4LE0A

Crystal structure of the receiver domain of desr in complex with beryllofluoride and magnesium
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
132
structure length
132
Chain Sequence
MISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Transcriptional regulatory protein DesR
publication title Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 47
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4le0A00
4JA2A 1ISRA 5IEBA 3GRCA 3H6GA 1E6KA 4EY3A 4S05A 1E6LA 2FSPA 5T7BA 4KREA 4MRMA 2BGGA 3LUKA 4E7PA 3C6QA 2QV0A 1NTRA 4KK4A 4XLTA 3DLHA 2YHAA 3S99A 1ZY2A 1YS7A 4MR7A 1SRRA 3RVJA 2FEWB 1TMYA 5ED4A 2VUHB 5BQ3A 4MS4B 3UK0A 2FEKA 4P98A 2ZWMA 1QQBA 1CEYA 3SG0A 1VLZA 3RH0A 1JDNA 1YK0A 4IRXA 3SY8A 4LDAA 3SM9A 1PUXA 3H75A 1M2FA 3KS9A 5PNTA 1QO0A 3CRNA 1DBWA 3NNNA 3KTOA 2FW0A 1VPWA 3QELA 1ZDMA 3M6MD 3QLUC 2H3HA 5JNWA 2IYNA 4MAAA 1S8NA 3Q7TA 2FEPA 4G97A 2L18A 2QVCA 5IEJA 5TPZA 1FFGA 3OQMA 2FMHA 1GUDA 1MIHA 1NXPA 4YCSA 4RY9A 1CYEA 1RZRD 1NATA 4RK5A 4MQEA 5JNSA 2JVKA 2R25B 3IPCA 1JYEA 4EYKA 1ABFA 1AB6A 3EULA 4KV7A 5HQJA 4ZJPA 4KFCA 1KRXA 3TB6A 1PNRA 3JVDA 3RVLA 1ZH2A 2FKAA 4MR8B 3HXMA 1JH9A 3TO5A 3OLVA 3HVRA 3TD9A 2LIVA 2E4YA 3FGZA 1HEYA 3EGCA 3N0XA 3Q15C 1GCGA 4XFKA 2FLKA 2WMYA 1A2OA 5EWLA 3EAFA 1GLGA 3T95A 3EODA 1ABEA 2PUDA 4LE0A 1VRVA 4MS1A 2A9QA 2J48A 2JVJA 5C5CA 4Q7EA 2R4QA 4Q6BA 1ZAYA 3DGEC 4G0MA 4RXMA 2PUAA 4Z0NA 3CU5A 2IDMA 4RK1A 4EVSA 2IPNA 1F51E 3JS5A 2GBPA 2VK2A 5FWXA 4Z4GA 5T3YA 1DC7A 1C4WA 3TX6A 1MB3A 3GBVA 4MR7B 3O1JC 4CBVA 4ETIA 1TM2A 1JFSA 1DRJA 2E4VA 3QEMA 2FN8A 1W25A 3QLUA 4OG2A 5FBHA 4W5TA 4JASB 1ZGZA 4RK4A 4O1IA 2WY2D 1FSPA 3H5WA 1KMIY 3KYIB 8ABPA 3KCNA 2E4UA 1QKKA 3EQZA 2PMCA 3QELB 2M98A 5KQPA 1WETA 3M9XA 3CG4A 2MYUA 1NXWA 3MQ4A 4YS6A 2GX6A 3BRSA 9ABPA 5HM6A 4F8JA 3O2SB 3H5TA 4PE5B 1PEYA 3HZHA 4FB4A 1Z26A 2MSWA 4KNYA 5IC5A 1A0OA 2RDMA 2PJUA 3KYJB 5TPWA 4QICA 3KLNA 2W42A 4G0PA 2HPHA 2JCGA 2RGYA 5DLEA 1EHCA 1RXIA 2P4UA 5IUNC 2F8SA 2MSKA 2X7XA 4F12A 3DZDA 1BA2A 4Y9TA 1USKA 3FFWA 4WXEA 2FN9A 4Z99A 4W5NA 2P9HA 1SD5A 3GA5A 4LRQA 5B3JA 4O5AA 4HNRA 2CHFA 3JY6A 4IGAA 3L49A 4N47A 1JX6A 2MYNA 1QNLA 4KK3A 4TLLB 4G86A 5CHYA 3H6HA 2JBAA 4RKQA 4IILA 5DTEA 3SNKA 1U0SY 2IPMA 3FFXA 3HM9A 3LUAA 2FXIA 5EWLB 3H1EA 4L4UA 2HQBA 1FFWA 4RS3A 1JFVA 3BRQA 1XHFA 3KKEA 4H3HB 1T34A 1M5TA 1E2BA 3H5OA 3LFTA 4MS1B 1LJUA 2M1ZA 3FMVA 3MYYA 4KQCA 3LUHA 2GI4A 3N0RA 3EQ2A 3IPAA 1XWWA 4YP9A 5FWXB 3I42A 3HUUA 2JRLA 3GT7A 5KC9A 2E4XA 1VKRA 2N9UA 4QYWA 4Z4HA 1ZVVA 3MMNA 1QQAA 4YLEA 3FDFA 4NCBA 2AYXA 3OLYA 2MSLA 3ILYA 4WXMA 5DGCA 3LUGA 3QEMB 5TPZD 1USGA 1YTUA 2GKGA 4GPAA 3DBIA 3O75A 3OM1A 4LZLA 2LBPA 5KQLA 2PL1A 4OTZA 1RPJA 4MYRA 1TVMA 4HYEA 5TQJA 3NHZA 3HEBA 4Z4FA 2OENG 5EWJB 4W5RA 2ZAYA 1USIA 3MF4A 3P9YA 4NQRA 4WUTA 4F11A 2Q5CA 4G0QA 1Z12A 5IUKC 4MS3B 4MR9A 4D6YA 4KMRA 4GNRA 4DADA 1NXVA 3Q41A 4RV5A 3GWGA 4JOQA 1K68A 5TPWB 5KQGA 4WZZA 2PE5A 1ISSA 4OLAA 3A0UA 1DP4A 4F3TA 4JB2A 3QX9A 1DCFA 1P2FA 1JBEA 4RU1A 3OQOA 4RY0A 1ZITA 5CNIA 3GV0A 5JS2A 3I45A 1JYFA 5FBKA 3F7NA 3RVPA 2PL9A 2CD7A 3DGFC 5FWYA 4JB0A 3N0WA 3Q7SA 2TMYA 3N75A 1DC8A 3DLBA 2FMIA 2AYZA 2FTKE 2WRZA 3CZ5A 3EDCA 3T8YA 2PAFA 4G0OA 3OLXA 2JBAB 1NXXA 2FQXA 2VUIB 3E61A 3QLVC 2MYTA 2IPLA 4RKRA 4P1ZA 2OQRA 1BDHA 3I09A 3OO0A 2PUCA 4N76A 3C3MA 2HQRA 2LP4Y 1BDJA 2A9OA 1L5YA 4M88A 4EVQA 2JVIA 3NBMA 4ML3A 1ZN2A 3OM0A 2DRIA 4D74A 3W9SA 3L6UA 2GWRA 4MQFA 4E7OA 1UDRA 2B1JA 5BRAA 4OBBA 3CLKA 3FFTA 4JAVC 5IX8A 1J56A 1QP4A 3I5AA 3IP5A 3BBLA 3UUGA 3LUFA 3EJWA 1OXBB 4Z9BA 3RVNA 2FVYA 4RZSA 5DKFA 3RVMA 5ABPA 1QP7A 4RK6A 1JFTA 1YMVA 3RQIA 5JNVA 4D6XA 3LUCA 2XDYA 3IDOA 3O21A 1LK0A 3A0RB 3M9WA 4LX8A 3SQNA 2FLWA 3O1HB 5EWJA 4PZ0A 4H3KB 3CFYA 1URPA 1U2QA 3LOPA 3MA0A 4MS3A 1EWKA 3F6PA 3O2QB 4TN5A 3RVOA 2NUBA 1RXEA 4XAQA 3IP7A 4YR7A 5BRJA 5KQMA 3UKJA 1Z18A 3LUDA 3JVIA 4PICA 4NCAA 4OLBA 5GQSA 4MGEA 4MR9B 4G0YA 4WT7A 4RSMA 3URMA 2QW1A 1PEAA 3B2NA 4ZPJA 4O1HA 4DN6A 4YO7A 4MLDA 5TQ2B 4YGXB 3QEKA 2A9PA 3LKVA 1LJLA 1YK1A 4N0QA 1D1PA 3MIZA 4PYRA 5EWMA 5KWSA 2E4WA 2ID9A 2RJNA 1JDPA 2CHEA 1FQWA 3KSMA 4KQ9A 4EYGA 3F73A 3QLVA 1C0EA 4YWHA 4EGSA 3HCWA 3ROTA 5FWYB 3T6KA 1DRKA 2QR3A 2QZJA 3VNAA 1DJMA 4XXHA 4ETNA 4UHJA 3H5LA 5BR1A 2V0NA 2HSGA 1P6UA 1EAYA 2L17A 4RDCA 4Q6WA 3E3MA 5JNRA 1JLKA 1ZHHA 1M5UA 5JNTA 3LMKA 4EYQA 1APBA 4PEVA 1DBQA 2PUEA 3R0JA 1DBPA 1D4ZA 3N53A 1QO0D 2R47A 3JPWA 1DCKA 3NNSA 4H60A 4MQFB 5TQ0A 1JL3A 1DG9A 4Z4IA 3VNBA 1BVHA 1U8TA 1CHNA 2QU7A 2WJAA 4G0ZA 4B09A 2L19A 2WWVD 2QVGA 4IMIB 4QYMA 3ROFA 2PUBA 3KLOA 4XARA 1BAPA 2B4AA 2FMFA 5IBQA 1EWTA 3LUJA 4FE4A 1JF8A 5IUJC 1IIBA 1P6QA 3G85A 3KG2A 1SXGA 2I6FA 3HO1A 2QSJA 2A9RA 3Q9SA 3RVQA 5JNUA 1TJYA 4RXTA 2FQWA 3H5VA 3HUTA 4IMJB 1Z2DA 3F6CA 5TQ2A 3TMYA 2PUFA 2CWDA 1YVUA 3A10A 1KRWA 3OMWA 3RVKA 2JK1A 2YHBA 1TLFA 2NT4A 4YV7A 4Z4EA 5D2CA 1QMPA 4RY8A 3QLTA 3HK2A 4EUKA 3JPYA 3K9CA 5EWMB 3HJFA 1Z13A 1JHZA 1Y1LA 3ILHA 3GBPA 4N41A 1NXTA 3D8UA 5KI6A 2QXYA 6CHYA 2FQYA 4ZMSA 2IOYA 5TE9A 7ABPA 1U04A 1GCAA 5I4CA 1EFAA 4MPTA 3QX8A 2KYRA 1L5ZA 4RXUA 4QPJC 4KVFA 3T38A 