4LE0A

Crystal structure of the receiver domain of desr in complex with beryllofluoride and magnesium
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
132
structure length
132
Chain Sequence
MISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein DesR
publication title Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Dna binding protein
total genus 47
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4le0A00
1RZRD 2NT3A 3N0RA 4MQFB 4W5RA 4PICA 5JNVA 1PNRA 3KLOA 4UHKA 3RQIA 3L49A 4XLTA 2J48A 4H60A 1SRRA 1RXIA 1QMPA 2FKAA 4MS4A 4TMYA 3HJFA 1EWTA 1LBIA 2MYUA 5CNIA 4XASA 2PUAA 1E2BA 3JVIA 4LDZA 4OG2A 3H75A 4MPTA 2HPHA 3G85A 3QX9A 4RU1A 1FFGA 2ZAYA 2MSWA 1QKKA 1PNTA 4RSMA 1QO0D 1AB5A 2CWDA 3M6MD 4YR7A 3TB6A 2M98A 3OLVA 5TPZD 4ZYLA 4N76A 2L19A 2E4WA 3FDFA 3SQNA 1U2PA 4H3KB 3UUGA 4EYOA 1Y1LA 1MVOA 1QQBA 1CYEA 1JF8A 3H6HA 1SD5A 5FWXA 1Z18A 3RVRA 1JFVA 5IEBA 1GCGA 3HDGA 3GWGA 3QK7A 1YMUA 4O5AA 4RK1A 4IILA 2QXYA 3HK2A 4WWHA 2FEPA 3S99A 1YVUA 4IGAA 3LUGA 5IULC 4Z99A 4W5OA 3OLZA 3H5VA 5E3JA 4JB2A 4QPJC 1MIHA 1JHZA 1TM2A 3N53A 3L6UA 3E61A 5CHYA 4MR9A 1M2EA 4NV3A 1DZ3A 4D6YA 1ISRA 1OXBB 5T7BA 1LBHA 2GI4A 9ABPA 3JVDA 5KQPA 1NXXA 1EAYA 2RJOA 3CG0A 4MS3B 1BVHA 3Q7SA 2H0AA 4IF4A 3NNNA 1VRVA 4MR8A 5BQ3A 1XWWA 1J56A 1DBQA 4H3HB 4MR7A 5JNUA 2VK2A 4MS1A 1C0EA 2FMIA 3RVMA 4EYGA 1H9CA 5CNMA 1PEAA 2FSPA 5D2CA 4YP9A 4MRMB 4RY9A 4O1IA 2FQWA 3EDCA 4CBVA 3P9YA 4LE1A 3GBVA 2FMFA 2RJNA 3N75A 1DBPA 3DZDA 2QR3A 4ZMRA 3Q7TA 4TLMB 4WT7A 5TQ0B 2FEKA 3IP6A 1RPJA 2IPNA 3OQOA 1P6QA 1CHNA 3H1GA 3KYIB 2PL1A 3DGEC 5TPWB 3QLTA 1Z25A 3O74A 4RS3A 3BRSA 3OQNA 3GBPA 1DC8A 3CZ5A 2JVIA 1FFSA 1Z2DA 4RDCA 2IKSA 3H5WA 2IOYA 3RVSA 1NXTA 3T95A 4LZLA 1DC7A 5BR1A 2MYNA 4RV5A 3D02A 3N6VA 1YS6A 3RVNA 1YS7A 1CEYA 1I3CA 3HZHA 2PJUA 3OM0A 4KMRA 1ZAYA 3IDOA 3JS5A 2HSGA 6ABPA 1W9HA 4P1ZA 4RK0A 2F8SA 4Z4EA 1RZRA 5B3JA 3LUAA 1EWVA 1DCFA 1DRJA 3KG2A 4L85A 1F4VA 2H3HA 2LPMA 4KNYA 3A0RB 4QYMA 2R48A 2IYNA 5DKFA 4F3TA 3QLUA 1DBWA 2R4QA 2ZWMA 3CKMA 1JYEA 1LK0A 3LUDA 3K9CA 2IPLA 4G0YA 1QP7A 1USGA 2X7XA 2WB4A 3FFXA 4RY8A 2PMCA 4WXEA 3SAJA 1KMIY 1YMVA 4KREA 3OQMA 2WJAA 4F12A 1LJLA 4NQRA 4EY3A 2DRIA 4PEVA 1QO0A 2A9QA 1YK1A 1E6MA 2Q5CA 1P8AA 1T34A 5FWYB 2A9OA 3NHMA 1SXHA 1E6LA 2FQYA 2PLNA 1JYFA 3H5IA 2LUOA 3N0WA 3Q9SA 1VPWA 4RXMA 3QX8A 4EGSA 5EWJA 3TD9A 4PZ0A 4EVRA 3CU5A 1JX6A 1XHFA 2A9PA 3C6QA 4RXTA 2FQXA 5HQJA 4TN5A 1A04A 3KTOA 3CHYA 3IPCA 3ILYA 3OMWA 4KV7A 4N47A 3H5OA 4ETMA 3CNBA 4NICA 4E7OA 5KQLA 1BDHA 3M9XA 3SY8A 5KC9A 1JBEA 1NATA 1L5YA 3TMYA 5DCLA 3EGCA 2LIVA 3KLNA 4N0QA 2L17A 4KK3A 3F7NA 1EFAA 4P98A 1B00A 1RNLA 3QLVC 3T6KA 3W9SA 4MS4B 1JDPA 2NT4A 2M1ZA 4YCSA 4LE2A 1Z17A 4D6XA 4Z0NA 3EQ2A 4M88A 3QEKA 3LMKA 2PAFA 3OM1A 1P6UA 5B3JC 1D1QA 4KK4A 2RGYA 4EVSA 4Z9AA 2MSLA 1ZY2A 2OQRA 2VUIB 1NXVA 1E6KA 1YIOA 3QLUC 3HDVA 4MAAA 3IP7A 5TPZA 5ABPA 1ZVVA 3O1HB 2WWVD 3CTPA 4HNQA 4YRZA 5FWXB 1LJUA 2HQRA 1OXKB 1U0SY 4XARA 2CHEA 4LRQA 1APBA 3O2SB 4Z4CA 2AYXA 4RWEA 3JY6A 4Z9BA 3HSYA 1DRKA 1JWLA 1Z15A 4N03A 4B09A 3C3KA 1TVMA 1Z26A 3M9WA 3IPAA 4JAVC 5HSGA 1R8JA 4G0PA 5GQSA 1ZHHA 3F73A 1F51E 4G86A 1W25A 4LX8A 4MQEA 1PHRA 3CZCA 3H1FA 4IRXA 4MR9B 1NXWA 3HV2A 3NNSA 3OO1A 3RVJA 3GL9A 4E7PA 3TX6A 2QU7A 2MYPA 5IUJC 3F6PA 1QNLA 4FE7A 5JNRA 1GUDA 1JDNA 4RKQA 4JA2A 3HO1A 3I09A 1DCMA 2QVGA 4ML3A 1XHEA 3DLHA 4PYRA 1QQAA 3IP9A 4MR8B 3N0XA 5JNTA 4KFCA 4MR7B 4D74A 1P2FA 4MS1B 4OATA 4KVFA 1A2OA 1NXSA 2JBAA 2MSKA 3O1IC 4O1HA 4QICA 2PUDA 3MF4A 4MYRA 3GA5A 5KC8A 4EUKA 4KRFA 2XDYA 4MGEA 1M2FA 2KYRA 1JFTA 2PUBA 4HNSA 2QV0A 4DN6A 1ABEA 3I5AA 1D5WA 3O21A 3HS3A 5KI6A 3IP5A 3HEBA 2ID9A 5TE9A 4OBBA 2W42A 2JBAB 2VYCA 4YLEA 2WY2D 1YK0A 3BILA 1DCKA 1NXPA 1KRXA 4IMJB 1U2QA 2WMYA 3ROFA 1BDJA 2E4VA 3JPYA 5IEJA 3ILHA 1Z2EA 5IC5A 2L2QA 3O75A 2IPMA 5EWLA 4JOQA 3GRCA 5GOTA 5CNJA 2F8TA 1D2AA 4RK7A 1QPZA 2GX6A 4RXUA 2E4XA 3H5TA 3CFYA 4TLLB 2PKXA 4GNRA 3A0UA 1A0OA 1NY5A 3C3MA 3BRQA 3MYYA 4Z4FA 3CLKA 2YHBA 4F8JA 3EJWA 3K4HA 3FMVA 1M5TA 2QZJA 5JS1A 1K68A 3FFWA 3GYBA 2PUFA 3O2JA 3CRNA 4N41A 2R25B 5EWMA 3MMNA 4W5TA 4G0ZA 3UKJA 2GBPA 2CD7A 5TQ2A 3QEMA 5KQGA 3DBIA 1DP4A 2P9HA 4FE4A 3SG0A 3QELA 2LBPA 4ZJPA 3UK0A 4JP1A 5FBHA 4XFKA 2R47A 3FFTA 5JNSA 4NCBA 4KPYA 1GLGA 3LOPA 1TMYA 5EWJB 2IPAB 4WZZA 1KRWA 1ZN2A 1VLZA 3EQZA 5BRJA 3QEMB 2QSJA 4Y9TA 5C5EA 2JVJA 4NCAA 4ZPJA 5IBQA 3HCWA 6CHYA 3QELB 3VNAA 2PUGA 3N8IA 1ZESA 3NHZA 4W5QA 4MLDA 4XAQA 4Q7EA 3OLYA 2L18A 4IMIB 2HJ9A 1ZGGA 1HEYA 2JB9A 2OENG 3RH0A 4ETIA 4F11A 1YTUA 3A3KA 4FB4A 1C4WA 4YGXB 1ZH4A 3Q7RA 3RVOA 3HUUA 4DQDA 2GWRA 3KJXA 2N9UA 4Z4IA 2LP4Y 5DLEA 3SNKA 2P4UA 3T8YA 4S05A 1M5UA 1JL3A 4OTZA 1PEYA 3HUTA 3RVQA 1SXGA 2MYTA 3HXMA 4G0MA 4RY0A 1K66A 1MB0A 1NXOA 4XXHA 2I6FA 2PUCA 3R0JA 3T38A 1S8NA 3LFTA 5FBKA 2WJWA 4N0PA 5JS2A 4Z4GA 3SM9A 2QVCA 4ETNA 1IIBA 3G1WA 3C3WA 1ZDMA 1RXEA 3B2NA 2NZUG 4LDAA 3KSMA 1NTRA 4RK6A 2FEWB 1BDIA 1ZGZA 3I45A 4RK5A 1QP0A 1EHCA 5HM6A 5I4CA 1L5ZA 1TLFA 1Z13A 2FLKA 1DJMA 1USKA 3O2QB 4HNRA 1USIA 2V0NA 4JASB 3A10A 2CHFA 3H6GA 3LKVA 1JFSA 1UDRA 3BBLA 4JB0A 3KYJB 