3CF6R

Structure of epac2 in complex with cyclic-amp and rap
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
162
structure length
150
Chain Sequence
EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/gtp-binding protein
molecule keywords Rap guanine nucleotide exchange factor (GEF) 4
publication title Structure of Epac2 in complex with a cyclic AMP analogue and RAP1B
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cf6R00
3P4XA 4M9XA 3RRMA 4AKGA 2W6JD 2OILA 3EZ9A 2IS2A 2OEPA 2GDJA 3GCGA 4N0DA 3QIAA 3LH5A 4E09A 1XF9A 4JS0A 4OI1A 3U61B 3VKHA 4B3XA 1GL9B 5KU1A 5CYOA 5JS7A 2YYZA 2ZI6A 3NH9A 5KNBA 4PC2A 1F60A 1KOFA 1O87A 2GKSA 4LHZA 4DSOA 1UFQA 5EE0A 5KSYA 1T8TA 2ZRIA 5C4GB 4D0NA 2XZPA 5HR5A 3A4MA 5FPYA 4I1SA 4EFLA 3FHCB 1GVNB 1I2DA 4HAYA 2W6IA 1E2DA 5G40A 1LNZA 3QXXA 5FOTA 2V7QD 2VL7A 2WWYA 4GZLA 1JQJC 2AK3A 1LF5A 4YDSA 1OH6A 2F9LA 2ZR9A 2J7PD 4AURA 1MABB 3LD9A 1U0HC 3CM0A 3EZ2A 4C4PA 4ZO4A 1OXUA 2MSDB 3K9LA 2CMKA 3R7WB 5B30A 3EZ6A 4WXRA 2HEIA 2GA8A 3Q3JB 3SFZA 1GM5A 3C7KA 1AA9A 3REFA 3ZLJA 4D81A 4P4SA 3OFNA 5JCPA 2IYZA 3KXLA 4KAXA 4K46A 2HYIC 2HXSA 4DLRA 1PLLA 1ZD8A 4MYTA 4C0LA 3W5JA 2ZRMA 2GZAA 2AFHE 2NO1A 2OHFA 2REXB 3LRPA 1XEFA 2LCFA 3FFBA 4I1UA 4PQFA 5E7JA 4Q66C 4Q9HA 2DWPA 2ATVA 3A58B 1TPZA 3B5JA 1COWD 4KFSA 4LCBA 1II8A 3ADDA 3EPLA 1VYVA 2FEMA 3SNHA 1VCOA 4PC3A 3BB3A 3QBVA 1RPZA 2XEXA 4DKXA 3QQ5A 3AB3A 3UMRA 1KK0A 3LBHA 2CLDX 2Q0HA 2ZE8A 4MGKR 1SVSA 4A2QA 2WPDD 3RWMB 2R65A 3UK6A 2VHJA 1U98A 5JRJA 4EPVA 2WJVA 3FKQA 1AGRA 4Q4HB 5TMPA 4ZKEA 1G20E 3ASZA 4A92A 4OQLA 1NSFA 1CXZA 2PCLA 3LO5A 1P60A 3L43A 1JR6A 4LGMA 3UIEA 3VTKA 1Z0JA 1WBBA 1QHGA 4B32A 1W46A 2X77A 2AN9A 4B3GA 1GFIA 2JIZA 4BUJA 5DIFA 5F2EA 1FW6A 2DB3A 2G1JA 2ERXA 3WYFA 2FGKA 1E2JA 2QSZA 3A36A 3OEED 2PLRA 2BEKA 3HJNA 1RYFA 4A1FA 4IW3B 3AM1A 1WA5A 1FNMA 2QPOA 2IHBA 5AWFC 1R5OA 1II0A 2DHRA 3H2YA 3WNBA 1E9DA 2WSMA 2BIFA 2NOAA 4MGYR 3KB1A 4OKSA 3KQHA 3OE7A 3FPAA 2GVZC 1WCV1 1H8EA 4UQOA 2CVFA 1U9IA 4BFZA 4XVUA 3P32A 4LYAA 1E9SA 2P5SA 2AHOA 4KVAA 2KWIA 3SJCA 5C2JB 3LVRE 3RS5A 1QG2A 4BRWA 3LBNA 1KI2A 2H7VA 4CW7A 3KQUA 1FZQA 1G5PA 1QHYA 1KI7A 5CIQA 3R8FA 2X19A 2VSXA 4WOPA 3N2EA 2C2HA 4GI7A 1W4AA 1OHHA 1I4DD 4IOJA 1NMXA 4ERNA 4PZYA 3AVVA 2IYYA 4Q02A 4B2LA 3THOA 1G18A 3GMTA 4R9UC 1KSJA 1W4CA 4PX9A 3W6NA 4BFWA 2BKUA 2GCOA 3I1FA 3MMPA 5FBQB 5IK2D 3IHWA 3LBIA 1E1RD 5E3HA 4WW0A 1FMLA 3NIBA 3WYGA 1N3BA 1NVWQ 2VP4A 4HI0E 4KYIB 2EFDB 2V6JA 4PPNA 4ZIRA 3WYAA 1KY2A 4L4UA 3U7FB 3X1ZA 5KNDA 3EPHA 5IF9A 2QZ4A 5K8IA 1T0JB 1W0KA 4CEIB 2VHQA 3KTAA 2FFQA 2OBNA 3BGWA 5FUYA 5P21A 3AP2A 4CGZA 4JLPA 4JKIA 3MUFA 1P2VA 2J0QA 2X1VA 3QBTA 2GEDA 3FFAA 1N5KA 3DM9B 3TR0A 1LFDB 2ZREA 3CIOA 2VYFA 5CM9C 4ZDJA 1AZTA 1W44A 4IOLA 3PEVA 4PAMA 3U7GA 3CNLA 3I92A 4WZAE 5JECA 3DMNA 2GWHA 3GJ6A 5F3WB 5CK4A 2OESA 2Z4RA 1TF7A 1DEKA 3LX5A 1HTWA 4Z8YA 3K0SA 4BPBA 4PFSA 2V55B 2GAOA 5JBQA 1GRRA 3THYB 2Z0MA 1KHTA 4BFUA 2QEQA 1B23P 1VIYA 1Q21A 1TF2A 5E7MA 2SHKA 4BLOA 3KQKA 5M04A 4QBFA 3U3KA 1EESA 4V0LA 4JLKA 2BDTA 2QRZA 2O8BB 1M6NA 1EFTA 4LYHA 4D4KA 4JYCA 4BGDA 5AUPB 3LQRA 1F48A 3OIWA 1YJ5A 3QF4B 4F7WA 2BVNA 4C3ZA 4FIDA 4B71A 1E2EA 3CWQA 4MGIR 3KFXA 1ZNXA 3FMPB 3IO5A 5FPTA 3WNDA 1XEWX 2ECKA 3MRSA 2QAJA 4DT1B 2IL1A 3TGPA 2FFAA 1A2KC 4Q4JB 4K8OA 4PO8A 4B48A 1IQPA 3E5HA 4JMPA 2BWJA 2D2EA 2H57A 3DMDA 4PSAA 1JNYA 2NZJA 1LV7A 4M4SA 2BBSA 1NJGA 4BLTA 4URYR 5GJCA 3JZAA 2VP2A 2F43A 4G5RA 5GJVC 1TMKA 1CTQA 1VMAA 1NL3A 4TYQA 1NG1A 3NC0C 1X1RA 4NYJQ 1XBTA 2FV8A 4FWIB 4B33A 1G8FA 3CRQA 1A2BA 2W0SA 2YHSA 4RZUA 3ECCA 3R20A 4HDOB 5TXGA 4JJKA 5CITA 4HAWA 3CO5A 3KJGA 2ZEJA 1XJCA 2P6UA 1M34E 1TTTA 4YONB 3OIYA 4GZMA 5HE8A 1G41A 4C0SA 3GLIE 5BN5A 2FSGA 5L3RA 2BMFA 1Z29A 3Q85A 4HATA 3AVQA 4YMVA 1IY2A 1Z6GA 4URZR 1F2UA 3KJIA 3SFVA 5CB8A 3SQWA 1Z0AA 2IEYA 3B9QA 1C9KA 4QJ4A 2P0EA 2GZHA 3B7GA 5FL7A 4TLDA 3CRW1 4LJAA 3T61A 2G1KA 3CR8A 4M1SA 4Q47A 1DO0A 4PSKA 1E4YA 4GMXA 4JJZA 4MKGA 4MUBA 2XJ9A 4B6FA 3H86A 4F4JA 2C99A 1FTNA 2ZSAA 3HYTA 2WJJA 1Z6YA 1FTSA 2QMUA 3KJEA 4JVLA 4DSTA 1U90A 3BERA 1X3SA 3OIVA 1GP2A 3A1TA 2I1QA 2RGXA 2XGJA 1O3YA 3A1VA 4OBEA 3D8BA 3K0CC 3T35A 5KUTA 4OJKA 4A8JC 1VG9B 3ZQJA 4YMWA 2P6NA 1G16A 4HDQB 1NKTA 4WBSA 1XFAA 4LV5B 4WVFA 1HYQA 3TLXA 1ZM7A 3QENA 5EP2A 5FUWA 3ZVRA 2NO7A 4CRWB 4JLMA 3SOPA 3V4RA 1E2NA 1JAIA 4HLUA 1US8A 5GADl 2QPAA 4M9ZA 2OV2A 3AKDA 4QXAA 5FR1A 1XEWY 2DFKB 2FX3A 1CKEA 1GTVA 4ZDKA 3ICQB 2CK3A 1Z6TA 2J1LA 3DVLA 1U94A 3HU2A 3NEJA 4JLJA 4PQRA 3QEOA 4C0BA 3AF0A 2QTFA 5H8WA 3WXMA 3AF4A 2ZE7A 2QI9C 3MD0A 1HT2E 5J40A 1NLFA 3AH8A 4JBWA 4JBXA 3TSOA 3THXB 2VP6A 1GILA 3ZZTA 1CJVC 3WNCA 5DN6D 1GDDA 5D3QA 4V02A 1TUIA 4N1AA 3EC1A 1Z5ZA 4IVPA 4EPRA 2YINC 1TEVA 3ZQ6A 3TH5A 2Q21A 1E2IA 1OLOA 2R6DA 4KO8A 4Q18A 3QKSB 5JMTA 3NBZC 4QM6A 1J70A 2QUZA 1ZUNB 4QG7A 5HKKA 3IDQA 3CH5A 3NXSA 1JECA 5KSZA 1LF0A 3N2IA 4HDCA 4LJ6A 4H1UA 4DCSA 4Q7MB 1ZUIA 4X8MA 2ERYA 2WJIA 3QY0A 3VR4A 1MOZA 2PX0A 3WMEA 3CBQA 1NN5A 2OCPA 4CT5A 1FUUA 4HAXA 1U8ZA 4NYJR 2JEOA 2ZUBA 3GJ3A 1XD9A 2REBA 1G291 1YZKA 2ZRGA 3C16C 3MLEA 3A4LA 5FFMA 4PPQA 