2KHZA

Solution structure of rcl
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
163
structure length
163
Chain Sequence
b'MAASGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAGGDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAVALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKTASSSHPSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords c-Myc-responsive protein Rcl
publication title Solution structure of RCL, a novel 2'-deoxyribonucleoside 5'-monophosphate N-glycosidase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Nuclear protein
total genus 31
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2khzA00
4PFKA 5AJUA 1WEKA 4NPAA 4JENA 4LJRA 2Q4DA 3K2QA 1MTOA 3QUAA 4WL0A 4I36A 1S2GA 3F5MA 1T35A 3BQ9A 4P5EA 1F8YA 4JELA 2KHZA 3O8LA 1S2IA 4FYHA 2NX2A 2A0KA 3O8OB 4KXMA 3PFKA 2Q4OA 1F8XA 3U39A 2F62A 1S2DA 4LJKA 2A33A 2IZ7A 4A3SA 3O8OA 3EHDA 4KXNA 4OHRA 3IMKA 4HX9A 2PMBA 3HNOA 4OHBA 4FYKA 2PFKA 5AJTA 2HIGA 4FYIA 3MAJA 1KZHA 1YDHA 4U1RA 4JEMA 4KXLA 2IZ6A 2F67A 2IZ5A 4I4IA 3UQZA 4LJLA 2KLHA 1ZXXA 3OPYB 2F2TA 4MCJA 6PFKA 1S2LA 4I7EA 1S3FA 1RCUA 5ITSA 3OPYA 4MEJA 1WEHA 2F64A 2F48A 4RH3A 3SBXA 4P5DA 3O8NA 1PFKA 3GH1A
chains in the Genus database with same CATH superfamily
1G291 3FY4A 1LWOA 3DF9A 4BO8A 1A50B 1U2ZA 1NBME 3KYJB 3D1LA 3SMQA 1LBTA 5IXJA 2QTZA 5KQMA 4Y0AA 4IHAA 3BCHA 3PD1A 5FBHA 1QOPB 1JIJA 1NXSA 2WEKA 2WSSD 3AUJB 3NS7A 5ALXA 3TIIA 6YASA 4UEQA 1J2YA 4W1RA 2VHYA 3DWEX 3L40A 4RJKA 3S4YA 3T8YA 4IICA 3F1LA 1XU9A 4B73A 4DYVA 3KO8A 4HQ6A 4ARSA 4B45A 3TVYA 4AWAA 4EGFA 4FE7A 5EKSA 2PX4A 2PRKA 2QM8A 4UTRA 2IZ1A 1C4KA 2WF8A 1WL8A 5C4GB 3DZFA 2J9FA 5K20A 3TO5A 1SD2A 3HMKA 4E1AA 2CJWA 1I1QB 3DDWA 1T6XA 4MUMA 3D8BA 4R2KA 1BN6A 2MDTA 3DMGA 5BN5A 3RS8A 3D4BA 5AW0A 1VPEA 4IIJF 4RUKA 1EVQA 3S2YA 5LSAA 5KX5A 1PW7A 4B7ZA 4C29A 1KQFA 3JTEA 1PNQA 2QRUA 3CNBA 3LCUA 4KW7A 2JFFA 3JAKB 3O91A 4QPZA 2AFHB 3KKMA 1JG3A 2FOLA 1F51E 1ZQ1A 4LXQA 3VVCA 4D8TA 3ZVMA 1G21A 3QUTA 5FA5A 2G70A 4YCLA 4TROA 1I3LA 1G6KA 1BQ4A 1JZTA 5BRJA 1AK2A 3GEHA 1SA0A 3HCAA 4QSHA 3MUNA 3UMMA 1I3OA 4YCJA 2RBGA 2FMKA 3R3WA 3K1YA 4BMXA 3RFTA 5C2JB 2XQKA 1YNOA 5JDCC 3ADBA 4PAGA 3RADC 4Q47A 3VOSA 2ECPA 2XDQA 2JK0A 3AILA 1DADA 1F0NA 2VDNB 2FMFA 1JHZA 1NFFA 2BMWA 1M2JA 1UDXA 4HMOA 4QGSA 3RWBA 2Q3DA 1J9EA 1GPYA 1YZFA 2R3SA 3LOQA 1WDLA 2JLQA 3KYCA 1G20E 4IZIA 2YNMA 1K06A 3QJGA 1XHFA 4AUNA 1YZYA 5A0FA 1G2IA 3ZK7A 2A92A 2BR4A 1G4UR 1SU8A 3BGOS 3B9RA 3OLZA 4ZQBA 1O5OA 3UEOA 3HR7A 1PZMA 3M5DA 3ZU5A 1TPYA 3W5HA 1G41A 1PQWA 1NSTA 3G2IA 4WXPA 4CQNA 1EP3B 4LNAA 1SPXA 4ESHA 2LPMA 4J6FA 4A0FA 2I2DA 2O2CA 4TZTA 3OIGA 4MRNA 4L78A 4FW9A 1N2JA 3FPJA 1DKLA 3HSSA 3SWWA 4OPMA 3PX7A 4EP1A 5JCJD 1SIWA 4ZVRA 4FWTA 2OBNA 3MVEA 3OFNA 3QTBA 3H1FA 2H7YA 3ZV7A 1UT5A 1SG9A 3IUPA 4IJQA 5BVGA 5BT9A 3O73A 3E9RA 3A04A 1OKKD 3SZRA 1UJCA 1L5QA 2ADFA 4QOGA 5J4YA 2GJ4A 3A9WA 3ASZA 3OPYA 3B7PA 1PP4A 2X0KA 2GDJA 3A6EA 4XM0A 3AUSA 1SUSA 5K6AA 1R0WA 4Q37A 2GA8A 1KVTA 3B48A 3FGNA 4OQLA 5DK4A 3UAYA 1JWBB 1Y9JA 1T43A 1U9IA 2ZB7A 3JQRA 1TGYA 2H7XA 1W2HA 4RH3A 4EABA 2HWKA 5LJLA 3L6UA 2H2HA 4RKWA 5DKFA 5DNEA 4EW2A 4TZKA 4FR2A 3ORFA 4X7BA 5AI4A 4D9GA 1IMJA 1LTKA 1P5JA 3LO5A 5K0NA 1D8AA 3GLVA 1UKBA 1JA1A 4MQBA 3ED5A 5IW8A 2XUHA 4K2AA 4DNQA 3ZQ6A 1BIFA 4CF5A 2GJKA 1H2RS 2VRBA 4MRAA 3WYCA 3F8TA 1EFVA 1MEOA 2AC4A 4AUMA 1SQ6A 3GPLA 3H5AA 1XIVA 4LQ4A 1CS0B 4RVOA 3S55A 5CCDA 3OHMA 4DQUA 4MIKA 5SY6A 1W0CA 3K9NA 2CHUA 3TINA 3W04A 5JD6A 3WAKA 3IQEA 3ONDA 4QD3A 4LE1A 5EJ2A 2B25A 1GRCA 2G40A 4F5EA 2XZPA 2W2LA 2A5JA 5KWEA 1J2JA 1U9ZA 4WNYA 1AS0A 1R4MA 2WJ6A 1JN0A 3OCYA 2FX3A 3R3JA 5LQDA 4NHOA 4C0QC 3I2KA 1P1BA 1GCIA 4ZU1X 1L4YA 1X7XA 2Z83A 4X8MA 5KOHA 1EDEA 2R1TA 4C43A 3NOXA 2VHCA 1WXDA 2FPSA 2J46A 2P11A 3MS4A 3QXJA 2E5FA 3AY6A 4FZRA 4GOND 1N3BA 2XA2A 4P4SA 1YBFA 3VDQA 4AYWA 3WNCA 4E2FA 5MN4A 3O92A 3QWHA 4EY3A 1ZW6A 2P2LA 2XEXA 1Z22A 4RTNA 2RK3A 4HK4A 4DDHA 5KQRA 4W63A 4XRRA 1U2DA 2GJ8A 1PIWA 1J97A 4N1AA 3QTTA 3FDXA 2Y1XA 3B38A 1QQ5A 1T4DA 2WG1A 1XELA 2P2SA 3CHYA 3EMKA 1SOVA 4GOKA 4B80A 3AB7A 4R1TA 2VUSA 3S40A 4E07A 1IUOA 3O8CA 2PO7A 4OJQA 4DJAA 1JFFA 3BXPA 1DFHA 1R00A 3ACBA 4FWIB 5F52A 1WM1A 2WAOA 2HMYB 4KQGA 4PXAA 4MUBA 4UUQA 3VC3A 3MS2A 4LJAA 1NUPA 3C6XA 3ENZA 2NQ2C 3AY0A 3CRNA 1JIVA 2C83A 4L1KA 5E0KB 5A03A 1FRNA 1NXOA 1FSSA 4ZA2A 1NJGA 3SOZA 2XDAA 3USZA 3RSSA 3UKJA 2A59A 3FDZA 5BMVF 1YT5A 2IOYA 1Y3AA 3EGXA 3K35A 3JALB 4KZKA 4UDYX 3VHXB 1R4NB 4LJ8A 4AJHA 5CA1B 2WOJA 4MDFA 2QJOA 1QHSA 1R88A 1RACA 1SUDA 1U4SA 5C1IA 3ROXA 1C1HA 2Q28A 1M6EX 2B1QA 3G13A 5BVHB 1TVKB 1XAJA 5J63A 1LDGA 1W5BA 1TTPB 1BCRB 1V0JA 1A9OA 3DCIA 2XVXA 2OECA 3BL6A 2R5NA 4KE8A 4QSMA 5B1HA 3N2GA 3NIWA 2AK2A 1L1EA 1TLTA 4UATA 3BWEA 5KQLA 2PA0A 1AHNA 2O1WA 3QEMB 3WL7A 4Y1GA 3TCKA 1TUIA 4YLYA 5LLSA 3UKOA 2C7QA 1E3MA 4FYJA 1AM4D 5F1YA 1W44A 4MYSA 1J8FA 3OA2A 3D1JA 2WBLC 4M9XA 1MAWA 3B5IA 3QI2A 5DX0A 1CLUA 4OQXA 4Y2RA 2WVJA 1SG0A 2JIBA 3AH8A 4QT4A 3ZVKA 3OZRA 3Q40A 1XN1A 3GAMA 3P4XA 2O7VA 3O7MA 4IMPA 1BQ3A 4M60A 2O3SA 4TUYA 3BA1A 1KJNA 3DEZA 1UMCB 5I4BA 3GAAA 3OZWA 