2KHZA

Solution structure of rcl
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
163
structure length
163
Chain Sequence
b'MAASGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAGGDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAVALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKTASSSHPSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords c-Myc-responsive protein Rcl
molecule tags Nuclear protein
source organism Rattus norvegicus
publication title Solution structure of RCL, a novel 2'-deoxyribonucleoside 5'-monophosphate N-glycosidase
pubmed doi rcsb
total genus 31
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2khzA00
3O8OA 5ITSA 4JENA 1F8XA 4JELA 1MTOA 2PMBA 3O8OB 3F5MA 3GH1A 4RH3A 4WL0A 4NPAA 3OPYA 1S2GA 1S2LA 5AJTA 3EHDA 4I4IA 4MEJA 2Q4OA 3MAJA 4P5EA 2F2TA 3PFKA 6PFKA 2Q4DA 4KXNA 4KXLA 2IZ5A 3U39A 2F64A 4OHBA 1ZXXA 3BQ9A 1S2DA 2F67A 4HX9A 2A33A 1F8YA 2IZ7A 1KZHA 4P5DA 4PFKA 1S3FA 2KLHA 4FYHA 1YDHA 3IMKA 1WEHA 2KHZA 4OHRA 1PFKA 4JEMA 1RCUA 2PFKA 3O8LA 1S2IA 4I7EA 2F62A 3QUAA 1WEKA 3HNOA 4LJLA 2NX2A 2HIGA 3O8NA 4I36A 4FYIA 4A3SA 4LJRA 3SBXA 4FYKA 4U1RA 4MCJA 3UQZA 4KXMA 3OPYB 2F48A 2A0KA 4LJKA 1T35A 5AJUA 3K2QA 2IZ6A
chains in the Genus database with same CATH superfamily
1K3FA 1JV2B 4CEHB 1RVDA 1E69A 4PRZA 4O1HA 1I30A 1XRRA 1T8YA 3BWEA 3A6KA 3R4VA 4MWDA 3CC8A 3PX7A 2RHJA 3GMDA 4BNIA 4HAYA 4IHKA 3Q15C 2HAEA 4QXRA 5CVUA 5JV5A 3OC6A 2IS1A 4P2GA 4PIPA 4RDXA 1UBSB 2HU2A 1OV4A 2AN9A 2IV2X 4KR9A 5IM4A 4N40A 3SM3A 4RKRA 3B8HA 1N3LA 3LAWA 1GPUA 2NLOA 5HSGA 5IKEA 1CUUA 5FTMA 5HZGA 3I5UA 5K8CA 4Q4HA 4DCJA 4D0GA 1DKNA 2QTTA 3R9IA 1EWVA 2Y71A 2NO4A 2DH5A 3K1TA 4P5EA 5EJFA 5JDCC 1IY2A 2VT6A 4PG8A 4YMTA 4Y6QA 4P4SA 5LLDA 1G21B 4NMLA 4ARZA 2YQ5A 4WNAA 3RBXA 3PJGA 5AM3A 1UC8A 5LQMA 5I4KA 2GEFA 5L3QA 2R7LA 3OZWA 1XRMA 1R0BA 4CR7A 2B82A 3L84A 4DC9A 3GJTA 4JJZA 1F8UA 2X8BA 3A6HA 1ISFA 4IJ6A 3U7QA 1WPRA 2H5JA 5BW6B 3SHWA 2DQZA 4BKMA 1KPIA 4BWGA 5I4CA 4HEA1 1ZUWA 5C4GB 1SD2A 1OGYA 2HWKA 1F2UA 1T6BY 2QN1A 1IRXA 1WUIS 5LB2A 1JEQB 4ESHA 1WUTA 2ETXA 2IK8A 4ZEWA 3WO1A 3WKEA 3N87A 1V26A 3D64A 1IN8A 2HPZA 4UBLA 2XYGA 4KWHA 5AJHA 1HY3A 3LSYA 1C0EA 1MH1A 2CB9A 3B3AA 3IE0A 1NXOA 3TO5A 4D81A 3IKTA 4JXXA 5HDQA 1J09A 3AIIA 1MX1A 1Z8HA 2VF8A 1BEZA 4Q3OA 3K70C 3HGMA 4N0PA 5E9WA 1T4DA 2EEPA 3T7KA 4BZWA 3NT4A 1M73E 3OQBA 5E4JA 1RAGA 4ZOBA 2EJWA 2SNIE 3EQ2A 3NOOA 3JQEA 1GO2A 2EFHB 4E5DA 2UZAA 3QOFA 4IIJF 3TINA 3IILA 3MNFA 5JSKA 1AQ6A 3KOYA 8GPBA 1KQNA 5A4MS 4XUCA 1T6XA 2QD3A 3IHLA 2EX4A 3KYBA 1IWBB 4E4RA 3M4ZA 2Q0XA 3HCCA 4P98A 1HZZA 3SQLA 4ZTZB 4V0QA 4PU0A 3H0EA 2EQ5A 4RBNA 3F71A 5AM5A 3DZBA 4LYJA 5MGBA 3DJYA 2O1XA 1HYEA 4DV5B 2XE7A 3PG5A 4EEXA 4CU2A 1TE2A 2BDUA 3IFSA 4OEHA 3T5CA 4GVPA 3QNUA 5EWMB 5FFNA 4BYGA 1MB2A 4URUR 5A9SB 1R9JA 3F1LA 4TM7A 4F2GA 1VBFA 3VR5A 3I2HA 5JNUA 3VX4A 3LLMA 2E4AA 5F12A 3PJEA 1KQFA 2PKXA 4YYZA 3CSSA 2JLUA 3C7KA 1F3LA 1SC4A 1O8BA 3MWDA 3G85A 4ID3A 4KOAA 4Q4JA 3MPOA 4ES6A 3Q10A 1HSZA 3OH8A 1M1ZA 4MI6A 1US8B 4Q66C 5AKGA 1A1VA 3M5CA 1CULC 1M1UA 2HA4A 3R5HA 1Z0AA 4LW8A 1YFLA 2BF4A 1ZOIA 4RA9B 5EQJB 2GJSA 2VSOA 4TTPA 3R7LA 3U4GA 4EYSA 2X5NA 3TAHA 3EYWA 1K3UB 1R4MB 4YV7A 5L8VA 4J1QA 3V32A 2ZIXB 4UM9B 4HH4A 1L7VC 1CBUA 5C8YA 5I9IA 1QDUA 2FMIA 3SU8A 3TTUA 1JJIA 2HJSA 4F56A 1G64A 1RAFA 4FMDB 3KKZA 1U0FA 2YY6A 2C00A 3R77A 1U9CA 4MAMA 4RQTA 4EG6A 1M3SA 2RHLA 3L3BA 4IR7A 5JD6A 5K6AC 3JU3A 1W4LA 4FDVA 4UMDA 4HN9A 4JUAA 1TM3E 3O26A 1SZDA 1H4TA 4UDOA 4MEAA 5AOCA 2WJAA 3H1GA 3OZSA 1HLPA 2XI4A 4G01B 3RFFA 3LMKA 3MHTA 1NRXA 5DGXA 2GN2A 4N8SA 1KEUA 2WNIA 3VYVA 2HD4A 1COZA 4NU8X 1PV2A 5D1NA 5JCXA 5I7UA 1RQPA 2EZUA 4QXMA 4X3CA 1K68A 3RW9A 4BKQA 4D0SA 2WKRA 4BFZA 3AILA 1HTTA 3AINA 2IU4A 3L0ZA 5BN5B 1VXRA 1OMOA 3BICA 2OXIA 1LU9A 4C7JA 4YECA 3WGQA 4MIYA 4WLUA 5J2UA 4BEWA 2RAVA 3BWDD 2J3HA 3Q7TA 1ZHHA 2IYQA 3C3AA 3BIFA 3I42A 3AJEA 1KZ9A 2WM3A 2O2IA 5LBIA 3UK6A 2HF9A 1WVMA 3D8TA 2RH5A 1K97A 3IP8A 3RNLA 4EYEA 4D56A 4EYOA 4G0NA 2HLHA 3JD4A 1KAMA 1N2XA 2PTHA 2PGNA 2D59A 4I5DA 1NG1A 1UP6A 2JLSA 4K05A 3CX8A 4TWBA 4DDTA 1BRMA 1ADCA 4M8IA 4PFKA 5JQWA 3GZ4A 4G1VA 1QE5A 3ANMA 3F98A 4BB6A 1ZR2A 1RMYA 4IWXA 2C82A 1M2HA 4EHLA 5BOSB 5I9BA 2B8WA 3PEEA 5E7JA 2H4ZA 4IUYA 4FOSA 4XFKA 4B3GA 2H1VA 2P4SA 1WBJB 3GVIA 3GLHB 2ICAA 1ECCA 2VFAA 4LY6A 2BC9A 5C80A 2FMHA 4RXMA 3CBGA 3T1HB 1WBBA 3OU7A 4LFBB 2C9ZA 1X1AA 2VJDA 1UMDB 3SZRA 4A8JC 5DN6D 1OWNA 2BTOA 1SXJA 2ID4A 4XTRA 1WDTA 3CNBA 1EVLA 3EXG2 1LJ8A 3D7LA 3IQZA 4UTOA 1PGJA 5L7WA 1RPAA 2DFNA 1VJTA 4JVOA 4CIVA 2E49A 3EDOA 3K2BA 2Y76A 2CKMA 3HNOA 3OQJA 4Y9SA 4II3A 5KSYA 3LBNA 1KGDA 3OT5A 5JR3A 5FL7A 3GJ0A 4L2IA 2QTGA 3TTWA 3QFRA 4ZJUA 1Q0TA 3GVXA 3K15A 3LLCA 3TM4A 4XM2A 2B61A 3KR0A 3OE7D 3KQNA 1OB5A 4FYIA 2BM9A 3B1WA 2ZTMA 1VCMA 4OSEA 4GGMX 2WFAA 1Y5RA 3DO5A 2TS1A 5CD9A 1GY8A 3R7FA 2GSDA 1ZDMA 3S40A 1XKLA 3SDSA 3DG9A 3TEFA 2QTZA 3X1DA 1K3TA 3EC2A 3V4SA 1UXOA 1IWPB 4HHEA 1HOTA 3FYSA 4UZEA 1DC7A 3P7MA 3ENNA 3EOAI 2QX4A 1FMJA 3A32A 3C6MA 1VHDA 2JJ1D 1VP9A 1AURA 1KJQA 2QQGA 3PQ4A 4EH1A 1ECJA 2R6HA 2IQ5A 2Q0QA 4F85A 1M1YE 