3CF6R

Structure of epac2 in complex with cyclic-amp and rap
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
162
structure length
150
Chain Sequence
EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Epac2 in complex with a cyclic AMP analogue and RAP1B
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/gtp-binding protein
molecule keywords Rap guanine nucleotide exchange factor (GEF) 4
total genus 43
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cf6R00
1E2QA 3WNBA 1UJ2A 1F2UA 2AD5A 5KSYA 1G1MA 3KKNA 4OK5A 2V7QD 1XEXB 2V8OA 1W0JD 1J8MF 2QA5A 4C0LA 3F3YA 1AN0A 1ZINA 3FMFA 4C0KA 2C95A 3RWOA 3BB1A 3VR2A 5IRCD 1W2GA 1F2TA 5EE0A 4R98A 3W3ZB 4KAXA 4QOSA 1ESMA 4D80A 2J0VA 3DM9B 2PCJA 1R0XA 4JL5A 4MKIA 1TL7C 2VP9A 3MWYW 4G5QA 1XD2B 1P9WA 2GCPA 4KFTA 3TRFA 4DIEA 1W47A 3S1AA 3V9PA 3SS8A 3EASA 1E2HA 1VIAA 3JZAA 4XOIA 3U7GA 1DAGA 1G8YA 1J90A 2JATA 2BJWA 3KDSE 1KZGB 2GA8A 3B1WA 4TQUS 3SI7A 1ZD1A 4TT3A 4IVRA 5E7JA 3LBHA 2UVQA 1SHKA 3CLVA 2ERYA 2QBYB 3PEYA 1TU3A 3QIAA 1U94A 4DWJA 1P62B 2AHOA 2PZGA 1DTSA 5G53C 2ZYTX 5CJPA 1CU1A 5KU1A 1OH6A 1S96A 1JJ7A 1NKSA 1OXXK 2W58A 1FPMA 4IKEA 5CDFA 5FPTA 1R4AA 1FP6A 4PAQA 4V02A 1O87A 4M22A 4Q66C 3UWOA 2WZQA 4DT1B 4O3MA 4LY6A 3HU2A 2VH5R 1NL3A 5H68A 1E0KA 4U5XA 4B71A 3WNCA 3ZVNA 3D31A 4NPHA 4HUTA 3SYLA 5BN3A 3J81k 1PUIA 4BZPA 4EJSB 3GLIA 2W83A 3R20A 2FX3A 2OT3B 1LNZA 1XP8A 1E1QD 1CJTC 2QNRA 2FNAA 3C5HA 3ASYA 1NF3A 2JIZA 2BIFA 4HB2A 5DN6A 5L8VA 4XVUA 3RVBA 3PIRA 2QAGA 1OKKA 1LF5A 4CT5A 3L43A 2YWGA 3RWMB 4MITA 4TYYA 1EFHA 1E79A 3HPRA 4M1OA 3REFA 1PVOA 3U3MA 2CE2X 2RGEA 3P20A 1ELOA 1C1YA 3PUXA 3BWDD 4P4UA 5EZ6B 1US8B 4NE2A 1CJMA 1P2TA 2ZSFA 4HZUB 2GNOA 2OFOA 1KDPA 2RKOA 4IDQA 4R7ZA 3WRYC 1WCV1 4RFSB 4Q4JA 3OEHD 4QHSA 4N3NA 3PUZA 4CEJB 4FMDB 5F3WB 5IT5A 1WRBA 1P60A 1YHNA 4Q01A 4Q4HB 2OEPA 3K1JA 4BLQA 2YZ2A 3WYFA 1YZLA 5KYKA 3O8BA 3WY9A 4I1SA 5FL7A 1T9HA 2FZLA 3SHFA 3UATA 1E9DA 5EXXA 4GRAA 2QT0A 1ZU4A 3T5DA 4DXAA 2IK8A 2XB4A 3IPXA 4LHVA 4D0GA 3REGA 1ZC4A 5B57C 2H5EA 4G5SA 3GLGB 1HQYE 1D2EA 4PZZA 3QQ5A 1HH4A 2IYLD 4M9ZA 1P75A 1UKZA 3QPVA 1SVIA 2JLQA 1Z0KA 2BKEA 2BKUA 2VHQA 3CKLA 3T5GA 4BFZA 2I4IA 1TMKA 3K9NA 3LRPA 3QNUA 3CPHA 3PEUA 4R9UC 4EAQA 1KDRA 1AIPA 4NHOA 4XTCS 1RIFA 5KDOA 5AUPB 5HKKD 2QP4A 1E94E 3NG1A 1KYIA 1OHHA 1Z22A 1RRGA 2C2HA 721PA 4GOKA 2A7QA 3QXXA 2NZ8A 1XEXA 2GESA 1QF9A 2A5GA 4KCGA 4E09A 5KHOC 2OFXA 3FHCB 3GJ7A 4ESVA 5AUNB 1S1MA 2OXCA 2B8TA 1LW7A 3ASZA 2QAGB 1KKMA 1CEEA 1D2NA 4B76A 4TLBA 1G291 3EZ6A 3A4LA 4RKFA 4DVGA 1SGWA 3EIQA 3DL0A 1QHXA 5BYKA 1PLJA 5FOVA 3U7HB 3IILA 3TAUA 2O0JA 2YWHA 4RKEA 3BB3A 1A7JA 1AZSC 4A82A 1XTJA 1D9ZA 2Q3HA 1UAAA 1R5NA 4EPTA 4MUAA 2EWWA 1AKYA 2FPLA 2PMDA 1XWIA 2H92A 4D4JA 1GWNA 1DOAA 4TLEA 3CX8A 4B74A 4IFEA 1GL7A 1T5LA 2GXQA 3K0AB 3R8CA 4NP6A 1G18A 2HJGA 4D26A 1G16A 1YZKA 4RCYA 2JDIA 2HXYA 5CM9C 5CYOA 1IXSB 2OXRA 2JLXA 4HUQA 3JVVA 4LHZA 3KUCA 2IYVA 3BBPA 4POAA 2ZI7A 1LFDB 3PG5A 3VMFA 4LWZA 4BGDA 3TH5A 1GOTA 4ZI3A 4B48A 1DAEA 1BKDR 3SEAA 4JLJA 2TMKA 2QRNA 1VG0B 3HPQA 1Q21A 1OIXA 2NGRA 5DISB 4AYXA 1JR6A 1KK2A 4AC9A 1N6IA 1MO3A 1N6OA 2R9VA 3TKLA 4URXR 1IJFA 2I1QA 3T1VA 2VHJA 2ZM5A 2G0NA 3TK1A 521PA 1G3MA 3HWSA 1XTSA 1TF7A 4Z1MD 1KI3A 2F1IA 1J70A 2E9SA 4TYQA 4MGZR 1MABA 1KMHA 4PPGA 2VF8A 2F3RA 1II8A 4K81B 1Z08A 2AXPA 5DHAA 1KK3A 3K0FA 1VYVA 1UF9A 4QGAA 3ZVLA 3IBGA 2RGCA 1RKBA 4TMZA 1DADA 3L8ZA 2RGGA 5TARA 1E9AA 1FX0B 4P4SA 2J41A 1M7GA 2BMFA 1RVDA 1YZGA 1NJGA 1W1WA 1AS0A 1G7SA 1VYUA 1ZNWA 2VP0A 1U9IC 3CZPA 2DWOA 1J2JA 4Q4HA 1RW4A 1HQCA 5DI9A 1T5IA 4DDWA 4I1UA 4NYIQ 3B1XA 1X3SA 4KFSA 4FIDA 3VR1A 2C99A 1YZTA 2PZFA 3T12A 1DS6A 4M21A 4DKXA 2RGDA 4QG7A 1WP9A 3UXMA 4IDOA 3C8UA 2OCAA 5TY0A 1L7VC 4A2QA 3W34A 3DDCA 5AJVB 4LC1A 4PC7A 2WBLC 2ZVPX 5K8TA 5A5GA 5CB8A 5BXQC 2J0UA 1KI1A 3KJIA 1TAGA 3KQUA 4EQ6B 1E2MA 2PEZA 1W5TA 4DT1A 5LPNA 1EESA 1L8QA 5HPYB 4RD2A 3I73A 2VHCA 4ZCLA 4QHYA 2G9NA 4N0DA 2HT1A 2E87A 1E0AA 3FDIA 2WJVA 1T3HA 3TQCA 5DIFA 5IK2D 2FF7A 3THXB 2ONKA 2P6RA 2WAYA 1E2JA 3OIYA 1GSIA 4JLPA 4L8GA 1G8FA 5FI0B 2FDCA 3SHWA 1NVVR 2NTYC 2W2XA 1K6MA 1KI6A 4BLSA 4D4LA 4HAUA 5FOWA 1VCOA 5HCIA 3WYAA 3KQKA 3THWA 3IEVA 1G3RA 4LV5B 1AKEA 3TW4A 3UG6A 4C0BA 3I5YA 1UDXA 2QBYA 4MGKR 2QPAA 3PQCA 4O0MA 4Q7JB 5DE3A 3LFUA 4JVMA 3AF2A 4G1UC 5IK2A 4BFSA 1G5PA 4TYWA 1ANKA 4OHVA 1ZIPA 4HB4A 1XU4A 4Q19A 5DSZA 1CR2A 1RYHA 2BC9A 1GNPA 3QSYA 4MQBA 4L9SA 1Y63A 4OKSA 3L0PA 1T8TA 4B2PA 4HZIA 4WAUA 2QPTA 2JJ2A 3U6BA 1G5TA 3GQBA 1M6NA 3KKPA 1RZ3A 1D6JA 4FMCB 4IXNA 4NYMQ 2G3YA 2NO9A 3CRVA 3VQTA 5L3VA 3BH7A 1OFTA 1G21E 2CCKA 1GUAA 2X19A 4KLZA 4JLNA 5L3SA 2J7PA 1P5ZB 5KNDA 4A92A 5FL3A 5L3QA 1G7TA 5JZVA 2PZEA 1FX0A 4P4SB 5G41A 5KPDA 3CWQA 2WAXA 2PEYA 3IIKA 2W6JA 4IJMA 2OAP1 2HDNB 3VFDA 1LB1B 4LGMA 5LBIA 3NTUA 2PJRA 4U7DA 1N25A 1FFHA 5FUXA 4DSNA 3AV0B 4AY2A 4OBEA 5EE9A 1OSNA 4HLUC 1OH8A 3I1FA 3LXXA 2F43B 4FMCF 4Q48A 4OQMA 5BN5A 1ZM3A 1WF3A 4H9GA 2ZUDA 2X2EA 5JEDA 5AJYA 2KE5A 3BFXA 3AVXA 3GLFB 2ANCA 5AWFC 4BE7B 4V03A 5BN4A 4M4SA 4W5WA 3X1ZA 1W44A 1NLFA 2DHRA 1UADA 3NHAA 3T15A 2NO7A 4Z8YA 2XX3A 