4I9GA 2JVKA 3C3AA 3OP4A 2MYNA 2JIOA 2H1SA 3SICE 4S24A 1AGRA 3VSEA 1TE2A 3LAWA 2EL9A 1U8FO 1Z6QA 4UNQA 3TTTA 2J5RA 3HP1A 1HMYA 1YZLA 1ZKMA 2W2KB 3PFNA 3R77A 3QELB 5FPSA 3WA7A 4AZ3A 1IM2A 4OYYA 4PC3A 4D74A 4ND2A 4YRGA 4ZDKA 4ZK6A 2HF7A 2QG4A 4A27A 5JANA 2R7KA 4NY1A 4D82A 1TIBA 2EQAA 4BLWA 5TF4A 5ES4B 2JZNA 4RGBA 3U4AA 1R9NA 3IUEA 1OC4A 1M8KA 3MTEA 4K03A 4OMDA 4BYGA 2HMVA 4XSVA 4WRRA 2BHSA 3GDWA 4C07A 3GUYA 5BOVA 2OZEA 3GJXC 1E8NA 5E3JA 4YR9A 5IC4A 1XEXA 2GN8A 3OD5A 2WYIA 1EJBA 4IOMA 4LK3A 3VPAA 2BYTA 3L6BA 1SCAA 1OGYA 3CLTD 1FFDA 5NLLA 4DE5A 1OWPA 1P7WA 2WKPA 1S6YA 3LBFA 3QUSA 5B1DA 4B8ZA 5AVQA 5HA5A 3GMTA 5DISB 1LB1B 4PCLA 4AKIA 1PWYE 2ORYA 3TF5A 2G6BA 1G3MA 1UMBB 2CUZA 3ITNA 2GZ2A 3IPYA 4CIYA 1F0PA 4GM0A 4TZ0A 1FFHA 2A9JA 4M1SA 3ZQKA 4F4CA 3T34A 1TAHA 1NI4B 3ND6A 4X7RA 4OUKX 4OUDB 3ET5A 1OPXA 2PSDA 4C7MA 1J24A 3BJZA 4JIGA 1F8XA 2GXQA 3V48A 2EBFX 1IBSA 1DJLA 3DNFA 1TVMA 2WUDA 4A2PA 1GU7A 2TMYA 1E99A 3ZWOA 3W2GA 1VL1A 2FX5A 2GLUA 3LF1A 1N6NA 1NUTA 4FNAA 1WLYA 2CL6X 3A1FA 4WJLA 1T8TA 3BH6A 4G4IA 1D2HA 1S9HA 1UBNA 2BCJQ 3ZE2B 3HP7A 4AYXA 2VQ3A 4EARA 3JZFA 3IT3A 3PDIA 1JAHA 4CL0A 4OIFA 1PR0A 1TZ2A 2AQ8A 3PR2B 2O59A 3T52A 4MUGA 2WWRA 4B4KA 1ONSA 1KAQA 4DBLE 5JZ9A 1PT7A 4CGZA 2VHWA 1QHFA 4FM9A 2HNBA 4TRMA 4A82A 2YWCA 2WICA 3JWPA 1L3BA 1EFTA 1ZHFA 3OOYA 4A8HA 4ZHSA 4OLBA 3P4YA 1W8IA 3TQFA 3K0KA 1FUEA 2PKQP 2O3TA 3K31A 4KI7A 1TW3A 1XMVA 3A05A 4GQIA 3W2HA 1MIOA 2C2YA 2Z4RA 4MWEA 1DFIA 2V7GA 3VSAA 1LDNA 3HKDA 1IE3A 2C2GA 3K0CC 2I4TA 3A9TA 1B15A 4MEAA 2ZSJA 1MUUA 2EJUA 4Q19A 5JIBA 3NONA 4Q9LA 1PJBA 4YHBA 3PB3A 3ZCTA 1K92A 4UNIA 3V2GA 4EGJA 1CDEA 4BUCA 1AZTA 2DE0X 4HMPA 2FZCA 1Z4MA 3C70A 3JATA 3L0CA 1KOJA 4UD2A 2XW6A 2ABWA 5LA6F 3ORYA 2XTNA 1E96A 3LBYA 3AESA 3IOYA 1AKWA 3H6HA 3HNRA 2OHJA 2IFTA 3L43A 4TRRA 1M66A 4DMHA 1Y34E 4LY9A 4UHCA 4PLYA 5A5FA 1K9SA 3T0GA 4OXKA 1Q0UA 3BDVA 4DLNA 3ACDA 1B2LA 3F8WA 4KMSA 2ZYDA 4Q3LA 3AJDA 3CX7A 1R5JA 4NJEA 4UHJA 5EZYF 4ZHQA 5L8VA 3FPEA 5BV8A 3BJMA 3IX7A 5IJWA 3K0SA 3VU0A 1KEPA 2GXUA 2BPOA 4HXFB 3TNYA 1ZD1A 3BHMA 4NZYA 3BD7A 2IHYA 3UATA 1QFSA 3T41A 3SJUA 2WIAA 3KEGA 1QGUA 1L7MA 3TW8B 5CVCA 1K2VN 3WLNA 3KRTA 3RRBA 3SVLA 1Y6GA 3KKEA 5JPCA 4I9HA 1E2IA 2ZXFA 2BTOA 1XF9A 4RTJA 1YOVB 3MRVA 4D3YA 3B2NA 5LOVF 4P82A 2DETA 2DQZA 4HI0E 1JBQA 5FFMA 2FRXA 2E82A 3HCFA 3HJUA 3X1MA 1GLNA 4A6PA 2XMGA 3NQ41 3UOWA 3HYTA 1YV9A 4DIKA 1LNZA 1F1JA 4L4ZA 4MLCA 4M49A 5CK5A 1VLZA 3DMTA 3IAFA 4OSPA 5EWMA 5JSQA 3FDJA 2MHCA 4YJ2F 1Z82A 5FQNA 1H69A 1M2WA 1LC3A 8MHTA 3H11A 4KWEA 4LFCB 4INPA 4CDMA 3HKCB 4MWTA 3VMFA 1TD9A 1YRBA 4MS1A 1BKSB 3MWEA 4KV9A 5DLQC 4NU5A 2ONCA 4QREA 4XWYA 2RGDA 2Q1XA 3D4OA 1EUDB 1SZPA 5EPOA 1ECJA 1U8CB 5B58T 2WTBA 1NN5A 3KQLA 4ZCMA 2VTBB 4ONEA 3GLTA 1RABA 1GRRA 4TSFD 3WMFA 2CLEB 3V4PB 3DE6X 3PR3A 3ZN2A 2ORWA 5CG2A 3QWFA 3JQ9A 3WI7A 5CXQA 5DM2A 1YR3A 3RVMA 1LFDB 4BBJA 4IUBS 2X22A 3RJTA 1MJNA 2JGDA 2PRYA 1TQ8A 3HY6A 2AJ8A 3I1YA 1KP2A 2R8BA 1ISFA 2PGNA 5CUQA 1QAOA 5B2ZA 1UT6A 1PEDA 2G28A 4Q7QA 4RULA 2INGX 1EZZA 4CEIA 3F67A 5HDBB 3EDMA 3OU7A 1FP7A 2YCLA 4J4TA 5DWQA 2C9YA 1O0BA 1PJ2A 3SS8A 4CTMA 2RIPA 4MIEA 3MT0A 5JYEA 2Z1DA 4FHZA 5F77A 3H5WA 3I34X 3BHJA 2H57A 1RM4A 3B9QA 4Y2PA 5BT8A 2GHTA 2KJQA 2ZRMA 2Y9MB 1KFCB 1T24A 2GLXA 2ON6A 3B5EA 5CVTA 3GCDA 1THTA 2JKVA 1Z75A 3EFEA 2Z0MA 4J49A 3NM5A 4JXKA 1IY1A 2SCUA 4PZZA 5ILGA 3FOZA 1RS0A 2G67A 2KM1A 2OMEA 1Q74A 4HUJA 2X86A 5IZCA 1DJPA 3MYRA 1SUBA 1YJBA 3G5LA 3EARA 1CERA 1Q0SA 1ZUNA 3IKLA 2A1IA 4EB6B 4DUZB 3GAZA 3ER9A 3NP7A 4I50B 1E5QA 3O1JC 2I7DA 4JLNA 1QKKA 1T10A 4MROA 4U2FA 3IURA 5E9AA 1LTQA 1M7HA 2C9OA 2ZWAA 4DNFA 4DZRA 4JP5A 5IJ9B 3VZPA 2WAAA 1NVVQ 3KE8A 3FVQA 4H9GA 1ZH8A 2BM8A 2G04A 2JFNA 4ZVTA 5CBKA 1Q92A 1M5TA 2GN9A 4MVJE 1Z29A 1NXXA 4GSKA 5T4FA 3ZVRA 3EPHA 3R7FA 1N36B 2FDCA 1XNQB 4QQNA 4PY2A 5ECDA 3RFXA 3K0AA 1G55A 3F71A 4YRMA 1U28A 4N5HX 5ESWA 1KRXA 1AF4A 3RS3A 5HR5A 3KSZO 4DLWA 4L0CA 2HM7A 1WDMA 4MQUA 5K8IA 1UAGA 1GNVA 1UJNA 1J21A 3C16C 4I4TB 4W1QA 5EZ6B 1EP2B 1H3NA 1DZIA 1O5IA 1C8VB 1FX0B 1E1LA 2Q2NA 2OZKA 4HS4A 3FFXA 3P9XA 3W5CA 1U8ZA 2QPOA 3ICOA 1Q16A 2O54A 1Q22A 4DIMA 3DUWA 2CLKB 4Z4FA 3ZDXB 3KTOA 4PM4A 1CY4A 3CA8A 1XEWX 4DMLA 2QP3A 3IOBA 5A9TA 3RSLA 3EVNA 2QI9C 1P29A 4IH9A 5GJCA 5F3DA 5FI0B 2HSEA 4F5YA 1U2SA 5DOVA 3V1LA 4W5HA 4DV3B 4G0ZA 4URUR 1UP7A 2JNWA 4QARA 3JQCA 4ZVMA 4LMAA 3W6ZA 5A4IS 3SQDA 4EKYA 1V5IA 4FZ3A 4URXR 4M0MA 2ZE6A 3UFBA 3OQIB 5KKCA 3SBOA 1SXPA 3PCTA 4XCVA 5CXSA 2YNMD 2X0DA 3TTSA 4M9QA 4A8JC 4F5ZA 5C4IA 5JI2E 5JNSA 5JSZA 5MFPA 3M8KA 4N54A 3FTPA 3IIEA 2W93A 2NO9A 3P9RA 2OD7A 3KUKA 3RW9A 1FU7A 2WIDA 3TL3A 4TQGA 3QA3E 4EX7A 4Y0NA 2A57A 4OXXA 1TM3E 1NWHA 1AHPA 5F3RA 1GKUB 1N2CA 1DWPA 2OWEA 2O20A 3NWPA 4EX6A 1UDRA 2EJVA 2REQB 3ANMA 4YI3A 4D7AA 4HV4A 5B37A 4YT2A 3ZDFA 4LZWA 1W4ZA 1HDCA 2YZMA 4FEEA 4EG4A 3LV8A 3N3BC 2HCJB 1NOKA 1ESMA 2OGTA 4HDNA 4LHEA 5IEBA 3CUKA 3BIXA 1YFZA 2UZ4A 1BHSA 1YFJA 1KY2A 1VJCA 1TXGA 2LGJA 1EBFA 2QUZA 3BULA 3G2OA 3G59A 3LSYA 1SCDA 5C34B 3TIGA 2CT8A 3AHFA 4LXXA 5EYPA 3L02A 1QFMA 3QI7A 1QH8A 4ZARA 3VKWA 5DN6D 2P2NA 2RHLA 3NPMA 2LE0A 2PFKA 