2GKOA 2EGHA 2XB6A 3A10A 4N5DA 4IDFA 4U6NA 4MQ4A 5IKXA 5KYKA 4GZ6A 4MRPA 3KSMA 4G41A 3W5JA 3BH0A 1W47A 13PKA 3P4UA 3CRVA 1TCCA 1XMQB 3GGJA 5K5EA 3IDAA 1C3OA 1E9AA 1SVNA 1GZDA 1Y34E 4K88A 2YV5A 3N3BC 2O3JA 4DV7B 3JD2A 5DCLA 3WLLA 2QD5A 5DWDA 2XZDA 4O4LA 4FMCB 5F77A 1UAAA 3BSFA 2GZRA 1X6VA 1MAVA 4FHCA 1IM2A 2HSGA 4G67A 4I4IA 1F06A 4P08A 4ZQGA 5FP0A 4QOSA 4Y2GA 4BXOA 1C7FA 4C3VA 2ZWVA 2BZGA 4QFMA 3AUTA 4Z4QA 4B79A 3EVZA 2GOYA 3G1UA 3NATA 2WU1A 2II6A 3CCCA 4C03A 4F6RB 5ES4B 4MLCA 4JLUA 3HNPA 1KO4A 2BN4A 1OI4A 3NIFB 2IHNA 5JCPA 2IP2A 2GSWA 4IS2A 1XQ1A 4UXJA 5EJAA 2F1KA 4R3UC 1XJ0A 4X66B 3FPJA 1GPMA 3IBCA 3UKDA 1EB8A 1T0PA 3AVOA 3KHKA 2OT3B 1G5RA 3FZEA 3LDHA 1RTTA 2GHQA 5LU8A 3K71B 4G4GA 3ZHZA 1RRGA 3FGOA 5ELLA 3ZIAD 3AVTA 3H84A 4MCAA 5L7TA 4Q6BA 4XJTA 1MQAA 3NGMA 2J48A 2I54A 3JQRA 5IT4A 2D8MA 4CI0B 3GB9A 4OLFA 1RXCA 4CKEA 4RJTA 1E3MA 5D3KA 3H5IA 3WG9A 1XU7A 4GMGA 5IULC 2K7FA 2YVQA 1RT9A 3F6PA 3F3MA 5G2OA 2NUTA 3U49A 1M8GA 3QU2A 4FJ2A 5B58T 4HT3B 4LF4B 2IODA 3DCJA 5JJBA 2R96A 2G8NA 1QBGA 4BNMA 3ML1A 3GLHA 1KEPA 3A4IA 3FUXA 5C7LO 4UHHA 4CDGA 2GK3A 3HVHA 4PPFA 2IYTA 3GVPA 4CKBB 4DWWA 1HNXB 3WLKX 3BHNA 1R4MA 3G7NA 1J8YF 3H7AA 3I01M 4D6YA 5I6DA 6REQB 1B3BA 2VDKB 2WY2D 5DM2A 5JH7B 3KG2A 2WOJA 3OTHA 3VPXA 3WYCA 5D3MB 5K3DA 3I9V6 5JWRA 3BORA 4P3XA 4DJTA 3CRZA 2B4RO 2J4DA 3EF3A 3M83A 4UCFA 1WTCA 5AKXA 1YJQA 4WVFA 2QD2A 3GIDA 5BMVF 1Z8NA 3D2LA 3IQFA 2R44A 5JFTA 1IOLA 3ZLVA 3QOXA 1G9SA 2LKCA 1J5PA 3T61A 4YAOA 4HWTA 3NUGA 1XJQA 4C7KA 1NBMD 3ROGA 2D0DA 2OCAA 3V4RA 1YB5A 3TOZA 2XMQA 4BJ5A 2LV8A 3EIQA 4LRTB 1QYCA 3ASYA 3SN6A 2JIZD 1Z2CA 1R18A 4X1YB 4MGKR 1GSOA 1RWWA 2PSFA 4IIBA 4PE5B 4AMVA 5DM70 3RIYA 5BYBA 4GW3A 1GPDG 2A7QA 3OA2A 4MS4A 1G3UA 4GLBA 1NT2A 4A8TA 2ZAIA 3DZ8A 4LXHA 3X1ZA 3L9WA 5JPCA 2ZJYA 1Q0SA 4NL4H 2HHLA 4AJEA 3WGKA 3LPCA 4FDMA 1JLLA 1GPJA 1YKSA 2ZTVA 1YBAA 4UARA 1VLLA 4BJ6A 4OJMX 2GD2A 2WMDA 2ZSBA 1C9MA 1HZJA 1I0LA 2OBNA 1HE5A 4UZFA 1Z2AA 1I9CA 2VXOA 4BVFA 1J8VA 2R1TB 4FX2A 4MKXA 3OPYA 3I72A 5FTKA 1FNMA 1AY0A 3H3FA 4MTLA 3ITEA 4IIEA 1YR6A 4O4LF 3T7IA 4U7JA 3UFBA 4BGIA 5IWAB 1DG3A 1MDFA 4G24A 1Y1LA 4YVFA 2C57A 1MOQA 3MAJA 3WBJA 2ZYGA 2QBYB 3EFHA 3OBBA 2PZGA 3OOYA 3VPAA 4CL3A 3I83A 4CMCA 2IDZA 4Z2AA 3BFJA 1T36B 2E21A 3DVRX 2VPQA 5CFZA 5DM0A 1VMKA 2QMEA 5CTJA 1W0KD 4ND8B 1WUKS 1Y8RB 5C1PA 4QM6A 3W3AA 2DOKA 5CYGA 5BR1A 3ZXXA 4CL8A 1VQ1A 4DKJA 5B37A 1E6UA 2OZEA 4LRWA 5KO2A 2AYXA 2PEYA 1OBFO 2ONYA 1Z0DA 1RJGA 4TT3D 1X92A 2GEKA 4D3SA 3G17A 5AVZA 4AM8A 3FVWA 1N6KA 5SY6A 1C1YA 2A1TR 2CE2X 5CG2A 5FWDA 3TTXA 4BJ3A 3DONA 3GFBA 3ZJ4A 3KP1A 2J0UB 1R0LA 4B3FX 2CXHA 3D9QX 4OXKA 3RJZA 1GKKA 1JT9A 1P1FA 4IFBA 5C0OE 3RJ9A 2R0QC 1BDJA 2WJWA 2VP9A 2BFDA 1CUEA 5BSHA 2BUAA 4R8KA 1TU0A 2POQX 3C3EA 4LVUA 4URWR 1XTIA 1GCGA 4O4HB 1KO7A 2Q5HA 1YOBA 4Y6OA 5EYPB 2Q1XA 2RBKA 4COOA 2F9FA 1KAEA 3D2AA 4QVIA 3GT4A 3U0VA 3VDRA 3CKYA 1Y1QA 4IGAA 1G7RA 4JKOA 3TLYA 3QVXA 3EIHA 3OX1A 5FUMA 2RGRA 4YMGA 1S9HA 3FTEA 1KQPA 2NAPA 3I1YA 4ZO6A 3TH5A 4G6ZA 2Q5IA 3ZE8A 5E2IA 1ZITA 5LDGA 2E1RA 3L1VA 4DMRA 1FYEA 3BTSA 3OJ0A 4S1OA 2DKFA 3O74A 2JIQA 2P35A 4M1MA 4XWGA 8MHTA 2J0EA 1BGXT 5C5EA 5F3DA 2XZPA 3NM5A 1CERA 1XTVA 2FVYA 3P32A 3GMIA 4OGWA 2FQ1A 1NTOA 2XVYA 3OOEA 2EW1A 3WLFA 1G66A 1XGKA 1ZONA 2JAHA 3DMTA 1XP8A 3TG2A 1JHDA 3SIXA 1XAHA 2VEOA 1SHUX 2FXVA 2OB1A 1W73A 3PL5A 4IXDA 1PJQA 3VMMA 1LSUA 3BGWA 4XIGS 2V96A 4RULA 1FW6A 1V16A 5FFMA 5G1NA 1K6MA 2A3RA 3FMGA 4AUEA 1U8AA 3EJ6A 4AZ0A 2JFWA 2VH5R 3GHHA 3OSZA 4EY4A 3NRCA 1F20A 5A7FA 1TAHA 1IG3A 3LDAA 3FJOA 2DLDA 2DR0A 1PP4A 4LZWA 3HJHA 2FPSA 2DHQA 3FSGA 1O5IA 5DTQA 3UA3A 4ZO4A 4DFDA 5AKLA 4LDAA 4EX7A 2YYSA 1OH7A 3I23A 3I8XA 4QU5A 2Z6AA 1GZ7A 2D2EA 4IXNA 3ZK9A 4WLFA 2W70A 4CNQA 4FFDA 2B5OA 3BQMB 1SCJA 2PMBA 3CLRC 3KXIA 5HS4A 1SRRA 2ATCA 2JAWA 3A3KA 3DYBA 4P58A 5EN4A 1ZD1A 4A0GA 1KYYA 1IB0A 2J5XA 4EUNA 4YUWA 2QMUA 1XAGA 3IURA 4WLVA 3OX2A 4X9XA 3R74A 1XMIA 1YA6A 4M87A 1GVHA 4IV0A 3QPBA 3ZGXA 1RQLA 4HDRA 2Y4OA 2OAEA 4MS1B 4F06A 3UYLA 4TKZA 3W2FA 1XRPA 1ZM2A 3WLOA 2HHCA 5JZBA 3V7NA 4TXLA 2Z3VA 1GPH1 4RIFA 1VLVA 4AKSA 2F6RA 4PZCA 1L5HA 3F0TA 4CETA 1HDRA 4IVPA 3WTCA 2R5WA 3L92A 4B35A 4PZYA 1CTQA 4ZCTA 4QUGA 1XVLA 4ZFNA 3G2IA 4H77A 2PD6A 3D4PA 3K8ZA 2NVWA 1K06A 1KF0A 1FYVA 2H85A 4N3BA 1JXMA 5DULA 4H1TA 1LFDB 2IDMA 3QEJA 4M4SA 1QVWA 1ND6A 1OT3A 2XUFA 3DUWA 3LX4A 3DHEA 3EVGA 2WYVA 2BMAA 4IRMA 3BF7A 4NG4A 3VR6A 1RXWA 4C3UA 8AT1A 1FDVA 3L0DA 1EX6A 1TKRA 2RFLA 4MIEA 4O2LA 1DTEA 2CB0A 1WW3A 4HVTA 1AZWA 4QPCA 3J80A 1EH5A 1XL0A 4QWMA 4NEGA 3P9PA 4GC5A 1PFWA 1ZJZA 5KPJA 1NDHA 4RJIA 2H48A 4BMNA 2CHVA 2D5LA 2QT1A 6ABPA 3HYNA 1PE0A 1S4MA 1EQ2A 3O8DA 3WGNA 3QFSA 5JH7F 3URMA 1RTKA 3KUCA 4QXAA 5FTJA 2WVGA 1Q92A 1O1YA 5H4GA 4EG3A 1ISPA 3RT7A 1ODJA 4GE0A 4EOGA 2GRJA 4NP6A 1L2TA 2A5LA 2UAGA 3KJZA 5FL7D 4XYGA 1N5MA 1DC5A 3HKDA 1OTXA 3B1FA 1QZUA 3FH0A 4YMVA 5CFRA 3EGIA 3KWJA 4L73A 1CEEA 3D8RA 5DTMA 1GN8A 2RDMA 1L5YA 1WMEA 1O6CA 1T2DA 4S04A 2W6ZA 3DLCA 4NOJA 1SXJD 1ML4A 3T9CA 2UYCA 5EFOA 1PJRA 1JFSA 1IDN1 1G7TA 2AOVA 2PH5A 3HG7A 1ZMRA 2UUOA 3AU8A 4QTZA 3L7OA 4N5IX 3LQQA 1JA9A 3DMYA 