3N7TA

Crystal structure of a macrophage binding protein from coccidioides immitis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
241
structure length
241
Chain Sequence
PLPRKALLAITSAHPPFWPDGKRTGLFFSEALHPFNELTAAGFEVDVASETGTFGWDEHSLTQEYLSKEDEKVLHSEHNHFMEKMNKQVFKAGDLAPHDYGLMFVCGGHGALYDFPHAKHLQNIAQDIYKRGGVIGAVCHGPAMLPGIHDENGDSVIKDKTVTGFTTKGEIMIKVIDKMREDHLHTIADMAQTANAEYVPPEDPWDDFCKVDGRIVTGANPQSATNTARDTIKVYEGIVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage binding protein
publication title Crystal structure of a macrophage binding protein from Coccidioides immitis
rcsb
source organism Coccidioides immitis
molecule tags Protein binding
total genus 88
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3n7tA00
3OT1A 4P36A 3MGKA 4L78A 3SF8B 1FYEA 4B5KA 4AUNA 4OGGA 4UCFA 3TTWA 4GE3A 4UOQA 1CF9A 4B40A 1CE8B 3GRAA 1QF7A 2ISSD 4ENPA 5BV2P 3PQ8A 2H2WA 2VKTA 4GUDA 2YWBA 4GE0A 1KWKA 1GGKA 1PE0A 3M3PA 1QWSA 1KA9H 1CS0B 4MNTA 1I1QB 4L8YA 2WJZB 3NONA 2R1VB 1OI4A 3EWNA 3SOZA 3PQ4A 3EJ6A 3UOWA 4UOZA 2D7JA 3CY6A 1UCFA 1GGJA 2RK3A 2R1UA 3B36A 3F71A 3L3BA 3NOQA 2NV0A 1QVWA 4P34A 2VRNA 2AB0A 2YWCA 1KEEB 3BWEA 4OQ4A 4R7GA 4ADSG 1VCOA 3TTSA 1Q2UA 2GHRA 2A9VA 4BTEA 4Y1RB 1KXJA 4Y1GA 3PQ5A 1Q7RA 3WFZA 4ENTA 4AUMA 3KKLA 2IUFA 1P81A 2ZUSA 4BIMA 3CZ9A 4WINA 4K2HA 4JQSA 1GGHA 1J42A 3D54D 4ZDIA 3EZGA 4LRUA 4L8FA 1GPWB 3PQ3A 3TQIA 2V4UA 1KWGA 1VCMA 1JVNA 1QDLB 4BFLA 2ZUWA 2ABWA 3P9QA 1P5FA 2R1TA 3EFEA 5DFAA 4ZDKA 1R9GA 4RKWA 3TTTA 1A9XB 3ZJ4A 2NV2B 3ZJ5A 4L95C 4UNIA 1S1MA 1GPMA 4B2YA 3P9SA 3P9RA 1OX5A 3CYFA 1OX4B 3OT1B 4P5PA 4L7QA 4ENSA 3SF8A 3UK7A 3UMMA 2YWJA 5E9AA 4MGHA 4OJYA 1OY1A 3N7TA 4E5VA 1U9CA 3UJNA 4ENVA 1C30B 3CNEA 4OFWA 5JZMA 3L7NA 1P7ZA 2FEXA 3NOVA 1I7QB 1L9XA 1WL8A 2ZUUA 3F5DA 4Y1FA 4Y1EA 1I7SB 3BHNA 4ENQA 4I46A 4UZSA 2RK4A 4RKYA 1T3TA 3NVAA 4N12A 1N57A 3R75A 3TTXA 3ZR4B 3FIJA 3NOOA 1VCNA 1IZZA 3L4EA 2W7TA 2VDJA 4OGFA 4N0MA 3UGJA 4ZDJA 4HCJA 2ZUTA 4I4NA 3RHTA 3TTUA 2YWDA 4WXYB 3TTYA 4S0ZA 3L18A 1GGEA 1JDBC 1GGFA 4AJ9A 3CZAA 1QVVA 4I2NA 4QYXA 4MTCA 1K9VF 1ONSA 3PQ6A 2XF2A 3FSEA 5SY4A 4P2GA 4P35A 1IPHA 1OX6A 4LGYA 4Y1RA 1P80A 2VPIA 4OIFA 2ZUVA 4ENWA 1QVZA 1GG9A 2LXNA 4XLLA 1M6VB 1T0BA 3EN0A 2GK3A 3P9PA 1FY2A 4QYTA 5SYAA 4ENUA 3NORA 4Y0NA 1T36B 1P7YA 5K4AA 3MIIA 4AUEA 5JZOA 1PDVA 3TTVA 1VHQA 4E08A 1PV2A 1SOAA 5LIRA 5SY6A 3B3AA 2R1TB 2RK6A 4ZGGA 3B38A 1C3OB 1G2IA 1PDWA 2R1VA 2AD5A 3PQ7A 5SY9A 1O1YA 3R76A 4AULA 1IZYA 4B31A 4D1YA 1BXRB 4PXYA 1SY7A 2OR3A 3ER6A 2VXOA 3VU3A 3PQ2A 3R74A 5IP5A 4ENRA 4B7AA 1OX4A 4L8WB
chains in the Genus database with same CATH superfamily
4XIJA 5CEFA 1GPLA 4UULA 3L7BA 4B7XA 5EI5A 4NQZA 5AK5A 1LS6A 4HDRA 4MW0A 3IRVA 4I1PA 1OFIA 1EEXB 4WJKB 1A88A 1LZKA 2IU6A 5IULC 3DVQX 4O6VA 4IF4A 1ZCBA 1ZM2A 1R2QA 3LPCA 1IUNA 1C7JA 2JA2A 1JKXA 4HNAB 1LJLA 2AZTA 4N8EA 5K09A 4Q1AA 3RF7A 4E4TA 1ONBA 3EA4A 4ID3A 3L0SA 1L5OA 4LHYA 4EGFA 5KEIA 2O8FA 1E1QD 1HOTA 4QJIA 1FW8A 4OP3A 3VDNB 4BQNA 3L49A 4Y2XA 1N6NA 4HFMA 1E20A 1ECPA 2CKMA 1Z34A 4J3NA 1V11B 1BWQA 3GNLA 4IJVA 2JLZA 3ICPA 1BW9A 1ZL0A 5BNZA 1JS1X 2PUGA 5K3SA 4EY7A 2EP8A 3UMFA 3GJ5A 1AMNA 1UEIA 3AF0A 3IP6A 4W1QA 4Y2GA 3GGJA 4QNNA 1V3VA 3VR6A 5JLAA 2YXNA 1Z28A 4QQFA 2XYGA 2HIHA 1Q15A 2XVZA 3EFOA 1AZTA 1NVAA 1RPTA 4WACA 1IFXA 3PFHA 4UCWA 1ZM9A 1XCPA 3VKVA 4DNQA 3OP1A 4BQQA 4OM8A 4UDXX 4LDJA 2LD4A 1NT4A 3NIFB 1XA3A 2NT4A 3D1VA 3G5TA 1P62B 2IYRA 1TKCA 1DADA 1P72A 2E3JA 2IOQA 3JQGA 4R9VA 1R9GA 4LDNA 4WNAA 3ROXA 2NM0A 4GMDA 4LYHA 5JAIA 3CVOA 4Q7KA 3HA2A 2AJCA 4BIIA 3QJYA 3F73A 1D1TA 4EY6A 1EVKA 1BXRA 1TVMA 4URZR 2WSBA 3PA6A 1SIOA 5EMJA 4AVYA 1ECLA 4TSKA 3LPDA 4DLSA 3ZLJA 1G20E 2OLEA 