3CF6R

Structure of epac2 in complex with cyclic-amp and rap
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
162
structure length
150
Chain Sequence
b'EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rap guanine nucleotide exchange factor (GEF) 4
publication title Structure of Epac2 in complex with a cyclic AMP analogue and RAP1B
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/gtp-binding protein
total genus 43
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cf6R00
1G291 2B8WA 5SZKB 1SZPA 1AKEA 2FEOA 5GJCA 3L0SA 5JJIA 1OXTA 1VYTA 3NBZC 3U3OA 2QTFA 1NIPA 4Q1BA 2GNOA 1A2BA 2C8VA 2VTKA 3UPUA 1R8SA 4PC6A 4MGIR 3ZLJA 3B1WA 3KKNA 3W6PA 2A7QA 3LBNA 3OIYA 3DKPA 5IHPA 1U94A 2F1RA 1N5LA 4UNPA 1N6HA 2IYWA 3OE7D 1XX6A 5FL7A 2C9CA 3CRMA 4HAXA 3ZVRA 1Y3AA 1XEXB 1YR6A 2OFWA 3NEJA 1DAFA 4MYCA 3IEUA 4FCWA 1TPZA 4LHWA 2WWGA 4JT2A 5ELXA 4PXAA 1ZRHA 2ZRDA 1YR7A 1DARA 2BBSA 4KFSA 1SHZA 1DE0A 2OAQ1 5L3RA 4I1OA 2GXAA 1HURA 1P60A 4TN1A 1SVOA 2A30A 3EA5A 2ZSAA 5F3WB 1KI4A 5AK0A 3K0CC 5AUOB 1KI6A 3BERA 2F43A 1YKSA 1TADA 4P4SB 4HYYA 4P32A 4C0QC 3AVTA 4QGAA 5J4YA 2CMKA 2DB3A 4DEXA 3TUZC 4V0NA 2X2FA 1ZMXA 2YNMA 4B3CA 2YOGA 2HUPA 1SXJC 3AP3A 2RH5A 3OFNA 2HDNB 4PQRA 4Q9KA 3B1XA 4QG7A 2OLKA 4TMTA 2WSSD 3LD9A 1TF5A 2BBTA 1Z06A 2JLQA 4GMXA 4PHFA 4MITA 5JRJA 2V8OA 2ZE8A 1UBFA 4A82A 4EFLA 1AGRA 5AUQA 3AUXA 4TYYA 3A4MA 4KU4A 3ZD7A 1Z2CA 3GJ0A 5GJWC 4KLNA 4NYJR 4L4UA 1UF9A 2W0SA 3JZAA 1U99A 2CHQA 1KI8A 2KSQA 3O8DA 4KFRA 1KSGA 3R8CA 3TKLA 4Y0AA 4QBIA 4Q4JA 3ICQB 3T5GA 1ZD8A 2C99A 1FL9A 1IONA 2NO9A 4FMCF 4I99A 1E2GA 4ZV4A 4XSHA 1NMXA 4CYMA 4DDWA 3K70B 2XJ9A 2V4ZA 1KHTA 3M1IA 3ZZUA 4C9BA 2PJZA 4CEJA 3PEUA 3KX2A 1G3RA 3THWB 3E5HA 4RD6A 5FTNA 1UAAA 1XCGB 2BBWA 3K0SA 4NYMR 2IW3A 2GCOB 2OESA 5DGXA 2AD1A 4ZCIA 3SJBA 3T1TA 2GWHA 3LW8A 3A58B 2BMDA 1QF9A 1GOTA 4Q4HB 4JKYA 4F4CA 1XTIA 2QE7D 1FX0B 1NKSA 2JJ2D 3EZFA 2IF0A 4M1KA 3AF3A 1S2MA 2CE7A 4NDZA 2X1VA 1KDOA 3QENA 3IPYA 4LI0A 4V0ME 3H0KA 2QEQA 3U4QB 2DPXA 2JJ1A 5J47A 4P4TA 4JL8A 2FNAA 3CWZA 2J7PA 2ZRAA 4RVCA 2P6RA 2XX3A 4OJKA 4YMVA 1CF4A 4W5WA 1RPZA 1M8PA 2HV8A 3WHLA 1LY1A 1WCV1 2QBYB 3ZS8A 4MRNA 2X19A 1SXJD 3T5DA 2FX3A 4LJ5A 4Y0VA 1CRPA 1DEKA 1QRAA 1GAJA 4LC1A 4UKDA 5HE8A 4DC9A 3FHOA 4PFSA 1DAKA 2WMOB 2H16A 4PZYA 3AKYA 3CRRA 2VYFA 3X1ZA 2D7DA 2J5XA 2C2HA 5L3SB 1ZUNB 4UJ5A 4LZZA 3CNNA 3K09A 3OIWA 4F38A 4TMZA 3R9XA 1VCIA 2HLDD 3GLIB 4GRAA 1RRFA 5KSZA 4Z54A 3MMPA 3NG1A 2QRZA 4CEIB 2GRJA 2QPTA 4F92B 4IVQA 5CJPA 2VL7A 5C1BA 1CLUA 2FV8A 3LH5A 1XPRA 2XXAB 2IYTA 1F2TB 4XIGS 3VR3A 3WP0A 4DZZA 5JZVA 5JJKA 2J7KA 1RFLA 2VQSA 1G41A 3BB3A 5DHFA 4ARZB 1JECA 2IL1A 3B82A 4RD0A 2FPMA 3TK1A 4B74A 1CULC 3QKTA 3QOFA 2ZAOA 3MWYW 3B5JA 1P72A 3VMFA 1GFIA 3TNFA 2IEYA 2IS6A 3VQTA 4GOJA 4C2TA 2IXGA 2LKDA 4B2IA 4BLQA 2ZSBA 2CNWD 5CB6A 1TU3A 1E9AA 4QGHA 4PAQA 3RHFA 5K8UA 5KSOA 4DLUA 1P2VA 1WB9A 4DCUA 3L0OA 5B2ZA 1VG1A 2JEOA 3KFXA 3LFUA 1YZNA 3FHTA 5L3QA 4HLUA 1NG9A 1ODFA 2QRNA 1R5OA 3Q5EA 1MT0A 3HDTA 4Q9JA 1R10A 4LCBA 1OE0A 1U90A 2CDNA 2I4IA 5AJVB 4A92A 5M04A 2DY1A 3TBKA 2BJVA 3P4YA 4R98A 4GPTA 1RRGA 2XGJA 1E0KA 1BH2A 3WY9A 3SR0A 1F3OA 1LVGA 1PLJA 1AZSC 3KUDA 2ZUCA 2JIZD 2VRWA 2RAPA 4AYXA 4G0NA 5J40A 4GMDA 3IPXA 4ABYA 3NWJA 5DO9A 4A8JA 3CNLA 1NL3A 1KK2A 1ZUHA 1AKYA 2ORIA 2YC2C 4L5BA 3VR1A 1KI6B 3U44A 1X3SA 1UFQA 2F43B 4Q5IA 1T9HA 3C5CA 2O8CA 1GKUB 2P5SA 1G3UA 1I4DD 3NEYA 5JEEA 4CW7A 1EK0A 3TAHA 4BFUA 3WNCA 4ZKDA 4PQYA 4F91B 2VA8A 2OLJA 2QA5A 1Q21A 1QHIA 3CRW1 3U7EB 4JVSB 2QP4A 1NBMD 2CXXA 3QY0A 3IBGA 3UMRA 1XEFA 1YZKA 3AP1A 3FGNA 4M1TA 3IQXA 4IVRA 2AKYA 4NH0A 4UNQA 1OLOA 3L82B 5DISB 3REGA 4A36A 4TQ9A 3SDZA 4DJTA 1Z6GA 1KI9A 2OBNA 1D6JA 2J59A 2WWYA 1EFRD 4TT3A 4DCVA 2A5GA 1UJ2A 2CJWA 2GJSA 2HJVA 1S1CA 5KOYA 2RGAA 2F55A 4URUR 4Q4JB 1XCMA 2IS4A 2ZYUX 1G8PA 1SHKA 2ZS7A 4YMWA 2A5DA 1R0WA 2ODEA 5LB2A 3F0TA 5JHGB 1VG8A 3CH5A 4D4JA 3FTQA 1Z3IX 1I2DA 1DAIA 4YDSA 3HR7A 3OEHA 2X77A 4NMMA 2O8BA 1EXMA 4CEJB 1SKQA 3LX5A 3NHAA 3LY5A 2VP2A 1TQ4A 4CF7A 4C0AC 2CCKA 4QGGA 5KUTA 3IIJA 2JDID 3LVQE 3WHKA 4ZCMA 3H2YA 1ZBDA 1MV5A 1U9IA 4DCNA 4JLJA 4RKFA 2KBFA 4EIWA 2QGZA 4Q48A 1H8EA 3QI2A 5FBQB 4TSFA 4MYHA 4ZPXA 5FUYA 4OQXA 4C0SA 4Q1EA 3DEFA 4ZDJA 4RZUA 2R6DA 4QNRA 4TMXA 3KKQA 2R62A 5P21A 3DHWC 3I73A 2QMOA 4GP6A 3PQCA 2WJGA 2BKUA 1JBKA 4JLOA 4LC0A 1G4UR 5FI0B 2YVUA 2WPDD 5FOUA 1T0JB 1JEEA 5L3VA 1G19A 1KMQA 4W5HA 2PX3A 1JR6A 2OE2A 1CP2A 2Q0HA 1P75A 1G8GA 2ECKA 3AVOA 1RJ9A 2GESA 1OH8A 3A8TA 3PENA 4MUAA 2IS2A 4D0LB 3EPLA 1SQ5A 2ZI7A 2J1LA 1US8A 4IDOA 1NSFA 1OJLA 3OF5A 2W6JA 5C46F 2OZEA 4WOPA 3VFDA 2B7BA 2PLFA 5UKDA 4BLRA 4W5JA 3CF6R 1ZU4A 3FB4A 2P6UA 2PBRA 1Z6TA 3MAAC 4TL8A 3U6BA 3P27A 1LF0A 1ZNXA 1OXVA 4IOLA 3ZVLA 1TUEA 3B7GA 4MDFA 1E79D 4JT4A 1TF2A 2IX3A 1T5LA 2GEDA 5AR1A 4B6FA 2O5VA 2AWNA 3A36A 1AN0A 4OHXA 3EC1A 5H68A 2H92A 1LV7A 4EPVA 3RWOA 1D9XA 1TQ6A 4HAYA 4BPBA 1P2UA 1TQ2A 2GKSA 3HU1A 1OYWA 5EE5B 3A6PC 3N2EA 2ZXUA 4HLQB 1P9NA 2EFEB 2IYQA 4PPGA 2PCJA 1P9RA 2P5TB 3DOEA 1BIFA 3BE4A 3EG5A 5HKKD 2ZJBA 4H9GA 4BQSA 2W2TA 1F60A 2YWHA 1E1QD 1XEWY 2BC9A 