4OBEA 3NJ8A 4LC0A 4QPDA 4CVNA 1NXVA 5IEJA 2OTCA 2FGKA 2YWXA 1S9DA 3LUKA 1Y4UA 3OEHD 2BSAA 5J5CA 3STWA 4Q4AA 5JXJA 1IJFA 4C7OB 4WOCA 5E6UB 4DBLC 1K5GA 1J90A 1KRHA 2WIKA 5H02A 3MXOA 2ZXUA 2OBBA 5JT1A 4D9IA 4NZ9A 5KMGA 3ROMA 5D8DA 3RRMA 1AHHA 2QL9A 3BMCB 1QRUA 2Z08A 1LDBA 4RF4A 3TB6A 1NF9A 2PKRA 2BHTA 2NZ8A 2NO9A 1S8AA 1EFAA 1U1GA 1WMDA 5LQAA 1W8IA 1NBWB 2ZRQA 4FBLA 3CNEA 2Q3DA 1HQYE 3AHDA 5HGXA 3TQRA 1EXWA 1Q6ZA 2Q2NA 4E1AA 4UFNA 4XASA 4B40A 2JVJA 1ETHA 4JI5B 5HCUA 4HPWA 3NM6B 4PG4A 2ZCVA 4ZAZA 4DLPA 4D92A 1ZMTA 4K6OA 4KN6A 3DBHB 3PGA1 1XKQA 3OU2A 5CBPA 1YAHA 2C2MA 3ITNA 4EYQA 1IC6A 1ADFA 1C9NA 1ESDA 4R2MA 3E5NA 1UMCB 5TXGA 3VXKA 3AIOA 2ZYIA 1L5SA 1RHUA 2HCTA 2MJLA 4OBBA 2HLPA 4QU0A 1QDEA 3MC1A 1OB2A 3S0JA 5CFQA 1UK9A 5LCXA 3GRYA 2V58A 3MUNA 3EXIB 2G9NA 4UAVA 1PWZA 2C7RA 1B8OA 1Z83A 2BFNA 2ZQ5A 2P5TB 1YU9A 3NVDA 4PANA 5DVZA 2P91A 1GG5A 3M6MD 3CZCA 4JYZA 1AN9A 4Z99A 4BMCA 4D26A 5KWIA 1N5JA 1WHSA 5J2TF 3RTCA 4CYMA 4ZVPA 4FNAA 4P7JA 2NM0A 5K03A 3UUWA 1IJEA 3CPJB 2NTVA 5JOQA 3I12A 2VBFA 4W5WA 4FX5A 2P9EA 1KJ9A 1KSGA 3W3ZB 2EFJA 5BPHA 1FLVA 3WB0A 1JTFA 1K8RA 4DUGD 1S02A 1JLSA 1W85A 3ZJVA 2B0JA 2JCGA 1AJEA 1EJBA 2QZ4A 1T5BA 1SPXA 1ZN7A 3DAFA 2QGNA 3HUDA 4YCSA 2Z6VA 4KPUB 4WY8A 5F1PA 2PQ0A 4C21A 1LV7A 1U7ZA 4C3OB 5CBPB 2F8MA 5G0SA 3DDUA 1IEWA 1SR8A 5ABPA 1PJCA 4LAFA 3VI4B 3ZIAA 1W0KA 1FX0B 2XMZA 3RVOA 2PS3A 2WYIA 4U7DA 4O5OA 4LF8B 1WXHA 3UJHA 1ZK3A 2EJVA 1V95A 1Z5WA 4PC2A 4Q16A 4WKOA 4HN4B 4ONEA 4UNIA 1NC3A 2BEUB 2ZG6A 2WD9A 5DYWA 4NCHA 1SQGA 1T15A 1WB4A 2IT1A 3AEUB 3O82A 3M6WA 1Y63A 3GJ5A 2HWUA 5HTKA 3PCXA 1JR3D 2HQOA 4NCIA 2QB5A 1XCGB 5ETJA 3U40A 3WZLA 4CFYA 5CB4B 1RPZA 2JIBA 5B3JA 1S01A 2JKZA 4KQKA 1JDNA 1NF8A 4MV0A 4BMYA 1P3JA 5BSEA 2AFHE 4UJ3A 1GV1A 1RYMA 4ZCSA 4AQ7A 5F35A 1I7NA 3KT0A 2PBLA 2IQIA 3N6RA 2WB2A 1GILA 5SYNA 2R4UA 4XX1A 3QU5A 4YPVA 4FFNA 1B3RA 3WV5A 3HCAA 2R47A 1JHVA 1LSSA 1HQKA 4R6WA 3KB8A 1KJJA 1OC2A 1MFZA 1XTQA 1YR9A 3AETB 3ZJ5A 4B6PA 2DJ5A 2MDTA 3USZA 4DCGA 1YZUA 2OQIA 5BWOA 3G7SA 4R2WA 2ECOA 4I4TA 3SXPA 5I3CA 4B33A 1X3SA 5EKXA 1LW6E 3LCMA 4RIHA 2NVUA 4G63A 4OB6A 1BROA 3KC2A 1MPTA 1WZ2A 3C41J 4AWXA 1H9AA 1AKNA 1V6AA 4XM1A 5KDOA 4PZAA 1T3GA 1ZICA 5B4TA 3T38A 4TUYB 5K0EA 2OMKA 3IERA 4YT4A 3D5TA 4V0SA 4G9EA 3OZRA 2HTEA 1ML3A 2PX3A 4BGVA 3B78A 2CGEA 1ULAA 2ZBGA 3D3QA 3PICA 2WW8A 3AFGA 1NW8A 2R87A 2FW9A 3PFGA 1P0IA 2CVFA 3AV3A 3HKBA 3KWMA 3KOOA 3ISTA 3PKIA 4GP9A 1HE1C 2FG5A 2HA7A 1PJ2A 2W48A 4OU5A 2H63A 1KEWA 4NNPA 4TV9B 4CRWB 1W93A 3HM2A 5KDDA 1JJBA 3KOXA 3BWYA 1C0KA 5DYGA 3I92A 4IKEA 4IUCS 4OQ4A 2CXOA 4L50A 3ENVA 2FFQA 2R3SA 3X0DA 3DAYA 2QT9A 1V4BA 5EQTA 4DYVA 1UM9B 4NPAA 5HIAA 1V39A 1XNGA 5ALDA 3ER8A 3D7MA 4NYMQ 5FPYA 3WL3A 1NURA 1H0HA 2CNLA 1UBTS 2CLDX 4Z7NB 1BE8A 3HKEB 5AHKA 3ZXYA 2XHEA 3MZ0A 3NWJA 4JI2B 2LIVA 1ST2A 1XZAA 2ZVQX 3PGMA 4GMXA 5MFPA 2YHIB 3AKDA 2HO5A 2C58A 4OH1A 3U39A 5B7GA 1V71A 4B7ZA 4ISBA 2YJZA 2VRWA 4KAXA 3X1WA 1FQOA 3M6XA 1BG6A 1FDWA 1WDMA 2GNOA 3LKVA 5J5AA 3V8PA 4B17A 2WIJA 3I09A 2HBYA 3A6FA 4PQFA 1K2WA 5FBLB 4V1CA 4K6CA 1S2NA 3A1WA 2V65A 2VBCA 3DMRA 1WHTA 3HACA 1X7XA 4FEEA 5F4BA 3WIDA 3UPUA 1LPMA 4LFAB 5KYNA 2QRMA 4WN3A 1NF3A 2FUNB 4MK4A 4RPCA 5H82A 1KMIY 3OHMA 2XQJA 3L0PA 3RU7A 2Q6TA 4EFLA 1SBZA 3VRHA 1QRSA 4AXXA 3KQYA 3C5HA 4EG0A 2QRGA 3QHQA 3R8FA 1HDIA 2CL6X 2C4MA 1ZRSA 4OK3A 5C81A 5AW6A 1ZRMA 1JP7A 2ZB2A 4CM3A 3RVDA 2G0AA 4HG2A 4BVLA 2VPIA 3FR7A 1D1PA 2X8JA 3DBOB 1WP4A 2F3PA 3FMOB 1IBCA 2Z8YA 4K9OA 5KHOC 3TDKA 2FHPA 3DMDA 2PYIA 2YC4C 1TU4A 2GT1A 3RVKA 4AZ0B 4OFWA 2XCUA 1GPBA 4PG7A 3W06A 2Q07A 4DA7A 3OQHA 4I55F 2ZKIA 1MAHA 3ESQA 3I9FA 4O02B 3UJDA 1LPPA 3LX8A 4QBFA 5LZ2A 2VQDA 1TW2A 2NUBA 2WWYA 4CN9A 3DOHA 3NP7A 2I4RA 1WF6A 1U0BB 4M55A 2CNWA 4ZEVA 4QTUB 7ABPA 2XRFA 1QUEA 3BDAA 1GR0A 3F3SA 1DBSA 2O7VA 4OK6A 1AKTA 4D9CA 1SUEA 1SQ0A 4XLZA 2HSEA 1KKLA 4FFBA 2RHWA 3GC6A 1V45E 3LC7O 1C9DB 3FBGA 3G23A 1F2TA 1IOZA 1D4OA 2Q7XA 3E8SA 1G8AA 3KWFA 5K51A 1ECGA 3E9NA 3EWNA 3HRIA 3V4OA 5FBVB 3HYTA 2R7AA 1T9CA 4BV8A 1W4BA 1P33A 2AV6A 2ZUSA 5TPZA 5IT0A 3KXKA 3OMXA 4FHZA 5CBKA 2QPTA 5EJEA 1L4BA 4OLBA 1K4MA 5AW2A 1UP4A 3M1IA 4V2IA 4E5VA 4BV2A 6AT1A 3OIDA 4FMCF 3JQGB 4MI9A 5JHHB 4N3CA 2OM2A 3PFHA 1UKZA 2HRDA 1CQZA 1M1NB 2B37A 2JLVA 2ODTX 2XDYA 3LFTA 3BVPA 2ODPA 1AKVA 4FKBA 4YGYA 4JI6B 1YCGA 2JLCA 3AG6A 4BOYA 1G63A 2QRNA 4U7TB 3FJ1A 5I7RA 4KO2S 1E3WA 4P53A 4WOPA 4HNTA 1U6KA 5KQSA 1TIPA 2V9PA 2Q27A 1I7QB 1IN4A 1TJ4A 1DZIA 2E82A 2Q0SA 3GLIA 2HDHA 4P32A 5F78A 3KVOA 3SAJA 3KSRA 3RIGA 4XM0A 4M9ZA 3I30X 3CWQA 1RM3A 5EIHA 3C8ZA 1DG1G 2OV2A 3RK0A 1TMOA 4AJLA 3DKPA 2V6BA 3FOZA 5LNK1 2EIHA 3ZHRA 3F4LA 1U8YA 1R64A 3EE6A 3NBKA 1X1CA 2G4LA 2JRLA 5JSYA 5HTOA 1CY7A 5DI3A 1TJ5A 2PLNA 2Q8PA 1OFHA 2RC6A 4O4JF 1K9VF 4W8GA 4D82A 3KDPA 2R1TA 4UXIA 4AJHA 2ZB8A 4C6HA 2AH5A 4G4IA 2AOXA 1FNBA 4BX3A 5BUSA 4U7GA 1PX0A 4EI8A 2R7MA 4QXQA 5JNTA 3KAPA 1K7CA 1NR7A 2IEYA 3BTOA 3M9XA 3GRCA 2OUKA 3WRWA 5A2GA 3WNZA 4LV6A 5EPUA 2IZ7A 2MYTA 4J9VA 4NJOA 5L7YA 3X2FA 1ZGBA 2CK3D 1CX9B 1KAGA 3DUFB 3EBOA 4LHVA 4Q02A 1OI7A 1YB1A 4LHYA 4FD3A 4P84A 1CS4C 3S44A 4EHAA 1NOKA 