2KHZA

Solution structure of rcl
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
163
structure length
163
Chain Sequence
MAASGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAGGDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAVALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKTASSSHPSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords c-Myc-responsive protein Rcl
publication title Solution structure of RCL, a novel 2'-deoxyribonucleoside 5'-monophosphate N-glycosidase
pubmed doi rcsb
source organism Rattus norvegicus
total genus 31
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2khzA00
2Q4OA 1F8XA 1S2DA 3U39A 2IZ6A 5ITSA 2PFKA 1ZXXA 5AJUA 4I36A 1MTOA 3F5MA 1S3FA 4HX9A 2PMBA 4FYKA 2F48A 2IZ7A 4MCJA 4I7EA 4JEMA 2KHZA 3O8NA 2NX2A 4NPAA 1PFKA 4P5EA 1F8YA 3IMKA 2Q4DA 1WEHA 2F64A 4KXLA 3GH1A 2F2TA 4OHRA 3BQ9A 4KXMA 1S2GA 3K2QA 2HIGA 4LJRA 3O8LA 4LJKA 2KLHA 3EHDA 4U1RA 3QUAA 3OPYB 3MAJA 4RH3A 3OPYA 1WEKA 2F67A 1KZHA 3SBXA 3O8OB 1YDHA 4FYHA 4FYIA 3O8OA 4MEJA 3UQZA 4LJLA 1RCUA 4WL0A 4JELA 2IZ5A 4P5DA 5AJTA 4A3SA 4I4IA 2A33A 4PFKA 2A0KA 3PFKA 4JENA 6PFKA 1S2LA 2F62A 1S2IA 3HNOA 1T35A 4KXNA 4OHBA
chains in the Genus database with same CATH superfamily
2HSDA 3THXB 3W3AD 1LVUA 4UFPA 3MJVA 2M1ZA 2EP8A 1PK8A 2XMQA 4HQOA 1ZU5A 1G41A 3IAEA 5IAGA 5AVRA 4S35A 3LT4A 2R6GA 3ZLVA 5F9FA 1XVAA 4Z0TA 4D9HA 1XCPA 4GMFA 4D43A 4BQEA 4PLCA 3H2BA 2EC5A 4D79A 5MN5A 3N86A 4OYYA 4QULA 4M22A 4TTSA 2TYSB 2AKYA 1A9XA 4M46A 4KLNA 4FFBB 3CZCA 1RJDA 2DKNA 1F06A 1RDFA 4KYTA 1GGJA 5J1TB 2ZCJA 2PA3A 3QZUA 4ISBA 4CIYA 3RSGA 2DBZA 3NUZA 1SD1A 3EXEB 1GITA 4DM3A 4ZARA 3AI1A 4IX1A 3G68A 1UBLS 2C2MA 2XVAA 1YK0A 2ZR0A 1TAHA 3BGVA 2FW8A 2OY0A 3DLTA 1ZH6A 1JKFA 4YRNA 3KUDA 3BDIA 4G4SP 3T9BA 4U00A 1W581 5C1IA 4ESEA 1SVLA 1KORA 5KPJA 1TA9A 4P22A 4UMVA 3VR4H 2HMAA 4XR9A 1BOOA 1LX7A 1GZ7A 1SD2A 3LDFA 1P1RA 2O0MA 2OE2A 1A95A 3R0JA 4G8BA 4GS5A 4BNKA 1ZEJA 3QV2A 1H6CA 3JSAA 3VAZA 2PHZA 4D4IA 5TQ2B 1XZIA 4US1R 2AL7A 1RIFA 2DH5A 1IB0A 2QAJA 3BDVA 3IQGX 3NHYA 5M3BA 2WTEA 3O75A 2N1MA 5I4BA 1R7RA 2HLHA 1ECPA 3FRJA 4G26A 1NF3A 1XZAA 3RRJA 4FJ0A 3PHLA 1VSBA 3GLKA 2HA7A 4QBTA 4R1PA 5FX2A 5LQUA 1E0SA 2O3SA 2P4UA 4MV8A 3HVUA 2EW2A 3OU2A 3AY6A 4CDRA 5MN4A 3NV9A 1IN1A 3ER6A 3NTXA 3SXJA 4B8YA 4C2UA 5KVSA 2JCGA 4A6EA 2PZKA 3D7RA 5DI9A 1XMOB 3IUMA 2QLNA 3MWKA 3E05A 3GFBA 3F97A 2YCBA 3KOUA 1WUKS 4HQLA 1YWGO 5DX8A 1R66A 3TZBA 2EP7A 1X1SA 2ZJ3A 4URVR 4AF6A 3WMXA 2BV3A 4RMIA 3DBVO 4O4HA 2IHBA 3VVBA 1XROA 3PEFA 4R1SA 1D1PA 1P81A 1QWSA 3OJEA 2P9TA 3B70A 3HA7A 4HAYA 3UPUA 4P58A 3ZXIA 2X3UA 2KX7A 3F3KA 1NIPA 4YJHB 1QIJA 3EGDB 5KYYA 3ERCA 3NHAA 5JO0A 2ZJ5A 2V0CA 2WILA 3NTRA 1APBA 1Y4ZA 1W1WA 3F9RA 3I09A 3OFKA 5SYNA 1QB7A 3KQYA 5EPOA 5AVKA 1II9A 2VP4A 5B2FA 1ODCA 2RHTA 4EKIA 5DI3A 1NONA 1JMKC 3LT0A 2A5FA 4RESA 4MPPA 4BO5A 3QELA 4Z5XA 1VJTA 2XMPA 4XLZA 3WWOA 3KXKA 3QRWA 2IOYA 3OD5A 1V1RA 1RLMA 3C1AA 3HNOA 3ABZA 3BBPA 4R0VA 5K09A 4QUAA 4R2WA 1C3XA 4XDHA 5AICA 3TKLA 4UMEA 1ZI6A 4W1RA 1SXJC 4I4NA 3AZQA 2VHCA 4OJTA 4H4EA 4DUYB 5FYQA 1FRNA 1Q6ZA 4E3ZA 2ES4A 3PB3A 4D9JA 1E2JA 2PUHA 1JNYA 4RAQA 2PANA 1FMCA 4L75A 3IKLA 4R9UC 3WYGA 4W99A 4MGHA 4RVHA 4UOZA 2Q1YA 2PDAA 3AZPA 3EG9A 3INRA 5EESA 4F2WA 4LF8B 1L4LA 2QJWA 3KLBA 4QZVA 1FU4A 2Z95A 2IY9A 3INNA 1JQJC 3I05A 4L3WA 4ENQA 4IDFA 1NNEA 3C5WP 4UHKA 2J0QA 3D0QA 1MAAA 2YY5A 4RW0A 4RZIA 3KOWA 4HL6A 4YS6A 5ES3A 1OIWA 1PG2A 2Y1GA 4OK3A 1DINA 2OG2A 3NATA 2OHFA 4LXUA 4O1IA 1GZ3A 2B8EA 1JBKA 2JI4A 3OOSA 2PMEA 1GT91 1ZUIA 4CTOA 3PQ7A 4L5BA 4DLTA 1QK3A 3I37X 4F6RB 2W9XA 3VZQA 4R5HA 3PNVA 5JH7B 3ESRA 1FX0A 4JYCA 3L3BA 4LEIA 2CCKA 2F1OA 3SE7A 1T29A 1BS2A 4WKGA 1ZK3A 3KB1A 4H7EA 3U4HA 2I4MA 5CA1A 4B6GA 3LF1A 5T57A 1WDLA 4GPZA 2XZPA 4LRTB 4TRRA 3CKLA 3EXFB 1WL8A 3NYRA 3B2NA 1SIBE 3K0KA 1Y33E 2H7XA 3EISA 3I2HA 1MQAA 5CB8A 3K0AA 3OO1A 2QTWB 2X8AA 3P71T 1BN7A 3CM0A 2MJLA 3ZWCA 5LA6B 4BXOA 5A4KA 1RWKA 2ECFA 3GLQA 5E8JA 2FWBA 3E9NA 2V55B 3BERA 1J8FA 1TCCA 2P2ZA 1IBRA 4FI3F 3WKCA 4ENUA 4D3ZA 3VTFA 1KI9A 3AT1A 2C2BA 4RGYA 4D57A 1YRYE 2JFBA 2OOSA 2XI4A 1QCYA 1GARA 3CNBA 3F2VA 4BTEA 1DEAA 4F5WA 4QNNA 1KZYC 3JQAB 3VV2A 5LKRA 3GLFB 4MDFA 5EHZA 4G0WA 1F1BA 1VYHA 3E82A 2OP1A 3PPXA 1QH1A 2CE2X 2C07A 4YRJA 4QELA 2XOKD 1RT9A 2C7GA 1O3YA 2P1DA 3H9GA 3KC2A 5DNDA 5JRDS 4D81A 3NVDA 5FUQA 3B38A 1B0AA 1IM5A 1X15A 5CUQA 5CTJA 4X20B 1E92A 4RZQA 1ZY2A 2EZ4A 3PUZA 4LJLA 4MK4A 2HMSA 4CHGA 2OO5A 2VDLB 1MIOA 1EGQA 4WNCA 2HL6A 5K1ZA 5ISMA 2ZIXA 2GD0A 2YOGA 4XFKA 2BHTA 3GRVA 3E4DA 5LP6C 3C87A 2HEIA 3DHWC 2WB2A 1OKKA 3U7EB 4ZJZA 1X9GA 2ANBA 5MDHA 3DONA 2SCUA 1T25A 4JSYA 5ER6A 5LA6F 4DILA 3AVVA 2QL7A 1T36B 4NZNA 3UAOA 3IIMA 3QPDA 3MCTA 2CJPA 2H1HA 1OTXA 2NU7A 4QOJA 3A2KA 3BWXA 4OQMA 3B6EA 3DWEX 3L0SA 5DBEX 2X58A 1LRKA 2HGZA 4KQXA 3GB9A 5HQJA 2FRDC 2CC2A 2RCYA 2VDVE 4NF2A 1CS0B 2G77B 2X0EA 4AULA 1N0UA 1OU4A 4FMCB 1OXKB 3EAQA 5BOSA 1EHCA 1DBRA 2P40A 3B6KA 1NVKA 3DXZA 3KKPA 1JW9B 1QFJA 3PK0A 1B8UA 4US0R 3KXIA 1I5RA 2JIZA 2PZ8A 1E9AA 1DX6A 4KTTE 3RRZA 5IP5A 2AYZA 4NQRA 2CB9A 3H97A 5EE0A 2B8TA 4YTEA 