3N7TA

Crystal structure of a macrophage binding protein from coccidioides immitis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
241
structure length
241
Chain Sequence
PLPRKALLAITSAHPPFWPDGKRTGLFFSEALHPFNELTAAGFEVDVASETGTFGWDEHSLTQEYLSKEDEKVLHSEHNHFMEKMNKQVFKAGDLAPHDYGLMFVCGGHGALYDFPHAKHLQNIAQDIYKRGGVIGAVCHGPAMLPGIHDENGDSVIKDKTVTGFTTKGEIMIKVIDKMREDHLHTIADMAQTANAEYVPPEDPWDDFCKVDGRIVTGANPQSATNTARDTIKVYEGIVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Macrophage binding protein
publication title Crystal structure of a macrophage binding protein from Coccidioides immitis
rcsb
source organism Coccidioides immitis
total genus 88
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3n7tA00
3TTUA 1S1MA 1FYEA 4OIFA 2ZUUA 4RKYA 3TTVA 2GK3A 1KXJA 4QYTA 3TTSA 3P9RA 1OX4B 1P7YA 1Q2UA 3MGKA 4GE3A 1OI4A 3NOOA 4ENVA 4ZDKA 4P2GA 3ZJ5A 4OJYA 2OR3A 1IZZA 1VCOA 3SF8A 4B5KA 3BHNA 3TTWA 2WJZB 2FEXA 1A9XB 3P9PA 3CYFA 4MTCA 3VU3A 5JZMA 2A9VA 1GGEA 1G2IA 2RK4A 3B36A 3P9QA 4B40A 3RHTA 3L4EA 4WXYB 1T36B 1QF7A 5SYAA 4GE0A 3UOWA 2GHRA 1IPHA 3PQ4A 3MIIA 1VCNA 1VHQA 3CZAA 4S0ZA 4UCFA 1UCFA 2VKTA 1FY2A 3WFZA 4P34A 4ENQA 3PQ8A 2VDJA 3D54D 1PDVA 1P7ZA 2V4UA 4AUEA 4ENWA 4B31A 3EJ6A 2YWDA 3EFEA 4Y1RA 1T0BA 3L18A 2RK6A 3P9SA 3R74A 4ZGGA 4ENTA 5BV2P 2VXOA 4OQ4A 3TTTA 2YWBA 4ADSG 4D1YA 3UK7A 4R7GA 5DFAA 2NV2B 3CNEA 1QVZA 3R75A 1PV2A 2H2WA 2VPIA 1I1QB 1R9GA 1QVVA 3OT1B 1J42A 2AB0A 4P36A 1O1YA 4BFLA 3PQ6A 5IP5A 4LGYA 3UMMA 1KWGA 1PDWA 1OX5A 1CF9A 1C3OB 1P80A 3L7NA 3EZGA 4ENSA 5E9AA 4RKWA 3NORA 4AULA 2ZUTA 1M6VB 1GGFA 5JZOA 2LXNA 3FSEA 3ZR4B 1OX4A 4I46A 2R1UA 3EWNA 1CS0B 4L95C 1KWKA 3R76A 4ENRA 1VCMA 4Y0NA 1GG9A 2ABWA 3FIJA 3L3BA 4UOQA 4JQSA 3BWEA 3N7TA 1PE0A 4OFWA 3TTXA 4B7AA 1GGHA 2YWCA 1GGJA 3OT1A 3NONA 4K2HA 1GPMA 1Q7RA 4N12A 3PQ5A 5K4AA 5SY6A 5SY9A 4GUDA 4N0MA 5LIRA 1QWSA 3NOQA 4L78A 1JDBC 3F5DA 3GRAA 3B3AA 4BTEA 3CY6A 2R1VB 4HCJA 1N57A 1C30B 1P81A 2ISSD 1WL8A 2VRNA 1P5FA 2XF2A 1T3TA 3F71A 4Y1FA 4E5VA 1KEEB 2RK3A 4QYXA 3ER6A 4UOZA 4OGFA 4XLLA 4ZDIA 1I7QB 4ZDJA 4AJ9A 4B2YA 3M3PA 2R1TB 1QDLB 4AUMA 4E08A 2IUFA 1ONSA 2YWJA 3PQ2A 3PQ7A 4UNIA 2NV0A 2ZUSA 4ENPA 3UGJA 2ZUWA 1JVNA 4PXYA 4WINA 4UZSA 4OGGA 5SY4A 4P35A 3EN0A 4LRUA 4MNTA 1OX6A 4L7QA 4Y1GA 1BXRB 4Y1RB 4P5PA 2AD5A 2R1VA 1K9VF 1SOAA 1GPWB 2D7JA 3ZJ4A 4MGHA 4Y1EA 4ENUA 3UJNA 3B38A 1U9CA 3NOVA 1I7SB 1KA9H 1IZYA 1L9XA 4I2NA 3SF8B 1SY7A 1CE8B 3SOZA 3CZ9A 3TQIA 2ZUVA 4L8FA 1OY1A 3KKLA 4BIMA 4I4NA 2R1TA 3PQ3A 3TTYA 4AUNA 3NVAA 4L8WB 1GGKA 1QVWA 4L8YA 2W7TA
chains in the Genus database with same CATH superfamily
3BCUA 3ZKAA 1QZUA 4LZPA 1VPTA 1TT5B 1AO3A 4BTLA 1SBHA 1A9RA 1E0DA 5IABA 3FYDA 4IOLA 4M83A 4W1SA 2PUGA 2FKNA 3GWGA 3AESA 4BRWA 2VCEA 5M7EA 3WVNA 2KI5A 1KFJB 3NB0A 3K4HA 1LDBA 1PTJC 4HFNA 4P2GA 3UBTA 2X9QA 3KR0A 3R0JA 5H68A 1NVVR 3BGSA 3UF0A 1VJCA 3SD7A 4ZI7B 4NY1A 2E37A 4BX8A 4JQYA 2J31A 3HCAA 3RUCA 4B40A 2X2OA 1ESZA 1Z6YA 4MRRA 4PCVA 4E03A 3V7UA 3WI7A 4JJEA 4DMGA 5F7XA 1FLAA 1YHYA 5FBZA 3WGJA 3DQZA 4GU5A 1QVAA 4AO7A 3BXPA 2ZRIA 3FOWA 3EGXB 1UPBA 1WSWA 2X7XA 3KE9A 2XRZA 4CMCA 2BAGA 4LSWA 3TH5A 3WWEA 4HYEA 1MH9A 3ZN2A 4IWNA 2Y76A 3ZWBA 1XMXA 13PKA 2OK8A 2ADOA 4G81A 4MS1A 2JLQA 2CLKB 5C8DA 3S2EA 2POCA 2PZ8A 4TUYB 1GQ2A 4KQWA 4XQEA 2H31A 1ZOSA 4GZMA 2VK1A 1OHHD 5EXDA 5BQ5A 3H1AA 1Q1QA 4YUVA 2GEDA 3F97A 1T43A 2JGIA 3AKCA 1U8TA 1WP9A 3KEOA 5E7JA 1WF6A 4ZODA 5HKOA 2F1RA 2F43A 3K1AB 5E7QA 1JHVA 1QK4A 1BMDA 4J03A 1SBQA 3R5XA 1MMFB 3K5PA 2JAOA 3L46A 1VFNA 3PHGA 2PZGA 3C6YA 1UZAA 1EAMA 3KTDA 3RVBA 2A35A 4UM5A 1TW2A 5BSUA 2DU8A 1L8AA 2XA9A 16PKA 3DE1X 1FYVA 2Q1WA 2V7BA 1J49A 4OU4A 5CM2Z 4HX2A 3BE5A 2NX2A 4NV3A 4X8HA 4PBRA 1IATA 4D81A 5G0TA 1EFDN 3RO7A 3DB1A 4R84A 1Z12A 3MJHA 7YASA 3EIWA 3HJTA 4DQVA 3KDSE 3WL5A 3HDYA 2P4SA 1WB4A 4ESHA 4Y9DA 1AZLA 4LWQA 3QELB 2PPLA 2GNOA 4A27A 3L8EA 3WWDA 1J2EA 3AWDA 1GPJA 4GG1A 1UEIA 4LOJA 5DSXA 1JBQA 5FD8A 2B30A 2CFCA 1MUUA 1XRNA 2GF9A 4XB6B 3UJ8A 1ZCBA 1Y4DE 3A4VA 3PX3A 3GLUA 1VIAA 2PD6A 3QOFA 1JG2A 4UNIA 2XUHA 3MOIA 3RI3A 4FQ5A 1E3MA 1KC1A 2GM9A 3P20A 3B6JA 2XJ9A 2XGSA 4RX1A 1KZGB 1FSSA 4P3NA 1YVEI 2JH9A 1ZVVA 5SICE 3RK1A 1U8CB 3L8DA 1LS6A 4UFNA 1TZBA 4QOJA 3G85A 2WJWA 4KKXB 3T3OA 4UHHA 5B1IA 3EXEB 4D8WA 5KX5F 1VLJA 4BGUA 2VTBA 3O7MA 4M7WA 3CB2A 3SBEA 2GCEA 2YS6A 2Q99A 1CULC 3PCRB 2DQKA 2F9FA 2DUWA 4NV1A 4X3OA 4XFJA 2QXTA 1XMQB 4AJJA 2NYRA 2AFHA 3EPRA 5C8VA 5TC4A 3O74A 1ID1A 1DKQA 4KTTE 1N8KA 2OORA 4JSRA 4P5EA 3RVNA 2RDMA 3W2HA 4BMDA 1DB3A 2QQGA 1ZWLA 1HFWA 3CH7A 1WKVA 3GT4A 3HR4A 2ZROA 4K40A 4FMCF 4PAGA 4EPXA 5M29A 3EZNA 1VI6A 1YBVA 1MG0A 1NC3A 4IQ0A 4XQ9A 1X38A 3FHCB 4F6RA 4KDEA 4PY2A 3WGOA 2P77A 4GP7A 4U8HA 3CLVA 4Y7CA 5A9TA 4GECA 1YQGA 2W5UA 4M4SA 4BZZA 1C8BA 1PR3A 2NTVA 4J4HA 1KP3A 2ZWPA 4G0ZA 4LDQA 2NSDA 5G3YA 1MB2A 3WNVA 4A6XA 1XMJA 1N3BA 1NXVA 1DIOB 5HQ3A 1YZVA 4GKKB 2Z9DA 1ZUHA 1G41A 2VDJA 3EH2A 1ZONA 2X8JB 3ILXA 3L0BA 4KQKA 5KUTA 1IY9A 3QBTA 5CBKA 4NF2A 3U0BA 2Y4NA 2WP8J 4QASA 2REOA 3BH0A 5EXXA 5U4QA 1W47A 2Q2NA 4PNPA 2IODA 5KREA 2B6NA 2F4VB 1HG1A 5B1YA 1DO0A 1QNLA 4BEJA 2WIDA 1QFXA 3H04A 