5EHXA 4EI9A 2XJ9A 1BMTA 4QUHA 4ZYUA 4NATA 1E1QD 1SU7A 3SFTA 4KG7A 3SX0A 1BJRE 2PJZA 2PLWA 2Q3MA 4ZVNA 4BE4A 3SJ7A 1NBAA 1IXSB 1E9BA 3EIWA 3MWEA 4L6CA 2OFFA 2B3TA 4QUDA 4YRTA 3HA3A 1PW7A 3HV2A 3L1KA 5ENDA 1Q91A 3F5FA 2ST1A 5EKTA 1RCUA 3K9NA 2NO1A 1H05A 3WMFA 2YIVX 2R8BA 4G5HA 221PA 3JVUA 1R9NA 3FPAA 1JR2A 3BXHA 4ZT3A 1N75A 2X8WA 2VWPA 1RBMA 2OWEA 2B0CA 3LRXA 1M2KA 4BRZA 2EFYA 3AEKB 1OGIA 4MUGA 5AVKA 3CX7A 4C4RA 1EFTA 3RYHB 1C41A 3BRWA 3U5ZB 4MGIR 1VJ5A 5JS6A 4Y7DA 2E5FA 1Y1KE 4MV8A 3UN1A 3BBPA 4DLBA 1Z0IA 4JFRA 3JQ8B 2H4WA 3RVLA 3AF2A 2PR2A 3E2IA 4BNZA 3H2JA 4TTSA 5F2OA 1E64A 4ZRNA 3T3MB 5IDVA 4B7AA 1EZ1A 3K6RA 1LX7A 4GZ5A 1RLTA 5BV7A 2GEBA 5JHGB 4CIAA 3PDUA 2OK8A 3EXFB 1V8OA 2FJPA 2KE5A 3DO8A 5TQ0A 1Y48E 1II8A 5JJLA 3LHFA 4NKRA 4ZV4A 3GJ7A 1EQUA 1FL9A 3N59A 3NKLA 4MJ3A 5T6BA 2P4EA 1C8LA 2PGXA 3KYDA 2P78A 3NS7A 4XVHA 1XTPA 4AROA 5EJ4A 3QVUA 4ZTBA 1G5QA 3OLQA 2H4FA 2AD5A 3C3XA 1RZRA 2Y05A 4CXMA 2B20A 3TIXB 1ZM7A 2WDZA 4FOTA 4LDZA 1YK1A 1U9JA 3GUHA 3NAMA 4INJA 2VHEA 1X87A 1U0RA 1X7WA 3GBVA 2XQIA 3UW3A 2A1TS 2NWQA 2DPHA 1A4RA 4MWOA 3TNYA 4EKYA 1AQYA 1FYWA 3N8KA 5ALLA 5FAKA 1Y8ZA 1YI1A 1YRYE 2IZ0A 4L8LA 3RH0A 5MFZA 2B98A 4RSRA 2SECE 1TYEB 3OZVA 1WAMA 3RT1A 4MHSA 5JS7A 2JLXA 1M5UA 3RYHA 1B76A 2J9RA 3DOIA 1Y8QA 5CA0A 2EU8A 3RWMB 4D02A 5EXPA 2ZUBA 1SM4A 2H2FA 3LU1A 3W2TA 2EW2A 3SGLA 5A7HA 1R0SA 3G2MA 3NKVA 2ACWA 4LBYA 5EE5B 4INOA 3OLXA 3KQTA 4C0LA 4EL5A 4ARZB 4CIYA 1XXHE 2P65A 3PUIA 4IOMA 4F96A 1HL7A 1EUZA 1CIJA 1XQXA 3ED1A 2BISA 3D5EA 5D85A 3NQ41 3S6JA 2I6UA 4ZAWA 3HDHA 2AX4A 4M0MA 4S1TA 1W6UA 1PZXA 5FBHA 2ZPAA 1XPRA 4G8CA 2NUAB 4B31A 1DE0A 2HA0A 3A4LA 3K96A 1H2EA 2R65A 5HKOA 1AXEA 2QG6A 2ZRNA 3DXXA 2X4IA 1MGPA 2JGEA 3LK6A 4HDNA 5CGZA 1YQTA 1L1EA 5DI3B 1JPJA 3LQYA 3N0VA 3ZV3A 4RH0A 4PIVA 4Q6WA 4LY9A 1AS0A 3RSGA 3QYAA 4DNPA 1I4DD 1EB9A 2C94A 3WNVA 4RMJA 2IBMA 4TPKA 2Z2IA 4YK7A 1C7RA 1JDVA 2FF7A 4MP8A 4N7MA 2JIMA 5H7XA 2X0DA 4L4RA 3QPWA 4W9NA 4YWHA 4PHCA 3D8HA 5K4AA 1N0HA 1U94A 3FI9A 4X6UA 3IUPA 2O54A 1V47A 1VCHA 5ALMA 4ZREA 6CHYA 5LP6C 4MARA 3PZBA 3QUBA 1XRQA 5LBUA 1NVVR 1U1CA 3QTLA 3ZWWA 6GPBA 2K2QB 4X41A 4YRAA 1N6PA 2SKCA 1VFNA 4LK3A 1MA0A 1G5FA 1KHTA 3DOCA 1Y80A 5CLIA 3DF7A 1Y7LA 3KSZO 3RRJA 3DO6A 2OGUA 5FOXA 1ICEA 5K0TA 1ESCA 1P2BA 2C84A 2J5QA 2JGJA 3LBIA 4O2AF 2HK7A 4QUIA 5A04A 4RGVA 4AS3A 3G5LA 3HCPA 3WWZA 3SQMA 1F6DA 5E3IA 1ZVJA 5EIOA 1UPBA 3TSWA 3RM3A 5CMLA 5A4JA 4ZO8A 5CXUA 2CV1A 1CUHA 3FOWA 5DXAA 1UDWA 3OKPA 3P52A 3GWZA 3IO5A 1VB5A 4KXMA 4L15A 4OMUA 3PQ8A 5CURA 5CPBA 5CYFA 1QP4A 4GI5A 5JO0A 2G5TA 4L76A 4EJSB 3ZI4A 3NGXA 1ZRNA 1A8SA 2RJNA 1MJHA 1UJ6A 3K94A 4P3KA 1AUVA 4Y6RA 1PNVA 1EGAA 1H65A 2H1RA 4W1RA 4K86A 3R75A 1EFUA 1C4KA 4BX2A 5BP7A 1FMFA 1R74A 2WOOA 2B1JA 5EWMA 1ZGJA 2J4FA 1XD8A 2FJ0A 4IMJB 3A9WA 5CJ2A 3K4PA 3IP9A 2QRZA 4FZVA 2X1VA 1USVA 2Q46A 5CTAA 1RXSA 4KXYA 4MRMA 5AI0A 2HJRA 5B3JC 4LF9B 1A9RA 3WJ2A 3NBQA 4JLVA 4YB8A 1W5SA 3ESXA 4RSMA 4S3MA 4D9HA 3A04A 2O0MA 3SFZA 3NNSA 3LRTA 4KLNA 3BMOB 3IA2A 1T3SA 2AEJA 1CK4A 1RIIA 2QRQA 1DTWB 4JLBA 4ER0A 1CVLA 2I03A 4HAWA 2OP1A 2V4ZA 4FFMA 2OBFA 4FE3A 1BU5A 1Q2UA 3HS3A 4TYYA 4JMLA 4N49A 5FPKA 4P31A 1WCV1 2EG9A 3PXAA 1NE2A 4L8VA 3O2QB 1PFQA 1OWLA 2J9ZB 4DLVA 4FJ1A 3A7EA 4E70A 3K6SA 3DWFA 2LE0A 4CBVA 2VPWA 3KKKA 4RLFA 3OY2A 1E2KA 3GG2A 2GBLC 4MB2A 2KS6A 5BSRA 1BW9B 3KB6A 3MPUA 2HM7A 3CEMA 1VI2A 2PFSA 3V1LA 2OGZA 4QDXA 4GRIA 4IG4A 5BR4A 3QRWA 2X7XA 4PS0A 4YIKA 5AKZA 4HNRA 1ORIA 1IWOA 3ZWDA 1OU0A 4LVOA 2H59A 3UWPA 4TS3A 2OCDA 3JYQA 1QFJA 3HEMA 1RRKA 1W44A 4GDMA 4ZI7F 3OIGA 2REQB 5AOAA 1HNNA 3PHLA 2ZP1A 3S3TA 4D7AA 4I9UA 1QH0A 1KJZA 2I66A 3EAQA 4GOJA 2VS1A 4O1MA 2PLRA 1QHIA 2W8ZA 2Z98A 3AI1A 3FBTA 1HYGA 4JP2A 4BQNA 3ANLA 1A76A 3G9XA 4Q21A 3VH4A 3DFFA 1XJWA 5J2UB 3ZNOA 1HM5A 4RM3A 3N07A 2FOXA 3DMNA 2BW0A 2DHDA 3PUYA 2PT5A 3U3JA 3NTXA 4AS2A 1DU4A 1PT8A 1Z6XA 1NQAO 4DOMA 1KDYA 4D8XA 2YJTD 2JZNA 1R16A 3IQHX 4RVHA 1HE8B 3RWOA 2O8EA 4N5NA 1J1IA 4DIKA 4ZRMA 1KK0A 4BN0A 4PZZA 2O8VA 4CKCB 4TYWA 5CB4F 4HEQA 1OPXA 2PD3A 2I1VB 3FYHA 5IM4F 2G9VA 1RWOA 1Q7CA 1EHIA 5KX5A 1OKKA 3O8QB 4K2HA 4AY5A 3AHIA 3ZWQA 1HFEL 2NSJA 1QKIA 2RGCA 2J1LA 3JAWA 4LBWA 4PSKA 3ZV5A 4FI3C 1NGSA 3RAEC 2PGAA 1JH8A 1OWOA 3MD9A 2O2JA 4PC6A 2R1VB 4UU7A 4ZYTA 4QRIA 1KWGA 3A26A 4PAOA 4TVKA 3ZHSA 4DUYB 1YCDA 2BJVA 3B5IA 1EGMB 5GV7A 3KPVA 3ACCA 3N7AA 3VU9B 1TZMA 3QPCA 3BXZA 1ZH6A 2IYXA 4UCXA 3KXDA 1WP9A 4F93B 4FHEA 1U0NA 1NN5A 2ABWA 1NX6A 2IYLD 1KKMA 2PRYA 3K09C 4ABYA 3K9FC 1ZISA 2AMYA 2GAIA 4IFTA 2D2VA 1NY5A 2AIRA 3O8OA 1MOZA 3N28A 1JQDA 5B6JA 1QHYA 2OC9A 4O25A 3EEOA 3ETJA 1P73A 3R76A 3X3HA 1CDOA 5IJWA 5KYWB 1BJKA 3DFZA 4MJ7A 3VR3A 3ZZ0A 4O33A 2ACVA 3ANYB 4S0ZA 4LY0A 2ERCA 1DTSA 3GH1A 3KYJB 5JSHA 1DMRA 5TT1A 3MT0A 3NC4A 4WD3A 5TEWA 1R5BA 3I45A 3AHCA 4WXRA 3VU3A 3QI7A 4H35A 3K0AB 4IO0A 1BC5A 3OZEA 4Z1MD 1R15A 1ZAYA 2OP0A 2PMFA 4QAQA 1T1EA 4FK8A 4NEQA 5JSUA 2Z4RA 4CMIA 3Q11A 1ZOPA 4RQUA 5EWLA 5JC1A 1OYOA 4EO9A 3B1XA 1E2NA 2I1LA 4NBWA 3EVTA 5KWVA 3AF1A 4QPZA 2PXAA 1TMYA 5ANRB 2CDRA 3BWVA 3MTBA 3H1TA 5BYJA 4ZYWA 1FFAA 2CUZA 2GFQA 2O0LA 4F46A 1NF2A 5P21A 