2BY4A 4ROTA 3H16A 4NPCA 1HZZC 1T4CB 3D7MA 3JYPA 3UICA 1OWMA 1IY0A 1SBZA 3IVRA 4RTMA 1M7GA 1DWUA 2NTVA 2QXTA 1KQ3A 3WYBA 3MIZA 3LXUX 5AOCA 4KR6A 4DMFA 4FONA 1QO7A 3C6YA 3MM4A 2D1YA 4BP1A 3ZG6A 4ON9A 3JZDA 1FNMA 1P7YA 3BVPA 4HH1A 2Z6AA 2RFLA 2VHXA 4KO1S 1U7DA 3DQQA 2OGWA 5F2KA 4A36A 1SKMA 1QE5A 3JVEA 5LA6A 5FL3A 3EPPA 3IEUA 1PTJA 1KOFA 4DSOA 2XZLA 1OH5A 5CYFA 2ID8A 1XZGA 2QN9A 2NO4A 4AWXA 5CXUA 3ZWAA 1OH7A 1WKCA 1YL6A 3C3XA 5JMOA 4K9SA 3O90A 3D8TA 4IMJB 4GR5A 4GKJB 1QGYA 3U3OA 5GIOE 4DR6B 1CJCA 4I5DA 3HKEA 1PYDA 1XEFA 4KE7A 5JD3A 2Z57A 2I3BA 3PEFA 1XT6A 4QTZA 4EITA 1OU0A 3QUCA 2F00A 2JASA 1O95A 3RVRA 4MB6A 4HXEB 4QDJA 1F2UB 1AXRA 3ZDCA 2VYVD 4I1UA 3UHJA 2VAPA 1BS9A 3RQIA 2Z1MA 3N86A 1VMDA 1DQNA 2W2LD 3GO4A 1XJ5A 2B0JA 4MVWA 2ZIGA 1Y5NA 4LJ5A 1W35A 3G0CA 4M8SA 1X8XA 2FX2A 1GZVA 2YV3A 4ZCSA 5TQ0A 4X8OA 4D81A 4Q3OA 5EHNA 2VCEA 4U2DA 3OZBA 1NY6A 5LOVA 3LXMA 5C8YA 3GFVA 1DTSA 3T9CA 1V95A 3EG5A 3H42B 2DWUA 4E03A 2DFTA 4OBWA 4TS3A 3WK7A 4OFBA 1O6BA 2BGLA 4JHXA 1FMLA 2J33A 2HMUA 3AW8A 3TUZC 3I76A 3DEJA 3H83A 3V9PA 3I32A 1TOAA 4DV4B 3PQEA 3UJAA 3KQKA 2RGCA 4D3XA 1EK1A 5JROA 1HWYA 3NEYA 4YJ2A 3AK4A 3BK1A 1XVIA 4OLHA 3KJFA 1UBKS 4QEKA 1G8YA 3EVGA 3FUXA 4TV8F 1MA0A 3PNSA 4JYPA 3CW9A 4CKCA 5A4KA 3ZLUA 1IY8A 2WMNB 3AONB 1CUZA 4NECA 5CT4A 3RBZA 5F4ZA 3SHFA 4G1EB 2OKGA 4IXDA 5FFFA 2P3QA 2FSGA 3N2KB 3PHCA 4MV5A 2IGBA 5C52B 3IPXA 4L76A 1F5NA 2PT6A 3AI3A 1D2NA 2VJCA 4GS5A 2BI8A 1AA9A 1H23A 2PSJA 1YC5A 2DUWA 5C3MA 3C1OA 5DLDA 1U65A 2F3TA 5EIAA 5E7MA 3W5VA 3CUSA 3AF4A 4K8OA 3E2IA 4QQKA 3UW3A 2ZRAA 3IQGX 1A7JA 2HAEA 1WQ4A 3EWAA 2FSSA 3QV2A 3TJZA 4E5DA 1ZP6A 2NZ8A 1CW2B 4YRCA 3EIWA 4O4LB 3OWHA 3IOCA 2R6R1 2PS0A 5L9AA 2XRZA 1DMRA 1K6EA 4MV3A 1RYHA 5L4NA 2FPUA 2HYDA 2B5OA 4MW1A 1G2PA 2RHHA 4F46A 1SEVA 4J2OA 3OZIA 4FC6A 5AM4A 1ZJ5A 4TKMA 2AD5A 2ZCUA 2PX5A 1XTPA 1RWKA 3C4VA 1E3WA 1E9SA 3BTVA 4U0JA 4PYJA 1XYYA 1PL6A 2EATA 2HRDA 1JW9B 2XTJA 2NUAB 2IPXA 5EXSA 4D0RA 2H31A 2PH7A 1ZN8A 3GN2A 3RU3A 3S99A 3WS7A 4OD0A 2ZWVA 2Y4NA 5AKKA 1UBEA 1UJ6A 1FF9A 2EV9A 4Q9JA 1CUEA 4NS4A 3DXFA 3UQZA 4D9FA 1UT8A 2HDWA 3LVRE 2FPIA 4HNVA 1WO8A 3QGMA 1RPZA 5AK6A 4LXTA 3AC0A 4POAA 3D1VA 1MENA 2FDXA 4WOKA 2ZYGA 2RB4A 3WLJA 3SC4A 4LYJA 3VPCA 1OZAA 4P7BA 5JDIA 5LPNA 3A1WA 5CYGA 3TEJA 3HXMA 4YRTA 5H80A 4PPFA 5KC9A 5TPZD 2O0HA 3PZRA 3HJFA 1SQSA 1QQ6A 5CDSA 3DL4A 1M6NA 5IKMA 3VH4A 1BJKA 5GZ3A 2IDMA 4TYNA 3ESXA 3PNYA 4N41A 1OTXA 4E09A 2Q45A 2D1RA 1XVTA 4GSLA 2J07A 2ZE5A 3A6LA 1QZXA 1W30A 4Q3NA 3WLQA 4R8RA 1CR4A 4EPYA 2QD5A 1UWLA 2WJIA 4PLFA 2G82A 2C3OA 1QONA 2I54A 3UT0A 2XV1A 1IBMB 3WB1A 1DT5A 2BF4A 3GUCA 1D3AA 4K6OA 4KJZA 4PX3A 4MI6A 4ZVSA 1H2XA 2P5TB 2Q0XA 4Q4AB 4AYTA 2ZI6A 4NH4A 3Q5GA 3AEYA 2QR3A 3H97A 2HCBA 4FMBB 4MR8B 1QF7A 4TRJA 1Z28A 2BFDA 3AB8A 1WXIA 3H5LA 4OQYA 2EKLA 2WKRA 2QRNA 4OP1A 3L8MA 3TQCA 5I7WA 4A0HA 1JAIA 2WIFA 2KB0A 2EWWA 2SECE 2R7AA 3NHWA 3OM9A 4FFVA 2OR3A 4JT4A 1L4LA 2ICAA 4M8NE 4O0LA 1MJ5A 5CX1B 1ZJWA 3O0DA 1LLFA 4K6MA 3UBTA 5F64A 5JR3A 4QLBA 1R0ZA 2IHZA 1REQB 5SICE 4IXNA 4HN2A 5FTWA 1TGVA 4BPBA 1CY6A 3BWYA 2BF7A 3T1VA 1VGRA 4DL9A 5KYKA 1C8KA 1PT5A 2ZTUA 2I87A 5JAOA 4Q9HA 3M9LA 3OPVA 3IESA 1JHAA 2HLPA 2I91A 3R3UA 5JCZA 4OMUA 2O4UX 4V39A 4DRZA 5T8KA 5JQGB 2HU7A 3LE8A 2ZWMA 3PUIA 4YAJA 4BEBA 4KUHA 1JDBC 2A1TR 4URVR 2QBYB 2PZBA 4PYIA 3UGJA 5E6RA 1VE7A 1MO6A 1QHNA 1V47A 3E9YA 4QNRA 5AVWA 2FP4A 4CKWB 1GXSB 1V7QA 2RGNC 3FDIA 4Q9NA 4MW4A 1GA4A 1M74A 2C5EA 2J0SA 3AR8A 3WGKA 1SCNE 1T5LA 2YWXA 3IODA 3R6WA 4H3VA 5F1PA 3WJ1A 3SSNA 3LUFA 2Q4RA 4F45A 4MJ3A 5G4LA 4ARCA 1HE5A 4IV8A 2EKDA 2O8FA 2HK7A 2G9ZA 3FOCA 2P6OA 1ARZA 1HLGA 2X1MA 2CSUA 2W00A 5GINE 5BV0A 2EEPA 2PHZA 5ADVA 2QDKA 4MS1B 4EY6A 4D80A 3BXFA 2WMDA 2EHDA 1NUSA 3T4PA 3ESYA 3WICA 4JI8B 1IEVA 5C8ZA 3CEAA 3VISA 3W6NA 2OPBA 1YI0A 5HKKA 4BEWA 2DLNA 1MAVA 4I4IA 3SIPA 5KS2A 2B34A 1UFKA 2FOIA 1NKSA 2Q3BA 4Q1AA 1MRZA 3WK4A 1SCUA 4TYMA 4XPIA 4FFSA 3WGHA 3D6UA 5CCXA 3MWJA 1Y6QA 1JIXA 3JQBA 2GCGA 4NCIA 2GO1A 1NV8A 1ZW1A 2F8LA 1XLUA 2OPHA 1M8PA 4WGFA 1J8VA 5AKEA 2OQRA 3W5DA 2VZ0A 3O2SB 3QW2A 4IOKA 5EKDA 3Q9NA 4AF6A 4IXTA 1KAOA 4MYTA 2WE8A 4GR9A 1SRQA 5KJFA 2C03A 3T3GA 4Z1MD 4KQHA 1ODLA 4IINA 4YXFA 2OUIA 1E2NA 1J9GA 3FCCA 3DNMA 4HPXB 3SM3A 1YDGA 5IJZA 4DV2B 4KQEA 2GCOA 2UVPB 3G6KA 3IEKA 1K0FA 2YQ4A 2FKNA 4NJOA 1KBQA 2RHWA 3FFBA 5T6BA 4FMDB 3H3XA 4J1QA 2OYSA 4TLBA 3T3DA 1J0CA 1P0PA 3WLOA 2FH5B 5KVVA 1WSAA 1CWUA 2GD2A 3MINA 1RAAA 2OCKA 4XDZA 4CM1A 2JAOA 1ZM2A 1D1QA 5ABPA 3ETLA 5JWRA 1L5FA 3O74A 3AHDA 4GQAA 3MIIA 4KLRA 1W73A 3DCNA 4J75A 3EJWA 3TLXA 3VC2A 5L3SB 1GR0A 2W6ZA 3P0EA 5JXHA 3ZVLA 4MJLA 3CRW1 1NOIA 3L4JA 3D59A 1IUNA 1X1EA 1SXJD 1X7WB 3IJPA 3PTZA 4UDXX 2HIAA 4DG9A 1PFYA 2ZVJA 4MKHA 3O3MB 1UDCA 1O8BA 4NFLA 3HDVA 3CLUC 3BMNA 1CDZA 2IYYA 2GM5A 3ZE6A 3EVTA 2GJ9A 3B85A 4F8EA 4LE2A 2O7RA 1TCCA 3ELDA 4R3WA 4UU1A 3UMYA 1WNTA 1RHMA 1Z34A 5EP1A 1AKNA 3RFFA 5B3KA 4TV8A 1T36A 4H1VA 2AXQA 1CZUA 1Q1AA 1VECA 3I09A 2C8KA 4FYHA 5SYAA 4ZAWA 5K6TA 2FJPA 1PDOA 1HQKA 1U7ZA 1ND6A 3LX4A 4M3NA 5A3VA 1Y7IA 3DE0X 4AZ0B 2PYDA 2OXFA 2V5UA 5DRYA 4R98A 1B23P 3PHLA 2Z8YM 