4RD3A 1VDZA 1G5RA 3GQBA 4QHYA 2XOKA 3B60A 2R6GA 1TAGA 3EARA 2YWHA 3K70C 4KJZA 1PZNA 2PJZA 4O2RA 1PLKA 4UXJA 4ESHA 4XWOA 3VKWA 2MMCA 2GXSA 2YWFA 1W5TA 3GLGB 1U8YA 2WM9B 1WRBA 2OG2A 4Q1CA 3WMGA 3OAAD 1RRFA 4LRWA 3W34A 3ADCA 2XNDD 3L8ZA 3RRNA 2O8EB 3T1VA 1VPLA 2ODWA 3H0KA 4O0MA 2Z5FA 4Q7LA 1IBRA 2Y8EA 4PR0A 2CJWA 4MRVA 1ZINA 2PBRA 3QVUA 1KTVA 3QKUA 4NBSA 4KI0A 1RRCA 1DBSA 3ZD6A 4HSEA 3KB2A 2OFOA 3SYLA 2QE7D 3TW4A 1E0KA 4IVRA 1GL7A 3K70D 2FU5C 4US0R 2A9KA 1MO6A 3B6EA 1ZVQA 4GSYA 4IHQA 4DSNA 1Q1ZA 2BMJA 5BWMA 2JLXA 1E32A 1II9A 4Q9KA 2G0NA 2F9MA 3L0IB 4IFEA 3FKSA 4L9WA 4ASUD 2Q3MA 4DRZA 2A7QA 2QQ0A 1P9WA 4B2IA 2RGNC 3AF1A 1TADA 2WWGA 4NYIR 2D2FA 1SHKA 4Z54A 3T06B 2VQSA 2ZRFA 1HH4A 1KO8A 1VG1A 4X8OA 3UXMA 2JLWA 3ZGXA 2QM8A 2MMGA 1ANKA 4L9SA 1DG3A 2WHXA 1FOEB 3UANA 4B43A 1IXSB 1HE8B 2HLDD 1JXOA 2NO0A 4HZIA 4RJLA 5L3VA 2N42A 2WKQA 1KK2A 2F1IA 1Z0KA 4PO9A 4CF7A 2AKYA 2A5FA 3D31A 4OHZA 2Q6TA 3B1XA 3KKNA 2B92A 4NDZA 1G8YA 1QRAA 5HPYB 1FQJA 4GFDA 4WXPA 2AK2A 1XTKA 1T4GA 2XSZA 2VA8A 1OYWA 5FOWA 4LHWA 3QE0A 1S3GA 2C9YA 2ZRCA 4YXWA 4FCTA 3QEJA 3M0EA 3GJ4A 3HPRA 1PLJA 2B6HA 3JZMA 3LLUA 4JLOA 4RZ2A 2WV9A 4CDGA 2HF8A 3NBXX 1G6OA 1KJZA 4HEJA 4QJ3A 2JLYA 4AYTA 1QHHB 1KDTA 1QBKC 1T91A 1G4UR 3GLHE 4UNSA 3U4QB 3OEHA 3QOFA 1K6MA 3DDCA 4K81B 4TQAA 2FSHA 3X2SA 3ZS9A 1A7JA 1T5LA 5FTLA 2ZANA 1JPNA 4M8NE 1SXJC 2FEOA 1W2GA 2N46A 1VCNA 1J8MF 1KDOA 3H1TA 2D62A 2IUSA 2YOHA 2WTUA 4LV8B 1FL9A 1RJ9A 2WSSA 1W49A 3SN6A 3ZVLA 4GL2A 2C04A 3IEVA 4FXPA 1R5BA 3E70C 2VLIA 5CLQA 1IN5A 2IF0A 4R2IA 1W7AA 4XVRA 1G19A 4RD0A 1AK2A 2CE2X 2XX3A 1YR9A 2IUUA 4YQFA 2EFEB 2A78A 1FMJA 4AG5A 4DLZA 4HAVA 4ARZA 1D5CA 1L7VC 3U44A 4P33A 1W47A 4US1R 2OXRA 1UPTA 2FNAA 1F2TA 2AD5A 2FGJA 3NG1A 1IHUA 1UM8A 3EZ7A 1P9NA 2ORWA 4YMUA 1SXJD 1G9XA 5EJEA 3P27A 3SE0A 2EFCB 2WWXA 1CJUC 4EPYA 1JXMA 5J47A 1NLZA 2GHIA 5L3QB 4B47A 3VX4A 3TSWA 1OFUX 2ZS7A 5SZKB 2VSOA 4DLWA 4QBIA 3TMKA 4Y0VA 2GK6A 2BBWA 4IDNA 5HZHA 1EFUA 2HJGA 3I4LA 2CNWD 4GMDA 4LBYA 1QDEA 1UBEA 1YZUA 4D80A 3GLHA 1JEDA 2O8DB 1F6BA 3L8YA 4JL6A 2QP9X 2GXQA 4HAUA 1MH1A 2GILA 2WICA 4F4CA 1S1CA 1ZP6A 4NP6A 3Q9LA 2BBTA 4DDVA 1WB9A 2IS1A 3P1JA 2GF9A 5FL3A 5L3SB 2ZYTX 1ZM3A 1KKLA 3BFXA 4XH9B 2VHCA 4CEJA 1BIFA 1BYUA 1Z3IX 1GKUB 3EXAA 2LKDA 3WRYC 3KZ1E 2QTHA 2EFHB 5B58C 3VR3A 1YR8A 3GLFA 2PT5A 4OJQA 2DY1A 1ZNYA 3VR1A 3K09A 5JWOA 1FP7A 2R44A 2ATXA 3HYRA 2GJSA 5HZKA 2WAYA 2G3YA 2E87A 1E2HA 1N6KA 1XXHB 3HU3A 1CRPA 2X2EA 3C8UA 3ETLA 3I8XA 2PMKA 1E9EA 2WKRA 1BMFD 2YC2C 3LFUA 4JT2A 4A9AA 2O8FA 1L4YA 1I4TD 3AUXA 1G7RA 4BZQA 5FUXA 2QMOA 2QBYB 3T15A 2GAAA 3K0FB 4XWAA 1KI9A 2ZE5A 4O25A 1NF3A 4M53A 2JJ2D 1DARA 3VNUA 1E2LA 1S9DA 1GOTA 2IS4A 1GRNA 3DZDA 2IYXA 2IA5A 3CX7A 2ZAMA 3TE6A 4LYFA 2Q9AA 4V0OA 4CVNA 1AS2A 2FFHA 4CEHB 4B6EA 5DI3A 1SKYB 1X8JA 2G88A 4Q19A 2R6FA 5JI2E 2JLVA 2LKCA 3NHBA 4Z8XA 2MSEB 3RRYA 1PUJA 1OH8A 4QHSA 5EUQB 5KDOA 1AIPA 1D2MA 1P6XA 3OZXA 1YRAA 4ZCMA 4AC9A 3THWA 3WBJA 3CZPA 4Q1AA 1BYIA 1QF9A 5JJLA 1KYIA 1KJYA 2VO1A 4LBVA 4DUGA 5SZJA 5JRZA 1N6OA 2RAPA 3U3OA 1E79A 2EVWX 2VEDA 4CYMA 1KNXA 3TUZC 4MRPA 2KBFA 3FE2A 2P65A 2OM2A 3L2OB 3ZIAD 4P31A 3E2IA 1W36B 3K0AA 3OHMA 3CX6A 4Z1MD 5EP4A 3AVYA 2CL6X 4MITA 4IXMA 5EE9A 4X8LA 2V8OA 1K8RA 1RFLA 3CW2A 4P4SB 5A0FA 4F92B 3W3ZB 1OH5A 3Q5EA 1MO3A 4L8GA 1YRBA 2J0VA 4DVGA 4QBHA 3PUWA 4LZZA 4MKHA 4DHEA 1M7GA 3B1WA 4PC7A 1E2FA 5BN4A 1N6PA 3RS3A 2OCBA 3IEUA 1SHZA 4ZI3A 5DSZA 1II8B 1E99A 1N6LA 1E0SA 1AQYA 1Z0IA 2ZITA 1OIVA 1NVVR 1G17A 4DIEA 4DWJA 4GNKA 3VNVA 1GNQA 3F3YA 2HYDA 3ND8A 1Q1BA 3RDPA 2UZ3A 2IK8A 4V0ME 4XD7D 3GD7A 4C9BA 5BN3A 4D26A 3GEIA 3O8BA 3T5DA 2BM0A 1DE0A 1NN0A 4JVNA 1E0JA 3GJ7A 3FVQA 4HLDA 3EPJA 1WF3A 1DAHA 4A0GA 121PA 1XMSA 4UJ3A 4ZPXA 3PEUA 4JL5A 4P32A 1DAMA 4KV9A 2RHDA 3V00A 2C9OA 1NY5A 1XTIA 2RMKA 2W6JA 2ANCA 1KY3A 1R5NA 3DOEA 4UNPA 4YC7A 5HTKA 5GVRA 1D9XA 4TMTA 2ZJ2A 1SULA 1G64A 2GTPA 4TT3D 3U3MA 5CDFE 3CONA 2J5XA 4PC1A 1VHTA 1RIFA 3TVTA 1DG1G 2JCSA 3K0EA 4DLXA 1QZXA 4LI0A 3PR1A 2YOGA 1Y63A 4FN5A 2GF0A 3RABA 3V9PA 1CULC 1NRJB 2AX4A 1RW4A 3IUYA 2VPPA 4A0HA 3K1JA 3I3SR 1YQTA 1KDPA 3GFPA 2V7QA 3RS4A 4D4MA 1GUAA 3A4NA 1EFCA 3KX2A 3SS8A 3BWDD 4C0KA 2J7PA 2CCJA 4I99A 4TMVA 3PUVA 3N70A 4FINA 4I4LA 5ANRB 5JWHA 2JLRA 4AD8A 4RD4A 4HZUA 1TU4A 4H1VA 4DCNA 1TU3A 4JLAA 1D8TA 3AEZA 4V0MA 3DEFA 2ZTSA 1CR2A 4R98A 4Q9IA 3PEWA 2GCOB 4FI3C 3PUYA 3PUXA 1G4AE 4Q1EA 2JDID 2RGBA 1E1QD 4PHFA 4D6PA 3B9PA 4LC1A 1OXTA 3L0PA 5B57C 4ZIRB 1AKYA 2HV8A 3MCAA 4AKEA 4D4JA 1COWA 4LHYA 1S2MA 4OYHA 4PAOA 4Q48A 5JHHB 3KTAB 3IQWA 4DLTA 1MRSA 2WPDA 4BEJA 3X1WA 3FB4A 4UNQA 3W6OA 3W8NA 1AN0A 1OV4A 1ZM4A 3SC3A 1HV8A 1E2QA 5B2ZA 5CDFA 4PQYA 2G83A 3WY9A 1TF5A 1VECA 1XX6A 1KIMA 4L16A 4NCKA 4OHYA 4A36A 2IS6A 3QUSA 3VR2A 1F5NA 2EW1A 4NTZA 2RGEA 4B76A 4URVR 4FD2A 2RGDA 3B2EA 3WRXC 1KAGA 4Q7JB 1AS3A 3GJ5A 4FMCF 4QGFA 4MDFA 1LS6A 4IKEA 5IRCD 4QL3A 3BD9A 1G3QA 1KNQA 3IQXA 4D82A 1NN3A 1Z47A 3B1ZA 5H70A 2IYVA 3I32A 4FCVA 2ZR0A 4PXAA 6Q21A 3OEEA 1T6NA 3GPLA 3NHAA 4OQMA 4TYWA 4GOXA 3TRFA 2GJAA 2QY9A 2JLSA 2V1UA 2YNMA 1R8SA 3BC1A 3FMOB 1NLYA 