FDRA 3ZZ0A 1DB3A 2MMGA 4UUMA 3ZCUA 2A33A 4CL3A 5JC1A 3ZDCA 1JG2A 3V1KA 1PL7A 1Z2DA 1EM6A 3PD7A 4MWGA 4A8JC 4OBBA 2ZIEA 1Y5RA 4RVFA 3IX7A 2ZE6A 3M9WA 1JDUA 2RHOA 4M8KA 1U3WA 4ZDIA 1XU4A 1LS6A 1A9ZA 3CLHA 2UV8A 3HI4A 4RZHA 1Y42X 4HJXA 5LQJA 4QVIA 4Q4JA 4ITRC 4QJ5A 5TMDA 1W47A 4C0KA 2AHRA 3LK7A 4CMIB 1YR7A 4DV5B 1WB9A 4MKIA 3TRIA 2B94A 2QLBA 5ALHA 4B35A 1HSOA 4U7TB 4M55A 4BJHB 4F6CA 2WWIA 3AKDA 1IZ9A 3VZBA 3VC3A 3FUWA 2Y3IA 4AKSA 4O02B 4RF3A 1E9RA 4OATA 2JLWA 3EPRA 4K7JA 4FI3C 1CUCA 4LPSA 2I2DA 4B85A 4HNVA 4DIBA 1DELA 1C3OB 2HSWA 3PEFA 1RWMA 1O4VA 3JQQA 4DMMA 1ISFA 2H2AA 3PV0A 1HXHA 1MOZA 1WZUA 4KQIA 3BFXA 1KYXA 3JD4A 4QA9A 1GZ6A 2DT8A 1Y7HA 3HXTA 4NLLA 5E6SB 1E2IA 1CUSA 2MT9A 1OI3A 4CDMA 1N4DA 4IVPA 2E5LB 4BFVA 3OQ6A 1NNUA 1YHZA 5LLSA 4CV0A 1SQ0A 4Q19A 4J0GA 1U1GA 2GBPA 3F4KA 3V7NA 4EGJA 3C6YA 5DXAA 2CLMB 3TW8B 3WSTA 2XADA 4QTZA 4W5HA 2AC2A 1WV1A 8ATCA 1O0BA 4ZT7A 2WSIA 4R69A 5B2EA 4R8SA 3GEPA 3IAS6 1GKYA 1KR2A 1FP2A 1HQCA 1CJMA 2CWDA 4XZ3A 4Y30A 4MDEA 2WP8J 4TYYA 4GDMA 3O2JA 1DAPA 5KJ6A 4FBMA 4UUQA 2P5YA 2ZYUX 4M53A 1BHJA 4EHJA 1CJBA 1VYUA 1SN7A 3WIUA 3QNWA 5AW7A 4X8MA 1WSDA 4BMDA 4ARZB 2WOJA 4B7XA 3PVSA 3MJVA 4RM2A 2J0UB 1N1DA 3G0IA 1DT3A 1SVSA 3O4VA 4NF2A 1FS5A 4W9NA 5ALXA 4CE6A 3BGWA 1IH8A 1W93A 4TV9F 4GLOA 3NHJA 5CXSA 4PLTA 4QDUA 3DKRA 3O8BA 4WNAB 1N2CA 1W19A 3QLUC 1V45E 5I8ZA 1IN8A 2PJZA 2OV8A 3AM3A 3PNYA 1GM5A 1EESA 3BILA 1FY2A 1QPBA 1TMGE 2AL7A 1E7WA 2BR3A 4RPGA 1Q1QA 1T2VA 5F3WB 3O92A 3BSSA 1H2RS 1TI7A 1WMFA 2OFWA 2AZDA 3N2YA 2B92A 3UANA 3THWA 3I52A 1BFKA 1UJBA 3ZU2A 3WICA 5JR3A 3DDNA 3BJZA 1YC5A 5DW0A 5EMKA 3WK6A 2VK2A 4OP1A 3U80A 1O1YA 2YRFA 4C87A 1OTHA 3K70B 4PBRA 3UMSA 1I3OA 