4LDZA 2PKXA 2HJ9A 2JB9A 3LKBA 3MM4A 1R8JA 3QK7A 2PLNA 1RZRA 1D1QA 4TLMB 2NZVG 1W9HA 1PHRA 1XHEA 1DCMA 3NHMA 3Q7RA 4NV3A 4UHKA 2E4ZA 4ZYLA 4XASA 5C5EA 2IPAB 1ZESA 3JTEA 1M2EA 5CNJA 3OO1A 4DQDA 3RVSA 1A04A 2HQOA 3C3KA 4KRFA 1SXIA 4NICA 3CTPA 1BDIA 5JS1A 3OLZA 3CHYA 3HS3A 4N03A 5DCLA 5B3JC 1H9CA 1NY5A 4N0PA 1KGSA 3C3WA 2VYCA 5HKOA 1F4VA 2MYPA 1PNTA 3NNDA 4TMYA 5TQ0B 1U2PA 1NXSA 3K4HA 4OATA 4HNSA 4JP1A 4RK0A 3N6VA 4MRMB 2H0AA 3LTEA 5CNKA 4WWHA 2R48A 1NXOA 3BREA 4MS4A 3H1FA 3HV2A 1RNLA 1FFSA 3CZCA 4Z4CA 1YIOA 4LE1A 1K66A 3OLWA 3KJXA 1B00A 4G0XA 6ABPA 2O20A 3SAJA 2NT3A 4W5OA 1Z2EA 4F06A 4LE2A 1D5WA 2IKSA 2NZUG 1QPZA 3HDGA 4Z9AA 1Z15A 4FE7A 1LBIA 2FMKA 1EWVA 3CKMA 3OQNA 1DZ3A 3KHTA 3N8IA 1QP0A 1GUBA 3GL9A 1YMUA 2LPMA 4EVRA 4EYOA 2ID7A 1Z25A 2WB4A 1P8AA 3C97A 3CNBA 3IP6A 5F64A 4ETMA 4RWEA 3G1WA 3HSYA 4MQEB 3O2JA 1ZH4A 5CNMA 1MB0A 2RJOA 3CS3A 1Z16A 4MR8A 4KPYA 5KC8A 1JWLA 3BILA 3OMXA 3O74A 4YRZA 3HDVA 5E3JA 4L85A 4ZMRA 3H1GA 1AB5A 3CG0A 4KZKA 4W5QA 3H5IA 2PUGA 3O1IC 2L2QA 4MLCA 2F8TA 2LUOA 1D2AA 1OXKB 3IP9A 1MVOA 1Z17A 1ZGGA 5GOTA 4RK7A 3D02A 3RVRA 4S04A 3A3KA 5HSGA 1YS6A 1LBHA 2WJWA 1SXHA 4IF4A 5IULC 3GYBA 1E6MA 1I3CA 4HNQA 1MAVA
chains in the Genus database with same CATH superfamily
2PYDA 4O4HA 1GADO 1EVLA 1AT1A 3JAWB 3COPA 3RIMA 1QIKA 4JLVA 4AP5A 1LBQA 3U7IA 1UAAA 4F2DA 1JG6A 1TEHA 2WICA 1E9RA 4FI3F 1JEYA 1UPUA 5D87A 1NTRA 1SHKA 2CJWA 3M4YA 2D8AA 1QVWA 2I8LA 2WAMA 4LNHA 3UGJA 3IVXA 2O7NA 2XSZA 3TW0A 1I0IA 1E6CA 1KKLA 5LJLA 1IPHA 1E5TA 1MX1A 1IRXA 1W5FA 4NKRA 2J9ZB 3WYNA 3PTZA 2ANCA 4QFBA 1VLZA 4NU0A 4BC0A 2V7UA 8GPBA 2V3VA 4FQ7A 4B43A 1FU8A 2LRHA 1XCPA 3QXHA 4O2AB 3UANA 5DX0A 4EAAA 2ZW9A 4ZCIA 3I6BA 1WXQA 1X1SA 3N5CA 3KUXA 1NDQA 3FOWA 1Q11A 3O0DA 3HXPA 3QFTA 1X8XA 1Z4NA 2HLHA 1U8AA 5ICEA 3DF7A 2WYWA 4MYDA 2IL1A 2HI0A 2L18A 5H16A 3FPGA 3S68A 3W5SA 2LDBA 3K09A 4C4PA 3IIKA 1TF2A 3R3XA 2YW9A 4HOYA 4M9CA 3VZCA 1U63A 1MEOA 2CXRA 5BV7A 3C43A 1VB5A 1RJFA 4OHWA 3DT9A 4MVXA 3DR3A 2ZJ0A 4DNXA 2PSFA 3CUKA 4PM4A 2B25A 2BEJA 3TCXB 3N70A 3O1LA 3QG1A 4FDMA 4MYSA 1MKYA 5KYNA 2QQGA 1Z22A 3ORHA 1ZGJA 2FEOA 1WUIS 1RWXA 5JQGB 3MXTA 4QGGA 3F96A 1PZEA 1KRXA 2PCLA 3C5WP 2GKOA 2B9EA 2YIJA 4FGSA 4GI5A 3TB6A 4X24A 4TM8A 3WHIA 4PGFA 5KAMA 1MQAA 4R31A 5AXDA 1JH9A 4ESHA 1KJIA 1BS9A 2P2LA 4AYXA 1J20A 2D8MA 3ZYZA 4Q4JB 4S2EA 5FWAA 3G79A 3WLRA 4DLNA 1JHRA 1K2VN 4MWEA 3W6UA 1KI4A 4RTPA 1GLGA 1QIDA 3ADKA 1Y3FE 4KYTA 1XQXA 2OHOA 3K9HA 4DMFA 5LQAA 2A0KA 3O92A 2W6JA 3N2LA 5I8WA 1JG3A 1JSXA 2IYVA 3OG9A 4CMGA 3E84A 5FTKA 1TCBA 5I7SA 4CF7A 1W1UA 2AL7A 3HDYA 1OD6A 4DGQA 3NEYA 4QBHA 2PUAA 4AECA 3K6JA 2OBNA 4NZ9A 2EV9A 1Q20A 1UXOA 2EKQA 1AHHA 5K0JA 1N32B 5B6PA 2BMAA 1SBCA 3PQ4A 1AK9A 1BMQA 1R0YA 2XEDA 4QXOA 3EVDA 1Y98A 1XDGA 3VRHA 4NBKA 1ESDA 4HPXB 1OVMA 5HCUA 3VPBA 1S02A 1MC4A 1NMXA 3O1JC 4PRLA 2J31A 3F6RA 4CQMD 2H2IA 3BXXA 2Y92A 3EAGA 5K0EA 1ODSA 4Y0VA 1NU8A 3BCRA 3NBFA 1FMTA 1CS4C 5DLYA 5DM2A 5EHNA 4QOIA 4R1MA 3BEDA 3C5VA 5EP4A 2RCNA 3UGQA 5A4MS 4KUEA 1Z34A 4P54A 2E6KA 3GR6A 4P08A 1SKUA 4JS0A 3ENVA 2GD1O 3ICVA 3TSCA 1H3FA 1ZJYA 1WETA 1RC0A 3AB8A 3G3EA 3UC5A 1R5OA 4G0NA 3BRSA 1WDTA 3ZK7A 4F8JA 5KHLB 4ND3A 3OIWA 4DV5B 1A9QA 1S2GA 1U9YA 1Z73A 5ERYA 1YE5A 3DL4A 1KIFA 4IDPA 5GWXA 4C2BA 3KQTA 4CKYA 4YPOA 2FOXA 4TMZA 3HCFA 1M6YA 5CBPB 5TPWA 4OB6A 3ORQA 3WYDA 4BWFB 1A72A 1E9FA 1DJLA 2RGYA 3NZEA 4LZZA 2B7LA 5IUNC 1X1TA 1XEWY 5BO5A 3OWXA 4R5HA 1BA2A 1JA9A 5BPHA 1ZEMA 1SKYB 3V55A 1VXOA 1DGQA 4DEVA 1IUNA 4IGKA 5DGTA 1GT91 3O8LA 3H87A 4HAIA 4RZ2A 3WFJA 1IRIA 1XC7A 2P7IA 2OY0A 3V8PA 3WTBA 1M8KA 1U31A 4M83A 4NBRA 3ZV7A 1QNLA 5BUZA 3HB7A 2F1KA 1BC5A 1SIWA 4IL5A 4KBGA 4DSAA 3V6LA 3UMYA 1QR2A 3HY4A 3TIIA 4RVFA 2PVCA 3I2GA 2J09A 1XNJA 3LU1A 4IIJA 3RFXA 4OIFA 2ZRKA 2AN1A 2Q3FA 3ZCPA 3V1YA 3SXUA 1KS2A 4D46A 3PGXA 3DHYA 3DV2A 3ER8A 1RYBA 3KETA 1CUFA 1KR5A 3H5OA 2EBWA 5JTTA 2FYTA 3KKLA 3DBLA 2IC5A 3BGOS 1RPTA 1PBTA 4DCSA 2FSGA 2V1XA 2ZE7A 1X0XA 4J8PA 4OOFA 5DNUA 5TS2A 2B92A 5TF0A 1T36A 4KG7A 2BM8A 1MEJA 3K6RA 4IJVA 5AJZA 2XWPA 4F5DA 4KNYA 1BJTA 1VM6A 2AC7A 3MJ4A 2ZYGA 3QXJA 5BMVA 3DE1X 1Q0SA 2QL6A 5EJAA 1J23A 3HNPA 4Y2VA 4C0KA 2H1WA 4JMPA 1U80A 1HDRA 2OCKA 3FUVA 1GVNB 2MSLA 1U8ZA 4WXMA 5DGCA 3LUGA 2AYYA 4CZ2A 3DLTA 3O4IA 5LBIA 3LUBA 4KPUA 4INAA 3ILXA 2VHXA 3GLFE 4HB4A 4X63A 4UEQA 1TC1A 2HFKA 4PAGA 1XO1A 5TQJA 2H4WA 2OMKA 1L0BA 1OVGA 4X61A 4LHVA 5EJFA 2VTBB 4Y2PA 1XIVA 2O0LA 3IDFA 2Q5CA 3INRA 5D7NA 2JFGA 1NVGA 4FD3A 4WKOA 5MFZA 1DT3A 4Y9UA 4U2GA 3I1FA 3RJ9A 1XK7A 2OQIA 1Y1QA 3UJ8A 4CCWA 4ZXPA 1GZ7A 4AT1A 3SVZA 1LWNA 3FWYA 1NXVA 4HWGA 2I6QA 2YWGA 2O3QA 2QLNA 2J85A 4JOQA 4LA4A 4RYDA 5AW5A 4ZJYA 1J2EA 3INGA 2AFVA 4R51A 1Y80A 2XYPA 5KCMA 3QVXA 2WE8A 3EW9A 1O96B 1E62A 1ZIPA 4OXYA 4QDZA 5HZHA 2Q2QA 3KT0A 4I19A 1EGHA 1AN9A 5KHOC 4IP0A 5THKA 1QHSA 4QWMA 4RZQA 5C2JB 3NPAA 4EL0A 3N75A 1VBMA 3RUIA 2PIAA 1M1NB 2BSXA 3NETA 3O0TA 4PZLA 3K70C 1U7WA 5DNAA 4JI8B 1EFRA 3OLXA 4MLZA 4NENA 2OFFA 2VUIB 1OZFA 2X13A 2YV2A 4EPVA 1R0CA 4Z1MA 2D0DA 3QITA 5FLXA 1VG0B 3I09A 3IH5A 4G4JA 4PQEA 2MR6A 3C3MA 5HF9A 3HACA 