3HPQA 3P20A 5UKDA 1CF4A 2GESA 4MRNA 1EX6A 1H8HD 3CRMA 1ZJ6A 2CCKA 1SVLA 3NEYA 4G1UC 4LHXA 2EWVA 1T3LA 2R8RA 2H5EA 4EPWA 4IOMA 1KI3A 4IDHA 3MJRA 2O52A 1UDWA 5FPKA 4KODA 3CRRA 4OK5A 1UBCA 2FPKA 1SVKA 1A5TA 1XJQA 4IJMA 5L8VA 4KLNA 2QG6A 1LB1B 3Q7QA 4RKFA 4JVSB 5H1YA 4OQXA 1RRGA 4M9QA 1WDTA 2O0JA 1PUIA 1ZU5A 4AKIA 4HLUC 4P4TA 1G3RA 4EUNA 5G41A 1EG7A 1OKKD 1CJMA 3TK1A 2IHYA 5IK2A 1KI6A 4XWKA 2MSCB 1E96A 5EZ5A 3EPKA 2F43B 1E1RA 2JASA 1KZGB 3NBFA 3Q72A 1N5IA 1P72A 4ZCIA 3LWNA 5E4FA 5JEDA 2ODBA 3SQXA 4KHZA 3CUEF 1WE2A 1G6HA 1YHNA 2OCYC 5JSZA 3JVUA 1CP2A 3EWSA 5CLLA 1Q1EA 1CU1A 1L2TA 5JEEA 1U81A 2QM7A 4TQUS 1LW7A 3TSZA 4W9MC 2D3WA 1P61B 2C03A 2OFWA 2VIIA 4KSBA 2ZAOA 4POAA 2XXAA 1NJFA 1QVRA 2EFGA 3QXJA 5JFGA 4UJ5A 2A5YB 1TQ4A 3U7HB 2C78A 4OHVA 1P73A 2G77B 4C2TA 1ESMA 1EFHA 2P3SA 4XOIA 1R0YA 1VYUA 3ADKA 3ICEA 3LLMA 1XPOA 2FH5B 2B8WA 2ZJOA 1E9CA 1F2UB 1NN1A 2C98A 3FMIA 4B3FX 3VHLB 4TYNA 5A5GA 3TAUA 2IUTA 4EDHA 4ZKDA 2NO9A 1JEEA 2DYKA 3EA5A 4QFMA 1RZ3A 4NYMQ 4KFUA 4QNRA 4AWXA 2HT6A 3ADBA 4IRUB 2IWHA 2CEAA 2PCJA 1CEEA 2QGZA 1G3IA 3PVSA 4TTRA 4WZ6A 3CPHA 4J0QA 4U5XA 5EXXA 4B35A 1Z0DA 2IYRA 2LWIA 4MYUA 3I73A 2J0SA 1Q22A 4PHGA 3QG1A 4ZDIA 4PSVA 2RH5A 2O5VA 3RSLA 3HU1A 1VG0B 1ZC3A 1Z0FA 4ZCLA 3EWAA 3HWSA 4FMDB 3SR0A 4B3DA 5FH9A 1JBKA 5ELXA 2IEZA 4HLCA 1QHXA 4LX0A 3AP3A 1WBDA 4KBFA 2PJRA 2ZJ5A 3CPJB 1ZM9A 1X8LA 2ZI4A 1X86B 4QRHA 1D2EA 1US8B 2ZPTX 1P7CA 2DFTA 1Z22A 5J4VA 5JHGB 4NH0A 3WP1B 3ZVMA 2NPFA 5K8TA 2DWQA 2YV5A 4BECA 3FDIA 1E6CA 3DHWC 3MSXA 3RVBA 3LQQA 2RHMA 3VQTA 4EJSA 1GG2A 1JB1A 3MG9A 4US2R 5HCIA 3ZJYA 2P5TB 4MYCA 2QP4A 3B1YA 1VG8A 3GEHA 2XTZA 2QORA 3R8CA 3TW8B 3GLIA 2H92A 2ZRAA 3W8RA 1Q3TA 2ZU0C 5D3MA 1H65A 1HEIA 1OXSC 1XEXA 4LK2A 5FOUA 5KOYA 2Q9BA 2YVUA 1Z2CA 2ZYWX 3ZS8A 3RLFA 4TMZA 3L0SA 1NG9A 2JA1A 3TVDA 1X8KA 3B78A 1ZYUA 1OJLA 4G5GA 4WAUA 3DZ8A 5AUNB 1IY1A 4LC0A 1Y3AA 2OE2A 4EQ6A 4NCHA 4AYWA 2ODNA 3QKTA 2Q9CA 4JT4A 2XZLA 1XJ0A 1Z06A 1NMZA 2VSFA 3WHKA 2ZRBA 4Q9LA 1D6JA 3CZQA 4UXIA 3TQCA 3AKEA 4OI0A 1KK1A 4BWYA 3MFYA 4LJYA 4A0RA 2AR7A 2ZS9A 1TEXA 3T5GA 3AVTA 4L15A 3TKLA 2IT1A 2A3RA 3SHFA 2WWIA 2QMHA 3NDBB 3DM5A 1MT0A 4M1KA 1W1WA 3RANA 1KGDA 4HAZA 2PX3A 1WXQA 1XTJA 5KNCA 1QVAA 1G7SA 1XCPA 5CB6A 4PPFA 5FOVA 1N6NA 4GP7A 1W0JD 3DKVA 2NG1A 2CXXA 1P62B 1C1YA 1IN6A 1S9HA 1TUEA 3EIHA 5HCNA 4DLSA 1XRJA 3V4FA 3B82A 3IIMA 2CJWB 2WOOA 4TL7A 2GK7A 4JKYA 2ASEA 2AWNA 3VFDA 2NTYC 4A0FA 1P4SA 1WQ1R 5K8UA 4FWTA 2GNOA 4M2LA 5TDHA 4MKIA 4NCNA 2BMEA 1GITA 1XMJA 3F0TA 1GIAA 1G3MA 1JR3D 1EWQA 2VTKA 2E9SA 3VR6A 2CHVA 1ZNZA 3AVOA 5FPHA 4A2WA 3VU9A 5EE1A 4KLZA 4A8JA 3A8TA 2YC4C 3TJZA 1AZSC 3CKLA 5DN6A 1UEIA 3ZDQA 3K8YA 1AS0A 1FFHA 3FGNA 4DLYA 1YZTA 3UWKA 4KCGA 2VH5R 4N0EA 2A5GA 4URXR 3BFKA 4LJ5A 4PZLA 2OAQ1 2I1VB 2IYUA 4XSHA 4V0NA 4TL8A 4EPXA 1R8QA 2FSIA 3DKPA 2AKAB 1L8QA 2GJKA 4A82A 2GCNA 1XD2A 2J0UA 3SJAA 3J81k 5EE3A 3TQFA 1HY3A 421PA 2ZRJA 2VBCA 3NWJA 2C77A 1Z08A 5G53C 5F9HA 3AVXA 3BBPA 1K5GA 2V3CC 1RE0A 3FMFA 1GKYA 4CT4B 1J7KA 4QGHA 2WBLC 3PJRA 3BJIC 4GOJA 3PV0A 5J5CA 5KDDA 2F1HA 1V5WA 4Z51A 4NZYA 2GZDA 3K53A 1MO5A 4OI4A 4EIWA 3LW7A 2GBLA 3K9NA 3R9XA 5EXSA 1XNJA 1IOZA 4HB2A 4M1MA 2C9CA 2QA5A 1R0ZA 4B2PA 1NBMD 1OF1A 2N1BA 1SZPA 2IYWA 4RVCA 3OAAA 1RJ9B 2ZQ5A 3VR5A 2XNDA 1UDXA 5TB5A 4M9SA 1E9BA 2J7KA 3ZH9B 2X2FA 1G21E 2EWWA 2NMVA 1ZNWA 1A4RA 4F38A 1Q12A 5GJWC 4DC9A 3CNNA 1OFTA 2Q3FA 3GJXC 4FW9A 5EZ6B 4ARZB 3U44B 1KMQA 4G0NA 1ZIOA 4UNNA 1IN8A 1J90A 2QE7A 4HLQB 2GXUA 4EFNA 3BXZA 4AI6A 3EW9A 2DFNA 1F2TB 1G7TA 1AKEA 4A15A 1EXMA 5FOSA 3OESA 5KDLA 3T1TA 1YZQA 1YZNA 2EYUA 4ASUA 1ZD9A 2RB4A 5F9FA 4M22A 5DYGA 3IPYA 3QKRA 4TLAA 2QGNA 1P75A 4E07A 2HT1A 2ZVQX 4RCZA 5C46F 4R2HA 1G8GA 4OQNA 2JJ1D 3P4YA 1XDBA 5JWRA 4P0TA 3EG5A 3O47A 2WWHA 4P4UA 2HDNB 5JJIA 2FFBA 3UG7A 4ILEA 2BMDA 5B64A 3RC8A 2XITA 2V54A 1T9HA 2HLDA 3QI2A 5BQ5A 1DAEA 1XMVA 1YU9A 3GLHB 1WMSA 1SXJE 4B74A 4C0QC 3ZD7A 2V6IA 3AUYA 3IIKA 4NE2A 4R7ZA 4LPSA 1CJKC 1J8YF 1KMHA 3ND9A 4QKQA 4TSFD 5EXTA 2FWRA 1XPUA 3HR7A 1T0HB 5DISB 3AGQA 1XXHE 1JJVA 2CDNA 1DOAA 4RFSA 2FSFA 4CEJB 2QSYA 1S1MA 4Q5IA 4CIDA 1OXVA 4KFRA 3QPUA 1EFRD 3RNLA 3SYKA 3ZYCA 4LWZA 3GLFB 2WIBA 1BS1A 4RFVA 1UADA 1E9RA 2E1RA 3LDAA 2HCJB 3KJHA 3CH4B 2JLQA 1FQKA 3AKYA 4LJ8A 1CR1A 5AR1A 5G3YA 3G82C 5EXPA 2FDCA 3C5HA 2ZIAA 1HE1C 5G3ZA 4TMKA 3I62A 1W36C 1Z6AA 4C0JA 1N0WA 2VP5A 2O8FB 1L4UA 2ZYUX 4U02A 2BCJQ 2DPXA 1YZGA 4PC6A 1R10A 2WIAA 2QENA 1KKMA 1OW3B 4GP6A 4B75A 2NIPA 2H8KA 2W6ID 3T1OA 4D0LB 2AFIE 2GETA 4OI2A 2KB0A 2CBZA 2H16A 1G7CA 1SXJA 2WWFA 3IIJA 3HP1A 3TUJC 1U8AA 2AXPA 3AGPA 1GAJA 5FTKA 4D4LA 1T5IA 4BASA 5LDDC 1KSFX 3LNCA 5DI3B 3NVAA 1E94E 1W36D 5FR2A 4FMBB 3KKPA 1XCMA 3RC3A 1P2SA 4Y0AA 5LD2C 1OFHA 2WAXA 4Q1FA 2GXAA 3PFIA 3OFND 1KZ7B 2NO6A 3W3AA 2ZE6A 1P5ZB 4GT1A 1NIJA 3RYTC 3BB1A 3THWB 4Q4AA 4PO1A 5FBLB 2OT3B 2QPTA 2C5LA 2IBMA 4KBGA 2NZ8A 1ZUHA 2CNWA 4QBGB 3B13B 1TQ2A 1UKVY 2QAGA 1DAFA 4A4DA 1UBGA 3F5FA 1XMIA 3M1IA 5GVSA 1KSHA 2W83A 1S3SA 3EAQA 2WWWA 1LVGA 3IHLA 4RSGA 4LBWA 4MKFA 4A2PA 1DADA 3C4JA 1CLUA 3MWJA 3ZZUA 2XB2A 3ZVNA 3QSYA 2IXEA 