2P6MA 5F1KA 3VFDA 1TAUA 1KTIA 3AKEA 3CWCA 2ZE8A 3EA5A 1ISPA 5TEWA 1Y82A 3DZJA 1F6DA 2H5JA 4V0MA 1U3FA 5HZKA 1ZW1A 2C5BA 4FWBA 3C3YA 3LP6A 4BVKA 1AMUA 2MIIA 3GGJA 3U17A 1OTHA 3FYTA 1KAQA 4RF4A 5KNBH 1XPRA 1UJCA 2O0LA 4LCJA 5EIEA 2NTNA 4BFTA 1SVSA 4PYQA 2BFOA 2FPGA 1OXKB 1GTMA 2PGAA 1VIMA 3K8OE 3LC7O 3LOPA 3Q98A 1KH2A 3MAGA 3ME5A 1NUHA 4YCLA 2IH4A 4X8LA 2W00A 4O4IF 2R7LA 2UYQA 3AUJB 3IOEA 5AJWA 3VMFA 5JW6A 1Z15A 3E5RA 4OY3A 4L15A 1RD4A 4PIPA 2RGRA 4FFLA 2Z4TA 3A7DA 3K9WA 4DT1A 3CUEF 3P5BA 4ZT3A 2X1VA 5C51B 2ZJ2A 1P2BA 4PAWA 1E64A 2WFAA 5J4VA 2W37A 3N2KA 2BF7A 2ZAGA 1QHXA 5K0NA 4HDAA 2ZATA 1LPOA 1X8KA 2WVGA 2PJDA 4IIDA 5KCMA 4DV7B 3GVHA 2YC2C 1C14A 4LPKA 3HMKA 3VPSA 2BJWA 4M0PA 2CVFA 1II0A 3BTSA 4DQXA 2BEJA 4WBNF 1Z2NX 2J0QA 4MV7A 4CV1A 2ZRHA 3HNPA 3SG0A 3U6KA 1K4KA 3CRRA 5F3WB 1MT0A 3DS8A 3R5SA 2OCPA 3UN1A 2YTZA 3QLEA 2DR3A 4GDMA 1R0KA 4XWAA 2FB9A 2PTHA 3LUGA 4ZAYA 2H5IA 1A82A 1U0FA 1XRRA 4A5OA 4FFBA 2X9LA 1WUJS 4MWSA 1KI9A 3M1YA 4UVHA 5E7MA 2I34A 2JGEA 3Q3HA 4DA7A 3MPUA 4EY3A 1RYFA 2O5VA 1OHHA 1VBKA 1VI2A 2VPQA 3GJXC 3PT5A 4I5FA 2WC1A 2XD9A 1ZJ6A 4HQNA 4EA9A 3OLXA 1TPZA 3G7SA 2BEUB 2Z5GA 1U65A 3FX2A 4OQYA 3LA6A 1FYFA 2GERA 4RY0A 3IT2A 3OBIA 3WK4A 4FHEA 4M1YA 1Z13A 1JNXX 3ABQB 3EG5A 3RFUA 4D45A 1QQBA 4CR8A 3R6DA 3W34A 5IAGA 2F64A 1Y8QA 2I22A 4FD2A 4R68A 1FFXA 5K0EA 2WIAA 4AJKA 5JCJD 1I3LA 2VA9A 3GB9A 5JADA 1TMOA 2XX3A 1P2DA 4YAEA 3AILA 3UAXA 2G4VA 1OI4A 4B79A 5HS4A 1LX7A 1N2EA 4XM2A 3EE6A 2ZIUB 3CSUA 3SX0A 2FEXA 3NVDA 1GRVA 3TN7A 4DLBA 1GGEA 1UXHA 2ACWA 3HA2A 3PHLA 1MW8X 3MGGA 2O8CA 3NNNA 2NGRA 3RS9A 2LRHA 2HWKA 2B4TO 4EW6A 2FWPA 4WKPA 5BV1A 4PZ0A 2IYPA 1U7OA 5CH3A 3T9AA 2AI1A 3UWOA 4M60A 4ZI7F 3K6SB 4P1ZA 5J2UF 2EFYA 4MUMA 2Y1EA 4WERA 4COKA 3WMWA 4KLAA 3RCBA 3W5IA 4F06A 1EUDB 3TRIA 3TRKA 2O3QA 5TGZA 1QQAA 3FWNA 4M9CA 1K6EA 1NP3A 2MR5A 2V45A 2Y1KA 5JPCA 3HB7A 1C1DB 2GFHA 3O4VA 2CXPA 3P45A 1QP7A 3GU3A 4DUGD 1NYTA 4WVFA 4DWWA 3H6GA 4WVLA 4NHEA 1KOFA 1N33B 5KTSA 3STYA 4NULA 2QD2A 5BN1A 3OOEA 4WZBB 1TMKA 2DG2A 3AHGA 5FA8A 4J3NA 4TUYF 4G0WA 1MDFA 5IYZA 3IRVA 1QH1B 4KBGA 5BURA 1ONNA 4HH4A 5KVVA 4MPDA 4TZTA 2HJHA 2ZVQX 3QVKA 5ALLA 3F4LA 4GKBA 4O63O 4A26A 3KQMA 3DBHB 2AQHA 2ZLBA 3D3WB 3QUBA 1Q95A 4DAEA 1IXZA 3L6BA 1G3IA 3W06A 4KQ2A 5AJXA 4I4CA 1XU4A 1DTWB 1E18A 1EINA 5DXAA 2WA1A 5FO1A 1OQAA 4HRAA 4OB7A 1Y8RB 1OVMA 3GDGA 2G09A 4ZARA 1J9ZA 2Z4SA 4I4LA 4IS2A 4LX0A 1RC8A 3QXSA 4X1KB 2VKQA 3ENNA 4LSZA 3LYAA 3TLGB 3VAYA 2R1VB 2BDEA 3IR5A 4K0KB 2HSWA 2PD3A 4WIAA 4D0GA 4BB0A 1AKVA 2ERXA 4MRVA 3JYQA 2C5HA 2VL7A 3F8WA 4I1VA 2WQ6A 5KKNB 1CS0A 2V7GA 3NTOA 5IAKA 1KEVA 1Q12A 1SXJE 3M6FA 2WHXA 3OQBA 1XZBA 4Q16A 4YRKA 3JALB 1X7WA 5DHUA 2IUFA 2BV3A 3RSQA 4FFSA 5JTTA 2W6ID 2J4DA 3FYSA 4JUFA 3JQFC 2J7KA 1P5ZB 4PC1A 1EFLA 3KKZA 3IPLA 4MNTA 2W11A 3G2HA 2P67A 3NKLA 4IDPA 3A1UA 1O54A 4LDNA 2RAPA 4DLWA 5I7WA 3F6SA 1XAHA 1PG2A 1J22A 1OW3B 4X45A 1N6RA 4CM8A 9MHTA 2QT1A 3SEZA 3INNA 4D4GA 3PGVA 5BOSA 2ZBQA 1IZYA 1TQ4A 4RD4A 3BT7A 2ZITA 4QXAA 3BF7A 4L75A 5FEUA 2JLAA 4HDRB 3HCWA 4IQFA 4KQXA 1V0JA 4B32A 2KS6A 3G2PA 1ZA2A 2P79A 4I4NA 1ZGAA 4IZ6A 3FTNA 4R9VA 1G63A 3TZHA 3U16A 3JR3A 3HJRA 4XIGS 4O4LF 3IPAA 1ZZEA 2HIAA 1U4OA 2R4UA 2JNWA 5K0LA 3P0EA 2IE8A 2AKYA 4KXXA 5BR1A 2DFPA 4I6JA 1F2TB 1P7YA 3CZ4A 1Q2UA 3K0FB 3QEOA 3QKTA 1AZTA 1VKOA 4BRUA 5AVUA 4JB3A 5CXSA 1KK0A 2M6RA 3NTVA 2A1TR 3AEYA 3MTBA 4Y2GA 1CE8A 2I2FA 3ESCA 5CA0A 1IBMB 5HS6A 4LHZA 3VZPA 1O57A 2JIZD 2FJPA 2G17A 4NYJR 4YASA 1W5SA 3B2NA 1OYYA 3GCWA 3L9XA 1MZVA 3H2HA 2X76A 4PLWA 4US1R 3H2JA 5J2TF 1GKUB 2WJIA 3O75A 3IUJA 4LNUB 5DLDA 5G2OA 3WKBA 4ZO8A 1JG1A 2C3PA 4HXYA 4WCVA 1SGWA 2Z57A 4ENQA 5BNZA 2VPYA 2XGGA 4M8SA 3KQNA 3CN9A 2PUCA 3E23A 3R3JA 3ZK8A 3DZKA 4WGFA 3OIFA 5KVCA 1QCCA 4CKWA 2RIPA 3MINA 3NOXA 2JRCA 4K86A 1KH3A 3AM3A 2V7EA 2OXFA 2D54A 3RFXA 2VQEB 2VNSA 3EPKA 1YR2A 5KNCD 3FRJA 1PT7A 1KAOA 4X6UA 1NL3A 4HVTA 1QHEA 2AB0A 1KVUA 3ZEAA 3X1XA 1JEDA 2AEJA 4JP8A 1JJVA 3UANA 5G0VA 1ONOA 1E8DA 1IHDA 3KQSA 4QBFA 4W99A 4AIIA 4BZPA 4FEYA 2WOOA 2EC5A 1TJYA 2W2VA 2ENWA 3BFJA 3M6XA 2RFLA 5EP4A 5F5LA 5L3VA 4XVCA 3CV3A 8ATCA 3ED1A 3ST7A 2JJYA 3SEAA 2Q4EA 1RP7A 1Z83A 1EWTA 5MN4A 1E1RD 1H2RS 4JC0A 1FUEA 2RKBA 5JCJA 1A76A 4Z3DA 1C2YA 1GQRA 4LZZA 5HF6A 3GLHB 3HI4A 4PLYA 5H3LA 5BSMA 1XAJA 3TZEA 1IUNA 4BJ5A 1JEQA 4JC8A 4YP0A 3K2BA 1JHPA 4YQZA 5AVOA 3SZMA 5F21A 1A8PA 3F6CA 1HNNA 2QXYA 4BQOA 3RVQA 1IXRC 2J32A 3PC8A 5HRAA 3FJYA 1A88A 4Q3KA 3FMFA 4RM2A 4WCFB 3EIHA 1WIWA 5B2ZA 4HZGA 4YRPA 4PNHA 4CETA 4HNTA 5AVRA 5ELXA 3GPLA 1MRNA 4KZPA 3ORYA 2M2IA 2BHNA 3ER6A 2A3NA 3BORA 2XCQA 3ENZA 2BZ1A 3C8HA 3RIGA 1ML3A 1YJ8A 1M5UA 2VF7A 4COOA 4KITB 3B20A 3SQNA 2QJFA 4EY6A 3DAGA 1ZUD1 2WV9A 1NV9A 2FZ5A 1JLLB 1W35A 5FLEX 4OGGA 2GILA 3WDMA 4CF4A 3KYCB 3D4NA 3IEIA 4UPDA 3STWA 1Q17A 5CA1F 3JQQA 5D3ZA 4D2IA 4GXRA 3NHSA 5JECA 5JHGB 1Z82A 2ZAIA 1J09A 4LYHA 1W2HA 4YCJA 1XCPA 2OILA 1CHNA 3UMGA 3R3SA 3RFCA 3UXHA 4BLPA 1B16A 3G1TA 4FE7A 4M22A 1B8NA 1JQBA 2E5FA 1QPGA 3K9CA 4CQJA 1HE3A 4W1QA 2WHEA 3EXHA 1NPYA 3GAMA 4ITVA 4JQZA 2GAAA 4GBJA 2A1UA 1BCRA 1ISIA 2ZDQA 4OI1A 4X1YB 1JG6A 1Y5RA 