2DLDA 3CONA 3TSAA 7AT1A 4WVFA 5T4HA 3H0KA 1AV6A 4ENTA 2ZAGA 3MOSA 4GPIB 4MPTA 5TMBA 3UT5A 4BFYA 4YRMA 4QDKA 3IBCA 1V1MB 4J6EA 3WYFA 4ZK6A 5EGNA 4K46A 4CMIA 1NG1A 3ZWOA 1J0XO 4FX2A 1JVNA 1VRCA 4LZLA 1XKLA 4R5MA 2X0JA 1ZP6A 2VOEA 5GGXA 2XTNA 3OQ6A 1DFGA 2FDXA 3R0QA 4K9SA 3T4XA 1BU5A 3HDJA 2Y77A 4YRCA 4HVAA 4MIOA 1E4EB 3BPSA 4H3VA 2ODEA 3VNQA 1VMDA 2ODPA 4BJ1A 1I2MA 1KQFA 1W2GA 1PKXA 5G3ZA 1E6UA 2JIMA 4Z9BA 2YWDA 5CAEB 2NO4A 4UU1A 1HT2E 4RXUA 3T3HA 5HXAA 1CUEA 4Y98A 2CXNA 5HKAA 3M5DA 2AJ8A 4Q9LA 1NRWA 4P80A 1Z0SA 3BK1A 5CX1A 4BNFA 4CF4A 1OREA 2XBUA 1GGVA 4J0HA 4PSAA 4QU0A 3W6PA 3ZHUA 5AVJA 2Q5QA 3LHDA 5TE9A 2IPOA 3CC8A 3FMVA 3HWWA 1ORWA 2O06A 4CEIB 1SKQA 3H65A 1UJ5A 1KK1A 4I50A 5HVNA 3GA0A 3DQPA 1UKVY 1K8XB 3OVMA 4Y8VA 2XSZD 4HQFA 2HSZA 2NZVG 1KI8A 1P44A 1KY5A 3OSZA 4DB2A 3VNVA 1DAMA 3HCFA 4F4HA 3O2NA 4P36A 5JY6A 4I4LA 3VYRB 1SBIA 4C5BA 1VG8A 5DNWA 2R00A 3ZXUB 4W5QA 4N41A 4HAUA 4W7SA 4BQOA 2W71A 2XVYA 5H16A 2X6RA 3L49A 1YXMA 1C4XA 1EDEA 1CLUA 3OBIA 4B3JA 2OORA 2YASA 4KI7A 3RBVA 4Z51A 2EFGA 4BZWA 4D8TA 4MWTA 2DXIA 4KB5A 4U4AA 5ICMA 1SVSA 3O8QA 1NMYA 2G5CA 4CMEA 2J0EA 1O1YA 1YD7A 2OBBA 2QX8A 2VL7A 3EMBA 3AV0B 3JU3A 3Q87B 4LK2A 3VXKA 1ZRMA 4MLDA 1OF1A 3CCCA 4I3FA 4I4TB 1Z5GA 2A7QA 4KEAA 3ULKA 2O5RA 2V4MA 4BNYA 3TVYA 4WJLA 3FB1A 3VJKA 3W6NA 2J4CA 4PSDA 1G3UA 5K3EA 1CDDA 2A7XA 3UJNA 1SAYA 4I5IA 1YE8A 4A03A 1BXGB 4OHFA 3LXRA 1XSEA 3N3BC 3TW8B 3VSCA 5IULC 1YH3A 1JDPA 5LOVF 1A2OA 3DZGA 4PRKA 1IY1A 4K9PA 4RNCA 3VJRA 5C3MA 3RFXA 5DV9A 4F5ZA 1ACJA 3X1JA 2YVKA 4WKPA 4OFXA 2P4EA 5TPWB 4Q4JB 3UIEA 1WDKA 2HJGA 8ADHA 3OFSA 5BYJA 4BC0A 2E89A 1AQNA 3D43A 2WB4A 3DC2A 2W8BA 2WRZA 4XIFA 5FEMA 2PRZA 3KOMA 5JRJA 1U11A 3RIMA 4QT0A 3O91A 3ZXSA 2OAP1 3BXHA 1G20B 1XMXA 4I4TF 4IV5A 2D7JA 3FYTA 3I53A 4OGKA 3E53A 3K0EA 2Q2VA 4Z7JA 2GGSA 2X4LA 5DO9A 3UHPA 1EFDN 1MABA 2BLLA 4O33A 5AW8A 3NTOA 1OXVA 3A70A 3HYSA 4NCAA 1P73A 4DEXA 1VTKA 1HSOA 4ZYTA 3PITA 2AMVA 4LX8A 2KSQA 3FCYA 2I91A 3ZHXA 4HDRB 2XCRB 1XAJA 3ESQA 5JZOA 1G5IA 2JRLA 3TIVA 3ZIUA 3MG9A 4IDEA 4QUDA 2C5GA 2OWDA 2UVDA 3ORYA 5SV2A 4EJSB 4E11A 4J29A 3CLKA 4PXSA 2FXIA 3DLCA 3CKKA 2I34A 1FDIA 3EZ6A 4ILEA 1KWGA 1MZPA 3EEBA 1R27A 1Z7BA 4F2HA 4PRYA 3TEMA 1PX2A 1C1XA 4RJKA 4QBFA 1UJMA 5HF9A 4MP3A 1ORIA 4O2AB 4KQHA 2AYXA 3H9EO 1RP1A 4ZC1A 3VTAA 4O2RA 2WZQA 4FYYA 2IHNA 5BSUA 2F2TA 1N3LA 1X70A 3G85A 3ESDA 1PFUA 1QHFA 1JKMA 1GUYA 1QIHA 3OE4A 1XQVA 2PZGA 4GI7A 4H7IA 4UU8A 4EL5A 4DQXA 1NULA 4E32A 2IGBA 4F97A 1U8UA 5CP8A 3V1LA 4UEJA 3R20A 1QVVA 4RFVA 2WOJA 2H31A 2P11A 5EVJA 4TWBA 1JQAA 1U1FA 2YZKA 1BHQ1 3VPGA 1Q6YA 1FTNA 1L4HA 1WXFA 3A2NA 5IJZA 3KWFA 5EOVA 1NJ1A 3VH3A 4XVQA 2FUEA 2R00C 3NBFA 2EHJA 1Q0SA 4E7OA 2QZ9A 4KN9S 3PFCA 1NLMA 2Y3IA 1EK6A 1Q0PA 1LPAB 1U8CB 3L7CA 4UVEA 1GZVA 4K1XA 4DDHA 2G9VA 3MERA 2A4KA 4Y9UA 3KR0A 4OAQA 5AKHA 3RRYA 2G67A 4CMEC 1D2RA 4O2AF 2VA9A 5LPNA 1JDZA 1ZNQO 1UMDB 4DT1B 3M49A 1I3LA 3Q9NA 3UFBA 3WIDA 3OCUA 1GLNA 1E1RD 5FOWA 3BMNB 3SOZA 2BONA 1UKEA 1KEZA 1RQNA 1AQ6A 3GVPA 3O03A 4KHZA 5E7MA 2IPMA 1O4WA 4I0WB 2EFCB 4Z2YA 3WK9A 1UDWA 1Z56C 1NBIA 1V37A 1WF6A 3J81A 1KBOA 3L0YA 1ORTA 5EFOA 2J7PD 1QFZA 4RHCA 1DC7A 4TQ9A 2X5XA 3HUFA 3LE8A 1CRQA 3ZU2A 2I7VA 2VF2A 1IULA 4JOCA 4BVKA 2ZRFA 5D00A 1ULAA 1WB4A 2ASEA 4KDFA 3FUTA 3UK2A 3RTEA 1YB7A 2HV9A 3EXG2 4HTFB 4RHXA 4WOBA 1K0FA 5DMXA 2RH9B 5BWCA 1KVSA 4HDKB 2ZYHA 4RK6A 2MR5A 3QX9A 4RBNA 4QTTB 1MORA 1GY8A 1UIMA 1JG3A 4HZIA 5GJWC 4HNAB 3WDMA 4E5NA 3BC1A 1ZG3A 2BEWA 2CL0X 3RSOA 5KQMA 4GH5A 2C8JA 4JEUA 5AW4A 4CU5A 3L9XA 4PLGA 1FP1D 1TECE 4MMZB 1KJWA 5BW4A 2UUAB 1VCMA 4UTXA 2GEJA 1YMUA 2BFBA 3EAGA 3NPMA 2CVFA 5CNIA 4LJ6A 2YR0A 1D6JA 1NJGA 3E9QA 4R2KA 4EHHA 1Z6QA 2V98A 3T1HB 2NTVA 9ATCA 2J87A 4WZ6A 4XZ3A 4ND2A 3W2EA 4ZVVA 2WJ6A 3LRXA 1S8OA 4J4BA 1UDRA 1T0HB 5DTEA 4AXXA 1F2VA 4QGFA 1VLHA 2I87A 2VUSA 2XH8A 2QLBA 2JRCA 1AS3A 4EUHA 1ESEA 1OWLA 3AHDA 3GQBA 3N76A 4HWSA 4BRSA 5JNUA 1HFJA 4CLRA 1ORVA 4EKGA 3V8VA 4PZPA 3BSWA 2Z5FA 1DTEA 4NPAA 3B89A 2UXBB 3X1MA 4IJ6A 2AUMA 3PL1A 3AEQB 5A5DA 1GV1A 1UDXA 4TS4A 5FLKA 4KVAA 1M2VA 4RMNA 2VYVA 4BGIA 2Q0QA 4Q93A 4TYPA 2JGIA 3T6KA 3GDHA 2V9ZA 3N7TA 3TRHA 2H7VA 4M7OA 1JIKA 1P1KA 3GZTB 3ZJVA 2EJBA 5EIFA 4FYWA 3ZNPA 5J2UA 4I1IA 2CXRA 3VHXB 3TAHA 2J9XB 3OPVA 4IPTA 3RG8A 4C2AA 4HGRA 1W47A 4MVWA 2GF2A 3KLNA 4CLEA 2B2NA 4I3GA 4CLHA 2YHBA 1EXVA 1NLYA 3TFQA 1FXSA 3F90A 4QYSA 5FULA 3WGQA 4AM8A 5IJ9B 1VG1A 5KNBH 1EFPB 3Q2IA 3S1AA 2LDBA 3Q7SA 2FMHA 2XITA 2Y93A 3VYUB 1IONA 5KYUB 1Z0ZA 2QIPA 1MC8A 3RQSA 5EC8A 5KKNB 4FNAA 2EKDA 3L46A 4J0QA 4OL0A 2ZVQX 2PTGA 5DP1A 4UDYX 2GS9A 4FS3A 4DZZA 3KQVA 2OHJA 1KDOA 2IU4A 2WM9B 3ROXA 3V4PB 4ZZ3A 5JZSA 3KRTA 4Q1FA 4K26A 3V1MA 1T4MA 2C5AA 3VI4B 3OZVA 1PSWA 3ADBA 2Z6VA 3A9SA 3GJYA 1XKTA 3VOTA 3WL8A 2GCGA 4ZALA 4AECA 2GZRA 3IMEA 2HA0A 5ALKA 2O3TA 3GNTA 4MV7A 4I5FA 5K0LA 2OUIA 3G8AA 3PX3A 5HZMA 3U4IA 5JADA 1A2KC 4K2AA 4ZOCA 2R1ZA 1N8NA 1KDRA 1YIDA 3K5PA 4KVFA 4X7RA 1C3LA 2HJ9A 4ZT5A 1KQ3A 1O6GA 2I1LA 3AYZB 2IIQA 1IZ9A 3I2YX 4JFRA 1EUDA 1I1HA 2VSOA 1ICEA 1ZKDA 3LW7A 3VO1A 4EKYA 5LLDA 3K20A 1TPZA 3ZVKA 4OHKA 4L5AA 5IBQA 3KVOA 