3CF6R

Structure of epac2 in complex with cyclic-amp and rap
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
162
structure length
150
Chain Sequence
EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Epac2 in complex with a cyclic AMP analogue and RAP1B
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/gtp-binding protein
molecule keywords Rap guanine nucleotide exchange factor (GEF) 4
total genus 43
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cf6R00
4L15A 5TY0A 1D2NA 1EFTA 3ZDQA 4F7WA 1G6HA 4I1SA 2QU8A 3B85A 2VO1A 5DE3A 2H8KA 4AYXA 4LJ5A 3V4FA 5J4LA 1KNXA 1QHHA 4PHHA 3O8DA 2BVNA 2QT1A 2D06A 4MYCA 3BOSA 5FOTA 3KB1A 2XEXA 4RKEA 3AVPA 3SBDA 621PA 1NN5A 3GJ4A 1A7JA 1EFCA 2JDID 2BBWA 4YMWA 1JEEA 4NL4H 2ZJBA 4YDHB 4P4SB 4PFSA 2ZRPA 1OFTA 1R10A 3SFZA 3R8FA 2JAQA 3LQRA 5LB4A 5AUPB 3CF2A 2WM9B 5G41A 4JLMA 1NMYA 3PVSA 2FFQA 5JWRA 2FA9A 4BZQA 1X8LA 4UQOA 4M1SA 5H68A 3DZDA 3BORA 1KNQA 2ZUDA 1TQ4A 2XNSA 1GWNA 2FN4A 2O0JA 4CIDA 4L16A 3SDZA 2ZM5A 4OJQA 2V4ZA 3B2EA 1WE2A 4LJ8A 2P2LA 1G6OA 2IF0A 1O3YA 2QORA 5HPYB 4BASA 4WVFA 3QG1A 3SHFA 1KK1A 1S3GA 3SI7A 1KO7A 4JJKA 4BFUA 4ZI3A 3KKNA 3U6KA 3C8UA 3VMFA 1OB2A 2UZ3A 2VHJA 5G40A 4C4PA 3I32A 1E32A 5DYGA 4Y0AA 3K0SA 2F43B 2J1LA 1M34E 4CEHA 1IY2A 1CU1A 1TU4A 2CL0X 2F55A 1JALA 2PX0A 3E1SA 1AA9A 2ODBA 1YZTA 3AH8A 5FOSA 3X1XA 4CZ2A 5B64A 4JLBA 1L7VC 3Q3JB 2Q9CA 2REBA 2QRZA 3GEEA 4TYPA 3T5GA 1UKVY 2ERXA 2G1KA 4F38A 4ARZB 3K0AB 4D26A 3LO5A 2HJVA 3PEUA 3NEYA 4DLSA 4FMCB 3Q7QA 4P0TA 3SNHA 3ZQJA 4BFYA 1IN4A 4PO1A 5FUXA 1CR4A 2ZRNA 4FI3C 1G3QA 1ZM4A 2C2HA 4TMWA 3RRMA 2BMEA 2ODNA 4LPSA 5AUQA 2CE2X 2OSBA 3KB2A 1O87A 1E2QA 3GLHB 2QP9X 1VCOA 2P0EA 4HUQA 1XU4A 5F98A 3D6TB 3SN6A 1FTNA 4IEEA 2F9MA 5EXXA 3GLIA 2QMUA 1J70A 1E96A 1MRNA 1UPTA 2ZU0C 4K81B 1EWQA 5B30A 4Q4LA 3KFXA 1KJWA 3LV8A 2ZVQX 3X1DA 3PUWA 4H9GA 2F7SA 2QRNA 3EZ9A 2JLZA 4NCKA 1WP9A 3QNUA 4LOAA 2GA8A 3FMOB 1PV4A 4Q1FA 3GJ3A 4KAXA 4PQRA 4GP6A 1G5PA 2BV3A 2GHIA 5F9FA 2NZJA 1M7BA 2DCUA 2ZRFA 2FF7A 3A1SA 4B3CA 1P2VA 1XTQA 2JCSA 4B73A 2ZRHA 4PSAA 1DO0A 1HQCA 3QKSA 2KI5A 5FOXA 3WBJA 2NMVA 3AKDA 3ETLA 4OHXA 2ZI6A 3QF4B 3QXSA 4AWXA 3ECCA 2JLXA 4OQNA 3Q72A 5TXGA 1EFRA 1E4YA 1H65A 2HT6A 3I92A 4OHWA 4WW0A 3AUYA 1NN1A 4Z51A 1KMQA 2LKCA 5AUNB 1COWD 2ZR7A 1E9SA 2MMGA 3DOEA 3L0OA 1P7CA 2IXFA 3TAHA 4DZZA 4AY2A 2J0UB 3PR1A 1FX0A 1CJUC 1TX4B 2C04A 3DPUA 1P3JA 4XH9B 1W46A 3ADKA 5BN4A 2O8CA 1RYHA 2RGNA 3B1WA 4JBWA 1Z6TA 1YR6A 4DB4A 4TYQA 3O8RA 5JHGB 1VYVA 3PUYA 3AGPA 1H8HD 2QMOA 3UMSA 1E0JA 1CKEA 1G3RA 2ZR0A 4YDSA 3UATA 2YOFA 1IXRC 4MUBA 3NXSA 2C9YA 3OEHA 2NO9A 3NEJA 2DY1A 3GFPA 3THOA 4M8NE 5E7JA 3RWOA 4CEIB 2WMOB 1LTQA 1VDZA 3Q85A 3ZZ0A 5FUWA 2HLDD 5KSZA 2YOGA 4IKEA 1GKUB 2D2FA 2J59A 3BH6A 2EW1A 2F3TA 3UXMA 2EQBA 2LCFA 1TL7C 2VHTA 3P27A 5BN3A 4LV6A 2YV5A 1AZTA 5C1BA 1RRGA 4HB2A 4BQSA 3RS7A 1IONA 3O8BA 1ZIPA 4NHOA 1XTJA 1TQDA 3C15C 4C7OB 1XJCA 1EWRA 2NPFA 3N2EA 3VR6A 2ODEA 1W0KA 4EAQA 3PG5A 4Q9LA 1KDPA 1VPLA 2I1VB 3MUFA 3PUZA 4JVSB 2IL1A 2XZLA 2ZVPX 2C95A 5J40A 4M1YA 4HUTA 3U3KA 1D8TA 3WYFA 5FOWA 2OFXA 1KJZA 1GP2A 1N3BA 4O25A 2DFNA 1G8GA 1KI3A 4E22A 1X6VA 2Z43A 3TSOA 5CJ2A 4AKGA 2VP2A 4WZBE 5KO2A 1Z6AA 1XEWX 3A1WA 2XSZA 1YZLA 1S4QA 4LZZA 3KQHA 2H92A 4A1FA 2R9VA 5FPYA 2EVWX 1ZIOA 3TE6A 4URXR 3U7EB 4LV8B 4GMDA 2QTFA 3U7GA 1FOEB 1GKIA 1X8KA 4WXRA 1XP8A 1P5ZB 1MOZA 2RKOA 3X1YA 1IN6A 1BO6A 3QXXA 4QM7A 2LKDA 4G01B 3ZIAA 4DCSA 1FUKA 4HI0E 2XZOA 4IHQA 2GXAA 2ZROA 3EXAA 4HDQB 3FYHA 3CR8A 3U2QA 1ZW6A 1D9ZA 4XIGS 1F48A 2FSIA 5IT5A 1EXMA 4AIIA 1KO5A 3I3SR 1XWIA 2I3BA 1Z0IA 4MKGA 4ZDJA 4IXNA 4C9BA 1YZKA 4M1OA 1J8MF 4EPYA 3VTKA 1NBME 2AN9A 2ZRMA 4LC0A 2IS4A 3H1TA 2O8BA 2UZIR 1X1RA 1Z22A 1UAAA 5GJVC 1NIPA 4UXJA 3NWJA 3RSOA 4AC9A 2QP4A 3CONA 3EW9A 3LH5A 2HJGA 1MABB 1F2TA 1Q1QA 1V5WA 1BIFA 4PPGA 4ZCMA 3EWSA 4MRRA 4BLQA 4X8LA 1KY2A 2ZRKA 3GEHA 4A15A 3CZPA 3V00A 3O8CA 5LDDC 3X1WA 2ZI3A 1BKDR 1R0XA 1VHTA 3L0SA 4LCBA 1DBSA 3VR4A 3AEZA 2ZETA 5HTKA 3WP0A 5L3QA 4HAXA 1G19A 4O2LA 4DSNA 4PC6A 1BYIA 2QGZA 4A0GA 5DGXA 1GDDA 5JRJA 5DO9A 3QKRA 5SZHB 5CDFA 4UXHA 1UM8A 4OHYA 4IXMA 1G7SA 2HXSA 1XZQA 3MD0A 4RZUA 2CCKA 2ZRDA 3BBPA 3NH6A 4QXAA 1F2UB 1AJEA 1G3UA 4LYHA 2SHKA 1M74A 1NVVQ 4TLDA 1Z07A 1KJYA 3G5UA 4DIDA 3RSLA 4G0NA 4AKIA 3PEYA 4HLDA 2JJ1A 1F3OA 3B78A 4B3GA 3REGA 5DI9A 2D2EA 4MGIR 2ZTSA 4DCNA 3OEHD 3MGCA 2H1LA 3LX5A 1W48A 4QHSA 3T1OA 5HR5A 2IX3A 3P26A 4RFSB 5P21A 3IBGA 3AP1A 3B13B 3C14C 1FL9A 4I99A 4C2UA 1SXJA 4DRZA 4M1KA 1QVAA 4QC2A 4NH0A 5DIFA 3TSZA 3CPJB 2ZYWX 5DHAA 1TQ2A 5AR1A 3DMDA 4QGFA 1DG1G 1VTKA 1TMKA 2V7QD 3UIEA 3CRMA 3RNLA 5FBQB 1E2LA 5EP2A 1NJGA 2O8CB 1UJ2A 4Z8XA 2Z4SA 1HURA 5EE0A 5FOVA 1Q3TA 2BWJA 2RHMA 4DEXA 2QAJA 1JQJC 1DOAA 1KMHA 1E79A 1OE0A 3WNBA 4ESHA 2JIZD 2AWOA 3PEVA 2OCPA 2F1IA 3TRFA 1F60A 4CEJA 1G64A 1OJLA 2H5EA 3B9PA 4KSBA 1RPZA 1M1YE 2GEDA 1YZQA 3GFTA 3K09A 1E2PA 3AQ4A 2RGXA 3MWYW 2VF7A 2E9SA 4QNRA 5FL3A 4WAUA 3CPHA 3EIQA 5J4KA 1YZNA 1AN0A 2GAAA 3LDAA 3QKSB 4L8GA 3KDSE 1OHHA 4TYYA 1N2CE 3PXGA 2X19A 5JECA 2V1XA 2FE4A 4D0LB 1P60A 4KYUA 4TYWA 1QHYA 1Z83A 