5CNKA 3H5LA 2PE5A 4MS3A 2A9RA 1BA2A 3ROTA 3LKBA 2JRLA 3LUHA 5IUNC 3LUCA 4RKRA 1Z12A 5C5CA 4EVQA 5JNWA 4G97A 5IX8A 3VNBA 1FFWA 2QW1A 4KQCA 4ZMSA 4MQEB 5T3YA 3NBMA 4MRMA 1MAVA 4KZKA 2FVYA 5DTEA 1ABFA 3OLXA 1D1PA 5HKOA 2YHAA 5KWSA 4OLBA 3Q15C 8ABPA 2PUEA 5IUKC 5TQ0A 4LE0A 4Z4HA 2GKGA 4G0QA 1WETA 2FLWA 3GV0A 1TJYA 2VUHB 2HQBA 3BREA 2PL9A 5TPWA 4S04A 4OLAA 1PUXA 3D8UA 2TMYA 3E3MA 2FN8A 4WXMA 3CG4A 3JPWA 5TQJA 1ZITA 3LTEA 3CS3A 3KS9A 3GT7A 4UHJA 5F64A 2IDMA 3TO5A 5ED4A 1QP4A 2ID7A 4KQ9A 5PNTA 1BAPA 2AYZA 4WUTA 4G0OA 4HYEA 3F6CA 5DGCA 4MLCA 3RVPA 2NUBA 3MIZA 2BGGA 3FGZA 4EYKA 3O1JC 3H1EA 1MB3A 2JCGA 1FSPA 3LUJA 1EWKA 4Q6WA 2B4AA 2NZVG 1AB6A 3I42A 3QLVA 3JTEA 4YV7A 1ZH2A 4DADA 4YWHA 2E4YA 4EYQA 1GUBA 2FXIA 2B1JA 3OMXA 3HVRA 2FW0A 5EWLB 3DLBA 4RK4A 3URMA 4RZSA 1JH9A 2JK1A 3NNDA 2E4ZA 1Z16A 2RDMA 4YO7A 2O20A 3MA0A 1JLKA 7ABPA 2FN9A 3RVLA 3OO0A 4Q6BA 1FQWA 1U04A 1URPA 3Q41A 3EULA 3OLWA 2HQOA 4YS6A 4L4UA 5FWYA 2E4UA 2JVKA 3KHTA 2FTKE 3HM9A 4W5NA 3DGFC 3KKEA 3KCNA 1GCAA 3MQ4A 3EODA 4G0XA 2FMKA 3RVKA 4MQFA 5EWMB 1U8TA 2WRZA 5KQMA 1D4ZA 1DG9A 4GPAA 4F06A 3MM4A 4QYWA 4PE5B 1VKRA 3C97A 3LUFA 1KGSA 3EAFA 5TQ2B 5BRAA 2FMHA 1SXIA 3LUKA 1ISSA
chains in the Genus database with same CATH superfamily
3ZGNA 4AMZA 2L82A 3KXPA 4TQUS 3JQBC 2BEUA 3WBKA 2HB6A 4OD0A 4XB1A 2PGLA 1JFFA 1M2HA 3IOCA 2J5KA 4UHKA 1MFPA 2DY1A 1FLVA 4BEJA 1KC1A 4RQAA 4E46A 3OJFA 1RABA 2PHZA 1NAHA 3AY7A 4QECA 2WSSA 5TVGA 2D5CA 2XGSA 3N9IA 1MV5A 1AGRA 5FOXA 3SZLA 4WVLA 4WNIA 4FWTA 1XMVA 2D74A 1FJ2A 1IIRA 3WXBA 2QJTA 2G5GX 4WBNF 4H1WA 4INOA 4CFSA 1UJ5A 3FCOA 4L57A 3EUAA 1MAAA 2HNKA 2VQDA 2WFAA 1N4DA 3INNA 1DVRA 1DKLA 1JU4A 1NT2A 2HLDD 2O0JA 2WVGA 1XTBA 3HU5A 4IXDA 3E8MA 3ZYZA 5HS6A 4X7MA 4BCCA 2YC4C 1G6KA 3LHKA 4HNHA 4QO7A 4HGRA 2B6NA 1C4XA 3ONDA 4HTAA 4O5AA 4R8KA 4B76A 2QXYA 3K8ZA 1AH2A 1UJBA 3KOOA 4TRRA 1BN7A 4FKZA 3EOZA 5EJ4A 1QR2A 3CQ9A 3AHHA 5HJ2A 4LBYA 3FPAA 2EFJA 3ZY5A 2ZSBA 2RH9B 1JN0A 2QVXX 3NDRA 5A7HA 3ZE2B 1E1RA 1NYTA 3FZYA 4HYTA 4NCXA 4JB2A 4BQQA 2RMKA 4Q47A 1JHZA 1I1OA 3QX7A 4A2PA 5J59A 3IPRA 4AB1A 4DR5B 1CIPA 3ZJYA 3DLAA 3ED1A 4HADA 1YZLA 2R8PA 2BR3A 2XYRA 2J3IA 1DZ3A 4MJLA 1MMFB 1GN8A 4P4SA 2W0MA 1LBHA 5HGJA 1A50B 4CT5A 3N58A 1SHTX 4NS1A 1EAYA 3L8EA 1GPYA 3GZTB 3E8SA 1FF9A 1ULAA 3EBOA 3WQRA 4AM8A 2P2SA 3DDZX 1YVDA 4B3RB 1X3SA 3WYFA 3DKKA 5JCJA 2CW5A 5FWAA 3Q8KA 3QH4A 2OCLA 3BPSA 4FDTA 4F4CA 4B2YA 2J0QA 3RFTA 1X15A 2ORIA 4YP9A 3L1KA 1J1UA 3SOPA 5DISB 2H08A 2X2OA 4BB0A 3ZGZA 3L4BA 4FKBA 1XAGA 1DBVO 4EPVA 3NC4A 3QVOA 4CMKA 1ESMA 4NOKA 3E81A 4D56A 1DXOA 1OYVA 2G4LA 4L02A 1FJGB 1JR3A 2GJ9A 2K6GA 4NMMA 2Z09A 2YVKA 1OFUX 5DZSA 2NTEA 1Z25A 1DFIA 4G5QA 1E0SA 4OP1A 4R84A 1Z38A 3MTIA 3KAJA 1ZK3A 2JVIA 1XRSB 2EGHA 4JA0A 4LZLA 2Y1XA 4DMHA 1DC7A 2JI9A 2FCAA 2UYYA 4NOJA 3O9ZA 1G3RA 3HB9A 1KZ7B 4DC1A 2WSBA 2ZJ2A 1W87A 1XZIA 4NYJQ 5E0KB 3SZ3A 1K5DA 1T36B 1X1AA 2B5OA 1G16A 1GGEA 3KKMA 1QH1A 1ZCAA 3FBWA 4JBHA 4M9XA 2Q6TA 2HMWA 2Z57A 3H11B 4E5SA 3LT2A 1OFUA 2B36A 2FWPA 3E9MA 3MK31 4ZGWA 9GPBA 5JY6A 2CZQA 5LZ4A 3KG2A 1XAJA 4F71A 3TSYA 2QHXA 3PGKA 4QX6A 1VSBA 5DW3A 1LBSA 4JR2A 1B6SA 2IOQA 3N8KA 4BB6A 2GM3A 3EZFA 5AI8A 3NDIA 2PWZA 3ZH2A 3CMCO 4BFCA 5BQ5A 5BN4A 1QP7A 3B6ZA 3DDHA 3GNSA 1WDMA 3ACDA 1HEUA 2J59A 1D0IA 3N07A 1DTSA 3SJZA 1JAYA 3UEOA 1GL3A 1RQXA 1XA3A 4GOMD 2ARKA 4P5EA 2YHIB 3DQPA 3RYIA 3ZV4A 1IAQA 5FUMA 1EP9A 3DMNA 1HDGO 1YK1A 3PL1A 1XZDA 4OKSA 3IVRA 1MV8A 4C3OB 3CEHA 2A9OA 4EGAA 2PY6A 4R8RA 5E95A 3TAUA 1JYFA 4BX8A 5JJKA 1P5FA 1OWLA 2G9QA 4RL4A 1V3UA 3QW2A 1RZUA 2JI6A 2CEAA 1O9HA 5E6SA 5EKSA 1ETUA 3C6QA 4Q3LA 3ZIUA 1WOYA 2N3ZA 3EAGA 1BFKA 1CNMA 4Q9NA 3OMWA 1Q7RA 4N47A 1DOZA 3PXAA 2CLLB 1C1XA 3M9XA 1YUMA 3C3CA 4F4FA 1P7ZA 4UOEA 5JI2E 4J1QA 5AVWA 4GSYA 2O3RA 1YD7A 2FFBA 2W22A 5KDDA 5E7JA 3F7NA 2QN7A 1EM8A 3T7IA 3GP8A 1V8ZA 3OQIB 3NT5A 1KQFA 1YZ3A 4AZVA 4ZTBA 4XRRA 1QVAA 1ZNZA 3R3SA 3VNUA 1JDPA 5EE9A 4AIRA 5KYTA 2O8DB 2A5YB 2WLSA 3KSRA 4AY3A 2H63A 2V98A 3JR7A 2EU8A 2I4NA 4KLRA 4MWEA 1RJGA 2QL9A 3OKFA 1OU4A 4KKVA 5SY9A 4XLLA 1H3FA 4BO7A 2HQ1A 2TMKA 1KY5A 1HNXB 3V8QA 2J6CA 2WF9A 1E61A 1QIFA 1XKXA 1GWNA 3JZDA 5FB3A 4M1OA 1N32B 4MYSA 4NSNA 4TTPA 4YFYA 1F0PA 3K70C 1WABA 2AFRA 5LYJB 2C8LA 3TCNA 1JEEA 3GGCA 2ERYA 2I22A 4TV9A 1VJDA 2JCXA 1AU9A 4BV2A 2QG9A 4G2NA 1KBZA 4MDEA 4OGFA 4Z4CA 3ACCA 4CM4A 5HUQA 3ESAA 2AG8A 1P7VA 2FOLA 3G2JA 4K40A 3WLQA 1K6IA 1JYSA 1YOVB 5IJ9B 5LB4A 3RG8A 1I5RA 3WNBA 2VTKA 1F6WA 1TVMA 2NM0A 4JVMA 1XDGA 5F98A 3FBTA 1KAQA 2EGUA 3HWRA 4XOUA 1IONA 3E15A 3FPCA 3AR5A 4FYVA 3VOAA 4C01A 3M6FA 1EA5A 3CNQS 5EJIA 1XTVA 4G86A 4JLJA 4MQEA 2JFYA 1OGJA 3KOUA 3CZCA 4MR9B 1BROA 3RS8A 3URKA 3IBFA 5ERXA 1UDCA 3VR1A 2OV4A 2O7SA 1GDDA 1QNLA 4FE7A 4R51A 4CF3A 3L6OO 2K7ZA 2QQFA 4JA2A 4PINA 4X9XA 3ZY6A 3DFMA 3DNFA 4QOHA 2VRWA 4M8IA 3DLHA 2OY0A 3KBOA 1Z22A 2VAXA 2BC9A 4GOND 4BDTA 1P9WA 3BM5A 3MTAA 1U6KA 1VIVA 2ZCJA 1GUYA 3ZLVA 3WGTA 1X7ZA 4C06A 1XP5A 3FDZB 1S01A 3KU1A 2VJDA 1A5BB 3I9MA 4V0NA 1D1TA 2W6MA 1EESA 1MPXA 1YH3A 3GJYA 2XDYA 4CG0A 2YTZA 4FR2A 4YLYA 2P0EA 1GCIA 3K30A 2XB4A 3NPAA 