4FOOA 2BGTA 2IYWA 2JFXA 2ZREA 4BGEA 4DUYB 3KU4A 2BMAA 2X14A 2WJPA 1KQGA 2M98A 3CN7A 2JAHA 2XB9A 2ZIWB 1M2OB 5JFGA 4MNTA 4RTPA 2DWCA 1JG6A 1G6Q1 3R7BA 2PZLA 1LW7A 4C2UA 1DUSA 3LSTA 3NAGA 1P73A 1PCXA 2C7VA 2WJAA 1RYDA 1VPTA 3OIYA 4WFQA 2ETVA 3U9LA 1JBEA 4QBKA 4A6DA 5IZ4A 3LOUA 2ZR7A 4M86A 5I4IA 1CR1A 2H1CA 5IAOA 3HI6A 1UXGA 8GPBA 1FPMA 5B3JC 3I42A 1SC3A 4L22A 4PG5A 3F49S 2R8YA 4HQOA 4WVFA 4URYR 4MVJH 5IH3A 4ZWNA 4K6HA 2FPMA 4ZU6X 4K6FA 1M5RA 4B2LA 3FOAA 4C4TA 4CTKA 1ILEA 5K4HA 1QP7A 1DXHA 5JMTA 1PZXA 3UMGA 1NF3A 2DH5A 1GA1A 4LZOA 3UJCA 2OAEA 1P81A 4GX1A 4UXJA 7REQB 4QXOA 1RM5A 4ML3A 2XRYA 4F4IA 3MRXA 1IHYA 1NQXA 1YB7A 2CXOA 1WMEA 2TS1A 4RYLA 1TT5B 3NB0A 3V8MA 4ICIA 2DGDA 4EEZA 1TK9A 1Z68A 1SU6A 4V02A 1RQRA 1B0ZA 4EHLA 4O3MA 4YQYA 4D99A 1XBTA 2P0YA 4MLDA 2V54A 1ZDMA 4F5WA 4B2PA 3Q3GE 1DQYA 3R20A 1O77A 3RREA 4A2QA 5C1PA 2GR9A 5CEFA 1L7RA 1MO3A 2NZJA 2Z5VA 4KV7A 4AX4A 5LQUA 2ENWA 2WG2A 3D4NA 4JASB 4PS1A 2PX2A 3ZDEA 5B5SA 2XYPA 5C5DA 4A91A 2OC9A 2VJLA 3G2NA 4M83A 1OOEA 4O5AA 3A25A 1SWWA 3TZEA 1GZ6A 3L7MA 3KXIA 5HKBA 3MSCA 4D02A 3WDMA 3TR6A 3IAXA 3M5WA 2IS6A 3H6GA 3MBIA 1GZ4A 4HDMB 4NMHA 5LNK6 3VJRA 1E69A 4GX0A 1DOZA 3UHOA 4XZ3A 1LU9A 3AHGA 3D3JA 1LBIA 5D3MB 3SXJA 3LQ4A 4BBPA 4KSCA 1D6JA 2PRIA 4AZVA 4XGIA 3Q2OA 5K45A 4I99A 3LBHA 3E8SA 5K8TA 2GMWA 2NU6B 3WZ2A 1KO7A 3GZNB 3WJAA 3EXHC 2BW0A 3LCMA 2UZ0A 1KJIA 1WMBA 2IC5A 3OF3A 3T5AA 3U44B 4N49A 2WYWA 4OCZA 1RDFA 1SB8A 3GA5A 2I34A 1DUIA 4OI1A 3DAFA 3ZBUA 4BVGA 3ZCPA 1B0UA 4YACA 2ZVQX 2ZRHA 2H5JA 3OZDA 5FWAA 1MZVA 2AH5A 3NMUF 1O94C 4ODIA 4X6XA 5E1DA 4IWYA 3DEYX 3GY0A 3OJWA 1JPUA 1KSGA 4D4HA 3CRMA 2ZRQA 2JDID 4LPKA 1JAYA 2C3PA 1AKMA 4JI0B 4Q93A 4IXMA 2AN9A 2XE8A 4LV5B 1Z8DA 1VBFA 4CTOA 3HCBA 1KY3A 1TC2A 4QDZA 2X4IA 2X8BA 2WD7A 2XOKA 5D51S 3ZGOA 1M9NA 1E6EA 1RJFA 5KPDA 1SQ0A 3GJ5A 4ILKA 4E3ZA 2AHRA 3BFPA 3OZ7A 1W1UA 1CUVA 1HPLA 2I6GA 1P7CA 2GD6A 4I4LA 4ND7A 3EPRA 3RGGA 2L69A 4EG7A 7ADHA 3SE0A 4QHSA 5K8LA 2Q46A 2P2ZA 3KQHA 1EFHA 4C2AA 4KN9S 1U3GA 4FS3A 4L5AA 4WCFC 5I8WA 1HY3A 4DDTA 4OQEA 4YBRA 3NH9A 1QP0A 2NO0A 1CY7A 4DN6A 4WPGA 4WEOA 1DQSA 4MV8A 5IU6A 2YJ5A 4JOQA 3IHKA 1EBBA 4OHRA 5FOVA 5BQXA 1TLLA 3TQIA 1CDOA 1P91A 2E1RA 4BZZA 2J4CA 3RAJA 5FQOA 4IM7A 4BZWA 1R0XA 1C8LA 2DWPA 1LLDA 2PLAA 1SPBS 2Y1KA 5TRTA 2C4HA 2YWDA 2H0QA 4LRQA 1WBDA 4JMLA 2O8DA 2GBIA 4XJXA 3AYZB 2X3UA 1RE1A 4Z9AA 3K9HA 1VIDA 2OORC 1V8DA 4YB8A 1JZQA 3IKVA 4XD2A 1N2SA 3URMA 4D9MA 1CUUA 3S2FA 1J42A 2Z58A 2WU1A 3R5JA 3SQXA 1EQ2A 2FWIA 2VAWA 1T9BA 1GPNA 2WTAA 5DASA 1ZLYA 2D8MA 1X19A 4FN4A 2EKQA 2PLNA 4Q7EA 2FSHA 2NZUG 4QHTA 3ELWA 4COKA 2ATIA 3ND9A 5FCDA 2XH8A 1F14A 2C2BA 4PPYA 4E32A 4RAQA 1T2DA 1H0SA 5I7EA 2K7ZA 2P67A 4CHGA 1EFAA 3HBJA 5KINB 4M1TA 5KSZA 4G1FA 4DLAA 2XF8A 1Z5UA 2HMSA 2XQGA 3DOHA 3CNLA 3AUFA 2II6A 3QUQA 1FXWF 4FNMA 5LQNA 1XOIA 3PGJA 3Q9LA 4O4IF 5BOSA 1P0CA 5J43A 5J58A 2I2XB 1QIHA 4GPBA 3PUWA 2ZJYA 4UPVA 1OIVA 1YCFA 2A5GA 3W06A 2F3SA 2VJOA 2E87A 2A7XA 2ZVPX 4WOPA 1WBBA 4LF8B 5DLYA 1VRCA 1C7ZA 2ZE8A 2ZETA 1YS1X 4JA0A 4N6NA 1U6IA 3BF8A 4OBXA 4DCGA 2XKKA 2F48A 1C8BA 3IPRA 4MWSA 4CM7A 3ID6C 3MUEA 4NATA 2AJDA 2DWQA 5EJIA 1H6AA 3LQ1A 4WHMA 2DHEA 2WD8A 3EPJA 1F12A 2XYHA 3PCXA 4KXXA 4G5YA 2FG5A 4H6XA 1IN5A 2QLBA 4GO1A 4MI9A 1KK0A 4KIWA 4PC6A 2B4KA 4CQJA 5AOVA 1JQDA 3W77A 2APJA 1I2ZA 3QKRA 1UJ5A 1RT9A 5LKAA 5JDCA 2Q6KA 2HA2A 5FUWA 3ICVA 1QHYA 1ZM3A 5ALOA 5ULLA 2HRCA 4YCMA 3MJCA 4UTNA 1NIJA 3BMCA 3SHVA 1IBLB 4WNIA 2WINI 4DKJA 1RMTA 1Z8HA 1LSSA 4WN9B 3RIHA 3K5WA 3SR4A 1OBVA 3G7UA 4J3JA 4C21A 4CL8A 2PT5A 3QG1A 1E79A 5E7IA 2Z43A 2BGUA 2Y0PA 3NNNA 4OFWA 1F8YA 1MJFA 2ZB2A 3N6XA 3PWZA 3EIOA 3S2IA 5CB4F 2X2EA 4L8LA 4ALIA 1Z4LA 1NZDA 3CLSD 1Z4IA 3CNNA 1AZLA 1XMJA 3L0BA 3AWIA 4KMMA 3KIPA 3ZH9B 3KTAB 1O9HA 4YUVA 3X43A 5CITA 2ZBVA 4PIVA 3P20A 4IMIB 4L08A 4YMHA 3CXUA 2AW5A 1YBHA 1AUOA 1OX6A 1JEQB 1SRRA 2BVNA 3HV0A 3N8GA 5HIJA 4BYMA 5CR9A 1IC6A 2QZSA 3K94A 4FSHA 3C3PA 4Y2GA 4BL5A 3RBAA 1B6SA 1EK6A 1OZFA 1L4MA 1XTQA 1NUAA 1U9JA 2FWAA 2NU7B 3B6IA 2VAVA 3JSAA 1B41A 4LHXA 4TWBA 3FIUA 1S4MA 3TQQA 4C20A 1RJ9B 4D5EA 5FJJA 4RFSB 1RBQA 4JR0A 4UUOA 4AL4A 2E1PA 4L2IA 2JLBA 2YVKA 4DA0A 4ZT3A 3DVAB 4D92A 4N48A 3FNBA 3QIVA 4NQRA 1NBHA 3PS9A 4MRMA 4KH1A 5EAIA 5I7OA 2XCSB 4ECAA 5L3QB 1WUJS 2PMBA 5HM8A 2H2AA 1H2FA 3MUOA 3FNHA 1Z8NA 2AZ4A 1P61B 3NWEA 3MGAA 4CN9A 2W0MA 1MDFA 2QK4A 2ZAYA 4ME6A 4KR7A 1WVMA 3STWA 3GWZA 1ZRSA 2JBAB 2PKXA 3CQ9A 1S1MA 2GF2A 1FUYB 4HP8A 1F8UA 4WZBA 1W6RA 3CBGA 3A1DA 3RYCA 3IMGA 2BFPA 2EARA 2I03A 5DYWA 5KJ6A 1EAMA 5DPMA 3CPEA 3FNEA 4TMFA 4NARA 3TL6A 1Y3IA 1CE8B 1D6MA 1WQ1R 3RFVA 3U3DA 3UUEA 2ZEJA 4U9UA 1I6WA 1Q15A 2Q1YA 4JV5B 4NJMB 1YXMA 3E81A 4MA4A 1SC4A 3N7UA 2RAFA 2HSGA 3HR4A 2J0UB 4AKTA 2VNAA 3USCS 4K05A 2O6LA 3KZCA 3DB1A 3TIVA 1N5RA 4TQAA 4OMCA 3EJ6A 2JJMA 5E6UB 3E35A 4HZUB 2E3JA 2QJFA 2C1ZA 4YH1A 1UPFA 1RYZA 2ASEA 3A1SA 1X80A 1QTQA 4B83A 3LUCA 2XJ4A 1UK9A 4KVZA 3VRHA 4TLMB 1MVOA 4G5FA 3PQ2A 3A9SA 1XL0A 1SVKA 3KJNA 3LT2A 3QSGA 4QRDA 3RTDA 4EB0A 4L5YA 1L4HA 1SXGA 4MV0A 5ENVA 2NSYA 4IIBA 5K3SA 3NWJA 1DBVO 1R4ZA 1UXHA 4LNUA 2DF8A 3B5JA 1CEXA 2WIKA 