4EYOA 2BT4A 3ANYB 3T7TA 1XRJA 3NHKA 5IBRA 3ZVKA 1Q0UA 3BWBA 2F1RA 2C04A 2PX6A 4GPTA 3OECA 2Y1WA 4IQ0A 3VI3B 2SCUA 4C0SA 2IIPA 3KVOA 3TCKA 2IXDA 2J3HA 2VKQA 2ZSFA 1UMBB 2QY6A 4K81B 1F8XA 2AH5A 4QRIA 4QXPA 3SJZA 2WYOA 4OU5A 3AFNA 4GX5A 2ZRHA 4IRUB 4UHFA 1KSHA 4YXWD 1T8TA 5KVVA 4UVGA 3UT0A 1MW9X 3ISVA 3VNAA 1INLA 5IFKA 1Z7WA 3B1FA 4W7HA 2HJGA 3EQ7A 2BISA 4HFRA 2Q1XA 2VJYA 721PA 5KU7A 3HZHA 4KPGA 1QB8A 4QT4A 3C3BA 3A11A 3H2ZA 3M9LA 2KW5A 1KJQA 3KC2A 3GLFA 4B6OA 1Q22A 2GPNA 1VJRA 3B51X 1PFWA 1GUFA 5IZCA 1RWWA 3SNHA 1XPOA 1Q1NA 4RORA 4XQCA 4G9EA 1A77A 2P5YA 1NYQA 4PC3A 3RS8A 2QV0A 3ZV7A 4DB4A 2GF9A 3F6BX 4A0GA 1QOZA 3QU4A 2YZ2A 5IKXA 4L57A 3IP1A 4ZCIA 5EZQA 2H11A 3UF0A 2W0MA 4B3MB 2EJTA 4D3FA 3NR2A 3UXMA 4B09A 2WHEA 4PQEA 3RC7A 1AF7A 2HMTA 4AKTA 1TVKA 3SF0A 3PXEA 3W5JA 4NCJA 3DVAB 4G1UC 4TKZA 4OHZA 4EHJA 1U3CA 1U8EA 5IASA 2IL1A 5CHYA 4XX0B 2AFVA 4DG9A 4IFTA 1P33A 2NU7B 4EG0A 3AHJA 4M6WA 4BVEA 2XWQA 5KOIA 4RK7A 3BTOA 1U8YA 3RBAA 1UDXA 1GCIA 3TL3A 3KE9A 1A5ZA 1V2HE 2CUZA 4HH1A 2M6SA 4N40A 3DVSX 5GONF 2NU6B 3G6WA 1E79A 2HGSA 4NECA 1G1MA 4CGZA 5FF9A 5IJXA 1QK5A 3S5UA 5HKKA 1LBQA 5JS8A 1B41A 1P3DA 1NFQA 5CH5A 4ERNA 4RV5A 4EW2A 4OQLA 3KKMA 1OFUX 2PY6A 3SC3A 1CS0B 4IMIB 1Y4DE 1HYHA 1A04A 1MDBA 2WIGA 1ZU4A 2BPOA 2Z4SA 1YKGA 2OGSA 4ZEOA 3K0KA 1FIUA 1VJTA 2CZGA 2QQGA 3HWX1 3H5IA 1GNLA 4IX9A 2Y6UA 4IOLA 3PIIA 4KVFA 1U1FA 3CCBA 3F6RA 3NXKA 2I2AA 4DIUA 5LQAA 1GTG1 5CA0B 4LXQA 4CM8B 1WTCA 2YIMA 1U0TA 2YJZA 3OFND 2XNDA 1DMSA 4WXHA 1UJ6A 3L04A 3O90A 4HFNA 3ZX5A 2F48A 4CRWB 2B3TA 1EVYA 5EJIA 4YJ2F 5DM0A 4FNMA 3U49A 3EGWA 4K2HA 4ZAVA 3VPGA 1DBPA 3IIEA 4EG1A 1Z0ZA 4BQPA 4I81A 1EUDA 1HEUA 4RPKA 4OI1A 3IEXA 3U7QB 3VSDA 5H9WA 1R1DA 2R1TA 2JZOA 1W4AA 4A8HA 1K75A 3IV7A 2P69A 2ZRAA 5EA2A 4CMAA 2J3JA 3AMVA 2WILA 5AW8A 1O9GA 2FP4B 3EVGA 5GOTA 3IJRA 4PAMA 2ASVA 3RUAA 2PU5A 3I5AA 3EXIB 2HADA 1YRYE 3GFPA 3LV8A 5BUSA 3BT7A 5JD4A 5EJGA 5CCBA 3VUEA 3BXPA 3TIGA 3DXXA 3COZA 5FULA 1A7KA 1IK4A 4CN8A 3PEEA 3C87A 3MT8A 3EGVA 3IUYA 4C14A 4FNGA 2PK3A 2K2QB 3N5CA 4LE0A 4AM8A 4X91A 1KIAA 2ZGVA 2YXDA 3NS7A 1EP2B 3I4CA 3LIIA 4O4LB 4ASUA 4J0DA 3HYRA 3BFXA 3JQ9A 4PLTA 1KIMA 4TS1A 5I51A 3N2LA 3ADPA 1F2UB 1B0ZA 5DCUA 1XKTA 3TZEA 1ZHOA 2O3UA 4PZLA 3PX3A 4ZZ2A 3DHVA 5KB3A 2YMPA 2VCYA 4YRMA 1EFVB 1XZQA 4WEQA 1TK2A 2J41A 3JZIA 3LHFA 1VSBA 3PLNA 2VDJA 4E51A 1RS0A 3LX8A 3QKIA 4PSUA 3FLAA 3KAKA 3FJ1A 2WVHA 4OGKA 3O26A 1D0VA 3FDZA 3M5CA 2X58A 4DLPA 1B76A 5BQOA 4IXTA 4MTCA 1BXZA 3D8SA 5L40A 3ELWA 3NETA 3SS9X 5KX5A 1SNYA 2G9ZA 4B3DA 4CEJA 3AM1A 3OQVA 3JQAB 3O8OA 1HMPA 1QHYA 3U3DA 2JCGA 4OLHA 4TLEA 1SUIA 1M2OB 2PG3A 4R5MA 4BNUA 1P3Y1 3OZTA 4Q4JB 2QSJA 4O8ZA 2IGTA 3RVQA 4JK3A 1J0CA 5C37A 3L7LA 5BSKA 2QG9A 4JA0A 3N76A 4AULA 1BJTA 2FCAA 1T8YA 1SXIA 5IC6A 4BV2A 4B3GA 5KQGA 1BE0A 5AUQA 3NM6B 3JQCA 3LQ2A 4B7CA 3VR2A 4BO9A 1T2DA 1YQXA 2E4AA 3E7DA 2BVNA 1U0EA 3EBLA 4TSRA 1Z4LA 1N0HA 2J31A 3Q12A 1U6IA 2WT4A 2FSUA 4N5IX 3CGWA 4FINA 2VSXA 3NWEA 3O1HB 1ZICA 4N0DA 4ZZIA 2WMOB 1FJGB 4LECA 3HSYA 2YHBA 4FFBA 4FLEA 1LW6E 1XZAA 1R27A 4DPLA 1YR6A 1DQZA 2XPCA 2XCTB 3OAAD 3C8DA 1KI9A 4RQBA 4E15A 2J9GA 1WKBA 1NC3A 3V2IA 1P73A 5GZ3A 2RKWA 1LJ8A 2VPWA 1RNLA 3QXSA 1E0KA 2YMMA 4LYEA 2X2EA 3WNVA 3GUCA 1Y98A 2AN3A 3UGKA 3FN4A 3ZDAA 4ZO7A 1GTMA 1YL6A 3L8FA 4NL4H 1T2AA 3EHEA 4OKSA 3L0DA 4LDZA 3P7MA 3NC1C 2WQZA 2V5AA 3SSMA 1BMFD 3WC4A 5A5FA 2VPPA 3OC0A 1GD1O 3ENQA 4LFBB 2WAYA 5ICGA 2NSLA 4KQJA 5LUAA 3IR5A 3QELB 3FKSD 2OZLB 1HETA 2XRMA 3ASUA 4RHFA 1UKYA 3L0CA 3PGVA 2XXAB 3L8DA 3MWLA 1V7ZA 3UWMA 4WCDA 3U2QA 1O97D 2R8PA 2WUEA 3SVTA 2YVLA 1LPSA 3L8YA 3AERB 1VL5A 3SC2B 3RS5A 4Q1DA 1XOIA 1QDEA 2X4GA 3D3JA 4GL2A 5JD5A 3P9QA 3B60A 