2ZI7A 4QGAA 3BFVA 3CWZA 4EPTA 5CYPA 2YJTD 2ZM5A 1ZCBA 3BH7A 3K0AB 1R0WA 3SJZA 4JSTA 1NI3A 2O8CA 221PA 2OLJA 3K9GA 1U9IC 1ZCAA 3OIUA 1YE8A 4RD6A 3FHTA 1UF9A 4HUQA 4LJ4A 4GBMA 5DH9A 2JIZD 3FTQA 1T3HA 4BFVA 4JLNA 3IPXA 2OZEA 3DPUA 4NHOA 1Z28A 4XSGA 2NGRA 5KPDA 1EX7A 4TL6A 3NKVA 4V0KA 1CBUA 4TWZA 1BMFA 3TNFA 4C0AC 4F4IA 1UBFA 3PQCA 4ZDWA 2ZJZA 2F55A 1Q3HA 2DWOA 2WZQA 3SZRA 3O8DA 3A1SA 5FBWB 1DS6A 2ZJYA 4BZXA 1XZPA 2FA9A 2ZR7A 4NL4H 2HUPA 3OE7D 4Q4LA 2JJ2A 1H8ED 1X1SA 3D6TB 4M1TA 3G0HA 1HA3A 2EU8A 4B73A 1QG4A 4GPTA 3DL0A 2BKEA 5C1BA 4AK9A 5LD2B 4RKEA 5DHFA 4TYPA 1ZW6A 1G8PA 1MABA 4M1YA 3EX7C 2WMNB 2CHQA 1YR6A 1GL6A 1S8FA 4DBLC 1SVWA 1JAHA 1SKQA 2Z43A 3DOFA 3LY5A 1OHHD 2IYSA 3R7WA 5JZVA 2IXGA 2D06A 4MQBA 3RS0A 3PXGA 3BB4A 2OXCA 1IY0A 3CPEA 3I61A 4NKRA 2CL0X 1E2KA 2KI5A 2ZRLA 2YKGA 3U60B 1G1MA 3DO6A 1XTSA 2TMKA 4TZ6A 2J45A 3K9HA 2BHRA 1KSGA 1WP9A 5A4JA 4IEIA 1W4BA 5DYIA 4AG6A 4YLGA 3KKOA 1A82A 1W0KD 2J46A 1K5DA 1TQ6A 3PIRA 3SI7A 4PHTA 5J4KA 3MWYW 1Q0UA 4NCIA 1TL7C 2J59A 2CHGA 4OQFA 4JSYA 3UPUA 4F91B 4B3CA 4Q7KA 1JJ7A 4IDPA 2WMOB 2KJQA 4E22A 1GSIA 3ZIAA 3QVVA 2IF2A 1N6HA 1JALA 3JVVA 4Q4HA 5DLQC 4HZUB 2HJVA 2IWRA 4Z1MA 2GEVA 2OSBA 2R9VA 2ZUCA 4DLUA 3Q5DA 1E4VA 2F1RA 3CF2A 4ON9A 2IYQA 3UATA 1OFIA 3AKCA 4O3MA 2D7CA 5DHAA 1N6RA 2XJ4A 1KI1A 4LYJA 3SDZA 4KXFB 2XTNA 1BKDR 2F7SA 3KQLA 4I1OA 3SU8A 4YDHB 1XWIA 4DDWA 5J4HA 1EWRA 4G5QA 5EUMA 3NC1C 3PITA 1ZMXA 2FF7A 2J9RA 4UXHA 4B3BA 3PG5A 2VHUA 2QMEA 5DNYB 4L5BA 1KAOA 4Q9JA 4ITRC 5FI1B 4EFMA 1RC8A 3W6PA 5KO2A 4C2UA 1NP6A 3AQ4A 1XZQA 1E2PA 3NDPA 4XIGS 1KDRA 4XD7A 1XU4A 3KXIA 1DPFA 1E3MA 2DFLA 2UZIR 3A37A 4QHTA 1AQUA 3VMFA 4BRUA 1KO7A 3CX8A 3TUIC 5LPNA 3BK7A 5FTMA 3GFOA 3U2QA 1N2CE 1DVRA 3CF6R 5FBRB 3W9YA 3BIFA 1D9ZA 2ZJAA 1RVDA 2XAUA 1UEJA 1IN7A 2F1JA 3U3JA 1R7RA 4EAQA 1YVDA 4ACAA 1EK0A 1W48A 3M4YA 3B85A 3KDSE 5SZIA 3KKMA 1DO2A 1N0UA 4KVGA 4TT3A 1KO5A 3UMFA 3SYNA 3G5UA 4MRRA 1DELA 5JJKA 4MRSA 1S0UA 2ZRNA 1M7HA 2P67A 5E7IA 5J4LA 4PZZA 1KI4A 3BRWD 2Z83A 2C8VA 4DCVA 1I2MA 2J87A 2QRNA 2PL3A 3BAFA 3BH0A 3CF0A 5EP3A 3RRZA 1QHIA 3OF5A 5BYKA 4XJXA 621PA 1ZU4A 2VP0A 4HB0A 1GZSA 2YZ2A 4CEIA 3I5YA 5EP1A 3H4MA 4TLBA 4BEBA 3U6KA 2AXNA 2FZLA 2ZSDA 4RD2A 3Q8XB 5JS8A 1S96A 2J41A 2R2AA 1ZBDA 1IXRC 2ORIA 4DZZA 4TYYA 3QF7A 2F3TA 1G5TA 5C4MA 4I81A 1E2GA 1P2UA 2QTVB 1Z2AA 2NPIA 3D7MA 3IILA 2D74A 3EC2A 4DCTA 2GCPA 4DB4A 2QNRA 5FL7D 4BQSA 4QC2A 1KI6B 2FG5A 1ONBA 2CLSA 5TV2A 4MGZR 4QNMA 2JDIA 3LAWA 4LDJA 5DE3A 4DCUA 1E1QA 3PEYA 1OYYA 4EJSC 5TVKA 1IJEA 1M8PA 5JSZB 4JBYA 5AK0A 2WJGA 3TIFA 1HURA 2BM1A 4Q21A 5AJXA 4C0HA 5FBVB 1M74A 2OUKA 5KPJA 1TQDA 1N5JA 2IYLD 2REOA 1OIWA 3AP1A 1ZC4A 2QL6A 5CM8B 3THYA 1OT3A 1N0VC 4LBZA 5K8LA 4YMSA 1TNDA 4FMCB 2XXAB 4DXAA 3LXXA 3Q7PA 5CJ2A 1VTKA 3VHXA 4W5WA 5IT5A 4HYYA 2OBMA 5FUVA 2B21A 4DEXA 2A5DA 5FTNA 2O8BA 2ORVA 3AVUA 3I8SA 3LW8A 4E5UA 821PA 3NBYC 3LXRA 2FPLA 3QF4A 3D3QA 5CJPA 2ZU6A 4W7SA 1KK3A 3ZZ0A 2ZSFA 4B34A 3W90A 4C30A 3L0OA 4BLPA 5IHPA 2A30A 2BJWA 2ONJA 4R71A 4NCJA 3KUDA 5CK5A 5AJZA 2CL7X 1JI0A 1Q1QA 2CK3D 4XTRA 4FMDF 4DT1A 4G5OA 1XTQA 4Q4JA 1OSNA 2IYTA 4M1WA 3T1QA 5AUOB 2DCUA 3IBGA 3PENA 2BV3A 2JLUA 3QPVA 4WA7A 3C5CA 3X1DA 1T8UA 1OPXA 3EA0A 4PHHA 2JGNA 3AVWA 2YOFA 1AJEA 2BC9A 1AM4D 3EASA 5EQTA 1E2MA 2QQEA 3M6AA 2K5UA 3A1WA 2FPMA 4P3YA 1R4AA 3R9WA 3H84A 1H8HA 5HKKD 4C7OB 1VYTA 3QNUA 2VRWA 1QHNA 1HQCA 3B1VA 1PJRA 3GJ8A 3VKGA 4V03A 5FOXA 2CVHA 3A1UA 3QJYA 3SJBA 1IJFA 4D0GA 5JLJA 2PEYA 2ZRKA 4M0LA 2H1LA 2PZEA 4JIMA 1GKIA 4C7OA 4Q03A 1GNPA 1SVIA 3RS2A 1OIXA 3CB4A 4BE7B 2ZS8A 3EIQA 2XZOA 3WMFA 1ZIPA 4IVQA 4EJSB 1PVOA 2GJ8A 1Z83A 1OKKA 1IM2A 4IDQA 3SEAA 4QGGA 3AF3A 2W2TA 1SVOA 1ZRHA 2XOKD 5CIWA 2CCGA 4D2IA 3LX8A 4DJTA 3QXHA 5LBIA 4HUTA 3GLIB 3I5XA 2PZGA 2NQ2C 2VF8A 3UMSA 1G3UA 5D3MB 2Q3HA 2C96A 1XEXB 2WVJA 4GRAA 721PA 5IDVA 4N3NA 1NNEA 4XVQA 1SGWA 1UKZA 2B7CA 5SZHB 4RZ3A 2DR3A 1QHSA 4I1VA 4AIIA 4HB4A 1LS1A 4NYIQ 1N6IA 2ANBA 3MWKA 1RRPA 4QOSA 2KBEA 2HXYA 4NPHA 2AD1A 4EQ6B 2BBOA 2W2XA 4DB2A 4TTPA 4KU4A 3SHWA 3FOZA 4BZPA 1XD8A 1E98A 1ELOA 1LY1A 4ZI2A 2R6AA 2W2VA 1N5LA 2IW3A 2PMDA 3GLGE 1MRNA 3TAHA 2Z6VA 1BO6A 3FKSD 1E0AA 3NH6A 1SQ5A 1V43A 3O8RA 1XPRA 4JZKA 5TY0A 3QXSA 1UAAA 3QG5A 2OLKA 1TX4B 4TMXA 3THXA 4OHXA 5FPSA 2BOVA 2ZI5A 1CRQA 2OAP1 5KYKA 4MUAA 3X1XA 2GBLC 4BFTA 1B0UA 5GJBA 1T3SA 2WOJA 4G01B 2WKPA 4UKDA 2ONKA 3KKQA 3QKSA 2F3RA 2JAQA 1ESNA 2ZJ8A 4NYMR 3N5CA 1ZM2A 4LV6A 1YZLA 2EYQA 2P6RA 1OB5A 3CR7A 1Q57A 1P3JA 3CNOA 3BE4A 4RZXA 4EKDA 2XSZD 2Z4SA 5FI0B 5FTJA 4NMMA 5AJYA 3RS7A 3MWLA 3GJ0A 1VCMA 1ZD1A 4Q1BA 2DBYA 4YXWD 3O8CA 1YR7A 1PV4A 3KUCA 2G0TA 5AJWA 2PT7A 1DAIA 3MAAC 2ZI3A 3VU9B 4BFXA 2H18A 2IX3A 4S35A 1UKEA 1UJ2A 4A8JB 3UG6A 3U5ZB 2FJUA 1W2HA 2OBLA 4IFBA 3OEHD 1W5SA 5EE5B 4BFSA 4DLVA 1Z63A 1NY6A 2ZXUA 2KSQA 4LSGA 1P9RA 3K0CA 1NVXQ 2CLCX 3GFTA 2PEZA 4W5HA 3GLGA 4A6XA 1P2TA 1U99A 4BLSA 2WSSD 2O0HA 1JR3E 4KSCA 1S4QA 2O8EA 1C4OA 4WIAA 3VX3A 1DAKA 4IXNA 4JLDA 4ZV4A 2VF7A 4LJ7A 1VIAA 5LB2A 2QT1A 5BYJA 1DAGA 1HT1E 2J3EA 2ZRPA 1MO4A 4U7DA 1CR0A 2G9NA 1XD2B 2J0UB 4TN1A 1E9FA 5F98A 