3CR7A 4TUYF 1N0IA 2RG7A 4YUYA 2G9VA 1AMUA 5CMLA 1GTVA 4V02A 2AI1A 5JHGB 1S4QA 2PT6A 5AI4A 3RQSA 5CH3A 3LC0A 5JIBA 2PSEA 3OM0A 3J81A 1EE9A 1VHLA 2DRIA 1MUUA 2XIJA 2Z8XA 2B6NA 3C7DB 3V5NA 1WTCA 2WZQA 3L6CA 4H0CA 2N1BA 4UTXA 2AG5A 5J23A 2RGRA 4ZC8A 2R4TA 4RA6A 2OXEA 2OQVA 1BFKA 4RTJA 1ZVJA 4D3DA 1EKXA 3FGNA 2Q3CA 4CW7A 4YXWA 2C8LA 3LGXA 3ESXA 1XU4A 2O3SA 2OV3A 1JXQA 2CMHA 3E58A 3EFHA 3O82A 4PQGA 4XM1A 5E7MA 4RD4A 3S2IA 5FTLA 5I5EA 3X3HA 3HA7A 3VHLB 2W6OA 3V4VB 1AH2A 1WNTA 4HTFB 3Q5GA 2EJVA 1QUEA 2NYVA 3COZA 1GTJ1 3FA2A 3MMPA 2PKRA 4RVHA 3MA0A 5GZ6A 4QNMA 5KJEA 4C20A 3OEED 4XB6B 5HX7A 3FHLA 1Y9AA 2X5XA 3QVJA 4TYMA 1G41A 5KWIA 1E5VA 4ROSA 4MGEA 1FC0A 2C94A 1QOPB 4JR1A 1JIQA 2X0FA 2HA4A 3B51X 1RKXA 3B2NA 4U9UA 4QUAA 2JIBA 2XR1A 4RHUA 2NU7A 4J4HA 4AXXA 1DINA 1UPBA 1P7PA 2V7EA 1LJLA 4B4KA 5JZ9A 3MIZA 4KPEC 5EWMA 4YC7A 5EVJA 4WK0B 2W6PA 1TDJA 3BFXA 3NIWA 4AM8A 3SBOA 5EIEA 5JYCA 3IHWA 1PR4A 4D4MA 4DLWA 5K20A 5C5IA 1E2HA 1TZMA 1N8TA 2FUKA 3H9UA 1HV8A 3HCWA 3KJEA 4IIEA 5DGHA 4N8SA 3KQYA 4UBJA 5HHTA 4WBNB 2KI5A 2GZAA 2YX1A 4HGQA 1IQPA 1R0LA 4UHJA 3CRMA 3BTSA 4P32A 5FFMA 2CXTA 3TMKA 4CGYA 4N8DA 1QRDA 4X8LA 1A5BB 2V45A 3ETHA 4JBIA 4P7GA 4EB6A 5IYZB 3AOGA 3R4VA 1Q0UA 4R84A 3RKRA 2A5JA 3JD3A 2PKQO 4RLFA 4R1UA 2YS6A 1JI3A 2WIJA 5H83A 4OP3A 4CLXA 4CKZA 1Y3BE 2ZPAA 1TECE 1HSZA 4JJFA 5DZSA 1CIPA 1YV9A 2P65A 1M34E 2PSDA 1N2OA 5G3YA 2O57A 1X7XA 4ZOQI 4Q9LA 3N53A 1DTEA 1UZAA 2HTEA 1OTHA 2SCUA 1PGPA 3JPWA 3RM3A 4E46A 5AVKA 5IC4A 5FEUA 5ALIA 1WNFA 3SK0A 1U7HA 3N58A 2C5BA 2D5BA 1EWYA 3U4IA 2QVGA 2PV0A 3GC6A 4B8WA 4HSEA 5IAJA 2HQ1A 4RIFA 4Q9NA 4KAXA 3SBDA 2GILA 1G3QA 2BFBB 4M0LA 4TKLA 4ZCPA 1QRAA 3UFXA 1VYVA 2ZUVA 4NCXA 3VSBA 5JCJA 1Z82A 4QTUB 4QULA 4UEJA 3FVQA 1ODFA 4RAQA 4F6LA 1PYGA 1TM7E 3VKFA 1E79A 2X0NA 2B3DA 1TJYA 2A7QA 4AUMA 2PZMA 5B4UA 2XUGA 5F76A 2YYZA 1RSZA 2RGUA 4Y6QA 1XNGA 3F6CA 1FP6A 3L7DA 1P5ZB 1SXJA 1NQVA 2PGAA 1MORA 3OMWA 2HC9A 2UKDA 3QOFA 1E3IA 1JR3A 3TUIC 3Q12A 2NSDA 4JLSA 1OQAA 3I8OA 3WV4A 4C14A 3H9QA 4Y6RA 5FX2A 2OMEA 3UHPA 2HYIC 1QX4A 3N8HA 1ZP6A 2Z6QA 3KKKA 5HBRA 4I7EA 2ZI6A 4WVFA 2CXHA 3MINB 1VE1A 4IJ5A 4J49A 2YQZA 3H5RA 3W8NA 3RAFC 1MPXA 4R16A 4CI0B 1JA1A 1QE0A 3FZGA 3HPQA 3L7LA 2QQEA 2JB9A 4IWYA 1SUAA 1XJQA 1QPGA 1X7WB 1RQGA 1RRGA 2NZVG 3JQAD 3FPJA 3E1GA 3WGGA 5JCZA 3GLUA 4HPJB 5DHQA 5KPJA 1VE7A 2W5UA 4JZKA 2F3PA 4OYRA 4J90A 4P4SB 3I72A 1EA5A 4UFPA 5KYTA 4TT3A 5FL7A 5EJEA 3TEMA 3VZQA 4WLEA 2VDVE 1V45E 2FPPB 5L3ZA 2YXDA 1TW3A 4N03A 1UWVA 3IHKA 3RSGA 3VSCA 4Z2AA 2PPLA 3JAWA 3QFCA 2PCJA 5HOQA 2AJCA 1SOUA 3LYAA 4MYCA 4FB4A 5IHXA 1B0UA 1NJ8A 5JAMA 2NUPB 4TYQA 1NW7A 2J6IA 5CYPA 1P5HA 2XNDA 2WFMA 3K4HA 3W77A 4C78A 3JR7A 4OATA 3ABQB 1Z5WA 2WYIA 4R6XA 2VHYA 3C14C 3QZUA 3CBQA 5C1PA 4LAFA 3QPUA 3OZBA 2IEBA 3KSUA 3F3KA 3MGGA 4ITVA 3KOOA 5E0KB 3LH5A 4ZAZA 5TMPA 5A4KA 1E6EA 4O2AA 1XLTC 3OAAD 1SOVA 4GM4A 4Z7OB 5BYKA 4WOCA 3JQ9C 2FPOA 1MCZA 2GXUA 2O0MA 1LS1A 2VKTA 4RDHA 3RDPA 1FS5A 2P67A 3G8DA 3ISTA 3TOVA 3S8MA 1B41A 2QE7A 3CGGA 3LBFA 4R69A 4Q16A 1C3EA 1IZ7A 2WD7B 4Y2HA 3T3GA 2OR3A 4FEEA 3ELUA 4I9UA 3V1KA 1H2AS 2VTEA 3EOZA 3IQZA 2GA9A 1VYUA 1YMUA 2ETVA 5JQGA 2FSSA 3QVTA 1MOQA 2FJUA 1BKDR 1I5RA 3G1UA 3DDHA 3FPLA 4UUAA 5IT0A 1F2UB 1UZLA 3WIUA 2Y1OA 2Y6VA 3G1WA 4B4WA 2JLCA 1JMVA 1AKYA 3GT0A 3O2JA 4U7JA 4AMGA 1ISJA 4YRIA 5JFGA 4KPYA 4N7BA 3PQFA 1NW8A 3DZIA 2ZPTX 3MELA 3ZUPA 4FP9A 4YRZA 2VF8A 4Q9KA 5CIYA 1QYRA 2IXAA 4P7JA 2H4XA 4MUBA 1ZINA 2Q28A 4G5HA 3HJNA 5JLAA 1WY5A 3WNBA 2H2FA 1CUYA 2WUEA 3ZU4A 1V35A 3JV7A 2L2QA 5LYJB 3WV5A 4YJ3B 1MQSA 2PX3A 1VGVA 1L7NA 1YB6A 2ARKA 2I2AA 1ZGGA 2Q9BA 3IP9A 4FXPA 4AMVA 4L07A 3HKEB 3I9LA 1KEWA 1G2PA 3D3EA 3WHKA 1MAUA 1W4LA 2WYHA 4R1QA 3RFFA 1I3CA 4BJ5A 4JA2A 4K9RA 1JU3A 1ZOSA 4IBOA 1YMQA 4A15A 2BGGA 3NASA 4K6CA 1KZHA 3V1TC 4D3XA 2RGNC 1XDBA 1G6Q1 2ST1A 2HUNA 3C6QA 1MFPA 3NP7A 3W1WA 4Z7NB 5J4HA 3B70A 1GY8A 2A1TR 2QNBA 4ZO8A 3ZHVA 1TQDA 1XTPA 5ICGA 2WWYA 4N65A 1PUIA 2FWIA 3ICQB 4KQFA 3USES 4WPGA 1IBKB 1Q7BA 5AVJA 3G2HA 5DOVA 3JZAA 3TM4A 4FLMA 3FDJA 1XJ0A 2PBFA 2QRLA 3VUFA 3B9QA 5AVTA 2E89A 1U6JA 2ZWIA 5KCZA 2ZRJA 1B15A 1KQPA 3B7PA 4MZXA 1MENA 3CRNA 5MF6A 3DJFA 3KT3A 5M3BA 1P8JA 2FW0A 1TPYA 2G9QA 2GEJA 2W58A 4HDKB 4BJHB 4CTKA 3P32A 5K9ZA 5F1PA 3S8EA 3BUSA 2ZRBA 3V32A 5CVVA 4XVUA 1VPDA 1MV8A 4GXQA 1PZXA 3ZWOA 2M6KA 2VJLA 2XPCA 1A9SA 2GJ9A 1Y0BA 2Z4SA 1RZRD 3S6JA 5CBPA 1M8PA 1U2GA 1XTVA 4MQEA 4TRRA 4PG8A 5AVRA 3AUFA 5ECDA 3AKYA 3LLUA 3RUPA 3E0XA 4L4ZA 3GN1A 2Y0CA 4CKXA 4KFCA 4GKVA 2F90A 1KFCB 1MJHA 2V7TA 2WD8A 4OXXA 3DAHA 2I7TA 3NTQA 2G7MC 4DJTA 3M1YA 2FR8C 4E70A 4TTIA 2DKFA 3NC4A 2ZREA 3HVRA 3KPUA 4GEKA 1FK8A 5A04A 2W0SA 2ZBDA 3HUFA 1WPGA 3DZJA 2WU3A 3MWGA 2E0IA 3LQKA 4RJ2A 5FNZA 3MN1A 3DVAB 5F7OA 3IIMA 3QEJA 4LE0A 3WNZA 5LQRA 1VRVA 2RGNA 1YVPA 4FWBA 4NYJR 4A73A 3REGA 1QCDA 1RQRA 3R41A 3P9CA 4GRDA 3UJBA 3ZNPA 4YJ2B 1U1GA 4AF6A 2FW1A 2ODBA 5BMVF 2NMVA 3RBZA 1J1IA 2V4MA 5IDXA 5B1HA 4DIMA 1IHYA 2PGDA 3GGOA 3ITEA 4JEIA 2AEJA 2QENA 4UZEA 4US0R 2HMUA 3AHDA 4JQCA 3KAQA 3FVTA 4QDKA 1WXFA 1SNYA 3FZYA 1PR3A 3NTOA 