2GBPA 2W6MA 1NDHA 4OL9A 1FYEA 4KOAA 4V02A 3JRXA 2P6OA 3CX3A 5AHKA 2ZJ4A 3WGTA 5C5IA 4HGPA 1E5DA 2LGJA 4RFVA 5B58T 4DDMA 4E5YA 1I3OA 4U2BA 3P9NA 3HEAA 4A3SA 2GTHA 2C54A 3HYNA 4K9PA 2CYAA 2A7XA 5DLEA 2QN7A 3JARB 1TDJA 1M2VA 3BC1A 2HXYA 4AF7A 4NR0A 5BVHA 1TK9A 1BEUB 3KZ1E 3NYQA 2VF2A 2NU6B 2P3QA 3V8PA 3BHIA 4U00A 1IZ0A 5BORA 1G5HA 3LY5A 3ZYCA 3PQ4A 5FUBA 3MIIA 1BJTA 8MHTA 1YRBA 2HDHA 2VNHA 5DRTA 4TQ9A 1JLHA 1JW9B 1SD2A 3DAFA 3IT1A 2W98A 1RYEA 1D0SA 1J0EA 1PK8A 4CM7A 2Q27A 2FSIA 1PT5A 3D54D 5KYNA 5DTIA 4DMFA 4HEA1 2ZYWX 1K7EB 2EKDA 3OZWA 5FLKA 1A1SA 3VNAA 2W6IA 3ZE1B 4DCUA 4IV0A 4OXNA 1HOTA 2PS3A 5FPSA 1FFHA 3Q3GE 2EL9A 1MEOA 1C4XA 3M1IA 5JOQA 1GZSA 2Y1XA 3E22B 3SFVA 1I3NA 3ZD6A 4REQA 2NT4A 1FVOA 1E96A 1HRKA 3H9JA 2UXDB 4KH1A 1G3QA 4EPYA 5L53A 1E2UA 2CNKA 1RBZA 1L5OA 1H2YA 4J9VA 1JDSA 5ULLA 2D1RA 3QVXA 3U1BA 2BKEA 3D6FA 2AOTA 4Z5XA 1Z2EA 1JXMA 1JMKC 4UTNA 3BB1A 4IX1A 2ZSBA 2ZUTA 5AM4A 3SYKA 1WDMA 3LNTA 3GD7A 2NU9A 4NOJA 4TTPA 5K8UA 2AE2A 2REQA 1VGVA 5EWLB 2FW0A 3PUYA 4RD1A 4LISA 4FHFA 1WY7A 1K2WA 3KCNA 4N5DA 5FPHA 4MAFA 5EKDA 1OZGA 4X71A 4DLLA 2I3GA 3U9TA 1HT2E 2JLXA 4MWDA 1H3EA 1Y4AE 2ASEA 4CTNA 1N2GA 3H0KA 4HVCA 1P29A 2R66A 1OZAA 2VJQA 4AMZA 2I3BA 4IDCA 1Z0DA 1JR3E 2XWBF 3G89A 3R6TA 4JGGA 4TL6A 4Q7KA 4XR9A 3OCYA 5FPPA 2HPHA 5CDYA 5EHIA 3KSUA 3T7IA 5JIBA 3OLWA 6PFKA 1QIEA 4NYJQ 2YYAA 5CCEA 2JIZA 4IJUA 2XMPA 4X92A 1OH8A 3NVKI 5GZ3A 2ZJZA 4B85A 2H54A 3BICA 3CONA 2YZNA 1IC6A 4CV0A 3FMPB 2DFNA 3GMSA 1GTZA 2WMDA 3LT5A 2Q5LA 4OUKX 4P7JA 1KZHA 1BE1A 2WIFA 3RS5A 4C2AA 4CKCB 5JRDS 4W5JA 1DC8A 4A0QA 5GJBA 4PG5A 1K5GA 2NSHA 3KXDA 2ZUWA 4YMLA 2IDMA 2CHFA 4UZSA 3HKCA 4CKEA 3M34A 3Q2KA 4FD3A 4ODIA 3ZNPA 4NMHA 4D46A 5FX2A 1UL1X 1Y63A 3A27A 3OURA 3BXZA 3KPYA 3QLVC 3WMRA 2X8AA 4ENUA 1F0YA 2DY1A 2EGGA 3GFPA 3T7JA 4URZR 3UJ3X 1QS0A 1DXYA 4I5GA 2H08A 2OQRA 4MWTA 4H27A 3QX3A 3E3OA 2ZRBA 2IUYA 3ETHA 3JTMA 5BT9A 3UATA 5DM60 2AOUB 1N5KA 3C3MA 4BIMA 1QJCA 2AJTA 4R69A 1R4MA 2DEUA 3LUAA 2JS7A 3A6JA 1EGAA 3TJZA 2I33A 2WYOA 1Y9AA 2ZXEA 3GRVA 4KCGA 1JDVA 1YB2A 3C3DA 2W7TA 3I52A 3PLRA 1U0TA 3BL6A 1UDBA 4OXIA 5EESA 1I4DD 1FUUA 2LDXA 1A98A 5HF8A 4EA8A 5JNWA 4QAJA 2X0FA 1UMDB 3T3MB 3KAJA 5LJLA 1BXRA 1W8DA 1E2PA 3DM5A 1VG0B 3MCWA 3SE0A 1EQAA 3ESXA 3MUFA 4OLBA 3JVIA 1TK2A 5LP6B 5L8VA 3OFVA 3AVOA 3TYXA 4BLRA 4F92B 3QA9A 1RYHA 4RK6A 1Z29A 1CQIB 2XMZA 4TRRA 4DHWA 5KMGA 2PKXA 1TT7A 1I01A 4QUDA 1GZ3A 3FWPA 1WB9A 4DCTA 2B4RO 2ZSHA 1F2UA 1SU6A 3HG7A 4J75A 4ZA2A 1T9GR 2I66A 5BSKA 3FUWA 2WTXA 1G9SA 3MCUA 2IUUA 3VH3A 3W6ZA 4EG4A 3G0DA 4BNMA 1NBEA 3V8MA 2X2EA 4EG7A 2VATA 4KJZA 3LBIA 5E8RA 4ER5A 5DT9A 3CNBA 4OV6B 2IKSA 3NJ4A 3AZQA 4M86A 1VXRA 2I6TA 3LQFA 3WLFA 2C8LA 2G5GX 2YR0A 3ZCRA 4EKDA 2X5XA 5IF3A 3EASA 4WNAA 2CMHA 2V4UA 3KB6A 4A91A 9ATCA 1U4SA 3T5BA 2DPMA 2RIRA 2GA9A 1AGYA 2PU5A 4CR7A 4YUZA 2IV2X 4OQPA 4N6GA 1T5BA 3FCCA 3K2QA 3QLTA 4F5EA 1VMAA 1OYOA 3B1JA 1CUFA 3NH9A 3ZVRA 1AQIA 4HMQA 1EK5A 4UMVA 1ECLA 3B8HA 1DG9A 2Q9CA 4BNNA 4DJ5X 1C4OA 3D5EA 2GNPA 4J07A 5ESXA 5B6IA 3KJZA 4H35A 5KSZA 4G3XA 3AC0A 3OX1A 3PUZA 4BNDB 4OCZA 5JS6A 3ZGLA 2JFFA 3KDPA 4IRMA 3K31A 5D51S 1A72A 4II2A 2QZZA 5EC8A 3ZDEA 2FPWA 4DZTA 1CUYA 1XHEA 1NIPA 1S3GA 4Y0NA 3L5OA 5I9SA 1JLSA 3RYIB 5F73A 2BGMA 4EMBA 1XTJA 2XCIA 4FFNA 4XYBA 1JIQA 3Q8LA 5G4LA 4RTJA 4I1PA 5JAIA 3B1FA 2F9LA 4CN9A 1N0UA 3NRBA 2H9IA 3T5CA 4NJMB 5KYYA 2E6KA 2YFHA 4MDFA 5CDFA 3OZTA 1N2ZA 2R7KA 4FYYA 4NZMA 2ZJ1A 1JDBC 2GH1A 1BEZA 2CMDA 2ZAOA 5AW0A 1ZCAA 2ZTSA 3W5JA 3MJFA 3HK2A 3PUIA 1V6SA 2ZVDA 4NCNA 1AC5A 3LT2A 2CMFA 4I3GA 3VRHA 3HWWA 4GX1A 5F77A 3ORHA 1L7OA 2JJ8A 4IL5A 5ALTA 1VGRA 2JJ1D 2ZB8A 1GPYA 1Z5UA 1G8AA 3FKJA 4EJFA 3E9YA 2Z9CA 1DKNA 1KYYA 2EJVA 2BY4A 2MSKA 4L1KA 4YJ2F 5D8DA 2IXDA 3C1TA 2AA3A 3QSGA 4OATA 3C8ZA 1WW3A 1UMCB 2NUPB 3LQKA 3RVDA 2ZIGA 4LRYA 1J23A 2ZWVA 2R4QA 2A5YB 2CL0X 2CK3D 3PGJA 4V24A 3PFKA 2QRVB 2FMUA 1P6UA 2ZTUA 2W2KB 3O8QA 5CVCA 3S1LA 2QUAA 4F91B 4IHAA 1NN1A 3AETB 5K3FA 1N0WA 3KYIB 4B9AA 4Y1EA 3GJ4A 5TIIA 1L5FA 4IO1A 1SVIA 2PT5A 4RELA 3A1VA 1T6NA 3ROEA 3QNWA 4QT0A 2ZS8A 1E3JA 5HFAA 4DZRA 2DHEA 5DYNA 3RYCA 1MO4A 1WLYA 5H59A 1TVEA 4K26A 4NECA 4ZAXA 2DFKB 3TMAA 1H1DA 1RWWA 1V25A 3WIBA 5BNTA 2HNKA 2AN4A 2JCVA 4DKJA 3Q9UA 1DS6A 3ELWA 5JY1A 1THTA 3LQYA 4OX9Y 2QNRA 3UW3A 3D3JA 4DRXB 2QAGC 4ZYTA 4DFDA 4OLAA 2BH9A 2PSJA 5TT0A 2P9CA 4HQFA 2XUZA 2ZT8A 4HDOB 1M8KA 3IMKA 1ZNYA 1WNTA 3C8UA 4KMRA 4KRYA 5B6PA 3KS9A 4O2RA 5AKYA 2E49A 2QL7A 5IC6A 1QO7A 3UK7A 4DR5B 5H8WA 3MLBA 4KIUA 2X0JA 4GL2A 4DDTA 3HP4A 4R83A 3COWA 3RS7A 1CC1S 1M2KA 1GNVA 3T4UA 2XNKA 4DR7B 3T7EA 1NYQA 4PLCA 5EMHA 1FY2A 2XYQA 4OMCA 2CD9A 4P34A 1NPTO 4R8RA 3U13A 4QLBA 1EUYA 4QPJC 2VP0A 1UWKA 1OR8A 3DR3A 4K8OA 1ZC3A 1OPRA 2ZJ0A 3I01M 4YRFA 2FSPA 1N7IA 5DI3A 3RIEA 5KSYA 5E3IA 4LWZA 2JG3A 3TJMA 1TJPB 3L7YA 2WD8A 4OQ4A 5CNMA 2C0PA 1GAJA 3IOCA 4B6PA 3V80A 3KXPA 3JSAA 1YZHA 1ADYA 3K4QA 3P71T 1YBHA 1IBSA 3LHSA 2IZ6A 3C2QA 4Q93A 1Y9EA 2X23A 2HY7A 4ZO6A 2D1SA 4WXRA 1AOXA 3I6YA 4DQLA 4ZVKA 4GLBA 1XRPA 1ECPA 1FP1D 5FBQB 1EQ2A 2PHZA 4NNOA 2AWNA 1ESMA 1M3SA 4LXYA 1N6KA 5IJWA 2ZIAA 3PEUA 3EVTA 3Q6NA 4W7SA 