2UZ1B 3VZPA 1SZCA 3NTRA 4PC7A 4U2BA 3VAAA 1NNUA 1KK1A 4AO7A 2DTXA 4D44A 4ZCMA 1GRRA 2FPKA 2FDXA 5F33A 2JFQA 4K8OA 2PX6A 3O95A 3CLUC 2PSHA 3BH7A 5T4FA 4DNQA 2Y1DA 2ZSEA 4JITA 5JE8A 2ILTA 3LQ4A 2MSKA 3MWJA 2D7DA 4KPUA 1PZHA 4R2JA 4DLZA 4DJDC 4KMMA 3BMQB 3WAGA 4HGZA 4QYTA 2H54A 4B46A 3BMXA 5C1IA 1NVFA 1R0RE 1GL7A 3DKRA 4CMHA 5CFLA 4D4IA 2BEUA 4EVQA 3ZUPA 2XKJE 4HBZA 4DREA 4P6VF 4B0OA 4DQ0A 5T6MA 3NTOA 1GPNA 5K05A 1FSFA 1NWCA 4A36A 1XTSA 3KAKA 4Q3BA 1PBTA 1MZPA 1PZFA 2D2FA 3RDPA 2WJGA 3TN7A 3IVXA 4U39A 1BS2A 1L5VA 2Y6VA 4PF1A 2BMVA 3WBKA 1MC5A 2ZDHA 3K1ZA 4C2AA 2HN9A 4QSHA 1K7EB 5TMEA 4FYWA 2J0VA 2WMNB 4ND3A 1WMFA 2JEOA 3T7DA 9ABPA 3AVXA 1X80B 3ZH2A 2ZATA 2PBFA 3AR3A 1MC1A 2UVDA 2FMKA 2P0AA 3CSDA 2A9KA 1Z22A 2B7LA 4U5QA 1GTJ1 1ACJA 1DKUA 2E37A 2OUIA 2XZTA 3OE5A 4R9SA 5CHYA 2JW5A 4ANFA 4C6TA 3A2MA 1VG8A 3H0CA 4G0WA 1CS0B 1TW3A 4KLRA 1RRMA 4ZVVA 3WRYA 2IKSA 3IR5A 5E7IA 4NX2A 4A6DA 1ZH0A 1Z45A 3RVBA 4F3KA 3E5HA 5D3QA 3D43A 3MVEA 3QQPA 3PKJA 2NTNA 2W9XA 3IIKA 3AM4A 1G4AE 3EQ7A 3OQIB 2VP4A 1CJUC 2G63A 1Q50A 1P0FA 1Q3KA 3CE9A 4ZYZA 5K8VA 3JSAA 4GVXA 1R50A 3A06A 2ZITA 3HZRA 5A1TA 4IGKA 3D0QA 2YW2A 1FYFA 2CJWA 2FE4A 2GN0A 4J16C 4EARA 1LBTA 5NLLA 3Q8LA 1AXRA 1LD3A 1QIEA 2O7RA 3VSDA 1ZQ1A 5IKPA 3GAFA 4DNOA 3B9PA 2Q6KA 3ZWAA 4E5SA 1P3DA 3B6EA 3T99A 3IUSA 3FZQA 3F7OA 2YJNA 3QENA 4IH4A 4RHFA 4YDQA 2CJXA 5DNYB 1YQGA 1PNTA 4DF3A 2ZRHA 1IBLB 1XX6A 3KJFA 1RSZA 4ZOLA 1KI3A 5IANA 5JXGA 2G80A 4LS3A 1P29A 4CMEC 3PVZA 3VBEA 3MOIA 4DBLE 1JT2A 2RC5A 2EKQA 2V54A 2X7JA 3ZV7A 4EWLA 4MUIA 1QK4A 1R12A 2NSHA 3E1KA 3TLEA 4ZQCB 4AX8A 1HRKA 2Q4OA 5KUTA 3C6XA 4R9VA 4B3RB 3ABIA 1N0VC 4YQYA 2P4QA 1OPRA 1QE3A 2O20A 3PHGA 4M9UA 2IEAA 2ISCA 2ETVA 2EATA 3ZHOA 5JPIA 3R3YA 3DE0X 1J22A 3RBVA 4X64B 3AP2A 4GKAA 1X1TA 4EHFA 1SXQA 6LDHA 1HDYA 3VTKA 1E94E 3BJRA 4JJ8A 4B45A 3GCZA 3CN7A 4R9UC 3AJRA 3P4YA 3RANA 2IBSA 1UFQA 4O1IA 1SCBA 4WN9A 3JD1A 2IOFK 3UJCA 1O95D 3ISJA 4K81B 3K70D 4OJQA 1V8DA 5KYYA 2R86A 4YACA 3EXIA 2VSYA 4JVSB 4NNOA 2QP4A 4LWZA 5IHXA 2VSFA 4B74A 1FLNA 4DT1A 2X6RA 4XIJA 2BFBB 2CNBA 1U2QA 3BH6A 3NLLA 4FLFA 2H1OA 1LBEA 1IJKA 2OFWA 2AYYA 3I1IA 3WS7A 4DLLA 3TNLA 5JRZA 1KVSA 1WA5A 2Q8QA 4YV1A 4P0QB 1KO8A 1C8KA 2HX1A 4OXXA 5EPOA 1JIKA 1HETA 2B5WA 2QYSA 3NYWA 4Z8YA 1TX4B 2XH8A 3H99A 4Y9DA 1L4YA 3AFNA 5C1OA 3DAHA 3A6DA 2ZRFA 4QULA 3IKJA 1I3KA 5H1YA 1V3UA 3EZGA 3KOWA 1BFKA 3QPUA 4D25A 3UT6A 1NPTO 3BL5A 3FF1A 3M3HA 4GXRA 1FQJA 5DLDA 3KD3A 5DEIA 2ZU0C 3AM1A 2HQ1A 3THWB 2BBTA 2Z5VA 2YASA 3GL9A 1D2CA 2JHCA 2YMLA 4LJLA 2AXEA 2QVCA 3DTVD 5TEVA 4G9GA 4HKTA 5DGDA 3OBIA 4IGFA 4KACA 5FULA 3GGOA 4ENVA 4RACA 2YXLA 4GE3A 4W7IA 2DG2A 4RTJA 4YP7A 4PN7A 4U1RA 4DT1B 3Q0TA 3UBTA 3PC8A 2E48A 3KEGA 1QCZA 1NTRA 4WVLA 5HMMA 4ZMRA 2X40A 3OURA 3T8YA 2A1IA 4R6XA 5LA6A 3RNOA 1GG8A 2QW0X 4RF3A 4Y3UA 5TDHA 3CB4A 4ZDKA 4G0UA 5C46F 3LZCA 2BFAA 2JVIA 4NFHA 4EQ6B 1Y7HA 4NOLA 1V16B 2ZBQA 3K2QA 1ID8A 3FWHA 3ZK8A 4Q1FA 3L8HA 3CV3A 5C8ZA 1E6MA 3FSGD 1JSXA 1NMSA 2D5CA 3MJHA 4WESA 1VKZA 1U1IA 1Y9EA 3IPLA 2ATXA 4MYCA 5GJBA 4BQIA 5HUHA 4PNZA 3KK0A 1SEVA 1C1XB 4LOJA 5JMWA 1H8HD 1EFCA 3OLCX 3RYTC 1YFJA 1SWVA 3EMDA 3B6KA 3O8OB 4WZ6A 5KWEA 4P0PB 3Q88A 2H17A 2BP7B 2AKEA 3KPYA 2WT8A 3BSWA 3AI7A 1WU7A 1RP1A 4PHTA 2G5PA 4DBZA 4YRZA 5AW1A 2FPXA 4Q4CA 3FTDA 1COWD 3GPLA 2GN6A 3JQAD 1K7SN 2C5GA 1E77A 2D2IA 3R9WA 1U3FA 4BFWA 2H08A 3L01A 2PE5A 1S7GA 3CLSD 2NZVG 2XMBA 4DE5A 3AESB 3F4BA 4BMOB 4BB0A 3IVGA 1V5GA 1DAGA 3SF0A 5FEMA 5JAUA 1GGNA 4KPYA 2GERA 3GJRA 2CV0A 1ZGHA 2GLXA 3K6KA 3MCTA 5B6IA 3R44A 2P3SA 3WSTA 3N2IA 2JFXA 5I5EA 4HUTA 1SXJE 1WTAA 2VNAA 4CV2A 1UDRA 1NI4A 4DRXB 4EY6A 2W58A 4KVAA 2WAYA 1G3QA 2V03A 3SC2B 4BZQA 2C4KA 4IJKA 4D3ZA 4PLZA 4CDRA 4H1WA 2V8OA 2EP5A 4MV3A 3L0OA 2CFCA 4R9NA 4RHUA 4HEHA 4PLGA 2REBA 2QPOA 4UE2A 2CDAA 2QXTA 1KZHA 3FMPB 5AVSA 2HI0A 1NUUA 1SEPA 1ZGGA 3H2YA 1K5HA 1P5JA 3LKZA 1LJLA 4OQMA 3FZNA 3A6PC 2LIPA 4F4JA 3R9KA 2BFBA 2W2QA 1XKTA 4UE3S 2PXXA 4ZA2A 1PFGA 4YXFA 1E6LA 1OLXB 1P6QA 5KWSA 2O2CA 3IOYA 3H83A 1YCFA 2AEEA 4GWGA 4LJSA 1P0CA 5AW4A 3GRRA 1JFVA 3LT5A 3ZCQA 1JDBC 1DLJA 5FB3A 3CX3A 2FEMA 2BGLA 5IVPA 3TG8A 1YQXA 1P31A 1DIOB 1WQ3A 4QWWA 3JR3A 3PLAE 1IL0A 1SUSA 2IVZA 2BEWB 3PEFA 4BNLA 1HFKA 4RZHA 3G0DA 4UHFA 4JXKA 4DSNA 1GFIA 3JZFA 3CLHA 1AZLA 4Q48A 4LECA 5E1MA 1WWKA 5KDLA 1P1CA 1QHGA 3MIIA 4DBVO 1U3GA 5JWOA 4MHTA 4QTXA 2E89A 1K8YB 4Y2XA 2WD7A 3V7FA 1GZHB 1NM5A 5PNTA 3QW2A 4JBWA 4NZPA 1RLIA 3RRXA 2NQTA 1Z13A 4GYWA 3K0BA 1VI5A 4NQZA 1Z6PA 3P9RA 1RADA 3QE3A 5IZCC 1XLUA 1ENYA 3T7SA 3U0BA 1SK9A 3G2QA 3EPLA 5F98A 1LZKA 1U4SA 3I3OA 4ZZIA 2P7IA 1E1KA 1D6NA 3W5CA 2ZSJA 3TRHA 5JWHA 3LWNA 3NJRA 4WXPA 1Y89A 4CNBA 1GYPA 1YUBA 4PCVA 3KKQA 1PGOA 3LX5A 1ZM4A 3HRKA 3A0UA 4LDJA 1LDGA 4LX0A 1KMCA 3OKAA 4G1BA 4NBSA 1MIOA 3PC6A 2I6FA 4Q15A 4FKMA 3LGSA 2BV3A 2IWHA 3P96A 3ESCA 4TVSA 5AYVA 3AL0C 4AN1A 5IJAA 5FPPA 1WU8A 5DIFA 1Z37A 2XE8A 1YL7A 3GLGB 5JG7A 1PZNA 2NZUG 4D4KA 2Y1CA 3DNFA 1ZNXA 3EEBA 4LZJA 4I50B 1BFDA 2GEDA 4IIVA 1GJRA 1UM8A 1VGRA 1EFDN 2W4IA 2H92A 5KZMB 5GJWC 3KAQA 5AMXA 3DCYA 5JYCA 2KMLA 4HLUC 3B1ZA 3E2PA 1DXQA 3NI2A 