4RPLA 5JJBA 3VUEA 3REFA 2W2LA 5AW4A 1B2LA 4NJMA 1I7QB 3Q10A 3F9CA 3IAFA 3B1XA 3GQVA 3PDIB 4RNDB 2V6GA 2BR4A 4ZI3A 5HE8A 4V0OA 1GNPA 1IBLB 1T8PA 1ULZA 3L0OA 2V7WA 3W2GA 1Q0RA 2MSDB 3C74A 3NYIA 1L4KA 4BE7B 1PHPA 1V3VA 3W7BA 4LHZA 4EPXA 4AXBA 4JXKA 3JASB 4ARSA 1RIIA 2IZ7A 2Q1TA 4F92B 5KVSA 8ABPA 1PQWA 3T3EA 3U49A 2E4UA 2VTBA 1YS2X 4OJKA 5A5VA 1W44A 3N2EA 1Z5OA 3I2HA 2H2HA 4IQFA 4P84A 1EJ0A 1HH4A 1V37A 2MYUA 2D7CA 5LC1A 1P2DA 5J4YA 2W6CX 4E33A 3ZZUA 5LSAA 4HMQA 3P0JA 5CT6A 1YJAA 1ULHA 3NWBA 4KTTE 4XD7D 3H4MA 2YJGA 3ZJTA 5TQVA 5AOCA 5IC5A 5SICE 3EGVA 1I9CA 4O2RA 2R6HA 2ZTVA 4CFSA 3B52X 1FTGA 2HPHA 2WJHA 3KOZA 3A1NA 5IH7A 2PSHA 3JYOA 1O96A 1UMKA 2XDAA 3PE4A 4GXRA 4WGFA 1VPVA 3GJ6A 3GARA 3KHKA 3ENWA 1PU2A 2XITA 5JHHB 4PBTA 3QBTA 1VL2A 3AY3A 2YZMA 1FA9A 3H7IA 4G9BA 1J4AA 2DTEA 4P31A 1UJ4A 3C8DA 2FRDC 1M1NA 1H6CA 2IFTA 4PX9A 4C4OA 3FTDA 1MTOA 4Y9SA 5D01A 1K27A 4G86A 3HEAA 3IJ5A 3QQ5A 4KXXA 4K9OA 3E7WA 3PV0A 5CHYA 1L5NA 5I8PA 4HDCA 2XYVA 3SNKA 4EI7A 3NKVA 4I1VA 2CL6X 1OTXA 3H9EO 4FONA 4NBLA 5G02A 1NG1A 1NX6A 1CJTC 2AGVA 3WB9A 3GRAA 4CQNA 5KC9A 4MULA 4RIGA 4QOFA 4XWTA 4UASA 2C61A 3TZHA 4EW6A 4B4UA 1CR0A 4B6JA 3TBKA 1HT2E 2Z8YA 3HKDA 3EZ6A 1GRVA 1L4MA 1QFSA 2CW5A 1M6WA 4HWOA 3O26A 3OKAA 3PGVA 4URYR 3F6BX 5H59A 3WL8A 3P9XA 3L1HA 5LUBA 1EEHA 4QDJA 4ZV7A 1XPJA 3T1OA 3JXEA 4X20B 5YASA 2AZXA 4L1KA 3E3NA 2XMBA 1QHIA 4AP9A 3E82A 2GD2A 2YVKA 3CRRA 1RM4A 3HUUA 4L22A 3EWIA 4WN3A 3R8XA 1Z0DA 1S9HA 2LW7A 2E48A 3RUDA 4ZCRA 4GSYA 1Y89A 5F3DA 5I7FA 3U4QA 1X3LA 1JHVA 1OJ7A 2VH1A 4QOEA 3T7CA 3D59A 2AYXA 3WGNA 3DYVA 4IDEA 4HTFA 5TT1A 2HF9A 1USGA 4ZT7A 3AJDA 2QUZA 3Q8XB 1U0HC 1U6IA 2OAEA 3D31A 4PRZA 3OURA 3V7UA 2O4CA 1Y5IA 1ZBQA 3EQ7A 2ORWA 3K72B 1X7DA 2WWFA 1Q1EA 1OYWA 3G88A 1G3IA 4W5RA 4YMSA 2W6IA 2ZS7A 2HHLA 4D81A 4G0QA 3TGPA 3AB3A 1S2DA 1NVFA 2HW8A 4FHEA 1E18A 5CDHA 1M6EX 2IYWA 4BFTA 1KEKA 5AICA 4L0DA 1S8OA 3UK6A 4A6XA 1J8VA 2H1SA 3NOXA 3ZHUA 3HFSA 4F21A 2HSZA 1XD8A 4TSFD 1CR6A 2FRDA 4HX2A 2VXOA 2LNDA 3LO8A 3TBFA 1PLKA 3ZW9A 3A31A 3IHTA 3QX9A 2HO5A 3RC1A 2E55A 4KO8A 3TRJA 4JJ8A 5D5HA 5K3CA 3O3OB 2B20A 2CF6A 1AM4D 2RHLA 4PLTA 2WYOA 4CV3A 3TLKA 4D98A 3SNHA 1J22A 1F1BA 4IFEA 4EA9A 1JDVA 1Z6AA 3TUJC 1AKTA 3DONA 1L4YA 4KWIA 1Q21A 1AMNA 4CKBB 1NI3A 3A6GA 4QBTA 5IYZA 4HN4B 5F33A 4WCDA 3TR0A 5K1ZA 1OU0A 2RAFA 4H18A 4PLPA 4EUKA 5BN3A 3IBSA 1Z4LA 2DFTA 2EZ9A 2J5XA 3N7TA 4FBMA 4P92A 2G82A 2QZSA 4AKSA 5MGNA 2V4ZA 3NJRA 3AESB 4ZQFA 6NULA 3T7AA 4V0ME 1IC6A 1Y9EA 4MITA 4CUZA 4ML3A 1NR5A 2QDKA 5REQB 4ENUA 1OOEA 3IPXA 4YI3A 1R3UA 1Q95A 4U9IS 4K1LA 4P3PA 4AICA 3PQ8A 4E7OA 2OZEA 5DN6A 4CIDA 3RRFA 2Y0DA 3ZKWB 2BI7A 1WG8A 3SOZA 3SSMA 1P7VA 1E4OA 1H2BA 1N5RA 1V71A 3TM5A 4D9MA 5KKNB 1XXHB 4ZO6A 5A9TA 5LIRA 4HEJA 4RK6A 5GONA 1L7EA 1W5BA 2BFBA 6YASA 1A98A 3EPPA 5B4VA 4ENWA 5IDQA 4IIGA 5AKGA 1QH0A 1MMFB 1WZCA 3JSXA 4Q00A 1K4MA 1NVVR 4OQQA 4H7JA 2J30A 4R8MA 1AO0A 3MLEA 3LFHA 4UU1A 4GOMD 3OZVA 4NPCA 2ATEA 2NQTA 5BWNA 4F45A 3O8RA 5CVTA 1G2IA 1W4ZA 2NUBA 2ZUUA 3ER9A 5DISB 4FS3A 2X0IA 9LDTA 1BJKA 1Y7TA 3E2IA 4Q4CA 1KTVA 4AWXA 1JIVA 3HCCA 3L7NA 2RKOA 4XGQA 1UFVA 1UJBA 2KLHA 3IKMB 4U2FA 3HA3A 3BBPA 1N8SA 3KAKA 4O1HA 1C1YA 4DN6A 3PQ7A 1I10A 3M3HA 5TQ2B 3QEKA 5CX1A 1YK1A 4P93A 4LWOA 6GPBA 2EGUA 4PYRA 3CE6A 4MUYA 4Q3EA 5EL0A 1P77A 3KSMA 5AKIA 2J3KA 4KNWA 4EYGA 5C52B 5KYWB 1WWKA 3SC3A 3CVWA 1PJ2A 1KEEB 1CUVA 1VSBA 2HMAA 2QG6A 3D4PA 2ZJ2A 2GO7A 3QXGA 3DZKA 3R4CA 2DKNA 1DRKA 1GZ4A 3SOPA 3VNAA 3LVFO 5ALRA 1X7WA 3W8FA 1CT9A 1O54A 4F9GA 2QL9A 5F2NA 4QFDA 1DEXA 2XF2A 3G89A 1O58A 4U4AA 2XGMA 4DY4A 1K3UB 2W2XA 3G82C 5ALJA 4RDCA 4ND7A 4P4SA 1P3DA 1XCLA 4N3CA 1X14A 2Y2UA 4WINA 4ZXFA 4QBIA 4EHBA 2I8AA 1CUDA 3TTTA 4Q9HA 4EYQA 2PR7A 2FPPA 1PJCA 2RJ3A 4LDRA 1XWIA 2Y1XA 5DNDA 4L6AA 2XT9A 3OD1A 2HNAA 4WVLA 1B3RA 4DPLA 4DQLA 4LQDA 2P9EA 2XNCA 4MRAA 1FW6A 4H60A 1T3TA 2NUPA 5GINE 1T26A 3RF7A 2I7VA 1X1RA 3A9UA 1HFKA 2WJAA 2Z83A 3EDRA 4PTZA 3UJ3X 4CCYB 4R71A 1HORA 4O2AF 4PCAA 5LOVF 2HLNA 2CL5A 1O03A 2BMVA 2PRJA 2B4AA 5IN5A 1L9XA 2PRIA 2XUOA 2FOLA 2QX6A 2PK3A 3GRPA 5A3VA 4J2TA 3SMVA 4EJSB 2W70A 4DGSA 1G20B 1DQYA 1ENOA 3AM4A 4ILEA 4YT8A 4U7FA 3DKRA 1OX6A 1MV5A 2A14A 2E9SA 2V3WA 4IS2A 4PYMA 1GAEO 3LS2A 4CL8A 1GM5A 4UUQA 3ZWPA 1X2BA 4KFUA 5G0SA 3U6BA 4M89A 2LR0A 3FNIA 3BJMA 5FOVA 1XRJA 4QJBA 3A14A 4LC1A 3WK8A 1S2LA 5ER6A 1UBCA 4KYUA 1E1NA 2R7KA 3QENA 4Q93A 5IKMA 5JQGF 4X93A 4FJ0A 1NMZA 2AN3A 4R01A 4GM0A 4B9AA 4IX9A 3W4IA 2W2QA 3BQNB 2ABWA 3G2LA 1EI9A 3IERA 2NUTA 3ZOKA 5KTPA 3NU1A 2C2XA 2PO5A 4LJ6A 2UZ1A 2MU1A 2VK8A 2JDID 3EYAA 5CX4A 3GH1A 5EESA 4P0TA 5HKBA 2ZIAA 4QLAA 4ME6A 2ASEA 3OOHA 2KPOA 4J4BA 3WC4A 2JKZA 2YMPA 2C3PA 2IUSA 2O2XA 4MVJH 4UPVA 5ARCA 1CQIB 5E9JA 1HI9A 5DXFA 2Y66A 2O50A 2XVZA 1EXWA 1ZN9A 3LLMA 2JFWA 4XIGS 1N1DA 2PLNA 1NQ5A 2W9XA 4ILKA 4WKNA 4CTOA 5A5GA 3OKFA 5IASA 1P4GA 1G6KA 3CRZA 1YB1A 1X7YB 3HJBA 1TKAA 3W04A 2I1WA 2BKLA 5I9IA 1LVUA 4YJ3A 1IN5A 4HEHA 4XASA 3UFBA 1D3AA 2ZQ5A 3IUJA 2UYQA 5EZSA 3HKEA 3T7IA 3B8EA 3ESQA 3I0ZA 1WABA 4KQMA 1N2EA 4XWAA 5D3KA 3OO1A 4QGFA 1Y4UA 1A04A 2C9BA 2AQ8A 