1JAIA 2O8BB 2P65A 2WKPA 1G7CA 2AN9A 2A5JA 4UJ3A 2CL0X 3LAWA 2IXEA 2BV3A 3LO5A 4YONB 4D0LB 1GM5A 1XXHA 4GPTA 1GTVA 3L0SA 4H1UA 3IQWA 1YZNA 3I4LA 1ZRHA 3ZIAD 1R7RA 1KI2A 4F4CA 2CHGA 4RD0A 1KY2A 3G5UA 5D3QA 4DDVA 1TX4B 3B7GA 2AX4A 1GKYA 3AKDA 2NIPA 1HTWA 3TE6A 4LBWA 4UNPA 1G3IA 4PPFA 4KBFA 4JLKA 4DSUA 4B35A 5TV2A 4BLOA 5FPHA 1OFHA 2WSMA 4BECA 2Z6VA 5H8WA 3WP0A 1QHNA 5E7IA 1II9A 1VKJA 1DG3A 1BOFA 1DVRA 3RRNA 4DLZA 1CKEA 4PHHA 1EWQA 2OO7A 1WQ1R 1E9SA 1NI3A 5FUYA 4TMWA 2YWFA 2QSZA 5AUQA 1OYWA 1DAFA 2ODWA 2XTZA 1N6NA 2KBEA 3A1SA 3THOA 3AVOA 4Q00A 5EXPA 3QVVA 3I32A 1YJ5A 3GJXC 2P6UA 4AYWA 2O8CB 2ONJA 2XOKA 5GJVC 1MRNA 2XJ9A 2VYFA 2ZEJA 1Q57A 4EIWA 4V0ME 3I5XA 4KLNA 2QPOA 1FUKA 2NQ2C 1Z0DA 1FTNA 2AKAB 3UPUA 3GEIA 1JXOA 2NPIA 3CRRA 2J87A 1M1YE 3P4XA 4HDCA 1WMSA 4CGZA 2F1JA 5CJ2A 4MDFA 4HUQB 4AKEA 2OHFA 2XGJA 2PLFA 3IPYA 2LKDA 1UKYA 1X1RA 3EC1A 3GLFA 2AK3A 3A6PC 3CPJB 2VSOA 2KSQA 4URVR 2MSDB 2AD1A 4CEJA 1V5WA 1JR3D 2ZJ8A 4TMTA 2IYZA 3E1SA 4GMXA 3M4YA 4ON9A 5LB2A 5C4MA 5EE3A 1GNRA 3VHLB 5K8IA 1QHIA 1DO0A 1BYUA 1ZNYA 4JL6A 1G17A 1SHZA 2GEVA 2I3BA 4HDOB 4EPXA 4MGIR 4HAZA 1CR1A 1HT1E 4LJ6A 4RD4A 4ACAA 3PENA 3QKRA 4RZUA 5CB6A 1VCMA 1U8AA 1UEIA 2OZEA 2BMJA 3EA5A 2QMUA 2FMXA 3QXJA 3A4NA 4HZUA 4ZKEA 4B6EA 1NIJA 1DEKA 2J46A 2ODBA 3HJNA 4MA4A 1DPFA 1SXJC 4TMVA 3P1JA 1SXJD 3VX4A 2UZ3A 4C3ZA 2V6JA 4TQAA 3CPEA 1MKYA 2JLWA 3ECCA 3GLIB 3SU8A 1G9XA 2WJJA 3QKTA 2EFEB 2HV8A 2KI5A 4LPSA 1BH2A 1VECA 2J45A 2QMEA 2IYUA 2ZREA 4QJ5A 3U44B 5CM8B 1UKVY 1PZNA 2A5YB 3VX3A 3VKWA 2GF0A 5J4VA 4IHQA 2Q3FA 4Q4AA 3TR0A 2RHMA 2ODNA 4QXAA 2W6IA 3TSOA 4Z54A 1XTKA 4URYR 2HEIA 3JZMA 5D3MB 5HKKA 3MGCA 4LBVA 3U2QA 4TLAA 5EQTA 4B34A 5F98A 1Y3AA 3KQHA 2ORVA 4JLOA 3LLUA 1GKIA 1KI7A 5EP2A 3GJ0A 2FGKA 5TDHA 3QVUA 4G5GA 3WP1B 2B7CA 4LK2A 5FTMA 4PC3A 4XSHA 1E1QA 4LJAA 3LLMA 5G3ZA 2F3TA 2V54A 1A82A 3LH5A 5ELXA 4JBWA 2PCLA 2P0EA 2X2FA 5CYPA 5AK0A 3RC8A 2IUUA 1UKEA 4JLBA 2GJKA 4JKIA 4UNQA 3GD7A 3G0HA 2CLSA 2FSGA 4HB0A 4S2EA 2Y8EA 5E7MA 2GVZC 5JS8A 4YLGA 3O8RA 2MMCA 5EE1A 1JR3E 1DE0A 1LVGA 2GEUA 2CXXA 3FVQA 3NEJA 4WZBE 3TLXA 1N2CE 1E3MA 1G4AE 2QSYA 2AXNA 3V4RA 3CONA 5FL7D 1QHSA 3C7KA 5TMPA 4Q5IA 2B6HA 4U02A 2IC5A 5HCNA 4BFXA 1U0JA 1UEJA 1KHTA 2ZI4A 1RRCA 4JJKA 4Q7LA 4UNSA 3LBNA 3GLIE 3C16C 2ZRHA 4DB4A 3O8DA 3IHWA 1YU9A 4D6PA 1L4UA 1X86B 1Q1QA 4FI3C 4QC2A 4KHZA 3NDBB 2VP2A 3GLHB 1GRQA 2JLZA 1Z6GA 2GAAA 4BRWA 3CRW1 4BFTA 2D7DA 3GFPA 3O47A 4YC7A 2ZJBA 3MJHA 2HUPA 2ZRIA 3BH6A 3CNLA 4PQYA 2ZRKA 3K09C 2VP6A 2CBZA 1CJKC 1KSGA 3TQFA 2OSBA 2XTNA 1XD9A 2P67A 1OKKD 3MWJA 1KNXA 1YRBA 2WKQA 4FN5A 2BOVA 3LQRA 2ZRAA 2BVNA 5EXTA 4B3DA 4DCTA 1NN0A 3OHMA 4JBXA 4A36A 2ZSBA 1DARA 1NNEA 1ZC3A 2IL1A 3RSLA 1Z0FA 5EUMA 4QGHA 5LD2B 3F5FA 3W3AA 1I4DD 1VCIA 1XJ0A 2ZI6A 4GMDA 4RD1A 1W4AA 3ND8A 4QJ3A 2C9CA 2YINC 1GP2A 1FTSA 2GZDA 2YC2C 5JHGB 1R5BA 4B75A 4ACBA 2GK6A 2IYXA 4AKHA 3KUDA 3OF5A 3ICEA 3AVWA 1SXJB 1XCGB 3IBYA 1PLLA 4BRUA 2ZRPA 1G6HA 2FOLA 2ZVQX 5DN6D 4LJ5A 4HLQB 1II0A 4OJKA 1AGPA 1E98A 1NBMA 2QL6A 1GDDA 3MFYA 4BLTA 4LC0A 5CK5A 3W9YA 1DO2A 3PJRA 2GZHA 2G1JA 3PR1A 5B2ZA 4YMUA 1B0UA 5KUTA 4KYUA 3WNDA 3ZZTA 1E2GA 1VTKA 4M9QA 1CULC 4LYHA 2VRWA 4JBYA 3UKDA 2AK2A 4RD6A 4TMKA 1RE0A 2V55B 2FH5B 2EW1A 4JT4A 3SYKA 1D5CA 5C46F 1H8HD 1XBTA 2HYDA 4F4IA 5E3HA 1C9KA 5FBVB 5KSOA 1HEIA 3LW7A 3QEJA 4NTZA 1YVDA 4DUGD 4YDHB 1LS1A 3H4MA 2PL3A 4JSTA 3A58B 1YZQA 3SN6A 2QP3A 2FSHA 1JECA 4M1YA 1NN5A 1W4CA 5FI1B 1XZPA 3MG9A 4ERNA 3MRSA 1CIPA 1SKYB 1KSJA 1ZVQA 4QGGA 1WB9A 2OFWA 1GL6A 5JMTA 4ABYA 3LW8A 3CIOA 4E5UA 1NN1A 5FOXA 2QN6A 1NBME 2XB2A 2DCUA 3OAAD 1II8B 1XDBA 1EX6A 1TUEA 1T6NA 1KMHB 3D3QA 3G82C 2LKCA 3W6NA 3TVDA 4X8HA 3VTKA 1AS3A 3K0FB 2A30A 4HEJA 1T91A 4Q9KA 5EXSA 3AKCA 1S3GA 3AGQA 2WWIA 4IOKA 1Q1BA 1NN3A 2EQBA 3R9WA 1D2MA 4DJTA 4RZ3A 4DSTA 2ZE5A 2BCGY 1YQTA 2JEOA 3RANA 4CEIA 1GKUB 4PFSA 4ILEA 5FTNA 2BHRA 2CNWD 2IUSA 1GRNA 1YE8A 4Q7MB 1XFAA 2Z5FA 1E9CA 3TUIC 1KDTA 3R7WA 1DAMA 4L4UA 5JHHB 2D62A 1W4RA 1QVRA 3VR5A 3EARA 4C4PA 2I1VB 2HXSA 3RRMA 2IF2A 3B1YA 3M6AA 5FR1A 4LYAA 4Q4JB 3NEYA 4OK3A 1RC8A 2IS2A 3BXZA 1XMIA 1XTQA 4FWIB 4MGYR 5FFMA 3TAHA 2FPMA 2F1HA 4Q1AA 3Q5EA 5FBQB 1X8KA 1P4SA 4HAWA 4EQ6A 2VL7A 4EKDA 5JCZA 3PUWA 1Z6XA 4V0KA 2OILA 1H8HA 3BOSA 1S1CA 4DB2A 1Z83A 4M53A 5J4KA 2XXAA 3U3KA 1KJWA 3LBIA 4MKHA 4Q9JA 1XPOA 4A0FA 1E1RD 2ECKA 1G8GA 2GJ8A 3L8YA 4HI0E 3QBTA 4XH9B 2YVUA 1W36B 4P0TA 1YR6A 3U44A 2ERXA 3OEEA 3WHKA 4WXPA 4BQSA 3MSXA 5DYIA 3FKSD 1XPRA 2O8EB 1S9HA 4DC9A 4NCKA 4AKIA 4RJLA 4BASA 3LX5A 3SJZA 3AVTA 2KJQA 2A78A 1MO6A 3AF4A 2DYKA 1R0YA 2PLRA 2UZIR 4ZI2A 4LUCA 3AF3A 4TYPA 3LWNA 1OV4A 4JYCA 2Z4RA 2CVFA 3AUYA 2G0TA 4M9XA 5HTKA 1T0HB 2ZXUA 5J4YA 5JFGA 4DLVA 1BO6A 4XD7D 4TQ9A 1DAKA 2WSSD 1FOEB 4NYJR 2B7BA 2GZAA 4C0HA 4B3BA 2FFQA 1CBUA 2IYTA 3A1WA 4DSOA 1CLUA 2FJUA 1W0KD 3EC2A 4ESHA 2K5UA 1Z0IA 4DLWA 1Z8FA 3A1UA 5TXGA 1E4VA 1R2QA 1EX7A 4LCBA 1ZBDA 2XEXA 1KGDA 4HAVA 3E5HA 1KOFA 1TPZA 2V1UA 2ZTSA 3L0IB 4AYTA 3K70D 4WW0A 1P9NA 2J0UB 3KTAB 5FBWB 1VPLA 3ZH9B 4BLRA 1T3LA 5AUOB 1Z6YA 4AG5A 1R8SA 1OJLA 3GJ6A 3SQXA 2D06A 2WMNB 