3B8HA 2IYZA 3EA0A 4G5QA 1OFTA 3AVQA 1WRBA 2QT1A 1O87A 1GILA 2GCPA 1A2KC 2XNDD 2J46A 5BXQC 3BK7A 2IUSA 2ZRIA 5TMPA 4GT1A 3RSOA 4DWJA 2W2VA 3VTKA 3EPHA 3L8YA 1JR3D 2ZTSA 4LBWA 1E3MA 1NVXQ 5L3QB 3SZRA 2FH5B 4KI0A 3P26A 4BLOA 2PCLA 1D8TA 2FWRA 3KJEA 4LHZA 2PL3A 2BBOA 2V1UA 4LWZA 3IGFA 4PSVA 3GEEA 3ZGXA 3GJ4A 3MUFA 4E09A 2D62A 621PA 4AYWA 4B34A 2E1RA 3NHBA 3DL0A 3THYA 1SVLA 2JLRA 3KXLA 2E87A 5AUPB 3BH6A 2FA9A 4GP7A 4JL5A 1QHSA 3HPQA 4JKIA 2VHCA 4A8JB 4DLVA 3G5UA 5J4HA 1GDDA 3Q7QA 5GVSA 4OK5A 3U44B 1GL7A 4JJKA 1I4LD 2IYLD 1ELOA 4M1WA 1FQJA 2O8CB 2W6IA 1QHYA 4Z1MD 1W36B 3EC2A 3OAAA 3QG5A 4DXAA 1QBKC 1S8FA 4KJZA 3RC3A 4XOIA 4PPFA 4B43A 4QBGB 1M7HA 1U0HC 4ACAA 4LPKA 1O3YA 4V0MA 3GCGA 3U7FB 1IY1A 1HY3A 2IYYA 1E2EA 4KXFB 4P33A 2Z83A 2J9RA 3U60B 2GVZC 3MG9A 2YYZA 3J81k 2ZAMA 4RCYA 3LNCA 4M1MA 3K70D 3QSYA 3K9HA 3LXRA 1MH1A 4TL6A 2IBMA 1ZCAA 2CJWB 2ZRFA 4LJAA 1RYHA 2LWIA 1M2OB 1Z5ZA 4GOXA 4YMTA 1NSTA 3UANA 3CX6A 1M6NA 4NONA 2PJRA 4KFTA 4DDTA 4BEJA 3QEOA 1DAEA 1K5GA 2KE5A 4PC2A 2RGNC 4RKEA 4B44A 2AHOA 3WMFA 1OFIA 2R8RA 2ZRCA 3RWMB 1FPMA 1KSHA 1D5CA 1OIXA 1M7GA 2DWPA 4G5SA 4JSTA 4KODA 5SZIA 3RABA 2IYRA 2H7VA 5DI9A 1GL9B 3SE0A 2O8BB 4XJXA 2QTHA 3W5JA 1CR0A 4XTRA 4ASUA 3UIEA 4DDVA 1HT2E 2RMKA 5SZHB 4EJSA 3PCRB 1N5KA 4IFBA 2KB0A 4O2RA 3K0EA 4OHWA 4OQFA 4Z8XA 4Z8YA 3GFPA 4LYAA 4DSOA 3KQHA 2F3RA 4HSEA 1KAGA 2DCUA 3ECCA 1G6OA 1VG9B 5JLJA 1P62B 3CX7A 2HJGA 4FINA 4E5UA 5DN6D 3FE2A 2VP6A 2XSZA 3ASYA 2ZI5A 3C7KA 4YMSA 2GJAA 3KXIA 4UNSA 4Q01A 2GEUA 3EAQA 4A4DA 4EPXA 2FF7A 2GVDC 1N3BA 4EPTA 521PA 2IF2A 5KNCA 1E96A 4QNMA 3KTAA 2BM0A 4FD2A 4WZAE 3LV8A 3T1QA 5LBIA 4D26A 4DIDA 4D0GA 3BBPA 2QMUA 1Z6XA 4OQLA 1VG0B 4B71A 3GEHA 3X1YA 1RJ9B 3C8UA 4B3BA 2CLDX 2CHGA 2B21A 5AJYA 2VBCA 2YWFA 1W46A 2CBZA 1R2QA 1YU9A 1T3HA 1W0KA 4QHSA 1ZC3A 1A82A 3K9LA 3RRZA 2A5JA 3KB2A 1IJEA 4MGYR 1D2MA 1TU4A 2GK6A 1KI2A 2XOKD 5FH9A 2NPIA 3T06B 4DCSA 5EE1A 1NLYA 4UQOA 2ZI6A 1G7RA 3BFXA 3WXMA 4WAUA 4DB4A 3MSXA 1CR1A 2PZFA 3EWAA 3G0HA 4QBHA 4YDHB 2Z6VA 4TTQA 4OI1A 1NNEA 3ADDA 1NVWQ 3U7HB 1AS0A 5CYPA 3RANA 4UNNA 2QSZA 5A0FA 3W90A 2VHUA 2V7QA 2GBLC 2DFNA 1E9DA 2EFCB 2BMFA 4LYHA 5F2EA 5LB4A 2NQ2C 3IEVA 4P4UA 3EIEA 1XWIA 2KBEA 4LHYA 3CPHA 2AFHE 1XTSA 2NTYC 5K8TA 1TEXA 1IXSB 1XTQA 3LA6A 3NKVA 1UBCA 2ZRBA 4NHOA 5FL7D 4H1UA 2D74A 1Z28A 3IIMA 4GZMA 4QL3A 5DE3A 3BB4A 1ZM3A 4PTLA 1G8FA 4EFNA 4LRWA 4LSGA 1JEDA 5A5GA 3AVYA 4Q1CA 3TW4A 1P73A 5EP4A 4ERNA 3THOA 1LTQA 3GEIA 3KL4A 2HEIA 4AWXA 1GTVA 3BXZA 4YC7A 1KDRA 3UG6A 1W2GA 3FFBA 4HDQB 2W2XA 4TQUS 4E07A 3LQQA 1G8YA 1VIYA 1YE8A 2UVQA 1JPJA 2VF7A 4G5GA 5EZ6B 5A4JA 3PUWA 2WOOA 4C0KA 4DBLC 4D80A 5FUWA 2ZRNA 3THYB 1E2FA 3GLFE 1WF3A 3EZ7A 1UKEA 1WP9A 2QG6A 4OYHA 4AKHA 4ZI3A 4DSUA 3AP2A 1XTJA 4GNKA 4XVQA 3OFND 3ZH9B 1WMSA 3MFYA 4PSAA 3PEWA 1J90A 5CDFE 1II8A 2ZQ5A 3NBFA 1XMIA 1LFDB 3A1WA 2ZYWX 3K09C 3GJ7A 5KSYA 3C41J 4F93B 3WP1B 4A6XA 3OZXA 2GJ9A 2GK7A 4G1UC 2EVWX 5JSZA 3SQWA 2O8EA 4JYCA 2G77B 1ZIPA 4LJYA 1GNQA 1KO5A 2BIFA 3D3QA 4MRPA 4DSNA 1G1MA 4O2LA 4KSCA 1P61B 1MRNA 3AH8A 2JASA 1ZC4A 1COWA 2CHVA 221PA 2QQ0A 1V43A 2ASEA 2CL7X 4KYIB 1DG1G 4Q1AA 2HYDA 2ZE6A 3PJRA 2PZEA 1AQYA 1H8HA 2AR7A 4H1VA 1MO5A 1YJ5A 5FBVB 4Z51A 4P0TA 4LJ8A 1CJVC 1PUIA 4TL9A 4WW0A 1T8TA 4Q4LA 3PEYA 1XD2A 1UBGA 2FSGA 1VIAA 2WZQA 1XRJA 1ESMA 2EU8A 1GITA 3TR0A 1TEVA 2J0UA 2F9MA 2D2FA 3FKSA 4M4SA 1F6BA 1P2TA 2IYVA 2QTVB 1FTNA 3VHXA 5FUVA 3N2IA 4HLUC 2GDJA 5TVKA 1Z0KA 3PXGA 4EJSB 1E69A 1HQCA 2IHBA 4MDEA 1CR4A 3Q85A 4HZUA 1GRRA 2CL6X 2GAOA 3CKLA 5CJ2A 4B33A 4LBZA 2VO1A 2BCGY 3OE7A 4JBYA 2H1LA 2CL0X 1Q1EA 2GHIA 2JJ1D 1LB1B 5K8LA 3FHCB 5TXGA 4HB3A 2FSIA 2VP0A 2J7PD 4NP6A 1ZNYA 5EE3A 4D2IA 4IXNA 4I4LA 4A8JC 3UMFA 5EUMA 2AL7A 4K46A 2QAGC 5BYJA 2IWHA 3EPJA 3BD9A 3EZ2A 2MSDB 2RGGA 2GTPA 2YOFA 3BC1A 3KTAB 1NJFA 5FOWA 3IUYA 1NIJA 3RS2A 2Z4RA 4V03A 1S3SA 4IVPA 2RGDA 1E32A 3WYAA 1X6VA 1DG3A 2FEMA 4YXWA 1E9BA 3H4MA 4X8MA 3ICEA 1W4AA 3SFZA 1FMJA 3SU8A 4D0NA 1T6NA 1GWNA 4EDHA 4YMUA 5G53C 1W2HA 3MWLA 4TYQA 4TYNA 4B2PA 3BRWD 5DYGA 4MH0R 1OF1A 1TX4B 3GLGE 1E9CA 4BRWA 2KJQA 2RGCA 2ANCA 3E1SA 1OH7A 4Q7KA 4PX9A 4RY2A 4A0GA 1UEJA 4DUGA 4X8HA 4EAQA 5HZHA 2CLCX 4US1R 4GL2A 4Q00A 4FCTA 4Q1FA 3F8TA 3F3YA 3IO3A 4ZDIA 2ZRKA 3RS3A 4EPRA 1SGWA 4M2LA 3CB4A 4MRSA 1Z6AA 2IUTA 3U3JA 3MGCA 4OQNA 4A2PA 4BE7B 2GA8A 2DBYA 3SHFA 1J70A 3OIVA 2UZ3A 3OEEA 1W4BA 1UBEA 1QHHA 4HB2A 2C96A 1JXOA 1G7CA 1AIPA 1I4TD 4O3MA 3LLMA 4TWZA 1PLLA 4JBWA 1U9IC 1E2JA 2FZ4A 5GJBA 2WBLC 1EFTA 4RFSA 1KNQA 1IOZA 1FUKA 1E1RA 3WMGA 5EXTA 3LO5A 1Z6YA 2GXQA 2RHMA 5FPSA 4MRRA 1XNJA 1MKYA 5FPTA 4Q21A 4XD7A 3U3KA 4L16A 3DZDA 2ZU6A 1DELA 2C5LA 2OHFA 3REFA 4LY6A 2G0TA 4D4LA 1W7AA 1WBDA 3AVUA 4TLCA 5KHOC 1RE0A 4LYJA 1IXZA 1GIAA 3CRVA 4CVNA 5JI2E 1KIMA 3LVRE 1W36D 1W4CA 1W47A 2MMGA 1T3SA 2WJHA 4HUTA 1Z83A 2AK3A 2BMEA 4D82A 4UNRA 3SHWA 5SZJA 4B3GA 4JLPA 4PO9A 1PVOA 1KGDA 3GLHE 1E0JA 5EXSA 1BMFA 1XTRA 1S1MA 2GZHA 1II8B 5EJEA 5BWMA 4ZIRA 1T0HB 1TL7C 1T4GA 2JATA 2O8FA 1E99A 3WNDA 4HB0A 5CYOA 3B13B 1OT3A 1XEWX 3C4JA 3X2SA 2J45A 1PLKA 4ESVA 2HT1A 4EPYA 2ZUBA 4TT3D 5JSZB 