5BW8A 4JLBA 1SVMA 1ZAKA 2B8TA 1NSTA 2XB4A 4U00A 4A6PA 1X6VA 2FOLA 1OXXK 3S1AB 4G3XA 521PA 3UWOA 4DSUA 4IDOA 1NMYA 2IXFA 5KTYA 4DEYA 3P26A 3QXCA 1RKBA 4Q1DA 4X8HA 3S1AA 1IN4A 2ZROA 1MKYA 4LUCA 1XB2A 2GJ9A 4GDFA 4BFYA 1W0JA 3L82B 4OL0A 2QU8A 4UNRA 4PTLA 3AVPA 2WJHA 1ODFA 2A5JA 3EIEA 4MH0R 1W4RA 4LHVA 4XTCS 3K09C 4PPGA 2L0XA 1YKSA 4TTQA 1CS4C 1CJTC 2OO7A 3QPWA 4KFTA 4LOAA 2FZ4A 2FN4A 2ZSBA 2JLZA 4AKHA 3U7EB 3A6PC 2X8AA 1IXZA 5HE9A 2JJ8A 3K70B 1OB2A 2RKOA 4OK6A 5JCZA 1NBME 1OE0A 2PZFA 2QP3A 3AF2A 1JR3A 1AGPA 1BH2A 2R62A 2ZRHA 3QKRB 2C95A 2I3BA 4RD1A 3BOSA 4JLVA 5C18A 1FPMA 3F8TA 3T12A 3C15C 3WP0A 1MR3F 1DTSA 2A2ZA 4O2LA 5KSOA 1QHHA 1MV5A 2FMXA 2YWGA 1Z07A 5JI3E 5E95A 2BCGY 4IOKA 3U4QA 3GEEA 2UKDA 1FUKA 3CLVA 1R0XA 4TZ0A 2ZVPX 2BEJA 4WZBE 2O0KA 2GVDC 3PUZA 2D7DA 2CE7A 8OHMA 4MA4A 1Q20A 2I4IA 1CIPA 3KQNA 1G8HA 2OCAA 3SBEA 1FNNA 1FX0B 4BLRA 2OFXA 3GLFE 1JPJA 1KI8A 3U6BA 3IBYA 5H68A 2RCNA 2XNSA 5DGXA 3VAAA 2QAGC 3AV0B 3LA6A 4G5SA 4KYUA 4LJ9A 3RAPR 1KMHB 2D4HA 2AL7A 3C41J 1OH7A 1M1YE 3HDTA 1FX0A 4JYBA 2QROA 1Q44A 4JL8A 4NU0A 3I72A 4Q01A 4RY2A 4TL9A 1NVUQ 4ESVA 4RFSB 4PAQA 3R9IA 1KJWA 1BOFA 3TBKA 1JQLB 2RGNA 1VHLA 4M21A 4QJ5A 3IKJA 1HUQA 2V4ZA 4PANA 3FYHA 4DIDA 4JVMA 1KO4A 4B44A 1IAQA 3HR8A 2W0MA 4FCWA 2P2LA 4II7A 1KO1A 5LB4A 3WBKA 2ZYVX 1FP6A 5TARA 3ONWA 3PCRB 5L3QA 1J2JA 4URWR 2ZI9A 3X1YA 2PH1A 1NBMA 3IGFA 1IONA 4QM7A 3CRVA 2RGCA 3RWOA 4KITB 2H17A 3KL4A 4TMWA 4MYHA 3MGCA 5DO9A 3RSOA 2HCBA 2KE5A 4BLQA 2WJYA 2EQBA 4YMTA 2ZUDA 4TQ9A 1U2RA 1XTRA 2GRJA 2GEUA 4ABYA 2IC5A 1Z8FA 3KXKA 2O8DA 2VP9A 2W00A 2HF9A 2G6BA 4DUGD 1M7BA 2QN6A 3KFVA 4AYXA 1SKYE 1CR4A 2ZETA 1E79D 5AJVB 1GWNA 3LV8A 1ETUA 5AUQA 3RHFA 5KHOC 3U3RA 2RGGA 1SXJB 2UVQA 3WHLA 3BH6A 1M2OB 4IEEA 1NVVQ 5KSPA 5L3SA 2BJVA 3FWYA 2YWEA 4S2EA 4GOKA 4F93B 4LPKA 5BXQC 1NKSA 1XP8A 2ODEA 2JJ1A 1UKYA 3C14C 5DI9A 1RYHA 2V1XA 1EGAA 3IO3A 1D2NA 4Q4AB 4CZ2A 4AY2A 4TLEA 1GRQA 3B8HA 1HQYE 4LY6A 1R6BX 1F3OA 2QAGB 3MJHA 2VHTA 1XXHA 1A1VA 3W5IA 1NIPA 1N25A 2W58A 3E1SA 2XTMA 3ASYA 2B7BA 3SBDA 4MDEA 4E03A 2ZSEA 4H9GA 4Q00A 1LTQA 2JATA 3TR5A 2V9PA 2QBYA 2R6CA 1U0LA 3K0FA 1VKJA 1GNRA 4W5JA 4DDUA 4URUR 3EZFA 4TSFA 2PLFA 1J99A 1U0JA 1VCIA 1Z6XA 2AWOA 2ZJBA 1XCGB 3BS4A 4TLCA 3BORA 4NONA 3T34A 4RCYA 3REGA 3UKDA 4OHWA 1I4LD 4M1OA 3NTUA 2ZRDA 2O8CB 4ACBA 4OK3A 4HB3A 1EFRA 2F6RA 5J4YA 1E69A 3FHOA 1E9AA 2FE4A 3LVQE 4DDTA 3GP8A 4CEHA 4D25A 2QT0A 1R2QA 2RGAA 4HUQB
chains in the Genus database with same CATH superfamily
5DXAA 5JAHA 1WHTA 1VPWA 4GD3Q 2IU0A 4M9XA 2ICAA 3EZ9A 3H6KA 2IS2A 1PDWA 5FXMA 1NF2A 4DF3A 1DBVO 1WDWB 3K9QO 4WH0A 3GCGA 4IG9A 4E09A 3VKHA 1ODLA 2APJA 5CYOA 1YBVA 1ORRA 3NH9A 3AR3A 4PC2A 1XVIA 3DBLA 4H35A 4DSOA 3IT0A 1XZIA 3OLXA 5IWAB 3G5TA 2W90A 3ADPA 2A9QA 2BGIA 1T8TA 2JHCA 1D0VA 3OZVA 3Q0IA 7MDHA 2XZPA 4OB6A 1NE2A 1DXHA 1QFJA 2VP3A 2Y1LA 3A4MA 3HXTA 3CURA 1I2DA 5EJ9A 3KB6A 3DBVO 5FOTA 4WX2B 2VL7A 2WWYA 4FHCA 3IEMA 2R85A 1MB3A 2F9LA 2RI1A 3X43A 3QLEA 4L4ZA 1EJ0A 1UMBB 2ZR9A 4WKGA 3WGTA 3LCVB 4BGEA 4BO3A 4OGLA 2ZZNA 3AG6A 4A8TA 1NYRA 4ZO4A 4DDMA 4ZVSA 1KMMA 2P2DA 2PTHA 3KZCA 4L6CA 3LUHA 4QDZA 4WXRA 3WA7A 1OROA 4LSWA 3Q3JB 3SFZA 3D64A 3C7KA 1NJSA 3GRVA 3I9FA 4H1TA 4X20B 1PFGA 4D81A 3ZLJA 1JDUA 5IN4A 5CB0A 4CLDA 4NBTA 5HG0A 4RPCA 4FXOA 1O4WA 4P86A 4DLRA 5IJ9A 2CN1A 1DX9A 4MB6A 4C0LA 2ZRMA 4WHMA 4O8ZA 4JR1A 1EK6A 2X42A 2P1DA 4V1CI 5ICSA 2H1WA 4CQNA 1KQ3A 4YIHA 1DCKA 3A58B 2JH8A 4JB8A 3CEHA 3P9XA 2DBZA 1ESCA 1VYVA 4M9RA 4OAOA 4DWOA 2YFYA 3ADDA 1C29B 1PN3A 3E2PA 3Q5GA 4J03A 4PC3A 3U62A 3B6JA 4I9GA 3FCXA 2H0AA 3QQ5A 1UFVA 3MGGA 3IAS6 2Q0HA 4IX9A 1TMGE 1SVSA 3OPYB 4MQMA 4MPPA 4M1EA 4E31A 4UE3S 5E6RA 5KVAA 1P1FA 1VSTA 2N1MA 3OCZA 3TQRA 1L7MA 3H16A 4V1CA 4NCAA 3FKQA 1SOMA 1GPLA 1AGRA 3R0QA 1SOUA 4NS4A 3R3HA 5TMPA 2FMFA 3C1UA 3ASZA 4PGAA 3ETJA 4OQLA 4BKUA 5D3KA 5KYNA 4C6TB 1PNVA 1VXOA 2EV9A 2F48A 1P60A 1NR7A 3L43A 4ZVPA 3ZU2A 4OHUA 5BT8A 3SSAA 1OGYA 4EUKA 1DXQA 1QHGA 1YC5A 2X77A 3A3OA 4B3GA 3G17A 2JIZA 4KVZA 2PGJA 4BUJA 3PLRA 1APBA 1SXPA 1FW6A 1WDMA 5I4BA 1IBMB 2ZIUB 2O06A 2P7HA 2OV3A 1K7SN 3NVDA 1XKLA 4ZO8A 5EQFA 3SEZA 4JB2A 4HC4A 3OEED 2PZ8A 3B1KA 2PLRA 3HJNA 1JZTA 4MRAA 4OXXA 2JRCA 3T99A 3O4JA 4ZAWA 5BOVA 4BLWA 1WA5A 4RS4A 4B09A 1R5OA 2ZIXA 1JMVA 1ZGAA 4IIDA 1SC3A 2PSEA 1RBQA 1BFKA 4WLOA 3RG2A 5ITZA 1W29A 1B26A 4OKSA 3V8NA 4U7FA 3OE7A 2PSSA 3HRKA 3M9LA 3P32A 2O7RA 3RK1A 1CQIB 3TMAA 3V32A 2AFHA 2YWXA 3WADA 3I1YA 3AM5A 3FTPA 3BBLA 1BMQA 3DDZX 4BRWA 1VM6A 3LBNA 1P4HA 4EITA 2YL2A 5KJ6A 4QSHA 5CIQA 5EESA 4DW8A 4YRIA 3R8FA 1AK1A 1E64A 5DFAA 3HVKA 3H6GA 4U8HA 4GWGA 5LQNA 1MVNA 2HIHA 3SYTA 1A8QA 1CFZA 3BMOA 3M81A 2IYYA 4L5AA 4PZYA 3AVVA 3KC2A 5FHRA 1D1SA 4N82A 1K1EA 1Y0BA 4X9XA 1KSJA 3N6VA 4NDAA 3W6NA 4BFWA 2BKUA 4DCMA 1X3LA 4QPJC 2DE0X 2GCOA 2WSBA 1FTGA 1NDQA 1Q0RA 3IHWA 1ES9A 3LBIA 3ZHQA 1EFVA 3NUZA 1P45A 4MULA 1G20A 4AQDA 1DINA 3BQMB 4Q9NA 2VP4A 4NZ9A 4I4IA 4ZIRA 2DVMA 3WYAA 2JIRA 4CDRA 1CY7A 3EPHA 1RXYA 1SCJA 5ALPA 5IAOA 1YR3A 3ZWMA 3ES9A 2H5LA 3ZWCA 1V0JA 2RG7A 3KTAA 1DJPA 3QFFA 2FFQA 3CSSA 1ULHA 1Y9DA 