3OPYB 3ONFA 1BC5A 2VYQA 4LJ4A 1K6MA 1DKRA 4M1ZA 3IP5A 3PNKA 1X74A 1UBLS 4PXYA 5M29A 1Q15A 1A8UA 1E2JA 3IQHX 1N0HA 2B2NA 3BK1A 3WV5A 1EGHA 3ZD8A 4FUTA 1SHZA 1VL6A 2XMGA 1VBMA 3JU3A 2CDBA 4R6XA 2HHJA 3I6QA 5AJWA 5GP1A 2J7KA 3QIAA 4IIFA 1XOIA 2NVWA 4EQZA 3U4QB 5IC5A 1TZBA 1EI9A 1K8XB 2O6HA 1FU8A 1WB9A 4UCWA 4QUHA 3KJQA 2FRXA 3KR1A 3FIJA 2RB4A 5B1HA 1G3MA 1ZHOA 1I4OA 2HGZA 3QKWA 4D1YA 1SVLA 2JLRA 4N0DA 5FFFA 5ULLA 4O3FA 4XUDA 3CLKA 2DJ5A 5C7YA 2CMDA 4AX4A 3CH7A 3JYHA 3AVQA 2B9VA 3COZA 4QPDA 4X6XA 2DP4E 2JFFA 2YINC 4MUNA 5FQOA 4DT1B 4JEMA 1RW4A 1SXJB 3E7FA 1EK0A 1V11A 4KQEA 5JYBA 3ADBA 2WB2A 2QL6A 1DX4A 1L5MA 2BSAA 3H04A 2Q41A 3SF0A 4IEFB 1ATIA 1V5EA 3GD7A 1MJNA 2QSUA 3F67A 3U3OA 1NN5A 1U8XX 2XDWA 2P30A 4OYRA 4GP9A 3A2MA 3E9EA 1BEEA 2CD7A 1J49A 1YQEA 4GUDA 3DCJA 4DQXA 3EHEA 4AXBA 2GERA 3WHPA 2O1WA 4B0PA 1TO2E 3U44B 1OAAA 1WG8A 2Q6KA 4IGKA 3VDQA 4LHWA 1XDWA 3N1UA 3ZIAA 4WL0A 1E1LA 4ENTA 2HYIC 3K2EA 2PZEA 3NHFA 3VRHA 2QJWA 2JIQA 1R0KA 3NVMB 4WQMA 4LOIA 1EX1A 2OG1A 2Y1OA 4HGZA 3WG9A 3K0BA 1CETA 3JQPA 4DABA 1SQGA 1TJ3A 3WX0A 1LLQA 5BURA 4M0MA 4UNQA 4RQUA 1XTTA 2CC2A 2A5GA 2JVJA 3KD2A 3EIOA 3K73O 1KJYA 1FUIA 1EK6A 3H9QA 3AI7A 3PJDA 1XSEA 1ZWLA 2WYWA 3NHZA 3B1YA 4KQFA 3JW8A 3QY0A 4JLDA 1D2NA 2I7VA 3GR6A 4QFBA 2YWDA 4IDCA 1H3EA 5LCXA 1OLUA 2FW1A 4PWZA 3EXG1 1NDUA 4E12A 1YTUA 5REQB 3A32A 3A1NA 3PKIA 1QZ3A 4RTMA 3RVOA 2DETA 1GL7A 3L0PA 3CLHA 4HRVA 4TUYA 1DOAA 3SNKA 4GMHA 2P4UA 2FKNA 5FBLB 3OQVA 4DAEA 4G0WA 1M5UA 1Q7TA 1JHQA 3G3EA 2JIBA 1HQYE 1N0UA 1R6XA 1VJ0A 2JZNA 1U98A 3A28A 1GUZA 2VUTA 3C7AA 3JYQA 3KFVA 3OQHA 3ADKA 4NE9A 4DM4A 3MCTA 1NJ6A 1Q0ZA 2VZ9A 1I2DA 3JVEA 1BXKA 1I4WA 1X80B 5CD9A 5BSTA 2ZRHA 3AHJA 3BJZA 3GFPA 2XQVA 1KDTA 4RWZA 5B53A 3E5NA 1EXNA 1ZDMA 2J09A 4PLWA 1RXEA 2P6UA 4X3OA 4BBAA 3GLQA 3LY7A 2Q7OE 4IQ8A 1CERA 1NVGA 3RC3A 4B4KA 2ZBUA 4TSRA 1BHJA 4CIYA 1ETHA 2HJVA 3F5FA 3H4TA 4P53A 5ILOA 2PU5A 1QKJA 3FUTA 1G55A 3UPUA 3ZD6A 4LHXA 4YQEA 1U2EA 3H6GA 4OHKA 4OL9A 3KYJB 2A30A 4UVGA 2PE5A 2FR8A 1FQOA 5GJWC 2X8BA 5BQPA 1BA2A 3R3HA 2CF5A 5GGYA 1V45E 5DV9A 1N2OA 3WBJA 2QVBA 4OOEA 2GILA 4ECEA 2H5LA 5KTMA 1XKQA 4DVGA 2GCOA 2PX3A 4BV3A 2VC2B 1ANKA 1T9BA 2VPYA 4ALNA 4BVJA 3VZCA 5C18A 3VU3A 2DTEA 1DAGA 3SBEA 1Z0DA 3KZKA 4I5FA 2AMLA 3GLVA 4QHSA 3AGPA 1HRDA 1OBOA 3KUCA 3N3BC 5KWSA 5EIXA 2VZEA 2X15A 4DAOA 4E33A 1U3WA 1Y9DA 1JDJA 5EIEA 2WW8A 4GC5A 4GKBA 3WKCA 2VYVA 4DRXB 2PL9A 2R1VB 4M1WA 4IXNA 4OLAA 2YW9A 1RCUA 1GKLA 3DAPA 3MOIA 1FX1A 2I29A 3BTOA 1A7AA 3BYZA 3R9IA 3QA9A 4BNUA 3TLXA 3I8XA 3K20A 4GR5A 4Y2SA 1M2JA 2R8RA 1EVKA 3IUMA 2AFHB 3BE8A 3PLRA 4YAIA 2VDPB 1L5NA 1TLLA 1ZBQA 3A27A 3MJDA 1CDOA 4PVDA 4JB3A 4E88A 2FE1A 4QJBA 1TF7A 4IOKA 1NBOA 4WY5A 3NHBA 4I9NA 3PEUA 2VH2A 3UWPA 3MTGA 4YV1A 3M6XA 3G0OA 3FB1A 5KYWB 4MIOA 1EWKA 4Q24A 4ZQGA 1K7XB 1YA4A 4Y2YA 3V1MA 1XCMA 3KM0A 4X95A 2GPSA 4YV7A 4F6RA 3AHCA 2P9FA 4RTKA 1UKCA 4MYDA 3WSWA 2PH7A 4AP6A 2X8JB 2H1RA 3T1TA 2RHMA 4NBVA 5H70A 2E4ZA 1ZA2A 4CLEA 1TA9A 4HVTA 1DKUA 2C98A 3D7LA 3GXOA 1DIAA 1JLKA 1NQTA 2QIPA 1N8KA 1SQ6A 1KY3A 4JITA 4M6WB 4NX2A 3ZD9A 3GOHA 4HOYA 4M87A 2BTEA 5AJZA 4QAJA 3RAGA 3BJIC 1QF7A 3JQEA 2FWRA 2HEIA 4J4BA 2CHUA 2GTHA 1Y9JA 2I1QA 3QVSA 4YRTA 4Q15A 1FDVA 4CL3A 1LSOA 3VHXB 3GDOA 4PZDA 4X54A 1ZL0A 3L0CA 3MQ4A 5DT2A 5J1TB 2DLCX 1O6BA 1E1DA 4P38A 5CEFA 1U8TA 3DC2A 3ROMA 3MYRA 3PE4A 5EE5B 1MIOA 2BZSA 1HKUA 1QCYA 3UWMA 4ZZ0A 4IWNA 3KUUA 4H0NA 4Z7NB 1F2TA 2XEXA 3MERA 3QKTA 2NO4A 5CH3A 3ZXXA 2EHDA 1JJ7A 3P0EA 2QG4A 4EHFA 4EAAA 1RZRD 3N0RA 4ZCTA 4IDGA 3PDHA 1CP2A 3OHPA 1I32A 2IU4A 4CKCB 4PC6A 3NIWA 4A6DA 4BX0A 5A2QA 4AQYB 1Y80A 3PTZA 2XUJA 3LCUA 4NR0A 3HYSA 4NBSA 3A25A 4WZBB 2WABA 2IS4A 5EN4A 4YUWA 3ZHVA 3KELA 2C03A 2Q8PA 4G1EB 5I7AA 5CDSA 1GKIA 1HE4A 1ST2A 5JFOA 2JFHA 1WS6A 4E14A 2GBLC 2P77A 5A3QA 2FOIA 4I99A 4RPIA 1VFPA 1AQUA 1SUCA 2H17A 4HP8A 1EUDB 3DM5A 3KOXA 2CZCA 1N7JA 1K92A 3F49S 4ZXPA 3TB6A 2DEUA 1FVFA 3EIFA 4ASUD 1ZM7A 1A9YA 2IJGX 4BVGA 4DUZB 4U1RA 4EYOA 1AMNA 1OBHA 2EFYA 1FVHA 1G3QA 3VI3B 2VHVA 2QD5A 1G19A 2QTNA 3HTXA 5KYVA 2JAOA 1XBTA 2Q3MA 1UWVA 2QTBA 1GCGA 5DCWA 4CM1A 3D3NA 4P86A 4KBYA 4BRWA 4AJLA 3QXXA 4IILA 3LP5A 4BBZA 4DBLE 2I1WA 3QU2A 4MWCA 1UQRA 3CSDA 3D3WA 5I5EA 4DR2B 2VDWA 4B7ZA 1DTEA 1EXMA 3LUGA 2ISQA 3MBKA 4AECA 4UAJA 5JSFA 1EUCA 1UXGA 3EB9A 2E87A 1QH8B 3GN2A 4W5OA 1V71A 2E1PA 4J90A 4GZ5A 2NACA 4MW4A 4D57A 2HFKA 1Z4MA 2LV8A 3L6UA 4HLDA 4QDUA 4DRZA 4QVIA 3T1QA 5MN4A 2AFIA 1IBKB 3PYMA 5CM2Z 3U7FB 4OJQA 5EJAA 3VU9B 2HLPA 5KNLA 1U0EA 2BTQA 5JSQA 5FJIA 1V37A 4KYIB 4GMGA 1Z82A 1NXXA 2NUAA 1OF1A 4B48A 3H2GA 2OHOA 1Y1TA 5CYFA 1BH6A 3SYNA 4ZAZA 1KE1A 4WY8A 4KWHA 1XWWA 4GYKA 1CNEA 1R16A 5CTJA 3S5UA 3FVVA 3GARA 1H9BA 1J23A 4YC7A 4FUQA 3KFXA 4PNEA 1PZEA 2Z5GA 2Q1UA 2WSIA 2P4QA 1PKEA 1L7BA 2EG9A 1R4MA 1DRVA 1PEAA 1ZEJA 3B7PA 4GM1A 2DFPA 4PPGA 2DT8A 3EH2A 3DXYA 2W9XA 3FKSA 1RPAA 2C1ZA 4C0HA 1AUOA 3NTLA 1GZ6A 1X77A 2GS9A 2QR3A 2VPWA 1JSCA 1AHHA 3BQ9A 3FZQA 2FEKA 3QKUA 1CFJA 3LDAA 4YAKA 1FEZA 4K9KA 2LIPA 3TIIA 1PE0A 5A9RA 4Q7KA 1M2NA 1H0KA 5K0JA 1U90A 2RBGA 2ZXFA 1WU7A 