1BCSA 2BGLA 4U0KA 2NVOA 2QNIA 3HDJA 5DTMA 2CWWA 3RBVA 3ZTWA 3C3WA 2VBCA 4JP2A 4OSOA 2EQ5A 1RBZA 4YJFB 1F4VA 3JVUA 3H17A 4FDUA 4NV1A 2D0OB 4FB5A 2I4OA 1IVYA 4IQ0A 4ESEA 1UWCA 1X86B 4YMIA 1DMSA 5J9FA 2FPIB 3LW7A 2C7GA 4WCVA 3BIFA 5GPBA 2I7CA 1G8PA 3JYQA 2XAUA 4P2GA 3LTEA 1XV5A 4LVNA 1ELOA 3UCXA 1GN9A 4BRWA 3EGXB 3GELA 2OG2A 1W8DA 1L7OA 3HV2A 4RFSB 3JARB 2WP0A 1PR1A 1ISGA 3CCBA 1ORIA 3LKZA 3NOQA 3AEYA 1GYRA 3MXOA 5G4KB 1UPAA 2OBMA 2A58A 3Q98A 2B8JA 5D6NA 4BAGA 3PC6A 2RMKA 2D06A 1GPJA 3FUUA 3HXTA 1Z7BA 4OI4A 4HR7A 2GHRA 4UVHA 1FP2A 2P69A 2BUCA 1XPOA 1J8MF 1GCOA 3DMRA 4HDKA 3I64A 1PIWA 4K5QA 4LQLA 1HE1C 3S28A 3VPHA 4AMUA 4F06A 4UAJA 1O2DA 2GLTA 4DUPA 4QU5A 2BEKA 2K2QB 4K28A 1LBIA 1TM3E 1GNRA 3I2KA 4KN6A 3SYKA 4P5EA 5IT9A 1ZI9A 3KJQA 3NYWA 4B80A 3CKMA 3QHAA 4LYJA 1P1RA 3AFGA 5B37A 2PO7A 4YHHB 3OQNA 3UC9A 2BZSA 3CLTD 3TEFA 1TIBA 2Q5QA 3CSDA 5HTOA 1ISFA 4JYMA 4IIDA 4C0SA 4Q66C 4RPIA 1DC6A 2UYYA 3PB3A 3T9BA 4GQIA 2I0FA 3JYLA 3QUBA 4BATA 4FX5A 3D4OA 3TSZA 2C9MA 4MP8A 4FU0A 2E5LB 1PR0A 2YCBA 3TRDA 4PVDA 3MD0A 2QM7A 2A1UB 3G5AA 2YBEA 2JAUA 3KDSE 2Z2IA 2ODQA 4IRMA 3SQDA 2Q0XA 3OH8A 2Q9UA 4DMHA 5TJHA 5BWOA 5K0SA 1L9KA 3WJ2A 2CJPA 2ATXA 3NVMB 3WBBA 1B6RA 2IOFA 3K73O 2ONYA 1PWZA 3CZQA 3ZNOA 1J70A 3DVAA 3K9FC 1FZQA 3VR5D 3VR3A 4GL2A 4H17A 4C2AA 2WA2A 4C08A 4MX8A 5DHAA 1UBTS 3KBBA 3AFMA 5JBIA 1UKZA 5IULC 2VK1A 5KOJB 5CYFA 4YJ2A 4LEIA 3O8CA 2GZ2A 5IEBA 1ISRA 2GN8A 2R6AA 4O25A 2O7SA 1XTKA 3PUYA 5DM0A 5BUCA 3KU4A 5HVNA 3E9ZA 1EH5A 4MRMA 5E3HA 1SA0B 4JHXA 2ZDQA 2ZYIA 1U1FA 3IJRA 3ENNA 5KOHB 2EHDA 1RMYA 4JUFA 3FI9A 2ZUBA 1FDIA 5GOZA 1VP3A 3CJQA 3AR2A 2GYWA 2WHRA 3EAQA 3DH0A 1SRRA 3ECAA 4L9RA 3UUEA 5DGDA 3KV1A 3OY7A 2QROA 3PDIA 3BZWA 5G53C 2VN8A 2PGNA 2X2OA 3A4TA 3IOBA 4HHEA 1U2SA 4CCAA 1SKAA 1T8YA 2HBYA 2VT6A 2VPYA 4HWPA 2CY0A 4LSWA 2JG3A 1WD5A 1I4LD 1NNI1 2OGSA 1PJSA 3SLGA 5DT2A 2JAXA 4EJFA 4NYMR 1CQXA 1EQAA 3EZGA 1JW9B 3IVCA 3JASA 4IXDA 1M2FA 5CIWA 4YK7A 5FBVB 5LWQA 2QRUA 2QTTA 2IZ5A 3ESZA 1WY7A 1ZDMA 2H3HA 5FOWA 5FBWB 1LI5A 2JLAA 1EUCA 4NNJA 4X5OA 1ZC3A 1E61A 2ECKA 4YAGA 1YRLA 4I55B 2AFIA 5FWNA 4P38A 3R7DA 2BD0A 1BN7A 4ECAA 3K94A 1R50A 1V8FA 5G2OA 1RBQA 4CLHA 4M98A 1VLHA 1HBJA 3UUWA 4H1WA 2CLFB 5KNLA 2QMHA 1ABFA 3SC2B 5LQJA 4ZK2A 2OCBA 4HS9A 4L27A 4ZQHA 1SU8A 2IHKA 2R79A 4RIEA 5JC1A 4HZIA 4YDHB 1TXGA 1XL1A 3GDGA 2YOGA 4XOIA 1AUOA 1WKVA 2IYRA 5ALFA 3DOUA 4O4JA 1JIIA 3L84A 3CLHA 3L82B 4UVIA 1TO1E 3DMTC 4IVRA 1P1JA 1ACLA 2YUTA 2O07A 3IE2A 3ZHBA 1E2FA 5FIUA 1FTWA 4U7HA 3LYUA 2GK3A 2X3FA 3ZGYA 4Q3BA 4XPIB 3GJ0A 4ND4A 4BJ6A 1FXUA 4F6CA 2JFPA 4Q6BA 1QYCA 4B7CA 5DWVA 3FBTA 5G0UA 5K0CA 1QTQA 3OE4A 2JIPA 5ERGB 1M2WA 1V8BA 1FX0B 1P44A 3V33A 3BWCA 4X20A 1ZD2P 1E3SA 4A0SA 2AOXA 1LSJA 1QJCA 1G3RA 1UJCA 2B98A 4MCIA 5T3YA 4DDMA 2GBLC 3Q8MA 4R9VA 8LDHA 2ZATA 1CDOA 1V5FA 1MGOA 1NVTA 3H18A 2ZIFA 2FE4A 5TEWA 3U4AA 1DO0A 3ZBPA 3EGWA 1F0PA 2QG9A 4J0DA 4OAOA 5FBHA 4YPFA 3EQ8A 2WY2D 5JSFA 1AC5A 1U02A 2BMEA 2GCOB 3OESA 2HV9A 2G07A 3SVTA 1I4OA 1FLAA 5CM9C 3CUWA 4Y2GA 2Y3IA 4Y6LA 3H5WA 4NHEA 1M0EA 2ODPA 2H2AA 5C7OO 5A4AA 2DECA 2YWXA 3UA3A 1A9YA 2C5EA 4ZRMA 3T1NA 4P6VF 2WWGA 3NP9A 3E81A 2WF6A 3ZWMA 1AKRA 3LC7O 3K0BA 2XQKA 2X8LA 3E27A 3QPCA 4HWRA 1ZN8A 4A27A 1LUAA 1RQLA 2DFLA 2HT1A 1RADA 3DHNA 1A8PA 1KFEB 4TTSA 5ENDA 4E5VA 1EX9A 4JL8A 1YAHA 5DLPA 5AK6A 1LA2A 4ZVLA 1SXJE 3GZTB 3KYJB 4OK3A 5HFJA 3S2GA 3W6PA 3ZNNA 1G9TA 1U0OC 4G0PA 4WBNF 3WLEA 1YA8A 2GXQA 3AXSA 3DCIA 221PA 3QKUA 4GC5A 2DKOA 2EW2A 4WASA 3DZDA 5CB8A 2YH2A 5M5BA 1JR3E 3V42A 3IUBA 3MLBA 3RK0A 1N9ZA 1RXCA 1USKA 1TMOA 1YULA 4QDTA 4C5CA 1GTRA 1KO1A 4GMXA 5CK5A 3GT4A 3B82A 5IYZF 1J2JA 1DRVA 1TMGE 1XBTA 4BFYA 1DQNA 1NSTA 2EZ8A 2XUHA 3HFGA 3OUTA 1SUFA 4HNRA 4JVNA 1CPYA 5C8YF 3T5BA 1JDZA 1DPFA 3LDHA 2MYNA 4EMSA 1CVIA 2Y68A 2AF4C 3H4IA 4LHEA 4CKBA 4QELA 3CX3A 4R7GA 1ZD4A 4KUHA 3V3KA 1TTQB 4DA6A 1Z6YA 2R8XA 5ES4B 5IAEA 3H1EA 1QR6A 3PEEA 4J4TA 5BVGA 3A2NA 5HYVA 1JFVA 5H80A 1PVDA 3V8NA 4HK4A 2QMOA 4LRWA 4J3FA 1DOZA 4FJ1A 4O63O 3G2IA 4X1YB 3VZDA 3WYBA 3LUHA 4JLAA 1TYDE 4IO0A 4KH1A 4EI9A 5LMNB 3ANTA 4DA8A 5LP1A 3FZQA 5H9WA 3ZKWA 4N3NA 1PX0A 4BU0A 1FFAA 4ATNA 4ARBA 5AUPB 5ALKA 1KQNA 1XXHA 4YCAA 1HMYA 4IJUA 3EVGA 3CWQA 3M2PA 4WBSA 2YZ2A 4ZKDA 2W90A 3AJAA 1U4NA 3PK0A 3QY9A 2WMOB 2YJ4A 5TPZD 2FZLA 3GHHA 4W82A 1CY6A 2BEWB 1ML4A 1OFHA 1O95D 3HC7A 3OIUA 4OH1A 5CGZA 4YCDA 2YCLA 2I6XA 1QTIA 1N2CB 1L4EA 1TVMA 1W88A 1W8IA 2D2VA 3QE9Y 2ZE6A 5TSDA 1VBNA 5A7HA 5JXJA 1KP2A 4EJSC 2WQ7A 1QYIA 4CV2A 5IUKC 1PDWA 4PAQA 4UNSA 3V4FA 2PLFA 1NW4A 3AWIA 1J07A 3OETA 1CJSA 2J5RA 1J6UA 4QQFA 4D9BA 1JHMA 4X00A 3M7IA 3Q41A 1QG6A 2UUCB 4RV5A 3KWJA 5ADVA 6ADHA 4MPJA 3BE8A 2A88A 1F5SA 2GWHA 1Q7RA 4B6FA 1A95A 1B6TA 3RYFB 1KI2A 1NY6A 1OYYA 1XR3A 3I4LA 4G0VA 5CCDA 3U6KA 4G23A 2UZAA 2J1LA 3EC7A 3AM3A 3IQFA 4NK4A 4EFDA 3U3RA 1WV0A 5KYWA 1KEEA 1V1JA 1BA3A 1JQLB 1TQ4A 4PSDA 2HCBA 3UMMA 4YUVA 4EF5A 3MJFA 5K8LA 5ADUS 4DLKA 1DC8A 4NULA 2R44A 2WRZA 5C0OE 2NSYA 4MGZR 1U98A 2J45A 3O8QB 5HMMA 1PNVA 4AMBA 4JIMA 2V6FA 1YZFA 2D2XA 1AZSC 1JHPA 1KP9A 3AR5A 3CSUA 