4M4SA 1KKMA 2OCBA 2KB0A 4LJ6A 1W36D 421PA 4G3XA 1T9HA 5FPSA 4JKYA 1GRNA 1SKQA 4TYNA 4A8JA 3EARA 1TTTA 1Q1EA 1UADA 3BE4A 5DISB 1KSHA 2ZJ8A 3RANA 3GLIB 2A9KA 1P2SA 2IF2A 2X2FA 3BAFA 4KXFB 4H1UA 2OAP1 1NF3A 3VHXA 2GKSA 4A6XA 1Z8FA 3PIRA 2Z6VA 1IBRA 3AKYA 3GLGB 1OXUA 2RGNC 3T35A 1SHZA 4XWKA 1ZAKA 1WCV1 2WWIA 3BGWA 2JJ1D 1KIMA 4FMDB 4HAYA 1OW3B 1KI8A 3DM9B 4HZUA 5K8TA 4ZPXA 2BBOA 1KO4A 3TK1A 3GLIE 2ZEJA 3SEAA 3P32A 4Q1AA 5EP3A 1KZ7B 2P6NA 1E3MA 4D0GA 2RGBA 4QHTA 3ADCA 4TMTA 4V0ME 4R2IA 4LUCA 4NBSA 3UPUA 3MFYA 4TT3A 1G20E 2WIAA 5FTNA 3EZFA 2IYRA 3I73A 1F5NA 4KBGA 1GVNB 2F43A 5KSPA 1OYYA 2ZYTX 4AKHA 2QP3A 1NLZA 1PLKA 5FI0B 2GZDA 4JSTA 3CIOA 2WICA 2PX3A 1JR3E 4DLVA 3R7WA 4Q5IA 1Q21A 1CP2A 1Z6XA 3W90A 4A82A 4LJ9A 2GCPA 4POAA 4BGDA 5KNDA 1Z2CA 2Z4RA 3K0FA 4PO8A 3UK6A 3CR7A 2WJJA 1U0LA 2CCGA 3C4JA 1NVUQ 2C5LA 3U4QA 5AWFC 1BS1A 1KDTA 721PA 1R0ZA 3BFXA 1XJQA 2MSEB 4MH0R 3GJ8A 3R8CA 1SVLA 4B3BA 2QM7A 4PTLA 1EGAA 1NBMD 2CCJA 4JSYA 4L4UA 3WY9A 2R2AA 3NBYC 1NJFA 4URVR 4KLNA 4A2WA 1E1QD 4MQBA 4C0SA 3MG9A 3DO6A 4IOMA 2XSZD 2FH5B 3CH4B 3W3AA 1NY5A 4PC3A 4DIEA 4DCTA 1OPXA 2ZI5A 4XSGA 1ZNZA 5EP1A 2ATXA 3KTAA 1N5JA 2CLCX 2KE5A 4FINA 3ICQB 2WJHA 1IXSB 5SZJA 2RGGA 1R0WA 3QKUA 4OK3A 1XBTA 3TQFA 3L82B 2OM2A 1MKYA 2ZSDA 5FPTA 5CK4A 3ZZTA 4GI7A 4DVGA 4DC9A 5K8LA 5HE8A 4O3MA 3G0HA 3AP2A 5DHFA 1FTSA 1UBFA 2XJ4A 1A2BA 3WMEA 2BBTA 2ZJZA 2C98A 3MJHA 3TMKA 1CRPA 5EUMA 5M04A 3IUYA 4QNMA 2RGAA 1OLOA 1U94A 3FMFA 4TL9A 4M2LA 3A1TA 4OK5A 4BFVA 4MYTA 4XVUA 2CHVA 1US8B 1CR2A 4KFSA 1UKEA 1XCMA 4KO8A 1AGRA 4EFLA 4OI0A 2V6JA 2OZEA 1OH7A 5TVKA 4FN5A 1XZPA 4K8OA 2H57A 2GAOA 1N6LA 3GJ7A 4Z8YA 3H4MA 4UJ5A 4B35A 2PZGA 3UMRA 1E9DA 5GADl 5TMPA 4NU0A 4DDVA 1KI6B 1IHUA 4A0HA 2HF9A 2JDIA 2GTPA 4B2IA 2JLWA 4NYJQ 2Q9AA 2AXPA 3K09C 4MRPA 4ZDIA 3Q8XB 1G41A 5KSYA 3GJ0A 5GJBA 1CJVC 3KXIA 2X2EA 3ZLJA 1XXHA 4OK6A 1WF3A 2VSOA 3CKLA 4FCTA 1II8A 1TF5A 2FPMA 1XB2A 2YOHA 5FUYA 1FNNA 3C5HA 5UKDA 3CRQA 2VHQA 3K8YA 4HEJA 3TR5A 2NPIA 1Z47A 1KK0A 4A2PA 4JL8A 1OH5A 4Q4AB 2ZRJA 1GOTA 1ZD1A 5KPJA 4HDOB 3SC3A 3K9HA 5AJXA 3EAQA 5BW8A 3A1UA 3QBTA 2HYIC 5BXQC 5G53C 5IHPA 4Q1CA 1CS4C 4KODA 4N3NA 1CR0A 3BD9A 2R6AA 1VECA 3EZ2A 2PEYA 3M4YA 4B34A 1TUIA 5A4JA 1G18A 1JR3A 2ZI4A 3OE7A 4KVAA 1OHHD 1W1WA 2A78A 4JJZA 4MYHA 4OQFA 2GCNA 5FL7D 1KMHB 2OG2A 3DZ8A 1Z6GA 3CH5A 4ACBA 1RRCA 2WWWA 1WBBA 2ZJAA 3X1ZA 5K8UA 1SKYB 1ZM2A 3H86A 1HY3A 1E9BA 3I61A 2F1HA 2UVQA 4IVQA 4TL6A 4PO9A 1IM2A 1H8HA 1KAGA 3KJIA 4EPXA 2J0QA 1H8EA 4TMZA 1JBKA 2ZSAA 2E1RA 4TQAA 1ZUIA 2QUZA 4CEIA 2WMNB 2NO1A 4G1UC 3AVYA 4JS0A 2CHGA 1XMIA 1EG7A 3EG5A 1C9KA 2FFHA 2VP5A 2JGNA 4BLOA 1W47A 4OI4A 1GIAA 4NYMR 2WKQA 2CDNA 1JEDA 2C78A 4Q48A 2VTKA 4QL3A 3CUEF 1E1RD 1NVVR 2IK8A 4IDOA 1RJ9A 3A4NA 3QBVA 1XNJA 1KZGB 2OV2A 1W7AA 1Z0DA 2HDNB 4P31A 2NQ2C 3IDQA 2GBLA 2YHSA 3UWOA 4NONA 4UNQA 4KFRA 4QJ5A 3MWJA 1SHKA 5EZ5A 3TUIC 2VP9A 2I1QA 1OH8A 1GL7A 3TKLA 3KXKA 1KI9A 3GFOA 1DAFA 2KSQA 3U3MA 1R5BA 1WMSA 3LFUA 4EDHA 3THWA 1EESA 4FIDA 2QA5A 1P2UA 2DFKB 2Q3MA 3FFAA 1V43A 1KSFX 1K8RA 1WXQA 1SVWA 3QPVA 4MGKR 2TMKA 1NKSA 3L0PA 4B75A 2R6FA 3MWLA 4DCVA 2DHRA 4QGHA 3SJCA 2QBYB 1KYIA 1GUAA 5CDFE 2GZAA 3VFDA 2AX4A 1R8QA 2FSFA 2CBZA 2XOKD 3Q7PA 4LBYA 1XF9A 3R9IA 3OAAD 1W0JA 3LQQA 4PQYA 3AVWA 1DELA 3KXLA 3TVDA 3AF2A 1GL9B 1F6BA 3OESA 4NKRA 2NZ8A 2V3CC 4LBVA 1K5GA 3QE0A 5DLQC 3VU9B 1GNPA 5C18A 4Q19A 1II8B 2ZRLA 1G8PA 1AS0A 1XXHB 2MSDB 2QMEA 4Q03A 1S9DA 4I4LA 4MGZR 1XEWY 2XX3A 1OF1A 2ZPTX 2IWRA 4IW3B 2F3RA 2ASEA 2O52A 4NCIA 4OQMA 3BH7A 2WSMA 2X1VA 4MITA 3GLGE 4DXAA 2PZFA 1HUQA 1NKTA 1UBEA 5K8IA 3FMPB 4P4UA 2IS1A 5FBVB 1BMFA 1E98A 4M9QA 1FQKA 2Z5FA 3FB4A 2BKEA 2ODWA 4KI0A 3QY0A 4B44A 1G7RA 4MGYR 4I81A 5JZVA 2G83A 5C4GB 5IF9A 3FWYA 2BHRA 3KKMA 2V6IA 3DEFA 2FV8A 3U5ZB 1TF2A 1R7RA 2JLSA 5EXSA 1SZPA 3KJGA 2IYSA 4C0KA 2O8DB 4WZAE 3D8BA 2BM1A 4D4LA 2O8FB 1DEKA 3WMFA 3RDPA 1ESNA 2FZ4A 2J9RA 1XD2B 3K0FB 5J4YA 5KUTA 3VR2A 4X8OA 4DWJA 2Q9BA 1AKYA 3DMNA 3K9GA 4D4KA 3P1JA 4FCWA 3CPEA 4BRWA 4DUGD 4H1VA 1Q3HA 3NG1A 1P62B 3U3OA 2W2TA 4A92A 3WMGA 3V4RA 3ZD6A 4YMUA 5HKKA 5KHOC 1UF9A 2CNWD 3SJZA 4YLGA 4UNPA 4ILEA 1J7KA 4G5OA 2FZLA 1XD2A 1L8QA 2RMKA 1CR1A 4XWOA 1W4AA 3RS4A 2VHCA 1M7HA 3WHLA 3IIJA 1E2EA 1IN8A 3TH5A 5JFGA 3RC8A 4Q4HA 2G0NA 2HCJB 4B3FX 5JCPA 1DAMA 1MO4A 3DVLA 5TARA 2PEZA 5JRZA 1JXOA 1VYTA 1HH4A 2QTVB 4GPTA 2ZS7A 4E03A 1PUJA 1RRFA 4HB3A 4HSEA 4F92B 5JSZB 3U4QB 4LHYA 3GLGA 2A5FA 2B8TA 3SJAA 5LD2C 1DADA 3EC2A 2PLFA 3L43A 3TJZA 5JMTA 1QHHB 2BDTA 3K70C 1YR9A 3HJNA 1VG1A 2IYQA 1RKBA 2HV8A 1GRRA 4V0MA 5ELXA 4NYMQ 1W36C 1ZRHA 4L5BA 4DJTA 3VX4A 3KUCA 5FH9A 3NVAA 5E3HA 2ERYA 1E1QA 2QG6A 3D7MA 5JS8A 1W2GA 1Z28A 3IO3A 4A6PA 3K70B 1E69A 5EE9A 1E2IA 5EZ6B 2AFIE 2DYKA 4QBIA 2CL7X 4KBFA 3GJ5A 3T12A 1TNDA 4P32A 2RB4A 5GJWC 5FR1A 2ZQ5A 4IEIA 3A36A 2ORVA 2ZI7A 1XRJA 4RVCA 2QBYA 2NO0A 2QQ0A 3SR0A 5AJYA 4GSYA 521PA 5HZHA 4RKFA 4TLAA 4Q9IA 4EJSB 4GRAA 1XMSA 3QI2A 1KAOA 5A0FA 1W5TA 4S35A 5IDVA 1YVDA 2A5JA 1TPZA 3OZXA 3OIUA 4DBLC 2AL7A 1E9CA 4LGMA 4WA7A 4DDUA 3KL4A 1X8JA 2N1BA 1PLLA 3RS0A 1T8TA 1IN7A 2GWHA 