4YALA 4H0FA 4DABA 2COUA 4G0PA 1DJPA 5AH0A 3BIXA 1GIAA 3QUTA 1T0IA 3NONA 2XUFA 4D92A 4RXUA 1LTQA 2YV2A 3JQ8B 3E9MA 1RLUA 3H11B 4BKPA 1GAWA 3DJYA 4BFWA 3DO8A 3KSAC 3TUZC 3OPYA 3MAJA 3MTQA 4RIGA 1HTWA 3OLVA 1UJNA 4NBLA 3U7IA 4B6JA 1LF0A 1ZIDA 3MC1A 1RAEA 2QLFA 1ES9A 4GM0A 1KPIA 4XLLA 4H1WA 1DX9A 4RY8A 2CXNA 1M1ZA 3M9LA 3JY6A 1SVOA 4GX0A 4CG3A 3PUXA 4B4WA 4BLUA 4DIBA 1LI4A 5CLLA 2BN4A 1E94E 3K72B 4EB8A 2CW5A 1B3RA 5A2GA 4LF5B 2G06A 3NQ41 4G8BA 2Z98A 1XFDA 4RYLA 1SXQA 3A2LA 4JYAB 3PL1A 3ML1A 1QMPA 4DLPA 1OT3A 1GUYA 2FPSA 1IWPB 2IY9A 3B1ZA 1D5WA 3TFQA 2RH4A 3ZHUA 4MR9B 5JBNA 1Z4IA 3PXCX 2AR9A 2HCRA 4LYJA 3SLGA 3MYRA 4MYRA 1BQEA 1RVV1 1XA0A 1T3GA 1ZI6A 2FSUA 4G5QA 5ENZA 5ER9A 1IVYA 5B2EA 2WYWA 2D5LA 2VF5X 5FBLB 4TKUA 2SKCA 4I66A 2VNKA 1BE0A 3DVLA 3PWKA 4QRIA 3TAUA 3B7GA 2FMIA 2UDPA 2VQ3A 3QVWA 4FOTA 1EVIA 2CDRA 3CC8A 4NV0A 4CQMA 1BKSB 1D07A 2GAIA 3M2TA 3HJGA 1E7MA 2ZBEA 1IOVA 3U39A 3RYFA 4B5KA 1G8GA 4Q47A 4M1TA 2CHVA 1HA3A 5CT4A 1KYXA 1I7SB 4FWIB 5LD2C 3NT2A 2DWCA 3PNLA 4RH3A 2DC1A 1VTKA 1YKGA 3Q72A 2C2OA 2GBLC 4WLFA 1ZHFA 1T2VA 4XUCA 3MBOA 3CBQA 1GGMA 1E92A 1MP0A 2JCXA 4F46A 4KQ6A 3ZWDA 4RL6A 3RRMA 1TYEB 2WP0A 4GMKA 2YXLA 3FLBA 3U9SA 4DE5A 1V9CA 2ASVA 2X1HA 1ZGBA 4GXQA 2JJ1A 2PFKA 3SY8A 1KVSA 2YDYA 4MKZA 3TLJA 5AQ1A 1JBKA 5AHXA 3NYIA 2BUBA 3FDXA 2QF7A 3QGMA 4QUBA 4TXNA 3RK0A 2TECE 1M1YE 3NWOA 2HNAA 4HH1A 4RK5A 4WV3A 1WVGA 1VBFA 1FPMA 3ONWA 4FC7A 1XX6A 2CK3A 2IEIA 2X0NA 4HYYA 4J0IA 1QC5B 1P2VA 4UNQA 2QMYA 4B9EA 2JVIA 1V9LA 2IYUA 4G5HA 1ZH6A 4BECA 4CPDA 5JVDF 2VT7A 4EF6A 2G76A 4LW8A 3L2OB 1M74A 4OJQA 4LVOA 2YOHA 1BE8A 1I5OA 2E4VA 3EGDB 1N5JA 5MGNA 3K0KA 4RAQA 4QQFA 3N0WA 1IY8A 3MCVA 3FZYA 3OLCX 4BO3A 3KVOA 3Q3JB 3S1SA 1MNQA 4OOEA 1ATIA 3WWZA 4L0DA 4QPCA 3FPCA 2REBA 4TSRA 4MAAA 1B1AA 3BWEA 2GEKA 1T1EA 2JARA 1IQPA 4MLPA 1QLJA 1X87A 1JXQA 2Q3CA 3DL0A 2WG0A 1A97A 4BMPB 4ETIA 2SCUB 1ZITA 3EZ2A 3L05A 1DO8A 4JZYA 1XLUA 2Q8NA 3KHUA 4JI4B 3WMGA 1L4HA 1PUIA 1T3SA 3AJRA 1B23P 3INTA 4QGFA 1N8TA 4BKQA 1GO2A 2ICAA 1GZ5A 1QAMA 2XYHA 3UW1A 2BMVA 1UKYA 4MVJI 2C5SA 3PNYA 1T6BY 4WWHA 4NK4A 2Y0PA 1KZ4A 3H5WA 5LZ5A 2HRBA 1W2GA 3O8OA 1W52X 2QENA 4GWLA 4OP1A 5AICA 1PJ4A 2J9RA 1ZLYA 2J48A 3R7DA 1DWPA 4TV9F 1KR5A 1XQVA 4WINA 1WX1A 3IV6A 3QVLA 1PHPA 4II7A 3V00A 1NUUA 5JZVA 1SXJD 4P54A 4S3MA 3RU2A 1RQGA 2XZTA 3DC7A 3EFOA 3OHMA 4X66B 2B3TA 1ORTA 1CR4A 2FG6C 1A9YA 3RSSA 3THWA 4LS3A 4K6HA 1P91A 3QWHA 2GKOA 3QVSA 2R1TA 3PQ3A 3DHYA 4H60A 2XSZD 5DHQA 3G8BA 5KNCH 1GZ7A 3MJVA 5FNVA 4FQ8A 4ZVRA 3SCZA 3H83A 5JDCC 2F43B 3ZCUA 1AMNA 2OHIA 3FH0A 1FP2A 1V6AA 2HA5A 2IK8A 3SIRA 5IFKA 4TZ6A 4ZQEA 1ZR2A 2WR8A 2C5FA 2GK3A 4YJ3A 1BJRE 5B53A 3DPUA 4ARAA 1DZIA 4DIMA 2A9FA 4QXMA 3KEFA 1O6CA 4I4TB 3HKEA 1S6YA 2D2IA 2XZDA 4R7TA 3U5ZB 4KAAA 4ND7A 1H4SA 2VYCA 3L8YA 4LBVA 3EDOA 1O96A 4Q3DA 3RV4A 2CKMA 1GG5A 1QHIA 4KQGA 2J9FB 2W90A 4Y6SA 4C4SA 5TRTA 2W2QA 3Q41A 4JROA 5CNJA 3I5YA 3ZV3A 4JT8A 2HIGA 2UYGA 1CZNA 2YHBA 1G4UR 4QRHA 5KWJA 1V43A 1SOVA 2MWMA 4Q1VA 2WKQA 1PO7A 4XR4A 3WFJA 5CDUA 5BYJA 1T0BA 3MXOA 3B3QA 3GGPA 3BMOB 4ND4A 4CNBA 4DIKA 3IAAA 2OFPA 1K5HA 4WKOA 2C96A 2E6UX 2NUBA 1USKA 2D5IA 2PV7A 3EDMA 3DGEC 5ESDA 1K2VN 1KDOA 1NM5C 5B7GA 4PONA 1G66A 1R0CA 3LK6A 3HVJA 2ZJ5A 3VPHA 5AW6A 1VOTA 3ZG6A 1D4FA 4RFLA 1DIRA 3JASB 1MX3A 2OBFA 1K9SA 1HT3A 4IXWA 2QTNA 3WWOA 3DZIA 1HDEA 3TSYA 4CG0A 2PJRA 3SFZA 2HPZA 2OZEA 4E1VA 1M8GA 2D2EA 5BQXA 2R00C 4CL3A 1M6NA 5ALKA 4MW0A 4BY9E 4DQ0A 3TUIC 2GWHA 2OFWA 3GLRA 1KDPA 4HY3A 1KSFX 3DTTA 4KO2S 5CJPA 1RWNA 2GS9A 3DGFC 1BA3A 2VDUE 4KK4A 3RKUA 4W9MC 4YAIA 4CM4A 2G9NA 1R9JA 2CF5A 3UMJA 3PGLA 5JANA 2C4HA 1Z2DA 2H9AA 4YJGA 4NS1A 1NONA 1BVRA 3QLVA 1ZOIA 5DHFA 1J7JA 3TLMA 2GK4A 1K6MA 2FMHA 1JAIA 1J97A 3TR0A 1FW8A 3FYCA 4YV7A 2DRIA 4MDHA 1T3TA 3AQ4A 3U7GA 1UM9B 4QNNA 5K99A 2RK3A 4UOZA 1OT5A 2A86A 1K6JA 4OLHA 1DC3A 4YRSA 1QM5A 3F9RA 3C3XA 2YYSA 4E08A 1BN6A 3ND5A 1WSBA 4UM9D 4S12A 3ABSB 1TAGA 2CUTA 3CNNA 2QJWA 4CHTA 5MF6A 2IW3A 2WMNB 2WPNA 1RRMA 3VX4A 1WXIA 5BN5B 2CLDX 5JAMA 4W5HA 1ZPDA 1S2MA 2PL5A 3WYEA 521PA 4JLJA 1XAGA 1ESEA 2WF5A 3H75A 2A30A 1KEEA 1SU4A 4NRDA 4DR3B 1T9HA 3K32A 1EDZA 1F5NA 1Q7CA 2EKZA 1PP4A 5HIJA 1WAMA 4X54A 1OJLA 5D5HA 4MRMB 2A14A 1EUCB 1A0OA 5GOTA 4INPA 5AM0A 1DBVO 1W36D 4UHFA 1KJIA 3DFIA 3P8ZA 2XUJA 1PS9A 4KVZA 5LZ4A 1ZHOA 2BFPA 4ZMBA 2FYTA 2GJAA 3L79A 5D6OA 4ZOBA 2Q3JA 3C98A 4BGIA 4EQ6A 3C3JA 4L73A 3VX3A 5CD9A 2X15A 1DRKA 1VL5A 3GVPA 4TLEA 4MROA 1E58A 2P62A 4ND8A 4TYMA 5LN1A 2HHHB 2XBLA 1PTKA 1AXRA 4ROSA 4KR9A 4J91A 4YK7A 4YP5A 4KAFA 4HWKA 2QS9A 3OCXA 3DPIA 3BXFA 3IUMA 5KYVA 4A36A 4YMGA 3C4VA 3SBDA 3P9QA 3AEUA 3OA2A 5DXFA 4IIJA 4M36A 4YJFB 4AVYA 5L7TA 2JKZA 1PX0A 5CH8A 5LOVA 5SZHB 2ZJ3A 2WKRA 4D9HA 1Y1RA 3U09A 3UPTA 2H1WA 4P3PA 2ZJFA 4GDFA 3ZIAD 5DO9A 1PDVA 4OBBA 3TRDA 1UPAA 1KYVA 1PR1A 4FDAA 3MUEA 3VR3A 4DCCA 4NFLA 2FG7C 2F3UA 2AUTA 1YRHA 2C9ZA 2G1JA 4AC9A 5CJ2A 1CQJB 2HU8A 2QG4A 1RTKA 2X1MA 1SXJA 1RFLA 4C7XA 3FBTA 4PIMA 2EAUA 3V8QA 1XXHB 2FKAA 1V8BA 3I37X 4PR3A 3GFBA 3L6UA 2ZYHA 2O2XA 3HFRA 1BYIA 1N9GB 1QX4A 1PDWA 2EERA 2G1KA 1GCIA 2F17A 3QJGA 4JLKA 1FX1A 2MSLA 5E6SA 