3C97A 3GLQA 3MUFA 4AY3A 1CNFA 2UU9B 2J0QA 3MRXA 1X9GA 3N2KA 2G7ZA 1CUAA 5AKZA 2B9VA 1DC3A 2B94A 3AERB 2ZREA 4CT0A 4KRYA 3CEPB 5CM9C 3OQPA 4X66B 1W44A 3RJMA 4UEKA 1YBAA 1DJLA 1KPGA 2JBAA 4JC0A 4E0BA 1AKTA 1UJBA 2ORYA 3IKMB 3EDOA 2JZOA 3SM9A 3IDFA 4EGQA 5AW2A 16PKA 3AQIA 3HKBA 1VKRA 1VGVA 4I1PA 2DPYA 5CLHA 5F3WB 3EIWA 2QY6A 4XYBA 2OESA 4EL0A 3O8OB 1R12A 3FPBA 4OLJA 4OLFA 3LXMA 1WZIA 2ZFUA 1RM0A 2D4AA 1U3CA 3ACBA 3KBOA 3NNDA 3LX5A 1R27A 5EXEA 5BYAA 5CFNA 4BPBA 3IAM6 2VN8A 4PFSA 1ZJYA 4REQB 2GAOA 1XO1A 2D2XA 5AHRA 1I1OA 4O63O 2Z0MA 1KHTA 3B3JA 3ADOA 4Y9TA 1F51E 2A0UA 4PZEA 5LOVA 1TF2A 3FPFA 3NTXA 1RWBA 4BZZA 4ZYLA 3L7OA 1UBRS 3RVJA 2C8JA 3MJTA 3U3KA 5C8YA 1RQRA 3E1KA 4ARCA 2PHZA 1ZR4A 4F5EA 1GCOA 2QRZA 4MR8A 2VDWB 5K0BA 4LYHA 2H4JA 3HKCB 5B5SA 1VSUA 4FC6A 3QF4B 3A31A 3JQ8A 4OFWA 4F7WA 3WL5A 3OT4A 3ODGA 4HH0A 4MLCA 1E2EA 4FNAA 1UZUA 1U9YA 2CNOA 4G25A 1ZVJA 3GDGA 3KFXA 3OU6A 4FFWA 4RCVA 3UHAA 1GU7A 1ZNXA 3AR7A 1GGEA 4I4NA 5FPTA 1LPPA 1EGQA 1SZCA 3WNDA 2FSVC 5KWEA 1F6DA 4LNHA 3MJCA 4WNCA 5LDGA 1IWOA 5DLEA 3VPXA 1BS2A 2HH9A 4K8OA 1C0EA 2C57A 4PO8A 1LUAA 1IQPA 4Q4JB 4YJ3B 3GUYA 3ZR4B 2BWJA 2D2EA 3DMDA 5L45A 1O6FA 3QJ5A 1VE7A 3CZRA 4L22A 1N8SA 4BLTA 2GPYA 3HUFA 4P7BA 4URYR 1NRIA 3P9QA 1XTZA 1SR8A 1T2DA 3Q8MA 2VP2A 3MVEA 5GJVC 1UBLS 1XA3A 3SFTA 1CVLA 1V11A 2WU1A 1HM5A 1NG1A 3B20A 1FP2A 4ZPJA 3PNBA 3D3NA 4ZVVA 1G8FA 3P8ZA 4RZUA 2TECE 1IQ0A 2HA5A 1X74A 1VLJA 3R20A 4RHEA 4DGQA 1JQBA 2AIRA 3IURA 5CITA 1RR6A 2OXEA 4XYGA 2V3WA 2ZEJA 4ZFNA 2P6UA 3KVRA 3OCJA 4QO8A 1H23A 2WG0A 5HE8A 1G41A 1Q7EA 4C0SA 1I0IA 4CKYA 4BCBA 4OJYA 3GLIE 1F7UA 1QZ3A 3KE8A 4Y6GB 3FWKA 1X1BA 1A76A 1AF7A 3HB4X 2O2CA 4ERXA 2QXYA 2BMFA 5K20A 1M1XB 3NM5A 3OD5A 4QEZA 3SFVA 4DCCA 3E9CA 1OILA 6REQB 1KAQA 3KCQA 3U4MA 2D1TA 1RKXA 1Y8QA 2GHQA 4HAIA 1NBHA 2OGTA 1DIOB 1H2FA 3RO7A 3S70A 4JP5A 4TLDA 2V7XA 1L1FA 2JS7A 3T61A 3CR8A 2ZT5A 1G5FA 4KQCA 1FXUA 4M1SA 1K7EB 3PWKA 1DO0A 4PSKA 3IYLW 3FBWA 1G8KA 3GLRA 1E5QA 3FBTA 1U9CA 4B6FA 3ETCA 3V6LA 3EULA 4NJMA 5KNCD 2O57A 1FTNA 3NQ41 3PJGA 2WJJA 1Z6YA 1P7ZA 3KJEA 4JCCA 4YBRA 4DSTA 1UJNA 2DFDA 5JVDB 3BERA 5BR8B 1NX6A 1Z45A 4WA8A 2RGXA 2VDJA 4OBEA 3CH6A 3IMFA 3HVJA 2H4WA 2QG4A 1T0UA 4XGIA 5JRDS 1MW9X 1PFQA 3E7FA 1WTAA 1XFAA 1MX1A 5CDYA 1YS4A 1HYQA 3TLXA 2HQOA 3ZVRA 3BPSA 5EP2A 3L6DA 4MS3B 2CF5A 2VBFA 1XHEA 1D3AA 4FE4A 4QECA 3R5JA 4CRWB 1N34B 2FUCA 3MERA 3V4RA 1JAIA 1DXYA 1NI4B 4ZOBA 1DC8A 1M67A 2VUTA 4DV5B 5FR1A 4FMPA 1PJAA 1NTOA 3TTYA 2FX3A 3A14A 3OPXA 3K9BA 1TGVA 3R4VA 3VHXA 5AVKA 2F00A 2J1LA 1QTRA 1NXTA 1L5FA 1U94A 3DVLA 3FJOA 3HU2A 3ND6A 3QEOA 5ESDA 2JVKA 2M6KA 1BQEA 4B6SA 4CKZA 2BYTA 3JAKA 3DBRA 1OTHA 4L8VA 3TTVA 5H8WA 2E6KA 5BSRA 3FZNA 2N9UA 4AP6A 2QI9C 1HT2E 2FX5A 2WE7A 2IEBA 4UVHA 1AKRA 1NLFA 3AH8A 4JBWA 5CVDA 5J40A 2VP6A 3MBOA 1GILA 4K6MA 5BSMA 2IV3A 1DWUA 1QWOA 1Z0SA 3CUSA 3NALA 1NMSA 2X4DA 4LRSB 3JS5A 3WNCA 1M2KA 3N0XA 3X2EA 3EC1A 1EFDN 4MP6A 2QX7A 2XKAA 4KE9A 2YHIB 1E2IA 4Q18A 4KO8A 2Q5CA 4QM6A 3LUJA 2QUZA 2NQ8A 3LSYA 4QG7A 5FLEX 1ZKDA 3GNSA 1Z8DA 3UGKA 2IHZA 3MYRA 2XRFA 3TGLA 3F4KA 4R3WA 1PZXA 3GRRA 1HFJA 1ZUIA 4I14A 4U6SA 3RD5A 1G2OA 2ERYA 4CT5A 4HWSA 4MMXB 5JSZA 1A9QA 1FUUA 2CVPA 2I4RA 3F6RA 4U7HA 2JEOA 1E20A 4QJIA 3RR2A 4I3GA 3KYCB 2X5OA 3G8YA 4MEJA 4TTAA 3DF9A 5EG5A 2I4TA 5BT9A 1FQOA 1O6GA 1WUIS 2OHJA 3C16C 3MLEA 4QX6A 1HGXA 1BVUA 1Y82A 2DY0A 4PPQA 5CEEA 4CLOA 1VDZA 3D4NA 2OCDA 3N76A 4GIBA 3VU3A 5A4KA 4GVPA 4UAUA 8MHTA 1R0CA 1PZNA 1UXJA 2PH5A 4LY3A 4HVLA 4RMGA 4ESHA 4NBWA 3O4IA 2YWFA 4O4HB 5JO9A 4ITVA 1N3LA 1W5TA 1P3DA 3L4BC 4C4SA 2DTEA 3ELUA 4YQYA 3GLGB 1WRBA 2OG2A 2Z95A 3UMVA 3W34A 2H29A 1TCBA 3L8ZA 3V3TA 1F12A 1MFPA 3LFHA 3RRNA 2O8EB 1CEQA 2JI7A 4FYXA 1TUGA 1QLHA 3MS7A 2ODWA 3KR9A 4LIPD 3LTEA 4O0MA 4OMCA 1IZ7A 4RK7A 3KV1A 4P2BA 4N7BA 3KLMX 3J7AC 5TEVA 4DA4A 4PR0A 1EBBA 1H2HA 4OXYA 1EHIA 3JQ9A 2HADA 2G72A 5A4MS 3E7WA 3EUEA 1FYEA 1AMNA 1DLJA 3IAUA 4LZJA 4MS1A 4GF5A 3TW4A 3TXAA 5HWSA 1GL3A 1Q6ZA 2Q4BA 2VDKB 4US0R 3HM2A 1JHAA 4AMVA 4DSNA 5BWMA 2QVLA 5EYPB 4F45A 4ASUD 2G0NA 4L9WA 4AO6A 3IKTA 2BSAA 1GZ4A 3COSA 4H15A 4B2IA 4R3UC 2E1PA 2EJVA 4WFJA 1R9JA 4J6FA 1HETA 1LLQA 3OKCA 1O0CA 3AHDA 1SHKA 2BKLA 3IC5A 3T06B 1IHOA 4AZ3A 1HH4A 2JFQA 2ZQYA 3EIFA 4QAJA 4X6UA 3UWPA 1IWBB 1E3LA 1N2SA 4KZKA 3ZGXA 2PUDA 3L4EA 1HE8B 2CZQA 2KQUA 1X1DA 2HLDD 3AK4A 3I4CA 4GPEA 3TECE 2N42A 1V35A 2QJOA 1DZIA 1Z0KA 1BDMA 2YHUA 4KQXA 4CF7A 3BREA 3D31A 4OHZA 4ZO6A 2B92A 2PX2A 4NDZA 1G8YA 5SICE 1XF1A 4EB8A 3S0JA 4IMPA 1FQJA 1IQRA 2AK2A 1XTKA 4LQLA 4NARA 4RJ2A 2WZBA 3IEIA 4WESA 1OYWA 2GLXA 3DZJA 2QM0A 4MI6A 1Z0UA 3GT4A 1JFRA 4YHHB 2I8AA 4E5KA 3M0EA 4CN8A 3ENWA 1PLJA 4NFLA 3R7LA 1XRPA 2Q45A 4RZ2A 3S5UA 5LVAA 1DIGA 1JFFA 1K6EA 3NBXX 4X84A 5K3AA 3MOIA 1KJZA 4G63A 1X70A 4HEJA 3STHA 4P4LA 4AYTA 1QHHB 1HRKA 8AT1A 4YY3B 5HK8A 1G4UR 1Z5WA 2E4UA 1L5QA 2WUEA 2AB0A 3OEHA 1CVIA 1K6MA 4DQDA 5HZGA 1WB5A 2QYTA 2G5TA 1BCSA 2FUG6 3AJ9A 3DQPA 4M8NE 3SG0A 3WJ1A 3G6WA 2I4MA 5CU7A 1K9VF 5EI5A 2IW1A 4ISCA 5BMVA 3SLRA 1KDZA 1TA9A 3F47A 3UFBA 2D62A 4DDHA 1V2GA 5D1HA 3F3SA 1RJ9A 