3PFFA 1B26A 4DR6B 3WRYA 2GTIA 3GAAA 4RK1A 5C32A 1R6DA 1X7HA 4R8SA 4FZ3A 4YJGA 3M1YA 5BXQC 2KSQA 1XCOA 5I45A 1WF6A 2IP1A 4UAGA 3CYFA 5CM9C 3KUXA 4CMGA 4RJ2A 1E6KA 2Q27A 4MAFA 2D5AA 1HQKA 2YWJA 2YIVX 2VK8A 1DHRA 3DOUA 3LUHA 3I62A 3G2PA 4N3GA 3SEFA 3OLXA 5EIBD 4G1CA 4UU8A 3C5HA 4U7PB 4OI0A 2XB4A 4PLFA 4J1NA 4ONEA 1JTVA 5IYZF 3BZBA 4BWGA 4K03A 3ZTYA 2NSDA 4MV6A 3AM4A 4DLRA 3IVAA 5EJ5A 1SVLA 5BQ5A 3SQXA 3Q87B 4CN9A 2QL5A 2XTZA 3KJHA 5E2AA 3CLSC 4FI3F 4G5FA 4IV0A 4Z0TA 3IPYA 3IYLW 2IA5A 4RLHA 3BMCB 3AJDA 4Y18A 4J90A 1HYBA 1KBOA 1QIKA 2A7XA 2EBWA 4FR2A 4ZTBA 1RLJA 2JAUA 3FWHA 4DQDA 3KD2A 5GJVC 1GFIA 5IAAA 3OOEA 1ODJA 1K27A 2BZSA 2FXVA 1FLNA 1ZD5A 3TTUA 1MABA 1I14A 4GZ6A 3L18A 4X54A 4F8JA 3W7VA 3RAEC 1KE2A 4KFCA 3VNVA 1L7PA 3U4AA 3SKVA 2K7ZA 4LSGA 3HYTA 4JSTA 2QJTA 3O21A 1K3TA 2QU8A 4QJ5A 2NV6A 3FRIA 3DEFA 4Z9YA 2DM6A 2LDBA 1XU4A 1Y6ZA 4EVQA 1L8XA 2F3UA 2HRCA 4YJKA 1V7CA 4C07A 2C9BA 4JKIA 1MTOA 1P18A 2VYND 3PC8A 3C5WP 4FDAA 4NJEB 3WSWA 4EJ6A 3DCIA 2RH4A 4L8GA 3BFKA 1E2QA 3V4RA 3I9NA 2HUNA 4L5CA 1H4VB 2BELA 1QIIA 2PH5A 4UUBA 4ER0A 5JS2A 4MYTA 3R6TA 4KN8A 1Q0SA 2AHOA 2AD5A 1XXHB 2NO6A 1LTKA 2C9MA 2NAPA 5T3YA 2FDXA 1NOIA 4REOA 5IAKA 4R3NA 4S05A 1DRJA 4MV5A 3NGLA 4CTKA 4DMKA 1MORA 1T4CA 2O3RA 3IAXA 2ZTHA 3BHJA 3MCTA 5MFPA 4PO1A 4ZKEA 2CNBA 4I1SA 1KAEA 5AI5A 2P4SA 1KPIA 5CXUA 2XUJA 3LHKA 4Q21A 4DMGA 1E5VA 1HQDA 3ICVA 4F97A 1GL6A 2EV9A 1JQ3A 2VBIA 5TF0A 2J85A 3WS7A 1J39A 1RTKA 3A1CA 3IV9A 3BF7A 4XUDA 3QITA 1ZESA 5ALHA 1RRMA 2DC1A 1QWSA 1N3IA 2JFGA 2ZUBA 2G88A 4XYMA 3MWEA 1QCZA 3WYGA 3ZWAA 4MI1A 1FTQA 4IZIA 4Y2HA 4F9TA 3ROMA 5AVYA 4RD6A 3HC7A 3FHLA 1SKAA 2XJ9A 1SVIA 2GETA 4URUR 1CZUA 1A8IA 3QKWA 1PNVA 2Z04A 5LQSA 1CW2B 2KBEA 4G07A 4JYZA 4PC7A 4KDRA 3MTAA 5K8UA 1IL0A 5C5CA 3IQWA 1QH1B 3SDSA 1GZ7A 4ZVVA 5CNMA 3IS3A 3H9GA 3Q7SA 3GFSA 4KE9A 4RL4A 1CUJA 4YS6A 1XE3A 3WRWA 1CERA 3LIPA 5UKDA 2PKXA 1KH3A 4FSHA 4U2BA 1Z5UA 3D6NB 4I1RA 1YR1A 2JEOA 3CURA 3W7BA 1Y9EA 1RC8A 3CZRA 3D3EA 2QTFA 2D5LA 4EKYA 1NVVQ 2HB6A 3CO5A 3U17A 4FMBB 3V1LA 4PG6A 3EZFA 3K09A 3SIRA 5K0JA 1KRXA 5KNLA 1XDZA 2DSTA 2J9ZB 3DEZA 4KX3A 4MAAA 1YUNA 1CUFA 2H57A 2ZVDA 4CMIB 3ZIAA 2DHEA 5FOSA 2RJNA 4PG4A 4BXOA 2GBGA 1UPTA 3WIVA 1XMXA 2ON6A 3D81A 3LUAA 3OQ6A 4BKPA 5AW2A 3Q3HA 5FRDA 1M0EA 4W5HA 2O7VA 3R1IA 3WYNA 2J0UA 5F3WB 1M10A 1O6BA 1WMSA 1AU9A 1US8A 3TZCA 1L5VA 4EPXA 4P98A 5HA5A 4ZDWA 1YIAA 1CYEA 1DCFA 1D5WA 2JIOA 3IODA 1I7NA 3USES 2Q2VA 1U2TA 4BVLA 1BX1A 1YSCA 2GNPA 2K2WA 2QMHA 2OBYA 1GNQA 2NXNA 1L9XA 3A6KA 3IOMA 3KEGA 3N05A 4WCFB 5EXDA 3RJ5A 2XMDA 3DYVA 3UT6A 4DQLA 4C3ZA 1QWOA 4J4TA 2F1KA 2Z3VA 4FMCB 2W2KA 2JVIA 5A3VA 4F04A 2W48A 2VTVA 5LD2C 1AKMA 2QLBA 5T57A 4LJRA 2QTAA 3VR5H 1VE1A 1NDUA 4MWOA 1NOKA 2MYPA 3JTMA 4HDMB 1SRQA 3P1JA 1BN6A 4ZQFA 4HNVA 3JVVA 4TUYB 4CFZA 4CQJA 3X1JA 1JALA 1PZEA 2J7PA 1GGFA 1PP4A 1HZZA 1QVVA 4E7OA 2ZWOA 4UEQA 5LMNB 2XUPA 2E1PA 3NKVA 2IYZA 3R0IA 1BQ3A 5IJAA 1YB1A 1ELOA 2I66A 3LDGA 1Y6QA 2XTNA 1H9AA 4XKJA 3PZBA 3RVNA 1QVZA 2PNFA 3EEQA 1LGYA 3ESQA 5E6RB 4D02A 4A0RA 2ODEA 4EMUA 1IG0A 2G9VA 4WY8A 1AHPA 2PQMA 2B8TA 4JP2A 4KQ6A 5TQ0B 5BT8A 2AUNA 4HVLA 5EKDA 2VLIA 1A8UA 3ILYA 2OHXA 3RGWS 3INRA 3SYMA 1CDEA 3EOZA 4G1BA 4E1VA 3GVIA 4N1AA 1SBZA 5C8YA 3E2MA 4TV9F 1U4OA 4KXYA 1HWYA 3O1IC 3CLRC 4RD4A 2IXAA 1CR4A 2Y68A 3GXBA 4H7JA 4MA0A 5CTAA 3OT5A 5CVCA 3DOOA 3V4LA 1E66A 5TV2A 4ZAZA 4ZQCB 1B43A 1QORA 2VF7A 5DVZA 5C51B 4DZTA 4W5NA 4M3NA 2IHKA 4KGVA 5FR2A 1DDIA 2ZTSA 2X2OA 1JE0A 5AJZA 5C8XA 5IZCC 1IN4A 3BOSA 1GGKA 2P9TA 3FFTA 3OE5A 1D7AA 2I1WA 5CG1A 1S3GA 4HZUA 1XALA 1ZMXA 3JQFA 4GPIB 5DTQA 1TAUA 1TCVA 1YS2X 3RV4A 3FNQA 3GLHE 3NB0A 1ZK0A 3DKVA 4J7XA 4Z9XA 3K0FA 5LA6B 4M54A 