3I4LA 3W34A 2XZPA 1E2HA 3FHOA 1VYUA 1RRPA 2NO7A 1P73A 2RGEA 3CW2A 3I72A 4G5SA 4R98A 3KQKA 1G8FA 4V0KA 1RJ9B 1LV7A 1EFUA 4W5WA 5FR2A 1N0VC 3NBXX 1Q57A 1SVKA 2OBMA 3B60A 1XPRA 2AD5A 1XFAA 1P9WA 5KU1A 4BWYA 4X8HA 2IXGA 4TZ6A 1AQYA 5ANRB 4HAWA 1S2MA 1FNMA 3FGNA 3CRW1 4UNNA 1P9RA 1I4DD 3AVQA 1A5TA 3IPXA 3OF5A 4ZKDA 5KNCA 1HE8B 1QDEA 1N6KA 1OV4A 1QHIA 1S96A 1XTKA 4OHZA 2PMDA 3RS5A 3SBEA 2BKUA 1PZNA 1Z5ZA 4EFNA 3FPAA 4Q9KA 4TLEA 2QPTA 2G3YA 1Z2AA 4RZ3A 4KHZA 2JLRA 2ECKA 3A8TA 1YHNA 2XOKA 3RHFA 4HUQB 3E70C 2WJVA 1W36B 5JSZA 3GLFA 4JBYA 3C16C 5BWMA 2WWYA 3VNVA 4RY2A 2GRJA 1NP6A 4O2RA 5EXTA 3S1AB 4MYUA 4JL6A 1WB9A 2P67A 3K1JA 2OUKA 3LXRA 5CYOA 2QNRA 4FD2A 1Z0KA 3E2IA 3NBFA 1KI1A 3RLFA 4DLWA 1T8UA 4QKQA 1VMAA 1Z06A 2VBCA 3K0AA 4NYIQ 2QAGB 1WRBA 2W6IA 3GP8A 1Q12A 1RE0A 3KKQA 3N70A 3TUJC 3QENA 1UDXA 3I5YA 3EPKA 1LY1A 3N5CA 1NLYA 2FGKA 4Q66C 1G16A 4XD7D 4BLSA 4Q4AA 1SXJB 3I8SA 2WWHA 2XJ9A 3AVUA 8OHMA 1XTRA 4M22A 1YQTA 4DLZA 3DM5A 4QFMA 1JB1A 4MKIA 2OCYC 1RW4A 2K5UA 1NIJA 2QENA 4C3ZA 3T1VA 2GJAA 5AK0A 1IN5A 1MABA 3AGQA 2DPXA 3QF7A 2QE7A 1TAGA 1XPUA 4BLTA 1E6CA 2BEKA 3LLMA 1SVSA 1G8YA 4TWZA 1VIYA 3TAUA 4PC1A 3SQXA 5C46F 4PR0A 1R8SA 1W0KD 1CJKC 1RFLA 2W0SA 1X86B 2ZREA 3LY5A 2VP4A 2O8FA 4HLUC 3RAPR 2O8DA 1L2TA 2HLDA 2VEDA 4A0FA 4NZYA 5JI3E 2R6DA 1IJFA 5DNYB 3U7HB 2IYUA 1RIFA 2XITA 3QKRB 4P4SA 4BZXA 1QF9A 4ZCLA 5DN6D 1XJ0A 4D4MA 3EPLA 5A5GA 2R65A 1DAEA 4ZDWA 3DKVA 1P9NA 1ZVQA 4US1R 4IDHA 2NTYC 2BCGY 3OEED 3W5IA 5H1YA 3EA5A 2G88A 2IYLD 4QOSA 2CVHA 3QXJA 4IVPA 4DDTA 4GDFA 1SQ5A 2NO6A 4B43A 2ORIA 2IEYA 5CM9C 3TVTA 3ZVNA 5CITA 2R6GA 4MRSA 4IVRA 3L8ZA 2H17A 4MRNA 1ZCBA 4GNKA 4TSFD 4RFVA 3QVUA 3ZQ6A 1G21E 1LNZA 4LK2A 5EQTA 4MDEA 1L4YA 3U7FB 2R8RA 1OXSC 1WBDA 2BMDA 5C2JB 1W44A 4Q7LA 1JAHA 1U0HC 2ZRBA 5EE5B 1N6HA 2GXQA 4U00A 2O8BB 2C9OA 4XVQA 4BFSA 3UMFA 4QJ4A 3F8TA 3HPQA 5E95A 3U44B 4FMCF 5FTLA 1II0A 3SQWA 1JPNA 4Q9HA 1SXJE 2YWFA 3OHMA 2OILA 1PLJA 4TL7A 5FI1B 1DG3A 2C99A 5DSZA 4US2R 1OXTA 1W49A 3OFND 3WRXC 4DKXA 1NG9A 4ERNA 2QGNA 3QPWA 3RC3A 3EWAA 4MUAA 3HDTA 2B8WA 1K6MA 1G8HA 1SVOA 4LYFA 1G3MA 4GZLA 4D2IA 4M9SA 2ZRAA 5JLJA 3QSYA 4JT2A 2BOVA 4LJ7A 1J2JA 4PHGA 2A7QA 2IT1A 1CJTC 2XB4A 3D31A 3HPRA 1T3SA 4KSCA 3QEJA 4IJMA 1NY6A 2BC9A 4RCZA 3I5XA 2J5XA 3Q5DA 3PJRA 2AK3A 2IA5A 2QY9A 4MRVA 4GOXA 2QZ4A 2VH5R 1KI4A 1QVRA 4CW7A 1CRQA 4IFBA 2GNOA 2GF0A 3VKGA 2NOAA 2QSZA 2OESA 3REFA 1TEVA 5FUVA 1SULA 2G77B 3RS3A 5KNBA 4BRUA 1I2MA 5IK2A 1OH6A 3AM1A 2QAGA 3K0CC 1TQ6A 5FPKA 2JASA 2OXCA 3RS2A 4Z1MD 4II7A 2YKGA 1ZC4A 3MJRA 4Q4JA 1B0UA 1EK0A 2QSYA 1XX6A 4KLZA 5J4HA 3HU1A 2W0MA 4TQ9A 2G1JA 4PZZA 2OLKA 4AK9A 4HZUB 4YXWD 4FCVA 2O5VA 1NL3A 4PXAA 3GLFB 2L0XA 1QHNA 4V0LA 1U90A 4C7OA 4GFDA 1MO3A 1NLFA 3U3RA 1QHGA 5B2ZA 1UEJA 1U81A 4ABYA 4Q1BA 3AVTA 4TSFA 1HEIA 1ZU5A 1HA3A 4C0AC 3SFVA 2EFCB 2W00A 4V0OA 4CT5A 2XTNA 1VCIA 4GL2A 2OCAA 2V7QA 3GEIA 1KSGA 4QJ3A 4Z54A 3CX6A 4W5JA 2GJKA 2J46A 2PT5A 2OFOA 2ZS8A 4KV9A 3VR1A 2ZS9A 1R5NA 1FZQA 2WZQA 4OBEA 1YZGA 1I4LD 3VAAA 1QRAA 2F9LA 3ADDA 2RHDA 4TMXA 1IJEA 2RCNA 3EZ6A 4QRHA 4Y0VA 1N6PA 4HLQB 4KFTA 4FMBB 1CJMA 2QI9C 4C0LA 3TLXA 1HE1C 2GXUA 2XTMA 3ZVRA 1GILA 2GXSA 2CLDX 2GVZC 3BFVA 3NBZC 2VRWA 4URYR 4L9WA 1JR6A 3ZVMA 3TR0A 1N25A 1KHTA 4Q47A 1Q1ZA 2RAPA 4RD1A 5FBWB 3C7KA 3FFBA 4OQLA 5AJWA 4JYBA 4EIWA 1KI6A 4DLYA 1HV8A 1AZSC 5JWOA 4BPBA 4CEJB 1DAGA 1Z63A 3U3JA 4HLUA 4URWR 3UWKA 4RD6A 3QUSA 4TN1A 5TDHA 4EJSA 5GJCA 1Q1BA 2CLSA 4D4JA 2IYVA 3O47A 5HKKD 2PLRA 1U0JA 4LYJA 2D62A 2FJUA 1SGWA 2X77A 2DWPA 4TZ0A 3AP3A 3EIHA 1E79D 2QE7D 1JPJA 4RCYA 5L3SA 4Q7MB 1E0KA 2F1JA 4LBZA 4ZIRB 3ND9A 1PJRA 2J7PD 1LS6A 4V02A 4CGZA 2OT3B 3N2IA 5FTMA 4CEHB 1XCPA 5GVSA 2A2ZA 1A2KC 1SXJD 2JLQA 4RFSA 2EYUA 3B82A 1E2MA 4GP7A 2F6RA 3QXCA 1JAIA 1KKLA 1MO5A 3BB4A 1M7GA 1G291 2VSXA 3IHLA 5AJZA 5GVRA 5LD2B 121PA 4OHVA 2YVUA 4M21A 1OB5A 4B74A 1OKKD 4DCUA 3SZRA 1DE0A 3KUDA 1E4VA 3NH9A 3X2SA 4PC7A 1XCGB 1FPMA 2PMKA 5C4MA 2VF8A 5BQ5A 3C41J 2PCLA 1KY3A 1F2UA 2YINC 1M6NA 1X3SA 2IW3A 2R44A 4EKDA 3LWNA 1Y3AA 2ANBA 4B47A 4M1WA 4PQFA 2ZXUA 2GF9A 3QPUA 1HYQA 1OIXA 4AG6A 2QN6A 2HT1A 2VYFA 2B7CA 2CE7A 3K70D 3AVXA 2ZE7A 3WNCA 1II9A 2J0VA 2ZJOA 3CLVA 4NCHA 1ZBDA 4YMVA 1LF0A 2WSSD 2GJSA 3DDCA 1E0AA 4XD7A 3TQCA 2A30A 3ZIAD 4EFMA 5L3QB 1D5CA 3U6BA 3SS8A 3PFIA 2VP0A 4ACAA 4C0HA 2P6RA 3BRWD 2ZJYA 1KDRA 3A1VA 3ASYA 3B1YA 5JJIA 3ZJYA 3THXA 2EWWA 3MRSA 4G5RA 1RC8A 2DFLA 4HAUA 4C0QC 4PHFA 2J7KA 2V9PA 1UEIA 3LW8A 3BB1A 5JBQA 1EX7A 1P4SA 4HDCA 3R7WB 2DFTA 2OXRA 1YE8A 5IRCD 5H8WA 1E9RA 4BZPA 2KJQA 4ZCIA 2EU8A 1CLUA 3HP1A 4OYHA 2QM8A 4TT3D 1KO1A 2B6HA 2VQSA 4B33A 2CK3A 2FEOA 5CLLA 1NBMA 1ZC3A 2ZE5A 4LDJA 4YMTA 1PVOA 1U2RA 3KKPA 4M1TA 3VKHA 1QHXA 4Q00A 4A2QA 3B8HA 4I1OA 2XNDA 3ZH9B 4FWTA 1G5RA 1QG2A 2GK7A 1T0JB 2J45A 4ZIRA 5L3SB 2R6CA 2WAYA 1IQPA 3B1ZA 3IO5A 4D25A 1MT0A 3LBIA 4URUR 1D2EA 1JJVA 3Q5EA 1T3HA 1Q0UA 2C77A 1M8PA 3GD7A 3A6PC 2Q21A 3RRNA 2OEPA 4Q1EA 4EQ6A 3RRYA 4IOJA 3JVVA 1JXMA 2EWVA 3SU8A 3AV0B 2J41A 1NN3A 1ZYUA 3BERA 2IS2A 1XMJA 2GESA 4Q9JA 5LPNA 1CIPA 1J90A 3VX3A 2FEMA 3BH0A 5SZKB 1E2KA 