3CVOA 3DE7X 3L7OA 1M6VA 4IJQA 2NADA 2J9RA 4JOSA 2B8TA 1DC8A 2VHJA 2FMUA 3VO8A 4CYMA 5KNCH 1FFSA 4RDCA 3WVNA 4LV6A 4QOEA 1JDTA 1CUVA 1TYEB 2IODA 2OM2A 3C7KA 3PFBA 4N3AA 1Z6YA 4LZOA 2BGRA 4TKZA 3WFIA 5HCUA 1GG2A 1G8HA 4D97A 3LQRA 3ETLA 3VKVA 3Q2OA 1UC9A 2VQSA 2BFAA 1EGAA 5LKAA 2FX5A 2F1JA 4PV7A 3WLPA 4X92A 1NBIA 4A9AA 1A9QA 3FNRA 4OLJA 3EVAA 1DRJA 1ZNXA 2F2TA 3EZXA 3W2HA 5B4TA 3E05A 4ZMBA 5HTOA 2G0NA 3L7CA 1RQ7A 3KPVA 3QYFA 2WUVA 4TN1A 3TLZA 3U7HB 2AC2A 4XDHA 1GO2A 2XRMA 3UXMA 3FYUB 1DBWA 1VKJA 2VP2A 4RE5A 1CEEA 3QMWA 2Q6IA 3EW9A 2C00A 4L7VA 2JA2A 4RC9A 2H07A 2G7MC 3UMYA 4FZRA 3WK9A 4TT3A 3K9CA 5AK3A 2ABWA 1HV8A 3UMBA 3ANLA 3A9VA 2QUKA 2G9ZA 3QTTA 2WJAA 3M4XA 2QX8A 3DAOA 4F12A 2DRIA 4HK4A 3VTZA 3SYMA 5LDGA 3TQCA 2VP5A 3FPBA 5GONB 1W0CA 4L9RA 2XQIA 2L42A 5KNDD 3S2SA 3K2BA 4RXMA 4FEYA 3CY6A 3NC0C 4FNOA 4UCXA 4G1VA 1NVWQ 3SQDA 3NTOA 3UKDA 1CRZA 2HBQA 2YWRA 3QJGA 3FVQA 3U4CA 5BNZA 3T94A 1OFGA 1ZHFA 2EOAA 2RAFA 1NZDA 3JQAB 4JR0A 2C7QA 4QPPA 3CW9A 3JWGA 5T8KC 5HGXA 3ILYA 2PT6A 5ELMA 1Z4QA 4KXMA 2O3QA 3GRUA 4YMTA 2UUBB 3KSDO 2ONJA 3TR0A 2QUJA 1L9XA 3BWDD 5KC9A 2J9XB 1Q0QA 1X70A 5DCLA 4DJTA 3EVGA 3GFFA 4LOHA 4LSZA 5LQKA 2JGKA 3NT2A 4N0QA 5PGMA 4C6RA 4N5DA 3ZWMA 1JFFB 1NJ5A 4PNHA 1F14A 1JDBC 1GG5A 3LNTA 4TWRA 3TF5A 4ZV9A 2V96A 2VDMB 4QDXA 3S29A 4AZ0A 4DG5A 3KQYA 4YCSA 2QTGA 2NXWA 2ZQZA 1NVEA 4MW2A 1G0OA 3DXFA 3QKSA 1KO5A 5LD2C 1USWA 1CJCA 4L07A 1SC9A 5JISA 1JVSA 1IAVA 3BD8A 1DTWA 4FCWA 5AIAA 3GJ6A 4HFNA 3WP0A 3AOGA 4G2TA 1H2WA 3IEMA 2C7GA 1XQVA 2ACEA 2FZEA 4WLUA 2W71A 4E5PA 3V6LA 1XKTA 3NCHA 1KMHA 3QUSA 4EI8A 1M73E 3FCSB 5FDFA 4Y2GA 4O8CA 2E82A 3I9FA 4ZQFA 5TR9A 4AMYA 5EQFA 3R0XA 5BNIA 1CUXA 4FC7A 1NIPA 1NKTA 3C48A 4CQLA 2VTBB 5BOSA 4IDOA 4Z9BA 4C0LA 5AT1A 2FSVA 3W4KA 3LL7A 1YBMA 2A0KA 4B09A 3IQXA 2OOKA 3OTHA 4WJZA 5J2UB 3TZHA 4AULA 2AD1A 4DWVA 2IGBA 3RJTA 5JXIA 4ITUA 2JHAA 3ONEA 4OQ4A 4ZRMA 2VA9A 1X1QA 3ADPA 3SPXA 3K1YA 1GPLA 3PFFA 3OFND 2WWIA 3T4XA 1SC3A 2AI2A 2QU7A 4P4SB 4A36A 3DBLB 1GUDA 3GLHB 4Q9KA 2QVGA 1MC1A 4YASA 1KEZA 3ASZA 2PSDA 1VL8A 3TGWA 4CIDA 3ZV7A 3BF7A 5JNTA 1V26A 1AM4D 3CNEA 4URVR 3ZJTA 5H81A 4AWBA 4GKAA 2VDLB 4O1HA 2J0UB 4DF3A 1L5SA 3JARA 3M83A 1U2DA 2Q7DA 2VNHA 3QHPA 1XRQA 2ZBFA 3TJMA 4H7JA 4EB6A 2QAGB 5KTRA 3WQHA 5BV0A 1RMQA 4S1PA 5IZCC 5J2UA 3OEEA 3NYRA 3BXGA 4MP6A 4DN6A 2CJFA 1CUAA 1U4NA 3KB1A 1GAWA 5CFLA 1J39A 4YB8A 3T5DA 2W2QA 3EQ6A 3HEBA 3MGKA 2ID9A 5TE9A 2GVZC 3SZRA 4OBBA 3Q3HA 4YUXA 3S2EA 2WWGA 2JFOA 3N2ZB 4KG7A 3H42B 5G4LA 1U99A 3ZZUA 1UIRA 4PC7A 3RJMA 2LTAA 4PYQA 1A77A 1P17A 2OGWA 3OIYA 1XVTA 2R5FA 2INGX 4AJPA 3DOCA 2ZULA 4RQBA 5GOTA 3GRCA 3RFXA 1OPXA 4NYIQ 2XXJA 1H69A 2XJ9A 5E6RA 4OY3A 4LW8A 7REQA 3U3KA 2GF9A 3CLRC 1LF0A 1RDFA 1NFRA 2WTXA 4QRHA 2IYRA 1UBUS 2RHTA 5FPSA 1ZK4A 2D2EA 3RU2A 4EHNA 1QH1B 4D98A 4IG4A 1PJQA 3C1AA 5KOJB 1JG6A 4IQ4A 4K9OA 2PRJA 1SKAA 2QN9A 4QXOA 2J4CA 1GPKA 4PPYA 3SYRA 4E03A 3PR2B 2HADA 2H51A 3GDWA 4H31A 2JANA 3K4HA 3ESZA 1GRCA 1V1MB 2FNAA 3OE1A 1WKVA 3UPTA 1DJMA 5F7ZA 3VJKA 3GLIE 1T8SA 2BRUA 2Q5LA 3MINB 1HETA 4J16A 4A73A 3GAFA 4C03A 3TSOA 2XY4A 3HXTA 5H5JA 1B6GA 5BN4B 1EINA 3R09A 5CK4A 2IL1A 4R1MA 3ZWPA 1Y7TA 3CLUD 4E5MA 5AI9A 1VL2A 2ZT7A 2EKQA 3NIGB 5ALHA 1HTBA 3ZDXB 4QAQA 2ZWVA 5I7UA 3RYIB 3DZIA 5CLQA 2JFZA 2OUKA 2ZCVA 4O25A 5TIIA 1E3JA 5BWMA 3OEHA 2BKUA 1F60A 1MNQA 2J9YB 2FQQA 3I6BA 3OTWA 4FEEA 4II2A 3GJSA 3UK0A 3DC7A 3OFSA 3SBXA 4MMYB 5THKA 3ZNNA 5JSUA 3KFLA 1T5DX 2A67A 3AUAA 3WOHA 1FXWA 5E6SB 5AW0A 2OCIA 1AHPA 1E3DA 2NZWA 2VEOA 2VSXA 3E4CA 3X44A 2JJMA 2ZDGA 4TMTA 3T9AA 5F23A 1MA0A 4RTPA 3V4VB 4ALMA 1KJ9A 1M66A 4YRSA 4ZQBA 1C1XB 1NJGA 4DJJA 1NOIA 3GG2A 4GC9A 3PNQA 4CN8A 4LUCA 3KQPA 4J0GA 1PF7E 4MHOA 2OYCA 2WF7A 1BEUB 1RWOA 3GMDA 4EJ0A 2ZUEA 4ROSA 1MF7A 4TZ6A 1EM8B 4U7JA 4JJ7A 4B8WA 1YR3A 3W5DA 5FJJA 3ZHCA 3AIIA 2PWPA 3C7CB 3O3OB 3VDXA 3VKUA 1SUSA 4B6GA 1JHDA 2X4LA 1TXGA 4PX9A 4INJA 3QOFA 3HUTA 3OZXA 2GESA 2MYTA 3MWFA 4GPIB 2BBTA 3N76A 1CZHA 4XXHA 4EGJA 4N7JA 4MITA 2C5SA 2GPNA 1N7HA 3A2NA 4QSMA 4BMZA 2A59A 1HORA 1H2YA 1MU0A 2X41A 1EDBA 3EQ9A 3H2YA 3F9RA 4R83A 3KSMA 4ZOEA 1LK7A 1A1VA 1WZ2A 1NVFA 5CFPA 5BUSA 3LSTA 4B87A 1AZLA 3VSAA 4AN0A 4CEHA 1QG6A 3HJCA 4UBMA 4TV9B 2FWJA 1G5RA 2J5RA 3ZK7A 2V59A 2VDVE 3EW7A 5AKXA 4CM4B 1JFSA 4LHYA 2H0QA 1LS6A 1WF3A 5I6DA 2R7AA 3MWDA 5CNKA 4FD3A 5AW1A 2YIMA 1B0UA 2ZE8A 3H9UA 4IIJA 3KX2A 3QJ5A 3VR0A 3WYDA 3GROA 2D0DA 4CKBB 4TMKA 5LQNA 2G07A 4BB5A 3KQWA 2OBFA 2C5FA 1P9RA 1BHQ1 1QF9A 1H1DA 1PYGA 2HT6A 2GAAA 4FMCF 1WLSA 4G97A 1C29B 1UFOA 4JODA 4KQCA 4MP8A 4B34A 4MQEB 2AT1A 2XOKA 4F2GA 4XWAA 3LK6A 5AVRA 1KTVA 2CNNA 4INPA 4N40A 1M6EX 2H54A 3ABOB 2NUTA 4CI0B 4DDKA 5CFZA 721PA 3DMHA 3NM6B 1NW6A 3HCRA 3VM6A 1P5JA 8ABPA 4O63O 13PKA 1GL6A 3QENA 2GXQA 3B1KA 2I80A 4L75A 5C53B 3KDSE 1TJYA 2JIOA 3DB2A 3LBNA 3U39A 4OA5A 1PJ3A 3SC4A 4M4SA 3P2YA 3H8JA 2FZWA 4UAGA 4EA7A 4WXMA 4OI4A 3BDVA 4D7AA 2UVDA 5FOQA 1CR1A 3WJ2A 1K4KA 3KR2A 2R97A 1HTTA 1K8YB 1L7EA 3BWYA 3NONA 3O38A 4KJZA 4AZ3A 1TYDE 1XPJA 3ZVNA 2JLQA 1KMCA 1HLGA 2JLBA 2OSBA 1HR0B 4O59O 3UWOA 2PFKA 4REMA 