3AM5A 3V1YA 1R0SA 3ZR4B 3GUYA 1I33A 3FW1A 3EVAA 4HNUA 3EWNA 3W8NA 4IJQA 5B4VA 3GNSA 3GUUA 3LI2A 4BO6A 5AXBA 4X1IA 4Z2YA 4EATA 1OGIA 3ACCA 1KDRA 2E4XA 1CJVC 1FFXB 1ZNWA 2FWMX 3N2ZB 3GRUA 2O8DA 1ZD2P 4RDHA 1P9NA 4TROA 3LX6A 1KU6A 2ORWA 2QRGA 2AUNA 3RGWS 3JYOA 1KFCB 5KTOA 1JX6A 1OMOA 4QULA 1SRRA 1NNLA 1XCMA 5GTDA 4GXNA 3QVGB 2Q2OA 5BR8B 5AM3A 1RPNA 2R2GA 3BG5A 3KWJA 1IUPA 3I4LA 3R1IA 5JU6A 1EXDA 3LQ4A 3N8KA 1P0IA 3QEBZ 2XBMA 3CN7A 4HWRA 1TUGA 1JR3D 1JQAA 1YJCA 4CM3A 2CBGA 3TKLA 1AGNA 3REQB 1KVRA 1ZUWA 2Y1DA 2HCFA 4B4KA 4FZ5A 1P3DA 3BGOS 2LCQA 5ADWA 2Q0XA 3IBSA 3CZCA 3NTQA 1N7GA 3ITDA 1ZU5A 2A57A 1M2HA 2QAGA 4L07A 4U7GA 5IJ9A 3CIFA 3PRHA 3AUKA 3T5TA 2B8EA 4WZ6A 3MEQA 5CRIA 1LFDB 2ST1A 4CCYA 4XD7D 4E4RA 3ZGNA 3EFHA 1F3OA 1RQNA 3FGOA 1T6YA 4TOIA 2A1TS 4IZHA 3NO4A 3RC2A 2M9MA 3KXLA 1EBBA 1ZJ5A 3IQDB 1NW7A 1PFVA 4GI2A 1SFRA 3DZFA 1B0PA 2IIPA 3DB2A 3DG9A 3KV1A 2JLSA 2ZSEA 3PR1A 3NHFA 2PKEA 3UB4A 4DOMA 3ETCA 1NR1A 4JEUA 1DIBA 5KTNA 3T94A 2YIJA 2FWBA 1UKAA 1PFYA 4HBGA 2GXAA 1LSJA 1T4DA 1FE8A 1XDSA 2W2OA 4KDCA 3KOZA 4O1IA 3LUFA 3MT8A 2OO3A 1P4HA 5EN4A 3H5OA 2YXNA 3WGHA 1G5QA 4RK4A 3N7AA 1BN7A 5JSUA 1MB9A 2HFKA 4KWHA 3RTDA 5CCBA 3THXB 1N0HA 3W9BA 4YXWD 3LSTA 3U7QA 2VDNB 4NPAA 3ZV4A 2R96A 2BFFA 2WWYA 3RFFA 3OICA 5TEVA 3U4DA 3IQXA 5JBQA 3T1HB 4FR2A 4MSUA 5IDYA 4TMZA 3PGA1 4HGZA 1DEOA 2Y0EA 5KI6A 1YAJA 2ZTHA 2C7BA 1CEXA 3CNEA 2H0AA 3R3ZA 4AJPA 1FW6A 2QLMA 4NCKA 1X7YA 4P93A 3UK0A 3GQVA 1QYXA 4F9FA 3IQZA 5BSTA 1HBJA 3L6CA 3BE8A 3SMQA 1E32A 3ZOZA 3X2EA 4M9ZA 4CIBA 2XLCA 3BXHA 3K5WA 4UEWA 4PEVA 5AXCA 5I01A 5K3AA 2IRWA 3DZCA 1UZNA 5H5JA 4G1EB 1E9FA 2LIVA 3DEYX 3UFXB 2AMFA 2HXSA 3IIIA 5E3HA 2CXQA 3I23A 2VDMB 1ENYA 2PBZA 4XFKA 1XRMA 3ZH2A 3H8JA 4EYSA 1DBQA 4PLZA 5FOTA 1CY6A 4HJRA 5LBIA 4YR9A 1FXSA 2ALJA 4TWJA 1EWVA 1L4UA 1R0YA 1W29A 1JQLB 1Z5WA 3FDIA 3LO8A 1T9AA 4PE5B 1C29B 4ZOLF 4EG8A 5DWQA 4Y6LA 1PK9A 1TADA 3OH8A 4JBYA 1EK2A 1ZW6A 4UBKA 2UYYA 2QQEA 3L40A 1OGJA 3NJ8A 3U3ZA 5AHOA 3L8HA 1I2DA 2AYZA 3ZE0B 4RDCA 4TTJA 4MUYA 4IIBA 2HQSA 3JQ7A 2I4OA 1AS0A 4KXQA 2MJLA 4UHJA 2I6UA 5B1HA 4FGWA 3PFGA 4D0SA 1A04A 2VPPA 3ZIAA 1O9BA 4MOWA 1UXGA 5BW6B 4KGVA 1BHJA 2V3CC 3HCFA 5EZYF 3WLAA 2XYRA 3T9DA 3L0PA 4H17A 5JJLA 3RLFA 2XDYA 4BCCA 5G53C 2O2YA 2PH3A 4DG5A 1QE5A 4P8RA 4H9GA 2BTOA 2C4UA 3MINB 1W5FA 2YS7A 3MZ0A 1T2NA 3F78A 3FUCA 4GNRA 4RADA 4RJJA 4F8YA 4AY2A 2NP6A 2FSHA 4V1CI 1YONA 3F0TA 3JQ9C 5HM6A 2GCGA 3ZE2B 1QU2A 2GBLA 1OBOA 2H0QA 4D9EA 3C1OA 2AXPA 5G0SA 3RVPA 1TO6A 1YS9A 3JAWA 3ICEA 1HLDA 3H99A 3ADBA 1XA4A 3DEIA 2A58A 4BX3A 1E3QA 1WW2A 1QB8A 2PXAA 2VOJA 1QIFA 3GWZA 3H18A 3FCAA 3NTRA 3E1SA 4BWFB 4NG5A 2EQBA 5BN3B 1NXWA 4DDKA 1CB0A 2A5JA 3DWIA 3G5AA 2O54A 1UQUA 1VJRA 2R8BA 2XNSA 3CUSA 3OU7A 1MA0A 2RGYA 3C43A 5DHSA 4JB2A 4DIFA 2FZCA 5AW8A 4OJYA 3RQIA 5HZHA 5C8YA 1RJFA 2NV6A 4B3FX 4DBLE 3C3EA 2A9VA 4L2IA 3W8DA 1WE2A 1QAQA 3FF4A 4D9NA 2P8JA 1KY3A 2CLFB 2P6NA 4D4MA 4PNEA 3MOSA 2VXBA 1S1CA 1OFIA 1QF7A 2W2NA 3PC4A 3RRYA 2BHLA 3PNPA 1UAAA 4E21A 3F3SA 3GMIA 1MTZA 2VDQB 4XD2A 3AFOA 3T7SA 1OB5A 1CUVA 4KGXA 1VZ2A 1JR3A 4NQRA 4TYWA 1J25A 1RMTA 1V48A 4C7JA 1EVKA 1W30A 3FYUC 1B43A 5BSVA 2WAAA 1CDZA 1NN0A 1RZ3A 3A4LA 3II6X 4HFJA 4KNVA 2R85A 4TTSA 4V03A 1ZICA 5G3ZA 2C4VA 5A0FA 3SHFA 2MSEB 2BZGA 4CE6A 4KPYA 3GBVA 4X00A 1X13A 1EHYA 2QR5A 1OKKD 4B48A 5KC8A 4OHKA 1KFKB 3AVXA 1SURA 3DP7A 3VNRA 3TB4A 3AF1A 2LKDA 5EJGA 2PRKA 4C87A 1E5TA 1OWPA 2WSBA 2C20A 2OGTA 2I9KA 5D00A 4DQKA 4G0XA 1T9CA 4BCBA 5K3DA 3NIGB 3AFGA 4BPRA 1K97A 1QIGA 3AB3A 4FMDF 4MUKA 1O5TA 1QXSA 4G0VA 3WLOA 4CRWB 3THYB 3CRVA 3HY3A 4QVIA 1EQUA 4GI7A 5JG7A 3USES 3AQIA 4GOJA 5TPWB 3Q7TA 4KX3A 4QJ3A 3ITNA 3IAM6 3I53A 3EXHB 3IULA 2A78A 2GMWA 2IYEA 3U4HA 3TNLA 2PRYA 4Q19A 3RR2A 4PRZA 4HQ6A 4YP9A 1CUHA 1SCIA 2FPMA 3ZHYA 2WD7A 1U0LA 5CT6A 5DMHA 3U3RA 4REOA 4YRLA 1SXHA 3WSTA 4D5GA 4KLRA 2NTJA 1MFPA 3PHCA 4JYMA 1JILA 1ZQ9A 2L82A 4S1TA 3V3KA 3ZW8A 1NRWA 3L84A 4IIEA 2GZMA 4QOHA 4UASA 1KAMA 3CY6A 3FPSA 3SYMA 4E5KA 4ALIA 1O87A 4I1YA 2HBQA 3UH1A 5BVHB 1Z6ZA 1P5FA 2O2ZA 4LZWA 4QLOA 2QOEA 5FUMA 4B2IA 3N7UA 4JVNA 2OCAA 4RHYA 4GIBA 1SVLA 3W1EA 5THXA 1KY2A 3BA1A 3OEED 2QM0A 2QZPA 4I4IA 4MV3A 3UMRA 4DIDA 1PT8A 1QX3A 3NWPA 2UZAA 3W8EA 1NX9A 2PANA 1MJGM 2IYTA 5I7AA 3ZS8A 1RWKA 1C7ZA 2UUAB 4GYYA 2GDZA 2DAPA 3HY4A 4FCCA 5D1HA 2ZIWB 3G2NA 1IXSB 1MJ5A 3KTFA 1C9MA 3LYHA 1SOAA 2CMKA 4Y9TA 2NZYA 3OF5A 2PAAA 2QV7A 4L6CA 1X70A 2V9ZA 1L7PA 1IJBA 1P1HA 1VYHA 2NO4A 3D3QA 4REQB 1MQ9A 4FEEA 5AI8A 5KTYA 5J23A 3RDPA 1YJ5A 4ZVMA 4K7JA 1SHJA 4QUHA 2CXHA 2UXBB 5ITSA 1Q5PA 2A0FA 3HO8A 3JWPA 4MKRA 3ESAA 4CEIA 1L5MA 1BJKA 1IULA 1UANA 1H6AA 1T9GS 4HFRA 5ANRB 4DBVO 4RTPA 1E7YA 1G291 3GV0A 1U63A 1KQNA 1ZD9A 4QATA 4MLDA 4AP6A 5CXXA 3S68A 5AW1A 4CEHA 4NATA 3JS5A 1Y4ZA 3LD9A 1P0CA 4ZTZB 1U8UA 4ZCMA 1MQAA 1JQ3A 1U2DA 1R5BA 2AG1A 4GQAA 1M10A 1MABA 3SF8A 1Z5OA 1G6HA 3KB8A 1GNLA 3WGUA 3OZVA 4EDFA 3K1TA 3SXJA 1GKYA 1VIYA 1V5FA 2R44A 3I3OA 3C70A 5KDOA 2PQ0A 2OMKA 2HZBA 3CLUC 2PYIA 1YJQA 3UB2A 1E6CA 1QJ4A 3E2MA 5IUJC 2ZSAA 3TDKA 1RC0A 2J85A 4KXUA 3TLKA 3WLLA 1XZ8A 5TDHA 3WAJA 2H4HA 2HLNA 1DMSA 3AK4A 