1I24A 3ZQJA 4FFOA 2GD2A 3GJ7A 1T9CA 4TGLA 5F7XA 5IWCA 2IOFK 2JGEA 4H4CA 3ZY6A 3E0QA 4O4IA 1HYEA 1QHSA 2Z8XA 3W8RA 4CBVA 2WE7A 2XDAA 2PZEA 3NUGA 3ZWXA 3U0BA 3B13B 3E5NA 1YRQA 1NVAA 2O1EA 3WGOA 1S2LA 4F1WA 1OZFA 4KQ9A 4EDHA 3GDFA 3CVYA 4QYTA 2DUUA 2JHCA 3E7WA 4I4CA 2YWFA 5JY1A 2ISCA 2Z3WA 2I99A 4OXQA 1TQDA 1U1CA 1IHYA 2JNWA 1VLLA 5I47A 3K71B 5J5AA 2EJVA 5FFNA 1JHPA 5TJHA 2NZ8A 1YR8A 1BMFD 3L8DA 5LNK1 4QVGA 5K2MA 3EDOA 2CJFA 4PQEA 1OX6A 4TZ6A 2IUSA 2NUPB 4CKWA 4IJMA 3Q7IA 2CVPA 4LGYA 3DDWA 2ATEA 3PCRB 1Q14A 3HO1A 2YOFA 1RCTE 1ODSA 4HDAA 3M9XA 3GBSA 1NXXA 5H3HA 2R0QC 2IBSA 2I7CA 2DR2A 3IAXA 4CR7A 3AGQA 1H5NA 3U16A 3U7GA 1QHHB 5D8DA 3ZHCA 5A9SB 5IG2A 4IGEA 3WAJA 1U1IA 5IFKA 5IBCA 1NJSA 2ZOSA 3C39A 2H63A 1FW8A 1Y8AA 2IBTA 4MLCA 3HA5A 1U9JA 5D6OA 2OCLA 3RODA 4MQEA 4FYPA 1GNTA 1KAGA 5DSZA 4Q03A 1IQUA 1RBZA 3VAYA 1I7LA 4EO9A 1RPAA 2W83A 1DX9A 4BNIA 4DZRA 2VDJA 2QR3A 4OQ4A 4EYGA 3NHMA 1PSDA 4C4OA 1K08A 4C05A 4FZ3A 2HX1A 1CIJA 1J8MF 1LBEA 2X8BA 3A4YA 4WK2B 3ZCUA 3TD2A 3WICA 3GLIB 4B3GA 1XJQA 1ZLYA 2RGBA 3PHHA 5K8CA 4INOA 3WJ1A 1AK9A 3FGNA 3ONFA 1XYYA 3SJAA 5BV8A 2BJWA 4UD2A 5EUMA 1SU4A 1P0CA 2QAGC 3K0FB 5HUHA 2C7VA 2GPAA 4JOBA 1Q7BA 1U2EA 3OPYA 4J0CA 4BP1A 1FTGA 1K97A 4KNWA 4RTNA 1OFVA 3KM0A 2C0CA 2WLTA 4CR8A 2JBHA 2Q3DA 1VHJA 4Y6OA 3STTA 4Q3LA 4UQLA 2CJWA 3T4UA 4RKYA 1TJ4A 1H9AA 3AI7A 2H92A 3ED5A 4FUTA 3TQIA 4N6OA 1A76A 4CVNA 4MVJF 1JIQA 5FWNA 1G16A 2FZLA 2O7VA 4J03A 1YB5A 3OQPA 2GR9A 3HXLA 1N2XA 3F8WA 3D6TB 4AJKA 5AVTA 3ICWA 5F78A 5HM8A 3U60B 2ET6A 5TLSA 1IYZA 3IMGA 4X1IB 1Z3CA 1WY5A 5L3QA 3M4XA 2AN3A 3QVLA 5KTSA 4WWHA 1BXZA 3V8NA 1IK4A 3E15A 2AVNA 3GMIA 3HE3A 4Y6QA 2WFMA 4YI3A 4DL9A 1FVFA 1Z2DA 1J56A 4FLEA 1J2EA 1E1LA 1RMQA 1M73E 2B98A 3CRRA 4Y2PA 1RYYA 2EZ8A 3HKEA 2FK7A 3KLMX 5IKPA 5KOHB 1TEVA 2K5UA 1O9GA 2CUZA 3PFKA 4M9QA 3UB4A 3IP6A 3L82B 5CM9C 1NYRA 1Y1LA 2B30A 2IKSA 4ZVMA 1KDVA 3W6ZA 1EFRD 3M1IA 2JFHA 1EP2B 1ISPA 2A78A 5L7YA 1A4RA 4QHYA 4YO7A 4EKEA 4MINA 1Z0IA 1KAQA 2IYWA 4XD7A 3OE5A 3SICE 2A9PA 3V4SA 4ZIRA 1A98A 4DKXA 1VE6A 4J8PA 3BD9A 4E31A 2NP6A 4G23A 4RTRA 3A04A 1I6WA 3OESA 2NN3C 5IHXA 4A1FA 2EG9A 3CURA 3P1JA 4KE6A 2O8FA 3ZWYA 1ENPA 1GG5A 2DR0A 2X13A 2Z2KA 3PNOA 1U0JA 5C4IA 2RGYA 3JWEA 4RY0A 5JCXA 1CEQA 2W2OA 4G0PA 5DDIP 3FGOA 3Q6MA 4ZAYA 1C0LA 3J7TA 4F45A 3WZLA 1UL1X 3CF6R 4AU1A 2NU9B 1Y5LA 3RAPR 1PP4A 4DG8A 2FPUA 3OHSX 5U9CA 3ZW8A 2RGWA 5B6PA 4WXMA 2ZYDA 2WF9A 3QTLA 4DB4A 1EBFA 2WAAA 3CBGA 3DBLA 3E1KA 2C3UA 4NPHA 2DSTA 1IZZA 4P32A 1MGPA 3BWDD 2O8DB 2XVXA 4HZGA 4G67A 5HJ2A 3FOFC 4FFRA 1CJCA 1NV9A 2GWRA 4H17A 4HVTA 1RKUA 2QN7A 3BMCB 1GRNA 3FWZA 2PUEA 2DQSA 1C80A 4UNNA 1JQEA 1KY4A 2GYWA 5TGDA 3KZKA 2B94A 1JAHA 3DP7A 3UKDA 1QXSA 2Z2JA 3GRPA 3JQ6A 4DR4B 1GL3A 2QTMA 2OBLA 3VKVA 1EQUA 1FNSA 3E3LA 3I6IA 1QO7A 2I2WA 2GM9A 3EMVA 4RAOA 2H1IA 4JY7A 3QVGA 3IVAA 3KKLA 2DCUA 2X1MA 3EF1A 3H9BA 2QROA 3PIDA 5AKYA 1E9RA 1QRUA 1OTYA 4EY5A 1HYBA 1OXTA 2APJA 2QWXA 4JYBA 2PGOA 4P35A 3WLAA 1AQLA 3H2KA 4GXNA 1PS0A 5C4GB 1FB5A 4JVMA 4DLYA 3NBKA 1IPFA 2AUTA 1BEUB 2GZ2A 2ILVA 2VLBA 1VYUA 3B3JA 3DAPA 3I92A 3GFPA 4RIGA 5DEIA 4BVHA 5E2IA 4OHCA 2WEKA 3DKPA 5EMNA 2RHMA 1F4LA 1P0PA 3O8OB 3KO8A 4JP1A 4IFEA 2HHLA 1K8YB 1LFDB 2C3YA 3UGQA 3RRNA 1TYCA 3LGAA 4QTUB 1VPWA 2ZTVA 3GLVA 3LVBA 4YIHA 3EAFA 3LUAA 3S1SA 3IP1A 3IC5A 4AJIA 3NWJA 2HN9A 5A7HA 5F1PA 1VIDA 4EB6B 2V7QA 1EYZA 3AW8A 3ZWDA 1JIVA 2P9EA 2N42A 3PNKA 4JJFA 1QS0A 1WHSA 3EY4A 2VDKB 1AOXA 2RGNC 3SY8A 5CVVA 2COKA 2A0WA 3WWPA 4F91B 3ZGLA 1MN6A 4JLMA 5EMKA 2J48A 3ENVA 3H11A 1IG3A 4BRWA 1KFKB 1SXQA 3QPCA 4H3HB 1I30A 3QY0A 3OP4A 5F2NA 2C7PA 3H5AA 1LK5A 1V41E 3HVJA 3IOCA 2BKEA 4NATA 1NBOA 3WJAA 5A5GA 1N2GA 1Q3HA 1JQBA 2D0OB 4XSVA 1XXHE 1KQNA 1ZL0A 3CG0A 3L02A 4LV6A 5EIXA 3KJNA 4TS9A 1IXKA 2ZIZA 3TQOA 2O59A 4OHBA 1YZ3A 3D64A 4DCGA 1FLAA 1NM5A 1SXJB 3R0IA 3QIVA 3EH1A 2PEZA 3LVFO 3DNFA 5DM4A 4KQCA 3BIWA 1D5CA 1DEHA 5G3YA 5E4TA 3KB8A 3FCEA 5CK5A 4JWKA 1QG4A 5AJUA 1JDSA 3IUYA 5HRAA 4QU5A 4DBZA 1AHPA 2YHIA 2ILTA 3TRDA 3OCYA 3FHTA 4MRAA 3T41A 5IKOA 3OQNA 3WRWA 2HXGA 4J0IA 5EZQA 4QXPA 3TBKA 4DCTA 4R9VA 4O4JA 3UOGA 3NGMA 1DCKA 2C4VA 4LJ8A 4BO6A 4CF6A 4E2FA 1FYFA 2A0UA 1ZSYA 4NEHB 5EKTA 4B4VA 4EGFA 2F3PA 3TZKA 1GUAA 2CGEA 2IS1A 4NENB 1RC1A 2VQ3A 3OMXA 4Y6PA 3W1WA 1IHUA 1P7PA 4R8MA 1F6WA 3LY9A 4XVUA 3Q1LA 5IFLA 5EZ5A 4DR6B 2E7ZA 2OUKA 4QLAA 3WLPA 4ATNA 1YFLA 4MA4A 4LY9A 4NEQA 3AILA 3VA7A 2PZLA 3MJSA 3UANA 1GTMA 2C0QA 3OI7A 1C9EA 2GJSA 3DHYA 3HH8A 4HUJA 5CT8A 3QBTA 5TNXA 1V11A 3KEQA 1HLFA 3CPHA 1MXHA 3QK7A 4MTLA 5H02A 3WQRA 3IAHA 4CIVA 1O89A 2QMUA 2FPIB 1R4ZA 4F2DA 3LZ6A 1ABBA 4MHTA 3PQ3A 1BN6A 4MV3A 3TE6A 4IUBS 1XMQB 1P2FA 3C4QA 3DKVA 1ZHFA 4QYWA 4B80A 3CT4A 3T7AA 5INTA 3ZZNA 3PEYA 3FPSA 2NV6A 4PXYA 3QFCA 1GAXA 4BLSA 1JQKA 3R8CA 2WJGA 2XCLA 3QU7A 3QUAA 4JJIA 2YBDA 4KC0A 5H9VA 2YMPA 1KSFX 3EULA 3DFFA 3I04A 4Q4AA 3VC7A 3H13A 5BQXA 3OZWA 5KOJA 2GKOA 1X9HA 4HMQA 1U4OA 4B9EA 3IV9A 4IIUA 1YS6A 3M83A 2KBFA 2OHIA 3B7WA 3H7AA 5FORA 3TW4A 1S4QA 4OAOA 5HP4A 3MTAA 1F5NA 2RBKA 2F3QA 2FVXA 3RS0A 3CKMA 2PH7A 2OAEA 4ODIA 3TMAA 1RLUA 1J39A 4HH1A 