3QJYA 5BYKA 4M9ZA 4IFEA 2CXXA 3I8XA 4JVLA 1GZSA 1XEXB 3FE2A 3KX2A 2BMJA 4DSOA 3I62A 3ICEA 1KK2A 3EPHA 4EPVA 1IY0A 3AF0A 2H7VA 2GZHA 5B57C 2P65A 3LBNA 1FMLA 2EFGA 3M6AA 2YWGA 4CRWB 3DOFA 1ZM3A 4PSKA 4Q01A 4BE7B 2QTHA 1N6OA 4Q7JB 3EPJA 2A5GA 1X1SA 1G9XA 5FPHA 3GCGA 1H8ED 4GZMA 3T1QA 1E2GA 4CVNA 3QXHA 4TLCA 3IQWA 2P5SA 5CIQA 3T15A 1NG1A 4DDWA 2FSGA 2YWEA 1N5LA 4FXPA 2IUUA 5H70A 4HZIA 2ANCA 3Q9LA 2AKAB 5KDLA 2W6ID 4B3XA 2CNWA 2O0KA 2W6JA 3QQ5A 3TW8B 4PZLA 3CBQA 4CYMA 4WBSA 3EA0A 2BCJQ 3R20A 1XTIA 3TGPA 3G82C 3OE7D 1GG2A 5J5CA 2Z0MA 2WHXA 1NN0A 1ZNWA 3FDIA 4AYTA 4IOLA 1GL6A 1Z0AA 3BJIC 3NTUA 3F0TA 4PPQA 3SJBA 1GTVA 4EJSC 4XWAA 2FX3A 2NGRA 4JLKA 1E2DA 2ZU6A 3KJEA 5KDDA 3PENA 1J8YF 2WOOA 1TEXA 4JT4A 3I1FA 4R7ZA 2ZSEA 4XOIA 2GJ8A 2WKRA 3VR3A 4LHZA 3B6EA 4KVGA 1M2OB 3GPLA 3CO5A 2B92A 3MWKA 1NRJB 5BYJA 1U9IC 4BLRA 1AM4D 2QMHA 4JLJA 2PT7A 1P2TA 2HXYA 1XMVA 3F5FA 2REXB 2AKYA 4J0QA 3GLHE 4FWIB 3KFVA 4Q1DA 2NIPA 3WYAA 4F91B 4DHEA 5KDOA 1TU3A 3IEVA 2VSFA 1MV5A 1COWA 4YXWA 3FOZA 3JZAA 2G9NA 2V1UA 3E5HA 1GNRA 3W5JA 1P72A 4A4DA 3UG6A 1OYWA 4DLRA 3TNFA 4KITB 2WOJA 4PX9A 2JA1A 3T06B 1ZM9A 5TV2A 1TF7A 2JIZA 4XVRA 5CM8B 3KKOA 2AHOA 4NYIR 2JEOA 4ZV4A 3CX7A 3IIMA 4LJ4A 1FP6A 3A4LA 1E2JA 3A4MA 1G17A 4NMMA 2W6JD 4TMVA 3WNDA 4BUJA 1WA5A 4JBXA 1QHSA 4BECA 3IPYA 4DLUA 2UKDA 2X8AA 1OIWA 2RH5A 2ORWA 5EP4A 4C30A 1OIVA 5E7IA 3U44A 3PV0A 1XXHE 3JVUA 4PAMA 5J47A 1S8FA 1DVRA 2VL7A 4PANA 3FVQA 4NCJA 4JLPA 2LWIA 4NP6A 2ZYVX 3H2YA 3CWZA 1R2QA 1ZNXA 4ON9A 4A9AA 4D82A 1GFIA 1UKYA 1EFHA 2VPPA 1VKJA 3L8YA 2QAGC 4Q18A 4TL8A 3VR5A 1S9HA 1F2TB 3QKTA 2W2XA 4WOPA 3RVBA 4OQXA 4OI1A 1G7TA 1NMZA 4JLOA 1ZD8A 2NG1A 2XNDD 1YR7A 2HUPA 4NCNA 1VG9B 1UDWA 5JS7A 2FOLA 2KBEA 2GJ9A 2ZSFA 1W5SA 3AKEA 5HE9A 2BIFA 3UG7A 1YU9A 1VHLA 2FGJA 6Q21A 3CF0A 2ZSBA 5HCIA 4O0MA 4U7DA 5JCZA 1FP7A 3P4YA 3NKVA 3DHWC 4ZDKA 4NE2A 3CNOA 1US8A 2PL3A 3RYTC 2IXEA 3FKQA 1OFIA 5CJPA 2KBFA 4PPFA 3WBKA 4BFZA 4HATA 1DARA 4KCGA 1KK3A 2N42A 5EE1A 1XD8A 3BC1A 4IRUB 2IYTA 1YRBA 2C9CA 1L4UA 1P75A 1GAJA 2OHFA 3LLUA 3AKCA 2QPAA 3TIFA 3ZS8A 2HCBA 2OAQ1 3PEWA 1T6NA 3TBKA 2CHQA 3AVOA 1Q20A 4LYAA 1BH2A 2G6BA 5F3WB 2A5DA 3KTAB 5D3QA 2MSCB 3BFKA 4E07A 2D7DA 1G1MA 4QBGB 1C1YA 1G3IA 4AYWA 2V55B 5LBIA 1KI2A 3NHBA 2ZAOA 5DN6A 2N46A 5AUOB 2D7CA 2ZI9A 2ZRGA 4YONB 2WV9A 3MLEA 4M1MA 4ASUA 3ND8A 5G3ZA 3NIBA 5KSOA 4A8JC 1HQYE 1NVWQ 1QBKC 1ZU4A 3V9PA 5LB2A 1T91A 2PZEA 4GT1A 4YMSA 1U8ZA 4TMKA 3IKJA 3UKDA 1YRAA 2YWHA 1VG0B 2HYDA 2PH1A 5E4FA 4C0BA 1U9IA 2GETA 1DS6A 3PITA 3C5CA 1U99A 2GCOB 4LV5B 1FFHA 1NMXA 5FFMA 3S1AA 3W6PA 4R71A 1KI7A 1JQLB 3BWDD 4DSUA 1YKSA 4JLVA 4DLXA 4N1AA 3ZD7A 1TUEA 1NSFA 4IOKA 2ZAMA 4AKEA 1LF5A 4UNRA 1E9FA 1Q44A 1JNYA 2C96A 2E87A 1E0SA 4D6PA 4F4JA 2IBMA 1G4UR 2OLJA 4LI0A 4S2EA 4DLTA 3EX7C 4QM6A 4RD2A 5EXPA 1FQJA 2VHUA 4P4TA 2J0SA 2EFEB 1IY1A 3LX8A 1MRSA 2DBYA 3LW7A 3MSXA 4AD8A 1GITA 2WAXA 4D0NA 2FFBA 3IIKA 4US0R 3NDBB 1VG8A 1Z08A 2IYXA 2Q3HA 3LVQE 1D9XA 3ASZA 2WJYA 3M0EA 4L9SA 4Q7KA 4LSGA 2XTZA 1ZCAA 3EZ7A 4ESVA 3NC1C 4W5HA 3AUXA 3AVVA 1S1CA 1XD9A 4JYCA 4B76A 2CJWB 4BFTA 2GVDC 1CXZA 3D3QA 1I4TD 1OKKA 4B32A 3SYLA 4A36A 5D3MB 2O8EA 1W4RA 1ESMA 3CM0A 2WIBA 1DTSA 4HLCA 1D2MA 4HYYA 4HB4A 2YZ2A 4F93B 2Z83A 2WVJA 1FW6A 1AKEA 4DT1A 2J7PA 2ZE6A 1KDOA 5FL7A 3GJ6A 2ZRIA 3WP1B 1ODFA 1FX0B 2BMFA 1T4GA 4AG5A 5HCNA 2J0UA 2V54A 1N5KA 2ZJ2A 3CF6R 4W9MC 4EPRA 3T1TA 1NNEA 3NHAA 4MDFA 4TQUS 3EC1A 3K0CA 3B9QA 2I4IA 1R4AA 4E5UA 1GRQA 2CEAA 3LVRE 5FBRB 4NPHA 1SXJC 1LVGA 2IYWA 5JWHA 3FKSD 2JJ2A 2C8VA 2JJ8A 1JJ7A 4A8JB 5CB6A 2Y8EA 1FMJA 4M0LA 5F2EA 4LHVA 5D3MA 1E9EA 3B1VA 3MMPA 3NC0C 4V03A 3VHLB 3ZVLA 4WXPA 1E1RA 2YNMA 3GJXC 2AR7A 4M9XA 3OIWA 3QVVA 3ZYCA 2QQEA 4BFXA 2DWQA 4JVNA 3WYGA 1IOZA 1A82A 3LBHA 5DH9A 1VIAA 4PAQA 1VCMA 3R9XA 4PSVA 1GSIA 2IEZA 2BJWA 3W9YA 5DI3B 1UBCA 1OSNA 3SHWA 3CX8A 5KTYA 4LHWA 2REOA 4AI6A 4HB0A 1AS3A 2AK2A 1DAKA 1J99A 1ZINA 2Q6TA 4JL5A 4UNSA 2IYYA 1Y63A 2AFHE 3AF1A 4G5GA 5FTJA 2YC4C 1SKYE 1XEXA 5JI2E 3U60B 3L0IB 3GLHA 4BEBA 3THYB 2WWXA 1OFUX 4CDGA 3FHCB 1FUUA 1XTSA 1S1MA 1AGPA 3DKPA 3IILA 2GCOA 4FMDF 4JMPA 3UANA 2OO7A 1Z0JA 2WPDA 1OFHA 3ZS9A 3J81k 3PQCA 4EQ6B 3BB3A 4P3YA 3B1XA 5KOYA 3QIAA 3IHWA 4MA4A 1T3LA 4Q4HB 5E7MA 3HU2A 1AIPA 1ZUNB 1NSTA 1E2NA 1RZ3A 2BJVA 2QT0A 4HAVA 4LC1A 4W7SA 5G3YA 3K9LA 5TB5A 4ARZA 2O8EB 2J3EA 5JEEA 4EPWA 4BLPA 5FTKA 4YC7A 2IWHA 1WQ1R 2CJWA 1W2HA 4IDQA 2IYZA 3K9NA 4LPKA 1U8YA 2W2VA 3BIFA 4DSTA 1CBUA 2PJZA 3LD9A 4NDZA 2YC2C 4Q02A 4Z1MA 1DAHA 3IQXA 3P4XA 1G4AE 3OEEA 1N6NA 4KU4A 5JHHB 1QZXA 1D6JA 1G7CA 2ZRCA 3VQTA 3W6NA 3QG5A 3A58B 4LRWA 3NDPA 4ITRC 1W4BA 2OBLA 4I1VA 1KGDA 2AXNA 3R9WA 2F1RA 2GBLC 1U98A 1ZP6A 3TW4A 3L2OB 3DL0A 1UBGA 4WZ6A 2DWOA 3THXB 3CB4A 1P61B 1DPFA 2FMXA 3PUXA 1E9AA 1NI3A 2WSSA 4B71A 4E09A 3QOFA 1E99A 5EUQB 4C0JA 1P6XA 4LJYA 2P5TB 4JVMA 2ZJ5A 2D74A 3AF3A 2GK6A 4P33A 2BEJA 2IUTA 3CNLA 2FG5A 3H84A 4PPNA 1SVIA 4OKSA 3T61A 2ZUBA 2YJTD 4TLBA 4DEYA 3W8NA 4HAZA 3WXMA 2ZIAA 4B2LA 2BM0A 2JATA 2WJGA 4N0DA 2XB2A 4URZR 3ONWA 1CEEA 4UJ3A 2WKPA 2CL6X 4B6EA 2JJ2D 1CULC 1ZMXA 4GBMA 3IEUA 