2BGGA 3VR6H 1C0LA 5I7SA 1EU1A 2RHDA 1MB3A 4N5IX 1U2RA 4RCZA 4B47A 3V4PB 2VK1A 3DHWC 1STOA 2B1QA 2P9TA 3I42A 4P3KA 4M7PA 4BWVA 5DWVA 1YR2A 4KTVE 1CR2A 3RHFA 1XNHA 2OCAA 2VXBA 4N0EA 3NOVA 3PFWO 1SN7A 2QNIA 3LUBA 4QLOA 4JYZA 4G4IA 4LF7B 3PSAA 4Z2YA 5GIOE 1II9A 3FOZA 2I3BA 2PRIA 1NE2A 1E2MA 3IVAA 1JH9A 4WEQA 1XXHE 1KI7A 4UXHA 1B2LA 2V6BA 3ZI0A 1TYZA 2HF8A 3CM0A 4D4LA 7ABPA 1PJ4A 2ZYRA 1N2GA 3AJEA 3RVLA 3FHJA 1SZCA 4X7BA 1U3CA 4KMOA 1KIMA 1ZW1A 4X1KA 5CG2A 2EWWA 4PX3A 1SVOA 5IBRA 3MXTA 4WZAE 2CGEA 1QBGA 1LB1B 3WNZA 1K1EA 4UE6A 2QZSA 1Q95A 3KCNA 3Q7IA 4OHVA 5TNXA 4MQFA 4OP2A 3DS8A 2QN6A 4PFKA 4WIAA 4F2DA 5KQMA 3U1TA 2EAUA 1ZONA 4GRIA 4DNFA 5BP7A 3VBEA 4YJFA 3AH8A 3PZBA 1GTJ1 4HWKA 4J43A 2ZBPA 4JJKA 4BO0A 1I6MA 1LC0A 4GX1A 2P41A 2A57A 4EKIA 1P0QA 1WPRA 3SF8A 1QGDA 3IBYA 1VC2A 1YDHA 2O8FA 1NJ1A 5GY7A 1KYXA 3TPZA 4FD2A 5JYEA 1NBMD 4OXRA 1YHNA 2FK8A 2A2ZA 3M3HA 2WV9A 3ROGA 5JNVA 3WA7A 3V97A 5F76A 3PSHA 4EWLA 4KXXA 4J9UE 1UC4B 2GA9A 2JH3A 3TOXA 4AJ2A 1K5HA 5KSOA 3T0GA 5CNIA 2AVDA 1QTNA 4GQIA 3JVIA 4M21A 3ZLTA 3PQCA 3QGMA 4KR2A 3VR3D 1C9MA 4J3FA 1BO6A 3IEPA 4HSEA 3RBVA 4YQFA 2Z6UA 4M1EA 1QPGA 4NH0A 1T5TA 2GMWA 2XYHA 4XCQA 4XOIA 3AHEA 4ERNA 2DR0A 4RSMA 1OLUB 1UMCB 2W2MA 4IHAA 1TZMA 2ZJ7A 3G17A 2W2TA 1L4MA 2WSYB 2VHTA 3P0JA 3PQ3A 4R2MA 1MORA 4YACA 3N59A 3IHLA 2VSYA 3HRIA 4FHCA 1JF8A 4G1UC 4OP3A 3S44A 3BF8A 2XTZA 1IATA 4L0CA 2YICA 4RUKA 4L4ZA 2ANCA 3H2HA 5K6AA 1GTRA 2DFLA 3BWVA 3I2KA 1CDZA 3Q7QA 4DEXA 1UJ4A 2MSDB 2XE7A 2GO7A 3PF9A 1L6RA 2P5UA 5E9AA 5U4QA 1UWLA 4PM4A 1JI0A 1L7AA 4QRDA 4KN6A 3IELA 4U9HS 1KSHA 4HY3A 4O6VA 5HOQA 1IPHA 1NBAA 3OAAA 2Q5IA 5EOVA 5K2OA 3L1JA 4QGBA 1SXQA 3BKWA 2Q1YA 3VKFA 2HA3A 1UH5A 4RH1A 2A5LA 3N8HA 4RKYA 5BW5A 1J1IA 3U48A 3V33A 3GEEA 1IN7A 1VYVA 4QFDA 1YRYE 1RKVA 3G2OA 3GIDA 5AOVA 1UBJS 3TW0A 5FOTA 1GPMA 2X9LA 1JIVA 3UHAA 4QG3A 1C9NA 3WYGA 2GN4A 1KS2A 1B6TA 3JVDA 4X90A 4B80A 4X6LA 2AI1A 5AVTA 5M34A 4HDOB 1ISPA 3IDAA 4G23A 1SB9A 4Q1CA 4QATA 1Z0FA 4MEBA 5K8JB 3T1YB 9MHTA 2CFOA 1TYBE 4HZIA 4TXMA 2BDUA 2ZRGA 2BSXA 2QS9A 5LJLA 3IKLA 3KYBA 2E6KA 2XDAA 4MS1A 4NHOA 4WN9A 4BFLA 1R8YA 2HCBA 2GCOB 3W05A 3BFJA 4EECA 4HQFA 1SHUX 4KXYA 3S2GA 5BVGB 4EKEA 1YZYA 4U2GA 4Q3BA 2IHBA 1D07A 2UUCB 4LE1A 2Q1TA 3ZZMA 2I6TA 2VL7A 2EJWA 4F7DA 3KR9A 3B1WA 5K0GA 1ZPDA 2RJNA 2VH5R 3ZQUA 2BD0A 4Q1AA 2H2IA 3FTFA 4UCQA 4OM7A 4DLLA 3EDYA 3DGEC 3L40A 4RTOA 2LCIA 3IAEA 2FRDC 4C3UA 1FOEB 4O0LA 4H7EA 3UMMA 2HA6A 4L0MA 3CZ5A 6AT1A 3PC7A 3ZCSA 1H94A 4DR4B 4D9EA 2WHQA 3PFCA 1N2SA 4XTRA 1WZIA 5FPQA 3KK0A 3KEQA 1O5IA 3HSKA 4AG6A 4BNDB 4OU5A 4HNTA 4UVEA 3DZGA 2ZRFA 4I6GA 3ZHYA 1IJFA 1MN6A 4UMEA 4E1AA 1UINA 2FUEA 1ZWKA 2XTAA 5HKBA 5A9SA 2NZJA 2V45A 3AVXA 1HFKA 4KFRA 3E7WA 2EDAA 3PE3A 2DUWA 4GX0A 4WESA 1IN1A 4ND8A 4IGEA 1IN5A 1I2ZA 4RY2A 5G1PA 2J9FA 4BS9A 2P9EA 4MDHA 2HJRA 3OPMA 2D1RA 3RS2A 4F6RB 3ZWVA 2JHCA 3CWCA 3LHDA 2A4KA 3HRHA 3CKMA 1V1RA 1ZXBA 1JYEA 5H0IA 3F3YA 1D3AA 5I7EA 1EJ2A 1E18A 2R8YA 4WKPA 5A05A 2PMCA 3AFHA 2PX6A 3AF2A 3ZBTA 3RTDA 3ZX5A 4ZVPA 1LJLA 1NYRA 1EJBA 1JIQA 3R9XA 5K3CA 3ZXYA 1DEKA 4FS3A 1JKFA 3PXGA 1J8VA 1Z63A 4FOSA 4MW6A 2GBIA 5ALFA 5HF9A 3RG2A 3SLKA 4A8JB 3JVUA 4YJ2A 3VSCA 4HO1X 4OHOA 3HVKA 4MI3A 2HW8A 3VNVA 3ZKAA 1MIOB 1R5OA 4FWIB 2V6JA 2ZSEA 2PT5A 1CS0A 1S3FA 1DV1A 1CRPA 2ZTHA 2C57A 3AERA 4UNPA 2XX3A 4TKLA 1PFYA 4CV3A 5IARA 1E62A 2I2XB 4IHJA 3TDMA 4IPTA 1V5GA 4A0GA 1CD5A 4HD8A 3CVVA 2Z9DA 3JZAA 5BUQA 3EVFA 1KH1A 1LZLA 1YU6A 1E3IA 2VP4A 4XFDA 1Q1NA 4Q3NA 4WXPA 1SBTA 4EVIA 3IUSA 1LLUA 2YUIA 1XIVA 3THSA 2BKXA 3ZW8A 1B00A 4V1CA 4TZ0A 3K5HA 4XPIB 4WBXC 3WYAA 3EGDA 2X9VA 1ZCJA 1ECCA 3Q0IA 2JAWA 2O3JA 2H7XA 3QY9A 5JZOA 1KKMA 2WHPA 1P7PA 4DQVA 3BE5A 5FNZA 5IT0A 3ELUA 3EQ2A 2COKA 4LQDA 3WMEA 4CMBA 5IXYA 2JFPA 5EKXA 1I3LA 1B8UA 3NHAA 4XYLA 3VZDA 5A3RA 1DAFA 3UJBA 2JIPA 5ES4B 1OTHA 2G6BA 3ZZNA 4KLAA 2VP9A 5FPKA 2R4TA 1ZY2A 1SEPA 1E6KA 4L5CA 3ROXA 4BN5A 1WW3A 5THQA 1N0VC 4A23A 4RHUA 821PA 4GE3A 3CLVA 2JEYA 1P2BA 1OXUA 2EJBA 3DEAA 4IVQA 5G1OA 3DJYA 3RIGA 3WRYA 5JQWA 3VR6A 3FE2A 2OXEA 1X0XA 1COWA 3JD4A 4J0EA 1YZGA 2BZGA 1U9ZA 4H3VA 4E5NA 4N48A 3KEOA 3R0QA 4YJGA 3D3WB 4G4SP 4HR7A 5B58C 2QNBA 3M9WA 4NG4A 2TMDA 2P5SA 2VPPA 2OB1A 3HHEA 3MN1A 1EUCB 4MYUA 3R7AA 1L3IA 2PRSA 3A31A 4CG2A 4FNGA 3LW8A 5GQSA 4B75A 1WP4A 2AJ8A 3BL6A 4YMWA 3AI1A 4Z1MA 2O5CA 2AFIB 2VJAA 1VYUA 3HV2A 4EHJA 4NECA 5EHZA 1KF0A 2IEIA 4PYIA 2WJPA 3AQ4A 4HHEA 1JXAA 2BTQB 4A0SA 2MYPA 1ESZA 2YVAA 1X1EA 3OZCA 3LQQA 4KQXA 2ZT6A 1JDNA 1E5TA 1FLNA 2E48A 3I09A 1L7DA 2BL4A 4P7BA 1Z37A 1PR3A 1ZJWA 4X7RA 4X6YA 3VVMA 1NUTA 2DHRA 1T6ZA 2RC6A 4V2IA 3CINA 3QWFA 1KVQA 1GKUB 1VKNA 1AK9A 1XZAA 1TYAE 2GKSA 2P4EA 5ALEA 1JB1A 1O95A 4ETWA 4YAOA 2ZYSA 3PXEA 2RI1A 3GA0A 5ADHA 5FPTA 1CUHA 2BKVA 4A2QA 2KYRA 4O0MA 2PUBA 1XF1A 3C5VA 5DRYA 2PKWA 2ZJ5A 1Q3KA 3EFBA 4IOMA 5EMJA 5T64A 4KCGA 1JHRA 4BLRA 1D5WA 3O21A 1ZH6A 3UQYS 4PZYA 4L8GA 5KI6A 3V2UA 2OORA 4XQGA 1T8PA 4RSRA 3NHSA 1XGKA 3E84A 4YPOA 4NE2A 2D1QA 1R5JA 4IDDA 2ZRBA 4RVFA 4X41A 5G0WA 1NXPA 3UTDA 3GLIA 3RHZA 1FMFA 4YRFA 2DECA 1BOOA 1PG2A 1W4RA 