3BIXA 1MTZA 4BE4A 4TV8F 4D3YA 4XRGA 5AXBA 3IHTA 2PUWA 2ZETA 3EDQA 1CEYA 2FH5B 4QPNA 3MFQA 3ZLJA 4TV9A 1DX4A 2XMZA 3LWDA 5EYPA 3CF0A 3K8QA 2QKYA 4LBVA 4OB8A 5CTAA 4W5NA 4I08A 3WGKA 1VKJA 3AWIA 3PK0A 4DCOA 3TUJC 3I76A 3L3BA 3ECAA 4L16A 1VOTA 4CTKA 1CUGA 3X43A 1P3DA 5D1HA 2VJQA 3JZAA 3KDAA 4TTJA 3UJ8A 1ZH2A 2FMIA 3KUCA 1IRIA 3AJEA 2IZ1A 1ZVJA 4LHEA 3NBQA 2X23A 3BTOA 4IGKA 2ZR0A 1NQAO 5MHTA 3OY7A 4MPRA 2QTMA 5TLSA 3HXMA 1R0LA 1NBMA 1W1WA 4UUBA 1SUBA 3BH0A 1RLMA 4YUYA 5H9WA 1W36B 3WGQA 2DSNA 4DLUA 4EO9A 3N2EA 2VJAA 3LF1A 2KBEA 5EEGA 4Q12A 2GBGA 2W2OA 4GM4A 4GZLA 4Z9BA 2ZBRA 3FTPA 1NN1A 2V0CA 3DFKA 3I9V6 3PGXA 5KYVA 2FUKA 2WAYA 3IJRA 1DXHA 4FCVA 5BSMA 4D9KA 2O2IA 3VJLA 1Z18A 3D6UA 3WLQA 2E48A 5JLJA 4IXDA 4FX2A 2H1HA 1Z4LA 3RS2A 1ZD2P 1H4SA 4F2PA 1E61A 1JR4A 1SC9A 2R1ZA 1KS9A 3UMBA 2NP6A 3R2JA 1HKHA 3LUHA 2WJWA 1KJNA 4LZWA 1XSEA 1NG1A 2QA5A 3B6JA 3PSAA 3DZ8A 3C8HA 3EASA 4ZCQA 1UMDA 2EWMA 2ZK7A 3DE1X 4D4JA 4R3WA 4MS3A 3AEZA 3ZWCA 5DASA 4NDNE 4RGQA 1X1QA 4Y9RA 3ZV7A 5IWCA 4ID9A 2IS2A 1V3QE 4RKQA 1VRVA 2OKGA 5F7XA 2FSSA 5CURA 3HB4X 4HRVA 4YAGA 1JB9A 2GCEA 1JZQA 1LRLA 4HNQA 4K6CA 5AXDA 1DAIA 1VL6A 4LWOA 3L06A 2VSYA 4OX9B 2PGJA 3LA6A 4R31A 1JN0A 5E4JA 3L93A 3D2CA 3DEFA 3OF5A 3T5DA 3L6OO 4FTWA 4MITA 1L5HA 4DR6B 3DEZA 2RSLA 5AUNB 2RGXA 1G3QA 3MT0A 5DWVA 1ITZA 2N1MA 4OGLA 1Z17A 2W8BB 2CK3A 5MN6A 1NFFA 1TB4A 4EM6A 3BCSA 5J43A 1YB6A 3FGNA 1MJ5A 2GR9A 3K0CC 4CT0A 4UNNA 3FFAA 2NN3C 3JD2A 1FYXA 2G76A 1NI3A 2VYFA 4PZPA 4GE0A 2O20A 2NVWA 3GGPA 3DKPA 1TJYA 1KEVA 3M34A 4IL5A 4WKGA 1PTJA 1ZESA 2BHTA 4FYJA 1KO1A 2FWBA 1Q6ZA 3NM5A 2XUDA 1R5BA 3F6SA 3DCIA 4TTQA 4E1VA 2CLKB 4MEAA 2OD7A 1PHRA 1XDUA 1Z7BA 4B3IA 1IHYA 