221PA 2PCJA 5KPDA 3M1IA 4KFUA 3RRZA 4ASUD 4YQFA 1EX6A 4AURA 2A5YB 1OXVA 4QBFA 4LY6A 3ADBA 1Z29A 3B7GA 821PA 3KQLA 1ZJ6A 3WHKA 4GOKA 4F4CA 4TTRA 2OFWA 3HYTA 1DO2A 1LB1B 5CYPA 4RD3A 2WWGA 2QEQA 1XDBA 3CZQA 1UFQA 3LA6A 4LJAA 4NYJR 2JLYA 4B48A 3VU9A 3W6OA 3TSWA 1LFDB 5DYIA 2EFDB 3W3ZB 4CF7A 1HT1E 2XAUA 5AJVB 2DB3A 4QGGA 1B23P 1ZNYA 3OAAA 3QEOA 4TTPA 2WBLC 5CLQA 3VNUA 1KTVA 2Q0HA 3T5DA 3SOPA 1ETUA 2P3SA 4V0NA 1N0WA 4B2PA 3T34A 5L8VA 3BK7A 1N6RA 5KYKA 3OIYA 4KYIB 4QG7A 4XTRA 2XXAB 1G5TA 2C03A 3B5JA 4WIAA 1K5DA 2RGDA 4LX0A 4K46A 4PHTA 3KQNA 3THWB 3ZZUA 3F3YA 1YJ5A 3IBYA 2ZYUX 5SZIA 3SYKA 2QL6A 2EYQA 1ELOA 4GMXA 1U8AA 2FU5C 3HYRA 3JZMA 1PUIA 4A0RA 1AS2A 4R2HA 3P20A 1T5IA 3GMTA 1JI0A 2A3RA 4KJZA 4X8MA 4UXIA 4XSHA 3MAAC 4RZ2A 2FSHA 5B58C 1Z0FA 2H16A 4U5XA 2IHYA 2ZANA 2WWFA 4OL0A 1MR3F 2FPKA 2ZR9A 5L3VA 1ZM7A 1TADA 5F9HA 4PC2A 3W8RA 2WTUA 1AK2A 4QHYA 4B3DA 4NTZA 1IAQA 3HR8A 3A37A 1MH1A 4BFWA 5FOUA 3BXZA 3CNNA 4IDPA 4RZXA 1S0UA 5L3RA 1Z3IX 3HU3A 1QG4A 5CK5A 4D80A 4Q21A 2DR3A 1C4OA 2RGCA 3H0KA 2O0HA 1YR8A 2EFHB 3ZGXA 2KWIA 1VCNA 1GNQA 3AF4A 4RSGA 5IK2D 4CT4B 2PJRA 2AD1A 4GOJA 5CIWA 1GM5A 1E94E 5EJEA 3U61B 3PCRB 1ZUHA 2HEIA 2FNAA 3GQBA 2J87A 1A1VA 1EFRD 2Q3FA 1S3SA 4JLAA 1CTQA 3FTQA 3THYA 3CWQA 1KOFA 2AWNA 4LWZA 1YZUA 2FDCA 1W0JD 1MO6A 1Z6YA 2VLIA 4QGAA 2IS6A 3IGFA 4OI2A 2ZITA 4JLNA 1XEFA 2B21A 5JJLA 2XGJA 2D4HA 1ZD9A 4Q4JB 1RYFA 2QPOA 2CK3D 4JLDA 4F4IA 3GLFE 1N5IA 2GILA 4LBWA 2VIIA 5DI3A 4OJKA 1E2FA 4N0EA 5HZKA 3CRRA 4TTQA 2OE2A 1JECA 5EE3A 1BMFD 1HT2E 4EPTA 3FMIA 1N0UA 4D81A 2VP6A 4MKFA 2H18A 4ZO4A 4DUGA 4FW9A 2MMCA 3LXXA 4RD0A 1KSJA 4JIMA 3HR7A 1ONBA 3KJHA 2PBRA 4RJLA 1T0HB 2GEUA 5J4VA 4MKHA 1AQUA 4G5QA 4DB2A 1OXXK 1R6BX 1LW7A 3LNCA 1Q22A 2D3WA 2ZUCA 3EIEA 1KO8A 2BBSA 2ONKA 4PZYA 4XTCS 5JJKA 2W58A 4I1UA 4XJXA 3VKWA 2FWRA 3LRPA 4ZKEA 1XPOA 1JR3D 2HF8A 2FFAA 4M53A 3EASA 2V8OA 4PAOA 3WRYC 3KZ1E 3OFNA 2R62A 2IHBA 2W83A 4IDNA 5BN5A 4R9UC 5JEDA 2ONJA 3BS4A 3TUZC 2IC5A 3FKSA 1T5LA 5CB8A 1N6IA 3LAWA 2GEVA 1W4CA 2WJIA 3CRVA 4DT1B 2QROA 2VA8A 4QBHA 2FPLA 4RD4A 2XXAA 2WPDD 2CVFA 3QF4A 2JLUA 4B6FA 1UKZA 1SVMA 2JLVA 5FBLB 1BOFA 1R0YA 1A4RA 3K53A 3PUVA 3SYNA 2CMKA 3FHTA 4LHXA 4BEJA 4ZI2A 3RABA 4JZKA 1R5OA 1HTWA 2IUSA 3KQUA 4C2TA 1NVXQ 2OBNA 1RVDA 2ATVA 1I2DA 1ANKA 1GKYA 3MCAA 2YYZA 3K0EA 4JKIA 4UKDA 4EUNA 2P6UA 4U02A 2G0TA 1CF4A 1LS1A 3AB3A 1WDTA 1IXZA 1DAIA 2ZE8A 3HWSA 3OIVA 3RWMB 3SE0A 2B7BA 2GDJA 1OT3A 1BYUA
chains in the Genus database with same CATH superfamily
4OAQA 5TY0A 4QO8A 2ZBEA 4JAVC 2QU8A 2QLLA 2VO1A 5JALA 1AXRA 1NJ8A 5LXTF 5FYDA 1SFRA 1OXKB 1T0BA 2H8KA 3DAPA 4HG2A 5EHNA 3RTEA 1KWGA 1RT9A 4R84A 4MRMB 2BVNA 2QT1A 3DHYA 4IYJA 2B4QA 4MYCA 4V3CA 3UK1A 4J1TA 2OG1A 1YQQA 1KC3A 3DOJA 3LLSA 2QV0A 3K16A 2C2XA 3F1KA 4RKEA 3AVPA 3ID6C 2NP7A 1N78A 3SBDA 2LGJA 2QDXA 2PWYA 3QEMA 1EFCA 4LCEA 4UMVA 4NZNA 3G9UA 4UZFA 2DFDA 1E1NA 3PLRA 3G2JA 4KQ1A 1CFZA 2GPBA 3N2KA 3ROKA 1X2BA 5KJFA 2ZRPA 3UW1A 1FMCA 3R8FA 3DMTA 3KPUA 3I3OA 2J4CA 1OC4A 2FFQA 3TQSA 2CYCA 2EFYA 3EVGA 3WL8A 1V8DA 1QTNA 1ZESA 3I9KA 3RVPA 2E5FA 5A1TA 3BORA 4DMHA 1MV8A 1SU6A 4M9UA 4BMZA 4CIDA 5EINA 2UU9B 2W2LD 3SDZA 3WJ2A 1SG6A 4JQZA 4D3YA 4BNYA 2BGRA 3B2EA 4IXTA 4LJ8A 3UA3A 3VOBA 4QTYA 4YAWA 5CPFA 2QORA 5CEJA 3BWXA 5JNWA 1Z4LA 2I7CA 4NICA 2GCEA 1RE1A 2DJ5A 4NJOA 3SI7A 1KO7A 1CEYA 3GLSA 2C9MA 3CZ5A 4ZI3A 3GF4A 4GZ6A 1U2DC 3U6KA 3VMFA 1VGRA 1CDDA 1YB7A 2OHGA 2WG0A 2VHJA 1HWYA 5IKMA 3PFCA 3REQB 4IUCS 2CLKB 1JSRA 1E32A 2IY8A 3K0SA 1M34E 3BT7A 1IY2A 1CU1A 5BQ3A 2F55A 3IKLA 1E8MA 4QEZA 4TMYA 2WHPA 2FX2A 3L1HA 5CTAA 1B43A 5ITZA 2WQ6A 5FOSA 4CZ2A 4O8CA 2PKXA 1KWKA 3LCMA 2Q5QA 5CAEA 3ZXIA 1C7EA 4TYPA 1FXUA 2REBA 4KRXA 2FUKA 2A33A 5A5EA 4D26A 5TNXA 3LO5A 2HJVA 4FMCB 3Q7QA 4BFYA 1SUWA 3ZQJA 2FKAA 5MFPA 1AQJA 2ZRNA 4MV6A 1F5SA 1G3QA 1EUZA 1PJ3A 1QBGA 1SOWA 2C2HA 2FMHA 3RRMA 4UCQA 1YB6A 1GTJ1 2WIFA 1U7TA 4A8HA 3CS3A 2QXYA 2Y71A 1O87A 2BY4A 2AOWA 2NU8A 5IDWA 2QP9X 1VCOA 4MR7B 5CDSA 3QFFA 1DKNA 1HKUA 5KI6A 4MCAA 1QRUA 4RF5A 1CUVA 1N9ZA 1U8UA 4J2TA 5A3RA 2JFWA 4P35A 2CMFA 3RKSA 2WZDA 3GEDA 4IEEA 5EUBA 3R6DA 3SN6A 3BCHA 1BCRA 4INOA 4FWBA 1J70A 1JEQA 1MRNA 1UPTA 1ODIA 1PWEA 2UYOA 3K9FC 1OTYA 2OCXA 4Q3AA 4Q4LA 1JTFA 1Z5PA 3ZDCA 2HHAA 3HJAA 3WSWA 1DEHA 4UHBA 1O6CA 1GPUA 3DQPA 4M0UA 3HZHA 4MV8A 1NYRA 5JMWA 4NCKA 2ZT7A 4L75A 2P40A 3O75A 1P80A 5BSMA 1ECPA 1KH1A 4MQUA 2GA8A 3OZGA 2BI7A 2IX9A 2JARA 2PM8A 4TN5A 1N2JA 4Q1FA 3TG2A 3DF7A 4KAXA 3VPXA 3EODA 4H6WA 1T8WA 2I4TA 1M7BA 2DCUA 3MN1A 2RONA 1P2VA 3AIIA 4QPPA 4B73A 1KL7A 4Q3EA 2BGNA 1DO0A 1HQCA 2HFJA 2ORYA 4MUEA 4WJKB 5FOXA 2X15A 3WBJA 4BDTA 3ETLA 3EY9A 3DAYA 4FTWA 1OZFA 4BTEA 3DB2A 4XDYA 1F0KA 5SYNA 4FDAA 5HMLA 4PY2A 1HE2A 5JZBA 3EAFA 3DCYA 1E4YA 2HT6A 4OHWA 1MQAA 4V0SA 3PWTA 3H4IA 1KMQA 5CHYA 2GNAA 4RY9A 4CMAA 5IFKA 2PUCA 3DAFA 5LJLA 4ZQEA 2JH3A 2YCBA 1MMFB 4LOKA 1P7CA 2IVZA 5HW0A 2IXFA 4CV1A 2IEGA 3V3KA 2QN8A 4MIEA 5T8KA 1MO2A 2OVFA 1RBYA 4XQGA 3DFMA 4PX2A 1CE8A 4I55B 5CW2A 3CH6A 3ESXA 5AOVA 4YUVA 3STTA 3ADKA 2O8CA 3D5TA 3AR3A 5EZQA 1RYHA 2FEPA 2LCIA 4NHEA 3OCVA 