2FV8A 1OW3B 4V0MA 1LS6A 2H8KA 5JWOA 5KSZA 4A15A 1RYFA 5EE5B 4ZDWA 4X8LA 2W00A 1ZM9A 2VTKA 3DOFA 3FMPB 4L5BA 1NG1A 4C0SA 2G1KA 2ZSEA 1Z2CA 2QQEA 2WJYA 621PA 4YQFA 4JMPA 4Z1MA 4FINA 3TW8B 5BYJA 3TJZA 4A2WA 4RFSA 2VIIA 2ZITA 3U6KA 2UKDA 4ZV4A 2J0QA 5JECA 2EVWX 1MR3F 2BCJQ 1HA3A 1XX6A 4O25A 5SZJA 1COWA 4GFDA 4A0HA 2Q0HA 2ZRGA 4NZYA 4W5JA 1WBDA 4B3GA 1NVUQ 1OB2A 3K9GA 4D4MA 1GFIA 4LJ9A 3B85A 4EDHA 2VHUA 4CW7A 3T1OA 1I2DA 2C96A 4Y0AA 1LY1A 1JPNA 3FB4A 4I99A 2GXSA 1FNMA 2DPXA 2ZI9A 1KIMA 4L16A 2O8DA 2WIBA 2YKGA 4LOAA 5HZKA 4Q9LA 1MO5A 2EWVA 2IXFA 2XNDD 4TTRA 5GVSA 1ETUA 1NY5A 1ZCBA 1OYYA 2V4ZA 3GLHA 3A36A 5FTKA 4LX0A 3MCAA 1BYIA 3RS0A 3WYGA 4F91B 1BMFA 1MABB 4D2IA 4XVRA 1U90A 1US8A 2OCBA 2H16A 5JCPA 3N5CA 1YR9A 2P5SA 1GZSA 3KKOA 2CHQA 2QE7D 3U3JA 3D8BA 2H17A 4TN1A 1XMJA 5HE9A 1R5OA 121PA 2XSZD 4PQFA 4A8JC 1AK2A 1YKSA 4GSYA 5F9FA 3T1QA 4KJZA 1PUJA 3GCGA 3KQNA 3Q9LA 3SFVA 1JXMA 4DLXA 1J99A 2XZOA 4ASUD 1OF1A 1OH5A 3SJCA 5AJWA 4F92B 3QF4B 5JI2E 4DDTA 1HV8A 1FQKA 4AURA 1W5SA 3WBKA 2V3CC 1N0WA 4KITB 3QI2A 3ZZUA 4US0R 5JSZB 4BPBA 2GWHA 2WPDA 4AG6A 2XZLA 3MMPA 3RYTC 2MSEB 3PV0A 3ZGXA 2OLJA 4LV8B 2C8VA 1SXJA 4WXRA 1BMFD 4MYCA 3GLGA 2ZYWX 4M1SA 4JZKA 1UFQA 1SVKA 1CJVC 4GI7A 5L3QB 3PVSA 4US1R 3M0EA 1QHHA 3BGWA 1TUIA 2AR7A 1TEXA 4NCNA 3U3RA 1GNQA 1WBBA 1EG7A 1LF0A 1P7CA 1CF4A 5EP3A 2RH5A 5C2JB 4O2LA 1Z28A 1VIYA 4DLYA 3ZQ6A 2X77A 1Z47A 4GDFA 2V9PA 3UMRA 4C0JA 4DLTA 3QE0A 1E4YA 5FOSA 4PHTA 1JR3A 5FPSA 1UBEA 4JVSB 3VNUA 4YMTA 4LYFA 4ZKDA 4KSBA 3IKJA 4PSAA 3ICQB 3W90A 1IONA 2VO1A 2R8RA 1JNYA 1AGRA 3X1DA 2HT6A 3DZDA 3THWB 4IEEA 3ZDQA 2RHDA 3CWZA 1COWD 2NMVA 1F2UB 3B1VA 4D81A 1IHUA 1KK0A 4JIMA 3SQWA 1E9BA 3L2OB 3TNFA 3HR7A 4PC6A 4CVNA 3IO3A 4KVGA 2IEYA 1VHLA 4Z8XA 1N5LA 1TU4A 2C5LA 4M1KA 5KDLA 4MUBA 1SXJE 2ZRJA 1CS4C 5TB5A 1Q1EA 4P32A 3KZ1E 3FFAA 1IQPA 3W5IA 1U0HC 1U2RA 2FPKA 4ZCMA 2GXAA 2YOHA 3DPUA 4QBFA 2CMKA 421PA 3K09A 1R0WA 3MUFA 4QGFA 4MYUA 4DCNA 5L3RA 1JALA 3UG7A 1ZNXA 1QHYA 4FCWA 3K70B 2ZIAA 2JGNA 4IOMA 4QJ4A 1ZM4A 2RCNA 3QF4A 4CZ2A 4D25A 4KVAA 1S8FA 4TSFD 2W2TA 2VP5A 3OIVA 2CL6X 3KJHA 4DLSA 1RRPA 4R71A 3O8CA 3B6EA 2PJZA 2JIZD 1L4YA 2JJ1A 2FWRA 2R6FA 3KJGA 5BQ5A 3SDZA 2F7SA 1Z3IX 3H84A 3TR5A 3X1YA 4W7SA 2VQSA 4CYMA 1XNJA 2F43A 5CIQA 1E2PA 3MAAC 4TL6A 2QMHA 4OL0A 2ZSDA 1RPZA 5BWMA 1A2KC 3N70A 1IN7A 4NYIR 4ZDKA 3BK7A 4WZ6A 1CR0A 4EFNA 1QG2A 2IXGA 4NCJA 1E2NA 4Q7KA 2IEZA 3K0CC 5CDFE 4LYJA 1OFUX 4OYHA 4I4LA 1OXUA 2XITA 4IOJA 4QBHA 3SE0A 2REOA 4XWKA 2HLDA 3AEZA 2ZUBA 4K46A 2YJTD 5E4FA 1PLKA 2CL7X 2ZE8A 4IVPA 4PANA 5GJWC 3EAQA 1IAQA 1WA5A 1ZD9A 1CRQA 4JKYA 4Q47A 4I1VA 3HYTA 1G5RA 3AQ4A 3OIWA 4QNMA 1NSTA 2OV2A 3ONWA 1SVSA 3AGPA 3EIHA 4RFVA 3EPLA 3VNVA 1K8RA 2BWJA 2CK3D 1N5IA 3LQQA 4QL3A 5DO9A 5LB4A 3UWKA 1NVVQ 1SKYE 3F0TA 3MWLA 2R6DA 1AZTA 4LJ7A 2QTVB 4P31A 4A2PA 2IA5A 5FTLA 2R65A 3EW9A 821PA 3EPJA 2OESA 4IW3B 3VR4A 2ZRNA 1RJ9B 1U9IA 1IY2A 4PAMA 1G6OA 2ZJAA 1TF5A 1MH1A 4XTRA 2WWGA 3K70C 4HSEA 5SZHB 5JSZA 3QPWA 1W0JA 1T4GA 2REBA 1NLYA 2R6GA 2QP9X 4DBLC 2J7PD 2JAQA 3CNNA 2C9YA 4KYIB 4LDJA 3IQXA 2R62A 4BEBA 5JJIA 4DDUA 3THXA 3RS5A 4KSCA 5TVKA 2FGJA 2QEQA 3PXGA 1NKTA 3TMKA 3QF7A 4LJYA 2CLDX 5DLQC 1N0UA 3RRZA 3UANA 2YYZA 1KSHA 4RY2A 1N6LA 4TWZA 1GRRA 2IWHA 4TMXA 1N0VC 2O8CA 4V0LA 1E6CA 1Q12A 4LPKA 2SHKA 1G20E 2E1RA 4TZ6A 3GJ4A 2D3WA 4TYNA 2ZE6A 2IX3A 3MWKA 4N0EA 3B2EA 4X8MA 4GZLA 1P73A 5B30A 1N5JA 1E1RA 1Z0JA 2WIAA 4JVLA 4B3FX 1YR7A 3IEUA 3LVQE 3Q7QA 1OT3A 1E96A 2OCYC 1XJQA 2ZQ5A 5FBRB 1IBRA 4EPRA 5CLQA 1XXHB 4E22A 1E9FA 3OIUA 3H1TA 4II7A 3ZJYA 1XEWX 2C03A 3HDTA 2WWXA 4JLDA 2HF8A 2QORA 1KI4A 1ODFA 1ZMXA 3KKMA 3W8NA 1KKLA 3CZQA 5FTJA 2JLVA 3TSWA 4EJSA 2FEOA 3N2EA 4XIGS 2WJHA 3EZ9A 2XXAB 4BFYA 2XNSA 3GLGE 1X8JA 4CF7A 1KK1A 2F1RA 4DCUA 3BH0A 4XWAA 1T3SA 4OI0A 4TLCA 5JJKA 4AK9A 4CRWB 5IHPA 1EFRA 2F9LA 2Q9CA 1SQ5A 3TSZA 4A8JA 5JLJA 1P2VA 1S9DA 2Q6TA 1NBMD 4DCSA 3K9LA 2J3EA 3P26A 1KDOA 1Z29A 4B3CA 1KJYA 2WOOA 3I72A 2IYYA 1V43A 1HYQA 3Q7PA 3AVVA 4BZXA 1W49A 2D4HA 3BD9A 3NC0C 2ASEA 3OE7D 1NG9A 4QBGB 3C41J 4B47A 2QY9A 1ZNZA 1F3OA 1NY6A 2C98A 2ZSAA 5H70A 5J40A 4WA7A 5K8LA 3ZD6A 3EZ7A 4A8JB 2R44A 3DHWC 3K53A 3OAAA 3N2IA 1A4RA 3FE2A 3KXLA 4CEIB 2JJ8A 2QAGC 2DBYA 1HURA 2QENA 4B44A 2P6NA 1VYTA 4IDPA 3EXAA 3W6PA 4LRWA 5KNCA 1JQLB 3P27A 3IDQA 5HE8A 2GKSA 3SJBA 1E2DA 1GITA 1XXHE 2J9RA 2KWIA 3NWJA 2DY1A 5J47A 2F9MA 4UQOA 2FZ4A 3B9PA 1CTQA 2DR3A 1JEEA 4Q21A 1ONBA 4FD2A 2ZI3A 3SJAA 3L0OA 4Q4LA 2EYUA 5KTYA 5FH9A 1Z6TA 1UBFA 4GBMA 5G40A 4Q1CA 1FW6A 4PAOA 3FHTA 2WVJA 1FZQA 4C7OA 3AF1A 5DGXA 3AP3A 1XEFA 2N46A 1SZPA 1F6BA 2V6IA 3MJRA 5A0FA 1E0SA 2BM1A 1KI9A 2OCPA 4HYYA 1IM2A 1W2HA 1TEVA 4PHGA 3E70C 2IS1A 4NCIA 4JSYA 2IBMA 2JDID 3CF2A 1H8ED 3H0KA 2Z0MA 4WIAA 1M34E 2WTUA 3Q72A 3UIEA 2DB3A 5JBQA 1KO1A 3DOEA 1FUUA 3RRYA 5M04A 2Z43A 3DO6A 4MKFA 5HZHA 1R6BX 2BEJA 4PO9A 4G01B 1JPJA 1P2SA 2A5DA 2AKYA 2DWQA 3CRMA 1Z6AA 2H7VA 3FPAA 1RFLA 3GLHE 3ZLJA 4IOLA 3K9HA 3QXHA 2WV9A 4G5OA 1OFIA 2BMDA 2W6ID 1C4OA 2CHVA 2G6BA 2GBLA 3A4MA 2CJWA 1SVLA 5FPYA 2FSIA 4KBGA 4PXAA 4MKGA 5G3YA 1E2EA 4UJ5A 