1XFAA 2R00A 1KZ6A 1A2BA 2WJVA 3ZGYA 2XGMA 3ZI7A 1IWOA 1N6HA 1BH2A 2RB5A 2HMVA 1PWZA 3D1JA 3VDXA 1M0WA 2NXJA 4C6TA 3D8BA 1YZUA 3CH4B 4D8XA 5IKOA 3FOBA 3EEOA 1JA0A 1V3VA 2JFHA 4TS9A 2FPIB 2VRBA 3K70B 2EHDA 2XNHA 1O6BA 3CGGA 1DEXA 3GEIA 3GPIA 4N7JA 1EVZA 3OT1B 4L9WA 1WY5A 2H29A 5DNCA 4RMIA 2PYZA 3OO1A 1QS0B 1KDZA 3WIDA 3ITEA 1FL9A 3H2SA 5CT9A 1H05A 1HWYA 1NW6A 3BGWA 1YR7A 3AZPA 3K1YA 5AI0A 5GONA 3V2IA 2QGFA 5F5XA 1NQTA 3T3GA 1RKQA 2Z09A 5JSHA 2GYUA 2JLYA 3G0HA 1DWOA 1P9WA 3CUVA 5K03A 1X3SA 4UBJA 3HCRA 4P81A 3S1AB 2NZWA 5JNTA 1FMCA 3ZBPA 4FOOA 3TD9A 4EM6A 2QJRA 4ZCQA 1G5TA 4ZPJA 5EZ6B 3SNKA 2EX0A 3RS4A 5CBPA 1UPCA 3BXOA 1V1JA 1W5AA 2G5TA 5FRDA 1N1DA 1RXSA 2NZ2A 3Q7PA 2VZEA 4K28A 4DMRA 1NASA 2ZE6A 4AMVA 3TZQA 2MINB 4W1RA 1Z8HA 4A73A 3I58A 2KHZA 1XTRA 2P5YA 3UJ7A 4QYXA 2ILVA 1AKMA 5JNRA 7ADHA 1VHJA 3EVCA 4PRKA 1YC5A 2TMYA 4RAOA 4D3XA 1QH9A 3GEGA 4MI3A 4F6CA 5K0GA 4KN8A 5I7SA 2F1KA 3FSJX 1T8TA 1Y8ZA 4MTLA 1N3IA 3HVHA 1NUAA 4Q4AA 2W4IA 5IUKC 4K6KA 3IT3A 3SC3A 3B9BA 3LP8A 1HYQA 1GAQA 2VHYA 5CB8A 1ZSVA 1M76A 3OM1A 3DOIA 4EGCB 2QHXA 1EWKA 1U7UA 2AF3C 3HA7A 1B6GA 1C3VA 5FBKA 3R4VA 1BDJA 2PRJA 3D8UA 2XMGA 3PPIA 1Y4UA 4Q1AA 4Z9XA 1P2GA 4EX7A 3DT9A 3EOBI 1FTWA 2AW5A 2HOQA 3EWIA 3FNFA 3IERA 1ORRA 3ABRB 4MWCA 4X3PA 4CV2A 1WWKA 4DL9A 1UAGA 2O8BA 2A67A 5JXGA 2D8MA 2F9MA 3LO5A 4KK3A 1VJ5A 3R9KA 4KE7A 4B74A 3BJMA 3WISA 5D3QA 3BH6A 2VDKB 4UCXA 5ICFA 3TPFA 4FNOA 1OVGA 3IKLA 4L27A 2O6HA 1PJ8A 2JK0A 1FK8A 2CXOA 3W3AD 4OBXA 2PDAA 4NI5A 3IESA 2I2CA 3S7TA 2KB0A 4INOA 4RMNA 2BBWA 4QA9A 1FFWA 1EI9A 3Q3IA 4IDOA 4KLCA 1GKIA 2O3JA 1I2CA 4WOKA 3WL3A 1FNCA 1N7HA 1TTPB 2PKYX 4M9XA 2V1UA 4XSGA 3BCSA 5CM9C 2GD0A 1I3CA 2O8VA 3N0VA 4QSHA 1GTL1 4YV0A 4KWIA 2OO5C 1HNWB 1TOAA 4HX5A 4HPJB 2X6RA 1A9SA 1SA0A 1V1MA 4EKYA 1W96A 3NPAA 4YGXB 2IS4A 5K8JB 1PR5A 2EYQA 3CEJA 3IAHA 3NEAA 4B7CA 3RTBA 2O14A 1M7HA 3S81A 2CN1A 5JNSA 4N7BA 3GJTA 3M4ZA 3A1FA 4TWIA 2H07A 4JLUA 3KR2A 3IR6A 1R8YA 1E8NA 2IHVA 2ZJ8A 3GP3A 3GRYA 4G0QA 3WLIA 3ZHOA 1FVHA 4L08A 3KFVA 5LB4A 2QG9A 2Y68A 4S1PA 3EQ7A 2YQ5A 5EP3A 1X7DA 2WBLC 4C89A 3PYXA 3ADKA 4II3A 1R9GA 3HBJA 4RD6A 3VJMA 3MTAA 4HR7A 2E1RA 3MW8A 1P77A 3VPFA 3RG2A 3A06A 1Q7EA 4NEGA 3H9GA 2ONYA 5DMXA 4B0OA 2Y05A 4FGJA 4NYMR 5HBRA 4B2LA 2FX3A 3OE7A 2VHVA 2NZUG 2F8TA 2VF4X 3H86A 1E6MA 2HT6A 4KRGA 3QEAZ 4ZOCA 5INTA 2AEMA 1HMPA 2OBMA 2RHTA 4M0LA 4QBKA 4Q9NA 2EKBA 4U6NA 3TIFA 3W77A 4DNXA 4N41A 1K3TA 1EFUA 2C77A 3OJLA 2JFGA 4HWPA 3BMCB 4IKEA 3VVBA 4ACBA 4DTCA 1UJ4A 2VQ6A 3EQZA 4RO0A 1URPA 5H70A 2QK4A 2QYHA 3DHVA 3D0OA 1L4KA 1UBJS 2E4AA 1Z07A 3HCOA 4FI3C 4GUDA 4TV8A 1XZDA 5IDQA 4DSNA 4LTMA 3DFFA 5IKEA 5FA6A 2IX9A 3LDAA 2GFIA 4JJ4A 4F3NA 3MGBA 3T1NA 2TMGA 4ZIRB 1V4BA 2X5JO 1LU9A 1S0UA 1QRSA 2UYCA 3MTJA 2PA0A 4O0LA 2P2LA 3RU9A 4RTLA 4OA5A 3O3NB 5EJ9A 3G2OA 2VUHB 4OFBA 1MNAA 2Y0CA 3ACDA 3QHAA 1NLUA 3A1DA 4YXFA 3IUNA 4MAMA 1G6KA 4B8ZA 1PR4A 1WD7A 2C2ZA 3KAQA 1IUOA 2FFRA 4FB5A 2FEPA 3IUSA 1GTG1 2EF0A 3WHPA 1JJFA 1HYHA 5AK0A 4EKNB 3OWHA 2FH5B 4MV5A 3C24A 4R3WA 3UC9A 5B12A 1JSZA 2V6MA 3FXAA 1VG9B 2AJDA 4YMIA 2BH2A 1QMGA 3EVFA 2HTEA 3OO0A 1M7BA 2FFAA 3PHHA 1D2MA 1Z28A 4R2JA 2VWPA 3ROKA 3EISA 4HN4B 4U5XA 5FBWB 4IHJB 4H3VA 3AG6A 2BM0A 2CHUA 4Y18A 1XJCA 3GLGA 1WLSA 4U6SA 1L1RA 4HGQA 1MR3F 1EKXA 1L5LA 2FFBA 4UUNA 2ONJA 3C3BA 2IYRA 3PXGA 3V1TC 4ZHQF 5KYKA 2PLWA 4MYTA 1W8IA 1YRLA 2D1FA 4TLDA 4MEBA 5JH7B 1BKDR 1Q6ZA 2QKYA 5HGXA 2FRXA 2SICE 3D8TA 5IPFA 3I1JA 2R1ZA 5GGXA 3BWDD 1U0RA 2RGUA 3IVMA 2C7PA 3A6PC 1TGVA 4P4LA 3D2LA 1SCDA 1R8XA 3F7NA 3OIDA 1L5RA 1VBMA 3F4BA 5HBGA 2VT3A 3VU0A 1U4NA 4KE6A 4C5AA 3TNFA 3UIEA 3CJTA 1VMIA 4L4UA 5AT1A 5CIQA 2J5RA 3ZIDA 2ZZKA 1MIHA 4RHEA 4LVNA 2I80A 1RXEA 3ORSA 4Z4HA 2VBIA 4R1PA 5HEKA 3ONVA 1VJDA 4FN4A 1RQLA 4Z49A 1QRTA 1T26A 2VI5A 3FPJA 4K3VA 5DWDA 4CM1A 4EA6A 3ETEA 5A6SB 1XEXA 4HGOA 2Q1TA 3I05A 5I4BA 4P98A 5L3SA 3UGQA 3ZK9A 2WDZA 4EY7A 1J4AA 1DKOA 1ZCFA 4P4NA 3BKXA 2HJVA 1RHKA 1SN7A 4KGDA 4YO8A 3RHZA 1PR2A 1E0AA 1DAOA 2GYVA 3EK2A 2NU8A 1I0LA 2D0DA 1GPKA 2GHIA 1XALA 2Q8PA 1GUDA 3DEKA 3CLUD 3KRTA 4O2BF 5ALPA 3AVQA 4OP3A 5CVJA 1VB3A 3DW1X 4HO1X 4PQRA 1ZZGA 1ZK3A 3RUAA 1OSNA 3V1MA 1FFGA 1YA4A 1L7RA 5E9WA 4Q12A 1CUIA 3K1ZA 1QE0A 2QRNA 5F52A 5BW4A 1O8CA 5LZ9A 2E55A 2Y9PB 4G65A 4HNAB 4P3KA 3T38A 2HUPA 4DLYA 3SXUB 1XZJA 3VH1A 1Z2OX 4JEIA 3CSDA 4J1TA 4Q24A 4EECA 3B52X 1QQ7A 4EA7A 1I7LA 1ND6A 1P39A 3R6LA 4QFCA 4E3WA 1CUAA 3M3HA 3W3AA 1C8KA 1GPMA 2OBXA 1NBOA 1LRJA 4YUAA 4KFUA 3K9NA 2WSLA 4YRNA 4QDOA 1ESCA 4GLFA 2RJ3A 1X92A 1DJOA 1GU0A 1EEHA 3HN6A 3JQ9A 2N46A 4XIIA 3RUDA 1P19A 2NPFA 2DSTA 2Z8ZA 1XRJA 1E63A 5EIBD 3EBLA 1POXA 4FCWA 4R51A 2P6UA 2XUDA 2PMCA 4QG7A 5EMJA 4GR5A 1P5HA 3KQWA 3MXTA 2QMOA 4INAA 2C9YA 1KNQA 2W2MA 1P3JA 3VAZA 3EDRA 3CRW1 3T4PA 1YRQA 1JAYA 4J16C 2XIQA 4L4RA 4OMUA 3WLJA 2PUTA 3EXFB 1GY8A 2XMQA 3Q2OA 3G5MA 4RPKA 4K0RA 3RFTA 3WGVA 2AQ8A 2B6HA 4TSFD 1GPWB 4MWOA 1FJHA 5CTAA 1EK6A 5EMKA 1LB1B 3ZGXA 1SQ5A 1KIFA 1F5SA 4C4PA 3LU1A 5LQNA 1AMOA 5ICMA 2JGKA 3Q87B 4NYMQ 4EF5A 4EGJA 2JIMA 1R5OA 1XVUA 3ONFA 3WIVA 4WY5A 4C4RA 4CLOA 1WPGA 2ZSIA 3NCHA 1U9ZA 1NJ8A 2IS1A 4A8TA 