2XMDA 3ZWPA 1N6LA 2NTJA 2QRGA 1W1IA 3F5DA 3I9KA 1CRLA 4FGLA 4I9HA 4L76A 4P08A 3H2SA 2EX0A 2Z2KA 3MM4A 2OPBA 3L8YA 2EDCA 4FDLA 4ZQIA 4AKIA 2GN1A 3RF6A 4L9SA 1RBZA 4O2AA 5GJVC 2YFQA 2GN0A 4ZXFA 5A4KA 5C1PA 2OBXA 5CK4A 3LHKA 1M9NA 4P5PA 3W3AD 1QV6A 4HRXA 5T41A 1UEJA 3IH5A 3OKPA 5AVJA 1T2UA 5GAJA 4CIYA 4WX2B 3DTVB 2H17A 3BMXA 1MX1A 3MWGA 4JXKA 1S2IA 1W85B 3E7PA 3ROKA 5JNRA 3KNZA 1NDHA 1AG9A 3OPQA 3SJCA 4ARVA 1JKFA 3BEDA 4QTXA 3I8XA 3DEYX 4QTYA 8ADHA 4O4IA 5ITZB 4PX5A 4JLKA 3U3MA 5CB6A 3O6VA 5DDIP 2X77A 2ZJ7A 3UA4A 5SYAA 3WLIA 1F2UB 2XT6A 3PRHA 5AVRA 1XMQB 3AFMA 3ZTYA 5ES3A 1CZRA 1CERA 1CUYA 2FX2A 1QB8A 1QYRA 1QAOA 1RPAA 4HCJA 4MR8A 3LKZA 3RTGA 5LQKA 5KYUA 4RXUA 1P17A 1N9ZA 2UUPA 3FGOA 1ZVVA 1I01A 4DDVA 2PQ6A 2H8GA 4FE4A 4WGGA 1S1CA 1IWPB 4CM3A 4EFNA 3HB7A 3S2FA 8ABPA 2O2EA 4OAPA 1RZ3A 1UJ2A 2TSYB 1DMSA 1KFKB 5FTLA 1HI9A 1ZZEA 4DSAA 2R6JA 4Q9DA 1J1ZA 1I0ZA 4CMIA 3ENQA 4KPUA 4XDZA 4ER7A 4EFKA 3VUFA 3VZSA 2VHQA 3FWYA 5BSVA 5SZHB 4F6RA 1TUBA 2HUPA 1J8FA 4ZO4A 3WFIA 4O4IF 1P1FA 5CDFE 4M8LA 2JARA 2VHXA 2VPWA 5EG5A 1PJ2A 4HTAA 4JBHA 1DIGA 3LFTA 4DRYA 1QV9A 4MKHA 4INZA 3BOSA 4IDEA 3A26A 1A0OA 3H1EA 3AJAA 3L0IB 3MB5A 1Z74A 2O5RA 4GO1A 4NX2A 4OHCA 3OY2A 5HUJA 4HHEA 4U39A 1MABA 1JBKA 1ZL2A 3J7TA 4PC6A 1M2NA 2EIHA 5ER6A 2Y1XA 1CQJB 2JGJA 3QFRA 4NZZA 5IJ9B 1L5LA 1KZ6A 3VJMA 3L1JA 5LB4A 5JWRA 1WETA 1FTNA 1WOYA 2PZJA 3MXTA 3QPDA 4P93A 2CUKA 1AKWA 2A5FA 2CXPA 1KNQA 2UDPA 3C3BA 4RZ2A 1NXXA 3HK2A 3AZOA 4XB6B 3N3AC 3TNLA 3OBIA 1WMSA 4MRRA 4EQZA 2DKFA 3CZCA 4ON9A 4C05A 3QMVA 4OGFA 3RF7A 3FYHA 3M6LA 2VH5R 1YK0A 4XR9A 5BWLA 1HPLA 1NVMB 2Z6VA 3BEOA 2XJ9A 4ZHQA 1KR5A 1W87A 1T0IA 3JSXA 3QVXA 4FYKA 3GY0A 4YBZA 