5I7UA 3F6YA 1WDMA 2V98A 4XXHA 4CLDA 4P0QB 1OLSA 2PKQO 1F4VA 2H18A 2CDAA 1NLUA 3COWA 2Y0DA 2NO9A 1QRRA 4GLOA 3OG9A 1YK1A 2EYUA 3UFXA 2JJ1D 2B2CA 2P9JA 5E7IA 3TXAA 3HYNA 1CY1A 5F98A 3C97A 3VOBA 1QCCA 1XWFA 2FF7A 2LTAA 4HQ6A 1FZTA 1FYDA 1LPNA 1UC8A 3M4YA 4H3HB 3H05A 5ES3A 3V9AA 1AUXA 4E88A 1Z33A 4H1HA 3RRYA 1JPVA 5KDDA 3SPXA 4KBYA 1NPTO 3ZLUA 1UKZA 1YB4A 1NIJA 3HB9A 3UWPA 1VMKA 1CIJA 2CSUA 2OECA 1PG2A 1XZLA 2P68A 3ETJA 3PWSA 3FNGA 4R83A 3WGVA 2HJVA 3O82A 2Q5QA 4Q05A 4YJ2A 2BFMA 1SKYB 1YZGA 3DFUA 5JSUA 2F1OA 2QTRA 1FTYA 3G8YA 2PPVA 1SVMA 4MV7A 4XD7A 3RYTC 5FO0A 4BZPA 2R6R1 4EF6A 4Q3NA 1R4AA 2P75A 3U1VA 1SD5A 2Z9DA 2JLBA 1HDCA 5IDWA 2G9UA 1QG2A 1XV5A 3N5KA 4A4DA 5HRAA 2GH1A 1UK8A 3I1YA 4HHEA 1S0UA 5HMMA 1M1XB 2OP0A 3VU8A 1Z56C 4MQ5A 2ZRBA 1KZYC 1KVUA 3HJGA 2DPXA 3AOEC 4R31A 1ULUA 3RVKA 1KAQA 3QE2A 2PLRA 3HN2A 3KWMA 2ZIFA 2W2VA 1V8OA 4TQ9A 1VG0B 2ZKIA 2ZRFA 1KIFA 4L3VA 5L9AA 4FGUA 2JGDB 4W82A 1O4VA 1O6GA 3RSLA 3T9BA 3VU0A 1VPTA 1XGKA 3HUUA 4TQGA 2FR1A 4A5SA 1AO3A 4BFWA 5CDFA 2N3ZA 3UJHA 4BQEA 1X14A 4D9MA 4D7AA 1MC5A 1LEHA 1AGNA 2WDPA 5LQUA 3ZQUA 1QV7A 2P9EA 3RT7A 1ST2A 5J5AA 3NH9A 4P1ZA 1YQEA 4CIBA 1ZJ4A 1EFAA 1D8AA 1DAPA 4MVCA 1XN4A 3L1JA 2C7PA 5GM1A 5BSHA 4FZJA 3AKDA 1ML4A 1V35A 4BDSA 3HY6A 2GN8A 1LA2A 3RFUA 1NQAO 3KOWA 4O3FA 3VBCA 3WICA 4LDRA 4N7JA 4I55B 3EEYA 1H0SA 1PWXA 4QWWA 4PR3A 4MQEA 3FNRA 2G8NA 2BKAA 2N1MA 5D00A 3OM0A 3RC1A 3LT1A 4F5YA 1FLDA 4ZC1A 1LI4A 3GRAA 5EJAA 4QBGB 3SYLA 3KR2A 4WESB 3WK4A 2OFXA 5BSMA 2ZR9A 4MRNA 3U9LA 1QQAA 1GUDA 4GC9A 2H2AA 5KPDA 1DTWA 1PCXA 5KTYA 2HT6A 3FPGA 3D6FA 2BUAA 4BBAA 5JO0A 3ZCUA 3N0WA 4IYRA 4WD3A 1L5HA 4EHNA 1SCIA 2AFIE 2FMIA 3WGUA 4RPIA 2RJOA 3B7PA 3CZ5A 3KYCA 5AKYA 1G38A 3NKFA 4KV9A 5FIUA 3VR5D 4C0QC 1NP6A 5F2NA 4OYRA 2O5CA 1NHWA 4A2QA 3EBOA 1U7HA 4EKEA 2PSEA 3WGIA 1NPDA 2VS1A 5F21A 2ZSJA 1VE3A 3TF5A 1KEEB 2RH5A 5CFPA 1FYVA 2Q3EA 3L0IB 4IZ6A 5J4HA 4PAOA 4Q1FA 3GT4A 1EQAA 3PVSA 4M1MA 2A9VA 2OO7A 2X19A 1T0JB 4PCLA 2X0DA 1CKEA 1FA9A 4YRSA 4DZRA 3QWHA 2QAIA 2WUWE 1Z22A 3OETA 1NRXA 1O95D 2IYVA 4KQ1A 2PX8A 4PQGA 4YCSA 4YRIA 1ILEA 1NP7A 1J42A 2ZB3A 3LUJA 3E9EA 2PV0A 1GCOA 5CVEA 4EPRA 4ZCMA 4HK4A 1F7VA 5K3CA 1KI6B 4PLHA 3A1TA 4XLZA 3Q7QA 3ZNQA 1OVMA 2FUNB 2V0NA 5A4KA 2A1TR 2AX4A 2R4QA 2VTBA 2RGDA 2OSVA 3A2LA 1SHTX 3PF8A 3KZVA 2GZ2A 3NPAA 3UC5A 2ASEA 1IXSB 2E9SA 2FW0A 1IXRC 3PQCA 4QQKA 5CFZA 1YE8A 1OILA 5ISMA 3E4DA 2IOHA 1M1UA 3GAZA 3AV0B 3EQ6A 4PLGA 4HN4B 5F7JA 2BKVA 1X80A 4UOEA 4ND3A 1F12A 3HCAA 2WHPB 3DEYX 3ZW9A 2I6FA 4ZQBA 4WOPA 3V3KA 1WP9A 2H1SA 1P6XA 2D0OB 2C5AA 2GYWA 3L4JA 2H85A 3MJSA 4KR6A 1J1ZA 4YFVA 1T9ZA 5EHZA 4IFIA 4US0R 1JWBB 3O4RA 1PZFA 1IWPB 1V3QE 4ND6A 4MX8A 1MF7A 5JC1A 1MFZA 3ZW8A 2JCYA 4XDYA 2WG2A 5HXAA 4O0LA 3EVTA 2W8BB 4IUBS 4L5JA 2HA5A 3A0RB 4HSGA 2OCGA 3JZFA 1ZC4A 3VYTB 4ZOQI 2WKRA 5G1PA 4LI0A 2EP7A 2AR7A 5IHXA 3EPPA 5IYZA 3PTLA 3JALA 3RTCA 2EC5A 3OZGA 3DOJA 2X5OA 2AK3A 1BE6A 1QC5B 3OFJA 1SCKA 4N3BA 1V1RB 5IG2A 3FOFC 3GPBA 2IZ0A 3FSEA 1ZMOA 2H92A 4S1OA 5CIWA 4DQUA 2WW8A 1P80A 4H7EA 5AHOA 1GU0A 2ZUVA 1YFLA 3K9FC 3B3JA 1X74A 5IAOA 5T4BA 4Y8VA 1HORA 5F76A 3N2YA 3K8YA 5CFOA 3M5DA 2PM8A 3DTTA 2GERA 4NG5A 4R98A 4A23A 5C1IA 2RGBA 3ZQ4A 1C0EA 2OOKA 2O2SA 2YRFA 3CLTD 1MA0A 1GL9B 5GADl 3G2QA 2EFCB 1VYHA 3G2IA 3RRZA 1BTOA 3JV7A 5LB2A 1TKRA 1NBIA 4TTIA 5LDGA 2OFWA 1SC6A 4CEIB 2VF8A 1FFWA 3AI2A 3FYHA 2I78A 1WVGA 3ACBA 2F17A 2RIPA 2OENG 4UTVA 2BRUA 3SMQA 3X1KA 2W5UA 3CA8A 1EVZA 4RY9A 3KXKA 3N2GB 1OLXA 3SSOA 3B53X 3DDHA 3U4GA 2HSZA 4QT0A 2O8CB 1Y9AA 5KMGA 1OBOA 2JJMA 1ND5A 3LY8A 4QYIA 1S6YA 3K8QA 4P33A 3TFOA 2PS0A 4PV7A 3MD0A 2ZZKA 5C7IO 3DGEC 4D79A 4HDAA 1T3HA 2FX3A 1CJTC 2CXHA 4KMRA 4LK3A 2X3UA 