1KMNA 2WSSA 5DM0A 3VSCA 1RZUA 3RAEC 1MH9A 4RHXA 1IN5A 2IF0A 2J5RA 5JXJA 1G19A 3CJTA 2L42A 1W6UA 2IX9A 1SY7A 3TSAA 1AK2A 3DLIA 4FZ5A 2YMPA 4QUGA 1T8PA 1U3TA 4ANFA 3BRCA 3IDAA 4IGAA 4AN4A 3MWGA 1D5CA 4KV7A 4B3MB 1W47A 5IZCA 1A2OA 4CNQA 2AD5A 1XMXA 4MQEA 1CUHA 4J3JA 1IHUA 2FB9A 4G5XA 1EUQA 1ENZA 3EZ7A 1P9NA 2G70A 1M2WA 3EF1A 1SUFA 4IINA 3L7BA 4MPJA 3ROMA 4CM6A 1J2YA 3Q9UA 3WIOA 3P27A 2EFCB 5E3IA 2EBWA 4TVSA 2AS0A 5J47A 3Q8KA 1NLZA 3NHUA 3TOZA 1XYVA 4YB8A 2W5UA 3EQZA 2QMQA 1HZZC 3TPFA 3OIDA 3FJYA 1KIAA 1M2FA 1OFUX 3W3AD 1UZAA 2REQA 3W77A 4YWJA 3ZQ4A 4ZJUA 1R5JA 3WFIA 1Y9JA 1J23A 2J3JA 5D7BA 2BBWA 3T9AA 3NT4A 3W5CA 4IDAA 1EFUA 2QTZA 3I4LA 2GGSA 3RC9A 4CL3A 4PYKA 1V39A 3NAGA 2EP8A 3HN6A 4W99A 5B55A 1MDBA 2PVSA 2AHRA 2P35A 1GPAA 2EJUA 2RHGB 1Z38A 4Z9FA 1T6XA 1XZFA 2BI7A 2RKWA 4QTXA 3SXUB 5LKRA 2CKDA 1C0KA 1F6BA 2YVAA 2E4WA 4U39A 3SY8A 3WG9A 9ATCA 3AUSA 2PO7A 1MH1A 4RORA 3GUUA 4GM0A 2I7CA 3UBTA 1ZP6A 2RI0A 4OB8A 5IFKA 3KEMA 1HNNA 1ZH2A 3QYPA 2BBTA 4O2BF 1NUHA 3NEAA 2ZYTX 1ZM3A 1A97A 3ZHOA 4AU1A 4RS3A 5AMXA 4CEJA 5LZ4A 4GZ5A 1Z3IX 4N0QA 2FAXA 2ZXEA 3N6XA 5LJLA 2O7QA 2BEWA 3KZ1E 4L78A 5B4UA 2GNPA 4V0QA 2G8LA 3E9QA 2X5KO 1ZOPA 3F6EX 3PYMA 4HF7A 4J7CA 5HIMA 3A2NA 3W6UA 1Q95A 3PDHA 4KTVE 3H9GA 1U5AA 4ES6A 2R44A 3N07A 3HCPA 4I5DA 3SJUA 3W4JA 4AZWA 3HYRA 2H2WA 5HZKA 1NZJA 1XXLA 4BFCA 2GNAA 4KPUA 3W1EA 4MWOA 3WGIA 1E2HA 1N6KA 1XXHB 1X87A 2XLBA 1MC4A 1VJ5A 2X2EA 4X85A 3A70A 3WRWA 2PMKA 3HYNA 2YC2C 3LFUA 4PTZA 1G7RA 1ISHA 5FD8A 2PRSA 4AWBA 4D6XA 1C2TA 4XWAA 4MVJF 4MVJE 4PYNA 4LOIA 1MB9A 3ELYA 4O25A 1A5BB 2ISSD 1QIKA 1S9DA 5KVVA 3QX8A 1GRNA 1XAHA 1Z2EA 5LLSA 3DZDA 1Y7LA 2IYXA 4LDRA 1FVHA 3CX7A 2ZAMA 4KSYA 4CUZA 3EFHA 1M2VA 1YR1A 2PX4A 4UFPA 5HZMA 4DV3B 2P2CA 4YPOA 2DQSA 4V0OA 2FWAA 3GMIA 4CDNA 2QD3A 4YRRA 4Y2TA 2NYAA 3IODA 4MLDA 2PL1A 1K3TA 2R6FA 2G5GX 1WCIB 2LKCA 2DUMA 2NXCA 3DC2A 4TXHA 4Z8XA 5ALXA 4MV7A 1FF9A 2B36A 4MWDA 5F5LA 4QHSA 5EUQB 4IIJA 5ES4B 1AIPA 1YCFA 2PA3A 2R1VA 3HYSA 2YY5A 4R9RA 4WNAB 4TV8A 1R6UA 1YRAA 5ENDA 3T35A 5FWYA 4AC9A 3WBJA 2Y9PB 3CZPA 4I3HA 3ZHYA 4YUXA 3I2JA 3HCRA 1BYIA 4RF5A 4DY6A 2ZAGA 3KKKA 3K9CA 4FZJA 4HMQA 3DV0A 5I7EA 4F6RA 3D1JA 4XD2A 1KJYA 3USZA 1XR3A 2ATCA 2VO1A 4K88A 2WFLA 4MTLA 4ZQHA 3A7DA 4OHKA 3VDXA 1K9SA 3UT6A 3UGJA 3OICA 1WTCA 4GVLA 3SCZA 2QR2A 1EK2A 2EVWX 1QSGA 2PUEA 5LMUB 1DBPA 4D4GA 4EB3A 2XQGA 3VC3A 2FI1A 1F14A 3SE7A 4UDNA 4Z1MD 2O2IA 4MITA 3L84A 4IXMA 3ORFA 4GOND 5HA5A 3W3ZB 1H1LA 1V6AA 1XLUA 3RT1A 1J8VA 1GAWA 1YRBA 4HPJB 4KX3A 2XUJA 3ZIDA 4DIFA 3GF4A 1GDHA 4XGRA 5ALJA 3KSAC 4MKHA 3DTTA 4DHEA 1MC5A 1M7GA 3B1WA 3OHSX 1UDCA 1LNSA 1MVOA 4UDOA 5BN4A 2ZB4A 3LQFA 3RS3A 1O9GA 2OCBA 4LXUA 3PT9A 2QX8A 1J09A 4PCVA 5DCYA 3V2UA 1II8B 4BVGA 1MD9A 3MPUA 3REQB 3U4DA 1EXWA 1VRCA 3FLAA 2H2IA 2RAUA 1G0OA 2VG8A 1E7YA 3DDHA 1OIVA 2CLOB 2JK1A 5FO0A 4UCQA 1M1ZA 4PYIA 4AF6A 4Z7NB 4DV2B 4DIEA 3VNVA 3IAS1 1GNQA 1QYXA 4Y2VA 2VA9A 2NSJA 2UZ3A 1T9DA 2B3TA 5FEMA 2FW0A 3TEJA 3MQ2A 5AKEA 1BXKA 3AYXB 3TJMA 1XNRB 2BJHA 1EUZA 2FR8A 4R81A 1OZ0A 4O2AF 2MYNA 4D96A 1JDSA 4MYSA 3IQDB 1JILA 3UMMA 4YJGA 4RTRA 2BM0A 3D7LA 4J1TC 2OBFA 3KNZA 2YXPX 2BZ0A 3RYHA 1JLHA 4JC8A 3D7RA 1JHVA 3ROEA 4INAA 3EPJA 2WNIA 3A2LA 3F98A 1WF3A 4A0GA 1QXSA 2C9MA 1LW6E 1DAMA 1PR2A 5E6UB 2CB0A 2GEJA 1UMDA 4MIOA 1OB5A 3OI7A 2IELA 1R5NA 3FNQA 1JKJB 5HTKA 3A06A 1D9XA 4QLOA 4R69A 5AK3A 5LXTA 3U3MA 3TRDA 2B20A 2C7QA 2JZCA 4XCXA 4ROSA 2BFCA 1RIFA 3IOMA 4NBNA 2XHZA 5C1IA 5JDIC 4LI0A 3KQVA 2BGJA 4UD2A 2X22A 3OSUA 3ZBQA 2YOGA 4QNNA 1U0NA 4M98A 1CULC 3COPA 4JNKA 2AX4A 3IJ5A 5ALRA 3WGQA 3KLNA 2Y4OA 3MAGA 2WK1A 3K1JA 3I3SR 4B5KA 5HKAA 1V3TA 1U0EA 2C2BA 5GONA 4YROA 4WCFA 5KU7A 4XCVA 3RS4A 4D4MA 5BOSB 1GUAA 1OZAA 1KU6A 3GFGA 4UASA 1USWA 1EFCA 1N1DA 3A4NA 3WK5A 3KX2A 1V71A 1XROA 4WXHA 3O5AA 3EEBA 1SQ0A 3N70A 4EL5A 1E3JA 2JLRA 5F4BA 3RIYA 2QAIA 3IDSA 5GZ1A 3R7SA 1G0NA 1YMQA 1TU3A 1ZR2A 3M4ZA 2IEGA 1D8TA 1NONA 4LYDA 3V1KA 2WDZA 4C03A 1CR2A 5E3JA 3KU4A 2UZ4A 1ADGA 3ESAA 4QFDA 2O54A 1NGSA 2G67A 3UXYA 3V8RA 1ZMRA 1IIBA 3H1BA 4B3SB 3E48A 4OBXA 5D01A 1OXTA 1KZ4A 5B57C 4L5CA 4WE3A 1PD0A 3L8EA 3BAZA 3LS2A 3EXFA 4AKEA 3I5MA 3OQOA 1MIOB 1Q2UA 4K0RA 1UPAA 4NEHB 2H9AA 4NSNA 4AJ4A 5KKAA 2R7KA 1S2MA 4PCUA 4DN6A 5JHHB 1LI5A 3HRIA 3EIXA 3D6AA 4LX8A 1UBKS 1R6DA 2O2SA 5JXGA 3DLBA 2OKGA 3FB4A 4MGHA 2HIAA 3SC3A 4EW1A 4ZI5A 2FPIB 3UJDA 4XX0B 4PQYA 1E6WA 5FFFA 3WNVA 2B8EA 3TKYA 1VECA 1IZ9A 3TQQA 5AW4A 2O59A 1FDWA 3PX3A 3PXEA 4L16A 4OHYA 1ARZA 1HKUA 2H0QA 1PP4A 1P2BA 3EGWA 4HX2A 4G2TA 5BNZA 3WLIA 1V96A 3JR3A 4MWTA 4HX5A 4P9NA 3UN1A 1DUSA 1GCUA 5I5EA 3B2EA 3JWIA 5FWNA 3U3XA 2C7PA 5GZ3A 1IHYA 3H3FA 2Z2ZA 3JZIA 1LS6A 5IRCD 3R9KA 2FYTA 2UZ0A 3IQXA 2FJ0A 2P68A 4H08A 4RPGA 3ESCA 3P2MA 4NQZA 3IAM1 4Y6SA 3M6WA 5TPZA 1T6NA 3WBFA 3LG2A 3LF2A 3E3LA 1N2CB 4DMKA 1IUOA 2RHJA 2FZKA 3ENVA 4I1RA 2V1UA 2YNMA 3P20A 5UKDA 5JSHA 4YBZA 2X1HA 2Z8YA 2Q07A 4GKKB 5JC8A 2F2TA 4NDNE 3W9BA 3V1LA 4WJLA 4U9IS 4P35A 4AXXA 1NMQA 4LHXA 3GAFA 1P18A 4H7PA 4PG7A 4EPWA 1RBYA 4IOMA 4E13A 4CIBA 1I24A 3HS3A 1VC2A 1H5UA 1KP3A 4DV1B 4PO3X 1UAYA 