1OWNA 4BZXA 4P2BA 2L2QA 2IPMA 4HQOA 5EWLA 4J0CA 4QXAA 3ZWNA 5C51B 1I3OA 3R5JA 5DH9A 5AUNB 1GFWA 3NORA 1QDEA 4DEVA 4R0VA 2BMFA 4XEHA 2E4XA 3EK2A 3ZCXA 4NBLA 1WW8A 3NJRA 2PMBA 4AJ1A 1ENYA 3EPPA 4JJEA 3E1KA 3SDZA 2WMNB 3CC8A 3M5DA 3BDIA 2QM8A 1KPGA 4ERXA 1OR8A 2H9AA 1WDLA 4GIBA 4G63A 2WKQA 2ZSUA 3EJWA 3VOTA 1QAOA 1Z28A 4CQJA 1UDXA 5AVYA 5KSWB 1SBQA 3R6WA 1RXSA 1Z2CA 4WPGA 2B21A 5CFRA 1VMKA 1Z73A 5I47A 1XLUA 3MMNA 1GNSA 1G291 1Z3CA 3NXSA 1IY8A 3OP1A 5FA5A 1ECBA 2ZIZA 3VDNB 3FKJA 2C07A 3SLGA 1AGYA 4WFKA 5ERGB 1PWZA 3OX1A 3PCXA 4M83A 3AJDA 3HNRA 1NW7A 5DLPA 1H2FA 5BYAA 3E35A 4LNHA 4D43A 5K8IA 1KXZA 2OXTA 2BN4A 3R77A 1EEXB 4M2LA 3E3OA 3IAM1 4TLDA 4DLZA 3ZDFA 1MRZA 2DERA 3PNSA 5HXAA 1YS9A 1XYVA 1SCUA 3KQOA 4LRXA 3ETHA 4KUHA 4NBKA 3IPXA 4DDVA 5FTLA 4MWZA 1EWQA 2ZUFA 3RC8A 3H97A 4F97A 2BV3A 1T9AA 2CEKA 2H31A 2QUIA 3LOUA 3P45A 4IQ0A 2LDXA 4DG9A 4NCAA 4JV5B 4I66A 2FN7A 2PQMA 3IAFA 3OECA 4O5OA 3VNAA 4BX3A 5FUQA 3NBFA 5FOUA 2FZLA 3UGKA 3DZBA 4EEXA 2R1UA 4NZMA 1RQ2A 2P7HA 1ZGGA 3I73A 1EFRD 2MSNA 4KNWA 5AI5A 5AKKA 5L6LB 4LWPA 1KHHA 4F11A 1DARA 1Z0AA 1E2GA 2AZMA 1JFLA 1W93A 1SZJG 1K8QA 1RWWA 2HA7A 3QVKA 3OP4A 4ZU3A 1HH4A 1ILEA 4WAUA 1OBCA 1IVSA 1RBQA 2Z4SA 4PFJA 5DLEA 3MUNA 3UHJA 1J33A 1UC5B 1C7IA 1J0XO 2CDRA 3ODGA 1T26A 1YRQA 3O8DA 3USCS 5AW6A 2IH2A 2QVZX 3FPHA 2BFDB 3DBVO 4MUIA 1MFZA 4TTSA 3QKSB 1BDBA 3U7RA 1U8YA 3LPNA 3FG9A 2ZSAA 3OZRA 1DTWB 1QZTA 3LFTA 3PC2A 3TQTA 2OQVA 4I3HA 1UPFA 4ETNA 3PPXA 4BKRA 3WR5A 5GJVC 1X1TA 1VG8A 1NTRA 4MRNA 3RROA 1NR1A 4PY2A 4GLFA 5E9QA 5DPMA 5KDOA 1KMHB 1XLWA 2NGRA 1V7CA 1DFGA 1Y48E 1TLFA 3KUKA 4NU0A 2PX4A 2D8MA 1E8MA 1XD9A 3AFNA 2QQEA 1ZN9A 1NBHA 4Q1BA 1S3IA 1EFVA 1ZCFA 4CQLB 2DSNA 2ZR8A 2O0LA 3CRRA 5BOSB 2QDKA 4I8XA 1FTNA 3D8RA 4BO6A 4CTKA 4JJ4A 4W4TA 3QFCA 4CT4B 4ZCQA 1U9IC 4J76A 1N92A 5CT6A 4RTSA 5KWJA 1RRGA 2VYND 4B4VA 5EIBC 2BT4A 4I1IA 3EBPA 1NP3A 2FDXA 2QW1A 4DDUA 2FFHA 2ASEA 2FPKA 5CLFA 1FSFA 4KZPA 5BQXA 1FMCA 2CUZA 2D2FA 1THZA 1ABFA 3CLTC 3O1LA 1NNSA 2PRKA 2Z95A 3OLXA 1A5TA 3E2MA 4PZLA 3TH5A 4M0DA 4OPMA 3SN6A 3NIFB 1XNJA 4Q7MB 2EV9A 1RWXA 1TVKB 1TF5A 3WL3A 5DNDA 2P2NA 2IH4A 5IJXA 3FNGA 1QIIA 3DTVA 1XCJA 4PFSA 5EY5B 5ARDA 4W9MC 1X9IA 2PRYA 2OCGA 3D1VA 3HHPA 3OKCA 4XYEA 3D8UA 3FHCB 6ADHA 1UADA 1W48A 2KW5A 1TPYA 3O94A 3OZDA 3GZNA 4IAOA 3DNMA 4XYGA 1VZ2A 4EG5A 1ZRHA 5CURA 4LJ7A 5HKAA 1XRMA 1J0CA 2C2BA 2ZJ6A 2OGZA 4KQMA 4A8PA 1LFAA 5E2IA 3K1TA 4D80A 4DE5A 1KEEA 1M5RA 4EO7A 4B7UA 4HUJA 2HWKA 3SP1A 2PGIA 4OHBA 2GHQA 1EE2A 1BX3A 1WB5A 2HMVA 1VL5A 4CNQA 1J1ZA 4MPDA 4RYDA 4BRUA 4M0KA 1NWHA 3DULA 2WWYA 4JIMA 2NZVG 4LXHA 3HA7A 4O8ZA 5LOVA 2HT1A 1GXSA 4JLUA 2IXBA 3KJHA 2VPTA 4JDUA 4BQPA 2R0QC 1ZI6A 3OZGA 1NSTA 2C4HA 3C4VA 3DB1A 3HU3A 3SXUA 1P91A 3WIDA 3WV4A 1W4LA 3RHSA 1AVTA 3OF3A 4C1BA 3STUA 5IN4A 4ZTUB 5E6RB 4KW7A 3DEJA 2QY6A 3LY9A 2D2IA 2QP4A 5EJGA 4C0BA 4UPEA 1Z16A 5BW4A 2O20A 1I10A 2Y3IA 1GLVA 3BXFA 4OJMX 4QUGA 4OXXA 2OFFA 3L46A 4OXNA 4BLPA 1PJBA 2GXUA 1WCXA 4NU6A 4LECA 5AJXA 3LLMA 3QJYA 4LYDA 3OLWA 4XM1A 3ER8A 1RPTA 1USVA 1FDSA 5JZSA 4C4TA 2V7QD 3BSWA 3LLCA 3MGCA 5JASA 1XK7A 2G72A 1KOLA 3B9QA 2XD4A 4N3BA 2QLBA 3DGFC 3I9V6 5KKAA 4E4TA 1QRDA 3CW2A 2A3RA 3GUVA 3O95A 4OXIA 2QMHA 2WIDA 1IRXA 1L7RA 3IAUA 3OF2A 1J9ZA 4AY5A 1FDTA 1HL7A 1DLJA 1FTQA 2JARA 5ESWA 3S3TA 3TR5A 1NG1A 4AG5A 3BWXA 4F06A 4O4HB 1N2CE 4QYWA 2JASA 1LVUA 1B2RA 4CM3A 2XNDD 4HWTA 1KTIA 1ODKA 5FEUA 4FMBB 4V3CA 4II3A 3J7AC 4ZT5A 3JRNA 3VPXA 1UBSB 3G8CA 3PB3A 4GDFA 3HACA 1IY0A 3I9OA 4F45A 5AM2A 3SK0A 5C37A 2BMAA 4KJXA 3KQTA 2A1TR 1WMAA 1XDZA 2VBIA 2AZ4A 3E8XA 1IY9A 1XLVA 2GN0A 2YZ2A 1CRLA 2I3ZA 3A1EA 3OWOA 3RQIA 1NI4A 3HBFA 4I81A 3NTRA 3RVDA 5CG1A 5K8CA 1QMPA 1JEAA 2QTWB 3NANA 4O2AA 4WK6A 3WTCA 5EHGA 1LBIA 2CXOA 2E18A 1EUZA 2IUEA 3BTSA 1L5FA 3GUHA 4XPZA 4LDZA 4XD2A 2IYXA 1H2BA 2F3UA 1KH3A 3VU8A 4ZVMA 4RABA 2AMFA 1NVKA 1WUTA 2DCUA 3DMRA 1T0BA 5CCBA 3UJ7A 2NSLA 4XM0A 4DDTA 4PGAA 4KGZA 5CVJA 2FAXA 1MP0A 1SU7A 4ZYLA 5LP6B 2HDOA 2IP4A 3SQNA 5A5FA 1AKTA 1OSNA 2O3TA 3BGVA 3LCMA 3ZHTA 4DV3B 2ZIGA 3R8FA 1Y1LA 2CDNA 5C46F 1PGQA 2H00A 1IJKA 1RKUA 4JEHA 1W36C 3W3ZB 1CYEA 1NRJB 2RGNA 4X91A 4ID3A 5HF8A 1N6HA 2I7XA 1VIDA 5T5QA 4MMZB 2P69A 1M8PA 1KNQA 1Z6AA 1KEKA 5C5IA 3MRVA 2ADOA 5ER6A 3HK2A 2VRCA 3PIIA 2QT9A 3NBYC 5ANRB 5DYWA 4A03A 4GW3A 4LF6B 1C9DB 4IH4A 1RM5A 2N1BA 4M8KA 4QPJC 4D3DA 4EI7A 3I23A 3O8QB 2H18A 3B53X 4EQ6A 5FUVA 4EKYA 2XEDA 2ID4A 1FDUA 4BU1A 1MDBA 4ISBA 4D6YA 1OXBB 3B3GA 3I0NA 1QIGA 1ISMA 1ZLYA 3SR0A 3I8OA 4H7IA 4R2LA 2XBUA 2PO5A 4MQMA 3Q9NA 2G5CA 2RGGA 1D4OA 1GIAA 3MWDB 5DBIA 3WQSB 4IIJB 4FW9A 3E9ZA 1VRVA 3NNNA 5BQ3A 5FV4A 1J2YA 1NV8A 1YBFA 4N5NA 4D9BA 1E20A 3DTNA 3WHLA 2AW5A 1NGSA 4L8VA 3RVMA 1U8CB 3QPBA 3IVMA 5CNMA 1F0NA 1SFRA 1AUVA 1WCYA 5JZVA 3R7FA 4G5RA 4YUYA 4KVGA 1N36B 1ZN7A 3UBMA 4OREX 1II0A 4C2BA 3T3DA 3ZXSA 2FPMA 2RCNA 4EFMA 3CLRD 4HJXA 3HR8A 1R8QA 3EGOA 4GZ6A 4JT8A 3OQOA 2GN8A 3TCKA 3H1GA 1RXYA 1YXMA 2JEZA 1QP8A 4UDOA 4RS3A 1WZCA 1K8RA 1PR9A 2J1LA 2YBDA 2I6QA 3B6KA 4PTYA 1B0PA 2O2YA 1VJ1A 3O7MA 4Z1OA 3MJHA 1J00A 3BE6A 3A8TA 4IG9A 