2ZAOA 2CVHA 1HT2E 4HAXA 3ADCA 2QGNA 4IRUB 2GJSA 2R6CA 5CLLA 5FPKA 3FGNA 1WDTA 1X1SA 4M0LA 1JQJC 2ZRLA 1BS1A 4AD8A 1XCPA 2RGBA 2YV5A 4I1OA 1OB5A 1NMXA 2D74A 1ZYUA 3GLFE 2ZRMA 2AWOA 4YMWA 1NJFA 4OQNA 5CIWA 5HR5A 3BJIC 2OBNA 3GFTA 4S35A 3AVYA 1KZ7B 1KNQA 2OG2A 4Q1BA 1DAIA 3CB4A 4V0NA 5L3SB 4OHXA 1XMSA 1LTQA 4O2RA 5P21A 2QM8A 2VA8A 2O5VA 3ADDA 1E69A 3KFVA 2QRZA 3ETLA 4EJSC 4FCVA 3GJ3A 2ZU6A 3LXRA 4LV6A 4PO1A 5BW8A 4KO8A 1F48A 2IYQA 1E2LA 3SBDA 3CH5A 1EFTA 1G3QA 3BERA 3QENA 1Z5ZA 2VSFA 1M74A 2GDJA 3BRWD 3IHLA 2O8BA 4BFVA 5KO2A 4KU4A 1TQ2A 3T61A 2BBWA 4JVNA 1XZQA 3AVPA 3B60A 4P3YA 3EG5A 2IT1A 4HB3A 4TLDA 3KL4A 4M1TA 1TF2A 3T34A 2D2EA 2VP4A 3K0CA 2O8FA 2FN4A 4EUNA 4GL2A 3ZZ0A 2IWRA 1GIAA 5K8UA 3SZRA 2VLIA 5H1YA 4XSGA 2WICA 2PMKA 4LJ8A 4BFWA 2WWYA 4JL8A 4C2TA 2IS6A 5GJBA 1Z63A 2GILA 2IHYA 3B9QA 3D6TB 4MYHA 1ESNA 2YOGA 2FU5C 4G0NA 4EFLA 1OPXA 5EJEA 2WM9B 2Q3MA 3DZ8A 1E9EA 1MV5A 3C14C 4A6PA 2RAPA 4JLVA 2ODEA 3EWSA 4J0QA 4UNNA 5J4LA 2IYRA 4NDZA 4GOJA 3SBEA 4FW9A 2JA1A 3KB2A 4IDHA 3U7FB 2OLKA 1S2MA 1RJ9A 3LA6A 5LDDC 3K0AA 5A4JA 2QG6A 4MRRA 2WWFA 5B58C 4ZDIA 5UKDA 2RMKA 3T1TA 4GP7A 2XOKD 2XAUA 5JJLA 4PC2A 2QU8A 1ZUNB 4OHWA 2NPFA 3VAAA 1Q3TA 2PX0A 3B1ZA 5EP1A 2GJAA 3I62A 1G8PA 1N6PA 3X2SA 2L0XA 3K0EA 5D3MA 4C30A 2XJ4A 4KI0A 4QFMA 3K8YA 2H57A 3HP1A 2H1LA 3KXKA 4M1MA 4HAYA 2B92A 4MRSA 2ZRDA 5FUVA 3QXSA 4KV9A 2QQ0A 3AKEA 1TTTA 2GVDC 3NVAA 1XPUA 1JEDA 4C0AC 2CCGA 1DBSA 4NCHA 1G4UR 1HUQA 2PT5A 1H8EA 4HLDA 3NH9A 5FBLB 5EZ5A 2ZPTX 3CR7A 4CEHA 5KNBA 5SZKB 1JB1A 2ZUCA 3AP1A 1EK0A 2QUZA 2KBFA 2AFHE 4RD3A 4TZ0A 4TL7A 3FMOB 4NYMR 3BORA 4DCVA 4TT3D 3PITA 1TQDA 4QKQA 3RHFA 3ZD7A 2ZJYA 2YHSA 3DVLA 4GNKA 4OHZA 2J0SA 1M7HA 2WJIA 2WKRA 5JI3E 3ZIAA 1ZW6A 2YC4C 1MT0A 2PT7A 3AB3A 3DMNA 3RC3A 2F55A 4GZMA 3B5JA 3LY5A 4G5RA 5E95A 2NZJA 4QNRA 1UPTA 3VU9B 4OQFA 4ARZB 2NG1A 2REXB 1SVWA 2QT1A 4AIIA 4NH0A 4BEJA 1AA9A 4NONA 4Q02A 2ZR0A 4W9MC 1U0LA 2V1XA 4ZCIA 1E2IA 2YWEA 1JBKA 1GILA 1CJUC 2W6JD 1D8TA 2ZETA 1B23P 4LHXA 2J7KA 3LV8A 1Q0UA 1IXZA 4GT1A 3IO5A 4C9BA 5LD2C 2WMOB 2LCFA 1N6KA 5FUWA 3KB1A 2R6AA 2VF7A 4PO8A 2WHXA 4LHWA 1R8QA 4QHTA 5AJZA 3NBFA 1J8YF 2HJVA 1E9RA 1OLOA 1NLZA 1DG1G 1N6HA 4OI4A 4WBSA 4YXWD 1TQ6A 1E0JA 2P3SA 3HYRA 1XCMA 4W5HA 3P4YA 2ZR7A 4E03A 4RZ2A 2RB4A 5AR1A 5EUQB 4LI0A 2FG5A 1FQJA 1EFRD 1VG8A 1EFUA 1OIWA 1FL9A 2JLRA 3B8HA 4H1VA 4MYTA 2P2LA 4UXJA 4EPYA 1FNNA 4ZIRA 2ORIA 2IUTA 4BFUA 3QKSB 3H2YA 3FMIA 2X8AA 3QEOA 1KTVA 1DAHA 5GVRA 4TTQA 4CEHB 5C1BA 2RGNC 1HE1C 1KO5A 2NO6A 2MMGA 4KXFB 2LWIA 4XWOA 1OH7A 2PX3A 2ZI5A 4Q1EA 3FTQA 4KFUA 4OHYA 2HLDD 1QVAA 1FP7A 4US2R 4C7OB 4FXPA 3A1VA 1EXMA 3EPKA 3CR8A 2A9KA 5FOUA 4JT2A 3RLFA 2Q9BA 1P3JA 1M2OB 2DWPA 1A2BA 5EP4A 1X6VA 3BIFA 4NKRA 5J4HA 3EX7C 2GJ9A 1O3YA 3QJYA 2C9OA 3EWAA 4D4KA 1KO7A 1NMYA 2EFGA 4TL9A 4UXHA 4E07A 3NKVA 4XVQA 3EPHA 1FMJA 4QM7A 4PX9A 5DH9A 4AWXA 4L15A 1ZP6A 2JLSA 5C4GB 2Q9AA 2A2ZA 3HU1A 2WJGA 3JVUA 3WXMA 3R7WB 4Q03A 2JJ1D 5AJXA 3A8TA 3OZXA 1TADA 3BE4A 3RNLA 4JJZA 3CX7A 1VG1A 1ZU5A 1TNDA 1U8YA 2A3RA 2ATXA 4PZYA 3UMSA 1P2UA 4TSFA 4BZQA 2CJWB 3NDPA 4B33A 3A37A 4MDEA 2FFAA 4YXWA 1QG4A 3KTAA 3FWYA 3CF0A 1IN8A 1IOZA 1S0UA 3UMFA 4DZZA 4BLPA 1SVMA 4A1FA 1G7RA 4EPVA 3BAFA 2O52A 4LBYA 4PSKA 4C0QC 2BBOA 1VMAA 1E99A 3AVQA 3CW2A 3SR0A 4M1WA 2ZS7A 3VHXA 3CF6R 3NBXX 2JJ2D 5GADl 2O8EA 1I4TD 4JLAA 3I61A 3QXCA 2ZJ5A 1R10A 2C04A 4JS0A 3ADBA 2D7CA 3Q85A 5DNYB 1PV4A 4K8OA 2Z4SA 3IGFA 1ZIOA 2RGXA 2HYIC 4F93B 3T35A 1XRJA 1UBGA 4R2HA 1YR8A 2BMEA 1HY3A 2GBLC 2VEDA 3A1TA 3GFOA 2CK3A 1SKQA 1MO4A 3CO5A 4Q9IA 5J5CA 3V00A 4DHEA 2ZRBA 4FWTA 1GL9B 5CITA 4C2UA 4KFRA 1SULA 1W36C 3CNOA 1X8LA 3GEHA 2OUKA 3AM1A 1W4BA 2BBSA 1DELA 3ZS9A 4F7WA 1YZUA 1XB2A 3KQLA 1KJZA 5CK4A 3U4QB 2G83A 4OJQA 4OI2A 2OAQ1 1Q3HA 1N3BA 4Y0VA 2JLYA 3THYB 1WXQA 3VR3A 5SZIA 4AKGA 3PEWA 4WOPA 3RS7A 2BJVA 3EZ2A 4YDSA 2GAOA 1IY1A 3QUSA 1N5KA 1NSFA 1ZCAA 4MRVA 1Q44A 2A5FA 4PZLA 3SOPA 1Q1ZA 3DKVA 3ADKA 5IDVA 1I4LD 1SVOA 1KO8A 1D9XA 3TUJC 1G3UA 4DIDA 5JRJA 1ZAKA 2N42A 1AM4D 2CEAA 2EU8A 4BUJA 4EPWA 1EFCA 4WZAE 1KI8A 4GOXA 2O0KA 1IN6A 4Z51A 3BS4A 2W2VA 3UK6A 1XJCA 2CLCX 2DFKB 1VG9B 1YRAA 2VPPA 4B43A 2IW3A 1F5NA 4LBZA 2QTHA 3KFXA 4D82A 1KAGA 3PUYA 5GJCA 3I8SA 1JI0A 2Q21A 2ZS8A 1M8PA 3VR6A 2VBCA 2DFNA 2IHBA 1H65A 3GEEA 3KJEA 3FFBA 4A0RA 2QI9C 5KDDA 4A9AA 1NVXQ 3C4JA 5F2EA 3W8RA 1P9RA 3B78A 5F9HA 1AQUA 5KSPA 2NO0A 4F4JA 1XD8A 2XSZA 1RRFA 3RS4A 5FR2A 3QKSA 5JEEA 4JYBA 4LSGA 3KX2A 2GCOB 4X8OA 1OE0A 2G77B 1NP6A 2IYSA 3TBKA 3ND9A 3P32A 1JAHA 2KB0A 4KODA 4U00A 2GTPA 1QZXA 1XD2A 3IIJA 2J5XA 4IEIA 5KOYA 2VHTA 4DEYA 3D7MA 1U98A 3GPLA 2GCNA 3GJ8A 5C18A 1U99A 3RS3A 3U7EB 2GCOA 4RCZA 2ANBA 1ZM7A 1A5TA 3C5CA 2J1LA 4FMBB 3MD0A 4GP6A 2HF9A 1MRSA 4Q1FA 2GRJA 3VKGA 5JS7A 1CXZA 2F6RA 3X1XA 1J7KA 1S4QA 3KKQA 3RDPA 4UKDA 3U3OA 2ZR9A 4HDQB 3TIFA 3V4FA 2XZPA 3QBVA 4IXMA 3TVTA 1HE8B 3GP8A 1NIPA 3B13B 1OXSC 2FFHA 2HCJB 2N1BA 3QPUA 4JLMA 4ARZA 3QKRB 4FMDF 2WPDD 3FOZA 1KSFX 1XTRA 1IJEA 4PTLA 3LD9A 1ZUHA 3SNHA 3K0SA 3VKHA 4HLUA 1CP2A 1Q22A 2P5TB 4PHFA 1EWRA 2PH1A 1AS2A 3DKPA 4ASUA 3U61B 1LV7A 