5TR9A 3K15A 2UZ4A 3P2YA 1QCDA 3QH4A 4I4NA 4ZYUA 3WBJA 5JYCA 2P2DA 5IZ4A 1XZEA 3P5SA 4C4XA 2R2GA 4D97A 4BZXA 3CE6A 1FJ2A 2FOLA 4MUKA 4G0YA 1NUQA 4IGFA 1XPUA 5EJAA 1VLQA 4DMLA 4GQAA 1F6WA 4EY6A 1WV0A 5KTTA 1BVHA 3BN3A 4KV9A 4RVGA 1X7XA 5CT9A 5G02A 1Y7PA 1OT3A 4HDAA 1TYBE 4MKZA 2GX6A 5LZ2A 3KFXA 4OGWA 1ZLXA 3H2IA 2GAIA 3O0DA 1VIAA 2GZHA 3KZOA 4I9UA 5B36A 4E09A 5L3ZA 4QJ3A 1SVIA 4JHXA 4RA9A 5IKOA 1R37A 1QLWA 2CDRA 1ECCA 1R4MA 1RI2A 2ATEA 2VPXA 3FFBA 2QJFA 4FYYA 4X1IA 4YAIA 4JXZA 5KWJA 3T4XA 1JLLA 1TTPB 2OCBA 1BCSA 3B78A 2II6A 3EDYA 4MVCA 3REQB 3VH4A 4GI2A 1ZOOA 4QREA 3TQFA 4TYQA 3Q40A 3N0WA 1H0SA 3QNMA 1VB3A 1KNXA 4BUCA 1UBCA 4BMZA 3LHDA 1XTJA 2HIMA 4B43A 5TF4A 1CDOA 3LCCA 4PO8A 3VMFA 3HM2A 3OVMA 5HM6A 4AN0A 2BKUA 5CT5A 3KL2A 1N6RA 3M6MD 3NONA 4MTLA 2IBTA 5HM8A 1H4TA 5KOHA 5FPHA 1Z5UA 3H1TA 1KK3A 3AMVA 5C7LO 4L4SA 1ADBA 5B2FA 1VKOA 3X1KA 3G82C 1Q1ZA 1R9JA 1U2DA 4I7EA 2QMZA 2WIBA 4UJ3A 3C7KA 4FMBB 3PDCA 5AJWA 3UV7A 1U7UA 4LYAA 4MINA 4BPRA 4C6SA 2AMVA 4BTEA 4EUFA 5K8JB 5KYKA 3Q6IA 4YCDA 3O03A 3QELB 3KHTA 2IOFA 2C92A 1OI7A 1FFHA 2OECA 2Z5FA 1HMYA 3Q7PA 3A04A 3QFTA 1IATA 1KEWA 3GNTA 4Z0TA 4N12A 4WRRA 4W1QA 3LRTA 3C3DA 5DBEX 3VC1A 1Q0ZA 2RH5A 3KB1A 4PFJA 5DZSA 3GEEA 4Y9SA 4OKIA 3KLOA 5KPDA 3QVWA 4FNAA 5TQ2B 2FW1A 1FP4B 3UOAB 2OWEA 2FEXA 1GKIA 1U90A 1EK0A 3MWLA 3AIKA 1TM7E 1VRCA 2ZRFA 4IOKA 3IUYA 5FFNA 1YQGA 2CB0A 4W5TA 3S2SA 3H7AA 1JS1X 3WQSB 1SXJE 2X1VA 521PA 2O5VA 1M2VB 1UPFA 2P67A 3GJ7A 3CX8A 5FT9A 5DCWA 5KYWB 3LDHA 5J2TF 4N8SA 4CM5A 1OFUX 4X60A 3BE5A 4IG9A 4ADSG 1MRZA 4IMPA 3NT5A 4J3NA 4ND5A 3OZCA 1YUNA 3V3KA 1P2VA 2ZSDA 4R5HA 4Z1MA 4KLCA 1MDFA 4JCOA 2X3FA 2YJ5A 3RYHB 3ZXXA 1Y82A 4MYDA 1ZI8A 