1ECPA 1LSJA 2VBGA 4A2WA 4M0UA 3AK4A 5ENVA 5CDYA 4I50A 2A86A 2QEQA 4KIJA 4RETA 3V8NA 1L8AA 2OBNA 4MQ4A 4B31A 3T0FA 5KX5F 2BE9A 2IPOA 4RJTA 4YV0A 2FWIA 5B36A 3ZHBA 1INLA 4CR8A 4YDQA 1N8TA 3WKBA 4C1NA 4BKQA 1N5KA 1PDWA 3M6WA 1ZUNA 3HPRA 4V0ME 1JR4A 2QRUA 3B85A 3RTGA 1NQVA 3C8MA 3H2KA 1U02A 2P6OA 2IZ7A 4RZQA 1EFTA 4NMHA 4FIDA 3LUDA 2X6RA 2VXYA 2ZS8A 4LNUA 2ZWOA 4ZV4A 3FDXA 3G8DA 4ES6A 4HTFA 4K0KB 1U8ZA 3DQZA 3FR8A 1LV8A 1HM5A 3OOYA 4B6FA 4IUBS 3AJ8A 2J8ZA 4ACBA 4BE7B 2CXNA 4ZHQF 2PH5A 2BAGA 4X1KB 4H3SA 4J49A 4NABA 2WYHA 3AFOA 3N2YA 1ZUHA 1WEHA 4DWOA 1GQRA 2WPDD 1DQSA 3NBAA 3AUSA 1VPWA 2HLDA 3QX8A 1YDEA 1LJ8A 5CU7A 3I72A 4IJUA 1LF5A 5JMOA 2WJHA 1L7XA 2D1SA 3BGWA 5EL0A 5EZ5A 3F5DA 1MXFA 1E59A 1T35A 2XAAA 2FW6A 4YJFB 5I9TA 3RRJA 1DLIA 2Q4EA 4BBJA 1L7OA 4NK5A 2NAPA 4N49A 1WCWA 4BQRA 2UZ1B 1E69A 2C7BA 4R9UC 4PO8A 3COYA 3SF8B 1L5YA 2O8FB 1CB7A 3JASA 2LIVA 2LD4A 3KLNA 4RPKA 5TMDA 1O9GA 1S1MA 1UKAA 4KK3A 1QV6A 1EFAA 4ARZA 1SHKA 2XKBA 2W8BB 4KEAA 1PQUA 3AOEA 4CV1A 1HXHA 3W9SA 4KRGA 4RJKA 1JB9A 1KDVA 4HNVA 3V8PA 5C7OO 2M1ZA 3W5IA 2C1XA 1B1CA 1TW3A 1Z17A 4P3NA 1R27A 2Y92A 3TL2A 2GK4A 1RP7A 2C54A 2F17A 3VI4B 3HBJA 2OR3A 2OAGA 1FYEA 1XHLA 3I9KA 3KLPX 5F78A 1RYYA 2RGYA 4LCEA 4TLCA 4C4RA 2CV1A 1S1CA 2EBUA 4Z9AA 3U3DA 3NDBB 1XJWA 5NULA 3ND5A 1PT6A 2V7TA 2P27A 3A1VA 2VRBA 3PGA1 1PGNA 1YIOA 4WCVA 1WRBA 3P9NA 3O1HB 2W7TA 3M2PA 2CKDA 4IXTA 4LV5B 1R0XA 5CXSA 5SICE 3SC6A 4BVBA 4EL5A 4AURA 2O07A 3G49A 2ZB2A 1AUPA 1YZFA 3ZN2A 3JY6A 2ZLBA 1OYYA 2YMMA 1P2TA 4I5DA 5IABA 1RFLA 1DRKA 1QV7A 4QYSA 3ISJA 1LW7A 2K87A 3DYBA 3OPNA 2OYSA 3EYWA 2Y71A 4I3GA 2WZCA 4AJOA 1RQRA 2JAQA 2PCJA 3PWSA 4H18A 1WQ3A 1MX5A 3KKOA 5C52B 1BXZA 2EFCB 2KJQA 3CJQA 3F6SA 3R7DA 1YZUA 6REQA 5JBNA 3HCPA 1ADCA 2QLNA 4JS0A 4FIZA 1IB0A 1SR8A 2ZE7A 4PLVA 3SQXA 3WY9A 2H2AA 3WWCA 4NULA 1Y8AA 3P2JA 3PYLA 4LSGA 3W6PA 3VU1A 4OUKX 2EQ5A 3PFKA 4XB6B 4F5YA 3GW8A 4B3FX 3PPWA 2G9VA 1UF9A 4JUIA 2HFJA 4OMDA 1MTOA 1PSDA 3QNUA 3N05A 4NBWA 1HNZB 2QKYA 2P6NA 3HP7A 4INAA 5D3ZA 1ACMA 4ENWA 4MS1B 4WN9B 1P2DA 3JSXA 3T3IA 3OX3A 4CN9A 1CK4A 5KB3A 2G0TA 3SDSA 1Y3AA 4K9NA 3ZV6A 3ZVLA 4AF6A 1N78A 1U6JA 2A33A 1EK2A 5JUWA 1ADGA 1EXDA 4Q4AB 3P9CA 1XC7A 1ABEA 3H9GA 1Z36A 2PU7A 3TJZA 1BU5A 5A4IS 1YUBA 2HIHA 4TM7A 3AB8A 4ZAYA 4GDMA 2V9ZA 3FOFC 3BILA 1J20A 1K5GA 1VBNA 2PK3A 2R85A 2HSJA 2DFKB 2ZRIA 3ROKA 1T5SA 2NXNA 3BHMA 5HFJA 5A7GA 1U28A 1Z2EA 4PLFA 4R1OA 4DLNA 4OLFA 5E7QA 3AUJB 4TTQA 1B8NA 2A88A 2QRZA 4JOQA 5EGNA 2DLNA 1HLPA 1OWOA 3HWX1 5HFAA 1LWOA 2I2FA 2NLOA 4WDQA 4G5YA 4JSYA 3OJCA 5A9SB 1QQ7A 4LJYA 4ANFA 2AYYA 3FVRA 4S1VA 3V8RA 3ZVMA 4YY3B 4WESB 2KLBA 4CLOA 4C78A 2YDYA 3UIEA 1M5TA 2QMQA 4GP6A 5ALQA 5EYPA 5LWHA 3AMVA 4BXOB 1K68A 1OC2A 1YBHA 3GLTA 3KAPA 2XUOA 4IL5A 3Q7EA 3W6ZA 5LWQA 1A8SA 2V5UA 1V1RB 1MZVA 4FXOA 4MCAA 4L6CA 2C5GA 3G0DA 4MTLA 3GZ4A 4ER6A 2AKYA 4V0LA 2ENWA 3X1WA 2CXSA 3FETA 2OLJA 1Z34A 1JV2B 3KTAB 5TQ2A 3L82B 3WYNA 4DWJA 3M82A 1ZOLA 4NCKA 3ZCUA 3V8MA 3UGJA 3R9XB 4MYTA 4ARBA 3ZDQA 1IXRC 4D0LB 2ZP1A 1J21A 2GOYA 5JAZA 4G1BA 1CB0A 3P2IA 4YCJA 5EP2A 5FBHA 4YJ2B 3FFTA 1N1DA 2HBZA 1UR5A 3QKRA 4X6UA 1EVIA 2E2WA 2MCFA 4EHIA 1KRWA 4CLXA 2R7NA 4HQRA 1P81A 2RGDA 2QA5A 1XU4A 3PX2A 4MCJA 2OVBA 1H5UA 2Y76A 5I3CA 1P0FA 5BYKA 2ZW9A 5FV7A 4DCJA 5E1DA 4PG6A 2OHHA 4BLTA 3C7DB 4FQ5A 4FT4A 4IHJB 1A5ZA 4MULA 2IU6A 2BFFA 4ZWNA 3RRNA 4AIIA 2L18A 1UC8A 2HJ9A 4LK2A 1AS2A 1RRMA 2P68A 4MW1A 1JKMA 2FI1A 3KJZA 3GJXC 4EP1A 4D0SA 4DRYA 1XRRA 3UUWA 1PUIA 2GWRA 2MIIA 2WWWA 4J3JA 1EVLA 1GZ3A 4X71A 3ROQA 3EGDB 4FDLA 3WISA 1HT3A 1AUQA 3B82A 4U6SA 3L41A 4AROA 1E77A 3HE3A 5FD8A 5WRFA 3SYTA 3HXMA 4ZK2A 1WDTA 1MB0A 4NS4A 1N0IA 2VT2A 3KUXA 4A1FA 4C6HA 4DG8A 4R05A 2FEMA 3OE4A 4HSGA 4N0PA 4KVAA 4YHBA 1WMSA 3HZZA 4QQFA 1B8VA 2ZJ0A 3VO9A 1GFSA 1XAHA 4Q3OA 1TIBA 5EP3A 2GZSA 5UKDA 5L3SA 2JFUA 1FNDA 3MT7A 1DO2A 2HCFA 3BIFA 3U3JA 2OB2A 4NEGA 3RHTA 3I8SA 4GR9A 5AHOA 3K09A 5D6OA 4OIFA 4ZVLA 1M1UA 1GA6A 4EFNA 2IYQA 3BJMA 5A4AA 4KL8S 2QK4A 2GPYA 1XJ0A 2Z2KA 3NHKA 4Q39A 1NDHA 2VUUA 1Y7PA 4NDNE 1VIMA 4CPDA 2JLXA 3WLFA 4F5WA 4IFIA 1GYRA 1V9CA 3VO2A 5LN1A 1J8MF 2NZ8A 4YJGB 5C8YB 3PCTA 2H29A 1M6YA 1J0AA 3WJ1A 5BR4A 3OFJA 1QAMA 4K9QA 2QD2A 5JNWA 1Z5GA 2ECKA 4EMBA 3L77A 3IMFA 1K3FA 3DLCA 1MQ8B 2PJDA 4RQTA 1KO1A 2NO0A 4D82A 4HMQA 2CK3D 3DPIA 3K94A 3VJRA 1PD0A 2AS0A 3FWHA 3ITNA 1C80A 3V6MA 3I0ZA 4UNSA 4CCWA 1G1AA 3KQHA 4I9FA 4TVKA 4ZTZB 2O2ZA 4H7KA 2WTBA 4Q12A 4AJNA 1XQXA 1RE0A 2O8EB 1E9DA 3AF4A 4KAJA 1CJTC 2C92A 1WETA 3ZLUA 5K01A 2R9VA 1IXYA 2UVPA 1BKYA 3IULA 3OM9A 3SIWA 3VO1A 1VLHA 1TC1A 2IPXA 4Z5XA 1KYVA 4B74A 4H1TA 1KDOA 2QENA 3CG4A 3QPCA 3QWBA 4LC9A 2ZYHA 4R16A 3WLTA 1HZZA 3LYHA 4K2AA 1FUKA 1XPRA 2D5AA 4RVGA 2XOXA 3PC3A 1I1QB 4MIKA 2JH9A 1NF2A 4J6FA 5DGCA 4C4XA 4EKDA 3W5HA 2ZAOA 3M4JA 3M4NA 5C8YF 4R9SA 4NHEA 1ADJA 2F3TA 2X86A 3PR3A 4UMFA 3VV3A 5BR7A 1Y34E 2CDAA 3AWIA 4RPLA 1OZFA 3RIMA 2B4AA 1GQFA 3H87A 4D41A 4UAUA 4DR6B 4EOGA 3QLVA 3U3MA 1YDFA 1ADBA 1MO6A 3UGTA 4BP1A 3ZS9A 1ELOA 1T15A 1E7QA 1KOFA 3DFUA 5EWLB 3SWWA 3QPAA 4OV6B 1N2CA 4TYPA 4AW9A 1HOXA 