3KSUA 4BBAA 4XDHA 2QTHA 1MD9A 3UC9A 1CTQA 2LTAA 3ACCA 1N0HA 3M2PA 3NBAA 3V55A 1XK6A 5KOJA 3D6HA 3UJPA 4PVCA 1A96A 1FMCA 1YR2A 2PEYA 3LXRA 4G9EA 3RAGA 2V1UA 5CXXA 1HEIA 4CKBB 4CQMA 4J91A 5FF9A 1DDIA 1EINA 3QVSA 3O83A 2H1LA 5TE9A 4EYGA 1JR6A 1PJAA 4BB9A 3JR3A 1P0MA 1T2VA 1QV6A 4X3CA 1PFGA 1GCUA 3PUXA 2PE5A 2GHRA 2PY6A 3A3NA 4D56A 3U49A 1NUQA 1LK7A 4XVQA 3UFXA 3B1YA 1UK7A 2EU8A 4L6AA 2VA9A 3O2QB 1EIWA 4PQGA 1OC2A 1BAPA 1ZY2A 4ZYUA 3VDRA 3ZHTA 1GTRA 5TQ2B 4PLWA 2ADOA 1H9AA 3DBOB 3C3YA 3O8LA 2NO6A 3KC2A 1AUPA 3EQ9A 3IHWA 3T5CA 3WGYA 3J7TA 1WHTB 3OE7A 4EENA 2HUNA 3UJHA 2A5FA 3RIYA 4ZYWA 5CFRA 2AOVA 2OXTA 5BP7A 1JALA 3EX7C 1O5TA 3BGSA 2J3DA 3GA0A 3WNDA 6Q21A 3SEAA 3HWSA 4F93B 4OQFA 3N2NA 3KTFA 2BGNA 3U61B 1P2SA 1NVDA 2UZIR 3SX0A 2JFQA 4RM2A 2AN1A 2DMRA 4PYMA 1QR2A 4CLDA 3M6VA 2Y9PB 4EAQA 2IXDA 5JW6A 2BM9A 1PR6A 1PSDA 1F20A 1JLLB 3CRZA 4MQFB 3HN7A 3F3YA 3NHZA 2IVZA 4FUQA 3WV5A 2NT3A 2FUCA 2VZ8A 5CA1F 3IUQA 3DE1X 3PWTA 2AE1A 2HX1A 2VDRB 3RG2A 1JMYA 1ML4A 4KI0A 1BU8A 4JFAA 4M36A 2Z5FA 1ZSVA 2Q6LA 1IZ8A 3AJ8A 3W3AA 4QGGA 1BYIA 5DXAA 2VDOB 3A28A 4Y7DA 2D62A 3FVWA 4LXYA 3TAUA 3G2LA 4Z0TA 1V1RA 3DLIA 3GC6A 2MTBA 4NNPA 4BX0A 5DSZA 2GTHA 4RGYA 1MF7A 1UBTS 2QN2A 1W36B 5BSFA 1NR5A 3MAJA 3ZX4A 3A4MA 5AVZA 4HDAA 2Q5OA 1D09A 4NNJA 3O75A 3NTRA 4HUQA 2ZTHA 3LQRA 3NHAA 1F3OA 3A9VA 3ZTWA 1G9SA 3RSHA 3TTUA 4CG2A 2ZUSA 3OTOB 4I6GA 4M1OA 4P35A 1EM6A 4QBGB 1AOXA 1BDMA 4GMXA 4AROA 4DADA 2IXEA 5DHUA 3NUGA 1ZRHA 3PSAA 1GSIA 3WDKA 2PGIA 3R4VA 4KDRA 2C0PA 2I4MA 3F4BA 3UY4A 4KLAA 4DLXA 4MZXA 3VTKA 1N6IA 3IA7A 3A1VA 4YVFA 3ZE9A 1W2WB 2BHRA 5DXFA 4FQ8A 4XE5A 5CLHA 4O4IA 4ERXA 1Z06A 2X8AA 4FWBA 2QI9F 5GWXA 1C4XA 4IZOA 2IOHA 2J4DA 1D6NA 4PGHA 3HXPA 2FRDC 1NLMA 5U1PA 1A9XA 3KYDA 4QTXA 1YL5A 3W5AA 3KKQA 4GX2A 4H3HB 3JD4A 5ALIA 1ZNZA 2BSAA 1PKEA 1ZUWA 4YHHB 4X85A 1YZKA 2CUKA 2CLSA 3KB2A 4ZYLA 2G8LA 1IVNA 3GLUA 1BXRA 4EY7A 4B7UA 5JJBA 5THXA 5IM4F 2HR1A 2NQTA 1HKHA 4B3CA 4G26A 4JKOA 3EGDA 3H4TA 1JIIA 1THZA 3DV0B 4RACA 4U7HA 4YRAA 1VKJA 4JGGA 3D7LA 4EYSA 2WTNA 4PLPA 3E0XA 4KL8S 4QGHA 3R3XA 3SDZA 2QTGA 1T1JA 3SKVA 4OB7A 5CTJA 2FEAA 2XF2A 2XE4A 4BS9A 2RARA 3UB4A 3AUTA 2C58A 2BONA 4GYJA 4PSUA 1N1GA 2QNIA 1OFHA 2PXXA 5A6SB 3ZC3A 2HUPA 1Q20A 4FFPA 3COJA 4UEKA 4X00A 4MVYA 4QFBA 3SSOA 1NP6A 4E88A 5I51A 4Q7MB 1GITA 4QEDA 2Y68A 1BCSB 2JAXA 2OHVA 4HTAA 3ZD6A 5A2QA 1QYWA 3VSCA 1QGDA 1ZR2A 4GRIA 3NH6A 4MPPA 3D6JA 5JI3E 4YYZA 2GNAA 3AZQA 4Z7NB 1SC1A 3K0CA 5HRUA 2A78A 1W46A 2X13A 3R6DA 3SYNA 7YASA 4DQLA 2AOTA 4RSRA 2DKNA 2UV8A 2DBRA 1XPRA 1FYDA 1SM4A 4JB8A 2XB8A 4NFSA 4ROSA 2AMYA 1XMPA 2O1XA 5DW3A 4YP7A 5EIEA 2XWPA 3DDHA 1AA6A 4Z9FA 1HYHA 2X8LA 4WERA 3TLEA 2IQ5A 4QOFA 1I5EA 1WUHS 2GASA 4OXYA 2PBLA 2HJWA 2VP9A 4RS3A 821PA 3KFVA 5BWBA 2AW3A 4BJHB 3DTTA 1IPHA 1NVGA 1BXKA 2JJ1D 3SLKA 3CKKA 1P9RA 1W2GA 1A2KC 8OHMA 1NIPA 5C5CA 4YK7A 1H4SA 1KRHA 1LPOA 4FT2A 4HGYA 1GPH1 3Q41A 4M4SA 1NN3A 1YACA 4JC8A 4TVSA 2OG2A 1HYQA 2ODBA 2WF6A 5GIPE 1GNPA 3WJ7A 1O3YA 1DE0A 4WUVA 3NBKA 2YVAA 3A7DA 1HDEA 2EVWX 1E92A 2IYPA 2QL9A 1YWGO 3DKKA 4M0FA 3VU1A 4B87A 5BQFA 1L7NA 3DBVO 4EPVA 3H2GA 2DU8A 5IC5A 1D9XA 4EHKA 3HH8A 4A5SA 2YJGA 5TT0A 2NTJA 3CNQS 3GCXA 5BO5A 5C5EA 1MEEA 1UAAA 1N1DA 1ZXXA 3A1TA 4YMWA 3SN6A 4RHEA 4NBVA 4L4YA 2IYAA 5EQDA 4P0TA 2ZWPA 4N9WA 1AXGA 4KQ1A 2W22A 1IDN1 2ZI3A 5AM0A 5I9TA 5LZ5A 5CH3A 4LRTB 3IOEA 1ZA1A 5LZ9A 5G0WA 3ZNOA 1ZJYA 3ZGNA 4AECA 5JARA 3TQRA 3M33A 2MR6A 2YJ6A 4IL5A 4MSUA 4BB0A 3EXFB 3SSMA 4DLSA 5JATA 3RKSA 2ERYA 1JEYA 2C5SA 2H8GA 2VQFB 5H3CA 4URFA 5BORA 2HREA 1WSDA 1GUFA 3HY4A 5ENDA 3PLRA 3KBBA 3CF0A 1TEHA 2HIMA 5F51A 3RODA 3GDFA 2B37A 2JC3A 4P2BA 3AFNA 3R5FA 5ALTA 2QN6A 1I4OA 2YJ4A 5KVCA 4BNJA 4BNMA 3BFXA 2V5VA 2PGDA 4LBWA 4R1MA 2GETA 1XTRA 3ZY5A 5KNCD 2N42A 3MF4A 4BMDA 4EQ6B 1QE3A 2RH9B 2DB3A 2FPWA 2CD9A 2WZDA 4DLTA 1U8TA 1FE8A 3MT8A 4FDMA 3TG8A 4BX8A 4I5GA 4LJSA 1PEAA 2FMIA 4JX9A 4RY2A 1GOTA 3AY7A 4B4DA 2ZI7A 1E66A 3HVHA 4G84A 1NVTA 1FFGA 1Q12A 2W6PA 3P97A 1RLMA 1U5BA 3B3JA 4IDCA 3T1HB 2ID4A 3LKZA 3QUAA 4G5RA 3HXKA 4J0EA 5EINA 4H2DA 5CJJA 4G85A 1I33A 4FPXA 5A5DA 1XU7A 2DTEA 1C41A 1OX4A 2YY6A 3AEZA 5KB3A 1HX7A 1OHHA 4X7PA 4JI5B 2AZXA 2CXHA 2YZKA 3CF4G 3LW7A 3PR1A 4NRDA 3N87A 1THMA 1XRPA 4WKCA 1Z8FA 1OI3A 1VKOA 4ZK2A 3ZHBA 5LB2A 3NJRA 4BFUA 1YBAA 3H0KA 3ITDA 3H2KA 4LOKA 3ZLJA 1LDYA 4YRIA 2Y99A 4JL8A 1V45E 5KSYA 1IPFA 3O8OB 4KXYA 3QYFA 2BFBB 3I6MA 2IHJA 2IWRA 4M2LA 3FJ1A 5HK8A 3AKZA 4IJUA 1IQPA 1SVSA 1SQGA 1RWNA 1KP9A 1KMIY 3DZJA 3N2EA 5ALZA 4P31A 4TV9F 4B9EA 3LY8A 3SZ3A 3DLPX 4E6EA 5IUJC 1CVIA 5DM1A 3LD9A 2PPVA 3KPYA 1X1DA 5J4LA 3QE2A 4BQQA 1K63A 4LYGA 1E4OA 3C7KA 1XRNA 3LIIA 1KJ8A 3DNPA 1KETA 3S8MA 3SM9A 2PMDA 4WFJA 3VAYA 1I30A 1XZJA 2OZVA 4F86A 4RX1A 1AVTA 4C4XA 4JKYA 3AETB 4JUFA 4V0KA 4P0QB 1NQWA 4Q00A 1AY0A 1D2RA 4Q3KA 4ID3A 4QU0A 3RHFA 1W34A 5JS2A 4IQ4A 3NIBA 2OLKA 3KLBA 2ZRCA 4DM3A 3MNFA 5LUBA 3GVCA 5KYUA 1HL3A 1C30A 1XTSA 2IELA 2P2YA 3LDGA 4GP6A 3FRHA 4B3XA 2IDZA 1ULUA 4NYMR 1TM7E 5E4FA 1GV1A 2FEPA 1PSWA 1E4EB 3LPAA 2GF0A 4OAPA 3HJTA 4YAEA 4ZPJA 5L3RA 1FDVA 1QG4A 1Y0BA 3COWA 1MTZA 3HXLA 