2EYQA 2CDNA 3IUYA 3PEVA 4P4TA 4P33A 3QOFA 3AUXA 1G41A 4ZIRB 1W7AA 2ZRFA 1E79D 4A4DA 4MRPA 2QAJA 4V0OA 2AWNA 2QM7A 2CE7A 2OBMA 5IF9A 5JWRA 2QE7A 5JRZA 1U8ZA 3OEHA 4RVCA 3NH6A 5DHFA 3QG5A 4IFBA 1CRPA 2GF9A 4Q18A 3GMTA 4RZXA 4WVFA 1I2MA 1F60A 1OIVA 1S3SA 2JASA 4OQXA 3RAPR 2C77A 3DEFA 2J59A 2XNDA 3NBYC 3WBJA 3FKQA 3ZVMA 2ZE7A 1ZD8A 2WSSA 1OHHD 2WWWA 2QZ4A 1PJRA 5DYGA 3WRXC 3MLEA 4M9SA 4XD7A 4ZPXA 5KPJA 3NHBA 2QMOA 2ZYUX 1XF9A 4F38A 4QBIA 3CH4B 4QM6A 3EIEA 1M7BA 4M2LA 4MH0R 4N1AA 3CUEF 1KY3A 1KMQA 4L9WA 4PC1A 3LVRE 4M8NE 3RSOA 3NBZC 3LNCA 1ZUIA 1VCNA 3ZQJA 1NMZA 1GAJA 4Q9HA 2DFLA 5DI3B 1WE2A 1QHGA 1TQ4A 4TL8A 2YOFA 3PUVA 2O0HA 4NMMA 2R2AA 3VU9A 1W36D 3TUZC 2RGNA 1IN5A 1AJEA 4YMVA 2G88A 1OXVA 4PQRA 1G19A 3RABA 2VSXA 1U81A 3S1AB 2BBTA 1EGAA 3QY0A 3TGPA 4LHYA 4UXIA 1CR4A 4B6FA 4DEXA 2O8FB 3LX8A 3AF0A 2JCSA 2GHIA 2OBLA 1E32A 1XTIA 1A1VA 2HCBA 4B2IA 2PBRA 4OI1A 3ZS8A 1P61B 2H18A 2FSFA 3AKYA 4EFMA 2GXUA 4DLUA 3I8XA 3EZFA 3BB4A 3CM0A 3E2IA 2BDTA 1JJVA 1VHTA 3H86A 2GK7A 2ZJ2A 2V7QA 3EA0A 5B64A 4Q1DA 3FYHA 5JWHA 2QGZA 3CX6A 5ANRB 4OQLA 1T0JB 4TTPA 4Q4AB 3W5JA 3R9XA 4MRNA 3QG1A 4R2IA 4XJXA 1Q20A 2MSCB 3AVUA 2NOAA 1Z06A 1GVNB 1W48A 4NU0A 3OE7A 2X1VA 1AQYA 1R0ZA 2IF0A 1GG2A 2QROA 1W0KA 4FCTA 2C78A 3AH8A 4URWR 2RGAA 3HU3A 1UBCA 3IIMA 4B32A 1K5GA 4ITRC 2ZAMA 3L82B 2B8WA 2B21A 1MOZA 3F8TA 3X1WA 2QTFA 3W6OA 3NXSA 2W0MA 1F2TB 1QDEA 2DFTA 4LJ4A 4DLRA 3U60B 2FEMA 1W46A 4NBSA 1VDZA 221PA 2ATVA 1XEWY 3QKUA 4ZO4A 3BC1A 1P6XA 2Z83A 4PSVA 3WMEA 4YMSA 2CCJA 4B2LA 2ZJOA 8OHMA 1L2TA 2YNMA 1G8HA 1P72A 4AI6A 1IXRC 4I81A 1KI6B 1XMVA 2WWHA 4PPQA 1N6RA 4CIDA 3OFNA 2FE4A 1T8UA 2O8DB 1QRAA 1OXTA 3CRQA 3BFKA 3B82A 3FKSA 1G64A 1QBKC 3NC1C 3AP2A 3NIBA 3ZYCA 4IVQA 1KAOA 1FMLA 2W0SA 3C15C 2BEKA 3PFIA 3SFZA 3I3SR 4OK6A 4DRZA 1IN4A 3OEED 4DUGA 3LDAA 4QRHA 1QHHB 3SC3A 5DI3A 4D0NA 1UM8A 2FFBA 4B3XA 1K5DA 4URZR 2WOJA 3WMGA 3WMFA 1IY0A 1NRJB 2D2FA 3Q5DA 2AL7A 3U4QA 2OE2A 3ZVRA 4A0GA 1BIFA 2EFDB 2ORWA 4BWYA 2GEDA 2OM2A 2ZYVX 1ZM2A 2EFHB 3I92A 3T06B 4B73A 3HR8A 3FHOA 4A6XA 1E2KA 3THYA 4URUR 4CDGA 3R8FA 1KO4A 4RSGA 4HATA 3PCRB 4ZDJA 3Q8XB 2CNWA 1Z2AA 4HLCA 4PR0A 4IDNA 4G3XA 6Q21A 2XTMA 3SYNA 2EFCB 2ZU0C 2IS4A 2JLUA 1E2FA 3BFVA 2NO1A 3OFND 2ZJZA 5FOTA 3DM5A 4NYJQ 2FA9A 2ZROA 3GJ5A 3KXIA 3M1IA 4CT4B 1Z0AA 4LZZA 3U5ZB 2ZS9A 1UDWA 2ZRCA 3WHLA 2IYWA 1ZJ6A 1NVWQ 1Z07A 2AFIE 3CBQA 3DMDA 3R9IA 4PPNA 4NL4H 3RS2A 2BM0A 4UNRA 3OESA 3Q3JB 2ZANA 2GETA
chains in the Genus database with same CATH superfamily
1E2QA 3L6EA 4QZVA 3RVOA 5B1EA 1VMKA 4E5PA 2Y1WA 2HQBA 2JHPA 2HMVA 1M0SA 4NK5A 3DT9A 1O9GA 5CDYA 4FCCA 2X4IA 4KSYA 1W0JD 3FSEA 2DPYA 4L3WA 3GRFA 3GVHA 1PWEA 3B20A 2CXOA 3QELA 3E22B 3RWOA 4Z4IA 3SE7A 2F3SA 5AMXA 2EWMA 1R3DA 5EE0A 4R98A 1LK7A 3PYLA 1JHZA 2C88A 2I7VA 2VTEA 3IDOA 1XNHA 3E82A 3GR6A 3JVIA 5CNKA 3ZNNA 1L7MA 1CZHA 3RJ9A 1XN4A 4MKIA 4FX5A 4DNQA 3D6FA 4DOMA 2UYQA 1W52X 4WOJA 2AXEA 1JJBA 1KZ9A 3MWYW 4G1CA 4G5QA 5E3IA 1P9WA 4KXVA 1IZ9A 1YI8A 1DJQA 3SD7A 4Q3CA 2E37A 3WL3A 3KT6A 5B2FA 1E2HA 4YJFB 1NHWA 1QQBA 4KBYA 4LDPA 1OZAA 1USIA 1DTEA 3QM1A 3LIPA 5DNWA 2JATA 3OM8A 2BJWA 3KDSE 1YB5A 4ZJYA 2GA8A 3C3BA 3ZHBA 3STUA 1CY8A 4FYWA 4CLOB 1AKVA 4IX1A 3VVBA 4UUPA 3FUCA 5C8YB 3S28A 2F67A 4BMZA 5LU8A 1JS1X 1GDTA 1FA9A 3CLVA 3TZEA 5IUKC 3PEYA 2AFRA 1P62B 1PHRA 2AHOA 2PZGA 5L51A 1DRJA 1P4JA 3E7PA 1JEYA 5LZ7A 5JCJD 1Q7TA 1JJ7A 1R4AA 2O8EB 2DM6A 4HNAA 4DV6B 4O3MA 5KQGA 4NY1A 3HU2A 1I32A 5H68A 4J43A 4P7FA 4RS4A 2XKBA 1KEKA 2XHZA 1CRLA 1ODTC 2ECQA 4V2IA 5EPOA 3WNCA 4NPHA 3ZVNA 4H7FA 1BE0A 4KQEA 5BN3A 4MVCA 1PUIA 1SPXA 4EJSB 1HOTA 2OLEA 3LWDA 3LPLA 4NXNB 1LNZA 5FAXA 1PEYA 5LQSA 4C07A 1SCKA 1BXZA 1N1MA 1CJTC 2WUGA 2FNAA 3C5HA 3IC5A 3M6IA 3NUQA 5G0TA 3YASA 3GGGA 2JIZA 5DN6A 3FWKA 2YS6A 5JS2A 3R9KA 2A59A 3D4NA 5L8VA 3PQEA 1QGYA 2IKSA 3FBGA 3OJLA 2VYND 3LUPA 2NU8A 3ZWWA 2DUUA 4N9WA 4CT5A 4GE0A 5K3CA 1DB3A 3RWMB 1V1MB 2WYIA 4RX1A 3BGDA 1EFHA 3HCOA 4MSUA 3OQMA 3HPRA 3FCSB 4M1OA 4U9HS 5DXFA 2HSJA 2RGEA 3PC2A 5G2OA 3P20A 1RQLA 1ELOA 3REFA 1C1YA 3PX7A 4JI4B 3LDFA 4IDEA 3CC8A 4V3CA 3BWDD 4YJ3F 1ORTA 1E2UA 1P2TA 5EMLA 3BJEA 4PAWA 3WRYC 1KDPA 1H69A 1Y98A 4UE6A 4TKUB 5HS6A 3EVAA 3OMXA 1W8DA 3OQIB 4NS4A 4YMIA 1T5HX 1CC1S 4DDMA 3JD4A 4FEAA 1F0NA 3R23A 1WRBA 1YHNA 2FCRA 4YNBA 3G0DA 3VO1A 3LC2O 4FS3A 4BLQA 5KKNB 1LVUA 4OXQA 5ALGA 3KOXA 2Q29A 3V32A 3D8HA 3HRHA 1GQQA 3O8BA 4I1SA 1W88A 1M2FA 2B8NA 2H7CA 1VB5A 4P84A 5FL7A 5TT1A 1EPUA 3UATA 4A73A 1MC4A 1OBOA 4XI9A 1Z4QA 2VK8A 2UUPA 5EXEA 4E5MA 5J23A 2PDAA 2XB4A 1NI4B 1ZD5A 2VRBA 3AJEA 1E3SA 2CDRA 4HXGA 3RTDA 1Y7IA 4CQMD 4D0GA 2CZGA 3REGA 3MBIA 1CF9A 4I4TB 4WUTA 4YCCA 5JU6A 5B7GA 3QQ5A 3I04M 1HH4A 1Y8QB 3ZDBA 2AFHB 3TCXB 1UKZA 3C3MA 4JA0A 2JLQA 5DDIP 2EIXA 1QQ5A 3MS2A 3T5GA 4ER5A 5LQDA 4DJDC 5ALVA 3K9NA 4NCBA 4P54A 1SURA 2B1QA 4XR4A 5TEWA 4UOEA 5LUAA 4GWKA 4EAQA 1B8VA 4NBRA 4TTTS 2AOUB 2J48A 4W6QA 3L7KA 3MA0A 1KDRA 3IE1A 3CZ9A 4NHOA 3TFWA 3R3HA 4BNWA 4F97A 5KDOA 3IP3A 5JZOA 3AHIA 1V96A 1XRMA 3Q7TA 4G8CA 1LX6A 1MJGM 1N2HA 1PGPA 3ABRB 3L1KA 3PC7A 1K6XA 2CNOA 4ISBA 1F9AA 3HCCA 