4PQYA 3K4QA 1RJGA 2JFFA 1N7GA 3EQ7A 5IWAB 3HPRA 3TGLA 4Z49A 1G9SA 1OYVA 1X7XA 2V4ZA 4MKGA 4O4HB 3VKFA 2JK1A 4GE3A 4V0ME 2FMFA 2OESA 5DNUA 1ZQ1A 3AF5A 4Z4GA 1U8EA 3NAGA 3RT7A 2C98A 1B76A 1FDSA 4MYHA 2XUOA 1DVRA 3VUEA 4O0LA 2L17A 1M8PA 1N6OA 1E2GA 1J5XA 2ZYUX 4JP2A 4AZWA 4CN9A 4EEXA 5LP6B 2M6SA 1P31A 2F8SA 1OWOA 2QY6A 4EUEA 1BVYF 1KJQA 1SVOA 2ZRAA 2VIIA 4MNTA 2DRIA 2G88A 4QJBA 4BLQA 5A5EA 5TQ2A 5FADA 1VPTA 1F3LA 1FP4B 1Y1TA 5DI3B 1VBFA 1WB5A 5H5JA 3WLIA 4EZIA 3QELB 1JG2A 4ND5A 1GU7A 4G6ZA 2RCNA 3DZ8A 4NAVA 2Z5LA 3EPLA 2YWCA 3V4ZA 4OQQA 5HMMA 5JARA 1L7AA 1HK7A 2XNSA 4G0NA 3JQCA 4GR5A 3URMA 6CHYA 3H6KA 1XN4A 3CO5A 3EC1A 3EOAI 2C7RA 1E6WA 1K75A 2J08A 2GTIA 2V58A 1GNSA 4TMZA 2XJ9A 4DPMA 3I3SR 4O4HF 3DFUA 3L9WA 4BMXA 2BFEA 1DAFA 3S5JA 3PWSA 3H8SA 1M0EA 3ESBA 5ALPA 2RAUA 2WJWA 1QH8A 1C3EA 3AR4A 3IUBA 4CLOA 4KAJA 2MSEB 2I80A 5BSFA 4Q9NA 1OI3A 1HG0A 4M1SA 1H2BA 3QWAA 1SY7A 3OEED 5C81A 4M1MA 4HNQA 3AX6A 3BILA 4TZKA 2BT4A 1M5TA 4FCWA 4EI8A 1MA0A 1HT3A 4TLEA 2TRSB 5AM3A 3MOGA 2AF3C 4H7HA 1OAKA 3ZZUA 1XLTA 1XZMA 3CWQA 3ASUA 4IUCS 4LRYA 3A9VA 5ILOA 2WD8A 1FX0B 3S7TA 3WMWA 4HUQA 1V2GA 4YN3A 3C7AA 5CB6A 2A4MA 1DKMA 1J97A 2HMVA 4KLAA 4AURA 4BJHB 5DHAA 3U37A 1JWLA 2OGWA 1U0OC 2AN1A 2PH1A 2FLKA 2WVAA 2GUGA 2HCRA 3FTCA 1C9NA 1JXOA 4J07A 1JTVA 4P92A 3F96A 4WESA 4AZTA 3HLYA 4Q05A 5SYMA 3COVA 4XRGA 3BXXA 2N1BA 2FN7A 1H8ED 2B5WA 2WYOA 4Q0MA 4YJ3B 4W7HA 2QQ5A 2UUPA 3A6HA 2FFJA 4JUIA 5LL6P 2K7FA 1WQ1R 1NY6A 3K0AB 4AZ3B 2ZI9A 1T4CA 3LV8A 5JS6A 4BXOB 1G8KA 2ICAA 3CEMA 4NS1A 2P62A 3AG5A 3WGHA 4L7VA 4CQMB 1E0JA 1Q83A 2Q46A 4BVEA 2C78A 2W6ID 2QS9A 4BFSA 3GZNB 1L7PA 3AJRA 3OTHA 4R0NA 1M5UA 2FKNA 1HURA 2V9PA 1F7UA 5HILA 5HKOA 1TO1E 3GJ3A 2C2WA 1FSSA 1I7PA 4YDRA 5E1OA 2EZ9A 3I2KA 3O5AA 1QH1B 3HCAA 1S6YA 2C03A 3WDSA 1X1TA 1XU4A 2Q8PA 5CA1F 1CEYA 2NTEA 4IJVA 1VM6A 1DIGA 4RA6A 4MVJM 1ORDA 3NRJA 1H0KA 4JLKA 3ZU6A 2G3YA 1RCFA 5SICE 3WLNA 2GSWA 4JCCA 3LU1A 1MIOB 5JD3A 4G5QA 3TOCA 4X8MA 1ZN2A 2WAYA 1GFZA 1SC1A 4DCCA 2E4WA 2QDKA 4JT2A 1G5RA 1S7CA 1M2FA 5K0BA 1S3IA 4IGFA 4R01A 4XDGA 4RA9A 2Z2XA 3UAWA 3DOUA 4B45A 2RHOA 4RE6A 2SCUB 2DOKA 3QE2A 2DQZA 1JR6A 2RHBA 1XP8A 4URXR 4PC2A 4Y2SA 3FCUB 2NU7B 1EVEA 1QGAA 2NYVA 4FE7A 5SZHB 5JR3A 1GLVA 2XKJE 1PQYA 3ZV7A 5GY7A 2IEYA 5E1DA 1Y1QA 5B5SA 3G9XA 3QE9Y 2B5VA 2ERYA 1P5JA 4JR0A 1EIWA 4EAAA 1C7RA 4Z6KA 1I8TA 2Q2WA 2G82A 3SC2A 1OY1A 3A4NA 3VPHA 1Z08A 3UMRA 3DZBA 1UBMS 1U2ZA 2XOEA 3GAFA 3KS9A 2BHLA 1OLUA 1PL6A 2BGIA 4BTLA 1G17A 5ADUS 2BGGA 4TYYA 2WJPA 1NGSA 2CW5A 3DL0A 1KE1A 3K1AA 1EK5A 5K51A 1J0BA 4BNDA 4KO2S 5E7IA 1JH8A 1MAWA 3CE9A 4JJKA 4JC8A 1F12A 1GAJA 3BXPA 3GUHA 3MTEA 4R2MA 4V02A 1R2QA 3G2KA 3LUCA 3PENA 2G9UA 2NO7A 4TKVA 2Z1NA 3WB1A 1HE3A 4CMIB 1J49A 1BXKA 3DAYA 3G13A 3IAFA 1MO4A 4D8YA 2I62A 5HJEA 3STVA 4E4RA 5AKKA 4D3DA 1B4DA 1XLTC 3AR3A 1TLFA 3MF4A 1Q0ZA 3H5NA 3LCJA 3N8IA 3NALA 5DYNA 3V97A 4H15A 1CUWA 5KX5B 1O96A 1B2RA 1U99A 1OFUA 4RLFA 4GSYA 5JAQA 4S24A 1NPDA 1RHKA 1EWYA 2IUYA 1ZMBA 3GJZA 1Z4QA 3JD0A 3IMFA 4G5YA 1UBHS 1TW2A 3I9KA 2AXEA 1NIJA 1UK9A 3DMFA 3P0HA 3PA6A 1YS9A 3JQRA 2BM8A 2RGDA 1XDWA 1BW9B 4LSZA 4WNAB 5CX1B 3RVPA 2P3OA 5IPFA 2V8OA 2ZUEA 4C3OB 4P7BA 4OLHA 2XUGA 1AZTA 4NR0A 3MELA 3AF0A 5ALWA 4I9NA 3GPLA 4XYEA 5DRTA 3WL3A 1RYFA 4CYMA 3D3QA 1NBME 1U65A 3QGMA 4I50B 1TEXA 5CCXA 1A2QA 2R4TA 2I76A 3WWCA 5M04A 4N7BA 1PUXA 2VZLA 4G1VA 4QUJA 2QJTA 1CS4C 2WP8J 5B12A 4ZT4A 1XCMA 1WZUA 2WTAA 3LLUA 2C2ZA 5BR8B 5EHQA 5AW9A 5LDGA 1WKVA 3I9V1 3OCVA 2HWUA 4BO4A 1HUQA 5LZ4A 5LSAA 1KFJB 2Y1CA 2RFLA 3BEOA 3TRJA 3WLOA 1KEPA 4D9BA 5IW8A 1WEKA 3L6EA 2CVQA 4M9XA 4TTJA 4BY9E 4LYDA 3JD1A 5CCDA 1IL0A 4AYXA 3QTTA 4G0VA 3C8MA 4LXYA 5JEDA 2I7TA 2WDZA 1GADO 3A2MA 2ID8A 2A57A 3O8QB 5ALGA 5AVXA 2HNKA 4B82A 4ZVRA 4EF6A 2UYHA 4FOPA 1QMGA 5JYEA 1NMEA 4IVRA 2PT5A 4FC6A 5CXSA 1MD9A 2H2DA 1W6RA 5CIYA 4AO8A 4E22A 2G08A 3QWIA 3K32A 4I50F 1ZIXA 5DULA 4HVCA 2EATA 2HU8A 4ZMRA 3ZNOA 4TWZA 1IN6A 4RQTA 5DNAA 3SXUA 1RXYA 2FK8A 1XQYA 4IIJA 1RYDA 1W4CA 4XUGB 9GPBA 2AOXA 1ZGAA 3C6MA 3G02A 1TEHA 4LVUA 4NCBA 2V7WA 1JIJA 1P77A 2HTFA 5J58A 1AMNA 1BKSB 3AR7A 2OB1A 2UV8A 3FFAA 2I2BA 4KG7A 3FDXA 2PD6A 3LBYA 3RANA 2EJCA 4DWOA 3ES9A 2IHZA 3DVQX 4RKQA 4B3BA 1XHEA 2GXSA 2VWGA 1Q7TA 4Q7QA 1XZJA 1UWCA 2F3UA 4JQYA 4KV9A 4DQLA 2FZKA 4G01B 2WYVA 1UC5B 1D3AA 3WFZA 3VYSB 2QSZA 4BMDA 3B6IA 5AHXA 1ZYUA 1EQ2A 4HXYA 5FUXA 2LKCA 2PGLA 1OMOA 2Y1LA 2WJYA 2RMKA 2G70A 2C31A 1KAHA 4G1CA 4DJDC 4JVOA 5C8ZA 3GJRA 2J0UA 4UVDA 4KU4A 1DBPA 3Q8LA 3A27A 1WXXA 5E3JA 2A30A 3ZN2A 2IZOA 1MABB 3AEZA 4N03A 1YQEA 4N0QA 1U5BB 3TLGB 3A05A 1NZFA 1J2YA 1U0TA 5ICFA 4PEVA 3EGXA 3S2GA 5JYBA 4OB6A 1E94E 2R44A 5LYYA 5HGXA 3SU8A 1V39A 4DXAA 1VMIA 1NOJA 3QLUA 3KP1A 4DBLC 2BM9A 1U1GA 2ZSJA 1T1IA 3DE2X 4ZQIA 4GRIA 2B8NA 2WSBA 3CUYA 4DDKA 4YUXA 4DIKA 3FMFA 3DVLA 3ESXA 1BVHA 1YGPA 2PWPA 1MG5A 1GUBA 1XA4A 3DGFC 3O8NA 1I4LD 2EYQA 1WU8A 3OU7A 1A5SB 1TM2A 3QWBA 4HATA 4RV5A 3NLLA 4KX3A 5KTPA 3ICEA 4H7PA 3D7NA 4G5RA 1NXPA 2BI8A 3WYEA 5T67A 5EKXA 1JHUA 5K4GA 2PTHA 4HEA6 1QMPA 4A8JA 1VBNA 2JARA 3GVIA 2I8LA 4IHQA 1U3VA 2ZIGA 3JPYA 3EEFA 4MS1A 