3ENQA 4BO0A 1YR6A 5A4KA 2B0CA 4TYQA 4Q24A 1YKFA 4R1UA 3AO0B 1VYVA 3LQYA 1NP3A 3HRIA 3GGCA 4I9HA 5D3ZA 4OXRA 1H8HD 4TSKA 3RVRA 3UMSA 1BX0A 5C52B 2ZR0A 3N8DA 2E48A 1A8PA 2CVQA 2YOFA 5HJ2A 4V2IA 3VOAA 4AAYA 4DJFC 1EAYA 1CY8A 4DREA 3J80A 2NO9A 3QMPA 3UBMA 1EJ0A 3RUPA 1BCSA 1VDZA 2GYVA 3ZZ0A 2HLDD 4JC5A 3W1VA 3ZDFA 4EJFA 1NUQA 1HGXA 3LHIA 1RZUA 2J59A 4IJKA 5BNIA 3AYZB 3BJZA 4WNAB 4Z1OA 4YCMA 2F3TA 2HQ1A 4XM2A 1TL7C 2VG8A 2VHTA 4RWZA 4ZVLA 4QUJA 3OP4A 3N6XA 5F4BA 2J6IA 1RRGA 1APBA 4YJHB 3HP4A 4J0HA 5H4GA 3TFOA 3I45A 4FJ2A 1U0NA 3LT2A 4NHOA 2NU7A 2HLNA 3OU6A 1SCAA 3LNTA 5KCZA 1IPFA 1W88B 1GQ2A 1XJCA 5HS4A 1U7DA 4C7OB 2A9RA 4KWCA 5K99A 5LQSA 2VN8A 1NNLA 2BMVA 2C3YA 2WJZB 3HZOA 4I8DA 1ZOSA 4MULA 4J0DA 4Q9LA 4X92A 4F9FA 5JY1A 1VPLA 3MUFA 3BXXA 4JVSB 2Q1SA 3T1HB 4LY9A 2YJ6A 1UBRS 3HDVA 4PLZA 5FAXA 5IW8A 4PU0A 2WIKA 3U3KA 3GNQA 3MOGA 2NZ2A 4GLBA 1ZK0A 2PGNA 1GP2A 3LBYA 2WD8A 4LFAB 3PKJA 4O25A 3J7AC 4RK0A 1TAQA 4A0SA 3I5UA 1P31A 3CSSA 4OP3A 1MGOA 1YRLA 4WZBE 2P27A 2I2BA 2GI4A 1XIVA 4W99A 2PU5A 3A1WA 3LVFO 2P3LA 2XSZA 4HEQA 3RIXA 2F3SA 3MB5A 3BMNA 2AJCA 4JP1A 1K7CA 2R9VA 3TE6A 3A6DA 3CLHA 1RYZA 4RQBA 3ZE0B 2WYHA 3GGGA 3P2EA 4IRMA 3ZU3A 1WKVA 3BWBA 1PW5A 4GMDA 1KZHA 4QICA 2I2AA 3OJEA 3V8NA 5LP1A 3D3JA 5GM2A 2NYRA 1T13A 1X8KA 3TRIA 4RLSA 4WXRA 1BS2A 1XP8A 2WRZA 1P5ZB 4FT2A 1MOZA 2RKOA 4CIBA 5K03A 3N74A 5LDGA 4TYYA 4UBNA 2CLLB 5DOZA 1YMVA 3ZIUA 2P9JA 4L5IA 3I9NA 2O7VA 2XWPA 2A5LA 2ZUSA 3LPNA 4QDZA 3TD2A 3U0VA 3QXXA 4QM7A 3KHSA 3G2IA 4G01B 4RIFA 4U9UA 1NATA 3U26A 4CG3A 4HI0E 4F4HA 9LDBA 3VO8A 2J6BA 3H19A 4JX8A 4R16A 2XZOA 1P1BA 3CRNA 4KMMA 5IT5A 4EY7A 1EXMA 3C3BA 1BN7A 3X44A 1KBQA 2VYVD 1YZKA 4M1OA 4ZVTA 1MOSA 3KBOA 1IQUA 1IN1A 3DCNA 1NBME 4A6DA 5AM3A 1CHNA 4YCCA 5FNVA 4LC0A 3UHAA 2UZIR 3VKUA 2NSYA 3NT2A 2IZOA 3OG9A 1MAAA 4C6TA 1L4NA 1HDYA 1Q11A 2EHDA 4FW8A 5SY9A 3IMEA 1NIPA 4UXJA 2QRGA 3T3HA 1ZWKA 3FYSA 5CFNA 4K9RA 2IE8A 3VV2A 3PT9A 2EAUA 3H9CA 2HMAA 3D9QX 4KDRA 2Y9PB 4BDSA 4Q39A 1MABB 1CUCA 1CG6A 1F2TA 5IN5A 3DONA 3QPCA 2RB5A 5C1IA 1O94D 1BIFA 3Q0IA 3GLUA 3M49A 1HLGA 3IRVA 2JEYA 2JFYA 1CR6A 3V00A 1Z38A 1U7XA 5LDDC 5FA8A 3SJ7A 3SKVA 4O29A 3TINA 4OX9Y 1VKOA 4LMPA 1DBSA 5L3QA 2A57A 3OFJA 4HAXA 3DWEX 2C2ZA 1TZMA 1VL8A 2XKBA 2BUAA 4JR2A 2XUJA 1BYIA 4A0GA 1BROA 1GDDA 3K20A 2XUAA 3QKRA 4IHJF 1WLSA 1WVGA 2O05A 3L8HA 3LKZA 1UM8A 4N03A 4RJIA 4TRRA 2QW8A 3QVGB 1FUEA 4XPIA 3ZWQA 1XZQA 4RZUA 2NX2A 1D1QA 2YMLA 3FLAA 5HS6A 3WLSA 2SBTA 1M75A 2W48A 4QXAA 3V2GA 7AT1A 1N2SA 5JXIA 4DR6B 1G3UA 1UAYA 4KKVA 2SHKA 2C2YA 3E5MA 1Q0RA 2WSYB 4CTMA 1NVVQ 2PSFA 4PZAA 1T2AA 1Z07A 4TLDA 5THKA 3OT5A 3NKFA 1K0UA 2WJ4A 4GQAA 1ISHA 1HYGA 6PFKA 1F3OA 4TRMA 3B78A 1SOUA 1UWLA 1VMEA 1GU0A 3H1AA 2VYNA 3LUGA 2ZTSA 4MUIA 4AUEA 1G60A 3MHTA 3T1OA 5HR5A 3TIVA 4RFSB 2ZUEA 3FPGA 2BFFB 3UK0A 3JAWB 4ZN6A 1WDMA 3LJKA 2I66A 1SXJA 1XA3A 1Y4UA 5KVCA 1XRPA 5T41A 1R18A 3IDZA 2DH5A 4MB2A 4NH0A 1C8VB 5DIFA 3TSZA 3RGWS 3O1IC 4CF4A 4Y18A 3M4JA 3E9ZA 3HUEA 2Z6QA 3JSXA 4TS4A 3FAKA 3P9ZA 3TEJA 2JFXA 1VTKA 2E18A 2R11A 4MIOA 2Z2XA 2P2SA 3R75A 5EP2A 1S3FA 1I3CA 1EDBA 1YDEA 3ACDA 4NMXB 1SBYA 1EXWA 1PJ8A 2AMFA 2PKEA 3ENKA 1N3IA 1UJ2A 2V6BA 2Z4SA 4L1KA 4P84A 3RAGA 2YZGA 2BWJA 2QM0A 3TLYA 5LYJB 3AEYA 4YBRA 2QAJA 2LV8A 4IH1A 2I4NA 3K92A 3M8KA 4OY3A 1G9SA 2JIZD 5DRYA 3THRA 1Z4NA 3ZHVA 3TRFA 1F60A 4I55F 1T36A 4ENSA 1G64A 4CEJA 1OJLA 4QUGA 1VB3A 1QCDA 2O2CA 3EAGA 1RXCA 4PG6A 3I6ZA 1DXQA 1YOBA 1NMQA 4ROTA 3HCEA 1TD1A 2QLFA 3BMOA 3KRTA 1GNVA 4JODA 3KVOA 4I1IA 3PNMA 2AN4A 2EQAA 5HWSA 3P7MA 3LYLA 3C2QA 3EIQA 2EKLA 3F9RA 1BA3A 2WYVA 2GTIA 3PD1A 3LDAA 3DMTC 3NX4A 4ND6A 4UDXX 4ZFNA 1OHHA 2JRLA 3AWDA 4MI3A 2D0DA 3ZW8A 4X90A 1SBIA 1D04A 1N4DA 2TMDA 2KLHA 1AURA 4YCAA 3PXGA 3WJ1A 2GBCA 1T5HX 1SPBS 3PPIA 4PV7A 1KKUA 2QTNA 2V1XA 1PG2A 2PS3A 3P71T 3NBUA 4QYTA 1KYTA 4HGNA 1H5QA 4X5OA 1KKMA 1P4GA 5JH7B 2RBGA 3K32A 1R6AA 3ZDXB 1JEYB 1REQB 1AKMA 4C22A 1Y5RA 5JT1A 1W36D 2AJBA 2I71A 1PUXA 2HK7A 2QR5A 4MPJA 5FPSA 2YUIA 1GRNA 5LBTA 3UK2A 3DNFA 4TYNA 4A8JA 3EARA 1J9GA 3OCZA 4CM1A 4BKMA 1UADA 3DDUA 3RU9A 1KSHA 2V7WA 4N40A 4BNIA 4D1YA 3GLIB 2A9KA 4KP7A 2IF2A 2EF1A 3BE6A 3C8DA 4Z9XA 2QD5A 3U4DA 1RKUA 3JQRA 2OAP1 1NF3A 4O2AF 3STUA 1JIIA 4D9JA 2AW3A 3KDAA 5FO1A 2GKSA 1UXGA 4B6RA 1Z8FA 3L0YA 4YYEA 1IBRA 3AKYA 2VOEA 5A9SA 1ZAKA 1WCV1 2WWIA 4FYJA 1LBEA 1BEUB 1H1TA 1KI8A 4HZUA 1ZVMA 2BBOA 1KO4A 4K6KA 1VJCA 2VRBA 4XDHA 4C7MA 2V7TA 3SEAA 4RADA 2P6NA 2GZSA 2OZLB 1M2FA 1P3Y1 4D0GA 4LRXA 4TMTA 4V0ME 1R88A 3A9CA 4R2IA 4LUCA 4PLFA 3UPUA 3QZUA 5C9ZA 1E64A 5IT9A 1E63A 3I73A 3ORYA 3TJRA 3C7TA 4NPCA 4GHWA 3WQSB 3ORHA 5H83A 3ET5A 3DBVO 2E49A 2PSHA 3IXMA 2ZYTX 5JJBA 4DL9A 4GPEA 1SXIA 1X7YA 2ZAIA 2PZMA 3IR7A 4O4LB 4CMKA 2CBGA 5EOVA 5IEJA 2XUFA 3T54A 1HO3A 2IZ0A 2RJ3A 4J16A 2I6XA 1JR3E 4FKBA 5DXFA 1PL6A 1C9YA 3R7WA 1QQBA 4GG1A 3W3AH 5HP4A 4PCVA 4ZEXA 4LDPA 4PICA 3W90A 1EYZA 3MT7A 5KHAA 2BTQB 2DRIA 3N8IA 4A82A 2GCPA 1T0UA 4BGDA 1TEZA 4N3CA 4NEQA 1QS0A 3CLTD 3ENZA 2TSYB 3AFHA 5JSKA 3BZWA 5ADVA 3K0FA 3IEPA 4OYRA 1PL0A 1E5QA 3O3MB 1U0LA 1NA5A 2XUZA 5DXJA 3VSEA 