4BO2A 4D5GA 4D46A 4UPEA 3USCS 2A7QA 2ZR8A 3FCEA 1XEXA 2GESA 2XGMA 4GC9A 2I7TA 4HRYA 4BCBA 3Q7SA 4H7PA 2IUEA 3W8FA 3VR6D 5HMMA 3GJ7A 2B61A 4ESVA 2IZ5A 1EJ6A 1CEEA 1P31A 2H4JA 3LCJA 4ZYTA 4Y2GA 3A4LA 3K31A 4KAAA 2C2YA 3RUFA 3T4XA 4ZICA 1NJ8A 3DL0A 5DGCA 1QHXA 1W1IA 2PFSA 4EL0A 3WMWA 3IOBA 2GOYA 2PT6A 1YS2X 5F4BA 1D1PA 3AI3A 1D4AA 1A7JA 1AZSC 2AW3A 3D7KA 3IQEA 2D5BA 4WNAA 4A82A 3DT8A 1EUDB 4L3VA 3ROPA 2CF5A 2EWWA 1AO3A 1CD5A 1L4LA 3EQ8A 4XCQA 1XWIA 4ZP1A 2H92A 5IXSA 5JH7F 1GWNA 2WHRA 4KDEA 1IUOA 5I7SA 4ZCRA 1EFVA 2QRKA 1R8XA 3MT9A 5HK8A 2GXQA 3K0AB 2M2IA 3D3KA 3VI3B 5ARBA 2HJGA 1WSDA 1G16A 2NV0A 4KLRA 4M6WA 2FMKA 2OZKA 2R00C 3AW9A 3DXZA 1XTPA 2BHLA 2P27A 3FNEA 3RSCA 4DREA 4X7PA 3D8NA 2H54A 3DB2A 4LHZA 1UL1X 4DRXA 1VGQA 1A76A 2IYVA 2WYVA 4IQ4A 4M7WA 5AIBA 1UJBA 1LFDB 1VHJA 3PG5A 1FK8A 5ADVA 1MNAA 3DV0B 1JXQA 4L4ZA 3C8ZA 2GZ3A 3R7AA 1N3IA 1GOTA 1ZHHA 1UBUS 1IWBB 1DAEA 1IOVA 1V6AA 1JEOA 3MRXA 2DRIA 3NYIA 1NPTO 2QRNA 3QP9A 4LISA 1SIBE 3HPQA 4LDAA 4R83A 4KXQA 5IG2A 3NTLA 1D2HA 5HJEA 3K6RA 3E5RA 4KWIA 4D02A 1NZDA 2OV1A 3AESA 1N6OA 4MO2A 4PS0A 4UVDA 3TKLA 4AC9A 4YAFA 1IJFA 2RH9B 2VHJA 5CH5A 3MHTA 3JPYA 4QA9A 2CJYA 5DM1A 5EWJA 1M6HA 2AOUA 1A95A 5LFAA 1SKMA 1ABBA 3LOPA 4QAQA 2NQTA 1KEEB 4NHEA 4PO3X 4ETNA 4ZQHA 3UPTA 4CFYA 5DSXA 2PNFA 2IU6A 3D54D 3IP8A 3LQKA 4KTTE 4ILKA 3O8QA 3WQHA 3LCCA 3HJTA 2OHVA 5BN3B 1KK3A 4PCUA 2BLNA 3UWSA 3B6MA 5AI8A 4IHJF 2UVPA 4Q16A 2RGCA 3L07A 2N75A 2A9JA 4C5BA 1A97A 3RV4A 4QOFA 2L18A 4FONA 2Q7OE 2IYNA 5TARA 2PUAA 5AXDA 1FX0B 4P4SA 3KLPX 2NZUG 3HXKA 2P40A 3D64A 3W5DA 4LZAA 7AT1A 2BF7A 1AS0A 1G7SA 2YYAA 4JT9A 3CU5A 1P81A 1U9IC 4L5CA 4K6HA 4M1ZA 4ZQBA 1CG6A 1XWFA 3C1TA 4YVFA 4UM8B 3GEGA 4HDKB 3A1FA 3NFRA 4TSKA 3ZWCA 2BGNA 4RQBA 3B1XA 5IVHA 2H2IA 2BGUA 2PZFA 1PP4A 4M21A 4X7MA 3CX3A 3QPBA 4HQKA 4QG7A 1XQVA 2QZPA 4HQFA 4UMEA 2I7CA 3QMMA 3JARA 4MS3A 2EGHA 5TY0A 3TO5A 1P7PA 5DWDA 1HRDA 3ZIUA 2FPIB 4A2QA 4JXXA 2W2LD 4LC1A 5KTNA 3O4RA 4EUEA 5CGZA 5A5GA 1JHMA 5EJ9A 5BXQC 1GN8A 2EQ5A 4L02A 4NH4A 3G9TA 2O7NA 3DKKA 4F1JA 1QU2A 3UH1A 2TMDA 4A26A 4MPJA 2LTAA 4GM4A 3W2FA 5JROA 3ETHA 4EVQA 3I9MA 2VT3A 5HPYB 1FFCA 3WK5A 1GPJA 2VHCA 2IH4A 3FTEA 4HVAA 1D2GA 4N0DA 5EWLA 2OK8A 3UHOA 4N5LA 4BGEA 2HT1A 2WJVA 1T3HA 4QLAA 2RG7A 5E4TA 2XWQA 3Q8LA 3W6ZA 1Z33A 2GNPA 3PSHA 3SXJA 3AFNA 4LMAA 2MIIA 4Y67A 1GSIA 1U2QA 1E58A 2Z2XA 5F52A 1OQAA 5FJIA 3S5JA 4BP9A 2W2XA 2NTYC 1QWOA 3GH1A 3T95A 1K6MA 2E4ZA 3H2KA 4GQBA 1E20A 2ZLBA 5FOWA 4D4LA 3WYAA 1SB8A 4MR8B 1GY8A 1V8OA 4C0BA 2AUNA 4P58A 1V2HE 2MYNA 1REQB 3BCSA 4CQMB 3X1MA 4Q7JB 1KZYC 2GYVA 3LFUA 2EKDA 4IWXA 4JVMA 1ZIXA 1G5PA 4TYWA 1ANKA 2C4TA 4KZPA 4IS2A 2NQ8A 2DX7A 1XDSA 1M3SA 3P9YA 1F2DA 2AJLI 4XGRA 3A3PA 4KO3S 3V8NA 2MSKA 4FZRA 3L0PA 2A9PA 1UPBA 2DPLA 1G6KA 4G84A 5K3FB 3HCRA 5BSWA 1XRQA 4KNYA 1L4FA 3CRNA 4W9NA 3MSCA 4XWTA 2UVPB 1FDSA 3KKPA 3F98A 4C04A 2F3PA 4D98A 4NYMQ 2G3YA 5F2KA 3BH7A 2FWPA 2MYUA 2CCKA 2Q3EA 3PC8C 4HX5A 4KLZA 4XDZA 5BPHA 2QQGA 1S7CA 1Z15A 2HBQA 4K26A 4OA5A 4PG8A 2WLTA 4LVCA 4RHXA 3FLBA 1H93A 3WDLA 4KYTA 1P5ZB 5B6IA 1OWNA 5L3QA 1G59A 6GPBA 5D7NA 5A4IS 2WYOA 5G41A 1SHLA 2I0FA 3OQNA 1DZ3A 3RF6A 2PEYA 1L7AA 4HTFB 1J56A 2TYSB 4QNNA 3CSSA 4EOGA 3HK2A 1VLJA 1EUYA 5LBIA 2HH9A 4YN3A 2CC2A 1LLCA 4GI3A 4JB3A 3C5EA 5IMSA 1TECE 3CEJA 3GRRA 4YHBA 3JX9A 4DSNA 1LK0A 3EMKA 2BTQB 1H2EA 3RRBA 5B53A 3WC4A 4CM9D 3G2JA 1EIZA 3RYIB 4B82A 5I7UA 3JYOA 3IDZA 1AHIA 5BN5A 4LFBB 2BHTA 2L19A 3I2HA 3MJDA 1GTSA 1L1RA 4H9GA 4JDUA 3RKUA 1JTEA 4YIKA 3C3CA 2DKOA 4GI1A 1ZH4A 2UXBB 2Y76A 1QTNA 5PGMA 2V59A 1UCFA 3AVXA 2EEPA 3SICE 4BE7B 3RKRA 4RHEA 3ZVKA 3NONA 3ROXA 2Y0BA 4ANFA 4ZGWA 3M1AA 3NJ8A 4P7BA 5CVCA 1OLSB 5ESXA 5LLTA 1YO6A 3DMTA 1MEJA 5AM3A 1WMFA 1FU4A 1TXGA 2V45A 1JAIA 2GT1A 4Z9XA 2P65A 4DIKA 2V58A 1WULS 1JQ3A 2B78A 1SG9A 2CL0X 1YDEA 1X9GA 3LAWA 2IXEA 4MV7A 2JA2A 4N5DA 3A0RB 2HK7A 2XCOA 5KX5B 2ON6A 4HQ0A 4EX6A 1XXHA 4GPTA 4AQYB 3I4LA 1ZRHA 2JFGA 1O0SA 3KKKA 2H2DA 3CNEA 4ZALA 1QQ6A 4ZOAA 3IAS1 2VTVA 4G4SO 3DAHA 4RDCA 5T6MA 4CG3A 4X63A 4RD0A 4S1TA 3U3ZA 1BKYA 2W6ZA 5U4XA 2NIPA 3RUDA 4DNPA 4DSZA 4G0YA 1GR1A 4MA0A 1TAUA 4NJEA 2F00A 2ET6A 4OMUA 4QDOA 3Q9SA 4UNPA 2O3TA 4YQEA 4Z4HA 1U11A 5KNBD 2LDBA 4DMFA 1ZJ4A 2RC5A 3ABIA 2FSPA 3FAKA 5TV2A 3DF9A 3UUGA 2V3WA 3KUXA 5H8WA 1DPGA 3WP0A 3H2SA 4YCBA 4H0FA 2OMEA 2NZVG 5AOBA 1NURA 4MW6A 1DG3A 4WHMA 2QMQA 2FSUA 3GELA 4XIYA 4QQKA 3A14A 3DSRA 1NI3A 1V5EA 2RI1A 4CLRB 5CBPB 1AURA 4OYLA 5DV9A 5AUQA 1IK6A 1WP4A 5DNDA 3P8ZA 4HMPA 2XTZA 3IP1A 1N6NA 3UNXA 4KR7A 3DR3A 5CDUA 3K35A 3K2BA 3OKPA 4KQJA 5EXPA 2JGDA 3WLSA 3QVVA 3I32A 2VHWA 1JT9A 1YJ5A 3SSOA 1J25A 2AYXA 3PICA 1RAAA 2B69A 4O2AA 1DOZA 4FYKA 1M8GA 2NSYA 4G89A 1XDGA 4C4YA 1SXPA 1WCYA 5GJVC 2QLMA 3G0IA 2ZEJA 4MLZA 4EIWA 3S8EA 3I5XA 1KH2A 5BNWA 4KLNA 1G20A 3T41A 1TJ5A 1FUKA 2NQ2C 2QPOA 1QP8A 1Z0DA 2Y92A 5DBFA 3TI7A 1W4LA 2J9ZB 4QDXA 3KG2A 4ARUA 2ID8A 2GDZA 1GG5A 1M1YE 4QUJA 1UPFA 3AIKA 3NTOA 1H05A 3QVGA 1V4VA 4RJKA 3B3FA 2PRYA 3NQ41 1O6GA 1PT5A 4MDFA 2IYEA 1Z5NA 3IODA 4QOHA 5ECGC 4AKEA 4XGKA 1UKYA 1SXGA 3CPJB 1Q50A 2OSVA 2KSQA 