1IK6A 4ZO9A 3GRYA 3PA8A 3DEZA 3JWGA 1G9XA 1Z5WA 2VAXA 3ZDBA 3T54A 4Z7OB 3JYNA 3A6DA 3DO8A 3N53A 1RAGA 3NC1C 5BQFA 4PBRA 4N47A 5JS7A 4BX8A 4N01A 3AEKA 1JAZA 4C0KA 2VHTA 1RRCA 1TNDA 3A6LA 4D8VA 1RADA 2R6DA 1M2KA 1M0TA 1ZM3A 4WUTA 3YASA 4LHYA 1AKEA 5LMUB 3R2JA 3B48A 3R5FA 4ZHQA 3PD7A 3BMQA 1KNQA 4QHSA 4BN0A 2LDXA 3OLVA 1J33A 3QEKA 4UNPA 2XMCA 3RHSA 1U3FA 4MDYA 1DTWA 5EIHA 3X1WA 2GKGA 2XUZA 1VG9B 3ADOA 3LUKA 2J4DA 2FETA 2EARA 5A4DA 3S8YA 2QV7A 1WZ2A 2NQ8A 4PQRA 3DE4X 2XIQA 3L7LA 2WIGA 3FLMA 5AR1A 4EECA 1FBNA 1JA0A 3ABOB 3CNHA 4NFSA 1PVDA 2H1VA 4FFDA 4MYTA 4Y9RA 4F4IA 3PYXA 2MSNA 4JI3B 2RGRA 5AESA 1KMHB 4IDGA 1XD8A 1T1GA 2VYQA 4LYEA 5KSZA 3T38A 1O5OA 4P5DA 4QGAA 2XD9A 1F6BA 3DVRX 3OKFA 4L78A 4QC2A 5TIIA 3CSDA 4PBSA 3ZWAA 4NBNA 1TMYA 1GPMA 4YNBA 3IQWA 4D0RA 3GLGE 2IE0A 1RBYA 3O47A 4XR4A 1N33B 2A33A 1LPOA 5JCOA 3CEAA 3EXAA 3RTGA 1Q0LA 1DAHA 4HFJA 2A1TR 3FSRA 4N40A 2WU3A 3GRAA 3VU1A 4EH1A 3R8XA 5F9MA 4OQYA 4JKIA 1DXOA 4IIBA 3HZZA 2FWRA 1QIIA 3H99A 3LQ2A 4H16A 3AR2A 3RHFA 4Z3DA 1DKOA 4NU8X 3WGZA 4MS4A 2BW0A 4JXZA 2Y66A 5BV1A 1IXYA 2HA4A 3VBCA 1AK1A 1IJKA 2XGGA 2H1WA 5AKIA 3NKFA 5DW0A 2YJ6A 4BWFB 1R5NA 1NW9B 4GLLA 2KYRA 4GX2A 1YRAA 4QAJA 2IT1A 1NN5A 2BFBB 1GDDA 4LZAA 3W05A 2JIOA 3HADA 3M7IA 3QLUC 4KRYA 4DN6A 3F3YA 2QT9A 1RAEA 5H4GA 3HKCA 2YYZA 4XYGA 3NBXX 4LYFA 3FNQA 5IZCA 3MUOA 4FYKA 1TJYA 2I7DA 2FWJA 2QG9A 4O3FA 3RWMB 5IK2D 5BP7A 1CF4A 1THZA 2XECA 3JQFA 4Q48A 4CLRB 4B4KA 3IEMA 1ZM7A 1J8YF 1R74A 1SHTX 2R4UA 2JGDB 4Y2QA 1OE0A 5EWJA 2VZEA 2HO4A 2YWXA 3SJCA 2J9ZB 1NYLA 2GEKA 1MA3A 1PG0A 2CUTA 3CLHA 3FI0A 4H0FA 5CH8A 4ZCPA 4A8JC 4DA8A 2YN2A 3JRXA 4ZI2A 3AVOA 1M2VB 2VTDA 3IVRA 4LOKA 4BZZA 2GD6A 3HUTA 3ORQA 4LY0A 4PSKA 5CIQA 1BU8A 3QOYA 3KKQA 3Q8MA 1M1NB 3B1XA 1R3UA 5J2UB 3TNFA 1CDOA 5KINB 3AJEA 1UAAA 1KP2A 2B8WA 2XCQA 5SY9A 2I78A 3V2HA 5AK6A 3NJ4A 1FMJA 4OH1A 4RSRA 2HIGA 2G63A 2OV1A 3C3XA 3KPJA 2EKZA 4KAXA 3KOOA 4RHFA 4E94A 4YV2A 2HYIC 1IQRA 3UMGA 4F93B 1U2SA 3KSAC 1X7HA 2NLOA 4XOIA 5T41A 3S1AB 2HOQA 1WJGA 3PQ2A 2AMJA 4OI1A 4YPOA 1NR1A 1T9HA 5HGJA 3D7SA 3O82A 4KGXA 3FVQA 1PFQA 1B14A 2X76A 1JKJA 2OZKA 2Y71A 2QAGB 2WUWE 2CHGA 3THOA 2IX9A 3N8DA 4HPJB 5FD8A 2EIXA 5SZIA 2BHRA 3OPYI 1F6DA 2JD1A 2WPDA 3G0DA 4EJ6A 1V5EA 5JAPA 1T0PA 2C54A 4HY3A 4DUGA 1H0RA 1U90A 2AE1A 1IOWA 1JKXA 4IDDA 4HNHA 3L1JA 4KMOA 2POQX 1Y7TA 5CBPA 3FETA 3FJYA 2W6MA 1FUKA 3F5DA 1YU9A 4NMLA 4U9UA 3NU1A 5LDDC 2V3WA 3BXFA 4L9WA 4U63A 2QZ4A 5J2UF 3NHLA 1RIIA 3ZJ4A 4BO1A 4DA6A 1GL9B 2XQKA 4H59A 4DA7A 3ORSA 1J2RA 3W8NA 1UXOA 2XMSA 3EVAA 4Z9FA 2YL2A 4LWQA 1JALA 3WC4A 5AUNB 5A7FA 3TPZA 3PQEA 1J7JA 1UDBA 3HXTA 1MEJA 4OLBA 2PL5A 3SQXA 4KXWA 3BH7A 1MFZA 1ND5A 1M2JA 2I55A 2CBZA 5C35A 2ZJ4A 3E1SA 3H6HA 4O1HA 4YRDA 4O4IB 1L5QA 5D3MA 2VTBB 2Z4TA 1ZK0A 3U09A 1P2UA 4MRMA 5IVDA 5CLFA 4GVPA 1YZTA 1DJLA 3ACDA 4OREX 1N6IA 4N8SA 4FE4A 1CUGA 2FQ1A 4X63A 2VHQA 4XYMA 4XJSA 5GPBA 5JFOA 4QPDA 4B83A 1QVWA 3CX7A 4OJKA 2HCTA 2SHKA 4Y0NA 2B7CA 2VAWA 1KYVA 2RHJA 3UCFA 1G98A 2XB9A 4ZDJA 2H0QA 5B7GA 2VJKA 2WWFA 3CNOA 3N39C 1YS1X 4DY6A 1L5MA 4M37A 5L6MB 2GJ9A 3BA6A 3MTGA 3IP5A 4Q4LA 3CRNA 2V0GA 1RQRA 3CZ9A 3OIGA 2V0NA 4O2BA 2Q7OE 4DABA 2QUAA 4FGJA 5I9TA 4D74A 3QKTA 3I8XA 3KTDA 2BE9A 3WGYA 2P6MA 3HDGA 3LRPA 4EYKA 5LC1A 4IHKA 3OQMA 3H9CA 5IKMA 1XG5A 3ME5A 3JQFC 1DX4A 2BEVA 2FQXA 1RLOA 1T3LA 3LIIA 1N1EA 1OBCA 4IL5A 2R86A 2ZUTA 1M66A 4C76A 4G5HA 4K88A 3Q3CA 2ZYVX 1EGAA 4O4IF 4LZOA 3QXJA 3L84A 3W5SA 1KFBB 3WLJA 1PJAA 2NSDA 1KOGA 1E79A 1V71A 3BE6A 2W6ZA 2JFYA 2YVUA 5E9WA 3DZDA 4CT0A 4CW7A 3CKYA 5E4YA 1YCFA 1UCFA 3VDMA 4A0SA 5K03A 3RABA 3WGLA 2BFPA 3H3XA 4V0QA 2BFFA 1P4AA 2OT3B 3KYDA 4RK7A 1LH0A 3WFJA 1P72A 2DE0X 2DH6A 1XK6A 3GMTA 3H8VA 3K09A 5ESXA 3WYCA 2CJXA 2HHAA 2HBQA 1IY0A 5EVCA 8LDHA 1ML4A 3Q7TA 3K1YA 4MV9A 1QYRA 3QLEA 1JEOA 4PQGA 4WECA 1CYEA 2XTAA 2X5NA 1GQYA 3ETDA 2UVPA 3E22A 3EHEA 2RHCA 4LHEA 1J24A 1QKIA 1QFMA 1VE3A 2GOYA 3D8BA 5C3UA 1EXDA 1M1YE 1NVBA 1QLHA 4M36A 4W9NA 2BUBA 3OPYB 3RJMA 2JI8A 3HCWA 3MAJA 3UJAA 3NDBB 1NQVA 5U4QA 1YB2A 1P3Y1 2FPWA 2W6QA 5D1NA 2P0EA 4CODB 2PVCA 1E9CA 2F67A 2QRHA 4FU0A 4RTPA 1DKNA 1HRKA 2CJWB 3PDWA 1IWPB 1GGKA 4GL4A 2CXQA 4WK6A 4C4PA 3RYCA 1QP0A 1ZCJA 2NSLA 3HCCA 4Q1VA 3S2FA 4F71A 5KHLB 4GNKA 4YUAA 4LOJA 4AMZA 4C5CA 3IP7A 3QPUA 3N0RA 3CH7A 3T9FA 1Z7YA 1Q2XA 2W70A 3EGVA 2WNIA 4E33A 1XEXA 5EP4A 2QV0A 3CYFA 3HL4A 3O3MB 1IBCA 4M0KA 3UQZA 4EX7A 2PQ2A 4JJ4A 5JNLA 4ISCA 1A8UA 4ZVKA 3I52A 4E5DA 1JXAA 2VJNA 1RWOA 4UQPA 1Y7PA 1U7TA 4ZYXA 2PFGA 3Q3EA 1QGUA 1CY4A 3KZMA 5TQJA 1OFGA 2HRCA 4HLCA 4UTZA 1YOBA 1N5RA 2FWIA 2J5KA 3CO0S 4GR9A 4KH0A 4RK0A 5BV0A 5DN6A 2ZXUA 3EIOA 4N49A 2IY8A 3CZ5A 3N05A 3SCZA 4AWAA 5BVGA 2YJ4A 2V8BA 2BGNA 1GNRA 4URYR 4XCQA 5ALEA 4ZYWA 2ZREA 3REQA 3EDRA 4O8CA 4GLBA 1KZ6A 3DR5A 5DM60 3UKOA 2NZUG 3K4HA 3LG2A 4DCMA 1L5SA 5LM3A 3O0DA 4ZODA 5F35A 1ONOA 3HC7A 5KCZA 2OB2A 4X66B 4EUKA 1P2VA 2W58A 4YT8A 3WGJA 4ZIRB 1KAMA 1UQUA 4I55B 3C1UA 3DDHA 5BR7A 1QYCA 1QHXA 1XNRB 1HDGO 1QDEA 1UPUA 3OZAA 2WVHA 1ZRNA 2HCFA 3RIGA 1BDBA 1BTOA 2ECPA 2AOTA 2JI9A 2RBGA 4FQ8A 3V7FA 2O8FB 3ZV4A 4P2BA 2DAPA 3L6CA 