1L8AA 4WN9A 5EIXA 3TO5A 2ECOA 5JFOA 5IJ0A 2M9MA 2KLHA 3GFBA 1QPZA 2CMGA 2QUBA 3ZHOA 3GLIE 4KYVA 4RHEA 3UW1A 3V33A 2GI4A 3G2LA 2MINB 3CNHA 3MNFA 4IQ4A 4MW6A 4Q3OA 1XP5A 1JDTA 3RSQA 1ORWA 1VGVA 2WD7B 3DE2X 2FG6C 4HAXA 3SFTA 1F2TB 3W7AA 5JASA 3JQAD 4F72A 1U4SA 1PT6A 4N03A 4ZREA 2W6NA 1TOAA 1I6WA 1N1DA 2B1GA 3B52X 4A9AA 4XJSA 1NXOA 3IHLA 2XZDA 3A2NA 2FLVA 1XN1A 3JVDA 4M0FA 4YONB 5IM5A 1C3JA 1CVIA 2I76A 3QKSA 4OP1A 2A0UA 2DQ4A 4AJPA 3AJ8A 5COAA 5JG7A 3Q5GA 1VE7A 5GVRA 4CODB 4C7VA 5KYUA 2HT1A 1VLMA 1EZ4A 1QZTA 4LOLA 1MXFA 5TT0A 2I8AA 4S1PA 4P83A 3ZS9A 1GP2A 1WCYA 4AZ3A 1N5DA 3W6OA 3M1LA 3T4EA 1HO3A 1VPWA 1OH8A 1GU7A 3A1UA 2VF2A 1IZ0A 1J9EA 3F0TA 2C5BA 2GBLC 1AXEA 2Q0QA 2V65A 2XE6A 3BAZA 1Y5LA 3KTFA 3AF3A 4LX0A 4HLQB 3ANSA 4IVQA 5LLSA 1BD3A 3W8DA 4GR9A 4CF6A 1EJ2A 2GAAA 2FEXA 2ONKA 2GPTA 3CPHA 5IABA 3GRYA 5ITVA 1F7UA 1GCUA 2ZYWX 1Z4KA 2GZHA 3HDTA 5AVXA 3K70C 3CUYA 4UTPA 1PFGA 4BMDA 2F3PA 3K1AB 1YS7A 1XTBA 2XQVA 1OOEA 3NV7A 5IXJA 1JU3A 5ESXA 3M1IA 1E2MA 2IYNA 1Y5MA 3W3ZB 2WZDA 3CNLA 4JLUA 3RREA 4L1KA 1VKZA 3COYA 3AX6A 3VC1A 2RD2A 3UCXA 2NVWA 1V4NA 3GCZA 1XTTA 3K09C 4B4VA 2YBEA 5JJKA 3E84A 4JUAA 1C2TA 1WB6A 2QQ5A 4CCAA 4XW2A 4OK6A 4X93A 3ZHCA 1E4OA 5JECA 3FYCA 3DKPA 3LFTA 1SBNE 3PKJA 4FE3A 4LGYA 2IIBA 4G1EB 3CN9A 4L3OA 2HU2A 1IUKA 4MWEA 5EYPA 5G0UA 4BGIA 1UDRA 2ZRDA 3P20A 4R9UC 2XNKA 3NCHA 4WGGA 4ETIA 5JZSA 4JXXA 4ESOA 3EG9B 3V1NA 2EZ4A 2XDWA 1QX4A 4ZI7F 4Y0AA 2HBQA 2R47A 2XNHA 3OZCA 4M8IA 1XO1A 2AEMA 1POXA 3R3ZA 4H6XA 4LGVA 3UHFA 1BCRB 4O4HB 5BRJA 4F60A 2FUG1 1IWBB 3K5PA 4B45A 5DH9A 1JHOA 2QIPA 1IU9A 2F7SA 2VAMA 2Y93A 2JJYA 4JFAA 5B2EA 4XE5A 2YVKA 1WZCA 4AUNA 5EIAA 3TLCA 1CJKC 3W6PA 1OXVA 2AR9A 1C9DB 5T3UA 4G89A 4IVPA 1RAGA 1EDEA 1B16A 2UZIR 1NASA 2EG9A 2R11A 3FCOA 4LTNA 3QVOA 5L95A 1DC7A 1NKVA 3CXRA 1V47A 5D2CA 4IEEA 1GG5A 3RIMA 2HPVA 3M3DA 1U9JA 4Q15A 1GSIA 1Z29A 3DL0A 3PQ4A 1IHUA 2IY9A 3BH6A 5FYDA 3JQQA 1AXRA 3LYHA 3SYRA 3Q4GA 2V59A 1BE8A 2QHXA 4H0CA 2PGIA 1OIWA 5LLTA 2JLSA 3PEUA 5HJEA 3AUXA 5BP7A 1VECA 3KSZO 1T1EA 1SA0A 2V7VA 4IMRA 4HDSB 4EP1A 1WNTA 1USWA 3TM5A 1NLYA 3UWSA 4G8CA 1MRNA 2JHAA 3L9XA 4Y2TA 4ABYA 1L4FA 4P9NA 3W4KA 2OAEA 2BEVB 5KNDA 1LF5A 5BRAA 1JJBA 4IDHA 4V2UA 2WUDA 5LBTA 2HO4A 3W5UA 1GZHB 4P3YA 2WAOA 3O1LA 4F1JA 3F67A 1ZN9A 2B8JA 1O96B 4CKCB 4ZCQA 1D4AA 2YWFA 4IKPA 4MI3A 2GKOA 4JOSA 3TLMA 4DV2B 2FPIB 3SFZA 1MJGA 2H7YA 1RWVA 2HQ1A 2ZRMA 1USKA 4BUJA 4B3TB 1QO0A 3O2JA 5AOAA 3JQFC 5DNYB 1ENZA 4MTLA 2YJGA 3H4IA 5KVCA 4R2HA 8LDHA 4HRXA 3IULA 4G5GA 5H9VA 2WFAA 3AIOA 2WDZA 4TN5A 4CGYA 5DU2A 3RFVA 4E5VA 2AJBA 1EJ0A 5AW3A 4K8OA 3QFSA 5DKFA 5JCPA 1ZUD1 3WZMA 3BCSA 4KMSA 5IT4A 1MO2A 1JIJA 3HE3A 3IRUA 5A4MS 4EY3A 3VHXB 1WMEA 5MN6A 2WM2A 2PZMA 4ND5A 3TUIC 7YASA 2CFOA 1CFZA 5ELLA 2QL7A 3R4VA 2CLOB 3ECCA 3LY5A 2FLWA 3H1GA 5CBPB 4OGFA 2XD9A 2ZBQA 1T2CA 4D9FA 3UJBA 1E77A 2LPMA 2RAPA 1WABA 2H59A 3USCS 4U5QA 3I9V1 2PCJA 1JSRA 4WZAA 3MB8A 4LXHA 4OD0A 4Z2AA 4J03A 5D5PA 4G4IA 4ER7A 3ESRA 3ZDBA 1OC2A 3ELUA 1FVHA 1WJGA 3OPNA 3ZCSA 2R8BA 5IF3A 1VDMA 1H2HA 4D9GA 2GEUA 3EC1A 3KLPX 5T4EA 4G0WA 3HR4A 4DMUB 2AOUB 1IBCA 4IM7A 4IDDA 4CKWB 5K4AA 2VHVA 2FWAA 1I3NA 3DMHA 2VH1A 3FUCA 2CJPA 1ZH2A 1QP8A 3RFXA 4EPYA 2CDRA 3AJEA 4ZO4A 1UBUS 3TBKA 4AG5A 1LBHA 1GPYA 3WIEA 1C3OB 2XGGA 3L2OB 2W6MA 4KBFA 3U13A 5B36A 2IC5A 1VIMA 3EB9A 4FC6A 4A91A 2G7MC 1U3VA 1N5RA 3K0HA 5AICA 5TPWA 3UTCA 4RGQA 3H8SA 1J0DA 4PE5B 3C3KA 2APJA 1RYNA 2Z2KA 3FNIA 3HDQA 1T3LA 3AH8A 3Q3GE 5G2OA 4DJFC 5JV5A 3L7DA 2QN6A 3OICA 4S1NA 1KXZA 1Q1AA 4CIDA 3EX7C 1N3LA 1WMAA 3R4CA 4RPJA 3GQVA 5DRTA 3OEHA 5A9TA 3O4GA 3S2UA 3T5GA 4D26A 1REQB 3PHGA 1O54A 1G8JA 3G0GA 2HA3A 4F4UA 3E15A 1IRXA 1Y3HA 4LF5B 