4G24A 4R2WA 2IQ5A 4YRFA 4IEFB 4N5MA 1I4DD 1Y8QB 1TJ5A 2UXCB 1GZDA 1W59A 2HQRA 1SG0A 4EVQA 3DKKA 4OK6A 5IP5A 3IAM6 4JELA 2RBEA 3RJTA 2FUEA 1KI8A 4NS4A 4ABYA 1VXRA 3HVJA 2C8KA 4LRUA 1F3OA 3ND9A 4XWGA 2IZ1A 3L8DA 3H5AA 1OGJA 3TN7A 3D8HA 2PANA 4FMDF 1BS1A 1D07A 1LSSA 5B36A 1TEZA 1N9GB 1S01A 2FE1A 4AG3A 4CL3A 1QH1A 1QP4A 1GGJA 4CCYA 2KWIA 3Q5EA 5IJZA 4E2FA 4RD2A 1QP7A 2VJBA 4P7KA 3ORSA 4HBGA 4XH9B 4MV1A 4F2WA 3AVVA 2BHTA 3KB6A 1T0JB 1E2UA 1U1CA 2WYVA 4EJSA 4W6QA 2XDYA 3FMPB 4GZ5A 4Q02A 2PH1A 2ZJ5A 3CONA 3TSOA 1G20A 3A4NA 1VI2A 4PZ0A 4EP1A 1QCCA 1DQZA 4Y2SA 3UOGA 3K30A 4K6OA 3ZYCA 4YMLA 1YZKA 4AO6A 3WNQA 4K1XA 2QTZA 1U5CA 2JANA 4AJIA 4ZOLB 2OWEA 3KB2A 3X1DA 4UBKA 3DCYA 1FZTA 2DFNA 4W1RA 1DARA 1KWGA 4QARA 1YUBA 3RHTA 1OXTA 3BTVA 1GPUA 2WTXA 1YDGA 3FLMA 4K46A 4CM9A 3RLIA 1TUBB 3NHUA 4HJXA 2E1RA 3C6YA 5F78A 4ZPJA 2OYSA 1T2VA 3SR3A 2JCBA 3TTSA 4E12A 3AWDA 1YB2A 2CVZA 4AK9A 3AM1A 1GKUB 1XKQA 5D84A 4GI7A 2COUA 2BSQA 2O19A 3VHXB 2GRAA 4PZYA 2HK6A 3M5CA 3DLIA 2OVBA 4QAQA 5AVOA 3FYTA 2CUZA 2X1LA 4HG2A 5EAIA 4ZIRB 1JKIA 4FFPA 3BMOB 3L01A 4I6GA 1C7JA 5AQEA 5LYJF 5KYKA 5TY0A 2VRCD 1GG5A 1SKYE 2QZJA 2G71A 3E9CA 2VQSA 3ND6A 2IEDA 3QFSA 5EIBC 1HYHA 3R77A 1LRKA 2CVQA 4LHXA 4UDYX 1X7YA 1WU7A 2ISQA 5AKXA 4IMRA 4NZOA 1IY9A 1Y81A 2VHQA 4IDCA 3VC3A 1SKMA 4WLVA 1WDKA 2JFBA 2D0PB 3HB1A 4IIBA 1SZPA 3PD1A 3UJNA 1C3OB 1OWMA 1E7MA 1SKBA 3L0CA 4NFHA 4RHYA 1DBQA 3T0FA 1QHNA 4RO0A 2OHVA 3R40A 2G1UA 3GFGA 2PUEA 5KJ1A 4J43A 1XMVA 4PY2A 3MHTA 4YJFA 3IOEA 4BASA 3KQMA 4MB0A 3D6NB 3GPLA 1ZUNB 3A9SA 5E8RA 1ITZA 2J6CA 1DT5A 1GL7A 2FPIA 2FWRA 1AQ6A 3PQDA 3PUWA 3T1TA 4Z3DA 1I2MA 2Z3VA 4F7WA 1AJEA 4ZALA 1VCHA 1PSDA 2B21A 2J4DA 3EGXA 5AVUA 4FC7A 3N8DA 5M34A 2VAMA 4RFSA 3JARA 1DBRA 3QVMA 3LUJA 4QUKA 3WYEA 1WZIA 5H7XA 1Z62A 5K8CA 2WSSA 1ZNXA 2LVBA 4JEUA 4NE9A 3BFVA 5G4KA 1DXOA 4ND2A 2W22A 3GEIA 3HDHA 4J7XA 2C54A 2R1ZA 3RVQA 4A82A 4B0OA 5LIPA 3FNBA 1GFZA 3PNQA 2Z8YM 3ZJUA 2OHIA 2VZ0A 4N3AA 1C9EA 1I7DA 4BO1A 3WK4A 3U09A 4IMJB 5E6SB 3HRIA 2PLRA 3DUFB 1S2OA 1IMJA 2VJKA 4RVDA 5HZMA 5IJAA 3S5UA 1QGZA 1BFUA 5SZJA 5HOEA 1G5RA 1KVQA 2FP4B 1VFNA 1NLYA 2O8NA 3GMIA 1MB9A 1LC3A 3LY9A 2ERXA 2YHBA 4NVRA 3W3AD 5A6VA 1L5VA 4YV7A 4Z4EA 2UVQA 4EL5A 1BQ4A 3P5BA 1ZR4A 4H9GA 1XYYA 3L8GA 5ULLA 5B1EA 1G98A 4BZZA 4DA7A 1E2KA 3D8UA 7ABPA 2PUCA 1DAFA 4GBJA 2O2IA 3I53A 4NCIA 1W75A 1V5GA 1XTJA 2ZR0A 1T5SA 3D7MA 3F0TA 2A1UA 2NU9B 4L76A 4F9FA 2HD4A 3MG9A 3NFYA 1HPLA 1D1QA 4MNTA 4X41A 1L8OA 2D5LA 2FOIA 4WKBA 4YJ2F 4OO3A 3VYWA 4UHKA 4QG3A 3GP8A 5AOAA 5IAKA 3VPDA 1CUSA 4QYIB 1P2UA 2PZJA 2H07A 3VDXA 2O0JA 5D86A 4FKZA 4N39A 3LXMA 4L28A 5T4FA 2PV7A 3DOOA 1Q17A 1U0JA 4MOWA 2CK3D 3WISA 4P4GA 2AJDA 1ADFA 5KOJA 4KRFA 3IQGX 1COWD 1MAAA 3DHEA 3SI7A 2PNFA 1QVVA 1T5TA 2XZOA 4F4CA 3MWYW 1SA0A 2MYPA 2H29A 3AI2A 3OEYA 4JBYA 4MW5A 5JSUA 5JECA 1J5PA 5KOHA 1EM6A 1SWVA 3TINA 4R8KA 4C05A 4CF4A 3LF1A 5I4IA 4BB5A 1JE1A 5ISMA 1VHWA 3JSAA 2I1QA 2A78A 3QVWA 3H99A 1JLLA 1LLFA 3D6JA 5ALPA 3T99A 121PA 1F48A 5AH0A 5EE5B 3ZDEA 4W1QA 3NHLA 2ZUSA 4JT8A 4LYYA 4DIOA 2D4AA 4EQZA 1QQ5A 2BM9A 3YASA 2C5HA 2QD1A 3AM5A 3H4VA 3HYTA 2PUWA 4I3GA 1T3SA 4M7OA 3GFFA 3RS2A 3S7ZA 5BVHB 1RDFA 1U0TA 3ZVNA 1F2TB 2V7QA 4YRPA 4AWAA 5HA5A 2JLVA 3KVVA 1B23P 2BP7B 1HDEA 1YR1A 2B1RA 4ZZ2A 1R9GA 2FJPA 3FSJX 1IOVA 3JX9A 1D5WA 5K99A 2CNLA 3COVA 2E21A 3VJLA 2PJRA 1Y6ZA 1Q0QA 2Y1KA 4KHZA 3UK2A 4BFZA 1GQSA 2ZSUA 3LQFA 2FMKA 4FE7A 4I55A 4JU9A 4IICA 3SZLA 4D02A 4RTQA 1Y3IA 3LIIA 2WV9A 4L7QA 1A76A 4QLBA 3EEOA 5BRNA 3V7YA 4U63A 5HTKA 4HAXA 2H8GA 5JS7A 1KY2A 1IIRA 4Y6SA 1OZGA 2A9VA 4I3FA 4C7XA 4YHBA 1TAQA 5A7FA 4J03A 5BSRA 3SC2A 1SU6A 5IK2D 1BGXT 3C97A 1WA5A 1YRQA 4PG6A 1NFFA 2GTIA 1D9ZA 2VNJA 3K5PA 3ZHQA 2PMWB 2CZQA 3H0CA 5BW8A 5CT4A 2ZVJA 2WINI 3G9ZA 1GYQA 3HN6A 2AKEA 1NVKA 4UREA 3ONNA 3DO8A 3PPXA 1WRBA 3SQOA 5KC8A 3VO8A 1QZ3A 2Y99A 1RPAA 1J09A 4ND8B 4PWZA 3ZEAA 3VR2D 3HSSA 3PHHA 1ZNZA 1O6FA 2YXBA 5E7IA 3C1TA 1ZWLA 1ZYUA 4UAVA 5DFAA 3H97A 2XRFA 3B89A 4KU4A 4M22A 1FB5A 3RUAA 2G1PA 4YAIA 1NN0A 1R4ZA 1BRMA 1AKEA 2O5RA 1P45A 2GK7A 2IIVA 3H3FA 3ZY2A 3KM0A 1B76A 4XPIA 1PQUA 2VRBA 4CM7A 1X1EA 3IELA 1N1GA 3TQCA 1MDFA 5A02A 2FSPA 4RZIA 4GOLD 3KU1A 3MQ2A 1UOOA 1FQOA 3VZRA 1FX0A 5K8IA 1Z33A 3C3CA 4LNUA 2Z4TA 3GEPA 4C03A 3E9QA 1U2DA 4F3YA 1PWHA 4YAJA 1P6XA 2E1PA 2ZAGA 4PLYA 3RRZA 3OQVA 1E6WA 1QP8A 3FFAA 4OFWA 1K7SN 5CVCA 2G1AA 5EIWA 5FR2A 1YJQA 2DYKA 4XD2A 1WW2A 3Q3JB 3QNWA 4RCVA 3ZWWA 4MS4B 1E2DA 4ZVNA 5COAA 2YV1A 1ZIXA 3MCTA 1RAAA 2AXQA 2ISSD 3N86A 1J8FA 2EWWA 3HB5X 3ISJA 2CVFA 1C7IA 3AFOA 1W6RA 2I1LA 1RJ9B 5EFZA 2CLKB 3UMBA 2R5FA 1PUXA 1KOGA 4IQ4A 1KMHB 2H51A 4TKVA 4QA9A 3TLYA 4B33A 2GCPA 2OZVA 3FJYA 3QWAA 3DTNA 1O5OA 4BZQA 3PEWA 3BN3A 5C4IA 2FPSA 4KBYA 2VHZA 5AVWA 1K0FA 4XWWA 5AWFC 4WZAE 3ANNA 4MWTA 5FBRB 1PL0A 2JPDA 1F6BA 4GHWA 5LP6F 4JLUA 4H0FA 3SLKA 2WAYA 5CW2A 4TS9A 4HAZA 3TQIA 4U7GA 4C76A 4YFVA 3EUFA 1M7HA 1K6JA 3JZDA 1JYEA 3G0IA 1SD1A 1LNSA 4U7PB 4IDOA 3I83A 2ZM6B 4LFBB 2CYBA 2XTZA 4J91A 1U6KA 2OFWA 5JJIA 2F4VB 4EH1A 1WKCA 4GBMA 3CY6A 3F5QA 3TLBA 1Q1QA 1RTTA 1SBZA 