3UXMA 1YRAA 4KCGA 3SYLA 2O8EB 1E0AA 1JQJC 2G1JA 1K6MA 2GEVA 2NO7A 1EG7A 3AEZA 3LAWA 3UWOA 2ZETA 2CEAA 3B9PA 2WMNB 5H1YA 1ESNA 3A37A 2D4HA 1KYIA 4MYTA 1NLZA 1A5TA 4KFUA 1S0UA 3GJ8A 1HYQA 1VCNA 3QXCA 1W0JA 2CCJA 3OEHD 3ADBA 4D6PA 4GDFA 2Q21A 4XSGA 1M74A 3ZIAA 5JS7A 3HR8A 3TQCA 3B78A 2D2EA 2X2EA 4F4IA 1ZD9A 2BEKA 1VDZA 1T91A 3WYGA 4A0RA 3QXXA 3PEVA 1FZQA 2DHRA 1PJRA 1XD2B 3FYHA 2FPKA 5AWFC 1H8ED 4TSFD 2J0UB 1CRQA 3C5HA 2EYQA 1RRCA 1OKKA 2V3CC 2C77A 1OHHA 1W1WA 3ONWA 3QKUA 1S9DA 3PUYA 1HE8B 4B35A 4Q7MB 1K8RA 2WM9B 4DLRA 4XVRA 2Q9AA 2Z5FA 4HZUB 1ZM9A 1G3IA 2OEPA 3ASZA 4IOMA 2CVHA 3ZZTA 2ZI4A 2XAUA 2VSOA 3PUZA 4TL7A 4JLKA 1R0YA 1JAHA 1YR8A 3TMKA 5AUNB 1GKYA 5KPJA 1NLFA 1PV4A 1JXMA 1IJFA 2B7CA 5IF9A 2QP3A 3SJAA 3SC3A 4DKXA 2F3TA 4FMDB 3V00A 4Q18A 3QVVA 3UMSA 2W6JD 1KTVA 2JIZA 3U5ZB 2JJ8A 3KJGA 1XMJA 3L8ZA 3WBKA 4TQAA 1T5IA 4AIIA 2QMEA 2FGKA 1KK1A 4FMBB 4QRHA 1VECA 4B3XA 2PLRA 3AM1A 2X8AA 3QXJA 4OK6A 2FN4A 3MJHA 3QKRA 2PMKA 5HPYB 2XZPA 1WA5A 4JJZA 4D25A 3R9WA 1A4RA 3QPVA 5G3YA 2VHTA 3AF2A 4I1VA 1G17A 3GLFA 4HATA 3L0PA 5CIWA 2JA1A 3LWNA 4CZ2A 1OXUA 3QF4A 3TIFA 4A0HA 5TARA 1GSIA 5JI3E 1HV8A 2VHQA 1Z63A 2RGBA 1Z2AA 5BQ5A 4FI3C 4NZYA 1Q1BA 1ONBA 1VHLA 1FP6A 5CM8B 4R9UC 4G5RA 3UK6A 1DS6A 5TDHA 5CDFA 3WYFA 3GPLA 3ZQJA 2GETA 2EFDB 1G6HA 3GJXC 2OSBA 3BFKA 4CIDA 3KQLA 4M1SA 3VKHA 4Q9HA 5LD2B 2NO0A 4RZXA 4LJ4A 2PMDA 2R2AA 1VTKA 3QKSA 1Q44A 3SNHA 4LV6A 4TTPA 2WWXA 1QHHB 3TVDA 1OXSC 4LJ9A 4EJSC 2YJTD 4V0OA 4YLGA 5FTLA 3L0IB 4IRUB 4QJ5A 2CK3A 1ZINA 2ERYA 2N46A 1DAMA 3M4YA 3N70A 4Q4AA 1IN6A 3FMIA 4IOKA 2ZJZA 4M22A 1Z8FA 2OAP1 3MLEA 2WKRA 2DWQA 2K5UA 3AGPA 1FP7A 4BLPA 3A1TA 2ZE7A 4FXPA 4RFSB 1FQKA 4L9SA 3K70C 4QXAA 1X86B 5IDVA 1J8MF 4OQMA 1CJUC 3RSLA 4O0MA 5E7JA 3MD0A 4D81A 2D3WA 3L2OB 1N0UA 4RSGA 5CLQA 4QOSA 1XJCA 3KJHA 4G01B 3SI7A 2MMCA 4K81B 4UXJA 3K1JA 4JLNA 3TSZA 4OHZA 2W83A 3D6TB 2NZ8A 4TMKA 3PUVA 3RAPR 2O0JA 2W6ID 3B1YA 4URYR 2BHRA 3SBDA 1QG2A 1UDWA 2WIAA 4FMCB 4B3FX 4LPSA 3RRNA 2BV3A 2OXRA 3OAAD 2NG1A 4PSKA 4UXHA 5C2JB 1OYYA 4TZ0A 3FMOB 4JLAA 3QXSA 4F4JA 2IS1A 1NRJB 2GF9A 3UWKA 2BEJA 5HCIA 1IY2A 2GJKA 2P3SA 4BLTA 1TF7A 1XTKA 1L8QA 2D7CA 1FW6A 3F5FA 3P1JA 1KNXA 3B9QA 4POAA 4ZIRB 1Z0AA 5J5CA 2GILA 2ZSDA 4TLAA 2O8FB 3B1VA 1MABA 1WXQA 2VIIA 4BFTA 5BN4A 2ZJ8A 4AG5A 2J3EA 5G41A 4MQBA 3CZQA 3GFOA 2A3RA 5BYKA 2YC4C 1P9WA 2R9VA 1R4AA 1NN3A 3AF0A 5FTJA 3W3ZB 2QUZA 1W5SA 4R2HA 4GI7A 1P4SA 1CJKC 2SHKA 5KTYA 1Z0IA 3PR1A 1KK3A 3I72A 1N0VC 1RRPA 5JEDA 3DVLA 4IEEA 1GL6A 1G16A 2ODBA 3BB1A 1C4OA 2ZS9A 3LRPA 1G4AE 4JL6A 4BWYA 4GBMA 1CKEA 2B8TA 4OI4A 3TE6A 4AY2A 5TY0A 5JWRA 3I61A 4ASUD 2GCNA 5FOSA 5G3ZA 3TRFA 4KLZA 1A1VA 4BZQA 4L15A 3B85A 1ZNZA 4BZXA 3K8YA 3GLGA 1D9ZA 2V55B 1R5BA 1ETUA 5FL3A 4TLEA 4PPQA 3UG7A 3IDQA 2ZROA 3B2EA 3IHWA 5JWOA 1HE1C 2ZSEA 1T3LA 2IHYA 2RCNA 2XSZD 4BEBA 3KKPA 2WJJA 2F9LA 2MSCB 3NBXX 5FOTA 2QY9A 3FKQA 3KDSE 2WWIA 3S1AA 3BGWA 2R6AA 2V9PA 2H17A 4NCJA 2HCJB 1U2RA 4M21A 2VP9A 1XBTA 1KZ7B 3BAFA 3CF2A 1E9EA 4NBSA 1LS6A 5DI3A 5EE0A 2AWOA 1UKYA 3B6EA 3U3MA 4YONB 5KDOA 1YHNA 3DZ8A 1GG2A 1YRBA 4ZCLA 3QPWA 4TYWA 4KBFA 3QUSA 4NE2A 4A0FA 2ZIAA 2RGEA 1R0XA 1DBSA 4FCVA 1W0KD 2AD5A 3RC8A 4M1OA 1G3MA 1OIVA 1RVDA 1ZW6A 4KVGA 3AV0B 2WV9A 1Q57A 2OCAA 1JJVA 1QHNA 4KHZA 4ZDWA 5GVRA 2GJ8A 1BO6A 1SXJE 2XTMA 1XDBA 1XB2A 2ZR9A 1U81A 1IN5A 2BWJA 1GVNB 2REXB 3QKRB 1E9FA 2IYUA 2VHJA 1BS1A 1Z47A 1NMZA 1UADA 1QVAA 5HR5A 1P6XA 2QORA 2JLZA 2VF8A 1KKMA 4DLWA 3IO5A 5JCPA 3NH9A 4NL4H 2O0HA 3K0AA 1OH6A 4WZBE 2YKGA 4JZKA 1KMHA 1LNZA 1N0WA 2AFIE 1LF5A 3GLFB 2V7QD 3RYTC 2BM1A 3QF4B 1ZP6A 4BFXA 5BW8A 3LQRA 1CEEA 3GFTA 1ZVQA 2XB4A 5D3QA 1HUQA 1US8B 2ZJ2A 2FZLA 3G82C 1QHXA 3T35A 4D4KA 3GLHA 5CB8A 2VSFA 4NKRA 2MSEB 3WRXC 4MKIA 5E7IA 2R6FA 3OHMA 3M0EA 1IY0A 4DDUA 1D2NA 1N6PA 1TMKA 4DLZA 1NN1A 4EPWA 1NVVQ 4U00A 2JLXA 3A1SA 3AGQA 2OV2A 2OCYC 2XTNA 4N0DA 4JS0A 2ZM5A 4Q66C 2H18A 5B57C 3I62A 2ATVA 1BOFA 3A4NA 1AQUA 3U6KA 2GF0A 2PZGA 3ND8A 2C95A 2ONKA 4Q4AB 1KAOA 1N5JA 3Q72A 5FR2A 4B47A 2V6IA 2IXEA 2QI9C 1RC8A 3TVTA 1G3QA 4NYIQ 4FWIB 4P31A 4PO8A 3MJRA 4JBXA 1EFHA 5FR1A 3CX8A 1AJEA 1EWRA 4DIEA 1W44A 2A78A 1Q1QA 2NIPA 1SVKA 4IOJA 1G8HA 4XWAA 1QDEA 1KI3A 1UPTA 1XD8A 3O47A 4OJQA 4A15A 5CIQA 4CEHA 4NU0A 2ZPTX 4RJLA 4L8GA 2NMVA 1U0LA 2YOHA 2JGNA 3T12A 3PG5A 4B2LA 1G5RA 2YINC 4PC3A 4ZO4A 4ESHA 1XZPA 2UKDA 4PZLA 3R9IA 3D31A 2XZLA 3PVSA 5FPHA 5E3HA 3VNUA 1MO6A 2KWIA 1SKYE 2A5YB 3ETLA 3DKVA 4CRWB 4XTCS 4IDNA 1T8UA 3NDPA 4CDGA 1P7CA 5DH9A 5F9HA 3TUIC 3C15C 3VAAA 2ZI9A 3H1TA 1E2LA 3BJIC 3U2QA 4JSYA 1NJGA 3IQWA 1XFAA 3CZPA 3SOPA 1COWD 1S9HA 1CIPA 4CEIA 2QENA 3EASA 2PEYA 4BZPA 1OIWA 1NBME 1MABB 4WIAA 5FUXA 4J0QA 4BFZA 1XPOA 3SBEA 3PUXA 4A1FA 3ZQ6A 1HQYE 5KDDA 3DDCA 3K9GA 3QG1A 3RVBA 2WJIA 4AD8A 4PHHA 1GKIA 4LV5B 4K8OA 4BGDA 1H8HD 4FMDF 4URZR 4X8OA 1XMSA 2EFHB 1OXXK 2F1HA 4FN5A 4RZ3A 4XH9B 5DSZA 3B1ZA 4II7A 5LD2C 4HDCA 1FTSA 4AKIA 1HTWA 1QG4A 4IW3B 3ADKA 4BLSA 1Z0DA 4DLTA 1J2JA 2IYXA 1ZJ6A 3A1VA 5IK2A 2ZYTX 5HTKA 3LBIA 4AKGA 1E98A 2RGNA 3FKSD 2CCGA 1IN7A 4PZZA 4M8NE 3SN6A 1EESA 4LV8B 2LCFA 4Q1DA 