2Q8NA 1A9XB 5E6UB 4EG8A 1PR9A 1ZQ9A 3DV0A 1PR2A 4RJ2A 5AWFC 5D7NA 3EMVA 1R0ZA 721PA 3BWEA 3FUWA 4F9TA 1ZS9A 3GJ8A 3OVMA 5C0OE 1AUQA 4K9SA 3NFYA 4LDZA 4EEKA 4B3BA 2IHZA 1W19A 2QM7A 1Y33E 5YASA 1QQ5A 4OXYA 1EVJA 2CCJA 4BC0A 4CFYA 4C08A 1V5FA 2FPXA 1ZJ5A 3IJRA 3MINB 4URVR 3ZHUA 4A2WA 4U6QA 3ZQUA 3VYUB 3Q7RA 1Y5MA 3G68A 4IOMA 5F23A 1XNRB 3EFEA 3L06A 4NJMA 1Z5OA 1QZTA 4DQVA 1OFVA 2O3SA 4G9BA 4J7UA 2VNIA 1NY5A 4DIEA 5ALOA 3WLTA 1VPVA 2FX5A 4WCVA 3SC4A 1OPXA 2ZI5A 1G4HA 4XSGA 1ZNZA 5FIUA 4R8RA 4P98A 4RVGA 2AZDA 2Q8QA 2VDVE 4G56A 4B4VA 1M3SA 4BO3A 3KTAA 1GPYA 1DJOA 1ESZA 1N5JA 3QMVA 1E60A 4FINA 2WJHA 1GPH1 5D01A 1BD4A 1IXSB 2QYHA 5SZJA 2RGGA 2BTEA 3QKUA 1ZHFA 3D8TA 1XBTA 5B6PA 2BGKA 1XZKA 1MKYA 2GM3A 1KETA 4R0VA 4QVGA 4QUDA 5CK4A 4ZAYA 1DC7A 1EBUA 4Y2YA 3M1AA 1LBSA 3AP2A 4RVHA 5DHFA 2XJ4A 1FFYA 2ZJZA 4ZCQA 5KWIA 1R1DA 1IL0A 3B3AA 3KTDA 3TW6A 4CDMA 3NTXA 3RRBA 5EUMA 2A0YA 3MQFA 4ZD6A 4QNMA 1YE5A 4PLGA 2RGAA 3R76A 1W5AA 5EG5A 3GCXA 2HNKA 3IQDB 4FR2A 4X6YA 2F00A 4C5CA 2A9FA 3OQNA 1FP2A 1P7PA 5I7HA 4W5TA 3L8EA 2OZLA 4O3FA 3NJ8A 3Q8WA 4WFJA 1NOIA 1L7AA 1SCUB 1F4VA 4EOGA 1US8B 1CR2A 5DBHX 1XCMA 3UMVA 4EFLA 1LPMA 1VC2A 3WBFA 1UJNA 4HRXA 3O4FA 3L6CA 3ZU5A 4CL2A 2R7LA 3I6YA 2P9TA 3E1KA 1FEZA 2AA3A 4E11A 2WLSA 2OCLA 1O54A 3LZDA 5THQA 1EWTA 4ARBA 4DV7B 3BJRA 5IM4A 2WY2D 3FF4A 2J3LA 2FHSA 3EGEA 1RPAA 2ZXFA 1FDUA 3KU1A 1ORRA 2GTPA 4A0HA 3DH0A 5K20A 3FCOA 5K0BA 2Q9AA 3INRA 1SCIA 3M1LA 3DS8A 2B61A 3GFFA 4ZDIA 2X0DA 1I4EB 4HDNA 3KBBA 5LZ4A 3D5EA 2WTBA 3EGIA 3ETGA 2HIHA 3HG7A 1O57A 3OPYB 2X2EA 4WJZA 4M87A 2NUPB 1RAGA 4OK6A 5HX7A 3ZWVA 3IQEA 2IS2A 2GO7A 2Y99A 2IXAA 4HQ0A 1RQ7A 1FNNA 1FZTA 5UKDA 4P1ZA 1Y34E 3TR5A 3U9LA 2FG6C 2NPIA 3I2GA 4ZVVA 1ZITA 1Z47A 5K6AA 3QEBZ 1XA0A 1ZGZA 1OH5A 2QMQA 4J9UE 2QQFA 1GOTA 1ZD1A 4FBMA 4JU8A 4HDOB 5GGYA 3RVQA 5IUKC 3K9HA 4CJXA 1L4KA 4PG5A 5DX0A 5A3QA 4OVKA 3A1UA 2G8LA 3E35A 2OAGA 4XVHA 5IHPA 2J08A 3G8CA 4HH0A 3P19A 4YRNA 1DFIA 1CS4C 9LDTA 4O2BF 3CN7A 4CDNA 2R6AA 3EZ2A 1X1AA 3MQ4A 4NFSA 1JHXA 2PEYA 4HVAA 4IUDS 5F9MA 3VNRA 1ZGAA 1E4OA 5DGHA 1V3UA 4R8SA 2FQYA 4XIIA 1ZY2A 4ZQBA 2H8GA 1ZPDA 1OHHD 3L6UA 2X0RA 4QUIA 4MJ7A 4OQFA 1W5FA 3A2KA 4QFDA 1CW2B 2OG2A 3QM1A 2I62A 5IT0A 3DZ8A 1Z6GA 4DLAA 2VH2A 1RRCA 2GZMA 1WBBA 2ZJAA 3B1KA 2X0EA 3WFIA 1QH1B 1YB5A 3ELYA 3H86A 1UBJS 3A3NA 3CLRD 3U13A 3GQBB 5ISMA 3CLSD 1DV1A 1IM2A 4EPXA 5LMNB 3KJIA 2CXQA 2VZEA 2J0QA 3OHPA 1RXYA 1LDGA 2SKCA 3LZ6A 1AXGA 1JBKA 3TMAA 4EUKA 3RYHA 3T1YB 1XMQB 1K8ZB 2EW2A 2QUZA 2CLHB 3IMFA 1OLXA 1FK8A 1P6UA 2NO1A 3ESDA 3AVYA 5DNVA 3R1IA 1A8IA 3EG5A 3M7IA 1C9KA 5AXCA 2VP5A 1L5NA 4UTRA 4FSHA 1VKHA 4AULA 3MIZA 1GIAA 1S7CA 3A2MA 3KD2A 2WKQA 3JAWA 4INPA 4OIFA 1I6MA 2WT8A 2RJNA 5DF1A 4JB8A 4LKOA 1JHQA 2GN9A 3NWEA 1TU0A 5K6TA 1A4UA 1PYDA 2IK8A 4IDOA 4UM9B 3IAM1 1RJ9A 1EDOA 3MCUA 3EB9A 2Q9UA 4UVGA 4QEDA 5KNCD 4F1WA 3QBVA 1KZGB 2FPSA 1X94A 3LHDA 1JAZA 1MB2A 2JZCA 2Q1WA 2GPAA 4QFCA 1KYXA 4UE2A 5DOVA 2PG3A 1E59A 2CD7A 2WDPA 2YHSA 3UWOA 4N82A 4F7DA 1KR2A 4YCJA 4YRLA 4KFRA 1DUSA 1SHKA 5EZ5A 1E77A 3O7MA 4LVOA 2EEZA 3KXKA 3LPDA 4L6CA 4XW2A 3UGQA 3C24A 3VHRA 4FYVA 1KI9A 3AR9A 3EFOB 2C5BA 3U3MA 3UICA 5KJ6A 1E3IA 1NDHA 4EVIA 2BONA 4D56A 4TRNA 2ZVJA 4ZZ0A 3HO6A 2PH3A 5JC1A 3H5NA 2RAVA 1R27A 2DFKB 4MGKR 3QPVA 4DR3B 1K8RA 1WXQA 2DQYA 2Q2OA 2WYIA 3A27A 1NKSA 3BA6A 3QOWA 3SM9A 2WF9A 3OX1A 4QGHA 1QQAA 2DPLA 1TD9A 3V8EA 4G89A 3C8ZA 1GUAA 4G5XA 3VFDA 5CDFE 2AX4A 2N3ZA 5DM4A 1VCHA 3IJPA 4TROA 1T1SA 4LBYA 3OAAD 3MW8A 2BRUC 2NZ8A 2XDQA 4OSPA 4LBVA 2DX7A 3RF7A 1NXTA 1Y1SA 1Z0ZA 4KUHA 5L7WA 3OQPA 3CCBA 1GNPA 3KSMA 3TLJA 2CUNA 2BEWB 2OGSA 4JUFA 1G8PA 4ZT7A 3IQGX 1IM8A 1A8QA 1XXHB 2QMEA 5FLKA 2J9GA 1OF1A 5KYWA 1J0EA 2B8JA 2O52A 5B1IA 3BGIA 1U9JA 4H35A 2I3AA 2KLBA 1HFEL 4Q9DA 1J2YA 2HPZA 2C4NA 2PZFA 2ARKA 4K3VA 3KYDA 1NKTA 5TX7A 2P11A 1YFJA 4P4UA 3H1GA 1F0PA 1LPSA 3JS5A 4MWZA 3O2JA 1BMFA 1FQKA 4BO7A 2FPWA 2HQSA 2ODWA 3FCAA 3OY7A 1UJCA 1NI5A 4KI0A 3QY0A 3W5SA 3WGNA 3G0GA 1L5MA 2BW0A 3H9GA 3J81A 4KB5A 4ARCA 3O21A 5C4GB 5IF9A 5LLTA 4NQRA 3FWYA 1M8GA 1EFDN 3MUOA 1M6EX 3OZIA 4WGGA 1QJ4A 3AW8A 1TF2A 3EY4A 5LQKA 3DULA 2HSJA 4DV4B 2UYQA 4WZAE 3D8BA 2BM1A 2CYAA 3EXG2 4D4LA 4DUPA 2O8FB 3WMFA 1ESNA 3GFQA 2B94A 2QI9F 2UDPA 1OGIA 3JYOA 1MQSA 5J4YA 5KUTA 1N2ZA 1JG4A 2E4YA 4DWJA 1SU7A 3K9GA 3SHQA 3BTSA 4D4KA 4EG1A 5DEOA 3O03A 4BRWA 4DW8A 4H1VA 4IGKA 3MSCA 1M1YA 1LRJA 3ZHTA 3NG1A 4ZYXA 4A92A 2W2TA 5HKKA 4U7HA 3SQOA 1Z5GA 1UF9A 2CNWD 1XU9A 1LI5A 1SZCA 4S2UA 3COZA 4ILEA 2I99A 2ZTVA 1Y3BE 4G5OA 2FZLA 3SVTA 4OMDA 1L8QA 5AHOA 2DSNA 3DOCA 3SEFA 1V16A 1WEHA 2W6PA 4RW0A 4BBAA 3M9LA 1X2EA 2PUVA 3OPXA 4D9EA 4Q3NA 2IV7A 4J0EA 4TRJA 2PUWA 3CU5A 3G0OA 4N9QA 2YUTA 3HEAA 3EVAA 3GPBA 1MO4A 5TARA 5JRZA 4R2KA 3S2IA 2JFFA 1JJAA 4LWQA 1IDN1 3BHIA 3DLCA 1BD3A 4QOHA 1CDOA 4HSEA 4BN0A 4E2ZA 4E5VA 5JSZB 5LYJF 1F4LA 3U4QB 1KFKB 4TM7A 3TPZA 5JANA 3SJAA 3PPVA 3L43A 3TJZA 4AICA 5JMTA 4WFKA 5L53A 1IBKB 2BDTA 2OXEA 1VB5A 2PAAA 3A6GA 3H97A 1OCEA 4DMKA 2PZKA 3RUDA 4XFJA 4MQLA 2JFUA 1K3TA 5IHXA 2HV8A 4YJKA 4V0MA 4YO8A 2PWPA 5EZYF 1TKRA 2ERYA 