3A6DA 4I1YA 1NW8A 1A5TA 1XJQA 3DFFA 4IJMA 4EUSA 5L8VA 4KLNA 4FKZA 1LB1B 3N5KA 3R0JA 2E0IA 3NETA 2Q8NA 4JVSB 5EFOA 1YMUA 3AV3A 2VJCA 4W1QA 1N1EA 5H1YA 3T9DA 4DQLA 4GLJA 1PJ2A 3IQHX 5L4LA 1G3RA 2MINB 2A1TS 5TS3A 1BAPA 3CFYA 1G5IA 4Z4FA 1CJMA 3OZFA 4QULA 4ZREA 3FSRA 4DCGA 2B5OA 3CZAA 1FJHA 4XWKA 5I9LA 4M8LA 3FSJX 3R6TA 4TS4A 2JASA 5IBQA 5KTYA 3Q72A 3Q2KA 4XFDA 3KPVA 3LWNA 5GZ6A 4G24A 3SZOA 1WE2A 1G6HA 3LQKA 1ONSA 1MEJA 4LKOA 3PTZA 1CU1A 4N3BA 4ADSG 5LJIA 1SG9A 1U81A 4TQUS 4LF6B 4BN0A 4ZP1A 2BFOA 4CKBB 1UBNA 4HJXA 1P61B 1CUIA 3FZEA 4ZJPA 1ECFA 2RC6A 4WCDA 4NAUA 4B3XA 1A95A 3QXJA 1WMAA 3WC4A 1TQ4A 2HFJA 2C78A 3EQ9A 1P73A 4RQUA 4TS3A 1IHDA 1EFHA 1FNSA 4F1WA 1R0YA 2XRZA 5JQGF 3ADKA 3OMXA 2H65A 3RARA 1YI1A 3AW9A 3CF4A 2B8WA 1XDWA 3C43A 1D2GA 1E9CA 1EE1A 1GNVA 1NNSA 1F2UB 1RLTA 3HFSA 5IZCC 4BNYA 1MPTA 4CM8B 1GPWB 1YDEA 5EMKA 3CV3A 3ITNA 4ZKDA 2NO9A 3E8SA 4IHJB 2DYKA 2C8LA 1TECE 3ELWA 4QFMA 3ZCVA 4FGUA 4DLLA 2QVCA 3L6UA 1NQOA 4N12A 3GEPA 4HFJA 1I7PA 2RAFA 5CDTA 2Z04A 3DTVD 1PYOA 1CEEA 1AKVA 5B3AA 4OMFG 4Y6LA 1P8AA 5FNVB 1ZGGA 2FPGA 2OGSA 5CT6A 2GSDA 3A04A 3MWDA 4RIIA 1ZITA 5TJ9A 2J6IA 1VP3A 2WQ6A 2PMBA 4B35A 5AT1A 1Z34A 1Z0DA 2LWIA 1UWKA 2FEAA 4LVCA 3WZMA 3ZH2A 3QG1A 5AXBA 2FQ1A 5AKLA 3QA9A 3RSLA 3HU1A 4JI8B 1Q1GA 1FPQA 1VG0B 1NASA 1WO8A 1Z0FA 1Z26A 2J4DA 1X7ZB 2IZ5A 3IVRA 3L8CA 3H13A 3HWSA 3O1HB 2DU8A 3D59A 3G8BA 1JBKA 3JCZA 2IEZA 3O91A 4JAVC 4UU7A 5F1YA 1K68A 1TM2A 4HLCA 4HNVA 1WBDA 4LZWA 3WRVA 1QTQA 1RCTE 3ME5A 1YIDA 2WFAA 3RU7A 4LOHA 4KLCA 3VTZA 1P7CA 4YJFB 3UA3A 5JHGB 2EHDA 1CYDA 3CRZA 2F8TA 5HF6A 5K8TA 3LECA 1N7HA 3WL3A 1XZCA 3JQ9C 2H7XA 3LQQA 2IIPA 1M34B 2BONA 4FFBA 4G0ZA 2PUAA 2KHZA 4P7FA 4EJSA 2YWBA 4I55B 1CK4A 2RBEA 1NW5A 1RBMA 3OZAA 3AEQA 4CMKA 3CTMA 1SAYA 2YXDA 1JL3A 3LSTA 3QOXA 3ZJYA 4Y0VA 2QRHA 1T5TA 1G60A 3I01M 1VG8A 1R15A 2XE6A 3DQQA 3SZMA 1QV9A 4OXNA 3LHDA 1F9EA 3PICA 4XUGB 4LF9B 4HXFB 3WGKA 5FAKA 3PCXA 4NNJA 1ODIA 3HWX1 1HEIA 4DNQA 1XEXA 4K6CA 4RTQA 5JAOA 1RAAA 1Q7GA 2NV2B 1KRHA 1NG9A 4CE6A 3GHYA 4CLEA 4N18A 2WF5A 1GTMA 2JA1A 1FDTA 4HGYA 5CNMA 5K3SA 1MA3A 3NTOA 3TQOA 4CN9A 4E33A 4UTNA 4G5GA 2ET6A 5A06A 4WAUA 4WXEA 2Q5FA 4N4AA 2J09A 1I6LA 3BE5A 5KKNB 4MVYA 3QKTA 1IZ8A 2JPDA 2W48A 2XZLA 3AHEA 3CXUA 1MO2A 4BKQA 3UB2A 2ZRBA 4NZOA 3TIIA 1JSZA 1EBFA 1ZCJA 3CZQA 4K1LA 1QB8A 3DD5A 4A6EA 4CCYB 5L7WA 2WWVD 5KTMA 1EQ2A 1DV2A 4LJYA 5REQB 4KJXA 2PNJA 3CU5A 1QONA 2AR7A 4K6HA 3T5GA 4A0RA 4BDSA 1WXFA 2QN9A 4L15A 2UYOA 3VUEA 4ENQA 1O7JA 1ONOA 4U7WA 2HSEA 3SHFA 1QX3A 3NDBB 3P0HA 3ABOB 4MR9B 4C08A 1O97C 1FP4A 2Y2UA 1KGDA 1Z5NA 1ZGCA 5TQ0B 4P83A 3OQBA 3S2EA 2DECA 5KHLB 3KJZA 4P5EA 3LL7A 2H4ZA 4U2CA 1CQPA 2QI9F 1EVJA 1Z68A 3BL8A 4GVXA 1PSWA 5CPBA 4AWAA 5JDCA 4FQ5A 1P62B 4ZCRA 4UTXA 5ICCA 4I50B 4FX5A 4DLSA 5HCNA 2O9JA 3V4FA 2JRLA 2RONA 2VHWA 3C4QA 3DG9A 1U5BB 1HWYA 2CUKA 3A1CA 3OZWA 4TL7A 4DWWA 2C5SA 4N6NA 3D4LA 2W93A 3C7TA 2R7MA 3PDJA 2C1ZA 3VFDA 2NTYC 3IAFA 1WQ1R 2VPQA 2XUIA 3RFTA 5K8UA 2GNOA 3K0HA 4NMHA 3I23A 2HNBA 1HSOA 1O97D 1VP9A 2DUUA 2QE6A 3DFZA 3OG9A 2D1RA 4LKRA 4M2LA 5TDHA 1XMJA 1WL8A 1H1DA 2CXSA 2BFNA 3C85A 3F0TA 4YN3A 3SICE 2OMKA 2OWEA 3OECA 2J5KA 2XUHA 3EH2A 1PJZA 3M3HA 4YMIA 5FPHA 1HFEL 1T2AA 4R8RA 4YPFA 5A3VA 1SMKA 1PDVA 1XL1A 4JROA 2AMFA 1ZO8A 5EE1A 3MMZA 3UPTA 5HNKA 4MCHA 1JS1X 1PJQA 1PYGA 5AKHA 3FRJA 3ZDQA 3MIIA 2R8YA 1FFHA 1M6EX 4EG5A 2VCEA 4H6PA 3FJ1A 4RA9B 5AK5A 1T1EA 4KCGA 4MVWA 2VH5R 3ST7A 3BFKA 3EN0A 4URXR 2D0DA 2AYYA 4DM7A 5K7SA 2I1VB 2ZQZA 3DHNA 1O0SA 3ZD9A 1EGMB 1D2HA 3SPXA 1K88A 3QPAA 2PPLA 4X0EA 5CW1A 2YCLA 2ZLBA 1C4KA 1GG9A 4TL8A 4V0NA 1LK0A 1UZLA 3R0XA 3X1JA 3D3WA 4EAAA 4EPXA 3G1TA 1BW9B 1SOAA 1E3WA 2AKAB 1N36B 1Z8NA 2DBRA 2GJKA 1CB7A 1NQTA 2HC9A 3A9VA 4P3OA 1CERA 1XTVA 2GN8A 3UXHA 4TYMA 4JHXA 4CMCA 2XNJA 3QELB 3DF7A 3EMKA 4G07A 4YFVA 2C77A 1E5DA 4GAEA 1O54A 3HMQA 4ZCSA 4BNWA 5KQMA 3BHJA 4C3OB 1VLHA 2PX6A 2H54A 2IPNA 4MCJA 4Q3NA 2I03A 3CG4A 3WQHA 3GZ4A 2BTEA 1FFAA 3AKZA 2HA3A 3K6KA 1GEEA 4CT4B 2C7VA 4JP2A 1FA9A 3EH1A 2CVZA 4H0NA 4PZDA 3PJRA 3BJIC 3WWEA 1NULA 3K30A 3NWBA 1N7JA 1H0RA 3A2MA 1W93A 4FSDA 4OSOA 1BCRB 2GZDA 4XJTA 1MO5A 5DP2A 3WK9A 5EVJA 1WKBA 1IOZA 1F0KA 1A4UA 4IIGA 1K86A 1XQ1A 3KZKA 3MLAA 4IWYA 1UPUA 4RVCA 4NMLA 3OAAA 5TLSA 2Z2YA 5DYTA 3VR5A 3Q3GE 2A35A 3LHKA 1JG7A 2J7KA 5CGZA 1G21E 2EWWA 2GO1A 4U2EA 1Q12A 1K5HA 1UT5A 4DC9A 4WECA 3GJXC 2Q3FA 3IH5A 4XPIB 5BQFA 3ZNOA 3GH1A 3PIIA 5K3BA 3U44B 4G0NA 4TRRA 5CHYA 2XWQA 1T5OA 1J90A 3RHSA 4R3NA 3TL6A 3W4IA 3BXZA 4HDKA 3EW9A 1B00A 4EFNA 1G7TA 1TYEB 5E1OA 1L4LA 5SYMA 1NYLA 2L18A 4A15A 3L40A 1VGQA 1YZNA 1XZNA 3SDBA 4NZZA 2RB4A 4YP1A 5FI5A 1K0FA 5DYGA 3QKRA 4UBLA 1SHUX 1XQYA 3PE3A 3BXPA 3H5WA 1U0GA 3KKEA 1H9AA 3EIOA 1Z62A 6ABPA 5DNUA 1P75A 3E9DA 2WV7A 3F7TA 4UE6A 4F1JA 5C46F 3IUPA 2JAPA 4NRDA 2AN3A 3QMWA 3VOAA 1DBRA 2JJ1D 5KYXA 2WQ7A 1BVYF 3O47A 4UMFA 2H3HA 4IQFA 4P4UA 2X8LA 2HDNB 4NATA 3MUEA 3BJMA 1ZK0A 1A4IA 1SCKA 4MS4A 2O5RA 2XITA 4E1AA 4Z6KA 1GUYA 4AZVA 5BQ5A 3M4XA 4IEFB 5C81A 4DG5A 2YS7A 2VSQA 1XMVA 1WEHA 1X7GA 3OQHA 4CR8A 4MTCA 4Z53A 2FP4B 4QXOA