1EJ0A 1UEIA 1ACJA 2C2ZA 3OM0A 2QZ9A 2OFPA 4O2BB 4OJYA 4L02A 4WKNA 1YIOA 2A0FA 3THYB 3H75A 3K70C 2O5EA 4JZYA 4U9IS 1PU2A 1F0KA 1Q7TA 3ER6A 1GFWA 3FRIA 3JQEA 3C3BA 1BX1A 1VE1A 4MS3B 3PGMA 1P7ZA 3IFSA 1GZUA 5FI5A 5FLXA 1MC8A 1CNMA 3ASVA 5DH9A 5GV8A 2LR0A 2QIOA 1JBKA 4N5MA 4CLEA 3HLKA 5EMLA 2MYPA 3OTQA 1MKYA 4C4ZA 1QV7A 1KE2A 2XXAB 4QXAA 1ZK0A 3ZCXA 1AGPA 5HF6A 3AFGA 1DRVA 5DNYB 3L9XA 2CZQA 2NSLA 1KR2A 1P62B 2JGKA 2RI0A 2FPPB 2VSQA 4IDHA 3AIOA 5DTIA 2FN7A 3PHHA 4X62B 3B7GA 5DHRA 2CNLA 3I92A 3UMJA 4ND3A 5EWLB 3P26A 1GU0A 1VL5A 4WK0B 2ACVA 2AZDA 3UGTA 5IT4A 3BCUA 3ONVA 2R6FA 4JYMA 3SFZA 4HPWA 1I5RA 3K8ZA 2VTDA 1I14A 3AYXB 4IUDS 1DAOA 4L8GA 3A2NA 5ENZA 3GW8A 3SBXA 5KPJA 1DJMA 1TUBA 5BSRA 1DC7A 2VPWA 5CK4A 5K3AA 1H05A 4YCDA 1QZTA 3QHPA 4NYMQ 3L46A 4EEKA 5IM4A 1WUIS 3CURA 1EJ2A 1U7XA 2XBUA 3KJXA 2WFZA 4H27A 1Q5PA 2W90A 1USUA 1IYZA 3PA8A 3FPFA 2D5LA 5EIWA 1YZGA 1NATA 2DY1A 2ODPA 2RD2A 1D1TA 3I53A 4TL9A 3RSCA 1ACLA 2PYIA 3X1DA 3K7EA 1I7QB 3VO1A 3GLFA 1J2RA 3GLRA 4IDAA 4IIGA 5L7WA 3MWYW 5IKXA 4E2YA 1G3QA 2ZI5A 5CDFE 1J1UA 1AQYA 3ITEA 1FVOA 4KLCA 4EF5A 5C1BA 2FZLA 3CMCO 5JWOA 3RRFA 1KYWA 1JMKC 2OO5C 2DAPA 2ZYHA 4P36A 1J2TA 4YLGA 5AVOA 3OFKA 2NADA 4IOJA 1QQTA 2Q5CA 4B3HA 3GGDA 2XWQA 5ALEA 1FCJA 4HXYA 4HKTA 4C01A 3H5RA 3NXKA 4QATA 2GZRA 3HDJA 2W7TA 1HLPA 1YR6A 1Y1KE 4YIKA 2CVOA 1BE6A 3P2KA 4PTLA 4Q48A 1W4RA 1HM5A 1GL7A 2P79A 3NV9A 5E8RA 2FQYA 2IBMA 4UHHA 1NKVA 3VKHA 5DHFA 2GZMA 3FGPA 4HFJA 3R9XA 1TM2A 1QPGA 1KDZA 2HXYA 1IM8A 1YFKA 2QYHA 1MORA 4DLLA 4WBNB 1A9RA 1HH4A 3PL5A 1TTHA 1XXHA 1ATZA 3NGMA 3M6LA 3LLSA 5FLYA 4Y7CA 2B30A 1DG1G 4IF6A 1JV2B 5FRDA 4RC9A 1HQCA 1YASA 3VR3A 4DXHA 1WNFA 4ETNA 4RTRA 3AR9A 1TYCA 1VBNA 1ZMXA 3EEBA 3K09A 1WXQA 4RK1A 1KWGA 2CXQA 3W4KA 2QTVA 2A5LA 4ZMBA 3L7IA 3WGZA 1FP4B 4DR3B 1QVZA 2GEFA 3C7CB 2YOFA 4Z3DA 1ABFA 3AXTA 3FI0A 3MZ0A 3O3OB 5A3RA 1W59A 3TZQA 1ZHOA 1JEAA 5AKJA 2GPAA 3HABA 4OQQA 1JEEA 1OB5A 3AHEA 5CW1A 2IYEA 1IXKA 2XUQA 2VCYA 3QVGA 5SV2A 1O4VA 4DPLA 3ICCA 4QUJA 1WW8A 3BC1A 3C7DB 3LLVA 3PXEA 1AJEA 1H93A 2FFAA 1SK9A 1Q1EA 1NFQA 3NASA 4U8HA 1IK6A 6ADHA 4LRSB 3L1KA 5KYXA 1GP2A 4S1TA 2ZAGA 1DZ3A 4OJKA 2WJ4A 3GG9A 3AHCA 3JXEA 3THOA 3DLBA 2GKSA 2X77A 5IHXA 1Z6GA 5D3QA 4DCOA 4Z4CA 1SN7A 4DIUA 2VQSA 1LF5A 3K72B 1JS1X 5DCWA 5EE0A 1DO8A 2DP4E 4CQMD 5F76A 4X63A 1L8XA 1QR6A 4GRDA 1ULAA 2O8CB 5DN9A 1ZKDA 1HG1A 2YBEA 2HO5A 1CD5A 1Z2AA 3T54A 1E3EA 1OR8A 4B82A 5KO2A 3FZQA 4EOGA 8AT1A 3E15A 2F3QA 4URZR 4QJ3A 2EFHB 1ULSA 2L17A 3PDUA 2OV3A 4F1JA 3E4CA 5HRAA 1Z33A 3JD3A 4XVUA 3I9V6 4FFBA 2PSEA 5B6PA 2COKA 2JJQA 2QNRA 2CVHA 1CFJA 2IX9A 2C1XA 1VOTA 5D6NA 3RK4A 1SHJA 4Y6PA 4BO9A 2HW8A 3IR5A 4V2IA 3E82A 5COBA 3STUA 4CMAA 2ZIXB 1DKQA 2I8LA 2PL9A 1K3FA 2UAGA 5CHEA 3UG7A 4E5PA 1X8KA 4MRSA 3JAWA 5AVRA 1G21E 1PJ4A 2FSUA 3H2BA 4P98A 4JP3A 1KGDA 1CUHA 2DC1A 2XGOA 3EDCA 5J5VA 1EXWA 1AB5A 2B0CA 3IO3A 3P52A 2W2XA 1HQYE 1QQBA 1JILA 1YSCA 5HF5A 1J23A 5HVNA 3SFTA 3AEUB 1RYFA 1G19A 2FNAA 2RHBA 3C97A 3PE4A 5FL7A 1X92A 1T6ZA 1IZ9A 1EXMA 2ODEA 3KHUA 3OAAA 3U48A 2XCUA 5I7HA 2BEUA 3DF7A 1OLSB 1W5AA 2OE2A 5ALVA 2VP4A 1PR5A 5IF9A 2WZBA 4IQ0A 2JRCA 2N1BA 2W6MA 3IR7A 4AP5A 1PGQA 4RF3A 1XVVA 4DARA 2YWJA 3U4HA 2MINA 2QVYX 3RKRA 1GGMA 4Q4CA 1U2PA 2X6RA 3COVA 1JIKA 2I7XA 4QUHA 2FG6C 4HRYA 3AR7A 4S1NA 2DPXA 5DULA 5HKAA 1WCV1 1I2MA 1PV1A 1C7RA 1K27A 3R7WB 4M37A 4M0UA 4LJKA 1PGJA 3E05A 2C0CA 2HMWA 4TV9A 4P22A 3P19A 3RJ9A 4GKVA 1ENOA 1CIJA 5FNVF 1XZKA 2PO5A 5HBGA 4G4GA 1GPAA 2VRCA 4NZ9A 2WYUA 3ZXSA 5LWHA 2H1HA 4M1EA 4X44A 3AVOA 2OEPA 3M1LA 4JP2A 4JJEA 4FCWA 2Q6IA 1TQ2A 1CSEE 3G2MA 2QMZA 4I5IA 4HNRA 4D43A 1WD5A 1OREA 5AI9A 4YMIA 2GYWA 5BYJA 2F8TA 2ZS7A 3GBSA 5FO0A 4YP0A 3NPAA 5LZ7A 3ZQ4A 3HU3A 2RE8A 3H2HA 1KZ4A 3VO2A 4W8GA 3V7WA 3ME5A 2G36A 2DRIA 3HEMA 1X1RA 3D7SA 2DQ4A 4PGMA 1JDVA 3QP9A 5A7HA 5CP8A 3RVKA 3UBMA 3TLMA 4XASA 3TFQA 1SC6A 4KAXA 3BTOA 3EB9A 4HVTA 2CKDA 5HKLA 4F60A 1E7MA 4C7JA 3HXTA 2VHQA 3FNQA 3PPVA 1TAGA 4K9KA 5T4HA 3X44A 2C7GA 1NAHA 3G6WA 4C5CA 4IIXA 5CLQA 3WK6A 1GT91 1GIAA 5IHPA 1KL7A 5J59A 3OQBA 1QVAA 1M1ZA 4ESVA 3ZV4A 2JAWA 5DB4A 3FTEA 1QH1B 2JHAA 2WUFA 4MQ5A 3M89A 1DTWA 5JJ5A 4BFLA 1YVDA 3A3OA 3JR7A 5J47A 3C3KA 5KNBH 5KYGA 2CLLB 5EXPA 4NFHA 3BIWA 4GGMX 2CK3A 3RUFA 1EEHA 3SC6A 3ZJVA 3LF2A 1YZVA 3VR2A 2V7EA 4UE3S 3HKBA 5JNUA 4K3VA 4RKQA 3QEOA 4HZGA 5A9SA 2HU8A 3ZY3A 2A3RA 3R6GA 5AHOA 4BNFA 3EVCA 3T5TA 3G0HA 5CJPA 3WK9A 1P0IA 3K0HA 5BQ3A 3D8HA 3ZWBA 3PPXA 3LYHA 3FCYA 1DIGA 3KLPX 3BFVA 1NQUA 4HVAA 4I9NA 4C4YA 1Z0FA 2IHUA 5G40A 1TO6A 2NV0A 2JGFA 2B1JA 2O7QA 3H5IA 2JIMA 1XD9A 3BXGA 3ORSA 2I71A 2O2JA 5IAKA 1TF7A 3I6BA 3UB3A 1RHRA 4UC0A 4ZPXA 3FA2A 3OTGA 3GP3A 5GGXA 4LSGA 5GY7A 3ROKA 4X20A 3TW4A 5HZMA 3RYTC 1W5EA 3DAYA 4OU5A 4OSOA 3T38A 4JNKA 3K0FB 1NVKA 2N75A 3HU1A 2H08A 3RVOA 4N40A 2KX7A 1GRNA 2GT1A 3ISJA 3KAPA 4DCVA 5JVDF 3B82A 1ORIA 4QECA 4CMKA 1PYOA 2RGAA 1CJTC 1RU3A 4DBVO 3PK0A 1IQ0A 3GN1A 4G6ZA 3GELA 5GP1A 2QR2A 3EGIA 4PICA 5JY1A 2OXRA 2WV9A 3PF9A 4TTPA 3B3AA 1YBVA 3AWDA 3B52X 1WDKA 1N5LA 3IMEA 3GMIA 4AG3A 5E95A 1S1CA 3L7NA 1E94E 1PI3A 2IZOA 3LDUA 3BF7A 2YUTA 