1AUVA 1W4AA 4WJZA 2H7CA 5C8XA 3DM5A 3KQLA 4PZYA 1QQAA 3JX9A 5ALFA 5H8WA 4K87A 3OT5A 3ZDXB 2DWPA 1LBSA 1WV1A 4BC1A 4GBJA 1OVGA 3QV1A 4B7ZA 1GG8A 4BMCA 3FH0A 2G1PA 2PQ0A 4KR9A 3B5IA 5I6DA 1WX1A 1M6YA 2A5DA 4WOJA 1K89A 1AGYA 1NVGA 3FUCA 3OQHA 3PGKA 421PA 2O05A 3NAZA 5FRDA 3T7RA 2E4AA 2D6FA 4HGQA 1UBFA 2EFEB 1BEZA 4ZQHA 1NSFA 7ABPA 4D25A 2DJ5A 4YDQA 3TVDA 3NASA 1B73A 5BYKA 1X2EA 2A1UB 5KJEA 1K68A 2FR1A 2X9VA 5KDLA 1O94C 1ZNWA 4NRDA 1ZINA 3RHTA 2CXOA 2AFIB 3OQIA 1G5QA 1E2NA 1E18A 1PE0A 1P0QA 3FYCA 5LB2A 4A27A 4D9MA 3AEYA 3GVXA 4UZSA 2DUMA 4CQJA 3WGMA 4DV1B 2C7QA 5AW3A 5SY4A 1UH5A 2X23A 4G2NA 3UJBA 4BQQA 1P17A 2CHVA 4E5YA 3OZTA 4J7AA 1TUBA 3BF7A 4C2BA 4QTXA 1ZA1A 2Q2QA 3QVGB 4K5QA 4KQJA 2P7HA 1B00A 2GTPA 2OGSA 3FVVA 3ZDZB 2AFHA 2HJHA 3HGTA 2ZSDA 1DADA 3IRVA 4NABA 5FBHA 2CJYA 4OXRA 4RD0A 3M0EA 2CK3D 3ZU5A 1IBLB 1MJNA 3RU3A 4NC9A 4RJJA 3M3PA 4LRQA 4WGGA 2WD7B 5DM2A 1J00A 4AZ0A 3AP2A 3VR3A 1OLOA 2D7DA 1ABEA 1ARZA 3AOGA 4K9DA 4B3RB 2XA9A 3IQZA 3NNDA 4PAQA 3TTSA 4QATA 1G66A 3BAZA 2O20A 1VPEA 2W7TA 2YVAA 4UEQA 1RRMA 3VHLB 1Y6JA 4YAOA 1KNXA 1A9TA 5D85A 5HQ3A 1Z39A 4DW8A 3VR5D 4XYLA 1G8HA 2FR8A 2ODTX 1NQTA 2CLOB 3UJPA 3L7NA 1LI7A 3G0HA 3QEMA 3LSTA 5ADHA 3R7SA 2NO1A 2JIRA 4DEVA 2Y0CA 1R8QA 4S3MA 5CFZA 3HK2A 1O0SA 1WHSB 1Z4MA 4YCAA 3IA2A 4HV4A 4PGFA 4NE7A 5T4EA 3W5JA 3JARA 4HDMB 5BMVA 2DPLA 1IMOA 3IHLA 1YC5A 1NVTA 4FWIB 2IODA 4GUDA 4YIKA 1YHYA 1OBFO 4KWEA 4L8VA 2MYTA 2ONYA 3I5AA 3O2JA 4C6RA 5C7IO 1IUOA 1E2QA 4IM7A 3H11B 4IV8A 2ADOA 4JELA 3AFHA 4H1WA 1BJTA 3AXTA 3GDOA 3GEBA 3M1LA 3UHJA 3ZIAD 3L0IB 1V9LA 4LTMA 2HF2A 2JAHA 3D2AA 4XQ0A 3KE8A 3MINB 2HLDA 1XTJA 3C3BA 5IASA 5IU6A 4R1LA 2XMRA 3GGJA 2G09A 1NHGA 4LC0A 2YV4A 4BNTA 5T8KA 2AXNA 1QUEA 2OXRA 3DBIA 4PINA 3CB2A 3GGGA 3QVUA 2C9MA 2HTEA 4DCUA 4KE9A 3SSAA 1FUIA 1USGA 4RPCA 4BU0A 1CBUA 3LHSA 1OGIA 3OX4A 1U5CA 3FF1A 3KALA 4XGRA 2PO5A 3W4JA 5DHQA 3QF4A 3T9DA 5CCEA 4HGNA 3PBKA 1R8SA 2UAGA 1BHSA 5BOVA 1EVJA 3EZYA 1ZXXA 2PGXA 2PGAA 3LY7A 5FA8A 5AQEA 2IZZA 3H4VA 4YAWA 1XT6A 4M0PA 2QRGA 3KLPX 3Q7PA 4MUHA 5LQDA 4YJGA 3C6ZA 3Q8WA 3W3AA 4RACA 3CW8X 3DJFA 1EA7A 4HNSA 2JJ2D 1FYXA 2Q4EA 4TXHA 3R7DA 3RUEA 3LM8A 3AH8A 1DIHA 4K8OA 5LUBA 1LSJA 3FZYA 2CV0A 2V1UA 4G1BA 4GE0A 3HEBA 3OC6A 2R85A 4JD5A 1HMPA 2WIDA 1L3BA 4WXRA 4W1PA 2I71A 5K3AA 2XXBA 4O59O 4LN1A 4DYVA 1GTG1 3GLRA 4TXJA 3CHYA 3N28A 4UCWA 3WOHA 1QIDA 2CNOA 2P9YA 4YC7A 4EG5A 3AZOA 2NADA 1QGYA 4EGQA 2YOHA 2QXUA 1NNLA 4IEEA 4OHYA 1LS1A 3NIGB 4YHHB 2O2GA 1GZHB 7MDHA 1EJBA 4O4JF 4Q34A 3S99A 4H4DA 5IJ0A 4HGZA 2CXHA 1R0RE 3FCCA 2B2CA 1K92A 2ZVDA 4HN9A 4TMXA 2YZNA 2P9QA 4CCYA 3DTNA 4N3BA 4BUCA 5C8DA 1L4BA 4FN4A 2RONA 4LF5B 3DWIA 5KOJB 2RDMA 1NOKA 4BKQA 4PYIA 1WB9A 4O02B 2E87A 2HWXA 5COBA 1NL3A 2BLNA 4E15A 1SC3A 1U80A 2A9QA 4P3YA 1TO2E 2DF8A 3H04A 4ZTBA 4UFNA 3HBLA 5EYPB 3X1KA 1KP9A 1HQYE 3IERA 1W35A 4QQKA 1DAIA 5AOCA 2EQBA 2WWYA 1C8LA 3WB2A 4BE4A 4D9EA 4MGYR 1M8GA 2WABA 3SAJA 1OYOA 4X61A 1KBZA 1BD3A 1ULSA 2VPQA 1CUDA 4P86A 1BIFA 4L07A 4XM0A 3TJMA 2QD3A 2GN8A 4HB3A 4OJMX 2M6KA 3KSDO 4HZUB 3VSBA 3BT7A 2C2KA 4UBJA 3ZE6A 2FSIA 3OMWA 1KO5A 3AK4A 4JHXA 4ZRDA 4ZVLA 4R8RA 3UATA 4CKBA 4EA8A 4CL2A 3FIUA 3PVCA 5LQCA 1NN0A 1VGVA 2FEPA 4RCVA 5CDTA 2DY0A 5L45A 3A6KA 2Q5FA 1H2ZA 3GYGA 2X1HA 1HLGA 3EUAA 3QEOA 4LCBA 1GP2A 1Q21A 4M3NA 2IUEA 4XFJA 2QPOA 3SG0A 1N77A 1KAOA 5KAPA 3HCPA 3UM9A 2VK1A 1UPXA 4KQWA 3TINA 2FKAA 1Z26A 4NONA 3ZY4A 1YFKA 4JT8A 1ZD9A 1T6ZA 3T12A 4JBWA 5T8KC 3TIGA 2IWHA 2XMZA 3I6YA 4XCVA 2L82A 5D3ZA 1UBJS 1T5SA 3VX4A 2IKQA 3OIYA 4RELA 2IJGX 3CLUC 3DOHA 4IOJA 3TZCA 2UXCB 4R9RA 2GN2A 3U6BA 3QXCA 3JAMA 4QG3A 2PLNA 1UBGA 4JASB 2BFEB 5EXXA 2PZAA 2JHPA 3DO5A 3M1AA 1XE3A 2K4MA 4EIWA 4F4FA 5CX4A 1Y8QB 4GKBA 1XD9A 2Z0MA 1QH8B 1DDOA 4JJAA 3NVAA 3WGVA 3CPJB 4ZI7A 1UJNA 4CLOB 3HUDA 1X87A 2PIDA 4J6FA 4XQ9A 1KAEA 1P4HA 3S55A 4RD3A 2ADMA 5LQSA 5KEIA 2MWMA 5FPQA 3EVTA 4M21A 2P2SA 2CBXA 5B53A 1CQPA 1IB6A 4ETIA 2CD7A 3VBEA 4I5EA 3ELBA 1BFKA 2IP2A 3I2FA 4QBHA 4G9GA 4PG6A 1K7XB 4JX9A 3V33A 1O9HA 5DGCA 3FOZA 1E62A 2B1RA 1QTNA 1OH7A 4MW7A 1E3IA 3DT6A 4HUQB 3WMGA 5AVSA 2C5EA 3TXAA 4IICA 3GN2A 3TUZC 2XYHA 5AMXA 3CT6A 2E85A 2G8LA 3U6KA 4P1ZA 2NYAA 1MV8A 3RFUA 5JHHB 3I6QA 4FS8A 5U4XA 4BGDA 2PM8A 4WESB 3E5HA 2VRCD 3ABSB 5F1YA 4J91A 1AC5A 3A1EA 3D2LA 3E7XA 1RJ9A 1INLA 2LPMA 1ISRA 4GW3A 2R751 4X7BA 5B3JA 5T7BA 3IHWA 1TADA 1ODIA 4KXLA 3W90A 5KQGA 4QJIA 2X4DA 4QA9A 1IVNA 3LS2A 1N34B 4S1PA 3T5TA 4QD3A 4ERXA 4O5AA 3EF3A 2H3EA 2O1XA 4M1OA 2J33A 2RIRA 2XB8A 2D5CA 1AM4D 1AIPA 1HZZC 2IF2A 3IA7A 3R9IA 4PIVA 4PAOA 3RVRA 4PHFA 2Z04A 1LDGA 3RTAA 2D1SA 1M2EA 1PEKE 1ZH4A 2ZJYA 3OLQA 5JS2A 2JGAA 2A92A 4OHMA 2V3VA 2CFIA 4ER3A 4HYQA 3AVXA 4YRSA 1AZWA 1GXSA 1ZONA 1ZVMA 1LSUA 2XDYA 3QIAA 5LN1A 1WO8A 1J23A 5AM2A 1X7ZA 3RO7A 1NRXA 3CVXA 3TSOA 2CUNA 4CFSA 2D5BA 4CETA 4KPYA 4RA6B 1XZNA 4F9TA 3GUYA 2BOVA 4WV3A 1ZMRA 1Y1SA 1XZCA 2DWUA 1K8RA 2FMXA 5KVQA 1NXVA 7ADHA 2ZYRA 3M9LA 3FE2A 3FKSA 1NLUA 4AJ1A 2QN3A 5FWYA 4ZP1A 5JI2E 4OLJA 1LBTA 1QHNA 1RWBA 5HIKA 4RA9B 4R40A 2XCUA 3EZ7A 3L1VA 3C5CA 1E6EA 4QOIA 4WDRA 3SNHA 1FRFS 3IPRA 1C8KA 