2QW0X 4AG5A 3Q7IA 3TTVA 3D2AA 3FYUA 3GMTA 3IJEB 1SCNE 121PA 1IB0A 2A2ZA 1E2HA 2JLVA 2VJYA 3DBRA 3AT1A 5K01A 1BVHA 1GKKA 1UDAA 1JIVA 2HF8A 4P83A 1LX6A 4L3OA 2W8BB 1ESNA 5ADHA 2OG2A 3QUSA 1F4VA 2H4YA 1ODTC 1QHHB 3ODPA 1OGYA 4HF7A 4MVWA 4IUYA 2IELA 3FPGA 2R751 1Y1LA 1EK1A 3M4NA 4HUQB 3UT5A 5F9HA 2QGZA 5MN5A 721PA 1U2TA 4IOKA 1QTNA 4XCQA 4ZCIA 2BUAA 2YJNA 3HZOA 4JYPA 5ETJA 2GO1A 3PDIB 4HDKA 3HP7A 4Q15A 1ULZA 1OWOA 3ANNA 2JGRA 1Q0UA 2BMWA 4KB5A 2R6R1 4H1VA 4L4XA 1KSGA 3TI7A 1F8YA 2XDQA 2QG6A 1Z7GA 3OE1A 3ESZA 2VJMA 4KSYA 2PD4A 4P3XA 4POOA 4P6VF 5EWMA 4G4IA 4H77A 2GESA 4Q4HA 2FX2A 1HYGA 4K3UA 4V39A 4X7PA 3S2FA 4CEJA 5AI9A 1QVZA 3R5HA 3MAAC 3ENKA 2XODA 4AP5A 1VG1A 4A6EA 1Q91A 2H4FA 4WK2B 2P9TA 1J24A 2P5TB 1Z34A 4C07A 1IQ0A 2ARKA 3IDOA 5ARBA 2OWDA 1LH0A 2ZULA 3BE6A 3AUYA 4O1MA 3W5AA 1B26A 3PCTA 2O7QA 2Z3ZA 2JEZA 2VXCA 3CLHA 3DOCA 2WJ6A 1W19A 4CFZA 5FOSA 1FZTA 5C32A 1XCGB 4F71A 4QUGA 3IVAA 3BB3A 3LL4A 1EDBA 4TS1A 3FOEC 2WKSA 4ZK2A 2H4WA 3KPWA 4JQSA 4XOUA 4PX5A 2OA0A 4QM6A 4GWGA 5DNAA 1F1JA 5B55A 1MD9A 3AVUA 3E2IA 4HLNA 4HD8A 3UAYA 1RKVA 1AA6A 4LOKA 4N65A 1L5VA 2PUHA 3U4QA 5FV7A 4UARA 5EGSA 1BRTA 3UHOA 4AO8A 4PN7A 3O2JA 3R0ZA 1E1LA 5I4IA 1L4GA 4M55A 2Y77A 3V8EA 3ZW7A 1YFKA 2W6NA 3KOYA 3DDNA 3LG2A 3NYRA 2VR1A 3EAGA 3IS3A 3ON5A 3RRJA 4Q21A 3PFCA 1LSSA 4DDUA 5K20A 4JUIA 2W93A 3M83A 2OGZA 1HZZC 2UZ1B 4OKSA 2KJQA 5FWAA 1Z56C 2OQ2A 4I9FA 1NJ2A 3PA8A 4XEHA 1B7GO 4RTQA 5DX1A 3GJ6A 2JFBA 3O82A 2Z6QA 4C29A 2XOEA 5K2MA 1GFZA 1ZNQO 2P2GA 4Q9IA 4N0PA 1DRJA 3TOZA 2AD5A 3ESYA 1UBCA 2PIDA 1JLRA 1J9GA 4GOMD 4QU9A 4JH0A 2BGRA 2OOSA 4KYTA 3FUUA 4PHHA 3H13A 2HTFA 2JVKA 3D3KA 1YWGO 3NMUF 1XDGA 2O2EA 5A5VA 3E8XA 2AOXA 4G25A 5CT5A 3BHJA 3DZDA 5A7HA 3SDZA 1Z33A 1R4ZA 1U31A 1UFRA 1FS6A 3E84A 4RF3A 3TM5A 8GPBA 1VE5A 5IN4A 1GQOA 2HSJA 2NSJA 3PTAA 4HP8A 2CKDA 3IIMA 2WPDD 2X5OA 2AEEA 2EX1A 3M81A 2C8JA 4XQCA 3DKVA 1XJ5A 2NZJA 4LMRA 1A8QA 2FR8C 4G1FA 1E77A 1CZOA 1AB6A 1UBNA 1VSTA 2ONKA 3DD5A 3N3AC 4U2DA 1R1DA 9ABPA 1OPXA 1S3SA 2PWYA 1C1XA 4ZD6A 5TY0A 1VCOA 5EZSA 5BV7A 1RMQA 3GCGA 2WJZB 2GUGA 3GLHE 4CM4B 4CVNA 4D99A 2K7FA 1ST2A 1CZRA 2HF2A 2I2BA 1QGOA 1KSJA 3I5MA 4MIKA 4UU1A 4YJGB 1ZJ4A 3VYVA 2C1XA 4TWBA 3OI7A 4NMXB 5K0FA 3G9XA 1MGPA 1TJ5A 2AG8A 3H1GA 4FFPA 5LCXA 1U2RA 2OYCA 1OAOC 1BC5A 2FPPA 3WYGA 1PG5A 4RZSA 2WT4A 2VKTA 4NZYA 1OFHA 2H48A 1YL5A 3NTLA 3WFZA 3G5UA 3CF2A 4Q1DA 1FRNA 1X1QA 3QE4A 4X6YA 1EZZA 4X7RA 3PNBA 4PPQA 4LTNA 1FUKA 2JBAA 4Q3BA 3FTPA 4QDTA 4R2XA 5EJ6A 1L7AA 5IM5A 4A0GA 1XE3A 1NXSA 2QMHA 3FNIA 3FBWA 2ZYRA 4BN4A 3O91A 3TZLA 5EWJA 1WQ1R 3JD0A 1Y42X 1NW9B 4OA8A 4FE4A 1NW4A 1AK9A 2X5NA 3LLCA 2VUIB 1LC3A 3O2NA 4G63A 4NJOA 3UH0A 2HBYA 4ZVNA 3WA7A 1L4MA 1SUAA 3PPWA 3V2HA 3FY4A 1TZMA 2BI7A 4A1FA 4PCLA 2UVPA 1X8LA 3HKDA 4GC9A 4AKEA 3ZZ0A 3V4PB 1HGXA 4UNPA 2QUHA 4DWVA 5J5CA 4U39A 1G7TA 4YBRA 4CI0B 2PUJA 4WKNA 4Q4JB 1WOMA 3C6XA 5EUBA 2I55A 3EEYA 5JJIA 2HO5A 3UHFA 4XUDA 3N2IA 4YMVA 2AMLA 4N40A 2D5BA 5MDHA 3TTXA 2DE0X 3EXAA 3HLYA 2PMWB 3A0UA 3K73O 5E4JA 2HWYA 1Q1GA 3HXKA 4MIEA 3VV2A 1SG0A 4BATA 1W88B 1R00A 5BW5A 3G49A 5KPJA 1N5DA 2WTNA 2BR5A 4IUCS 4XSHA 1PKXA 2BEWA 1IY1A 4G5GA 4OMFG 1IB6A 2BF4A 1O89A 1WCIB 4Q6BA 2NVUA 4W5TA 1Q1NA 4JLVA 4MEJA 5JPDA 1GU1A 1W87A 3OQJA 4XPIA 1GEEA 2J07A 2ZI6A 3EQ2A 4IIJB 1E6WA 2I4TA 3SS7X 4C78A 4EO7A 5IXJA 1L7QA 5DN6D 5IBQA 2EGHA 2QVCA 4OGWA 4ZCSA 3R6GA 3I0MA 1BXZA 1N5IA 1T4CB 2Q6KA 2X3FA 3HXTA 3MCZA 5LYJA 2LE0A 3LL7A 1ECGA 1DT5A 1RBQA 4Q7EA 4TQGA 4H6XA 4JLWA 4RD2A 1EBFA 5AFSA 2A0WA 1HQKA 2B20A 4A8JA 2X6TA 1NE2A 3RAGA 4PSUA 4P0QB 1CUZA 3HH8A 3L8GA 3K9LA 1PW7A 2XY4A 4ALKA 5FAXA 1L7NA 1C3OA 1L7XA 1SXJB 2JJMA 4FJ2A 4M6WA 3T1OA 3B8EA 2WW8A 4H08A 2YZ2A 4RA9B 2IV3A 3WBFA 5B7QA 3UMVA 1RJ9B 4UVIA 1YJXA 3SNHA 1Z8FA 3BDVA 4K6MA 4KSCA 5FB3A 3TTYA 1W76A 3A4MA 3CJRA 4O5OA 4L8YA 4WECA 1EWQA 3TOXA 3D6NB 4LZNA 2FUEA 4ZYVA 2Q5EA 1V9SA 3DKPA 4KKVA 4KQJA 3VDRA 2WSIA 1XN4A 1KXJA 3BWMA 1NBME 3C39A 1X3LA 3CVXA 1TK3A 1VSBA 2BCJQ 2WHYA 4RLSA 4UM7A 4NCBA 4PXSA 3VU1A 4FHCA 4S2EA 5IDXA 2IX3A 2HR1A 4FVTA 1U6JA 1NVBA 1GARA 1NVWQ 1BS9A 2E87A 3L1KA 1DADA 4JZKA 2JHGA 4LOAA 4WESB 5EINA 3ER9A 1IN7A 1Y98A 1N34B 4HHEA 1PU2A 4DC1A 1FP6A 3AY6A 3HB0A 1RLMA 2FPOA 2A9OA 4DMHA 4RCYA 2Y2UA 4PZEA 2DX7A 3WTCA 4GPD1 1HOXA 3ZI4A 3OBBA 4QDKA 2XITA 3KU1A 2YY5A 4G4JA 4PZ9A 3U7FB 3GIDA 4YWHA 1Q2XA 2VHWA 1L0BA 3B89A 3NUZA 3S0JA 4OEHA 3PWSA 4L9RA 4LY3A 1PWEA 1CJMA 2WWFA 3MELA 1P9LA 4M9UA 2OXTA 4OHXA 2ID8A 4GM1A 3IQWA 3HWSA 3NBUA 4GOOD 3OZXA 1DRVA 3B6ZA 3TNJA 3CH6A 3OMLA 3GT0A 2QLJA 2G83A 2GPNA 1COWD 1MPTA 1QWOA 1Z18A 2CD7A 3PHJA 4NMWA 5GGYA 5BV8A 3F7MA 4R2WA 1NULA 2GLUA 3MFYA 4E09A 3M6AA 621PA 1N5OX 2Z8YA 5IJ9B 4AQ7A 4XGKA 1SBNE 4HLUC 4U3JB 2Y2VA 1YB7A 1NAHA 5ERGB 3GVXA 1GADO 4Q4LA 3EQ6A 3KZXA 5DNVA 2ZT6A 5DM0A 5AIAA 3STTA 2CLSA 2QRLA 3MG9A 2ZIZA 3ILYA 2WPDA 3B7WA 4RQUA 4GOXA 1BVUA 3EG9A 2YH2A 3CB4A 3OF3A 3FIJA 2B5OA 3ZH9B 4Z54A 1O6ZA 1P4JA 5JXJA 5B3LA 2ZTVA 5DB4A 4XM1A 3UPDA 3C48A 3DW3X 2JK1A 1JSRA 3A14A 2Q2WA 4LF6B 1YAHA 3BTUA 4B4VA 3TG8A 4KE9A 3I8SA 4O2AA 2FN8A 3ZLUA 2WZBA 4ID3A 4DLRA 3BRWD 3KT6A 2J3EA 1AK1A 4OXKA 