4O02B 3L8FA 1F6DA 3KDSE 1ADBA 4OREX 2OHOA 3LKBA 3FPBA 2GZ1A 3GGGA 1YMUA 2E48A 2JLSA 3F6CA 2DWOA 1QZUA 4OB6A 4BCCA 4BE4A 2JHPA 1TO2E 2X58A 3L1IA 4MR7A 1GZ7A 3ZCSA 3L8CA 4DAOA 3DMYA 2BJVA 4MITA 4RHYA 3H8VA 4FMCF 4Q4JB 4LC0A 4OQNA 5JCOC 4UBJA 3KUCA 1COWD 1VJ0A 4NZNA 4ZT6A 3P9PA 2BMJA 2ZFUA 3L4SO 3G2QA 2QM0A 1OBOA 3G68A 3ZW8A 5CD1A 1FNNA 1NJ8A 2HA3A 5AKGA 1LK0A 3TX6A 3INNA 4TTIA 2Q6OA 2EHJA 1Y4SA 3L77A 1ZC3A 2C3UA 3MHPA 4CKEB 4H6VA 3LUKA 1JVSA 4JBYA 4NWIA 2RKOA 3CINA 3HJBA 4Q7LA 4CHTA 1DC3A 3EFBA 4EDHA 1RPTA 2X0NA 4KXVA 3VXKA 1PJSA 3QZUA 4O4JA 2BT4A 2X6QA 1IWPB 5T7BA 4O0MA 3A6DA 3NYIA 4FOLA 5ILOA 5JBNA 2NV2B 5E1MA 1U2GC 4CCYB 3EE6A 3I6IA 3KSBC 2F43A 1NMEA 1U1CA 4P83A 2GN1A 2IUSA 2JFGA 5K6RA 2PKCA 1KS9A 2YASA 3AM3A 1CUBA 2G1KA 5AW6A 1M1YA 1WU7A 2R85A 4G63A 4I6EA 4BPRA 5CB0A 1FJXA 1DKOA 3D64A 4QM7A 3RYFA 1IG0A 2EDAA 3ECSA 4L8WB 5HMMA 4I66A 4E46A 4P80A 4I3FA 3GUZA 1QCYA 4N6GA 3FHJA 5E3HA 1NAIA 1S2OA 4KYTA 5JUWA 2EP8A 2B21A 4XGKA 3HDYA 1OJ7A 3DTVD 4MAFA 2H4HA 4M7WA 1SHZA 3ROTA 1DOAA 1QOZA 3OCVA 3I30X 1KHHA 4JMPA 3RT7A 3FYDA 1BGVA 1C3JA 2REBA 4RORA 4B7AA 2QJRA 4EKDA 1N3LA 5FWXB 2AEFA 5GGYA 3L7AA 3JVDA 3T94A 3OZSA 3SD7A 4Q9DA 1EX6A 4WH0A 2HF2A 2OSVA 1MU0A 3I9NA 1PFVA 1TTQB 2F59A 1DAMA 2Q0HA 3JQAD 2GILA 1KEUA 1V5EA 3U1VA 2PUGA 4JQYA 1WE2A 2XSZA 4X5OA 1PJLA 3V1YA 2R97A 1NXWA 1LBHA 3NHSA 4HGQA 3U7QA 4BVKA 3U4QA 4XGRA 2GEKA 2XUGA 3KDAA 2IXTA 2CJWB 3MFYA 4H17A 3WFZA 5BUZA 1GGFA 1EJ6A 1JH8A 3S1SA 3P9CA 2UU9B 1ADYA 4G5GA 4G0OA 1WMFA 1X3SA 1XDSA 4D4LA 3H9GA 3I8OA 2ZAOA 4TMVA 1AZWA 2VCHA 3JVUA 5EE1A 5KX5B 3F5MA 1JQAA 4Y9SA 5UKDA 2YX1A 3WNBA 4TM8A 1M1NB 5BUSA 1KVRA 3PJEA 5B3JA 4NBUA 5FV7A 2QE6A 4UMVA 1GDDA 1V25A 3IQIX 1G9XA 4XQ0A 1TF2A 2XEDA 5BN3A 2YXLA 4XQ9A 4U2CA 3SHOA 1LJ8A 3WLFA 3DBLA 4L51A 3IE1A 1GYRA 1YS9A 1SA0B 2FQXA 2RB5A 3SK0A 2H1IA 2Y05A 4JC5A 4E5YA 4B3MB 3I9JA 3FHCB 4HAXA 4AKEA 5GPBA 4KH0A 4U2BA 3MC1A 3GOHA 1SB9A 1RD4A 1TECE 3NT2A 3VX4A 3VR5A 3K2IA 5I7FA 3WWCA 4HTFA 3UPTA 2Q4EA 3QMPA 2GCIA 3H2YA 1OZHA 1IZYA 3KYCB 4PYNA 4QU8A 4YGYA 5FPQA 2X19A 4NBKA 1BDHA 1LH0A 1HO3A 1GG9A 1OI2A 1T3GA 4WLEA 3C8HA 4HVCA 5B7PA 1OAOC 2PJDA 3ES9A 3CLTC 3QPBA 1CDDA 3QUBA 4IRXA 4ZGGA 5JD5A 5KJCA 3IC5A 5B4VA 2ZJOA 2W6NA 5LWQA 4GOOD 3DONA 2FPXA 4AKSA 1AZSC 2W6ID 2XDYA 4CF3A 4FBLA 2WFLB 4J07A 4JSYA 5AJYA 4BTVA 5YASA 4JOBA 4HT3B 3NBXX 3ZS8A 1E5TA 4BJ1A 4BQOA 5TJHA 2DFNA 2XMDA 1GGJA 2WB2A 2BD0A 1VLLA 2QN7A 4N12A 4MWBA 4RD2A 4XB1A 3AKEA 5IDVA 1RWPA 2FPGA 1C7EA 3FWNA 4X7MA 4BP8A 5HPYB 1L7AA 4X97A 5A0TA 3QOWA 2XE6A 4LUCA 4BB6A 4R68A 1U0TA 1KH2A 4NS1A 4WECA 1TM5E 1C7IA 5DOZA 2GB4A 1J22A 2CW5A 2VEOA 1Z0AA 4XCQA 2K4MA 1H2EA 3DV2A 2QWXA 2IYFA 4ETWA 5EL0A 1XMXA 4CUKA 3OPYB 2HWXA 4Q1VA 1QUEA 3TG2A 2Q3EA 1JE1A 2PDAA 1E6LA 3ADOA 3AGQA 5JJLA 3JQ6A 1VG0B 1O94A 2DT5A 3QEJA 3TNJA 4OH1A 4Q3BA 1N5OX 5ERYA 1OXXK 4ARBA 2EFYA 1NTOA 4CM8B 1NLYA 1CKEA 1E0KA 3K5HA 4ZCIA 2JFYA 4Q1CA 5D86A 4GH5A 4KPYA 4OI4A 1EDZA 1LCIA 3V2IA 2I9PA 2W98A 3KJQA 4M0DA 1TI7A 4WJKB 3FCAA 4UHFA 4WA8A 1ZYUA 1SUEA 3AEKA 1P6UA 3LOPA 4JSTA 1TM1E 4QBIA 4WNAA 3F6SA 3KOMA 3F7MA 2FRVA 1RRVA 2ONZA 4IOLA 3INRA 4KK3A 4XOUA 1XVAA 4BLOA 4L73A 1ESCA 3TLBA 4UFPA 3CLVA 2PYZA 1QMGA 3OU2A 4QO8A 1Z0DA 4WXYB 2HMAA 4UMEA 4YCAA 5D7NA 3HVKA 3P9ZA 1NQOA 1AX9A 3KXPA 1DBPA 3LC7O 3LNCA 2BFOA 4WCFA 5IK2A 3ROEA 5JZOA 1TT7A 2ZXUA 5FWNA 4ZOCA 4QBFA 2G5GX 2QOEA 2CNBA 4LOHA 3T5MA 1FTNA 1SU7A 2BAGA 2O14A 4X66B 1RAIA 3VTAA 4B4UA 3MAGA 1LWNA 5BYAA 5HRCA 4WZ6A 5B3LA 2R1VB 1CP2A 2FEOA 2V6MA 2ZTMA 4C6TA 5SYMA 4ZCLA 4BE9A 4KTVE 1COZA 1E60A 3RC9A 4UQPA 1KS2A 2XCOA 4TX1A 5GADl 5D1HA 4M7PA 3KJGA 5JS7A 3MRTA 1U7HA 3OEHA 4W7HA 2RGUA 4AJOA 2VC2B 4C0XA 3EGCA 4II3A 5KOHB 3R9IA 5JHHB 1J70A 2R1TB 3T7DA 3C39A 2OSBA 5K7SA 4Q1EA 3QU4A 4P4SB 2OORA 3SMVA 3GLGA 3U7GA 3R23A 2GGSA 2YHSA 3UWMA 4PG7A 1UQRA 4AJLA 3L7DA 4YUAA 2YS7A 3REOA 1EA5A 1KZ7B 3CZAA 1T0UA 2YR0A 1BX3A 3RUPA 4YMTA 1FDWA 1Y3BE 2XGSA 3IP1A 5FJIA 1A95A 2AI2A 3MCZA 5EMHA 3ZD7A 3R5XA 2PMEA 1B76A 2BMEA 2IOQA 4DSUA 3VZBA 4C05A 2LD4A 1NXVA 3L0IB 1PX2A 1QK3A 3KOXA 4OA8A 3RS9A 3WLAA 4WAUA 1ZFNA 1Z2DA 1XWFA 3U1TA 4DUGA 1XCGB 4FYPA 1CJMA 1A71A 3AHIA 1LS6A 3FPCA 1K7XB 4GWGA 5CGQB 3ZIAA 2QDXA 1DAIA 3IE2A 4JJAA 3NZEA 2X4GA 3ZW7A 2VDQB 1T29A 1RAHA 2CVPA 4MKIA 1Y9AA 3HHPA 5AVKA 5BNIA 5F5NA 2WHRA 1YDFA 3BXXA 1ZIYA 4NBSA 5FTKA 4EUHA 5AHKA 4DG8A 5A9RA 5J2UF 2ZJ5A 3EGXB 1QS0B 1UBLS 3CG4A 4RDCA 2FPRA 1TMKA 2PJRA 1HNNA 1GY8A 1ZMBA 2CJFA 3Q1LA 1QRDA 4D9JA 2H3HA 2NXWA 1MG5A 3CO5A 1VXRA 3M4YA 4MDEA 3CUTA 3M7IA 1PNVA 3MN1A 3B3GA 3I4LA 2ZRDA 5AYVA 5IBCA 4DR7B 3LHSA 1W47A 5HFNA 3RVJA 1M0EA 2O5VA 1X42A 2DPGA 3PDHA 1HBJA 3N2GB 4O63O 3RTCA 1RP7A 3CZ9A 3S0JA 1ADJA 2AKYA 4G1VA 2WYOA 1U99A 3BKWA 2ZBUA 1NC1A 3FKJA 4GVPA 4M9RA 1VCOA 2R5FA 1N5DA 1ECCA 3IS3A 4LGMA 4D0NA 4YAKA 3EEYA 2P5YA 2EW2A 1MABA 5B1YA 4W5RA 2B61A 1QE0A 4FLFA 3GGSA 1RJDA 4V0SA 4GLJA 5AUQA 2QSJA 1RI4A 1W94A 1T8WA 2V6GA 3W8FA 4ENVA 1ZJJA 2JIZA 1JSLA 2CLHB 2YJ3A 1KAGA 2PRJA 4FBMA 3PQ6A 1US8A 4ENWA 1S3FA 2JGAA 4QUIA 5EP2A 1KO1A 2AVNA 2NVUA 4NAHA 5AIBA 2JHFA 3ETNA 5TGDA 2FTKE 3T7JA 1WEHA 