4OI0A 4I9GA 4Z9FA 1XMIA 1QM5A 1G2PA 1GNLA 1U2EA 3E9CA 2QX9A 1MFZA 1YHNA 1Y8AA 1QIDA 5CD1A 3VR4A 3O4IA 3O93A 4GR4A 3SOPA 4KQXA 2YL2A 1V3VA 3QHQA 5G0UA 4L1KA 5BWNA 3CVXA 4RK4A 3A9UA 4EVRA 1G1MA 4AZ3B 4CLOA 5TEVA 1AKRA 4A7PA 4B0PA 2HT6A 3OT1A 1H5UA 2F3RA 2WMDA 4C4YA 3GYGA 1XNRB 4B81A 1PJ4A 4UTRA 2F1RA 1GN8A 4KI0A 1P6QA 3K9HA 5A6SB 3C6KA 3W8EA 4E5KA 1YC2A 2F1OA 4MWOA 3IXLA 1R6XA 2KLBA 4LN1A 1N6IA 2WZCA 3NHRA 4NE2A 3U0VA 5IG2A 1FZQA 3M89A 3E4CA 3Q12A 1BMTA 1FBNA 1W9MA 4UEWA 4XUEA 4YJFA 1HDXA 1XLTC 3LVFO 5LDHA 2RKBA 4L28A 1SQFA 2C9OA 1FLDA 5L7TA 1ULTA 1U3GA 1MQ8B 2C5HA 4BFWA 3R77A 1R0RE 1E3WA 2O3SA 1GA4A 2RBEA 3UJ7A 3KU1A 2BUBA 2B34A 2HSDA 2PRKA 2O2JA 1E1CB 2WWRA 5AKYA 1ESEA 3CWCA 4PIPA 4O08A 1YJ5A 4IJWA 2ONYA 3FPBA 2FR0A 4QPZA 5KHOC 3MCVA 3QJGA 1DKLA 2YC2C 4MICA 2A5GA 2Y66A 3FGPA 2PANA 1JHZA 3BIFA 4FFMA 4MRSA 1WW2A 5CIQA 4ZVMA 4K3UA 2JLVA 4N49A 2G5CA 1SUIA 4MVJM 1QTQA 3K32A 3CX3A 3LK6A 3K0FA 2E2WA 1NUAA 5M3BA 1MB0A 3U7QA 1S9HA 5AVTA 4WVFA 4XVHA 4YJGB 1I7DA 1ZFNA 5KNCH 1SXIA 4E0BA 4QJ4A 4E33A 1YA8A 2XA2A 4YK7A 2X8JB 3K16A 4HUJA 4I50B 1C8VB 1TU4A 2R62A 3EXAA 3TXXA 1U3DA 4CLRB 1F48A 3ABQB 4D6XA 2NU6B 3O47A 1PNRA 3WP0A 5LUBA 3LZCA 3B3JA 4BLSA 2OV4A 3FXAA 4Q39A 1MCZA 1PU2A 4BQNA 3FZQA 4ZO7A 1INLA 2QD5A 3TD6A 1X7DA 1CSEE 1QIHA 4WY8A 3GFFA 5LKRA 1NX9A 2LV8A 1PWYE 3MMPA 2PG3A 4JLSA 1GGJA 4EFMA 3HCEA 2V9CA 3L7LA 1COWD 1QP0A 4DLTA 2D59A 5D3MB 2AJLI 3JR3A 2VP5A 4JELA 3KDPA 3WQQA 5L3RA 2JK1A 1SVMA 5FWYA 1PO7A 3OFSA 1CZHA 2QQGA 4CI9A 1EFVB 4ZU6X 2EKBA 2GJ8A 3NXKA 4ACBA 4H31A 3DPUA 4JLBA 1QF9A 3O9MA 1LU9A 2HMTA 5CA0B 5HF6A 1YI8A 3HU5A 1XYGA 4QJBA 1FVXA 1CYDA 2R87A 4JNCA 1H4QA 1E9SA 1D1QA 1DS6A 2VUHB 3EDOA 