4YRZA 3K05A 1WB5A 3RRXA 4S24A 3W3AH 1GDHA 4YS6A 1KYIA 1SVWA 3DR5A 4RH1A 3UKDA 1DXHA 5I8PA 1PYDA 3DLIA 4C2BA 2CZQA 4LQCA 1WCYA 4BMVA 4H18A 1D2CA 1E6EA 2R86A 5M3BA 3QF4B 3QSYA 4EB6B 3P2OA 4U5QA 3I72A 4MW6A 1T0UA 5DE3A 5KC9A 4DLNA 5KTPA 4RGYA 1XF9A 4M1KA 2OAQ1 3A3PA 1C9DB 3CPSA 3AH8A 1ZK1A 3EIEA 1RZRD 3I34X 4OHVA 1GRNA 4UM9B 1YOVA 1OH5A 4J7AA 5JD6A 4JELA 3L1JA 1MPXA 1D4AA 4C20A 1G5RA 1KO4A 2C42A 2VJLA 4JYCA 5P8WA 4GPTA 1GL7A 1SZJG 4TGLA 3VKHA 2OHXA 5M2QA 3EIUA 4HTFB 1ZUNB 4QGAA 2QBYA 2WYUA 1GRRA 2HMSA 3CPHA 3EOAI 1N9KA 4FDTA 2MOKA 1N2JA 3AR9A 1CLEA 5IC5A 3L77A 4H31A 4NCJA 1I4EB 3VKFA 1GU7A 2EKLA 2B35A 3DE5X 3OF2A 4YRGA 1W36B 4G24A 1K4YA 1P18A 2ZU6A 3EW7A 4IR7A 1SG6A 2BHSA 2IU3A 1T91A 3MJ4A 1UFQA 3UXMA 4GAEA 2ZZMA 4PYMA 5A5EA 1NPDA 2FK7A 4C7BA 3ZGZA 5AKIA 1LQ2A 3H1EA 3P9KA 3P9PA 3WKCA 1XUOA 4PRLA 1H4TA 1KRHA 1XWFA 1N8SA 2FXIA 3BIFA 3MJEA 4MRAA 1W5EA 1ZDMA 3T9FA 1QPZA 2OG1A 3ZHCA 2YIMA 2RKOA 4PYRA 3UAZA 3UOWA 3WAGA 2B5VA 4AZ3A 3PF9A 1CRQA 3VNSA 5BUQA 3UKJA 1Y1KE 1VC2A 1Y9DA 1T4GA 5A3RA 1G7CA 5DN6A 3JQ7B 3R7SA 3A4IA 1PYOA 2XLBA 3IMFA 4W7IA 3Q0IA 1Z5ZA 4I81A 1IM2A 3M8KA 3ZOKA 1Q19A 3GDFA 1OFTA 4TTVA 2GRUA 1QRDA 2B98A 1JDZA 1E4YA 2ZG6A 1P0QA 1R8QA 3K9BA 1PV2A 4I50A 4JOQA 2QTCA 1SVKA 4AFNA 1Z39A 2O7RA 2HV8A 1OTYA 3C3PA 4GT1A 4KWEA 4B3JA 4DYVA 2VHTA 4RPHA 4P36A 4C3OB 1DKPA 1QSGA 2QVZX 1P7PA 2P78A 3PXXA 1EH5A 2ZQZA 2FW8A 4INJA 1NQUA 4FX5A 4G5SA 4M0FA 5KOYA 2BM1A 3I6QA 3VSBA 5ALGA 2IU0A 2WUVA 4IOMA 2PKQO 2L18A 2RCYA 4PG6A 4EPRA 4W5QA 1U0JA 3BRSA 4PX2A 1IIBA 4L4ZA 1KJJA 5LKAA 1KF0A 1N2CB 4YIHA 4ON9A 3OECA 3FMGA 4RQTA 3OQIA 3T3NA 1WBJB 2P3SA 1NQ5A 5LBUA 3LCRA 3TQFA 2IYZA 3PJEA 3EZ6A 5KNCA 4DW8A 1DWQA 5BQOA 2XV1A 4UFOA 4H6PA 5DBGA 3URKA 2DHDA 3PB3A 4J4BA 4X3CA 4AP9A 4AKHA 1WMAA 1A9OA 5H02A 3D7KA 3KQPA 4YMTA 2YW2A 1YQXA 5K0TA 4KODA 4O4IA 2A1IA 2OFOA 1I1HA 4X60A 1V95A 3LRXA 1MJHA 5TS2A 1UMBB 5JSKA 2A9JA 4ZDIA 5D01A 3HACA 1DBRA 2FQQA 4ZAZA 1QO0D 1SCQA 4WBSA 4BRSA 1T8SA 5ILQA 3TDMA 4MYSA 2VQDA 3HDGA 1ODLA 5IVHA 2EW2A 3WJ1A 3GFFA 2ZYIA 3A2NA 4ZAVA 1JAZA 2O8EA 3CQ9A 5FR1A 1C30A 1COWA 3EIQA 4KG7A 2Q4BA 4ZTBA 1R15A 5A05A 3A6EA 3B6IA 4R9UC 1YS7A 3CG0A 2BMDA 4LC9A 5A5GA 3AUTA 2P9HA 3VOAA 1C81A 3JWEA 4BE4A 3GGGA 3KZOA 1GGKA 1XD2B 4EG1A 3F6EX 3QPVA 3S8MA 3WLKX 5A5FA 5B6JA 4FDLA 2ZUFA 1XQ1A 4YI5A 2XCRB 2W6JD 2YV3A 4A4DA 1I51A 2EEZA 2C78A 1CDOA 1WXXA 3LQ2A 4RDIA 3MD0A 4UQOA 1G4HA 2TYSB 2EYUA 3G0IA 4JL6A 3VM6A 2HSGA 4I99A 4YP7A 3HXPA 3LBAA 3OC0A 3KVVA 4WCFC 2JANA 5E1DA 2NU7B 2GEBA 4AZ0B 2WD7B 3KB2A 3RANA 1QGYA 2VRWA 4U0JA 2K7ZA 3T3EA 1W4CA 1I8TA 3BRWA 4YPVA 5ALSA 4ATNA 1G3UA 1N4DA 4KPUA 3AEQB 4B46A 3IUQA 1FDVA 1KZ7B 3EC2A 5E0KB 3ES9A 1RIIA 4DCPA 4EHKA 4BXOB 1TT5A 2JB9A 1VCNA 3FZQA 3HM2A 3SBXA 3C6BA 1Y5NA 1YHNA 2PGLA 3O31A 3OIGA 2I7DA 3CW8X 1QRAA 3GD5A 3EC1A 3GZJA 1HPLA 4FUQA 4JR0A 4BFXA 1JVBA 4UU0A 5A4JA 3PI6A 4HWOA 1PEYA 1RWOA 1P7ZA 2CB9A 5LA6B 2GXQA 3VYUB 3G23A 3K9QO 5IT0A 1UPXA 1P8JA 3JWGA 2RHCA 4ZAWA 3GO4A 4Q9DA 3W2IA 3PZRA 5H4HA 4KDRA 3AI7A 3V1NA 1H85A 4ZI7A 2G9RA 3JYHA 3PXUA 4OSPA 4CIYA 5J2UA 1RZRA 1RAAA 4XAQA 5F2OA 2GDJA 4IP0A 2CE7A 3QIVA 5LLTA 1IQUA 1Y7TA 3BWVA 3FM9A 5IJXA 3V4OA 2ORYA 5B37A 3HRKA 5A4FS 4CKYA 5LZ8A 1TMGE 3EGXA 2PRIA 4Q9KA 5BVGB 4L3VA 4RKWA 1G9TA 4OB8A 2J6CA 4C0LA 2EWVA 3EHEA 4PLFA 4HB2A 1O0SA 1BX0A 5LLSA 4TUYA 1HZZA 1YBFA 4WA7A 3GARA 3QHPA 1P5RA 4E6PA 3TSOA 1MFZA 5T64A 4A1OA 2FETA 4GD3Q 4A10A 4LYAA 3WXBA 3H3JA 5GV7A 2ECFA 3PPYA 4KGZA 2PBLA 5HFJA 2A92A 4LUCA 1WSAA 4JC4A 4M9SA 2J41A 2VJNA 1LNQA 1HV8A 1B8PA 3BMXA 3K1AA 4FSHA 1TO2E 1MABB 4S0XA 4IXTA 3V3TA 3C1UA 3WBJA 4BNFA 1M1NB 1D9XA 2PZMA 5AW3A 3E8SA 3ONNA 5EJ8A 2G82A 2VK4A 2ZETA 1Q44A 4UE6A 1RAGA 2OPBA 5IKMA 3NGXA 3DUFA 5HXAA 3TVTA 3BYZA 1ZESA 1JI3A 4DR2B 5U1PA 4EUHA 1Z36A 1V8FA 2I4NA 3UNXA 3QE0A 4R1LA 2FR8A 2WB2A 2BKAA 2DBVO 4L72A 1UODA 1YIAA 3FGPA 4MUJA 3PFBA 3DBOB 4NAVA 5EKTA 5IH3A 4BVFA 5ALVA 4YHHB 5IDVA 4QGSA 5DHAA 4O3FA 1W2WB 3I9KA 4NAHA 2YL2A 5ER6A 1GOTA 5IDWA 2GKSA 1H1TA 1ZFNA 4OKNA 2VUSA 3AFIA 3ZLTA 1KJ8A 1IK6A 1X7HA 4Y98A 4D43A 1Z6QA 1GSIA 3Q15C 2NVWA 4J0JA 4LK2A 4R40A 1YR8A 1ML4A 2I6XA 2BI8A 4I5EA 1A5TA 1OAOA 1ZA1A 3QOYA 1VE7A 1UDRA 1UXIA 2HADA 3GHHA 4KXVA 3K8YA 5KCZA 3EGOA 1ZR4A 2ZRDA 4K9KA 4RDXA 1V4NA 4KQ9A 3TTUA 3BGDA 4URHA 2BFCB 3JCZA 1W1IA 2JW5A 1ORWA 1P44A 3IP6A 4QXOA 3WNDA 1HRDA 3VUFA 2AXNA 2ZVJA 5EXSA 3F9CA 1B74A 3K92A 2ZRJA 1TEHA 2A4MA 5JXWA 4G1CA 2JCSA 2QI9C 2F3PA 1V16B 4HNQA 3M89A 4K03A 5E4FA 4DMUB 1RKXA 2Q1UA 3EXEA 5CVDA 4MTCA 5HGJA 3U37A 2H1OA 1GAXA 1QFSA 3E9ZA 2NAFA 2WVJA 3TSZA 4L6IA 4XRRA 4YUWA 1IN5A 3HB5X 4PG4A 5KQLA 1NJFA 1ISGA 2JI6A 1OXXK 3ZY5A 5AVKA 3WWCA 4NXNB 1YDMA 2EG5A 2JLCA 2ZUCA 4IS3A 3IDAA 1G8SA 5EPEA 4CUKA 4DLSA 5JJ5A 1H8HA 2R60A 2NW6A 1KMHB 4KFSA 1K3UB 1QO0A 3O8NA 2XXAB 1STOA 3CMCO 4JIMA 5LSAA 4BQNA 4NWIA 3HBMA 3L7BA 1QAOA 1JS1X 3I45A 5KB3A 5ALEA 4JLPA 3H17A 3ZQKA 5HJ2A 3CLRD 2VF8A 2C5EA 2B4KA 2VVTA 4OO3A 4J0GA 1TZCA 3NTXA 2H63A 3WK8A 2DCUA 1JRLA 3P9ZA 3U61B 5AJVB 2O5RA 3W78A 1RTTA 2JI8A 4O6VA 1FTNA 5K8IA 1F14A 4TXJA 4XOIA 3I5AA 5F12A 3QU4A 4FW8A 2Z56A 4G4SP 4FS3A 4D9J