2ODTX 2QW0X 4G1FA 3N74A 1ZLYA 2HA2A 2II6A 4ZVPA 4Q7QA 1YCGA 4CEJA 1U6KA 4U8GA 4A0SA 4QXQA 2IYZA 1U8FO 3E1SA 3M4YA 3QEBZ 3UV3A 3EMBA 1QZZA 3ER9A 4F7WA 2QR5A 4P5PA 3ZJVA 5C4MA 3FYUC 2Y77A 3DXXA 4ZI7B 2GPAA 2C7BA 4MUJA 2GM9A 4QPCA 1GL3A 3DEHA 4PBTA 4V1CB 3AYXB 1ZNYA 4JL6A 5BRNA 1M1ZA 4MGIR 1T9ZA 2O2IA 4ACAA 1WD5A 1LTHR 3FSJX 4KIWA 4LNUB 4ETWA 1UJCA 3TFQA 2A0YA 2F90A 1U2GC 4FTWA 2IPAB 3QW4B 1HF3A 2WHEA 5CB6A 3HXQA 2Q4RA 1CV2A 2OZEA 1EBUA 1P17A 4AMGA 4ZKEA 1IWOA 2BR3A 2FMXA 4BO0A 4RVGA 4D9EA 1CIVA 2E4WA 4Q3OA 1DEKA 3AB8A 4EG3A 2I4TA 2H3HA 2HDOA 3GJQA 4PFJA 4KQ9A 3EGXA 3JWEA 4J1QA 2R8XA 2QKYA 4TQAA 4AY4A 5BVHB 1R66A 1MKYA 4ZAWA 1F8XA 3ECCA 3W2IA 3GLIB 4AJHA 4UEKA 1X1CA 2P8JA 4UE2A 3OO0A 5EA2A 5C1IA 5BQOA 4OHBA 1VECA 1Z4JA 2R25B 5EIEA 4ZPJA 1PSWA 2MWMA 2ZREA 1C1XA 5DYNA 4ND4A 2VYVA 1UKVY 1PZNA 3IOEA 2R7AA 4C20A 1TMYA 3VX3A 1QOQB 1B8UA 2ERCA 1YUNA 1LWNA 4U63A 5K3FA 5J4VA 2WG0A 1LDEA 1HG0A 3DBVO 4Q4AA 1V8BA 1S2DA 2RHMA 3TE7A 3WJAA 4F72A 2W6IA 4IIDA 4XYLA 2OCLA 1O6CA 4F2PA 1TIBA 3TL6A 4ZOBA 3W9SA 1BE8A 1FVFA 3U2QA 1V7CA 3H4IA 3PF8A 1KQNA 3NEPX 3G6WA 1T35A 3PUKA 4R51A 3G2QA 3GHYA 3LLUA 2A9FA 2FGKA 2R85A 2Y6VA 3LFHA 4KMMA 1TA9A 3MTDA 4LK2A 4XLLA 4EL5A 3WAJA 1RDFA 1Y8RB 1C5KA 4LJAA 2JHFA 4MB2A 1NVBA 1HR0B 1X0XA 5LXTF 3E7DA 3OLQA 1A82A 1R9GA 4JBWA 2FK8A 2FHSA 2P0EA 4GX0A 1QXSA 3VH3A 2IUUA 3D4OA 2ZTVA 2GJKA 3DKIA 3X3HA 4BBPA 4U9IS 4UNQA 3WL7A 3PNOA 4J2HA 4QFBA 4Y2PA 4YRRA 1A5AB 1G98A 4HB0A 5BT9A 5JS8A 1K89A 4S2EA 1S8NA 1LW6E 4ZVNA 4YI5A 5EE1A 1JR3E 1LVGA 1Y6QA 1D4FA 2CXXA 4G0MA 3TLXA 2HBYA 3COPA 3P0JA 2JI9A 5EHXA 5JADA 1G9TA 5T3YA 3BMXA 5BN5B 5FL7D 1U1GA 3C70A 1BCRA 3BCUA 3C7KA 3LL7A 2DC1A 2B6HA 2VKQA 4PGHA 4RPJA 3VM6A 3ZKWB 1QVWA 4RIHA 1QF6A 1U0JA 4GHWA 3MWFA 1UZAA 2ZI4A 3E27A 4QQRA 4MVYA 1YFKA 1D4OA 1KARA 1XR3A 2G09A 1MJNA 3L6CA 1RQPA 4HDSA 5KIAA 4O63O 4DDVA 2D5CA 2YQ4A 3DS8A 5GINE 5K4AA 3RT9A 3OHSX 1CZLA 5K0JA 2HW8A 1A04A 1HQKA 2DY0A 4R8MA 3UJAA 3H11B 4JB0A 1WOYA 4KHZA 2WJ4A 2XUAA 3PVCA 5T67A 4DXDA 1HDZA 3E4CA 4DDHA 3NIDB 5KVSA 5H5JA 1JPVA 3CRW1 1YGPA 2FY8A 4F1WA 1M2VA 3HDGA 2VVTA 2ZJBA 3MJHA 2ZRIA 3C5VA 3CNLA 5ER6A 3U9SA 1C7EA 1SCUA 3RGWS 3W6UA 3R9XB 2QMYA 1R9NA 2XDYA 1KSGA 3HBMA 5DX1A 1QIFA 3TQFA 3V4PB 2XTNA 1USKA 2R8OA 2CY0A 1ND6A 2IODA 4HVCA 2PRKA 4H3VA 5LMNB 4GUDA 1N34B 2KQUA 2W6QA 2CZCA 2ZSBA 3WQRA 1P7ZA 1X7WB 3AHHA 4J1NA 3RSLA 4OREX 4UTOA 5GONF 4L4XA 4OBXA 1VCIA 4GMDA 5JDIA 1H2HA 1W4AA 1FMFA 2C9CA 2YINC 3FVTA 3HL4A 1FTSA 1EB8A 3VKVA 3OPYB 2ZSUA 4B75A 4ALNA 3PU6A 3ZE7A 3RYCB 2ZIXB 3ME5A 1CQPA 1YBMA 2JAUA 2ZRPA 2FW9A 1ONNA 3OTHA 4G41A 3M83A 3ELYA 4GUAA 4F5ZA 3VOTA 1QSGA 1SU7A 1MIOB 4WCFA 4GPIB 2ZSJA 5D6OA 1C4WA 3MFYA 1KHHA 5CVEA 4BLTA 5JYBA 1RYEA 3F4LA 4HWSA 5K1ZA 3KEOA 4EHBA 2G1JA 4YMUA 3HO1A 2BMWA 4M0EA 4EHFA 5KNDH 1B0UA 2W2NA 3UKJA 3U19A 5IJZA 5GIPE 3MBOA 4K5QA 3GEMA 2VRWA 4JBYA 3UKDA 2ASVA 1PWXA 3D5QA 1XZMA 2EP5A 1FMCA 4ECEA 3NOOA 5GZ1A 2YXNA 3HB7A 3ZWAA 5C46F 4TKZA 4XEHA 4KX3A 4N7BA 1ZZEA 4KNWA 3G0GA 2NZXA 2PYIA 2DFVA 1XAIA 1Z17A 4UD6A 1MX9A 4WKOA 5CXSA 1MPXA 1CY1A 4QFCA 1Z12A 1QK5A 5I9MA 1G5IA 1PRYA 2QP3A 1Y9ZA 4XD2A 1W4CA 1UK6A 4EI8A 2DECA 1MD9A 3F67A 2UZ4A 4D9MA 4TS1A 2BSXA 3L0CA 1SKYB 4U9UA 1NVFA 2HK9A 2RBEA 1WB9A 1Y3CE 8MHTA 1JKFA 3LW8A 4IDFA 5J4LA 3CE9A 1IHPA 1JA1A 3MUEA 5LNK1 1JUDA 1ABFA 1TUEA 5B1HA 3TKAA 3KB6A 4X3PA 4IYRA 2LKCA 3BIWA 3NBAA 3WIVA 3W4JA 2RB5A 4QUKA 1FFDA 4CM9A 4D99A 5CG1A 3S7TA 3WRWA 2OK7A 5DU2A 2OB2A 1AS3A 5AT1A 4DJJA 3KQQA 2A30A 4R4JA 3BWCA 3QV1A 1T91A 4OKIA 4RZHA 3JQ7A 1QYRA 4HGYA 5ICEA 5JNSA 1S3GA 2PGOA 2CGEA 4CKWA 3AGQA 3DZHA 2AZMA 4XM0A 1ILWA 2EQBA 4PZ9A 1YIOA 4L0MA 4GVLA 2ZUEA 2F3QA 4QDUA 3T7IA 4R7TA 1I8TA 5F5NA 3EK2A 3OLXA 2JGMA 5ILOA 4CEIA 1HYGA 1VL5A 1KPIA 1MB2A 5FTNA 1Z3CA 2I8AA 1QR6A 2IUSA 1JWBB 1GRNA 1YE8A 4Q7MB 2VTDA 1W94A 1XFAA 2TMYA 1KP3A 1DAMA 1JF8A 2HQ1A 2D62A 3F5DA 2WFAA 3FYTA 2FPSA 4JASB 3VR5A 1VXOA 5AM5A 2QN1A 2I1VB 4LY3A 2X22A 4C4PA 1EMDA 3WGVA 5LZ4A 1GSOA 4HNQA 2IF2A 1BSVA 3A25A 3RRMA 2YXDA 3TQIA 1VJTA 4AJPA 5ALLA 2NTVA 4DM7A 3AU9A 2BHNA 1P8AA 2E7ZA 2Q1SA 3NEYA 4Q4JB 1PS8A 2IS2A 3LKZA 1M1NB 3C85A 3JAKB 2VZ8A 5FNVB 1GAWA 1FFXA 1XRSB 2F1HA 3Q5EA 4MVJH 4Q1AA 2D00A 2HMSA 2CHUA 4WASA 4KQMA 5A5DA 2X23A 1IBLB 3K6JA 5DCLA 4DY4A 5JPIA 2V7UA 2VWPA 1YE5A 2OILA 3AEQA 4FILA 4R40A 1J97A 4M53A 1AB5A 3AIIA 5FBHA 3R7FA 1ZNQO 1PR0A 3U3KA 4BQFA 5J4KA 5EJMA 3V9AA 1DJOA 3GXBA 3KYBA 4PINA 5DHSA 4ZWNA 4A0FA 4BRSA 4RVNA 3MCZA 2VLBA 4YJDA 2Q0SA 1UZLA 2YVUA 1WAMA 3ABQB 4QYSA 4A23A 2ERXA 3DE4X 3U44A 1DBVO 3JD1A 2G9RA 2XECA 3DGFC 4CF4A 1DQSA 4DC9A 1ATIA 4NCKA 3OU7A 2O7QA 2WD7B 3BJRA 4WECA 3LX5A 4CF5A 2J6HA 2HPZA 2DWUA 3A1NA 1EG2A 1PT9A 1R0YA 1T2FA 4KEAA 3S0JA 2XCSB 5TPWA 3AF3A 4I66A 2X13A 1OV4A 4IUBS 4RK7A 4JYCA 2Z4RA 3ZV6A 3C4QA 3W79A 3JD0A 4MA5A 3HSYA 1CQJB 2ZCUA 2GM4A 2UYHA 1T0HB 3FVVA 3WKEA 1QP7A 3N8KA 1PR2A 1BO6A 3V8QA 2PRZA 4EM6A 4CGYA 3VGJA 2R7LA 4HQ6A 1DAKA 4FQ7A 2IELA 3H2GA 1C7RA 3L5OA 1NQXA 4NYJR 1XJ5A 2J32A 3GBPA 3QVWA 1FJGB 1QG0A 3A1WA 3PHIA 5I8ZA 1CLUA 1KEWA 3LYAA 3OZ7A 4H3KB 3HL0A 4UDXX 3A1UA 