4Z6KA 3B3JA 1NY6A 5JVDF 1T5HX 2NO9A 3NNDA 4KWEA 2V7VA 2AF4C 1X7YA 4BHTA 1LH0A 1QIDA 2JGDA 2Y1GA 5E6UA 2BSQA 5BO5A 1W75A 1WX1A 2XRZA 4RV9A 4JI1B 3QMPA 4E09A 4FKMA 3PDCA 3WNVA 1J24A 4IYJA 4JLNA 2EZ4A 2HL6A 4F4UA 1BMTA 2E4UA 4KGXA 3LC1O 4YCBA 1SPBS 2G08A 5HKKD 5J4KA 1M10A 1S96A 3SNHA 1VE6A 1XU9A 2XMRA 3P2EA 3PNPA 2FSHA 4K86A 4RFSA 4UFPA 3I01M 1YA6A 3SJAA 1RIFA 3QG1A 4FNAA 4MSUA 4N1AA 2FUKA 2IYPA 5BRAA 2DBYA 1SXIA 2WE8A 2P65A 5YASA 1VP9A 5FXMA 3TWOA 4A0HA 2GNOA 2I3DA 4BAZA 4BGIA 2C7OA 5JFGA 3EIEA 3SR3A 1SCUB 1WULS 3GJ3A 4PSDA 5KNDH 3DL0A 3AQIA 1UJMA 2JS7A 2B5VA 3ZHRA 4L51A 1N6PA 3BWBA 1IZ0A 1G2QA 3IOBA 3KDPA 3PS9A 1HLDA 4QYIB 5AK5A 2HH9A 2HJGA 2VJQA 4FP9A 4XASA 3T9CA 5GTDA 2OBMA 2Q3HA 3A4MA 2ZPAA 4LJ9A 4OG2A 3QITA 4ZPXA 7ADHA 2V7BA 3I6ZA 3VFDA 1C9JA 4J6EA 4XIGS 3SQOA 1Y8QA 1KERA 3HEMA 5TGTA 3MTEA 5BQOA 1ODIA 5BPFA 2F4VB 3OG9A 1SOUA 1OLXA 3ABSB 5J47A 3DG9A 4HUTA 4PAOA 4LXTA 2UXCB 3OETA 3STXA 3THWA 1OXTA 1YFKA 2LRHA 2IW3A 3FDFA 3HDTA 3FOEC 3EEBA 3G7SA 3SBOA 2H59A 2ZOSA 3UUGA 4CMAA 3CPJB 3PPVA 3LBAA 2X1LA 3ABZA 1NN0A 4WH0A 1K97A 2YZ7A 4YJDA 4XH9B 5DXAA 3Q7PA 2DHQA 2DFTA 2IYLD 2PZMA 2YVLA 3UT5A 3ELBA 5JAMA 1GGKA 3WGOA 2JHFA 1XRNA 2RIPA 2G8LA 2NSYA 3HDGA 3SICE 2OXRA 4RK1A 5GINE 1FLDA 1C8LA 2VZLA 1PNQA 1ILWA 1JIIA 2FEPA 2GK6A 3PI6A 3ZE1B 1DEXA 1ZXLA 2QBYB 3PUVA 2BKAA 3ZNPA 5FTNA 1GZVA 3PIRA 2GZ1A 3HKEA 1NVMB 1IK4A 5GGXA 5BSRA 4FMDB 5F3WB 2GJKA 2YWHA 5JADA 3BT7A 1IM8A 1DAOA 3U7IA 4Y9SA 4BO3A 1SU4A 1ESDA 1MXHA 4MRAA 3ZZ1A 1TCCA 4BP3A 1XWFA 2QMUA 4GVPA 2VPXA 2X77A 5BUZA 2OZKA 4PXAA 2XADA 4M38A 1BXGA 2IW1A 1EFVB 2C94A 2V74B 3ZGLA 5DN6D 1KVSA 4IQGA 5KAPA 2D8AA 2ZRCA 1TAHA 1TC2A 1NR7A 3T7CA 3MAJA 4OQDA 1H6AA 2ZVPX 4I1YA 5KCZA 1B3BA 2A7XA 3HUEA 3O8CA 2D7DA 1PUJA 2EW2A 1B14A 1V96A 2DR2A 2I54A 1DBQA 3AP3A 4OVKA 4D5GA 1ODSA 3UAOA 2QTLA 4QQNA 4GQBA 1IEXA 3TB4A 4J7AA 2O0MA 3T3NA 2Z6QA 3NPMA 4ZAGA 4DIFA 3MRXA 4B7XA 4NESA 4P36A 4KDEA 1VMDA 1BVYF 4M7OA 3L9WA 2C5AA 3EC2A 4D4GA 1JHOA 4JX9A 2IHKA 1DBSA 1LPBB 4JSTA 1U7DA 2BDEA 4RGVA 2WJVA 3P27A 4P22A 5BNFA 4YMUA 1GOTA 4V0MA 1CKEA 1XDDA 3O74A 1RWQA 3O82A 3HABA 3NYIA 4NVRA 2EX0A 4MW9A 1RHUA 1SKUA 1XMQB 4JENA 3IC5A 4DUGD 5FF9A 5JU6A 1ZGBA 2C9OA 1JLSA 4GH5A 4NFLA 1W4CA 3IE0A 4P4TA 5FTJA 4L5JA 3U3RA 5FBQB 4RH3A 1DAEA 2JGLA 4BO8A 2EZ8A 2ZB8A 4O1MA 1KEEB 1BOFA 3LX6A 2VJBA 3GMIA 4RVCA 2VO1A 1YBVA 1I4LD 3WB1A 1JZSA 4L22A 3IHWA 3RUEA 4FGLA 1OYWA 1UMDA 2FMXA 2HSGA 2QTCA 5FL3A 6ABPA 1YL6A 3F46A 3LGAA 2AV6A 3WIVA 4BVHA 2C9BA 2IA5A 1RZRA 1J8YF 2OO7A 1IM2A 4ZOLB 3I12A 4B9AA 1NKSA 4D2IA 1GXSB 3BMCA 3E0QA 1P5HA 5LOVB 3N5CA 3TBFA 2WP0A 2R48A 1A9ZA 1U7ZA 2X42A 5FTMA 4F3TA 3UW3A 1F8GA 3ESCA 2GN2A 1IN4A 5COAA 3AY6A 4JUBA 2IYOA 3OURA 3SDBA 2R6FA 3SXUB 2ZWMA 3T7TA 1Q0PA 3KJGA 4EUNA 4EUSA 5TLSA 1JDUA 3PNVA 3LV8A 3MOGA 2G88A 3ZDAA 3EXG2 5DWDA 3C5EA 1CDEA 1VI5A 2ZRJA 1U7UA 3R5FA 3A3OA 4NBRA 4Y0AA 5CYOA 4YRNA 3CZ4A 5BXYA 5GOZA 4PN3A 1XCOA 2W43A 4F1KA 1K63A 1H1LA 2I2WA 5C5DA 4UU0A 1DG1G 1T2NA 3FJYA 4ZHSA 4ASUA 5I9IA 2XKJE 1ZNWA 1U1IA 3S5JA 3GH1A 4ALKA 1NUQA 2QX6A 2M6LA 3VH4A 3ZD7A 4PRYA 3TD9A 4DKXA 1Q0SA 4E2FA 4EVRA 5CEJA 1A7JA 1D2CA 2A0UA 2DE0X 3CU5A 1XZ8A 3SIXA 2P9YA 2FQXA 5K4GA 4HKTA 8AT1A 5JNLA 5KKNB 2RI0A 4LNAA 3PFNA 3VAZA 5AW8A 1JA9A 2GLXA 5GZ1A 4OSOA 2Q45A 4IZOA 4MAMA 4FLEA 2AN4A 1ZK0A 3ETDA 2ROQA 3O9VA 1B23P 5IAOA 5D3MA 1PJRA 1TQHA 3K9BA 3GRRA 2I7CA 3DT9A 3RO7A 4C07A 3PPIA 2WAOA 3G02A 1JAZA 3HB4X 2PV0A 3W6OA 3EGEA 4PZCA 3KPJA 4PANA 2FPWA 3NHJA 5KOYA 4BJ6A 1NYQA 4INZA 4O2AB 3C85A 1N6KA 3NFYA 3FYUC 2V7EA 3PCRB 1XJQA 1YR8A 3CISA 3FYCA 3NOQA 4BMVA 4G5HA 2N75A 4Z0NA 3ZQKA 5ESXA 4JXXA 3AR2A 1ZINA 3DDNA 1I36A 3DV0A 4JCCA 4QUAA 1GA4A 5BWLA 2OBLA 2IXDA 1KKLA 5AM0A 4ZVVA 2AJBA 3WADA 2X6TA 3OOJA 2IUFA 5DIZA 5DO9A 3T35A 2HC9A 3UJAA 4RMIA 4K0RA 3LYAA 4R31A 5EIBD 3RANA 2G40A 4MLDA 4IWXA 1P31A 1J97A 1FZQA 2QAJA 4Z3DA 3V7WA 3FB4A 5DF1A 3L7MA 3V4RA 1B42A 1GG9A 3LI2A 2WWVD 3WRXC 2HU7A 1RU3A 3LWZA 3V4SA 4F9TA 4JYAB 3LO8A 4TLAA 3E5MA 1NVDA 2AHOA 2BFNA 2ZANA 3CLTD 3FM9A 5KNDA 1Z3IX 2ASVA 4RWEA 5IH7A 2PG3A 5E1MA 2CNBA 3E53A 5DHFA 2R79A 4GS5A 5BXQC 2OWEA 1SY7A 1IYZA 3MT9A 3IH5A 3DW1X 2KB0A 1L8QA 2O2DA 3LHIA 1KP3A 3KT6A 5C1IA 1Z2PX 1HDEA 3A14A 1TK2A 3WBFA 3F73A 5JIBA 1OROA 4LDQA 5AXDA 3E0XA 5JFTA 1QFZA 3FKQA 5CT9A 3RVJA 1QGOA 2LWIA 4N6GA 3F5QA 5H8WA 1O6FA 1YB4A 4EG7A 2EKPA 1E9FA 4Q5IA 1A8PA 1QO7A 1D6JA 2CJPA 5C4IA 3GHHA 2AQ8A 3TZCA 5LA6B 1ZM4A 2EKDA 3HUDA 3MS4A 3LA8A 4PYRA 4YR9A 5KOIA 2RONA 2Y1WA 3BA1A 4JJ6A 1AO0A 2JKYA 1DAKA 2BGIA 4GHWA 4KACA 3GLUA 4GOLD 4KUGA 5L3RA 1T1IA 1KMMA 1FFHA 2EF1A 3WDSA 1F7UA 4L8FA 1E4VA 1NXSA 2OAEA 2P3OA 3DAGA 1D09A 3D1LA 4LJAA 2I4LA 4R68A 2BKEA 4XGQA 3W06A 3ZPXA 1Y42X 4D46A 4ROTA 5KJFA 1E4EA 2DQSA 4JL5A 4EZBA 3AINA 4P33A 4PONA 1U1GA 1UFRA 3M5CA 5FOSA 1V7PC 2OFPA 4G5GA 3WB9A 5LIRA 1RYZA 4MWOA 5KSZA 4RJLA 3UY4A 1Q1AA 1VI2A 2JFBA 1JSXA 2WHYA 4ZEOA 3TL6A 4TL6A 3WIBA 3T3OA 3LWBA 1Z5WA 5GM1A 2DWQA 1FP1D 2PGXA 1U2QA 1JKJA 3IDSA 4OHRA 2E4VA 3B6IA 3WDKA 4YRKA 5LQCA 1V47A 2ATIA 3GVCA 4FONA 2RARA 4PYMA 4I50B 3MS7A 3LY8A