1EVKA 1E9DA 4C1NA 2XOKA 3RREA 4EITA 6REQA 2JGFA 4E12A 2XQJA 1B6SA 3A58B 3GPDG 3MMSA 1RP7A 1SUDA 1Z68A 4D4MA 3FDZA 1OZAA 4MKIA 4LY6A 1IHPA 4P4SA 3UK1A 3SC2B 1QDLB 1EFVA 2YDYA 3F6EX 4HKTA 4RVOA 1Z28A 5CNJA 2YZ2A 1KZ1A 4CKZA 3BIOA 3JVUA 3L0ZA 2CHQA 1JU3A 1ZSVA 1TFRA 3TAUA 3EDMA 4MVJH 1OLUB 1XUOA 4YP1A 5EHGA 2BTOA 1E0DA 1QVAA 1CJUC 1L7EA 1Q44A 1OV4A 2AMLA 2QM8A 4N3NA 4XXHA 3WBJA 4C88A 2H4ZA 3ZHZA 3F6RA 4TXNA 1P2GA 4BNDB 5JTUA 2FUG6 4DV2B 2CLHB 4P53A 1FYWA 3C3YA 5L9AA 4GOXA 4P2GA 3U39A 2ZRKA 3HI6A 1R50A 3WQHA 1DKRA 4TKVB 1PZXA 3NVMB 4Q7LA 4TN1A 3LBFA 3ZE7A 1RAFA 2NXWA 2FXVA 1ZGJA 2NAPA 2RH5A 2ZRHA 4C07A 4V39A 4RTOA 5ELLA 3OUUA 4B17A 3M89A 5CA0B 1KPGA 3BGOS 4NCXA 1BCRA 2HUNA 3JW8A 1O96B 3HL0A 1IJEA 1KU6A 4MWDA 4J4TA 3B12A 5AHWA 4C7XA 2AC4A 2QQGA 4ZU3A 1Q92A 3CY6A 3HI4A 1WV0A 4KUHA 3ONEA 1P2SA 1XYGA 2EERA 1JSXA 4JXJA 2H5LA 2Q3CA 1WPRA 2Q3JA 4X64B 1LSSA 2W00A 3FUVA 4HNTA 1LD3A 3R40A 4ZYVA 4EATA 2JVKA 2YVLA 3QVTA 4I1OA 3AB7A 3Q11A 2VI5A 3NDPA 2X8JA 3BK7A 3PI7A 4X95A 1JBQA 4M8SA 4CIAA 2VTKA 2P2LA 1MRNA 2W98A 4E1AA 4C7OA 3PXUA 2ZRNA 2ZUWA 2CDRA 2P67A 5CDSA 1LPBB 1DP4A 2Y9MB 5H83A 5B1YA 4L02A 3QH4A 1ISJA 1HNNA 1YZLA 2B1GA 1ML3A 3K1JA 3QG5A 3VGJA 1G64A 1FJXA 1MTZA 4YCSA 3LX6A 3H6GA 1E3SA 3RBAA 4EHJA 1SG9A 3PXBA 1R6BX 1HDYA 2YW9A 3MFYA 3NM4A 3PFBA 4I99A 4TV9B 5EP1A 4F1JA 5IAAA 2CSXA 3GUZA 1DCMA 3WHKA 1GILA 5KO2A 3BVPA 4W9MC 4TM7A 4BX9A 2JFUA 4R1OA 2WQ6A 1CHDA 1X7GA 3GZJA 3B2QA 5JSFA 5LJIA 4HH0A 2BBTA 3LT5A 1FQKA 1LV8A 4TTTS 1I2ZA 4L2IA 3NP7A 5ALTA 1XRNA 3HY6A 1Z75A 2YXEA 1J8VA 4Y30A 1WULS 4WH0A 5L40A 3ZU3A 4DNOA 2VXYA 3AL2A 3PDUA 4X8LA 5AHKA 4R81A 4FGSA 1YQ9A 4UXJA 1R12A 4W63A 4RDXA 2XSZA 13PKA 4X8OA 2GA8A 5HQTA 4OSOA 1QIEA 3OZCA 4QNRA 4KJZA 5AKJA 5TARA 1V5WA 1TZKA 2IYLD 3M6UA 3R3UA 2Q4BA 1HYGA 2Q9AA 2YNMD 1U9ZA 3KTAA 3DTTA 2WSSD 4LXTA 4OO3A 1PUIA 4Q6BA 2RH4A 3T3IA 4ZV4A 1Y6GA 1NPYA 2REQA 4OH7A 3ACCA 4YQEA 1W36B 5D01A 2NP7A 2X1LA 1AO0A 4JZYA 4D0SA 4Y2VA 2WHQA 3LUJA 5F9HA 1TB4A 1F2TB 2PBRA 2DHQA 5LFAA 4RZSA 2H9IA 1GTZA 1SUPA 4LF7B 1SKYE 1T0UA 4UHBA 3FUWA 1VI5A 3V5NA 2OLKA 3M6AA 5BSRA 5LWHA 2HHHB 5L7WA 2ZJOA 1H66A 1SZDA 1F0NA 4IYJA 2HFKA 3KZNA 2FF7A 2C5FA 2XZTA 4H77A 3W9YA 4ARBA 1YZUA 2ORWA 3HUUA 5GWXA 5CDYA 1MB0A 1SBZA 3D0OA 3U3DA 1JDVA 3Q85A 1J8DA 1U4SA 1OSNA 2P6PA 3DSRA 4RQBA 2E4VA 4TMYA 4F56A 3SJZA 3N9IA 1CQIA 4E5VA 5LZ5A 2X0FA 1K4KA 1B0UA 1E5LA 4PTLA 4JKOA 3TI9A 3F2IA 1YZQA 4CM7A 3NHKA 3MWGA 1E1QD 3K9LA 4IV0A 1R18A 2C8LA 3OFND 5TVKA 2NUAA 2Q1WA 4IIJF 2J46A 3SLRA 1Z4KA 5F23A 4C87A 5JVDA 3ZVNA 3OOEA 1EXNA 2WD9A 1GG9A 1HQCA 4QPZA 2QL9A 2VN8A 4OK6A 5AVUA 1KH2A 1TAGA 1PR5A 4AJJA 2G4LA 3WK6A 2RKOA 1XLVA 2JI7A 4PFQA 3B9RA 5D2CA 2OV4A 2XRMA 2JJQA 3PNBA 1X8XA 4E2YA 1OXSC 3DT8A 4A8PA 5B3KA 3MMZA 1Y6ZA 1NSTA 3LHIA 1VHQA 2R47A 3IT3A 3Q7RA 2F8TA 5TMEA 2JFVA 4A8JB 1IXSB 1XZBA 2VXCA 4A0FA 2FX2A 5E8RA 3EFOB 5T4BA 2V7UA 2AEMA 2FUNB 2LBPA 1I33A 4B34A 5JFTA 2ENWA 4MS1B 4ZVQA 5JQWA 1T2UA 2PZMA 3DOIA 2J3EA 1NLZA 2CBGA 3HNRA 1FC0A 3Q3JB 1UEJA 1BHO1 1LSOA 2FZ4A 4EA7A 2EX1A 4FXPA 5ERGB 4CCSA 1FFHA 3A06A 3HR8A 5CEJA 1FYDA 1LLQA 5HDBB 2R62A 3AEKB 4JZKA 1RZRD 4L0MA 4EL0A 4R83A 4YCBA 2BSQA 3SLGA 1KTVA 2FSHA 1F0YA 1GIAA 3MBKA 1E8DA 5E2AA 2YZMA 2BBWA 2ERXA 3P96A 3VYWA 3RVBA 4G5SA 1KMQA 2OILA 2O48X 3EGWA 1WBJB 3U49A 4ZCSA 4U2FA 1IN7A 2I33A 2DKOA 2K7ZA 2WTBA 3BMQB 2Z4SA 5TC4A 4LDJA 4DGQA 3CH5A 1DTWB 2G40A 2O14A 2VDWA 3F6YA 3O3CA 5TX7A 1T0IA 2VXOA 3S6JA 1XXHA 1L4MA 1CY8A 4RE5A 3QXSA 2R96A 2RGUA 4HYYA 4Q66C 1CC1S 4V3CA 4C14A 3NR2A 4HR7A 3IURA 1URPA 4U9IS 4Y1FA 4J9UE 2EKPA 4J16A 2P5YA 4X6UA 5ED0A 3WYDA 1S8AA 3PFWO 5BR4A 4DLBA 2BFAA 1Y3FE 2O0KA 3GRZA 2Z1DA 4Y1GA 3GR6A 1V4NA 1ZJ6A 2IVZA 4IDNA 3S44A 1RYMA 3JQDA 4QQNA 3QLTA 2FLVA 1FXUA 3QX8A 5DE3A 2PX8A 1ZL2A 3BKXA 1CERA 4JP3A 4KW7A 2FSFA 3TNDA 3KQKA 3U5ZB 2BEJA 3ZDCA 3BQMB 3JQAD 2CZCA 2DPGA 1I7NA 1UAYA 5LBTA 4BNJA 2RHHA 1BHJA 1DHTA 3I04M 4MR9A 2QMQA 3KVNA 2WHEA 2R1VA 4UHEA 4DMRA 3SZGA 4K03A 5HMLA 1FQJA 1PDWA 4HQ6A 4UBOA 4GL2A 2PRSA 1DUIA 1WW8A 4ZHQF 2I6FA 1PKEA 4XSHA 1BD4A 5DYGA 4A0HA 3T0FA 3WLQA 1W93A 3FY4A 2GEVA 1CY0A 3K0HA 2A9RA 1P61B 4UASA 2G1KA 4NG5A 2DHDA 3DEJA 5FLEX 1OGYA 4BO9A 4EI7A 1U3CA 3A1NA 4MS4B 4WKBA 1WZCA 3EWAA 1HETA 2J7PA 4RPIA 1EINA 3BCSA 1VPLA 1JYEA 2F3RA 4D46A 2WKPA 1L4NA 4Z86A 3PRKE 5JI3E 3F3SA 4X5OA 2R6FA 2VBGA 4Y2RA 5I51A 4XWGA 2ZSKA 4KZKA 2EOAA 1M1UA 3DKIA 3KQUA 3KSMA 2E49A 3TTYA 3LUDA 4NICA 1ZC3A 5JNRA 1WXEA 3P9NA 3D3EA 2ZAIA 5J2TA 1FFEA 3TOZA 4EBBA 1GVHA 1WP4A 3IBGA 2Q4RA 1LC3A 1GZ6A 4MI3A 3IH5A 2XOXA 1NXSA 3UA3A 3O4IA 4EARA 5IZ4A 6ADHA 4IGIA 1U0FA 4LKRA 5EWJB 2XNCA 2FN4A 3VU0A 4RDHA 1FVXA 4R8LA 2IV3A 4H7FA 1K6EA 3OLWA 2O2HA 1L1FA 2O0HA 5TSDA 3UUWA 4I2VA 2E21A 4P38A 2NYUA 1UC4B 2Z08A 3FIJA 1FXWA 3CZ4A 3EXHA 3MWDA 3WKAA 5B64A 2RE8A 3PUYA 4B7CA 3GUVA 4A73A 1AXEA 1JHDA 1M6VA 2RI1A 4WINA 1UKAA 1EK1A 2P5UA 2QN6A 3C3AA 4MJ7A 4Q3AA 1LU9A 2PZFA 5ESWA 1ESMA 4G63A 4H3KB 1AQIA 3I1JA 5HNKA 1EK0A 2VYFA 3BL5A 4P08A 4UNRA 1N78A 3GH1A 2HA2A 2N75A 4G4IA 3BF8A 1ZD1A 3V4OA 2SECE 4KXMA 1UF9A 3PNLA 5HEKA 1BVUA 1KVUA 4ACAA 4HUTA 2BMFA 