2B6HA 4QC2A 4R71A 4JVNA 3C16C 4OKSA 5JCZA 1DVRA 5FI1B 3SJCA 3GJ6A 4DLXA 4D4MA 2ZSFA 5D3MA 4QJ4A 2Q3MA 3CNOA 4A2WA 2QT0A 2CVFA 1G7TA 3GLGB 3U3RA 2XB2A 4PC1A 2JLYA 4HAVA 3VX3A 4MA4A 2IUUA 3AQ4A 3W6OA 4I1UA 2G1KA 4IDHA 4RD2A 4QM6A 5FBRB 3MWKA 4PHTA 5EUQB 4DHEA 2WWFA 1II9A 2R6GA 3R20A 2ZRLA 1SVWA 2P0EA 1AA9A 1Z0JA 2DFLA 3VNVA 3T1OA 4EQ6A 1GRNA 3S1AB 2CE2X 1EFUA 4M1YA 5J4VA 1IHUA 3VKGA 2ZVQX 1N6LA 4IKEA 1OW3B 2I1QA 1CS4C 2EQBA 2I3BA 4LYFA 5DI3B 2VSXA 2IA5A 2C03A 2GAAA 5KDLA 5AJXA 3U7GA 4BECA 4DLYA 3HU2A 3RLFA 3O8BA 1AGPA 3R7WA 4YXWD 3IIKA 1MO3A 1N6OA 2JAQA 1XF9A 2IEZA 4NPHA 2IWRA 4AKEA 1GNPA 3BORA 1WBBA 1QZXA 2W0MA 5FTMA 5EP2A 3RS0A 5C18A 4PPNA 2VP5A 2F1IA 3VR5A 5K8IA 2NGRA 2OG2A 2R65A 1GP2A 1XU4A 4E22A 5EP1A 4OBEA 1WDTA 3EWSA 3H84A 4V02A 5KNBA 4DUGD 4S35A 3SYKA 5JFGA 5FOXA 3NTUA 3ZS9A 2Y8EA 1W48A 3FWYA 4US2R 4MUBA 4X8LA 1IN8A 3K0AB 4NCHA 5CK5A 3ZVMA 4LDJA 2WWWA 1KMHB 3W6NA 1XD9A 1AS3A 2QPOA 1YZGA 4IDPA 1W36C 1X8LA 2NZJA 1N25A 3KB1A 1XMVA 1XJ0A 3AVWA 3OEED 3E70C 4G5OA 2GBLA 3ZZ0A 1E2PA 2ZI3A 1XJQA 3DO6A 4PANA 1NN0A 3GLHB 2OILA 2YHSA 3CF0A 4AK9A 4C0HA 1RYFA 2QROA 4Q9LA 4RD3A 4C0JA 2GZAA 2OFOA 2WKPA 3RRYA 2WSSA 1JI0A 1X1RA 5DNYB 4MKGA 1N6KA 1M7BA 5TV2A 4OL0A 3EZ9A 4HLDA 1E1RD 5FOVA 3X1XA 2QL6A 1NMYA 4JYBA 2FGJA 2Q6TA 4PC7A 3TW8B 1U8AA 3KZ1E 3CBQA 1IM2A 2R6CA 4XD7D 4W9MC 3UKDA 4B76A 5BN5A 3ZVNA 1PZNA 2G83A 2ANBA 5CLLA 2C78A 3QBTA 3W34A 5C4MA 3QVUA 1R0ZA 3M6AA 1AM4D 1JR3E 1YR9A 3QPUA 2O8DA 4F7WA 3RS4A 3DM9B 1LW7A 4TLDA 2XITA 3KKMA 2FMXA 3CWQA 4QHYA 1HEIA 3HWSA 2HF8A 2WTUA 3W5IA 2FOLA 2N42A 2V1XA 1E2MA 1ZM7A 4US0R 1F2UA 3I8SA 1C1YA 4CEHB 1N6NA 1B0UA 3U61B 4MGKR 2ORVA 4NCIA 2OT3B 3KQUA 4TMVA 3EPKA 2VH5R 1Z29A 5FBLB 2ODWA 1BMFD 2VLIA 4CT4B 2ZRHA 3AKEA 3LW7A 3VR2A 1IAQA 4URXR 4W7SA 3FMPB 1IXRC 4KYUA 2VEDA 2OM2A 421PA 3O8CA 1KDTA 5FPYA 4TLBA 4AI6A 1KO8A 4HAZA 3O8RA 1NI3A 1QVRA 2JJ2A 2QE7A 3EARA 3N5CA 2P2LA 2ERXA 5KNDA 5JJLA 1HA3A 4ILEA 4ON9A 5L8VA 4ACBA 3ND9A 2ZYVX 4PQFA 2J41A 1N2CE 5CM9C 1KSJA 5E95A 2GXUA 4AYTA 4AC9A 3K0CA 2WHXA 3CPJB 4LJ6A 2W00A 2J0QA 5CK4A 4DVGA 2ONJA 4YQFA 2WOJA 4ITRC 1W0JD 2RKOA 1Z08A 3VR4A 1MRSA 1ZM4A 3AKCA 1S3GA 2A5FA 1IN4A 2P6NA 5J4KA 721PA 2C04A 3RDPA 3ZIAD 2FJUA 2ZR7A 4TMWA 4E03A 1AZTA 4CT5A 1VYVA 4OI2A 4DRZA 3MCAA 1SXJA 3MRSA 4DT1A 2YV5A 1JNYA 3JVVA 2TMKA 4QFMA 3X1DA 1FMLA 5H8WA 4V0LA 4RFVA 5AJWA 2WSMA 1JJ7A 4OK3A 2Z4SA 5F9FA 1OKKD 1OHHD 3I4LA 1CXZA 1BYUA 5JRZA 3RRMA 4BRUA 4WA7A 2D06A 3KFVA 2HLDA 4WBSA 5D3MB 1NG1A 1II0A 2WIBA 1Q0UA 3SEAA 2WJYA 3WNBA 1X8KA 4LBYA 1E4YA 1M1YE 2FPLA 1E6CA 2BVNA 4GSYA 5J4LA 3R8FA 1J7KA 2QPAA 2AXPA 3GD7A 1KI1A 1KO1A 4N0EA 3DM5A 2C98A 2DFKB 4WXPA 5LDDC 3T1VA 4L9WA 3ZDQA 1S4QA 2FDCA 3AF4A 1G21E 1DAGA 1I2MA 2XZOA 4A2QA 3KQKA 3GJ5A 3KJIA 3EW9A 1L7VC 2NOAA 2ZE5A 4JLDA 4MKFA 4P3YA 2NPFA 4EQ6B 3BS4A 4KV9A 4OI0A 2QU8A 1KY2A 1W5TA 2G0NA 3K9NA 2XEXA 2QAGA 1KJYA 1CJMA 2JLWA 1VMAA 2IXFA 3I3SR 2FU5C 2ZANA 4Q47A 3PIRA 3NVAA 1E2HA 2CNWA 4PAMA 3EIHA 2BDTA 1VCMA 3VX4A 5H70A 4B73A 2OFXA 3R7WB 3GJ3A 2O52A 3RS5A 4A6PA 5JBQA 2ZS8A 2HXYA 2FFBA 1Z0FA 1CBUA 3NC0C 4IXMA 4TTRA 4LJ7A 4B48A 1CJTC 4QKQA 2H5EA 4S2EA 4LK2A 3GLIE 2ORWA 2WAXA 2QP9X 4U02A 1EX6A 3E2IA 5EXPA 5EXXA 3NXSA 5FPKA 2JLSA 1Q22A 5B58C 4MKHA 1N6RA 4M9XA 2ZRPA 3K0FA 2PT5A 2REOA 1WE2A 3EX7C 3W8NA 2Q9CA 3AUYA 1A7JA 5JWHA 3VR6A 1NN5A 4TYPA 2PEZA 3PITA 1OFUX 3QE0A 1DAHA 3LBHA 1KZGB 3QBVA 2G3YA 3JZMA 4IJMA 4NYJQ 1EX7A 2JCSA 3QEJA 3RS7A 5AJZA 1NP6A 1XXHA 4RCZA 4Q19A 2O0KA 4KBGA 1ANKA 2REBA 4QHTA 1M34E 2G9NA 4HB4A 1YZQA 3DMNA 1G64A 3HYRA 1E2DA 1ZIOA 3ZJYA 1E2QA 5HE9A 2EYUA 2CK3D 4HLCA 4M0LA 5KPDA 4Q7JB 3A1UA 4HEJA 3LDAA 3V9PA 2W58A 1NBMA 1Q20A 2XNSA 3PFIA 1R8QA 3I1FA 3AF1A 1RIFA 3CM0A 2H8KA 3P4XA 2ODNA 4NYMQ 5JMTA 2EW1A 5E7MA 1X8JA 1GM5A 4JMPA 4RD4A 1OSNA 4V0KA 3V4RA 4LHXA 1EFRA 2QM8A 5DHAA 2AKAB 3W9YA 1ZUIA 1GZSA 3I5XA 4I1SA 4KSBA 1NVVR 1XPUA 1OV4A 1ZD1A 1PUJA 2O8DB 2F6RA 3I5YA 3THXA 1UKVY 2OBLA 5G40A 2WVJA 1EGAA 5F98A 5HCNA 3TSOA 4WZ6A 3VHLB 2RHDA 4BFYA 1FUUA 1F2UB 3KQNA 1R7RA 3H86A 3EZ6A 4PAOA 1KKLA 1X1SA 5ANRB 3BFVA 1N5IA 1GNRA 4GFDA 4NTZA 3TR5A 5GJVC 2QZ4A 2IC5A 1AS2A 4NYIR 2PT7A 2RB4A 3NH6A 1UKZA 3Q7PA 3ZD6A 3EXAA 1LS1A 4M9ZA 3CH4B 2FSFA 3TQFA 5EZ5A 2JDIA 2HYIC 1F48A 1R5NA 1DTSA 1UEIA 2AN9A 3GMTA 2FFAA 4NCNA 5KSPA 4U5XA 3QJYA 5B64A 4B75A 2H57A 2FFHA 3IBYA 1RZ3A 2QMHA 1NY6A 2AX4A 2QNRA 3DMDA 3T34A 1U8ZA 3VU9A 1DO2A 4LUCA 2OO7A 4JLVA 3AKDA 2ZJYA 2LKCA 1DPFA 1NKTA 121PA 4A9AA 821PA 2GZDA 1RW4A 4JVMA 5KO2A 4C7OA 2YWGA 4C3ZA 2WPDA 1FNNA 4BASA 1ZNWA 3TJZA 5B30A 4BFSA 3FOZA 1JB1A 1VKJA 1E2IA 4ZDKA 2ZRGA 2WKQA 4R7ZA 1MR3F 4EFMA 4B3DA 3GQBA 3TLXA 3PV0A 1E9RA 1VPLA 1NF3A 1D2EA 4GOKA 4LHVA 4TZ6A 2BJWA 3I92A 1SXJB 1TQDA 4DT1B 4FWTA 2FSHA 1TTTA 1E9SA 1MOZA 4Q7LA 4QM7A 2Q3HA 2F7SA 3BWDD 2B92A 1BKDR 2RGXA 2NO1A 1SVSA 1Z22A 2OXCA 2WICA 4N3NA 4URWR 1E79A 4BUJA 1S96A 4O25A 1KJWA 3OIUA 4HUQA 1FFHA 2OBMA 2IK8A 2IT1A 4C0BA 1OH5A 4FIDA 2ZVPX 5DLQC 1FNMA 4B6EA 1AK2A 2WJVA 2V6JA 3AVPA 1G5TA 3Q5DA 1TUIA 3A4LA 2J0SA 3AB3A 2JLVA 1EWQA 1MO4A 1L4UA 2YWEA 3BOSA 4U7DA 3IHLA 