4YPFA 1Q21A 1HEUA 1ZXBA 4NFLA 3LE8A 4GX0A 2ZGVA 4C5BA 2Q3FA 1DJMA 2POCA 1REQB 3DFMA 4KQHA 5KYXB 2YR0A 1FS5A 3C0KA 3KDSE 1ZKMA 2BFCB 4MKGA 3SF8B 4RVGA 1R66A 5EXTA 3KQOA 1FNSA 3AONB 3FAKA 4UBKA 2A33A 2Q3BA 2IHJA 4RPIA 1UMBA 4DMFA 4DQVA 3MTGA 3I5AA 4FYPA 3C7CB 1QYVA 4KZKA 5KOJB 3ZNPA 3B3QA 3VKHA 5CFOA 3HMQA 2ZSIA 5LB4A 1DOAA 4BGEA 1XZCA 3F78A 1RJ9A 3A37A 1CY1A 4RA6A 1KYXA 2ZAOA 3F6YA 1ZQ9A 3Q87B 4LVCA 4DPLA 3AJDA 4PRKA 2VA8A 1EFVA 2Q7OE 1EVIA 1D6SA 2BL4A 5AXAA 2YQ4A 5F64A 2FSFA 1A0OA 4HN2A 4ITRC 3DQPA 3KZOA 4PZPA 2HXSA 5I5GA 3A6GA 3ONEA 5AXDA 4F6CA 1I3OA 1FUYB 1RXUA 3HNRA 1GPKA 1MVLA 4O5AA 5H0IA 2I2DA 2H65A 2X1MA 5P8WA 2K87A 5TV2A 2CNKA 3IXLA 3ZW7A 4NICA 4A0RA 3KR9A 3OQ1A 3ROTA 3ZD6A 5HBRA 3LCUA 2GF9A 3PPXA 1P4HA 2I2WA 2PA0A 1KI9A 1FZQA 5CH3A 3T3EA 4UTVA 1WEKA 3RSCA 1OX4A 1HTWA 1NUSA 3I76A 1RRCA 2UXBB 3WDSA 5BW4A 4KYUA 1QGAA 4PCAA 4B8YA 1H6CA 1CEXA 3EARA 3G8CA 3UCFA 5DH9A 5CLJA 4ETMA 1CZHA 3KSBC 3LG2A 2IIPA 3BAFA 2A5YB 5FJJA 1OT5A 2YINC 5BSMA 1EUQA 3AVUA 1V8ZA 2HJGA 3QWBA 3UYKA 1T9GS 3L43A 4DJ5X 4LMBA 3ZD9A 2A4KA 2G77B 2OLEA 3K5HA 5PGMA 3WGTA 1AZTA 2X1HA 3TI9A 3FFBA 2Z0MA 3TQFA 1MCZA 2G7ZA 4PYMA 1PRYA 3I5YA 1OX5A 1FP4A 4IHQA 2Z2KA 5IMSA 4ZU3A 1IYZA 1DEKA 2ZLBA 2PAAA 3W5UA 3GNLA 2GASA 3DJFA 2B34A 1GA4A 2FH5B 3ZGOA 1FMTA 4I4TF 2QNIA 5JSFA 3SJUA 4KWCA 1SVMA 2X15A 4HADA 1NJ2A 4MQLA 1H5UA 1XZIA 2H7CA 3OOJA 2ZIGA 4OAOA 1AV7A 2D1SA 3P0JA 3E6AA 2Y6UA 2H8KA 4U7HA 4UULA 4K9LA 2FK8A 2ORYA 5M7EA 3DDOA 4S2EA 3K9CA 4PQYA 1TC1A 3ZCRA 4L7QA 4INZA 4UU0A 3VHXB 4HS9A 1MO5A 4IYJA 4S12A 3BTUA 2VHVA 2HUPA 4Z9AA 1SUWA 1T8TA 1WPGA 3D8BA 1UZAA 1BXGB 4QU9A 5TVKA 1II8B 3GIWA 5AKJA 3KUXA 4HH1A 5BVGA 2DC1A 3NTVA 4LGCA 1ZC4A 4YN3A 2AN4A 4YRRA 4ZQFA 5TMDA 2BKLA 1U0JA 2WVAA 4G0QA 1QJ4A 2DPLA 4PSDA 2I71A 1CYEA 3DQQA 3LHDA 5BV8A 3NCHA 3L5KA 1DUVG 1FP4B 3HCBA 3HKDB 2CMDA 4LE0A 2ZANA 5F21A 4TTRA 2QY6A 4ZYLA 3CSUA 1GNQA 2DBQA 2I7VA 3CX4A 2W37A 1GOTA 4WKNA 3DZFA 4E2ZA 3ZBUA 2XDQA 1H3FA 4HYEA 5CPFA 3TLZA 2Q62A 2W2VA 1KPGA 1DRJA 4WLNA 1QOQB 3TNDA 1V1RA 2GXSA 5BV1A 2QOEA 2O8BA 4NHOA 2NIPA 1KOGA 4DIFA 4NQRA 4L5AA 3VDQA 1QH1A 2PZKA 2X1LA 4GZ3A 4G3XA 4OXNA 1P1HA 1SBTA 4NZOA 1I4OA 4YUAA 2XBLA 4BMSA 4IXMA 4RE5A 1C3OB 5A6SA 2P6NA 4MOWA 2HMVA 2WHRA 3TLXA 2DBRA 2FXIA 3NV9A 2XYPA 3LYAA 4KX3A 5IVHA 3M49A 4ZC8A 1EJ0A 1JFLA 3DZIA 2BE7A 3D6AA 1QCCA 1MOSA 3E8XA 3FYCA 2WHEA 3KR2A 2IE0A 3PNQA 5ALYA 4DLAA 3Q3HA 4OHKA 3UV6A 2DVMA 4Q3LA 2OHIA 2OC4A 2WAXA 1J1UA 4UEOA 1O4VA 1A5AB 3GLTA 3QTTA 5KX5F 1VLHA 4BJ1A 3GNTA 2DUJA 4KN8A 3HEAA 5KX5B 3HZZA 2IUEA 4X6LA 4C1BA 1PYOA 4X6XA 1CR0A 2DUNA 3V9PA 4OLAA 3NTQA 3VC2A 3VISA 1EM8A 1IPHA 3DMFA 5LJLA 2AJBA 2HMSA 4DUGA 1C0IA 3CYFA 5IBCA 5ILOA 3QP9A 4GL4A 2FFAA 2GZAA 2ZUVA 2OPHA 3IOMA 1UADA 3ZCPA 5JAIA 2EERA 3MYYA 2RKWA 2ZRBA 1JZQA 5IDXA 1I4EB 4PZEA 1CPYA 2ZK7A 4HO1X 2DWUA 2NYUA 3NONA 1EWRA 1QAMA 4OFXA 3WKDA 2B36A 2C9BA 2HV8A 3DC7A 2QV0A 2DSTA 4LHSA 3TPFA 1KFKB 3W2EA 5FTLA 1KEVA 4CLXA 2WHPB 3K72B 4JB2A 1HEYA 4UNQA 5AJVB 4IWNA 1WDWB 5CNIA 5K0GA 2VHWA 1EHYA 1L1QA 2C0PA 2PUHA 3EN0A 4YUVA 1US8A 1NI5A 2COUA 2RGDA 1J06A 1J0CA 2F9MA 3BRCA 4RGQA 3R7BA 4CM1A 5I01A 2R7KA 1M76A 2YZNA 4PAQA 3U4CA 2VQFB 1YONA 3DV0B 4MVYA 4NU0A 3FWNA 1BGWA 1BEUB 2PZJA 2VDWB 1L6RA 3E23A 1L3CA 4AWBA 2ZDGA 2VYCA 5CIYA 2E5WA 5ECGC 1BVUA 4OYHA 1ZY2A 2QS9A 3KM0A 2WUVA 2CUNA 4PX5A 1IXRC 3F5MA 4G37A 5DX0A 2J6HA 2MSCB 4M83A 5CVJA 2FPMA 2H57A 3E15A 3SIPA 4ZALA 4CG3A 1CQPA 1S8NA 3H19A 3PFBA 5DNVA 2ZRJA 4OBXA 5E0OA 4KAJA 3SOZA 1D3AA 2PL5A 3U3ZA 2OV3A 1BXGA 1U9ZA 4B6QA 3HFRA 2XBMA 1M6VB 2XXAB 5EZ6B 2WTXA 4M9CA 3STYA 5B36A 2FPWA 1EIZA 3VHXA 5K01A 4EG7A 3H17A 1NBEA 4LRSB 2XQGA 1NL3A 3PNMA 3GEDA 4FQ7A 5CH5A 1DWPA 1E1LA 1QHFA 3L8YA 3NP9A 1NVXQ 1UZUA 1M83A 1O2DA 2WTAA 4J03A 3TQIA 3V4FA 4ME6A 3DULA 1ID1A 3I2YX 3OLVA 4G86A 5IZCA 1VFPA 3UJ7A 2R7NA 4RY0A 2ATVA 3KUKA 1RJFA 3JXEA 3N0XA 5I7VA 4JI0B 1L8LA 2O57A 5JYDA 1XBTA 4XR4A 4JVNA 4C0JA 1RKVA 3EPPA 3I6BA 3CTMA 2ZPTX 1W2HA 1F6BA 3BE6A 4FCTA 3LW8A 3H1EA 4FR0A 3BERA 3CVOA 4XGNA 2BBWA 2NZWA 3HZOA 3MTJA 4QVGA 2Z58A 4GPZA 4F2HA 3UC9A 1Z68A 1GFZA 1P0PA 1XZLA 1ZA1A 1IU9A 3BHIA 3LP5A 2BGWA 1DX9A 1Y7PA 4GDFA 1ZW6A 5F5LA 2OSBA 2JIOA 1UQRA 3KQSA 1N5LA 2CF6A 3THSA 2GYWA 3L8EA 1AIPA 2LP4Y 1W85B 2SICE 1GDHA 3DR3A 3H9QA 4ABTA 1W52X 5SYAA 4BLPA 2VHUA 3GLIE 1OWMA 3MMZA 2VAPA 5E4TA 1EJ6A 1ZK4A 4LQCA 4JJ6A 4MUHA 2ACEA 1Y1RA 5CM8B 3BZWA 3PDCA 4UBOA 4CWAA 4HV4A 5B12A 1UPUA 1T36A 2XQFA 5A3RA 2PMDA 4BKPA 2ON6A 1W46A 2NU7A 3DOUA 3MWFA 1JSCA 2F62A 1QU3A 5BSKA 3KVNA 4ESOA 5FPQA 4QREA 1Y33E 3OZFA 5KOHA 1ZUHA 3U48A 1XCPA 4C05A 1XRNA 4Q4JB 4EKGA 2C83A 2IS2A 1GRNA 1WOYA 3R5KA 3C15C 1OAKA 1VSTA 5DGIA 3WLTA 3ABQB 3X1YA 2WJ3A 4MV5A 3T0FA 2Q2VA 3F5QA 3N0TA 3PHHA 3ILYA 1EIWA 1KL7A 3R0XA 3VH1A 4AKIA 3VDNB 3AWIA 1P61B 1XWIA 1JHPA 2AG8A 3AUUA 3ICCA 3NANA 4MCJA 3SVZA 4TMZA 5K8LA 2ZWAA 3KTDA 2J3JA 3UQZA 3OZGA 4F21A 1G2IA 3L6OO 2XT6A 2BGKA 2KBFA 3FOBA 3PGVA 4BQOA 2AWNA 3TB4A 1Y3HA 5JJCA 5JD4A 2IH5A 3P9ZA 1TT5A 4CCSA 2PKYX 2BLLA 3JVIA 1NVUQ 4URYR 5JVDB 1NVVQ 4BVGA 1T10A 1NP3A 1I3NA 1P1RA 2GEJA 2YY7A 3I28A 4MVCA 4RETA 