4PCAA 2CY0A 3AIMA 3BRCA 3EDCA 5FAXA 1XJ5A 4B3IA 1R4NA 3R77A 4CMHA 1TK3A 1JKJB 1K27A 2NZJA 4BKRA 1MC4A 2WZCA 2INGX 2C3MA 4IFTA 4LC9A 5IARA 2VPZA 1LLFA 2B35A 5BSKA 5TF0A 2VTVA 3KU4A 4BO7A 1C1DA 4JXXA 4PCUA 2FG6C 2J3LA 1P1HA 1JGTA 1V6SA 1W1IA 3TE7A 3B36A 3SHVA 3UC5A 4NVRA 1WHTB 3L6DA 3KJGA 4MR8B 3VR5H 2CXPA 4B74A 5CBPB 1FSGA 3K16A 2X86A 5CD1A 3HM9A 1VOTA 4E5MA 4PR0A 2AGVA 1X8LA 2YV3A 1KFEB 1XMJA 1Y9ZA 3IUEA 3BJZA 1FMLA 2VPTA 4BMVA 2OZLA 3EDQA 4JMPA 4JVNA 4JSTA 4YPFA 3UGTA 1KVRA 3UTDA 1CP3A 1UOQA 1VLJA 1HY3A 2R8PA 5K99A 1GEEA 3P7MA 2WKWA 3E7FA 4ROSA 1HXHA 1Z74A 4U39A 2W0SA 1Z07A 5KNCD 3GG2A 4KACA 3U7FB 3AHCA 3IEKA 1TCUA 2JKZA 1Q57A 4QJ5A 4AQ7A 1GPNA 2Q0XA 4TSKA 4PVCA 3S8MA 4M7RA 1ZJ5A 2NSHA 4QPCA 3ISVA 4EQ6B 4WTOA 4KLZA 2WM2A 1NJ2A 3DEAA 3THWA 3Q88A 1NWHA 4MRMB 3F8TA 3R4CA 3ZLUA 4UU7A 4CRWB 3OCCA 1XWWA 1DBSA 2XQFA 2PUBA 4F2PA 2QDXA 5GJVC 1P60A 3PC3A 4OHVA 1GTVA 1B41A 2EBFX 3NIFB 3O6VA 4NYJQ 5LBIA 1Z13A 4DIOA 3Q2KA 2CCJA 5KMGA 4II3A 3QVSA 2ZAYA 3HYLA 3AC0A 3B20A 4IUYA 2WVGA 2GBLA 4G85A 4JUBA 2O5EA 1XRJA 4H1UA 4P54A 4HLUC 4Z3KA 4PZLA 1EE9A 3SBOA 1SVUA 3VKGA 3B85A 1IY2A 4EG7A 4O2BB 2AIRA 1DV1A 5EJAA 1GSIA 5EJ5A 1W34A 3NAMA 3ZI4A 1MQSA 3E0XA 3ZHTA 1AZSC 3K3PA 1XF1A 2YFQA 1SUAA 2YWBA 2FRXA 1R6UA 1QLWA 3G2PA 4ER7A 3K6SA 5A2QA 1GGMA 4RYLA 3U7QB 1M3SA 1TM4E 1LNQA 2XYQA 4YHBA 3KZCA 4NZ9A 4NZPA 1HSZA 1GPH1 3EXHC 4EFMA 3KZXA 1E3WB 3NBUA 4AJ9A 3Q1KA 5G0UA 4RKEA 3BFJA 3KKZA 4UQOA 3LX4A 2PL3A 1BMFA 1TJ5A 3OJCA 2RK6A 1RHRA 3OTGA 4X41A 4BECA 2ZUFA 3E23A 4DMFA 1U7UA 4Q1EA 1N36B 2EJUA 4LOHA 1N2HA 2BFFB 4HEA1 3AFGA 2C96A 3JQ7B 1K5DA 2AR0A 2O5VA 2XT9A 1WA5A 5FJJA 2OHOA 2QLTA 2VZ8A 2IEZA 4M9CA 5ALLA 1ZAKA 2QYTA 3WNDA 4MARA 2PV7A 5LWQA 4O2BF 1RHMA 1BA3A 3C5VA 3Q5DA 4NYMR 1Z17A 2I3GA 2DY1A 1I51A 5K6AA 2MSCB 3PSAA 3OAAD 2UVPB 3E22B 3NHRA 1CR0A 4YXWD 2I3DA 1V4BA 3E3OA 3DPUA 3G8DA 3LY8A 3M33A 1LPNA 1CD5A 2OGTA 2VEOA 4OMUA 1QIMA 1V9CA 2HCBA 4FQ5A 5H9WA 5BNZA 2LCFA 3T3OA 1SKAA 3A36A 4NYIQ 4GGPA 2WAXA 4HH4A 1ORRA 3C1OA 4AS2A 2V5UA 5CM8B 3UW3A 1K2VN 5ILQA 4J43A 5FTWA 4BQSA 1JIIA 5AVZA 2MCFA 3NBYC 1ZD4A 3MGCA 4YVFA 1SQ0A 1CF9A 5CLHA 5FI1B 5C31A 4AQYB 2HPZA 1X42A 1CZKA 1EWVA 1XZFA 3U31A 4OKNA 5L53A 5KKAA 2OENG 4DVGA 5LJLA 1UZLA 3RYCB 1K2WA 1Q1BA 3J7AC 1ZNXA 4ZO7A 3SBXA 3ZNQA 1PI3A 3OOJA 1D2GA 4LG1A 4WNIA 5FPPA 2BI7A 1TM7E 2GUWA 4YCJA 2Q0SA 3R9WA 5KAMA 3RIYA 4EW2A 2OXIA 2XUIA 4L9SA 5FTKA 2FMUA 5CJJA 4DLWA 5D7NA 4TVSA 1UC8A 3LDUA 2P9CA 3ZIDA 1Z18A 3ZWQA 1IBMB 4TRJA 1D8AA 5IXYA 1LTKA 4YCNA 1EVLA 3ZDQA 1A82A 1QGUB 4R3UC 2XAAA 1NG9A 2H9YA 1DJNA 1KETA 4Q39A 2HDWA 4BNHA 3QUQA 1WWKA 5BVGB 1FQOA 1A4IA 3CLVA 1UADA 1BXRA 3REQB 1HDEA 3PFHA 2XE8A 3NW9A 4PZAA 4AD8A 4EZBA 1J2TA 4C0SA 3PZRA 4YT5A 3ZBTA 1L8OA 4NCNA 4C3VA 1CVLA 4DV3B 4NOMA 2JCBA 5LZ7A 3HA2A 2GBLC 3C24A 4ZEVA 3IPYA 1UZMA 1JEYA 5A9TA 1OFUX 1O8CA 1IXZA 2IEDA 2YV1A 4B7UA 4B85A 2CZQA 4G5FA 2H1FA 4HEQA 5BNTA 2ZJZA 3AMVA 5BSHA 4TYNA 4FIZA 3R75A 3W34A 2AOTB 5LQAA 2AYYA 2HRBA 3ZQ6A 3QE3A 4U2CA 3PKJA 1F8XA 3HJGA 2O4CA 5CLLA 3QF7A 2CEAA 1Z5UA 1F0KA 1H4VB 3LFHA 4ZOAA 3S4YA 2YDXA 3CGWA 4AY3A 3GJ0A 5FBKA 2Z6UA 2BMAA 5HFNA 1NYTA 4FONA 4ZCRA 1EFRA 3WGUA 1W85A 1H1TA 5A3SA 2VYNA 3M4JA 2DQ4A 1H05A 3G2QA 1VYTA 3RVSA 5I01A 4ML3A 3UOAB 4EA9A 1FFXA 4CTMA 3NVKI 2Y92A 3QENA 5BSGA 2GF9A 3ACBA 3UICA 1UMBA 1VL8A 4WBXC 2DPHA 1JJIA 4WT7A 1NNI1 3HLTA 3K94A 1I0IA 4Q37A 1Q7CA 4N8EA 2A3NA 2P78A 1B8OA 1ADBA 1QVRA 2Z8ZA 3JQGA 3KZVA 4B40A 4E2WA 2ZYTX 1UPAA 2VUUA 4FDTA 2TMDA 4I81A 1CJBA 2BELA 1VSUA 3GA5A 1E59A 3OQIB 1LUAA 2R48A 4EHLA 5ESRA 3KDPA 2DB3A 4L8FA 5K6AC 4O0MA 1E1CB 3NANA 4FWBA 4MRRA 1M5RA 2MHCA 3D2BA 2HDOA 4A8HA 2DT8A 4PW0A 1JVSA 1TUBB 2X9LA 3SHOA 1M74A 2G7MC 3D5QA 4D96A 2IS4A 3PNYA 2W4MA 2R6R1 1E1NA 2ZK7A 4BMSA 2FEKA 4LZWA 2IHKA 3L4BA 2GK7A 3WSTA 5CB0A 4PN7A 4AZ0B 1VRWA 1QTIA 1W4LA 3KVVA 3D8HA 4WDQA 1KE2A 1Y9AA 2FY8A 3HFJA 3SM9A 4EFDA 3IR7A 3UV7A 1S8FA 3H5WA 1FLDA 1WDTA 2G71A 1SUWA 2YRWA 2OLJA 4KH1A 1CNMA 5HQ3B 5TQVA 1CP2A 3S3TA 5AOBA 3K6JA 2QYOA 2ECQA 3PUIA 3DZKA 2GQ0A 2JA1A 1MR3F 4CLXA 5EXSA 1OAAA 3P5SA 2YN0A 3RYIB 1PUJA 3AEUA 3L7DA 4JB0A 4CUJA 1PD0A 5BMVB 4UNQA 2VHJA 4HQKA 4ND8B 1RCUA 2VRNA 1J7KA 1CJVC 1ZUWA 3SR4A 5CEFA 3LP8A 4KRFA 5L51A 4X0EA 5TVGA 4ZDIA 5B36A 3RU2A 1ESNA 4E46A 3V48A 2BGMA 8OHMA 1BE8A 4GX0A 1IPHA 3JVVA 4QL3A 2HIHA 4C7JA 1H6AA 4CL0A 1KI3A 2R5WA 2LWIA 1EE2A 4ETNA 1PR3A 1SCDA 3OFVA 4P9NA 1F2UA 2V7EA 4HMOA 2C9BA 3UFXA 221PA 4EMUA 4NJEB 2C82A 3GCDA 4PFKA 3HCDA 2FA9A 4Y6RA 3ZS9A 4G36A 4KN5A 4V0SA 4YQZA 1M76A 4BB9A 1MVLA 2GLUA 5E6RA 5B1IA 5TJ9A 4PAWA 4L3OA 1PJZA 4ZU1X 4BNUA 1M2HA 2GHTA 3UHFA 2JAWA 2VCYA 1CEXA 4YCDA 3ZBPA 2J9GA 5HTKA 3G7SA 4LXHA 4C7BA 2IHTA 4QKQA 5FPKA 5J63A 5EMMA 1OXBB 2LRHA 1B7GO 1GSAA 1N0WA 2I67A 4YGYA 4F9GA 3PNQA 1LVGA 3EXG1 1EXMA 4K6CA 5EQDA 4C30A 3W04A 1GQOA 5C4MA 1G19A 2PYDA 1NQOA 1T4BA 3U3XA 4EI9A 2H00A 3PHGA 3Q9SA 2OHGA 4OFWA 3T7TA 4PHGA 5JXHA 2QG4A 5AVQA 2R7KA 2FMIA 2OBXA 2YZGA 4L5YA 1G8AA 2F9MA 4Q7KA 4YJGB 3V1KA 4DAEA 1JHYA 4KYUA 2ACVA 2X7XA 3V34A 2DBYA 2CLSA 1Z6PA 5E3HA 1MDBA 2FEWB 5IDQA 1KKMA 1PT7A 3L8MA </