1HE1C 2X9VA 2XBLA 1N92A 4HZIA 1G5HA 4AZ3B 4O2LA 2PVCA 2V8BA 2VYFA 1I2CA 4YECA 4DC9A 4E14A 4OHYA 2R9VA 2FSVC 1KH1A 1OV6A 3KXKA 1ADGA 4IGEA 1IVYA 2C4TA 1JDPA 1X9GA 2XADA 1RHQA 1YVUA 1CF2O 3QXCA 4M46A 1ZJZA 4MYHA 2BH2A 1M8FA 3Q6NA 4EVSA 3F7OA 3H4IA 1B42A 5EPUA 4CG0A 4U7PB 4R6XA 4EY4A 3BUSA 1TFUA 1GEGA 1O58A 4I1YA 4R01A 2B92A 4P6VF 5CFNA 3VYTB 1G5PA 4GOJA 1WCWA 3U4GA 5GTDA 3J7AC 4GE0A 1OASA 4XFKA 4Q3AA 4GHWA 1P80A 2JLCA 3EXIB 4IIJB 1QF9A 2VTVA 2XB4A 1A7AA 5IDWA 3RC8A 1HDGO 4MCIA 2QW1A 1TCBA 4QG7A 3F5SA 1N2CE 3BB4A 2CHGA 3AR3A 5C81A 4MQLA 2QRJA 2EBWA 4E11A 1JE0A 3GFSA 1SKYE 3C1AA 1L7PA 2AFVA 4RLQA 1QF6A 4FGLA 1L1RA 3B6JA 3D3EA 3R74A 5CFMA 2RGXA 4LDJA 1R37A 3LBNA 4KLZA 5IBQA 4QNMA 1JHQA 4OFZA 5K3FA 1Y42X 4Z4EA 4BO4A 4E2XA 2I3GA 2FSIA 3KQNA 1PFWA 1FS6A 2HC9A 5GJVC 2HWUA 1P1JA 4AJEA 3TGPA 3C3WA 4YJGA 5H3HA 3FETA 2I7CA 4L4UA 3EODA 3U39A 4AJ1A 1EA7A 4XWGA 4AMVA 5ITWA 2X4DA 3DD1A 3EBOA 4NQZA 3TI9A 5LKRA 2D4AA 3PDIB 4IW3B 4OYRA 4AMBA 1FUKA 4H1UA 1BS1A 3LPNA 3VV2A 3WP1B 3Q7PA 1IAVA 2Q29A 5KHAA 4DDKA 3K8OE 5I5GA 5JRJA 3I2JA 1QWSA 3OOHA 2ZUWA 2VPIA 5CA0A 2ZYAA 3P4UA 1LS1A 3RFUA 1FYEA 2DQYA 5JZVA 4HO1X 1C1XA 3O4VA 2H4YA 5F4BA 3D54D 1KJZA 3U9TA 2P9JA 4M98A 1MFZA 1E1CA 3CZRA 3UK7A 4ZO9A 1MIOB 2ZROA 4OHBA 2R6GA 3D2BA 3EVEA 5CMLA 3RRYA 1CR2A 4GLOA 4KGXA 4WW0A 3WB9A 1UOOA 5JT1A 1SHTX 1QGZA 2V5AA 4CODB 5LQRA 1P9OA 4D41A 2O2XA 2BKLA 3WWOA 3FOEC 2YNMC 4OJNA 4X6UA 1QRSA 2JFUA 1I51A 1I9CA 4QU9A 4TWAA 2JCGA 4TYPA 3JWEA 1RZUA 1M6VA 2R00A 3FR8A 3K2EA 4KXUA 4RK6A 4G0WA 3MS7A 1G7RA 2YZNA 3LLCA 4PSAA 3IXQA 1A9PA 2NO7A 4PSVA 3OWXA 5GVRA 1R8QA 4R9VA 3NHJA 4YQZA 3CVVA 1WX1A 4WNCA 4FYYA 3GMSA 3CZ5A 2Q1WA 4CMBA 3MYYA 4PLGA 2L42A 3SQOA 5DMXA 3CNEA 2GZ3A 3FMPB 2QTWB 4I7EA 2F1KA 2PN1A 4TTRA 1V5WA 2JJ2A 3NIFB 4Y9RA 5A4MS 1AQNA 1O0CA 1KDTA 4D96A 5GV7A 1KYXA 3FZNA 4BTEA 5T5QA 2C29D 1OIXA 1OYWA 1QZZA 4JP8A 4QJIA 3F7NA 3TBKA 4R31A 4Y1RA 1JPNA 4UMFA 3VH1A 4H7IA 4I2VA 4N76A 1KYVA 4RJTA 1KO5A 4JOCA 4N0MA 3AM1A 1XV5A 3OTHA 1B6RA 2OTCA 4WK4B 2BELA 3FTQA 1C0LA 3EISA 4BTLA 3ABSB 3KR2A 2E4UA 1H6CA 3UF0A 3VO8A 3KQPA 4D57A 1NX9A 1S3GA 2QQ0A 2QZPA 1Z7GA 4PIMA 5K6AC 3CVWA 1W5SA 3KKZA 5IANA 1IHDA 1FX1A 4EKIA 4B7CA 5IABA 1R5BA 1Q2XA 1ZZEA 3CZCA 2JIPA 1BFUA 4GIBA 1N4AA 4K28A 2QN1A 3VGPA 4TXHA 2E4VA 2P9GA 3GEDA 4Q34A 2I2CA 3MOSA 3G1TA 5F73A 1MB0A 1TL7C 1XX6A 2CXTA 2W70A 5LU9A 1UJMA 3MBKA 4TMTA 4LJRA 1CRZA 1JJAA 2ZBGA 5EWMB 3CSDA 1T13A 3ZGLA 2Z09A 4PQYA 3ZD8A 4EDFA 5I7RA 1TM4E 3T95A 1ZK3A 1T35A 3A1UA 3M6MD 1C3VA 2ZT5A 4JL6A 4PYRA 4NEGA 1T6NA 2M32A 2VJDA 3C14C 4I8XA 3ULKA 3ZI0A 1OZ0A 5D5HA 3U2QA 1E2KA 4A9AA 1PX0A 1E9RA 2EGUA 4JNCA 3WNQA 1N33B 1NPTO 5TPWA 4Y2HA 3F6YA 5KMGA 4OX9B 3S7TA 1NA5A 4QBHA 4P4UA 3HXQA 2BGRA 4QYXA 3EIFA 1JDUA 4M1QA 3CF2A 3PFKA 3IQWA 2V6JA 2I1VB 3VPGA 3ZHOA 1X38A 4BN0A 4H1WA 2VDWA 2J32A 4OJMX 3A1NA 3DKPA 4P5PA 4UVIA 4E70A 4OLAA 1G18A 5AJZA 1LVUA 3P8ZA 4MO9A 3WB0A 2W6OA 2CYAA 3EZLA 4QXRA 3G9UA 4CEIB 1XQ1A 2QE7D 5JRDS 3C5VA 3BXHA 4RMJA 4EI9A 4AZSA 2I4IA 5FAXA 2CE7A 3ECAA 3OJFA 4CLRA 3JQ7A 1G1MA 1XTJA 2ZJ4A 5LD2C 4YJHA 5J2UA 1UINA 2WMYA 2IIPA 2NUBA 4HSGA 5BMVB 1GZHB 2O2EA 3O7WA 3MG9A 3P71T 4Z4GA 2TMKA 2FRDA 3GNLA 1GV0A 1BN7A 1QIFA 2VXCA 1YMVA 3T1TA 4WIAA 1C1DA 5MGBA 1KA9H 1UM9A 1POXA 2ZRKA 2W42A 2SCUB 1WA5A 4CTNA 3JS5A 3JQ8B 5FBZA 2QY9A 2O05A 1GDTA 2GEUA 2IIBA 1WD7A 4JI4B 1G3UA 2ZJ2A 3CEPB 3I2FA 4NMXB 4Y2JA 5ECYA 4MDHA 4RVFA 2WIBA 4FYXA 1U1GA 1ZUNB 3L7LA 3T9AA 3UH1A 4EA8A 4BO1A 5A5GA 4NAUA 3WGUA 4ARUA 1ZIPA 4DV0B 2GPNA 1WPRA 4G8JA 1QFXA 3CYFA 2G7ZA 1U3VA 3CH7A 4JCCA 1JHDA 2CNWD 3PNLA 4RSMA 3X2EA 2QTRA 1HYBA 2XE7A 3AFIA 3BWBA 2F7SA 1NN1A 4WLOA 3RRZA 3C5EA 3M4XA 4IG9A 2OB1A 1KOLA 1U2QA 3HGQA 3ZUGA 5DX8A 4E15A 1MLDA 2HF8A 3RVLA 4OTZA 3ED1A 1DBRA 2PZKA 2Z2XA 4M6WA 2QX9A 2XSZD 2IUUA 1NLZA 3IAS6 2D2VA 1FL9A 3EOAI 3WB2A 3PRYA 3SXUA 1I7LA 2QV7A 3T7TA 4BUJA 2WHQA 3L5OA 3GYGA 3K0AB 4KFTA 2WQ6A 2BHLA 4RFVA 3E2MA 4A92A 5K3EA 2VRNA 1KJYA 1G8GA 4K5QA 3GI1A 4CU5A 2ODAA 2J7PA 3QVJA 3V4LA 3HUDA 4QAJA 1AS3A 1BRMA 4OP2A 1E4YA 5HF8A 3J81A 3BYZA 3HYRA 3HEAA 2XCTB 1K6JA 2DZDA 2NXCA 1NC3A 5PGMA 1LVGA 4XEHA 5ETJA 5T64A 3IBYA 3HB1A 2ZKIA 1MX1A 3QE0A 5IP5A 1YA8A 3CX8A 2W48A 3G02A 3GRZA 3G8BA 4C4OA 2NACA 2DHDA 1VJGA 4UEJA 3AU8A 1DHTA 1P2DA 2Z3ZA 3KR9A 2PUDA 1FMTA 4ZZIA 4BNDB 3I72A 4S35A 4DR2B 1DWOA 1RI1A 3OMLA 3PGVA 4ADSG 4DMCA 3U09A 1AC5A 4H0CA 1SBQA 2YN0A 4P3YA 5DIZA 3MUFA 3H9EO 3SZGA 2PJZA 3DYIA 1RXSA 1GCGA 2LCFA 5HS6A 4D6XA 4BNGA 4EB3A 1PG2A 1VL0A 3WKDA 5CLFA 1KOGA 4I46A 5MN5A 4AM8A 5JSZB 4QYMA 1AQJA 3O21A 1XKXA 2JI6A 4JELA 5I9BA 3Q7TA 1YDMA 4NMLA 3R5KA 4F4DA 2G7MC 1TMYA 1S4QA 4UXIA 3ICEA 2BTQA 2HPAA 1WXXA 4TKVA 3U3XA 1IOZA 3V6LA 3HA5A 2HJRA 1T34A 3C3CA 4EEXA 3EVFA 4CW7A 3NNDA 2HV9A 5KTKA 1BNCA 2V96A 2VVTA 5A3JA 4Y2TA 4L75A 1D4AA 5ALJA 2FUG6 2I80A 3WSVA 5CAEA 4GU5A 4UJ5A 1HDXA 1MB9A 4HDNB 4ZQIA 1JJBA 1KJJA 2GTIA 3ABRB 2YV1A 1UBUS 2C8LA 3FNRA 2EZ4A 2QLJA 3GT3A 3ICPA 3LC1O 1QGAA 3I9FA 4ETIA 4JHLA 1NHGA 4V3BA 2EF1A 2P0AA 4RJ2A 2C59A 3BMQA 5DI3B 4DPKA 1S3SA 1B8PA 1I3MA 4M8LA 1V9SA 1A97A 3AEXA 5EYPB 4ZTZB 2VHZA 1QH