5IAKA 5TXGA 1OA1A 3OZIA 1XK7A 2KLHA 4LCBA 4HNHA 1UBTS 3JQAD 4QIHA 3E5HA 1TPZA 4WMLA 4YR7A 1TJ4A 3HVUA 1P9NA 1D7OA 1GPUA 1Q77A 4FI3F 4U0JA 5FBWB 1E4EB 5C51B 4IINA 1N33B 5AUOB 4OGGA 2F59A 2HCTA 2OD2A 2OM6A 1OJLA 4V0RA 1VJ1A 2WQ6A 5IYZB 4A15A 1NYTA 4FZVA 5EE5B 2BGIA 3HCEA 2HNAA 4IBOA 2Z58A 1USVA 5M2QA 4AS3A 4YAKA 5FFNA 2VTKA 3O31A 4L5BA 1NG1A 4F5DA 4S05A 1L9XA 4C0SA 2ZSEA 1Z2CA 4I1IA 4LRQA 5EHGA 2GN0A 2XQKA 621PA 4JR1A 4YQFA 2P2CA 1D1SA 4JMPA 1T4CA 1ISSA 3O4IA 4P08A 2VCEA 4JBHA 4B3IA 3KR9A 4RSRA 2EL7A 3DCYA 2JHGA 1JFTA 2XVMA 3LOUA 2VIIA 1OTHA 3UTDA 2WMDA 5CA1B 3KYCA 8AT1A 2J0QA 5JECA 2EVWX 2F9FA 3B6KA 3BD7A 3MFQA 4AP9A 4D74A 1RU3A 1O4VA 3AM4A 4IKOA 5IFKA 2A9VA 4NZYA 2AN1A 3F97A 2ACWA 1OB2A 2VWGA 4KXWA 1I9CA 5LYJB 5TQ2B 4J0HA 3BWBA 1Z6PA 1GA6A 2V9CA 1LY1A 4KN5A 1U7OA 3A2NA 4IRMA 4C4ZA 2O8DA 1KIMA 2JFXA 2YICA 2XE6A 1XP5A 3O2SB 4GBED 3NP9A 4LOAA 4MVXA 4D6YA 4I1PA 1QCCA 2A57A 2EWVA 3A1EA 2J6CA 2IYAA 4I50A 4RDXA 5A3SA 3V7WA 3N76A 2C31A 2RH8A 4HAOA 3D0QA 4LX0A 4F91B 1BYIA 3QYFA 1RBMA 2QD1A 1PFVA 2OCBA 4HL6A 5JCPA 2H65A 4MR8A 2P5SA 1WQ3A 2G1AA 2Y0CA 1H5UA 3GGSA 2C4WA 2HBRA 3IJEB 4C06A 5BRJA 3UM9A 2FEKA 1VLLA 1DWPA 4V0QA 1PEAA 5AK4A 5HE9A 1BD4A 1DTWB 4YGYA 3OA2A 3GCWA 1AK2A 1FB5A 2X0IA 3HCNA 5F9FA 1C8LA 1O95C 1X39A 3GCGA 4UBIA 1JJAA 2VWHA 4GXQA 4M87A 2ZIGA 3G17A 3TQSA 4AT1A 4MI1A 1VFPA 4I08A 4D8VA 1ZUNA 1A9ZA 1PWYE 2GD6A 4ZHQB 4N0MA 3RRXA 4F92B 1JEJA 1HV8A 1P1CA 3DLHA 4MJ3A 3NRBA 4UFNA 1CZNA 3ZD9A 4L51A 3ZZUA 4US0R 1O03A 3DNMA 2EC5A 3M6VA 1BFKA 5JSZB 2H2HA 1EEHA 2WJZB 2WPDA 4FDUA 2IE8A 3KSZO 1YC5A 1EHIA 3E5NA 4LV8B 1SXJA 2MINB 4WXRA 4D9JA 2FEAA 3JARB 3PGJA 1BS2A 4J49A 5U1PA 2P4EA 3IVAA 3VDMA 4BWVA 4DBLE 4JZKA 1UFQA 1SVKA 1VKHA 3G8BA 2IPNA 1AUXA 5L7YA 5L3QB 2AG8A 4CETA 3AU8A 4F3RA 2BMVA 1QHHA 3RIXA 1ZUD1 2B99A 1I3NA 3WGKA 2OHGA 1TEXA 4NCNA 3B5IA 1TFRA 1GNQA 1V25A 3ZHCA 2CLOB 1WBBA 3IAUA 2RH5A 4O2LA 4UPVA 3AI2A 1Z47A 1CUZA 4Y2UA 3H9CA 1J0XO 3TRHA 4G37A 1UFKA 5DYTA 1HT3A 4KGXA 3HA5A 4BDTA 1KU6A 1GAXA 3QE0A 4DA0A 3ZU3A 2XD9A 3GX1A 7ADHA 1Z2EA 3K96A 4BMXA 1RZUA 1Q7EA 1UBEA 1OA0A 2J4CA 5CEJA 1NDUA 3O82A 3VNUA 3G1WA 4YMTA 2G06A 4ZKDA 3CLSC 2PHZA 2RK3A 5DBEX 3ICQB 4HH4A 2FRVA 4D79A 1FC0A 3PD1A 2C0CA 5AOAA 1X74A 3KE8A 4CQMA 4KQGA 3LTNC 1JNYA 1M2HA 1P4HA 3CRZA 2HT6A 4UQPA 1QO9A 1C4KA 5TQ2A 1JQEA 4ZQCB 2RHDA 3CWZA 3OT1B 2ZIFA 3WHPA 4C4OA 1XAJA 4BN0A 4D81A 1INLA 1UC8A 3SQWA 1E9BA 3HJBA 1THTA 2IHTA 4AO6A 4CVNA 5CA1F 3MLBA 2B5VA 3VZSA 1Z5GA 4DZTA 4EF5A 1R4NA 1VHLA 2G82A 4K05A 3RBAA 1MFPA 4B09A 1KH1A 4GM0A 5IH7A 3CTMA 1SXJE 2ZRJA 1CS4C 1OOEA 4D92A 4OIFA 4KWTA 4P32A 3JSXA 3GLIE 2FR0A 1RMYA 4J75A 1L4NA 4K9MA 3V1MA 3W5IA 1M8JA 5I51A 1U0HC 3DP9A 3GFQA 3H1EA 3QWFA 3E9ZA 4QBFA 4QRIA 3ASVA 1JQKA 4AXXA 2ZZNA 3P4UA 1R0WA 2OENG 3DTVB 3MUFA 2J9FB 2OD9A 4TV8B 4RC9A 5E7QA 3SGLA 4YYEA 4CI0B 5JH7B 3C43A 2YUIA 4JENA 4L0DA 3MS7A 5B3AA 3U4GA 4DPLA 3ADOA 2FAXA 2A7XA 4KE8A 4HAIA 3PQ6A 1BHO1 5LC1A 5AW3A 1JSXA 1ZM4A 3H5AA 4XDHA 4D25A 4KVAA 4RKRA 2JBAB 2W2TA 4XPIA 1NX9A 1QVZA 3LCRA 3M6XA 3OURA 1N2BA 1PCXA 2Z95A 1RRPA 4DLSA 2VQFB 2QX4A 3RYFB 2V0GA 1NTRA 3JQRA 2PJZA 4RK4A 1KZHA 4KHPB 2JJ1A 4GDMA 1XQ6A 2FWRA 3MRTA 3IBFA 2XVYA 3DO8A 3X1YA 1OFVA 5FADA 1NRIA 5JYCA 1XNJA 1O8CA 1C8KA 2KHZA 3DLPX 2PUJA 4GBJA 4RELA 4C4RA 4CDRA 4LI3X 4N49A 2QMHA 2RK4A 2ZSDA 4OL0A 1J33A 2NYRA 4WWHA 5BWMA 1A2KC 1NVAA 1O1YA 1J24A 3CCBA 1BFUA 1A1SA 1FXSA 3LT1A 3UVEA 1IG3A 1F0KA 1L5VA 1Z0SA 3KSRA 1E1MA 2IEZA 4BUCA 3BMNB 2XKAA 1OFUX 2XYGA 1S02A 4ARAA 4QG3A 3OH8A 4WFKA 4XWKA 3H2ZA 3R7BA 2HLDA 3Q0EA 3FZNA 1U2PA 3ZCXA 1Q91A 3E3OA 4K46A 2YJTD 1CUFA 5GJWC 3IESA 3GUCA 2C5GA 3INRA 4J6FA 4GPAA 4NFLA 2FN9A 1CRQA 4E13A 3AQ4A 3TD2A 1NSTA 4B7ZA 2QRUA 1QCZA 3AGPA 1P2BA 4BNMA 3VNVA 5C9ZA 4GGOA 3DXFA 4KYVA 1EDOA 4WFJA 4RV4A 1Y3FE 2V65A 3HB0A 3TECE 4LTMA 2PXXA 3O1IC 5IT4A 2A1IA 5DO9A 1GZ3A 1AQIA 3GG2A 3VYWA 2CMHA 4YV7A 2ZDGA 1A8SA 2PSEA 3MWLA 3WBFA 2XCIA 1AZTA 3P9XA 5JVDA 2QTVB 4EUSA 3BFPA 1V45E 4K9SA 2IA5A 3ESRA 3PXXA 4A2PA 3R3SA 2JHAA 1X7YA 4O1IA 2R65A 4N01A 4H3SA 4OO3A 821PA 3F49S 5M5BA 4KLAA 3WGZA 2ZRNA 4UDOA 1U9IA 1G6OA 5BV2P 4UASA 1BN7A 1TF5A 1LA2A 1T8PA 2I6SA 2QN9A 4FNGA 4XTRA 2M6LA 4RY0A 3H0CA 2WWGA 4JY7A 1DLIA 2O6LA 1G1AA 4HDRA 1W0JA 2REBA 4X44A 4UM7A 3W5BA 2R6GA 2GF2A 2QP9X 4GX5A 4IUCS 4DBLC 3CNNA 2VSQA 1J06A 1T0IA 4KYIB 2ZWIA 3GPIA 3UA4A 3UJ9A 4BEBA 1WXDA 2RHOA 3ZHVA 2RHBA 1N7HA 2P75A 1L7OA 4XJSA 1XU9A 2QEQA 3LYUA 1N0UA 1EX1A 2GSDA 3C98A 4JH0A 4YWHA 2YYZA 3RRZA 4NPAA 4FUQA 1N6LA 4TWZA 1GRRA 3N5KA 3T5BA 1VJ5A 5JANA 2WF6A 1LFAA 4BMYA 1BKSB 1N0VC 4AS1A 2XUHA 4HY3A 2C84A 4LPKA 4FHGA 2H51A 1E3JA 4HR7A 3L0BA 4HPJB 4WESB 5I5GA 4CPDA 1UM9A 2ZE6A 4S3MA 1NP7A 1T6XA 5AVXA 3LC0A 1VZ3A 4B4UA 4ZJZA 4X8MA 1YJCA 3QLVA 4F2DA 5IVPA 1GPWB 2VUSA 2PY6A 1P73A 1PJBA 4BC1A 2C4VA 1M1YB 3FWPA 2G5TA 2P9GA 4KDCA 2EX1A 2PIDA 4AMZA 4B3FX 1K8YB 4RDHA 3V1NA 3W06A 2NVBA 1DUIA 1YR7A 5JMPA 3Q7QA 2C92A 3D6UA 4NU6A 1Y8ZA 1ID8A 2Y4OA 2OCYC 1AMNA 3HQ4O 4PZEA 4E22A 1KE2A 1E9FA 3ZJYA 1QH0A 2VJLA 4EKYA 2VJNA 2VUTA 3T0IA 4MQMA 1A88A 2O2CA 3UJBA 3I12A