2WLTA 5GVRA 4DADA 1LTHR 4YJ3A 3NM4A 5KVSA 3UAYA 3BREA 3ESRA 3GCDA 5IASA 5JNVA 4TTQA 3L18A 1C9YA 2FRXA 5FKJA 1JE1A 3A6EA 3BA6A 3I4FA 3O31A 3TW0A 4DR5B 1WCXA 5KJ6A 2QQFA 3OPMA 3OF3A 4HRAA 4PR3A 3FNIA 1Z34A 2PZBA 4JCCA 1DXHA 3H5RA 3MLAA 4QUBA 4BBJA 1WLYA 5JCJA 4TV9F 1JSLA 2BZ1A 2RI1A 1P6XA 2D54A 4JT2A 2TMYA 4UDYX 2AQKA 1MAWA 2EYUA 3X43A 2C4VA 3GBPA 4NCJA 4ZVLA 1SG0A 4Q82A 4EQ6A 5GZ3A 1RKBA 1B2RA 2G04A 4WERA 1CY4A 2P1DA 3B36A 1ODFA 1YZNA 4GZLA 3ZWNA 1DEOA 2IX9A 4YCDA 2ZTLA 1ZMOA 1JZTA 3RQIA 4E5UA 5J1TB 3PIDA 1RWPA 3QUCA 2LW7A 1OE0A 5IVIA 3HJBA 4N6OA 1JLMA 1FP2A 3USES 3E70C 1X7DA 3UKOA 5K9ZA 4RL6A 1Z5OA 2CMGA 2A5FA 2WA1A 3SR4A 1CUVA 2QLLA 3O3OB 4GSYA 4EA8A 5LD2B 4AYWA 4MUYA 2FMFA 1MO3A 1UCFA 2BMDA 1N1MA 5EZYB 3QEAZ 1IEXA 2W2TA 4IL5A 4L4XA 1YZKA 3ZQKA 2VDPB 1RWBA 3HU5A 4YBZA 1U9IC 4REOA 4Z0TA 3DKKA 3WRXC 2CDNA 2QMYA 2VK8A 2ZZNA 1EDZA 1V8PA 3GJYA 3U7GA 1KO5A 1RI2A 1LX6A 4PPNA 4UDNA 3N8DA 3KQQA 4FW9A 3IP5A 1MB0A 2GTIA 4OP3A 4X3OA 3MA0A 5AW9A 1PV4A 4S35A 3CNQS 4MWSA 4QVKA 5DNDA 4ZV7A 3GLFA 3PC8C 1CVRA 3NUZA 5DOVA 3ZX4A 3W5BA 3D0KA 2BR5A 4JLDA 1KI1A 4C4XA 3ZQJA 1IK4A 3DEYX 4PPYA 3TVYA 3ZE9A 3GFPA 4RK4A 3PF9A 4B80A 2V7BA 1VE9A 4R0NA 1OXTA 2FX3A 2IUFA 3E8MA 3FB1A 4QYSA 4JP3A 3E05A 2BFMA 2A0WA 3IMGA 4O4JA 5ENZA 2FDCA 1GNSA 2VF5X 1T8WA 1SHJA 2AS0A 5LA6F 1CY6A 3PYXA 1XLWA 4C89A 1C8BA 2HCRA 4FUTA 1JFRA 3O8NA 5BWCA 2QLFA 3SJZA 2GHTA 4L8WB 1CB0A 2DMRA 4R84A 2CV2A 2L42A 4UNPA 4QX6A 1A96A 3IA7A 1LDMA 1TO1E 1GCUA 2CLHB 4KGDA 4K28A 4TZKA 4Z4GA 4QGBA 4IYRA 4EFMA 2C2WA 2JFPA 4LIPD 2FVXA 1OXSC 1QORA 3OIWA 3WK7A 4BWYA 5BW8A 4TSFD 4M3NA 4ZKEA 2VYFA 3NT2A 1QFZA 2AOUB 4GPTA 2ZT7A 2FV8A 4MA4A 4FINA 1XTTA 2OHFA 5HF9A 1MBZA 1NN1A 3J81k 2NMVA 5CA0B 1Z06A 1M6EX 1W25A 3RSFA 1E0JA 3QKSB 2C95A 1TFUA 2HMWA 3AIMA 4EG4A 4Z4CA 3ICVA 3RJMA 3SXUA 3WJAA 1MHPA 4HVLA 5HW0A 1Y1PA 1QAOA 5EWJB 3WL8A 1TZCA 3AJ8A 3RRBA 1E92A 3JARA 5IYZB 2B4YA 1VA4A 4W5OA 1GL3A 3HKEA 4GX1A 4IZIA 2X9NA 4RYLA 1QFYA 4UREA 1QYDA 4WDRA 3L77A 3RFCA 3MRXA 5FA6A 2WSMA 4FWTA 3HVJA 3UJ3X 4MQUA 2HF8A 4PZ0A 3TZCA 4FYMA 3UMCA 4PLWA 2VSNA 1JIVA 4TS1A 2XMDA 2LCQA 1T43A 1TRKA 3LT2A 1IY8A 1U1EA 5L40A 3PLNA 3FCYA 1I5OA 621PA 3O5AA 1MHTA 1CQIA 4W82A 2VTVA 3LUPA 5KSZA 3NGLA 2A9QA 3DE5X 1H1LA 5CLHA 1JQKA 3DZKA 3G88A 4XDHA 5AW7A 2AKAB 5BMVB 1A9XA 1U11A 3BWMA 5CLQA 1PX2A 2WIFA 3GFRA 3DZJA 2VDNB 2DECA 2BR4A 2WZCA 2VG8A 4TLAA 2FFBA 3EIXA 1TIBA 1J23A 1G6HA 2R4TA 3A1VA 3H2ZA 3KEMA 3I5MA 4OATA 3X2EA 2HPVA 4MTCA 4Q3KA 3N39C 4FSHA 2H0RA 3WK8A 5HRUA 3KQUA 5AM1A 5JLAA 4BVAA 4DILA 3WWYA 1YZGA 2GJ4A 5HFAA 1NSYA 1YUMA 2WG0A 4KE9A 1KQ3A 5BNWA 4Q1DA 1KDPA 1QOZA 4IDNA 3O7WA 4GU5A 4LZLA 2R1ZA 1YVUA 1DKLA 1KYTA 3R0ZA 4R8SA 4YP6A 4JJAA 4Q19A 5YASA 4P2BA 2G1KA 2X5OA 3OAAA 4BMZA 1KOJA 1B14A 1U6JA 2EEZA 4AP5A 2CXQA 5KYUB 4WN9B 3BXFA 2D1RA 2IXDA 1P8AA 1SOMA 3N76A 4P92A 4YCJA 1DJNA 3RK4A 2RK4A 4L0QA 2G82A 2JBHA 4OHRA 3G2HA 3OCJA 4M8KA 1AQLA 5JPDA 4HDSB 2Z3ZA 3L8ZA 1Z4IA 4LOKA 3JQ7B 1M2GA 5KVVA 1T34A 1QE0A 1CUZA 3G3EA 3PC3A 4GWKA 3A4MA 1QB7A 4KFCA 2BCEA 2OORC 4MUNA 1EEHA 3DBRB 5ALTA 5JARA 5ITZA 3PHJA 3WKAA 3B20A 3GJXC 2O8FB 3OFJA 5EINA 1EFVB 1R8XA 2BVNA 4TV9A 1YMVA 1JA0A 1KZ6A 3GUZA 4YIHA 3EIFA 4D9KA 4D9BA 2I4IA 5BNZA 4C0WA 2IDKA 3I64A 5C4MA 3H2GA 3P0IA 1BGVA 1UR5A 3D6NB 2J87A 3CLKA 1XKXA 4AJIA 3L46A 3MCAA 3UB3A 2Z43A 2O3TA 1ECFA 1CRLA 4OHMA 1G8KA 5BY2A 1DCMA 6NULA 2J3LA 1Z7WA 3EVDA 1DQSA 3K3PA 2JI7A 1SVUA 1T9DA 5JFGA 5INTA 4LFCB 1W35A 2L18A 2QXUA 2XKBA 3Q2KA 1ZD2P 1XTRA 1HPLA 4O2BB 2WWRA 4TQUS 4Y2QA 5FA5A 4Q3DA 4IMPA 4X45A 2QTFA 4GR9A 2KSQA 4MMYB 1KJYA 3W34A 1PCXA 3FYUB 4M99A 5G4KB 2BBSA 2SCUA 3LLUA 2OVFA 4ZO9A 3ZXSA 3JQ6A 3R8CA 3ODPA 3UJBA 4N12A 4FGLA 3M8KA 4P81A 1NXQA 2N1BA 4NYIQ 4HPXB 4X92A 4OM7A 1FFHA 4HGOA 1I5RA 1HR0B 1YQQA 3BXPA 3EJWA 4LCBA 5TQ2A 1H8ED 4HPJB 3KOUA 4QDKA 3KT3A 3HXOA 1KBZA 5HG0A 1W5BA 4QDTA 3KPJA 2FOIA 4QU8A 5FOWA 1ZVKA 3S2YA 2ZT5A 4N7RA 2J3IA 4WDQA 5JH7A 3I58A 1T13A 1YJXA 4ER5A 1TCUA 2ZYSA 3LS2A 3RK1A 5F23A 2WPNA 5CUQA 3CR7A 4QT4A 3RYCA 1HK7A 4AG6A 2ZBEA 2H4XA 1LK5A 3W5AA 2ID8A 1OFVA 1IDOA 1JPNA 2F64A 1E5VA 3HY4A 5A2QA 5IT9A 2XITA 1AB5A 2ZBPA 3GLUA 2H1WA 1I0ZA 1XRJA 3H6HA 721PA 1BVYF 1ZX1A 1WABA 1RLJA 2PX4A 3ZDBA 3SPXA 2GB4A 2ZSFA 2PUTA 4JQYA 1EWYA 4JBXA 1TA9A 5ER9A 2AFIA 2AXQA 3A11A 3NNNA 2ZE7A 1D2MA 3UHPA 4B4WA 3UMSA 4R1TA 5C8XA 5CCXA 4DL9A 5H9VA 3EDCA 1N0IA 1Y4ZA 2QR2A 3GLRA 1BWQA 4ZT5A 4UDXX 3UPDA 4AJKA 3E3NA 5LP1A 1C4XA 1FSSA 2O5VA 1EU1A 1V5WA 1E9CA 3DZCA 4JVMA 1RKUA 4XYBA 4YJ3B 1NXTA 1NFFA 1O95A 4XWAA 3Q12A 4O4HF 1C0PA 1DC6A 1X3LA 1DKPA 1ZM3A 2AMFA 1WX1A 3LYUA 4K6KA 4Y0AA 3SOPA 5EVCA 3WOVA 4M37A 1AHPA 3WLRA 1PR4A 4C7XA 4Q01A 2YWCA 1SVWA 1J2UA 2WNHA 3I0MA 4K9KA 2O2SA 1QFMA 1BE6A 4NESA 1YIDA 4B2PA 3V8BA 3RYCB 4C14A 1DQZA 1JDUA 2BEKA 3B6IA 3RIXA 1KARA 9LDTA 1VL0A 4Y2UA 4BFYA 2G67A 3CQ9A 2CXPA 4JR1A 4E1VA 4DSAA 2QX8A 4UQPA 4B7XA 1NR5A 4UCQA 2SKEA 2MYUA 5ES3A 4BP3A 2J45A 1O5TA 4BNGA 4YAKA 1CJMA 4L3OA 2EGGA 5MF6A 1AHIA 3RROA 3QBJA 3IVRA 4LJ5A 4AULA 3HJNA 4FEAA 4RX1A 4ZI7B 1ZESA 5KYYB 2LVBA 3O75A 5BR7A 3R3VA 1O3YA 4WXYB 2YJGA 4YV0A 