4TRRA 2Q5FA 3VJLA 3VYVA 4BX9A 2YL2A 3E7WA 2MR6A 4WKBA 4JI6B 3EWNA 1JKJA 3UW3A 3OTQA 4K9KA 5KKCA 4H0NA 1UQRA 5C4MA 3LC1O 4LUCA 3COVA 3ENKA 3DUFB 4W8GA 3TCNA 3TOXA 3VZDA 1NBME 4H4EA 3E18A 3SBOA 5K0FA 2VJMA 4ILEA 1D2CA 3D31A 5A7FA 4L4YA 1H1LB 1K88A 2GN9A 1G7SA 2EBHX 4P5DA 2YOFA 2PIAA 4UVEA 4C43A 3EPJA 4QWMA 3AKEA 4C4ZA 1Y81A 3HJUA 1UWLA 4HAZA 4EATA 1JHDA 2WFLA 4RVOA 3SQOA 3FGNA 1F4LA 1PZNA 3BYZA 1D4OA 2I7VA 4EG4A 5F23A 4HYEA 4YASA 2JGIA 2GN6A 5K99A 3KHSA 2X0FA 3LWDA 1J23A 2HMWA 3AUJB 3MJTA 4ITVA 4RM3A 4D9JA 3R7LA 4ESEA 4ZFNA 2V7XA 1R18A 3EFEA 1AD2A 3KJGA 4PLYA 3BGIA 3RUPA 4X95A 3PU6A 4IKEA 4RIFA 4Z8XA 1CT9A 2PRSA 4QO7A 5CAEB 4OLFA 4AJKA 2Q1YA 5EINA 3OQHA 2WWTA 2CJYA 2EFJA 3AM5A 3RAJA 4Q4DA 1V6CA 1BSVA 5ITSA 2CC2A 2BAGA 2GEDA 3JYOA 3BXXA 4M9QA 1SCAA 4I36A 3BJZA 2O5VA 1KFJB 2ECQA 1CV2A 1FRFS 2DCMA 4CM5A 2QP3A 3I2FA 5HGJA 3TKLA 3HA7A 1D6NA 3FXAA 1Y33E 3LXMA 1I33A 3OFSA 3RAFC 2IP2A 5BW5A 2JK1A 3HH8A 4NEGA 3CO0S 4OXNA 1C7FA 2BGJA 1DMRA 1OT5A 5CX1A 2HRZA 5AK6A 2CF6A 1RXSA 2Y99A 5E1BA 5JRJA 3EFBA 3V80A 1U65A 2HPZA 1CUHA 3E23A 4HWGA 5FUVA 4BGEA 3BSYA 8AT1A 2G1KA 4DLLA 3H2YA 3EYAA 1UL1X 2XUAA 1AXGA 2AD1A 3WX0A 4TZ0A 1W36C 3ICQB 3I58A 4IGEA 1RM3A 2PKRA 4WQMA 2E21A 4KYUA 1K9VF 3C8MA 1GRRA 5C7YA 4Z0PA 2XF2A 4P7BA 3NHLA 3ZOKA 1U5BA 4Q9KA 1P2UA 3PDUA 6REQB 1DDOA 5I9BA 1HNWB 2X6QA 2RC5A 3UKDA 5SZHB 5JXHA 1I6LA 3O73A 2H7XA 1SBYA 4N82A 3VH4A 4F6LA 3HP4A 2QE7D 4D25A 2CK3D 3EIEA 3X1MA 3EXHC 1KZ6A 2PD6A 1ISGA 5B4TA 1JJ7A 5JNUA 3Q8WA 3D7NA 1RXYA 2FZVA 3E7PA 3OZFA 2AG6A 3Q6IA 4LBZA 4HAOA 5IMBA 4PXYA 3ONFA 2XTAA 3KOXA 5DBOA 5HE8A 1GFWA 4UQOA 5FYQA 3A1NA 1SK8A 1G0NA 5ECYA 3IUPA 2XE8A 5FUYA 3SF8B 1MC1A 5EZ6B 1WB5A 3SEZA 3OD5A 3VMMA 5H7XA 3TW8A 1NW7A 1F2DA 3DL7A 2E18A 1LDYA 4ND1A 4BYGA 1ICEA 3JR7A 3PI7A 4M86A 3E1KA 4XZ3A 3T9FA 2G82A 1UT6A 5TVKA 4AMUA 5KOJA 3V2HA 3H5RA 1XZEA 1EX6A 1P9WA 3GBSA 1Z0UA 2EZTA 1HDIA 2QZSA 4PGAA 4TLCA 4FI3C 2VNAA 1I9GA 1YMQA 4FEAA 4WLVA 1FP2A 2XOKD 2GKSA 1U1DA 2OB1A 3C24A 3E7FA 2JBHA 4NPHA 3UXEA 3HU2A 2EARA 4UNSA 1ZU5A 1J21A 2QNIA 4QUGA 1P4RA 3HMQA 4ALKA 2Y27A 1A5TA 4OQDA 1EX9A 2C2OA 4G4SO 1JA9A 2GDZA 2VRNA 3CNNA 4JQCA 4TXHA 2D1YA 2DGDA 2OM6A 1TT5A 2WSLA 5BWOA 4L5BA 5CEJA 1I2MA 3DLPX 3GYGA 4A5OA 1X7ZA 1KYZA 4Y1RB 1TF5A 2FUG6 4E33A 5A5EA 2YWXA 3RU3A 3NFRA 5J2TF 3CZ9A 1GILA 3OX4A 5FNVB 1L2TA 5AQEA 1RWNA 3DBRA 1U5AA 1MOZA 2XQGA 2O14A 4RY8A 3GIWA 4CI0B 4IIEA 5LN1A 4D4HA 3SVLA 2RE8A 2QX4A 1DQSA 4PPYA 9GPBA 2JD2A 3QMPA 3QKRB 2B1QA 4C30A 1LB1B 4BN5A 3OKAA 2D1SA 1SUSA 2PLFA 3PGA1 1FUYB 1GJRA 3I28A 2VWGA 3IMKA 5GZ1A 4NBUA 2YVUA 5JYCA 2XMGA 3W06A 5IC4A 2WU3A 4C4RA 1PL6A 5E6UB 4ZO6A 5FPQA 4QOIA 2QTWB 4FR5A 5IJWA 2YXLA 2CN1A 1R9NA 1UDAA 3O83A 5C1BA 3GMDA 4OIMA 3AZQA 4INZA 4HY3A 4YJHA 3TS1A 3E0XA 1BMQA 3EAGA 2Q6VA 2Z2IA 4YCAA 2O2JA 1P17A 5ILOA 1QR6A 1DFIA 1MH1A 2NYRA 3D1JA 3DZ8A 1N5JA 3QW4B 1Y42X 1MTZA 1Z6PA 1OWNA 1MNAA 4P53A 4B82A 1C3VA 1LVHA 4ACBA 2WZCA 1KHHA 3TEFA 3PNKA 1Q0TA 1W93A 2FN7A 3RK1A 4WXYB 2NUTB 2VNSA 1Q7TA 1NI4A 2R79A 1GM5A 1CP3A 2ZDGA 3RC9A 4YXFA 1W94A 2O3QA 4KXMA 4RGVA 4DBLC 5I4IA 1TJPB 4E5SA 2XV1A 3I2JA 3QUAA 1D9ZA 3LBAA 1P0IA 4OHXA 1WCWA 3WL6A 3ZHTA 4H1WA 2N47A 4QBFA 1JF8A 2J3QA 3DHWC 3IOEA 4TWBA 5FTNA 2F1IA 5GINE 1B73A 2AFRA 2E5WA 4Y2VA 3PZRA 3RYHA 3T61A 2K7FA 1WS6A 2RK6A 2V7UA 2EVWX 4O1HA 4AKGA 2GA8A 1U1GA 2N0SA 1L3CA 4D1YA 5DN6D 4BFZA 1SY7A 1ULHA 2EFEB 3T4PA 1ISHA 2C2YA 3ER6A 4YCLA 2QTCA 3SJ7A 4DA9A 1W5SA 1U2GC 1S8AA 4M7WA 5A7GA 3QVGB 2LZ0A 1UBMS 1Q84A 2HSGA 5ENDA 4XWGA 3R7SA 1MGPA 2JEYA 1VE9A 4CUZA 1XF1A 4PFQA 5H4HA 4DC9A 5K05A 4A73A 3NJRA 1D8TA 3G1TA 2G1UA 3I9V6 2XDQB 5JSZA 2MMGA 3AIKA 5HNKA 4F46A 2W2PA 3H5LA 1DWQA 1N2HA 