4OF4A 4AJ2A 5CT9A 3OPYA 4BX2A 1GAQA 1JIJA 2E4YA 2VVTA 4MUJA 1QRSA 1B1CA 2BGIA 1UKEA 3EMDA 2QS9A 4COKA 5TDHA 4YTEA 3NXSA 1ECJA 4FEGA 3VJRA 1P39A 4O4IA 4QGAA 3X2EA 1C9NA 3G7SA 4FILA 2PUDA 1EVEA 1B8UA 1R8SA 4UFNA 3WGIA 3ZWCA 5B7GA 4Q48A 4GGMX 3UV3A 4ERNA 3W34A 1ZKMA 3OZUA 4X1YA 4EG8A 3PDUA 2PY6A 4CM5A 4EEZA 2IP4A 2DE0X 1Q5PA 3R9KA 4CTMA 4TKZA 4B8ZA 4MTLA 1GILA 1MTZA 2YOHA 4Z4GA 3T9EA 4RACA 1DC7A 5BVHA 3OFVA 4TM7A 1A7KA 5H4HA 1JFSA 3RODA 2J3EA 3VZPA 1FRQA 1GGHA 3O94A 5JISA 2P6UA 3C6MA 4M0EA 4L3WA 2IK8A 2O8EB 1VKOA 1WXWA 2O7QA 2VFAA 2WU0A 2BEWA 3EZYA 4D3SA 1F8GA 2DBZA 3ZJYA 4HGPA 1PR2A 4TTRA 4QGHA 4Y1GA 3IB3A 1VJ5A 1N2CA 4ZI7F 1QM5A 5BOSA 4D4IA 5KIAA 4QL3A 3PITA 4IM7A 4L02A 2PH5A 3OZAA 4AJPA 3VI4B 2EXXA 2QK4A 2VDQB 4G6ZA 4P5PA 2AMVA 3PRHA 3UJDA 1HQYE 3CG4A 4OXNA 1OBFO 1XKTA 3NHPA 1X70A 2QW0X 3NIBA 4FOPA 1AQLA 3O2SB 1LC0A 2PNJA 1JT2A 3NKLA 4X64B 5F9FA 3E9DA 5AI8A 2MSWA 2G06A 1CUJA 2E3JA 1L7QA 1N6KA 4BMPB 3AG6A 3OJCA 3RYFA 1HT1E 3VNUA 3V8VA 4YB8A 2D62A 4MHTA 1Y82A 1VJCA 4KRYA 3OX2A 5G0WA 1N34B 1NU6A 2ZIXB 5I45A 3TAHA 3NTXA 4K88A 1UQTA 2N75A 1ONPA 2O59A 3M33A 2R8YA 1SZCA 3DFIA 2H5JA 3HG7A 1GZ5A 4ID9A 2RG1A 4XJTA 1VPLA 3O8QA 4ZVPA 5AXCA 3S1LA 3BK2A 3ZDYB 1DQPA 5HUQA 3B7GA 3FMOB 1Q0PA 1RPNA 1JEOA 5F35A 4IILA 2AJ8A 3IMKA 4H7HA 1BFDA 1PWYE 2H7CA 3SR4A 3DTTA 3R3SA 1E69A 3WMWA 1Y8QA 3WL3A 3PUIA 2VHUA 2ZT7A 3L4EA 4NEGA 4V2UA 1N75A 3RT1A 4AIIA 3GB9A 3KJHA 3TQFA 1HDCA 1RACA 1E2BA 4DAOA 2X8WA 3VOAA 5F21A 1V5WA 1IEWA 2YWEA 4Z9XA 1XA3A 2R0QC 2ZWPA 3MYYA 4LNAA 1SWWA 3UKDA 5L3SB 4B3CA 1AS0A 1E5XA 1DUVG 2YZGA 3OZSA 3BJIC 3EHDA 2OCPA 3IALA 3OQIB 3N2YA 4OB7A 5IKPA 5BXYA 1N9GA 1U11A 1NZFA 3HYRA 1BWRA 4NE7A 4LF4B 1XDSA 4TL9A 2AVNA 2WTEA 2Y6UA 4MI3A 2CB0A 3SP1A 4DG5A 2GXAA 2HB6A 2EC5A 3I9NA 4TWBA 3EDMA 4UTZA 4NYJQ 5EJMA 4DA9A 3ZN2A 3CLVA 2P91A 1T43A 3VPAA 1ETUA 4CL2A 2PS1A 4MA5A 4D3FA 3THOA 1ZNQO 1P7WA 5CT8A 4B6PA 4UNIA 2HDOA 2OHFA 3DDCA 3PXBA 4BUCA 4ZOLA 1N7JA 3QSYA 2ZJ7A 1USIA 3AFHA 5FBZA 3KX2A 2Z98A 2J0VA 3M4ZA 3MUOA 3E5RA 2PKCA 2YFQA 3IAXA 3IPYA 3PICA 4JUCA 5HFAA 4EA6A 1TUBA 2D1TA 2P9CA 2J32A 1SK8A 4BV2A 4BS9A 4M9UA 4BNTA 3AEZA 4NS1A 4Q4HA 5DWQA 2XZTA 5DW3A 4LJ4A 2E85A 3RROA 3L4JA 2YKGA 2QN6A 2OLEA 2DPMA 3VHXA 1CDZA 2QAGB 2XZLA 2VA8A 3IR5A 4RENA 4PRYA 1B6GA 3N6XA 3CVVA 3UH0A 3KV3O 4D57A 4CMKA 4ZIRA 1CUXA 4J3NA 1DKNA 1S96A 1UPXA 3DBRB 4EKIA 3BMOA 3KKPA 4B17A 2ECPA 2R96A 1EGMB 1RHQA 2DY0A 4FCTA 4OP2A 4I6JA 4TRNA 3WDKA 3OPMA 1L8AA 4LQCA 5CXUA 5HRUA 3EXHA 3EDCA 4BEWA 1XAHA 4ZVUA 1VGRA 1U3TA 1VHJA 2GVDC 3R7FA 1Y34E 3EIQA 3OPNA 1YDHA 1MP0A 3WX0A 4EWLA 2OQRA 1VSUA 2YWJA 1A88A 3P19A 3OCJA 3WKCA 3R23A 4B45A 2P8SA 4A16A 1OR8A 1SCAA 1J7KA 3G59A 3ZDDA 1C3OA 2I1VB 4TN1A 4QBKA 1W5SA 5FPHA 1XRPA 1D1SA 3KK0A 2QAJA 1RAHA 4GMKA 3VDNB 3UWDA 4B1FA 3I58A 4HN9A 3GDHA 1Q84A 3S5JA 2I8CA 3L6UA 5T4HA 3TVTA 5JARA 2N42A 3C1UA 1G0NA 3AFIA 3KB1A 4HRXA 4OVKA 4MV6A 1DE0A 1ZUNA 4Y1RB 1XP5A 4ONEA 4F8YA 5IJWA 1OKKA 1CE8B 5TMDA 2B61A 3GLTA 4MH0R 3F7MA 1DI0A 1HYEA 1KORA 2NGRA 3LUFA 4BKUA 1FUEA 1JDUA 3JQCA 1TAHA 1SRQA 2I87A 3DEZA 1WOYA 3MBKA 3RQIA 4M9XA 3WDSA 1Z36A 3IDOA 1CZUA 1LLQA 1XVUA 3B2EA 1Z08A 1GKIA 4AF7A 1YBHA 3L9XA 2DBRA 2YWCA 3ZGNA 2X8JB 1XCOA 2ODTX 3AR8A 3LOPA 5KU1A 1OXXK 1NF3A 1P60A 3P0IA 2DPGA 4G2NA 3I61A 3ON5A 1GITA 1Z5NA 4BBZA 5JLJA 1OCEA 3EEIA 5AM4A 5E6SA 1JAYA 1PS9A 1HEIA 2NM0A 2XADA 3DUFA 3NATA 4EUHA 1TMKA 4U9HS 4UAGA 3GRYA 3LGAA 3QX7A 1R0KA 1AQUA 2FP4A 1JJAA 4WT7A 2CDBA 3LP5A 2PG3A 2ZJOA 5B58C 3TF5A 3IEIA 3BJZA 3G0DA 2PTGA 3GJXC 2J0UB 2NYUA 4L5JA 4PC7A 3GUUA 4WW0A 2P77A 4YGXB 1W0JA 3D4NA 5EJ9A 2VSNA 5KVCA 3Q85A 2XIQA 2AFIE 1IXZA 1DOAA 4P4TA 3A3YA 3UWOA 5GY7A 5I47A 4BEBA 3I3OA 1XMXA 1ETHA 2AB0A 3K1AB 4UKDA 5CXXA 2IH4A 1UL1X 1XNQB 4ZU6X 3JVVA 2NU9A 1W2GA 3T6KA 3VHRA 4H7KA 1LZKA 2YHIB 3FPFA 2IYFA 3C6BA 4C1NA 2J5KA 3A6ZA 2HL6A 2I4NA 3OCUA 3LVQE 2W98A 4QTZA 2VO1A 3ZU6A 2XT6A 5I7RA 1ICIA 2COEA 3GROA 2L17A 3KQSA 2ORIA 3H42B 3NGXA 4ZICA 3KQVA 1XX6A 2W4IA 1H4TA 2XUAA 4G01B 4LBYA 3ZXXA 1E2GA 2ZYTX 3AKDA 4MQBA 4YVFA 3HCOA 3KKMA 3U80A 3HVUA 2EU8A 1BO6A 2BM1A 2ZXEA 4AVYA 1QO0D 1IU9A 1II0A 4RMNA 4Y7CA 4A4DA 1BD3A 3C15C 5GVRA 5K09A 2HWXA 5CPBA 4DVJA 4U7DA 3KEGA 1V9SA 1E89A 3QNMA 4UM8B 3NT5A 2AW5A 4YUWA 3IA2A 5KUTA 1CJKC 2L19A 4I9GA 4RA9B 2NQ2C 2IXBA 3BMCA 1J9ZA 3ED1A 3BA6A 4LXHA 4XGRA 4B87A 4E5YA 2EP7A 2ZIWB 5E4TA 3ZY5A 4E2ZA 3Q8WA 4P53A 2GPSA 4IUYA 4ZYZA 2OZKA 2EBHX 2ACVA 5KNDA 4FE4A 4IH9A 3M5WA 4BO8A 1G17A 1FYFA 2GYYA 2QRKA 2V4UA 3REOA 4IG9A 1JTEA 1XDDA 1MN6A 2QSJA 2A9RA 3Q9SA 4F4FA 1HLGA 1NX9A 2Q5OA 1F2TA 3E7FA 4V0KA 5IVHA 1ZA1A 1J9EA 2BP7A 4I55F 3PQ2A 1BW9B 3K2EA 3LSTA 1LLDA 3OU2A 4HH3C 3S4YA 3ZWKA 4YQZA 1HE2A 1N0UA 1Z2DA 1ZI8A 3S1SA 3LXRA 3SPXA 1XZHA 1NJ6A 1O97C 2IOHA 2D3TA 1S2IA 1YVUA 3D3NA 3EY4A 3N8KA 3ND8A 4HAVA 4MGHA 1KOLA 4IDHA 1KRWA 3NHKA 3WNVA 1GTL1 1SBTA 1YI0A 2DX7A 2VZEA 4HRYA 1NVVQ 1UFKA 2J3MA 1XZLA 3ISVA 3QE2A 3T0IA 4KP7A 3USCS 3K0EA 1CRZA 4Q24A 1MH1A 2V55B 3RVDA 4C3UA 1LDEA 1ISHA 3V8QA 4FYMA 4UC0A 4Y2YA 2PU5A 1ZUIA 2FQYA 3AHGA 4IEEA 2QVLA 1K5PA 3E1KA 