3W3AA 3K53A 4OHYA 2AK2A 4OHVA 3CONA 1RKBA 1OFHA 2IYSA 3CR7A 4URVR 2ZJOA 3CUEF 5HKKA 2XTZA 1KOFA 1VHTA 1E1QA 1KSFX 1UDXA 1VYUA 2OCBA 5EQTA 3WRYC 1YZTA 1W4RA 3Q3JB 4G3XA 2QAGB 2P65A 2J87A 2XNDA 4KVAA 3T61A 1G9XA 1KJZA 1XEXA 2ZEJA 4R2IA 3JVUA 4B32A 1ZYUA 2FE4A 3TAUA 3D7MA 1JPNA 4HDOB 2L0XA 4RD1A 4HAWA 4IDQA 3SQXA 1QHGA 1WQ1R 4MYUA 5E4FA 3ADCA 4MGZR 2N1BA 1JR3A 3LX8A 1J99A 1NVUQ 4M9SA 4EKDA 5FBWB 1YVDA 5C4GB 1JALA 1E94E 4WVFA 4DEYA 3HJNA 2FG5A 3BIFA 3GP8A 3C14C 2DYKA 4QBFA 2Z0MA 1KI7A 4LOAA 1DO0A 4C4PA 1IQPA 3TSWA 4P4SA 2CLSA 1N6IA 3K0FB 3SS8A 4AG6A 3HP1A 3CR8A 1V5WA 5EP3A 2P67A 2BKEA 1SVIA 5JECA 1Z07A 1E4VA 1C9KA 1KO7A 2V54A 1CTQA 1F5NA 3QF7A 2G88A 2ZREA 1YZLA 3NBYC 4DB2A 3UATA 3DPUA 4IFEA 2ZRJA 1SKYB 2ZJ5A 1Q3HA 1XXHB 4KO8A 3QXHA 1TAGA 4ZKEA 2HXSA 3HU3A 3B60A 4Z1MA 1ZAKA 3SJZA 4AURA 5LPNA 1VCOA 3D8BA 1R6BX 2Q9BA 2C9OA 1J8YF 2Z43A 3KUCA 3CPEA 2F1JA 2A2ZA 2OCPA 2UZIR 3DOFA 4M53A 4N1AA 1YQTA 1L2TA 3V4FA 2PX0A 4NCKA 1Q12A 3CO5A 4HI0E 4C2UA 3TGPA 4DCTA 1HT1E 3L43A 1Q3TA 3QNUA 1OPXA 4XWOA 5FFMA 2VPPA 2EWVA 1KDPA 1XCPA 2WWHA 5DYIA 3TUJC 1P2SA 2HT6A 2PH1A 5KYKA 4EUNA 1DADA 3HYTA 2QGNA 4ZI2A 4KITB 1W49A 1U98A 2E9SA 1TNDA 1KO4A 3SFVA 1GRQA 3BH7A 5BN3A 1Y63A 2WAYA 4DLSA 2AXNA 1U8YA 4PO1A 4M9QA 2ZITA 5DIFA 3KKOA 3NDBB 3THWA 1SVMA 2OUKA 3RNLA 1H65A 1ZU5A 4DSTA 1B23P 2GCOA 3THXB 1ZCBA 4IHQA 4HAUA 4JLBA 1JAIA 1OB2A 2GXSA 3QKSB 3Q8XB 2XJ4A 3P32A 3LXXA 2EWWA 4Q03A 1XP8A 1HH4A 4Q4HA 3WMEA 5HZKA 4JVLA 1FX0A 2VP4A 3CIOA 4WXRA 5JHHB 1G18A 2C9YA 2HF9A 3AVXA 4HZIA 4CGZA 4JIMA 3ZYCA 1K5DA 3TH5A 5IT5A 5FTKA 3EIQA 1JQLB 1OB5A 1XZQA 3I32A 3IKJA 3SYNA 4QJ3A 3CW2A 3U4QA 3CLVA 1U0JA 1CU1A 2FFQA 2R44A 3QQ5A 1EFCA 4LX0A 3HPRA 4MRVA 3WBJA 4UJ3A 4Q02A 5KU1A 2A9KA 3FMFA 5DN6A 1UM8A 3VU9B 3FFAA 2ZR0A 4LBVA 1GUAA 5CITA 2QQEA 3KXKA 3FDIA 2QBYA 2Q3FA 2I1VB 1G20E 3NIBA 1YZUA 4C30A 1G5PA 3Q9LA 2DR3A 1KY3A 4C7OB 4PR0A 5GADl 5JS8A 3W8RA 4GZLA 1NY5A 1G7SA 1P5ZB 2QSYA 4LGMA 4Q9IA 5IK2D 2G6BA 2YZ2A 4RZ2A 1XXHE 5EE9A 2BMJA 5L3SA 4FW9A 2DWOA 1DOAA 2QAJA 3IILA 1FOEB 1Q1ZA 3AVVA 4JLMA 3GLIA 4QGFA 2EFGA 3QIAA 1BYIA 6Q21A 2JLUA 1L4YA 2NO6A 4XVUA 8OHMA 3NC1C 3MWJA 1P3JA 1E2NA 2XOKA 3LLUA 4I81A 4UXIA 4IEIA 5TB5A 3X1WA 1ZM2A 1E0SA 2KI5A 4BFVA 4BFWA 4KAXA 2ZRMA 2BOVA 3OESA 4XWKA 2HCBA 2ZUDA 2XXAA 1SULA 3I8XA 1F2TA 2ATXA 3FVQA 3BH0A 4C0LA 2ZJAA 1E2KA 1CR2A 2QN6A 3CRQA 4HUQB 5IRCD 2ZU0C 2J0VA 2BCJQ 2DFTA 4PHGA 3P20A 1IBRA 4ARZA 2QM7A 3VKWA 3FPAA 3T15A 1KK0A
chains in the Genus database with same CATH superfamily
3OTOB 2J9FB 3AHIA 1E66A 1KOLA 1W73A 4G24A 3KWLA 4DMHA 3QW4B 1GAQA 1OTYA 2XZDA 2FG7C 3HACA 1EP1B 4AJHA 1MT3A 1J8VA 3ZCSA 1A2BA 2X7HA 3N2KA 3UPUA 4MGIR 4OSEA 3U4DA 3ZLJA 2LIPA 3KKNA 1KHHA 2ZYDA 4F12A 1JEYA 3NTRA 13PKA 1XDZA 1XZMA 3A6KA 3DKPA 3NHWA 5JD3A 5FADA 5IDWA 1PFGA 1YH3A 2C0PA 4C4SA 1N6HA 1XX6A 4QFBA 2XQJA 4IJQA 4X6YA 2OFWA 1TC2A 5EGNA 3LP6A 4C3OB 3IEUA 4LISA 4LHWA 3SYMA 1DL5A 4PIPA 4F72A 5KNBD 3VUEA 1AMOA 1Y42X 5GV8A 3F96A 1DDOA 1ZXXA 3DS8A 5THQA 1ZRHA 2AT1A 2DE0X 1DARA 3E3MA 1EGQA 1G1AA 1DE0A 1PSDA 2OAQ1 2YYSA 3LKDA 5EQJB 5IUJC 2XE6A 4TN1A 4QFDA 2A30A 3EA5A 3RBAA 3GGCA 2BGUA 4CTNA 4UEWA 4ND1A 2CXRA 1TYDE 1NP7A 3I2GA 3W5BA 3PLNA 5J2TB 4OXQA 1UPBA 4GVPA 3QX9A 3OICA 4XPZA 2O06A 2ZR8A 2PR2A 4RQUA 5D85A 3SHTA 4UBJA 1ENPA 1YKSA 2A0WA 3GROA 4RESA 1KBZA 4C0QC 3JYNA 1NT2A 1CQPA 4DEXA 4DGQA 5K2OA 1ZMXA 4DJEC 1VLLA 4HPWA 4AF7A 1VL6A 2WU0A 2NUPB 2AXEA 3I5AA 2WYIA 3AINA 3I6YA 4ID3A 4QVGA 1W94A 1E1DA 1ZL0A 2JLQA 2CHUA 4GMXA 3F6CA 5I45A 2JF0A 2A1IA 1L5YA 5JRJA 3JQAB 3WAJA 2D4AA 3E3OA 3KT3A 4BN5A 3U4AA 4KU4A 1M6YA 3RIYA 4ETWA 5DWVA 2XYQA 3O1LA 4ZV9A 1JA0A 2UUOA 4RABA 4ZOLF 3ANLA 1ILWA 3F6RA 5JCJA 3CISA 2WHYA 3SGLA 3WL4A 3ROGA 1UPAA 4MUKA 5EKTA 3Q7IA 1SC6A 3F49S 5ES3A 2Q6KA 2IU3A 2CHQA 1KI8A 4KFRA 4R9SA 1KSGA 3OCCA 3R8CA 2EBFX 4WSOA 2I22A 4RAOA 5D7BA 3ICQB 5FAKA 3N58A 4BV8A 3C5EA 1EHCA 2O2GA 1ZD8A 4JA0A 1I80A 1X0VA 3H2KA 4XQEA 1WHTA 4ZV4A 1U28A 1WSAA 2I6XA 3K70B 1DP4A 4URHA 2FR8A 1JAYA 2V4ZA 2AVNA 4Z0TA 2ZCVA 1A98A 4WY5A 2YDYA 4BNZA 1VE7A 2W2KA 4JB3A 1MB9A 3E5HA 2GPBA 5IP5A 1P4RA 4RD6A 5FTNA 3V6MA 3IA7A 4U2FA 2VAWA 2IW3A 3L92A 4IICA 4XFJA 4ZCIA 2AD1A 2RCYA 3HCFA 3SJBA 4DIBA 2JIRA 3FWZA 1UWKA 3U7IA 3ZW8A 2BMDA 1O94A 3A6EA 1WB5A 3KOZA 1GOTA 2DSTA 3ZXXA 2R48A 4YROA 4BB0A 4F4CA 5ILOA 4MHOA 2WHRA 1FX0B 1EMDA 1NXOA 3MIIA 2X0IA 4M1KA 1IIRA 2B83A 3FVVA 3TD9A 1S2MA 3F6SA 3RVSA 4PBSA 1BJRE 1V5GA 1YTUA 1G5HA 2FWPA 1WCWA 1NQXA 2X1VA 5EHNA 3SEZA 1JF8A 1Q0HA 4J3NA 4V0ME 4EVSA 1MIHA 2QEQA 4CM6A 5FWXB 4PZ9A 1T13A 3CA8A 2I2CA 4X92A 1VPTA 4P4TA 2ADOA 3OFVA 4Q7QA 4CLOB 5CITA 2J7PA 1H42A 3EF3A 1NVKA 3LYHA 4W5WA 2HV8A 3H2IA 4Q4CA 1ZONA 4CCAA 3IH5A 1K2VN 2JGDA 1WCV1 1IC6A 2I7TA 2PAFA 1XZDA 3W5SA 4FTWA 4XPIA 3HFJA 2FX3A 2HSWA 2OCXA 4AO8A 3ESAA 4Y0VA 4X45A 1XJ5A 3LCCA 1DEKA 3RC7A 2IZOA 1GAJA 4E5PA 4EB8A 3FBTA 5G0WA 3PICA 5KZMB 4CMEA 4PZYA 1P6QA 1BXGA 3AKYA 3CTMA 3EXIA 3DEYX 1N1EA 1QHEA 2DU8A 4NU5A 1HDZA 3EJWA 2FTKE 4PSUA 4ZO7A 3P0RA 3UGQA 3LUFA 3TKYA 1BCSA 4XW2A 4IHJA 1UMKA 3CNNA 3PYLA 3LFTA 4TMZA 3QFSA 2MR6A 