4FFSA 2NZXA 3TB4A 1SUCA 1MX9A 4IILA 4XB6B 1ZEMA 3EBPA 3NTLA 3DBHA 1E1QA 4NHEA 4IOMA 4P4GA 2SKDA 4ARVA 5EHGA 2ZJZA 1CR6A 3K35A 3VNSA 1W34A 1ZUNA 3P94A 1FDWA 2LIVA 2VDPB 4HQFA 1IATA 2VYCA 1XJQA 2H5JA 2HEGA 3QUCA 3A6GA 1SCBA 2GVDC 4FYHA 4BFYA 2P3OA 1C0IA 1WSWA 5U4QA 4I9HA 4L15A 121PA 1U0GA 3BICA 3KSRA 1YC5A 4WZBE 2A1UB 1DIBA 5FBHA 3WLKX 1KEPA 1ADGA 1C8LA 3GFVA 3PVZA 3MT7A 2IBTA 4HB4A 1IM8A 2RCNA 3OCUA 1U0RA 2FMHA 4UBJA 3ZUPA 2R0QC 3LL7A 3NXSA 3SHTA 5DNVA 2CYBA 3BWYA 2A59A 1OXSC 3H8JA 5AHKA 3X2EA 3RB8A 4IRXA 2HQOA 1OF1A 3VU9A 3SQNA 3BEDA 5JE8A 3GT3A 4ARBA 3IUEA 4GBJA 2NU8B 4RPCA 4TLBA 2I2BA 1ISRA 3AR8A 4EX7A 5FBQB 2I4IA 3PJDA 1QK4A 3AP2A 5DM2A 3TH5A 1NMEA 2CBZA 1GDHA 3QVMA 5BWLA 4JOQA 1KZGB 1ATZA 3DLIA 4FJ2A 4RHTA 1AJEA 1UOEA 4M1WA 1MO3A 4JHXA 4PN3A 5BQXA 2Q5LA 1SQSA 3BRWD 3UK0A 4ZICA 3Q2IA 1ZUHA 4JEUA 2QR5A 4LSMA 4YXWA 3A3KA 5I3CA 4C4SA 3CVWA 5TPZD 1RHQA 1SOVA 1NJ6A 2DFDA 2NO0A 4GRAA 3WKBA 1J24A 2NUBA 5D01A 5FNZA 2FWMX 1QTNA 1TC1A 3INYA 4RELA 3UIEA 1TLLA 2VN8A 5EMKA 1X42A 4C4OA 1KKLA 1YJXA 2BFFB 3HCNA 4LDPA 2XBLA 2DP4E 1KSJA 3KQOA 5LOVB 1R6XA 1S1CA 2H4ZA 4YO7A 3SR3A 4GIBA 1QOQB 4HXEB 2Q2OA 3BJMA 3UO8B 4Y2JA 2JH3A 4BNDA 5JQGF 5HIMA 2YV2A 4NXNB 3HA5A 4NAHA 4C89A 4KGZA 4QTXA 3LY7A 4EFMA 2OTCA 1J00A 1W9HA 4MKRA 4RHUA 2QQ0A 5ALNA 3UK2A 5A3JA 4IV8A 2D3TA 3CT6A 3JQ6A 5KQRA 1Y82A 4K87A 2WA1A 4G4JA 4GO1A 1MAVA 3D3NA 4ZT4A 2VPTA 4NBVA 2BFDB 2LNDA 3H1AA 1MEOA 4LRYA 2VO1A 1R8YA 4YC7A 3G3EA 1D4ZA 3EZNA 2QU7A 3Q3IA 3CMCO 1N7GA 3QX9A 2VXYA 4EJFA 1I4LD 1X86B 4H7FA 3RYFB 4Z1MD 3P0RA 4V24A 2ZIUB 2QTVA 2B7LA 1ONNA 3OMLA 3QYAA 5K3OA 2DR2A 1P4AA 2QRKA 4QDTA 2Q50A 4QGFA 3BVPA 1VKOA 5HDBB 4PZPA 2IGBA 3CN7A 4TLDA 2J4FA 4CM1A 4N4AA 3HCEA 2IZ7A 1X1BA 5IN4A 3KELA 4YDRA 5F1OA 2B6HA 3B3GA 4CLRA 1JNYA 1JR3D 4FDTA 3QFTA 2OL4A 5IARA 1ID1A 1KR5A 1RE0A 5TC4A 3V9PA 4KN9S 2WVAA 3P5SA 4KWHA 3NONA 3PGMA 4FFWA 1E1MA 5CB4F 4II3A 3LBIA 2P5UA 4O5AA 2CB0A 1MOQA 1NQOA 4OHVA 4QUIA 3EZ7A 4KQKA 4MJLA 4Y6RA 5HUJA 2IHUA 2QNRA 3ZWVA 5D86A 2Z98A 4XOUA 3LC7O 1FLAA 3FTDA 3H7AA 4XASA 3I2HA 3TNJA 2UAGA 3HABA 3JQRA 1FBTA 1HRKA 1PG0A 2BUBA 2WNHA 2IUFA 3AUAA 5ALTA 3OFNA 1VZ3A 2IEZA 4BZQA 5K0GA 4A10A 3BE4A 4QZVA 1H1DA 1I1HA 3U4MA 1K68A 3QX3A 4G01B 1MB0A 4QDJA 2NTJA 2UVPB 2BF7A 3JWEA 1QGUA 1QBKC 4HTFA 2OILA 3LBHA 2BCGY 3RNOA 2CLLB 1A9OA 3ZJTA 1XZMA 1LV8A 3EXAA 3IAFA 2H1CA 3ZE7A 4DCOA 5FFNA 1MAWA 2ZU0C 1FFEA 2AYZA 3THWA 3UAGA 1SMKA 4PLVA 3H9QA 4OUDA 1R9MA 3JWIA 4A8JC 3RDPA 5JATA 2QAGA 1M72A 4X94A 1C8KA 3S40A 2FYTA 1DGQA 3Q2KA 1CE8A 3UJNA 4JYPA 4MW1A 4N7BA 4MYUA 1X39A 3H17A 4YUXA 4EYGA 3THYB 1A0OA 3STWA 1FMLA 1V45E 1Y0BA 2WUGA 3GZTB 4H9GA 3OZRA 5DRYA 3TLZA 2FPMA 1UBSB 2OGTA 3ZNPA 1ZJJA 1JDJA 1QUEA 1DB3A 2FPPB 3PEWA 5FLEX 2R7KA 3CUUA 4N12A 2FX5A 5JO9A 1VKNA 2I87A 2HNBA 2W98A 3HUDA 1ZN2A 3FPFA 2C1EA 4EK9A 1P1FA 3J7TA 1T5SA 1D3AA 3R40A 3NATA 2O3SA 4UE2A 1YRBA 1OAOC 5FQNA 4NLLA 4A1OA 1OAAA 1E9EA 2V5VA 3BQMB 3NHWA 3GEPA 3DAHA 4M0DA 4H7KA 5DJ5A 2BBOA 3W5CA 1PBNA 1CETA 3HMKA 3O8NA 4HQ0A 1R3DA 4MVJP 4YWHA 3ZGOA 2J9RA 4WKNA 2WIJA 2ZYDA 4CIVA 1TU4A 5AI6A 4BUCA 4MYRA 4IUYA 3QXGA 1FTWA 5G3ZA 1HEYA 3ASZA 3P97A 4Y0NA 5HTKA 3AVTA 1IQUA 4NOLA 4M37A 3I32A 3A4IA 1AIPA 3CXUA 5HYVA 5A03A 1BWRA 4C5BA 3G0CA 4ZVPA 3OFKA 3OD1A 1AUPA 3ZQJA 4GM4A 3ZI7A 3BREA 2X8JB 5GZ6A 1MXHA 1U28C 3ZZNA 4DXDA 2OR3A 4MQFB 1UBFA 5AKLA 5IDVA 4X63A 1WXHA 1XRRA 3A4LA 3C3YA 5ALRA 1OX4A 2JF0A 3LECA 3W6ZA 4WFKA 3GRUA 1B0PA 1G19A 2TRSB 4OHRA 4EAQA 4XIGS 5MGNA 1G5PA 4GEGA 4UOQA 3V8VA 2R5FA 1G5TA 1L3IA 1E18A 2QXYA 4Q7LA 1G4AE 2EJUA 1EE9A 4QATA 1ZWKA 2B9VA 2FE4A 5JYEA 1A2OA 1WPQA 2Z4RA 3HM2A 2Y8EA 5TT1A 1Z18A 2X1VA 4AQYB 3IT3A 2V58A 4WAUA 2II6A 