4I46A 1XYVA 2HLPA 1GKKA 1B8NA 1MHPA 3LKBA 3QK7A 4DV2B 3LCJA 3LSYA 5A05A 4CVNA 3QVGB 1WE2A 3LFUA 4MQUA 5DTQA 3U9SA 3OSZA 3KSBC 1CJVC 4UMFA 1I3NA 1U7UA 2J3LA 1T9GR 4QRDA 3SS9X 4JLNA 1EVKA 2ODWA 2C4UA 1K3TA 1Y5LA 4CKEB 4DQDA 3R6DA 4RHXA 2WDZA 3GLKA 1H8ED 3RARA 3HS3A 1NWHA 2IVZA 3GHYA 4FC6A 3W5IA 1HR0B 5JJKA 1MAHA 3QU7A 3SF0A 1DKRA 4LI0A 5DN9A 4C6HA 3W5BA 1FP7A 2I2WA 4G8DA 1YRYE 5J43A 2R68A 3D3KA 1U5BB 2ZJYA 4HNSA 4DDHA 2IYAA 2O8DB 2JFNA 4QUEA 4RK0A 1SH7A 1GEEA 2FSVC 3VPXA 3FWNA 4NQZA 1P1BA 3MOSA 5E6RA 3QXSA 2Q62A 4WCFB 1V9LA 1E1DA 4MEJA 1JPNA 2BRUC 4MS4A 3PVCA 3CLRD 1Z9BA 4GSKA 4B81A 5BR4A 2NO1A 4LOKA 3E05A 1GQ2A 1XXHE 4JUDX 1KYZA 4MI6A 3W90A 2F3UA 2XUJA 3KTFA 2Q0SA 5EKUA 1PO7A 5E2IA 3VH1A 2ID8A 3Q11A 2BEVB 4KDCA 1KMHA 2M6SA 2C4WA 3QX3A 3EIFA 4GRIA 1Q1NA 1QO9A 2J0SA 3A1VA 3LPNA 3EZNA 2A9FA 3QRWA 1C0IA 3GFPA 5HJ7A 2RFLA 4B3BA 3GRVA 3HDGA 5AK5A 1H8HA 3W2IA 2XCQA 1Q16A 5K2MA 1X8LA 1GRQA 1A2KC 4W5WA 2YY5A 3IBYA 1XCBA 4CDGA 2QMEA 2AG8A 1YVDA 3GF4A 1RYYA 3AF5A 3IVAA 2DPHA 1B8OA 1FTYA 1U90A 1WVGA 4KO3S 1Z5GA 1NYTA 1UKYA 1C4KA 1O6ZA 2EL9A 2FY8A 2WSYB 4KXNA 4QBGB 1XKXA 1N5IA 1W93A 1E1KA 1YQWA 2PAAA 1EDEA 2WJ6A 1MQ8B 2RH9B 4W1PA 2O1XA 2I3BA 5ILGA 3KC2A 3HVIA 3CINA 4CKCB 1IXRC 2JD1A 2JGDB 4MUIA 3L4BC 5K4GA 2VTKA 1MVOA 5A4IS 3SBXA 4RK7A 2GN1A 3D02A 3MUNA 2Y2VA 1NHGA 1TCUA 3Q1LA 1MRZA 4HDRA 2Q3LA 4LJAA 4BYGA 4DR3B 2I03A 4U6SA 2AFHB 4W5HA 2FSVA 3K8OE 1WDLA 3NORA 4EGQA 1NPYA 1ZM2A 2IHZA 3FGPA 3TLGB 4BX9A 4DNOA 2R66A 4DNQA 1E6KA 2YWRA 4KC0A 5CVDA 2COKA 2BRUA 2VBIA 1UEXC 3RTAA 3G2JA 4RLSA 2J8ZA 3QOYA 1SD2A 4JNKA 3P8ZA 2DEUA 1R6UA 2P78A 3U3OA 3P9SA 3DLHA 2RI6A 3DWFA 2OM6A 1DAIA 5C18A 5FL3A 1JE0A 5JU6A 1QLHA 1LPBB 2F62A 4MVJG 1KEZA 3E7XA 2O8EA 4ON9A 1CDEA 2FEKA 4LOHA 5CA1B 5JAPA 1JU4A 2PQMA 3IEXA 2C8JA 4DUGA 4N41A 1E9EA 4H6PA 1WZ2A 3JTMA 3CVJA 1SU4A 3R5KA 3TZBA 1KC3A 4JSTA 5DB4A 5A5DA 2ROQA 4LJ7A 4D0NA 5JMTA 1O89A 1X15A 2NO6A 4PO9A 1U8XX 3F5DA 2VCHA 4NH4A 5A6SB 5E1OA 2QT0A 1SC3A 4JI7B 1TU3A 2WT8A 5A1TA 4FSXA 1B93A 2UDPA 3ABRB 3CF4G 2C0QA 2CLDX 3D3QA 4IQ8A 4RY9A 4KDRA 3D1JA 3K16A 5CCEA 4YP7A 3L04A 4B71A 1JHUA 3H1BA 5KX5B 5E1BA 2R25B 3FD8A 3C3JA 2FWBA 3OUUA 4GMDA 3U5ZB 2ZIXA 4F4UA 3FI0A 2Q1YA 3ZBUA 3P2EA 3R76A 2GARA 5DX8A 3AXTA 3K20A 3UTDA 1AK1A 1C3LA 1PNRA 2ZU6A 3GP5A 1WP9A 5HDQA 3L4BA 1A5SB 3NRBA 2VA9A 3UPTA 3WQBA 4I5FA 2QM3A 3OLVA 1LTQA 1NPTO 1L5HB 3TD9A 2QAGC 3U3DA 4A2PA 1U2EA 2MIIA 2ZI5A 4CLRB 2ZBVA 5DI9A 3P9IA 4H35A 1V7QA 2W0MA 3AI7A 1FDUA 1GZUA 1YT5A 4YCBA 5BSTA 4DBZA 2EEPA 1OHHA 4L3OA 3EZXA 3PNKA 4M7WA 3U48A 4BBAA 2I9KA 1QVZA 3TDMA 2MR5A 1VLJA 5HQTA 4S35A 4CV0A 1AS2A 5C5CA 4NMXB 1E9DA 1AN0A 1IDN1 2JFYA 3A9CA 3AUYA 2EATA 3QVSA 1G21B 1G63A 3VPSA 3W0LB 1GPKA 1QB8A 5G40A 3TK1A 4DIBA 1DADA 3OQIA 3CU5A 4OHVA 2UUAB 2VPTA 3AUKA 4IIVA 3JS5A 2GBPA 2JC3A 1IJFA 2BJWA 2HWKA 4G5SA 4QYTA 1XELA 2P2CA 3KVNA 3V4LA 1ZEJA 2VJYA 3JALB 1LLUA 1NP6A 2ID4A 2X9NA 3DHWC 1H1DA 3J7TA 1OB5A 4BB9A 2J0EA 5F2OA 4ZOLF 3HGTA 3N6RA 3DMFA 4ISBA 1B8PA 1Y4ZA 3NBXX 1NJFA 1SCNE 1ZGZA 1SU7A 3CZMA 3MAJA 1Y33E 1NI4B 3FPCA 2FWPA 2IGTA 2R84A 4AYWA 2IH2A 3B8HA 3KHSA 2CNWD 3VVLA 4ZHSA 4HWTA 1NUUA 3S2UA 4H16A 3GUYA 2XCOA 3L8HA 4IKEA 5COBA 3WWOA 1VLLA 4KGZA 5NULA 2M98A 2X76A 5EZQA 3EUWA 4M4SA 5CCBA 1E9CA 3O47A 2O2YA 4N5HX 4UTOA 3R0QA 3ZI7A 4MDFA 2D5CA 3FKSA 4LN1A 3OJ0A 4NX2A 3X1MA 1PGJA 3UMVA 3CVYA 2ZJAA 3N1UA 5TVKA 4V3CA 5AK3A 4HYTA 3GLQA 3P7MA 1QZUA 4MVJF 5DSTA 3TZQA 4BQFA 4DVGA 2IBMA 1KVRA 1SR8A 1NQOA 2KQUA 3H86A 2QAGA 3KPJA 4NYMQ 4MIKA 2YZKA 2H1RA 3GQBB 3HJRA 4PG5A 2Q5FA 3WG9A 4E0BA 3ETJA 3FFWA 2ZSHA 1P0FA 2DQKA 1AQYA 4GECA 5COQA 4QNRA 1T8TA 5AI0A 5EE3A 4JXXA 4UXHA 2I54A 2OFXA 3QH4A 3B60A 4OHPA 7YASA 3RSZA 4NECA 4PLFA 2TS1A 821PA 2LE0A 3GUZA 3ZGXA 4HEQA 1OU4A 4FTWA 2BZGA 2H54A 1ISIA 1P33A 1PJ4A 1P1IA 2W71A 1N6OA 2O0HA 3NG1A 5BORA 1MJFA 2IPMA 3VOBA 5KTMA 3MERA 3IEPA 3TE7A 1AXRA 2AJTA 2OSVA 1AKQA 2WUDA 4FN5A 1T9KA 3U56A 5MHTA 2A5YB 2XYHA 1VYTA 2GMWA 1HL7A 2O2EA 4HVTA 4UU0A 3RR2A 1M5TA 1AA6A 1VE5A 2BMFA 2FMTA 4ARIA 1CP3A 3NRJA 3I52A 3C70A 1FS6A 3NWPA 2M1ZA 3FMVA 2X42A 4PQYA 5JSYA 4Y1RA 1DPGA 3F4BA 2M2IA 1TM5E 3E53A 3W8EA 3I9FA 4YGYA 4BTVA 3A9RA 3GJ4A 4J9UE 2VP3A 2FKNA 3RIYA 3KLMX 3IGFA 1E2JA 4FYKA 3GUCA 1ZL0A 3WBJA 1VKRA 4NG5A 4ZT3A 3R7LA 3RO7A 2Z4RA 3O8DA 5J4VA 1E5DA 2KM1A 2PMKA 3A4VA 3QWBA 3WMGA 5CJJA 3O9ZA 4GL4A 4IFIA 2CVHA 4Q3OA 4PHCA 4R98A 3W1VA 1LLCA 3KUCA 1UPCA 3LL7A 1P61B 2WF9A 1YTUA 4LXXA 1NQTA 3THXB 1RXWA 1N33B 4BLQA 1EBUA 2X8JA 3OM1A 4LZLA 3HNOA 4B9EA 2C04A 3NEPX 1M2HA 4JHLA 4LZOA 4DCGA 2JATA 2PL1A 4YRNA 2IPXA 5KEIA 1OGIA 5IAGA 1FYXA 2OENG 4MKZA 4EKGA 4NQRA 3V8BA 4ZV9A 2VUSA 4LJ8A 3E8XA 4L9WA 3B9RA 4DIKA 4D6YA 3NBAA 1MO5A 1QQ6A 1JBQA 2PKYX 4OJMX 5C1DA 3P2JA 4MW1A 2QSYA 1FFDA 2B4KA 1OTYA 2PVSA 2QUJA 4PIPA 3KXKA 2XA9A 1ZMTA 1NR1A 3ODGA 2J0UA 2YZNA 5ICFA 3T1HB 3WJ7A 3W5AA 4KLCA 1ISSA 4RPKA 2XMZA 4QXQA 4CIBA 1QIFA 5DBEX 1DAEA 4HB3A 5GGYA 1K08A 4YT2A 2ACKA 2WV7A 3DEFA 1T8WA 4RU1A 3A1TA 4WDRA 3CJTA 4IX1A 3T7EA 3OSUA 2TMYA 3Q7SA 2GA8A 2YHIA 3GCDA 2FWMX 2WE7A 6REQB 2FTKE 5JCXA