1HE4A 1E1QA 5K3EA 2XGOA 4QOGA 4RH1A 1T5OA 3TGLA 4W7IA 1JJIA 1G8MA 1IUKA 1YGPA 1H6CA 3G9QA 4J1QA 5EZ6B 4HT3B 1B41A 5LQNA 2E3JA 2HHJA 3LLCA 1YL7A 4KBFA 5G0SA 3WKCA 3T12A 1TNDA 3IAS6 1L1FA 4GIBA 4J3JA 2RB4A 4IILA 5GJWC 1HYBA 1FDRA 5FR1A 1FP4B 4L6AA 1SIUA 1HMYA 2NXWA 3VVMA 1OFUA 1QZ3A 1KARA 1CY2A 3QYJA 4QIHA 2DTXA 2HMYB 2P5YA 2NO0A 3C6XA 4OGGA 3IVAA 4BS9A 3BSYA 4MWTA 1SBHA 2HWUA 5KWJA 4DIFA 2PGOA 5BN1A 3F5QA 2JI9A 1F7UA 4MVXA 5E1MA 3C1OA 1K97A 4M38A 5EGNA 5A0FA 1W5TA 4HFRA 2L82A 4MVJF 4IIDA 4UQPA 5IDVA 1U0TA 3P9SA 2NLOA 1TPZA 4KO1S 4Y2SA 5JAPA 2QVZX 1DWPA 1X77A 3DE3X 1E9CA 4MVCA 1PD1A 1YACA 3PYXA 4CCAA 1G5QA 1EZZA 4I46A 1UZMA 4DCGA 3VPGA 1X8JA 5BN5B 1YJXA 2B5WA 2N1BA 3A3KA 1DKUA 3I2FA 5KYYA 1GN9A 3D0QA 3I4LA 3RTDA 3W34A 3KPYA 3OURA 1MAVA 3FHOA 1JW9B 3ZD8A 2VBIA 4KW7A 1I5OA 2RGEA 3BL6A 5BPHA 1I2CA 1J2RA 2PYZA 3UGKA 5CYFA 3KQKA 5FR2A 4V0KA 3I9FA 4ZO6A 5LJIA 3P0EA 3OO1A 4R0NA 3ZHCA 2E55A 3NBXX 1U0GA 4R69A 1Q57A 1SVKA 2RGRA 4EMSA 1I4WA 2OBMA 3B60A 1THTA 1XPRA 2ZUWA 3LT4A 1P9WA 3GPDG 4BWYA 1LX7A 2IXGA 4DA9A 2J4DA 4TZ6A 1HRDA 3IFSA 4Q3LA 1XE3A 1GQRA 4B7CA 2G80A 2W11A 1XAHA 2AIRA 5HIMA 5IJ9A 4EHLA 2QRLA 2BEVA 3L49A 3LYHA 1WOYA 2W93A 5AI0A 1HE8B 2V98A 4V0RA 2DERA 3PA8A 1QDEA 2P9GA 5D5PA 1JQKA 1OV4A 4Q1VA 4RMGA 2C31A 2BJHA 5J2TF 4OHZA 3E27A 2Z2IA 3N2ZB 5A2GA 1V96A 1RRMA 3BGSA 4UARA 4LF7B 3FPAA 4Q9KA 1BWQA 3KVVA 2QPTA 2G3YA 5I8ZA 4AJOA 4RZ3A 2NQTA 1JDPA 5GGXA 1YHNA 2Y0EA 2E6KA 3LZCA 4YYZA 3E70C 2FMTA 2WJVA 5KKAA 3B9RA 4M60A 2A94A 4LE0A 4UPVA 5JG7A 5JSZA 3L7KA 1I7QB 2HRZA 5F1OA 3GLFA 3AEKB 1FIUA 1LBHA 2GRJA 4MJXA 4RY2A 3IT0A 5EPEA 5EXTA 4JL6A 1TRKA 5DHQA 5TPZD 3V33A 5LWQA 1T9ZA 2OUKA 3LXRA 4HRAA 3WB9A 4DTIA 2IHNA 4QYWA 3ZHBA 1PVDA 1T8UA 4DAOA 1CD5A 2RC5A 1Z06A 2HO4A 2H29A 2QAGB 2YS7A 3MQ2A 4MV7A 3V1UA 3KKQA 2HTEA 1N32B 1M5UA 3QENA 1UDXA 4OFBA 4PONA 3AUAA 4JI6B 2PX6A 1NLYA 3FZNA 1NM5A 3ANXA 4OOEA 2DP4E 2G82A 4XCQA 2PMFA 3R3UA 2YBDA 5GONF 1XTRA 4DLZA 1H2RS 3G85A 4QFMA 4DMRA 3G8YA 3UMYA 1J2EA 2QENA 4EL0A 1KC1A 1JG7A 2GJAA 2Q1UA 4QU8A 3IURA 5IH7A 2NTJA 4ND8A 1H2EA 1STOA 4N18A 1BHJA 1XGKA 4R83A 1JNXX 5A4FS 5AKHA 4UCWA 1P19A 4QGSA 1VIYA 3TAUA 5K8CA 4PC1A 3PDIB 3SQXA 3O84A 3F4KA 5DBIA 2OC9A 4PR0A 1E4EB 2IHVA 1EG2A 1QTRA 2OYRA 5C46F 4TSRA 2ZREA 3DKIA 1JU3A 4RCVA 5B1DA 4RH3A 2O8FA 4AZ3B 4CM9D 1LSSA 4IMPA 2ADFA 3A31A 4FYWA 3RBZA 4LSWA 4L0QA 5ELMA 5EEGA 2VEDA 4NXMB 2W8BA 1C2TA 4GKAA 4KE8A 2D7JA 5CLFA 5JI3E 4MW1A 3HRKA 4M0CA 3U7HB 4ZYUA 2GWRA 4R01A 5AI6A 3ZGYA 4FX5A 4HDMB 2P9QA 4UZSA 3F7TA 1OBCA 2P68A 3TYXA 1Y7IA 1KQNA 2EEPA 3LQ2A 4LYYA 3CLKA 3F9CA 2BCGY 2EKBA 3DL2A 4X65B 4QOSA 3QXJA 1JJFA 3LOUA 1SQ5A 4MUJA 4BYMA 1K2VN 5ES4B 1RLIA 1YZFA 3TVTA 3UVEA 1CIJA 4YCLA 1BX1A 1SKAA 2C8JA 3Q88A 3DC2A 4MRSA 4OJNA 1P7YA 2H17A 2XKKA 1ZCBA 1WETA 3D4PA 3O73A 1R6UA 1YQDA 3HCWA 1DX6A 2WD9A 2OB1A 4ZALA 3OPYI 3UAVA 1C80A 1IC6A 2PVSA 3LO8A 4MDEA 2QW0X 2R8RA 1OXSC 2ZBPA 2SKEA 4LDAA 4Q7LA 1JAHA 2OORA 1U0HC 3PXDA 4LXIA 2X41A 1EA7A 2CN1A 5EE5B 2DR2A 1N6HA 2PX8A 4PIVA 1XU7A 4U00A 5JVDF 3H18A 1ACLA 5B3LA 3QGMA 1CRWG 1E3LA 3O8LA 3HPQA 3JD2A 4QJ4A 3ZGLA 4H0FA 1II0A 3ZYZA 1V9CA 1YDHA 2PL9A 3F6CA 3MILA 4Q9HA 5DB4A 1KVTA 4IIEA 5CVUA 1V47A 1DTWB 3UC9A 4B3JA 4TL7A 3HM9A 5BR4A 1OXTA 3Q3VA 5M29A 3RRJA 4R1TA 1WXFA 5KJCA 3HDTA 4BGVA 3JQPA 4MWOA 2Q41A 1UC4B 3EFOA 4B0OA 2WTAA 1K6MA 5GZ6A 3DDWA 1YUMA 3VOSA 2CXTA 4D2IA 1N5RA 4JT2A 4PHGA 2ACWA 1X9HA 3RVJA 1XZCA 4EFKA 1Y8QB 2HU7A 1GGEA 3D31A 3L05A 4F46A 4GM4A 3TLCA 1Q15A 4XB2A 2FQ1A 3MTEA 3DYBA 4K9DA 1SR8A 4NU5A 2ZATA 2OV3A 4IJMA 1WB9A 4CLEA 4O4HB 4OGFA 4JDUA 2BC9A 3I5XA 3O4VA 3SC2A 4MVJM 2J3JA 3TB6A 2F4NA 1ULUA 1GPAA 2IA5A 4O1IA 2AMLA 1XZ8A 4MS3B 2CT8A 2NUTB 1X15A 4FFNA 1XTVA 4EI2A 1VA5A 2QZ4A 4GOXA 5FBHA 4MICA 2H6EA 3L9WA 1NYTA 3F8SA 1ZG3A 3OECA 1OA1A 4IFBA 1J25A 4R5HA 5I01A 1RI1A 3TN7A 3OCCA 2NOAA 1KH3A 3LCVB 5I7RA 2OESA 1MOQA 1JFTA 4NR0A 4ZYZA 4M0FA 4N0MA 4MUXA 1RAIA 3SNKA 1I2MA 1GNTA 3WLFA 1WJGA 1ODJA 4AMGA 3LGAA 5EIWA 5B37A 3OZVA 5I9IA 1AMNA 4OQYA 3U62A 1Q50A 3RS2A 1M2JA 1IIRA 1L7DA 1TUGA 4KPYA 1V25A 3H6HA 4LTDA 2XYQA 3FJYA 4Q4JA 2RI1A 1B0UA 1EK0A 5J4HA 1XX6A 3DQZA 3AY7A 3HTXA 4ILKA 1QH1A 1O58A 2G1JA 3TNDA 2XUQA 4AK9A 1RCFA 3KR9A 1PX2A 5FF9A 3GV0A 2ZRQA 1T6ZA 2O5VA 2I6TA 4PXAA 5F76A 1CUHA 1TCBA 2QXTA 4X6XA 2HZ7A 4S1NA 4V0LA 1SU4A 5DCWA 5E7QA 4PS0A 3UW3A 3W8FA 1QLHA 5BVGB 1ONPA 2HF7A 3PXUA 4HPWA 2GARA 1QHGA 1UIMA 2O2SA 1U81A 1UWCA 2OWDA 3B5EA 3PFFA 4Q1BA 4CL3A 3A4VA 1JWAB 3FPBA 3DBLB 3VYRB 4ZK6A 3PRJA 1DIRA 5EL0A 5HG0A 5CDYA 5IJ0B 1ISIA 1M33A 4V0OA 5I9NA 1T9AA 3GEIA 2V7QA 2DFPA 1ILEA 3CC8A 1L4EA 2BM9A 3CX6A 3QWIA 4W5JA 3WZLA 4CMGA 4Z54A 1DCTA 4LQCA 3UCEA 2B37A 1UOPA 4GOND 3VR1A 1TI7A 1C5KA 2HREA 3EVEA 2VNKA 4L57A 2IYEA 2F9LA 5K45A 2D6FA 1PV2A 4Y0VA 4BNVA 1AK1A 1PFYA 1N6PA 1V8OA 4GVXA 5DTQA 3ESYA 4HLQB 4KFTA 4D9FA 2OP0A 4G8CA 2F3PA 5KTPA 1SWVA 3VH4A 1OYOA 4FONA 4YH1A 5LZ2A 4YT8A 2QLMA 3EXHA 3F1LA 4PM4A 3TLXA 5JPDA 2FEXA 4XVCA 4DNOA 2XNCA 1RD4A 3KZMA 2VTBA 3OT1A 3RQSA 4BPRA 1SUIA 2GVZC 3BFVA 4E30A 2HMVA 4X97A 4L8FA 4URYR 4C4ZA 4FCCA 3NIGB