3LQ4A 4P36A 3VDRA 1WUHS 4C20A 2Y0DA 2G77B 3EARA 4TL9A 4DCNA 1E7SA 2OAQ1 1P1KA 2VT7A 4U8GA 1UOEA 3DMTA 1MRSA 2GO1A 5DCLA 4KPYA 3OIGA 2ZRQA 4X7PA 1BFDA 4YPVA 4NXMB 5F9MA 3L7YA 2X9GA 2HLDD 2HDNB 4ETMA 2BSXA 2H5JA 1O0CA 2TS1A 1OI4A 2FEOA 2IV3A 3ND7A 3A9TA 1RM4A 1LVHA 3MUOA 2D74A 3ENZA 3GJTA 4X94A 1CLUA 4JBLA 1GLNA 4TLAA 4GAEA 4KIWA 3JTEA 3OURA 5E1DA 2JIOA 1V71A 1Y4SA 5FTJA 1E8NA 2OCKA 3T06B 3W5IA 2I6GA 3SSNA 4AUMA 3K6SA 1C3LA 2IWRA 3QTBA 4A8JB 4AKTA 4DG8A 3AV0B 4BO0A 3IRVA 2FEAA 3QUBA 4TLEA 2R79A 2LZ0A 3M9XA 1SA0B 4O4LB 2QMOA 5BN3B 3TIVA 4PSCA 1VI5A 4RIHA 1QMGA 5KUTA 3GOQA 1LK5A 4MMXB 3L8DA 1YDWA 2TMDA 1FXSA 3J81k 1G8MA 1SKYB 2Q0SA 3X44A 5CFRA 3FM9A 2JVIA 4GECA 4I81A 3RE1A 4AC9A 1DTWA 3QA3E 4B2YA 4CM9A 5LNK1 1OWPA 2DYKA 1XRPA 5IXYA 1FQWA 3ZJVA 3G2IA 1WZEA 4K9NA 5K4AA 3EEBA 4YNBA 1PFGA 5GZ3A 1NDQA 3LO5A 2JJ2D 3R8FA 4YVFA 2AJBA 1VIMA 4R1PA 2H48A 3ND8A 1PL0A 3PD1A 1NM5A 4M37A 1X7WB 4X24A 3T38A 1U8FO 3VISA 4A3SA 2VTBA 3UT5B 3C2QA 2FPSA 3RSHA 4Z7JA 1LDBA 1Z8HA 2JGRA 4ZDKA 2A9PA 1PJRA 3ITNA 2CUTA 3IVAA 1NW8A 2IQ5A 2NXJA 4HDOB 4UOEA 2OMEA 1JAIA 1QIMA 4MVYA 3WGYA 1C0EA 4LSWA 2PRSA 3PQFA 5FLKA 2QVGA 5J4HA 1VIDA 2HRZA 5L3SB 3FGZA 2Q5HA 2JA1A 2AE2A 4NBUA 5EE9A 3TMYA 3ZVNA 5HYVA 3OPYI 2WTNA 2EQAA 1Z0UA 4CL2A 1ES9A 2BN4A 3LFUA 5AVYA 4JC4A 3ZHVA 2QYHA 2E1PA 2HM7A 1U2QA 1Y5MA 3OCUA 4Z8XA 3TD2A 2REXB 3NTUA 1MO3A 5INTA 1K9VF 1MW9X 1DFGA 1CX9B 1M6NA 3QSGA 1W73A 3G0OA 3OF2A 1Y63A 1OROA 4XFKA 3ROXA 5CEEA 1MHTA 2C2YA 1NBOA 5CNJA 3CEAA 3VUEA 4EB3A 3WGIA 1UBMS 2V65A 3L82B 5F2OA 2QLFA 1G7RA 3RYCB 3CRZA 1O6CA 3C6ZA 2HNBA 4UZFA 3V8EA 2GZRA 5KPJA 1JKJB 2RI0A 3ICWA 3SU8A 1DWOA 3A8TA 3HJTA 4B6RA 1R0BA 4QXAA 2H63A 3BB1A