2BFOA 1X1AA 3UFXA 4GRAA 1KU6A 2X4DA 3NGMA 1THGA 4LVUA 5KSZA 2I3DA 4CKWA 4F04A 2QRZA 2GRJA 3MTBA 5HRCA 4F92B 4J0CA 1P33A 4Y2UA 3BRWA 3AM4A 4MEAA 1M83A 1PYOA 1Z0UA 3DMTA 1XPRA 4PYNA 2WSYB 3DF9A 3OJ0A 1F2TB 3L40A 4K03A 1HL7A 4ND8A 4RHUA 5JZVA 5BRJA 2W4IA 1FTGA 1XQ9A 2VQSA 4NDNE 2UZ4A 3M4ZA 1BZYA 1EFDN 2EKZA 2BGGA 3IR6A 1R6DA 1S2LA 2AR0A 3A0RB 4JOSA 1JHQA 1U7UA 2EATA 1NPDA 2ZP1A 3SQOA 1L6RA 3E0QA 4FEYA 3B5JA 4GE3A 3AKZA 1R74A 1U2DC 3MHPA 1V9SA 3UJ7A 1WXHA 1DBRA 1E60A 2LKDA 3LX4A 1NXQA 3D4LA 4C2TA 2CNWD 1IQRA 4CM4A 4IZHA 4MKRA 4YRBA 1E9AA 1WB9A 3MJDA 3AFMA 1D4FA 3DPSA 3WGHA 3WNZA 3AFHA 2AMJA 3HVUA 1UANA 1TE2A 4MMXB 1QK5A 2NUBA 3IERA 3EQZA 4EQZA 3HA2A 4ZK2A 2UUAB 5L3QA 2W2PA 1DQNA 2D8AA 4QYWA 3DZCA 4E1BA 2X4LA 1OWOA 3HDTA 1BDMA 3EIXA 4EY3A 4MV7A 4Y2GA 1OE0A 4UFOA 4YACA 5DM70 2X13A 2AEFA 2I4IA 3RSFA 4A92A 2FEWB 1V3QE 2DY1A 3EGXA 2E6KA 2BJVA 3P4YA 4D0SA 1RRGA 2QRMA 3ZBUA 1BH2A 1SCUB 4DS3A 5F23A 3FYUA 3VR6D 1EDZA 5TVGA 1PLJA 1J2UA 3KR0A 2ZUCA 4NNPA 5LXTA 1CW2B 4NDAA 4G0NA 4QPZA 5ALWA 1L4GA 3ELBA 3MT9A 4RSMA 3H5RA 5J40A 5T4HA 1EGMB 1Y7HA 3IPXA 4YCLA 4Z4IA 4A8JA 4A5SA 2UXBB 2RGUA 1YQEA 1O95D 4L5BA 4V0RA 1U8CB 2AN1A 3VR1A 1X3SA 2RI6A 3U44A 4Q5IA 2F43B 4AUMA 2BDEA 3C5CA 2FK8A 5IBPA 3BWXA 2P5SA 4JEIA 1G3UA 3NEYA 4CTMA 4EJ6A 4ARSA 4QATA 4RV4A 2W22A 3TAHA 3NQ41 4PQYA 3WSWA 3GAMA 2Y0PA 1PEKE 2HF2A 3CEHA 4JUCA 4ZARA 1I3LA 3CRW1 5LWQA 1W5BA 4JVSB 2ATIA 2QP4A 1JJBA 1GGJA 3QY0A 4C6HA 2DPYA 4G1VA 5IJ0B 2OBYA 1USIA 4QQNA 1CX9B 4WOBA 5E2AA 2ECOA 3IQXA 2OHVA 5KOIA 2AKYA 2W7TA 1DEHA 1N5MA 1N2SA 5BV1A 4XQ9A 1RLTA 3L82B 2BPOA 3EISA 3N75A 2JK0A 4RK7A 5ESDA 8ADHA 1F6WA 3B20A 3O95A 2V6BA 1JVNA 3A3KA 1E3DA 4H7EA 1D6JA 1IEWA 2J59A 2AI3A 4TT3A 2WWYA 4LJLA 4KQWA 3DNFA 2E82A 1P2FA 4YAWA 4D9HA 2GJSA 1DC7A 1SUEA 1M2OA 3E35A 3KHUA 1X0XA 4IGIA 4Q4JB 5F78A 3S5UA 3TX6A 4ZALA 1XCMA 1DXOA 1Y8QA 3DCIA 1BE6A 3ZIUA 1G8PA 2IU0A 4YMWA 1YJCA 1LDMA 1R0WA 3F0TA 2QD2A 2G1UA 5JHGB 4MIKA 5K20A 2D59A 1SBCA 1HNZB 4D4JA 2ZUVA 4U7JA 4E21A 1I2DA 3NPAA 4EW3A 2HSJA 3L8MA 2VOEA 4ZEMA 1DC3A 3T5AA 1SKQA 4HPXB 3C3WA 1Q0ZA 1TQ4A 1MC1A 4B6QA 4F6RA 4C0AC 4RQAA 1EVIA 2FEAA 1GPMA 1UM9B 2Y1FA 5T41A 1COZA 4ZQGA 1MV5A 1N9KA 3M3DA 3KHTA 1JKXA 3N0RA 1NXVA 3AZOA 2RD2A 3WJ7A 2KBFA 2QGZA 4Q48A 4C0SA 1UFVA 4OQXA 1PS8A 3DFUA 5CBPB 4RZUA 3QUBA 2J6HA 4G9EA 5CCXA 5A06A 3PQCA 2J48A 4G0ZA 4K9RA 3VKUA 1JBKA 4MUHA 3O2NA 1U9ZA 2X6RA 2YVUA 3AR4A 3EULA 2PZLA 2VT6A 1FF9A 2IBTA 1IZYA 1DFIA 3LF1A 3RFUA 4CKXA 5L3VA 1MDBA 1KMQA 2XTJA 3MT8A 4R7GA 5IH3A 1TJYA 1CP2A 4LZAA 2ECKA 4ESOA 1RJ9A 2GESA 3GXBA 5IJ9B 4YR9A 1Y3HA 4HDMA 2IS2A 4RF3A 4YCJA 2PYDA 2W6PA 4NBWA 2ZTVA 1N5RA 3KE8A 2XQKA 3C70A 1T4BA 3VFDA 2B7BA 2PLFA 4DTCA 3FLEA 3IQZA 4KR7A 3LO8A 3AJ8A 3CF6R 3FB4A 4E4RA 2P6UA 2PBRA 4TL8A 4EB6B 2H08A 3U6BA 2APJA 5LN1A 1ZNXA 4ZJPA 2OWEA 5A7FA 5H4HA 3DDNA 4FFSA 1GLVA 4IJWA 1G5QA 3G88A 2QT9A 4F86A 1C9MA 1JHOA 2GEDA 3A36A 3BEDA 3R9XB 3KZMA 1AN0A 2VDVE 1OFVA 4OHXA 5SY6A 1CZUA 4YXFA 2H92A 4Y2QA 2HO5A 2ONZA 4I4TA 5A9TA 1D9XA 3PBKA 4JAVC 5J2TF 2I8LA 1WDLA 1I3NA 2GAJA 5C81A 1HLFA 3D5QA 3GRCA 4N0PA 1SHUX 3HU1A 3A6PC 1OYWA 3ZWOA 4JI7B 3EGOA 5JXWA 1K8YB 2DZDA 4HLQB 2AMLA 2CNNA 3AFOA 3H2HA 4Y6PA 2HQRA 3UT5A 4JJ6A 4RORA 2J67A 4H9GA 1NXSA 1WO8A 4QEDA 1FS5A 4YNBA 2PMEA 1AKTA 4FGWA 1L4HA 4IMJB 4RENA 4Z2AA 5LZ2A 3TRJA 2QT1A 1GILA 5AM5A 2QTRA 2CNDA 4R16A 2B0JA 1A2KC 3AB8A 4XIYA 3MWEB 3OPYI 4MVJD 1BMDA 4YAEA 5IPFA 4R31A 5BXQC 1ODIA 3VUFA 1YFLA 2JCVA 2FPIB 3P0FA 1X7HA 4AECA 5TMPA 3LUKA 3IAUA 2P7HA 4KK3A 2QTWB 1E6LA 4FGSA 4QQFA 3ILHA 2HSEA 4DWJA 3S55A 1EI9A 2WVHA 3H3XA 3LY9A 2JGIA 4FQ5A 4KQ9A 4LZWA 3EPHA 3WBFA 4LBWA 3HCOA 2GTHA 3OM9A 1LDEA 3ZK8A 3P26A 4BLOA 5JSQA 4HDNB 1D8TA 2CNKA 2FWRA 1H0HA 1YNOA 1SBNE 2HX1A 4LWZA 2AJBA 2HI0A 3H13A 2HHJA 2FPSA 4RPGA 4WOCA 4PRYA 3RFXA 3THYA 2JLRA 1LLCA 1QH0A 1MJGA 2VNKA 5AUPB 3GWZA 3BH6A 3ZWCA 1THZA 4JL5A 2VCHA 3F4LA 4EGJA 4B4OA 3FPBA 1PT8A 2G8LA 2HA0A 3VTFA 2CFTA 4BBAA 5JPCA 1LVUA 2GPWA 1SB8A 4M0EA 2VYNA 5H83A 2HA4A 4DLBA 4DLVA 5J4HA 1GDDA 4QZVA 5AVZA 4FT2A 1CHDA 1N7HA 2B30A 2YFYA 4OK5A 3ORYA 4J1QA 3JQAD 2O8CB 4LN1A 4OP3A 4OB6A 3R41A 3ORRA 3B7WA 1MEEA 1R4MA 2VKQA 1VYHA 2I4OA 3QE3A 3OAAA 5IF3A 4AROA 1JYFA 2HMTA 2ZSJA 4MP3A 4XOUA 4ZVLA 4LF4B 4LXXA 1L7MA 1QZZA 4KJZA 1TFUA 3OOJA 3CEJA 2B4KA 2D2IA 1ECJA 2OK7A 1U0HC 3LY8A 2I80A 3G8CA 3HCEA 4F2DA 1O3YA 3VPCA 1H4QA 4W5NA 2C31A 1IY1A 2V5UA 3OP1A 4BN0A 1HY3A 1CLEA 5G0TA 4EF5A 3D4NA 1V25A 3H8JA 3HJCA 4P33A 3ZQKA 4YV7A 3CUTA 5JAZA 3U60B 1RJFA 4OP2A 2QG9A 1ZESA 2GVZC 1FVOA 1T9GR 2C59A 2YYZA 3SLKA 3W1VA 2PWBA 4RCYA 4GQIA 5EAIA 1V8BA 3K70D 5SY9A 3FCUB 1GPNA 4H6XA 4WCFB 2QKYA 1MH1A 3H6KA 1YJXA 2W2OA 3KD2A 1MOPA 3OH8A 2ZRFA 1E4OA 3NANA 4O4HB 2EG5A 4KPFC 1Z5ZA 1WNFA 2WJ3A 3A9TA 3DT6A 3O8QB 4GOXA 3ROZA 3WFZA 3G79A 2AXQA 1I3KA 4BS9A 4YMTA 5JAMA 4UEQA 3I52A 4BEJA 2ECFA 3QEOA 2QW0X 2RGNC 4G4GA 1GU1A 4RKEA 1EDDA 3AW8A 2R8RA 2XMGA 3N28A 1DSSG 3HEBA 3VZBA 1NDUA 5AT1A 1QPBA 3QUTA 1NVEA 1QRRA 3RABA 5IFLA 1RPZA 3Q4GA 1Q15A 3KT8A 5JC8A 1NUHA 4FOTA 2C9BA 2QTVA 3F78A 4IDEA 4AN1A 2QTHA 3CU5A 