1DXOA 1B6SA 1ISRA 4JOCA 5A5EA 2AI1A 4H7DA 3ZKAA 1S4QA 2ZYRA 1NNLA 3HL0A 3MFYA 3PRJA 4N1AA 4A73A 5CT5A 4BQFA 3FPSA 4KLAA 4CM5A 4AX4A 1VJ1A 3UFXB 3KTFA 2YCBA 3W77A 2V1UA 3SC6A 2R5FA 3GEPA 4PEVA 1P4JA 2CL5A 2OCKA 5E8RA 4RJKA 4Q0MA 5EOVA 5EIWA 4H6VA 1JX6A 3WDMA 1JU4A 1HTBA 2G83A 2OGWA 1RM4A 2DSNA 1CZKA 2GPNA 3N9IA 4FDLA 4FIZA 4HWRA 5H59A 3U17A 5LPNA 4NXNB 1NW4A 5TF4A 1CUWA 1N57A 2O52A 5GONA 1TDJA 4TS9A 3KWLA 4JGIA 1JBQA 4LOHA 1FA9A 3UMMA 4UJ5A 2Y9MB 4QPPA 2ZZKA 3ZG6A 1ILWA 5DRYA 3PUJA 5FYDA 3DLIA 4NBKA 4JBLA 2VHXA 4J7AA 1S89A 2VP2A 3B12A 4QRHA 1X1RA 1SBIA 3W0LB 2RIRA 4DTIA 2P7HA 5FL3A 5HF6A 5LP6B 1REQA 1AK2A 3IKLA 2EARA 5CK5A 4EB8A 1CQJB 3NAGA 4X1IB 1QZTA 2J8ZA 2GA9A 1JHMA 3HSYA 3RVSA 4U7FA 4KNYA 1MVOA 4ER7A 4QDUA 1MXHA 2F90A 3U4HA 3O21A 3DD5A 1TUEA 4YJ2F 4K9RA 3BTVA 3DPUA 4CKCA 5MGNA 1XU4A 1HC7A 2BONA 1LTKA 2RK6A 3NFRA 4E31A 1YZFA 2PZMA 1OC4A 4XRGA 1P19A 3I2JA 2VQSA 1K2VN 2A30A 3V55A 1E2LA 1NVWQ 3LZDA 5COBA 1MX9A 3K2EA 1GADO 3GMTA 4CZ2A 5DOZA 1CQXA 2CN1A 2IHZA 2PMKA 1RBYA 2IW1A 3H2SA 1Z0ZA 4CIBA 2EJUA 3ZTWA 1Y6ZA 3KELA 5FWAA 3SI7A 5BOVA 5C1BA 2JAPA 2W2NA 4MS3A 3OE4A 1H5QA 1YJCA 4HUJA 3ZX5A 3CGGA 1MPXA 1NAHA 1JNXX 4LHZA 1C3EA 1KVTA 4QUAA 1WMAA 3LY8A 5LQCA 5IVKA 1OFTA 4YO8A 1TK2A 1SVKA 2P2YA 4HAXA 5HHTA 1VE6A 2VWGA 1UEIA 1NYTA 2KPOA 4I3HA 3L93A 4MMZB 2B2NA 1I4WA 1MH9A 4D4MA 3ZLBA 2X13A 1A9XB 3B6ZA 1PU2A 4ZN6A 3A3PA 5CDFE 4YP5A 4I1YA 4LC9A 1P91A 1XD2B 1XF1A 1ZC3A 2WAOA 1E1RD 1Q7RA 3PEVA 3S4YA 3GLGE 2ADOA 2I8CA 2ET6A 2PWYA 1PFUA 2XRYA 3BWXA 2YQZA 4L74A 4MLPA 1AQJA 1NN0A 2XB2A 1KC1A 1YOVA 2CHEA 4YT5A 3IS3A 4QFCA 1DFGA 1AVTA 1X13A 2WD7B 1H0SA 2F1OA 3H6GA 1A7KA 1I14A 3KOMA 4KRYA 5KNBH 4G85A 1SCDA 1TJ3A 1YBFA 2P9BA 5AW0A 2R97A 1KR5A 1XQWA 4AECA 2DKOA 3QJGA 3COVA 4Q9DA 4FILA 1G8MA 3EZXA 2D5BA 2RGXA 1BKSB 3A31A 3NOQA 2PS0A 3PGKA 5K09A 5F73A 2OCIA 2IS4A 2C4WA 4PVCA 1DCTA 1X7YA 3N2EA 1LBQA 2XUDA 4GX5A 4YO7A 1SOWA 2Q2WA 1W29A 4ICIA 3YASA 3KDAA 3PC2A 3ADDA 4MWGA 1JBEA 4H7IA 5AP9A 2RARA 1XMVA 2ODNA 4XYEA 4FFVA 4EY5A 1Y4DE 3TTYA 2UVQA 3FOFC 1ZI6A 4WUTA 5FYQA 1VL5A 5AK6A 5K45A 2D1QA 2RGUA 1NNI1 2DB3A 2CJYA 4IIFA 1K6EA 1PR5A 1TZBA 3DCNA 2CYCA 3H4VA 1J0EA 5G0UA 3TZQA 4BNXA 4XQGA 2B3DA 2J7PD 2KYRA 1OLSA 1XAIA 2EHJA 4IVRA 4JJFA 3Q3VA 2WZQA 2FAXA 2A9VA 3WB9A 2H18A 3OO0A 4OKIA 3WBBA 1I36A 1F7VA 5LYJF 1R0YA 3BE5A 1JKMA 2H2WA 3AUJB 1AO0A 2IH4A 2YYAA 4ENTA 1OQAA 2O0JA 3GMSA 3H5NA 4KV7A 4QQKA 3VYUB 3H13A 1L7EA 3EGDB 4MV1A 2DTEA 3HB4X 4V3CA 3B2QA 4K1LA 3DHYA 2UXDB 4IGIA 1O9GA 1BCRA 3QXJA 4NDNE 4XIYA 3AC0A 1HT2E 1AD2A 1GUDA 4KIGA 2A78A 5AHRA 5GMOA 3SKXA 4V0NA 3PE3A 4J7UA 2XOKD 3N6VA 3UK0A 3ZCSA 1OHHA 4CTMA 3VU9A 2QTNA 1U5BB 2CLCX 3PUZA 4FHGA 2YZ2A 1T4CA 2YH2A 3EQZA 2GO1A 3K9BA 4BC1A 2F1JA 5IFLA 1SUPA 2PQ6A 4D80A 1NMEA 2P9CA 2QSZA 4XPZA 4BAZA 4O2AA 4E3WA 1J70A 1BW9A 1GAWA 1U0SY 3EXHB 5SV2A 3BXOA 4D9GA 4ZGGA 5F2EA 1KOLA 2IY8A 4X63A 5DBFA 3LPNA 4WJKB 5LXTA 4M2LA 2YN0A 1PT5A 4C4YA 5DHRA 3B9BA 2FPIB 2I7XA 2P2CA 2ALJA 2ZRLA 4J0FA 1X7GA 3PHCA 3C6BA 4Q4AB 3WGZA 5BQPA 1ZVMA 2VK1A 4JUIA 3CWZA 1WVGA 4FGZA 2FWJA 1DHRA 2QYHA 3O0DA 4W5JA 5FIUA 2W90A 5JLJA 3SS8A 1N2HA 3D6VA 1AN0A 1DOZA 3JWEA 3MGCA 1DSSG 2PUVA 2H31A 4J0JA 4LX8A 2PY6A 1Y3FE 4X7RA 5FV4A 1A69A 5BRJA 1PWHA 3KFVA 1GQRA 1T0JB 3ENKA 2VRNA 1IVNA 2OOSA 2PANA 1J1ZA 2JHGA 1UPTA 2FSVA 2Z9CA 3JPYA 1U2EA 5K4GA 3BGOS 4CL0A 3AWDA 4MUEA 2IGBA 1C9EA 1ODTC 2CCGA 2I67A 2ZAYA 1UC4B 1ZS9A 1QNFA 4PRYA 3W3AD 1X70A 3ET4A 3RTEA 3OQMA 4ENRA 2R66A 4KYTA 2O0HA 3NDRA 4E88A 1SBYA 3HP7A 1LPSA 2H3EA 1GCAA 1SCQA 3TOXA 4M9SA 3EODA 4BV9A 1G1MA 2P40A 2XNKA 3KKEA 3T7JA 3UUFA 1HE3A 4KN5A 2AR7A 4OVKA 1A9TA 3H5TA 2W2MA 4Z9XA 3HZHA 4Y0NA 3NW9A 4JC4A 3LCVB 4GXTA 2VAMA 3PDJA 1RABA 2EDAA 1DG9A 4BO9A 1V3VA 2D0IA 4WZZA 4CIDA 3HMKA 4FM9A 1W0CA 1GLVA 4RMIA 4BB5A 2BFPA 2XXBA 4M9QA 1K5DA 5GZ6A 4F91B 4HOYA 1Q2XA 4JS0A 1VKJA 1U2GA 5E95A 3MMNA 1X7YB 2VOEA 5AESA 1BMFA 5JD3A 1E63A 1KZ1A 1EVZA 1G3IA 1U3VA 5BSFA 3COPA 3VHRA 3VU1A 3LTNC 3KFLA 4D96A 4J43A 2N1MA 1IPEA 2CBZA 2IY7A 2WMYA 3OUTA 1ONPA 4HZUB 2FX5A 4TKVA 3KEOA 1MOPA 3B1YA 5JBNA 1YF3A 2F3RA 4BPBA 3P0HA 3U60B 1YU6A 4Q18A 1RMQA 1EYZA 1DIHA 2ZI3A 3RJTA 1WKCA 3REGA 2B69A 4ZDJA 1EM8B 4E51A 4D6XA 1FX1A 4KXVA 4G1MB 4CUZA 5LWHA 3AUAA 2AN1A 3AB3A 1F60A 2YDXA 3NORA 3JWGA 3NRBA 3C43A 2XKKA 1FRFS 1FOEB 1AGYA 1J97A 1TVMA 4B6GA 5BORA 2QM3A 4NAVA 5C7YA 5AKHA 1K27A 3RSSA 3I9V1 2CXNA 2WTNA 5COQA 2GARA 2B94A 1EWQA 3TBKA 2O6HA 3UG7A 4G0XA 4JKYA 1L5GB 4FYVA 1L4EA 1C1HA 5CHEA 2VNSA 3KTOA 4M9XA 3UV3A 1RYHA 1Y8CA 2HL6A 3V3TA 2ORWA 4UEQA 4RTMA 4J3NA 1HX7A 1YNOA 3CNNA 3M9WA 1EK6A 1YQEA 1FC0A 4PM4A 1FJHA 1XEXB 4B3CA 3ID6C 4IIYA 4HXYA 3OEHA 1QHNA 2OE2A 3FDJA 3AKYA 4C01A 2G5CA 2I3GA 3DVAA 4PYIA 3RFTA 2H1IA 4RZUA 1QQBA 1II9A 3QE2A 2HTFA 2X6QA 3IODA 1PYGA 4JHLA 4Z51A 4HX2A 1Y6QA 4RLQA 4CCAA 2Q2OA 4KO1S 1PGNA 3F3KA 2RIPA 5A3QA 4KKXB 1PL0A 3SHVA 2PU7A 1FTYA 3PC4A 1E3QA 5EHZA 1ZD3A 3G1TA 2H4JA 2GTHA 3MTDA 4X0EA 2I3BA 4ML3A 1JECA 1M8KA 1CUDA 2NZXA 5CG1A 3W9YA 4MA5A 5DEOA 7MHTA 2FPIA 2W93A 3DLPX 3QPVA 5K7SA 3KETA 3IAUA 3BZBA 3RKUA 3R40A 4B7CA 1V11A 1YR2A 2Q4