4DR4B 2O8BB 4ASUA 3NVKI 3UIEA 1WSWA 2DOKA 2ZYHA 4JENA 2OVBA 3AILA 5IAEA 4BX9A 2AJ8A 1UBRS 1CUXA 4OQFA 5EWLA 1SURA 2QE6A 1OLSA 1JH9A 4LYAA 3IDZA 2G06A 2Y0DA 1KAGA 2VAMA 3ECCA 3K1YA 1P74A 5IT0A 2V58A 2GHTA 2GM9A 3O8LA 8GPBA 4D56A 3ZKWA 4BX2A 1WCIB 4F9GA 5DYNA 3RK0A 4P8RA 3FNRA 3FE2A 4XJSA 1FDUA 3C7KA 1O4VA 2PQ0A 4Q05A 3SSNA 1J42A 4A4DA 3KSZO 4RGVA 4QUBA 1V9CA 4CF4A 4EPTA 2JAUA 3H1FA 1Q7TA 3ND5A 5DCLA 3PF9A 3O8OA 4FD2A 4WZAE 3KEGA 3STUA 5LBIA 1GR1A 1I24A 5HKOA 2GFHA 1T36B 4CMGA 2WF6A 3RC2A 4ALIA 1A5BB 3OBIA 3GCXA 3JR7A 4MCHA 5K3BA 1VG0B 1YB6A 5E0KB 4B71A 3GEHA 3X1YA 4BMYA 3E18A 1JDJA 3U19A 4B3BA 3TJMA 2B21A 2WJZB 3NI2A 4GKVA 5AJYA 3UNXA 3QU9A 1VB3A 2VBCA 1KH3A 2CBZA 2VJAA 1ENYA 3QFTA 5JD4A 4D74A 1OI7A 4IDCA 4N9QA 2ZXEA 4RTMA 3G7UA 1K6IA 1I0ZA 2ZTMA 2Q3BA 2LR0A 3GLSA 3GT4A 3JYOA 3K9LA 4HYTA 3KB2A 4MGYR 2AQIA 1TU4A 2ID4A 4DIUA 2XOKD 5CNJA 2SBTA 1IZ0A 2DY0A 1Y37A 1UPCA 2K6GA 2B69A 2NPIA 5IJXA 5BNZA 5EE1A 4WECA 3AEQA 3BFXA 3IPAA 4E5NA 4DB4A 3T3NA 3MSXA 3Q6NA 3PEEA 1IWPB 4QD3A 2C3UA 2PZFA 3I64A 3G0HA 3GIDA 5C7LO 5A02A 4M8KA 3FJYA 2Z6VA 5C51B 2DBZA 3C7CB 1V5FA 1SPBS 3L46A 1RZRA 1NNEA 1S3FA 5FYQA 3U7HB 4CM8A 4I55B 1PJ4A 3ROQA 3DWFA 2QSZA 4KE9A 2E49A 2Z1NA 1WB4A 3BIOA 2VHUA 3OKPA 4EW1A 4CTKA 1J25A 2NQ2C 1E3WA 2OGSA 2OO5A 3EIEA 2P75A 2B5OA 2XODA 3JV7A 5ALNA 3ZD8A 5BSFA 4FDMA 2OV4A 4DDHA 2AFHE 4KWEA 2NTYC 5K8TA 1JZTA 1J9GA 1ZH6A 4G2TA 3HO1A 2O2EA 7ABPA 2V7VA 2ZRBA 5EVCA 2YS7A 4NHOA 2XRFA 2X8JB 3STTA 4CEIA 5FL7D 4H1UA 2D74A 1Z28A 2IODA 3R74A 3JVIA 1GPAA 1MX1A 4QL3A 1XZKA 3A7DA 3FNEA 3RCBA 1H6BA 3EG9A 3KYIB 4JH0A 2C94A 1D2GA 3URMA 4Q1CA 1CRZA 3ZWVA 4AY4A 1P73A 3PYXA 4G8JA 4C6TB 4ERNA 3THOA 3GEIA 2W2LA 3OJCA 1TZJA 1VSQA 2WG1A 2WAAA 4PZAA 1HFJA 3BXZA 3EXFA 4NWIA 4OQQA 4HDQB 3O4FA 1IQUA 4OXRA 1M2VB 3RVMA 3ZWAA 2KYRA 2UVQA 1X74A 1PD1A 1JPJA 4LY9A 5DBGA 5CFNA 1DX4A 2Q6VA 3GJSA 4GI5A 1U3TA 2IGTA 3AEXA 2WOOA 4D80A 2QRPA 1RWVA 5FUWA 4CTJA 3JQ6A 3U4QB 1I4OA 1WF3A 1FDWA 3Q3EA 1UKEA 1WP9A 2QHXA 2GTIA 4MIEA 2IVFA 5H3CA 4ZI3A 3RVLA 2B99A 3WSVA 5BR4A 3KDAA 3I1YA 3ZH9B 1YUNA 2HA5A 1B3BA 3OFND 1WMSA 3SC2B 2JC3A 2GX6A 4BKRA 3PEWA 3VR5D 1C30B 3ED1A 3CVWA 1CQZA 2PVPA 1J90A 3IMGA 3O7WA 2EP5A 1QO0D 2R25B 3HYLA 2IU4A 2WSLA 2X7JA 3RIGA 1K97A 3OZBA 5KSYA 4O08A 4IIVA 4PCLA 3G1UA 4A6XA 3OOHA 2YZ7A 2EVWX 3GRRA 1FS6A 4M88A 3ROKA 3BE6A 2H2IA 2X58A 1K7YA 4L3VA 4ODIA 5FT9A 3WK7A 3ZU5A 3AR3A 5I9BA 1OJ7A 4LXIA 4DSNA 2NTEA 1ZQ9A 3LG2A 4O2LA 4JLUA 1MRNA 1L7DA 4YMLA 3ETHA 2WM2A 3WZLA 1ADYA 1BWSA 1COWA 4RTQA 1QH1B 4JLWA 3P2OA 621PA 3WLJA 4BMNA 1LQTA 1KZ6A 5HA5A 2JFFA 1DG1G 2B4YA 5BUZA 2NVBA 3RTDA 2HYDA 3RYFB 3PJRA 3HM2A 5LQSA 1PWYE 1RJWA 2FEXA 4FJ2A 3KSUA 2AR7A 4RV9A 1Q3KA 4U39A 1MO5A 4OLJA 5FORA 2ZTUA 1R16A 5JJ5A 4Q9AA 3PJFA 4H7IA 4IYRA 4FVTA 4P0TA 2WJWA 3UUEA 3WIEA 4KIGA 3U7QB 2TRSB 1PUIA 3H7IA 4TL9A 5I9SA 4TSKA 1SPXA 1HTBA 1F4LA 3LE8A 1IPFA 5KTKA 5BVGA 2J3HA 3C6YA 2NN3C 4QDXA 1TEVA 1MIOA 2J0UA 3PWZA 2D2FA 1RWKA 3FKSA 5B4TA 1AD2A 1QG0A 2A58A 3D3NA 3V46A 5JJBA 3N2IA 2QYTA 2GDJA 2XMQA 2PFKA 2RGRA 1Z0KA 4GGPA 1M67A 4LDZA 3PXGA 4EJSB 3RS8A 1KFEB 1CRLA 3ML1A 4Y7CA 3PU6A 3VVMA 4HZUA 1UK9A 1O57A 1Z5UA 2CL6X 4LI3X 5LLTA 4G37A 2H1LA 2GHIA 5B3AA 5L9AA 2YX1A 3GXOA 3V6LA 1YS2X 4EA6A 1CY0A 2FSIA 3RTBA 1PJ3A 2C07A 2VP0A 4NP6A 4G5XA 4JP5A 1ZNYA 5NULA 3QKWA 4BQOA 4MWSA 2AG6A 1EFAA 3IDOA 4RPIA 4I4LA 2I2WA 4NJEA 4XRRA 4TUYB 3UMFA 1EKXA 4LQLA 2QAGC 1SEPA 3AR6A 4GSKA 3VR2D 3EEIA 2MSDB 2LW7A 1YV9A 2QS9A 3FW1A 4IILA 3PRHA 1U2TA 1SWVA 2NWQA 2Z2IA 1GYRA 1NIJA 4GR4A 5FOWA 4P7FA 1TT5A 3CVOA 1JFLA 2LVBA 1OZGA 4IGFA 1S3SA 4IVPA 4ND6A 2WE7A 2YHBA 4KPEC 2H4ZA 2RGDA 5EKXA 1Z12A 2G71A 5E1MA 4YRZA 1DWQA 1P7VA 4MS1A 2MWMA 1NYTA 2ZWAA 3IE1A 3LPNA 1X6VA 4N5HX 1DG3A 3ZV5A 4YXWA 3PFKA 4JB8A 1NNSA 1E9BA 1WUJS 2ADMA 3M5WA 1W4AA 3KU1A 1C9EA 4YV0A 1GWNA 4AX4A 2AZ4A 4YMUA 5G53C 5LQNA 5ALGA 3AV3A 3LKBA 4R1PA 4INAA 2DC1A 3OOEA 4BLWA 4MAMA 4EUKA 1SUFA 3THRA 3OPMA 3EUWA 3A9UA 4J0IA 2BEWB 1NU6A 2FN8A 2WE8A 3E1SA 4WCFC 3TDMA 3WQSB 4BRWA 1YXMA 1A7UA 3J7AC 4PS0A 2A6PA 2HBQA 4OJYA 4PX9A 2PXCA 4A0GA 4GECA 4PGFA 2Y9MB 5EJ5A 5JYBA 5LCXA 1JR4A 1TGVA 1DRWA 4J91A 2QUBA 1ZWLA 3BGOS 4G36A 3RS3A 4EPRA 4CLHA 1P0CA 4GUDA 2HPZA 4LY0A 3LQYA 1O9GA 3O5AA 1V1RB 3BHNA 1IL0A 3S27A 4A2PA 4YAIA 2P1DA 2GA8A 4G97A 1Y7IA 2PDAA 3BUSA 2BGIA 4BZZA 5FB3A 4JQYA 1W4BA 1R64A 4B09A 4HB2A 1I1QB 1AQ6A 3KJZA 1JR2A 1X9HA 2WJPA 2IOFA 2Q27A 3MJSA 3K0SA 3LLMA 3ZWKA 2EL9A 4TWZA 3ORHA 1TRKA 1DUSA 4JLSA 1CIVA 1DIBA 4B0OA 4F56A 1E2JA 4MR8A 4O33A 3NYQA 4PX5A 5HZGA 5GJBA 3AHDA 3NDJA 1H5QA 1K63A 2WBLC 2D5IA 1SKBA 3A70A 1Z3CA 4BUZA 1PNTA 1ZIYA 1AKVA 1MTOA 3WMGA 2YMPA 2JFZA 5EXTA 2GXQA 1K5PA 1KYXA 3WLHA 2INGX 4MRRA 1MKYA 1FSFA 1U7PA 3D3WB 1O89A 2D1TA 1GQOA 1D0VA 4MPDA 3WHPA 4XD7A 3WGIA 2HCFA 5CVCA 3TTWA 4ZO6A 4KN8A 4O4HF 2JD1A 4MS4B 3LOQA 1ZVJA 3GJRA 3A4VA 3HSKA 2ZU6A 2C5LA 4YPFA 2YV2A 1XA4A 4YAJA 5CB4A 2R00A 1IMOA 4LYJA 1H9BA 4ZYUA 1YBHA 1YDWA 4OO3A 2PJDA 3S1LA 1FBNA 3LVRE 3WRWA 2G76A 1GZ5A 3AX6A 1IOLA 3O9VA 4ZOQI 1TU0A 1IMJA 3O7MA 3SF8A 1N4DA 3BJZA 4HUTA 2BMEA 4YY3B 4ND4A 5JSYA 3SHWA 5SZJA 4PO9A 4WJZA 1KGDA 1E0JA 2HIHA 1S1MA 2Q5FA 3MCUA 5A4DA 3KZVA 1T0HB 2B1GA 1ESEA 5ELMA 2R85A 3RJZA 4A2CA 4B81A 4QWMA 5HRAA 4HB0A 5A3QA 1XEWX 3C4JA 1A5ZA 4IG9A 1U9CA 1KXZA 3HA7A 5IKMA 2HPHA 5JSZB 2O8EB 3EMKA 1K5HA 4CFZA 3RF6A 5L95A 4CCSA 2NAPA 3BRSA 2BEUB 3G59A 4L76A 1O96A 1K6MA 3AT1A 1BROA 2NO7A 4UMDA 3LAWA 1EM8A 5AVKA 2MJLA 1SY7A 3L0BA 2ZETA 2COEA 3BJEA 1TO6A 3C7TA 2WMNB 3DVAB 3WGLA 4NK4A 3A37A 1PG5A 3P5SA 1QO9A 3BVPA 4MYTA 5A2GA 1OX4A 3KJNA 1Z37A 1A5TA 2HJWA 4KFUA 1Z15A 3IT3A 4PF1A 5THXA 5L4SA 1A72A 2CCJA 2QLFA 4IVNA 3ADBA 4X66B 2GPJA 2C3OA 2VK1A 2HLNA 3H4IA 3PGA1 4GDFA 1X7WA 4XSGA 2HTEA 1EGHA 1DBPA 4X1IA 2X9LA 1R0LA 2VT3A 3HR8A 5HG0A 1LDYA 2Q2QA 2X2EA 3DHVA 1CD5A 1XRQA 2GD6A 1ZD9A 2CF6A 4I36A 4JX9A 4MINA 4YQEA 2PR7A 5HHTA 3DLHA 3LIIA 2B2XA 4LXTA 4TXJA 1KDYA 1DEOA 4HGRA 3FYHA 3HABA 2BFDA 2PQ6A 3WRVA 3HN6A 4EDFA 2FPKA 2HMYB 4MQ6A 3JWJA 5D3KA 5CTJA 1N8KA 1XELA 3U4MA 4GL4A 1RRCA 1J7JA 1OKKA 3USES 3OWHA 3VHXB 1U3VA 1W1WA 3ONWA 4J90A 4UTXA 4RDXA 4F46A 5BSMA 4FYHA 3HVIA 2ODTX 1QGZA 1EJ0A 3NV9A 4JI0B 4XVRA 4I55F 4CM7A 4NEQA 1PFYA 1ISMA 5ITSA 5LLDA 4MHTA 2ZI4A 2VSOA 1A71A 3S44A 2I6QA 2ZJFA 1BFUA 2QMYA 3NM6B 1CERA 4QPJC 2C4VA 3TMKA 2IOHA 2RFLA 1QFMA 1JZQA 5AUNB 1GL3A 2G5CA 3QV2A 1IJFA 2JFGA 4F3CA 1SBQA 4DEVA 5IF9A 2Y1XA 2QP3A 5I7AA 3WQRA 1MORA 1GPWB 5EHIA 3SJAA 4DKXA 2Q9UA 3TZ6A 2YIJA 3T54A 3KT6A 3IT2A 5B1YA 2LBPA 2JIZA 2W6JD 4CM9D 3U5ZB 1KJQA 2P9QA 3V1TC 2JJ8A 1KYTA 2DAPA 2PWAA 3EFBA 3KJGA 5BWBA 1U63A 3L8ZA 1QHFA 1BH6A 3DJFA 5I4CA 3UENA 4B46A 2CNOA 1ZBQA 1UBNA 3V8QA 1SK9A 4L73A 4P92A 4QRHA 1VECA 4OUDA 1P4JA 2QOEA 3C8DA 1XYGA 2I66A 1J2YA 1G2PA 2OORC 4G6ZA 1AKNA 2GHRA 4GR9A 4L8LA 3DMPA 4R68A 4WINA 1GAWA 1WA5A 2WIKA 3IJEB 1WW8A 1OC4A 2ZFUA 4Y67A 1V39A 2UV8A 3R9WA 1GG5A 2C3PA 3LECA 3QPVA 4V39A 4I1VA 4WMLA 1K6EA 1T5OA 3TW0A 4N76A 2GDZA 1BFKA 2MT9A 3AIIA 5U9CA 2E48A 3P9QA 4MP8A 5TPWA 1C7FA 5BMVB 5K0GA 1FNBA 2JA1A 3R7NA 3TIFA 1N57A 2X4GA 1WCYA 3K92A 1RHUA 3OBBA 4E1AA 2VHQA 1GPJA 2RGBA 4MLDA 1E59A 4EHDA 5C53B 2E5WA 1S8NA 2O0MA 5DF1A 4PBRA 1VHLA 1G59A 3ES9A 1QMGA 3O38A 3R3XA 1F0YA 5CDFA 4XX0B 1OR8A 1A4IA 3WYFA 3ZNQA 3ZQJA 1JJAA 2GETA 3HXOA 1GXSB 2JI8A 3E9QA 3GJXC 1CZOA 1SC3A 1YDGA 3PFFA 3BFKA 1AUPA 4N3NA 1BXGB 2NO0A 2OFFA 5I3ZA 5LD2B 4LJ4A 2PUBA 2GK4A 2JZNA 1UEXC 1X1BA 2Y2VA 3I9KA 4I9FA 3QKSA 1MQSA 4Y6GB 3QYPA 2ZUWA 1BCSB 4CU5A 4ADSG 3SNHA 4BXOB 4LE0A 4Y2PA 2P90A 2XTAA 3WADA 4GS5A 3TVDA 2FPOA 4EJSC 2YJTD 2QLMA 1CVRA 1ESDA 2X2PA 3OLWA 1EGVB 3OU2A 4IMIB 2NVUB 2QLBA 3D4IA 2P9JA 2ZIFA 4IRUB 4TKVA 4Q4AA 2VQFB 3FMIA 1ORHA 4U63A 2O5CA 2QN8A 1AT1A 3GVPA 2ZJZA 3QFRA 1Z8FA 2WKRA 2K5UA 2FR0A 3A7EA 1FP7A 2YRFA 4D8VA 1I3CA 2ZE7A 4RFSB 1VP3A 2Q8NA 4AJ1A 4O4LA 1C7EA 2ZIEA 4FDAA 2W42A 3FD8A 1L7NA 1QIEA 3A32A 3IVMA 4IF6A 4OQMA 3ODGA 4O0MA 1G9SA 4Q3CA 5KJFA 2YZKA 4RTRA 1OBCA 3KVVA 2A67A 2GAIA 4KQFA 4I4NA 1YS1X 2VJOA 2VXCA 1WMAA 3SD7A 3SI7A 2R3SA 1R3UA 1E64A 1TM2A 4UQPA 4K81B 5MN4A 3WLTA 2PPVA 3JS5A 1BKSB 2OAGA 2BF4A 3IOMA 4RA6B 5CU7A 5HKLA 3JAWB 4DXDA 4WXMA 3W2GA 5F5XA 3PWTA 5TGTA 5HRUA 2O0JA 3B1YA 2CKMA 4IJUA 2A59A 2CUTA 2EZ8A 3DMRA 2WIAA 4B3FX 4LPSA 2OXRA 3L49A 1FP1D 1DKRA 2QDXA 3J80A 1M54A 1U5BB 3DV0B 2YV1A 1ST2A 2QMZA 3E05A 1FSSA 2EW8A 3A2LA 3C45A 3MCZA 1PGOA 1UT8A 2BEJA 3KIPA 1YB1A 1BKYA 5EG5A 1IY2A 2YQ5A 3PUJA 4N12A 2P3SA 4V24A 5FCDA 4BLTA 4W5OA 1FW6A 2D7CA 4ZJUA 3F5FA 1J06A 3P1JA 4ND5A 1E3TA 5DXAA 1Z0AA 2NXCA 3B1JA 2GN4A 4FLEA 4WTOA 4X1OA 3WDSA 4HDSA 1VBKA 1WXQA 2NZXA 4HQLA 2MYTA 5AKXA 5BN4A 3A14A 3P0JA 2FUNB 5C5CA 3BXXA 1Y82A 2C57A 2A3RA 4L7VA 3A1EA 2GVNA 3IULA 2PU5A 4IJVA 4UAGA 2AOWA 1QRDA 3BMOA 4TUYF 2JAHA 4UTZA 4Y2TA 1QTNA 3W3ZB 1MW8X 4PFKA 4ZC1A 3D81A 4R2HA 3HK2A 2SHKA 3FHJA 4GI1A 4XA8A 5JDCC 1QQBA 3HBFA 1ISFA 1KK3A 4X7BA 3M6WA 2R60A 3RHTA 3AJEA 1RRPA 3I72A 4ZCSA 2R7NA 5JEDA 4DDMA 5TPZA 1A9SA 3M8KA 1CVLA 4Z7OB 3LQ2A 3VC7A 1C4OA 1GGHA 1BCRB 1UR5A 1NBWB 1MVNA 4U7HA 3V4SA 3NDIA 1KTIA 4OI4A 5LR6A 3TE6A 3JD1A 1PAUA 1SQFA 3I61A 1V5IA 1J8DA 2I1LA 3HUTA 2PGOA 2IHKA 5E2BA 4RJJA 4L15A 5JS6A 4BKQA 3TL3A 1U1EA 3ZGOA 1TM4E 1WU7A 4ARVA 3GLGA 1D9ZA 5I01A 1TKRA 1R5BA 1ETUA 2FKAA 3F9IA 1NZFA 2Q6IA 3K0BA 4GAEA 4OXYA 5C8VA 1W93A 3B2EA 3BWVA 1AZWA 3G2QA 3IHWA 1KA9H 1HE1C 1UQTA 2M6SA 4TKZA 5IJAA 5EJ4A 5JWOA 4BEBA 2F9LA 2MSCB 1SJ9A 1U3CA 1W87A 2XI4A 4P98A 1KGSA 2HSGA 2I6SA 4OJTA 4QGBA 1N3IA 4FBGA 1GCUA 1NRWA 1XFDA 1Z5PA 3KU4A 2WWIA 4J49A 4WBNA 2PX4A 3MYRA 4NCJA 2HCJB 4QNNA 1XZFA 2FK7A 1BA3A 1AUVA 3W9UA 4RVGA 4Y2HA 3O4JA 2VAPA 2VP9A 3BAFA 1KZ7B 3QLTA 1E9EA 5CFOA 4G4SO 1UKYA 3E3LA 3TZHA 3BGDA 4JWTA 1GADO 2C1XA 3K0KA 4QBTA 1L1FA 4DA6A 2AE1A 3AESB 2RB5A 4TYWA 2I03A 2QYOA 4KBFA 1CFJA 1EX1A 2O07A 2XHZA 2Z09A 3TR6A 4NV1A 5HFJA 5CFMA 2OLEA 4FCVA 4KQMA 4ZEVA 1M2JA 4M54A 3WB1A 4DOMA 1U7WA 1RVDA 8MHTA 3K6RA 4G23A 4FDTA 2WV9A 4ZDWA 1JJVA 2O7VA 2QYSA 2WWRA 3MQFA 5A4FS 1XDBA 2BKLA 1U81A 4HV4A 7MHTA 3KQWA 2PMCA 3QY9A 4EJMA 2K7ZA 2G1PA 1RTTA 2AMYA 1PQUA 3QKRB 1E63A 2IYUA 1BS1A 3KCQA 3TX2A 1QVAA 2IKQA 1DDIA 4GPEA 5E1DA 3LUGA 3WIVA 3GFGA 3PXDA 4UU8A 1KKMA 4DLWA 4AT1A