2QT0A 5HM8A 1L5MA 3OAAA 1Z6YA 3OF5A 2ZYSA 2B6NA 4LAFA 4D3SA 3DO5A 1YQDA 3D3QA 1C3LA 5DMXA 2VDRB 2ACEA 4IFBA 4WEOA 3KJEA 1VBFA 2GNAA 4UVIA 1F8FA 2DJIA 2R1UA 1M3SA 2CMKA 2XTJA 4RUKA 1LQ2A 1PNOA 1VJ0A 5LQRA 2G5PA 3AVVA 2WOOA 3QG1A 4FGKA 3UUFA 1BMFA 1J8YF 3W2IA 1T34A 1VHTA 2RHWA 3ITDA 3QPVA 4BB5A 1BD4A 2G40A 3FKSA 4HJRA 4IIFA 4A15A 1RKQA 2WTBA 2HXGA 5F1YA 1JKIA 2QRPA 5EJ6A 1U7DA 2AXNA 1OBVA 1W19A 3H9EO 3WMXA 1QU2A 3X44A 1KAHA 2TYSB 3SNKA 4DR5B 1IOWA 4MS3A 3DXZA 1U90A 2GLUA 3IAAA 2FI1A 4WBNB 2JEZA 5TX7A 1E1RD 2G28A 1FVXA 1KVTA 1XAGA 2NV2B 4MQUA 1U7WA 2PU7A 4HDQB 5AVUA 1C1DB 4XTRA 1ND6A 1NU8A 3KR9A 4FQ7A 1WLYA 4HBZA 5J2TA 1G6OA 1W48A 1GTJ1 3KEOA 4UTZA 5REQA 2GM5A 1TFUA 2C4TA 4N7MA 4ETNA 2PGNA 4D0SA 2V6GA 4DUYB 1BFKA 3FF1A 4ENSA 2C8KA 4F45A 2C31A 2FPLA 3X0DA 1GNVA 1YJBA 1EQ2A 3O8BA 4L0CA 2HXYA 3EDOA 2WJHA 1ZY2A 3MCUA 4E5PA 4UFPA 3PC2A 5J2UA 4WOKA 4CEHB 4V1CA 1OFGA 3AP1A 1NIPA 4LZJA 3RJMA 4NOMA 1X7XB 4FYJA 4EJSB 4PX5A 4G56A 3LKBA 5HIAA 2VWQA 4G85A 4OYLA 4OHFA 4NMHA 3WGYA 3QEOA 4Q3EA 4RETA 2IU0A 1LBSA 2FW6A 3L8EA 4F9FA 1E32A 5CA0F 5JALA 4S12A 2PGOA 1NJ8A 4MV4A 4I3FA 2FDRA 3GXOA 4L5YA 3ACDA 1NSYA 3PNBA 1HKUA 1JPJA 2OCAA 4P80A 4Z99A 2GFIA 3NHBA 1DOZA 2G80A 4EUSA 3THXB 5I8PA 1VE5A 4ROSA 3HEMA 3OKFA 3MBIA 2BHTA 1SQGA 4MGKR 3W2FA 4BV9A 4ZHSA 1XCGB 4RE5A 3Q7IA 5E9WA 2A7QA 3IO5A 3IHWA 3PE3A 1Q7BA 2O48X 4FE7A 4Y3UA 3WK8A 1W76A 3ORSA 2JHGA 1Y4SA 2OVBA 3KZCA 3NNNA 4RA9A 2WMNB 2PZKA 3GJSA 2MYUA 1N2CB 2JGMA 3LPAA 3NZEA 1R64A 3KBBA 2VYNA 2GN1A 4J4BA 5L8VA 1JTFA 2CVOA 4PR0A 4H1VA 3GLQA 2G76A 3AVPA 4EYSA 1C80A 2R6HA 3L40A 3L6DA 1ISPA 5KQPA 4XTCS 1NW9B 4EMSA 2M2IA 2BKLA 5FPSA 4EW6A 5LC1A 2F9MA 2Q6LA 3R74A 3SN6A 5J5VA 4O4LF 4J6FA 4C05A 4KREA 3IAS1 4TWZA 2A78A 3GCDA 4DA4A 4UHHA 4FCWA 1L5LA 2GM4A 4JI1B 2PQ6A 2E55A 4DA7A 5SZJA 1T5HX 1XAHA 2PZFA 5ARCA 3HB0A 4YP5A 3ETDA 1PLKA 1DINA 1D2EA 2W6PA 3PUJA 1OGIA 3AFMA 4S2UA 5CU7A 5JIBA 1XZFA 3DM5A 1EK6A 4LJ5A 2OO5A 4GI1A 1NRWA 2FZKA 3RS2A 4YAUA 5LJLA 1DC6A 1FRQA 1JA1A 4OHOA 4X24A 4XQGA 1QYDA 4AN4A 1E4VA 4D6PA 3FOCA 4PSKA 2CDNA 6CHYA 2IPMA 1RYBA 2WF5A 4JI0B 1Z6TA 1JYEA 3JU3A 4UDNA 1PD0A 5B7GA 4IIVA 2YZKA 4UUPA 1TJYA 3FYDA 1JLLA 1I32A 4MUIA 4QA9A 2QVZX 1Y8CA 2H2IA 1CSEE 3BUSA 3U3RA 1U4NA 1HR0B 1U3GA 2VSQA 1QLHA 1AC5A 1P1BA 1YQWA 2BZ1A 2HZ7A 2XQIA 3H9JA 1JN0A 1KSGA 2PMEA 4Y9UA 3RABA 5B2ZA 4A6DA 1N6OA 3MK31 1JFLA 3B9PA 3DMTA 3OZUA 1UIRA 2F90A 5LQNA 3G9XA 1E1LA 3BBPA 3MMXA 4NK5A 1E2EA 1Z6GA 3DD1A 3JWJA 3ZDRA 1RBMA 1Q3HA 3NM4A 5BV7A 5A71A 3M49A 4JCOA 2X0JA 3VBEA 1N5IA 2R60A 2X4LA 3JD0A 3VTKA 2N75A 5DYNA 3U56A 1NJGA 3L8ZA 3INTA 1KI1A 3O8QA 1Y7IA 3AW9A 3WL5A 2BGRA 1RJ9A 1B15A 1CRQA 1S4QA 5DBEX 4LYYA 3PQDA 4RTLA 4EO4A 5K03A 5BV8A 3MF4A 1RI3A 5BSVA 4EJ0A 4V02A 4QQNA 3V1YA 4KXXA 2VHYA 1XRSB 2X2FA 4IIXA 2PZGA 2NNWB 4M7OA 1A8SA 1QLWA 1TK9A 2ZPTX 3G23A 4RJLA 2XT9A 1QRDA 1Z6ZA 4ND7A 5TGDA 2WM9B 2QLJA 5I48A 1XCJA 1H5NA 3NHMA 1RM5A 2DUMA 3E6AA 2I8LA 4RZ2A 1TZMA 5JLJA 2P1DA 4LJ4A 1PQWA 2JI4A 1QXSA 1G0OA 3O95A 5DLPA 4D4JA 2ZCUA 1H0HA 1Z2PX 3HU1A 3IKVA 3OJWA 4RK4A 1WBBA 3QVUA 2Z0MA 3VRHA 1QRAA 2B1IA 2OXEA 2I2FA 2D54A 1J8VA 4YUZA 4LCEA 4AYXA 2JLXA 5E6SA 3RFTA 1HY3A 5JVDB 1VHLA 4FNOA 3HWRA 1UMCA 2BUCA 1YR7A 3OOYA 1KO4A 2C07A 4OAOA 5FV7A 1MD9A 1WCIA 2FEPA 2RJ3A 2B9EA 3ZK8A 2AZXA 5BQ3A 2JLWA 5L6MB 3GMTA 4G24A 4W4TA 1JEJA 4RKRA 2QPLA 3UWOA 2I6GA 2HK8A 3CF0A 1YUBA 1KZHA 1N0WA 1OHHD 2YFQA 2X0NA 2XOEA 4LXXA 3ZWMA 3QJ5A 3UGTA 3V5NA 1J5EB 1L4YA 3HZOA 3E9RA 2VLBA 1PDWA 4I4CA 1PEKE 1YR3A 2JRCA 2B35A 3CUEF 4U9UA 3WNQA 3CH6A 4Q02A 4PRZA 1U9YA 4ZU1X 1EM8B 2C2MA 1VL6A 2XWPA 3JQ7B 4A0QA 1GIAA 5ARBA 4LMAA 1LRJA 3KZXA 5TS2A 5JEDA 4DAOA 4DWVA 3CX4A 4ND2A 3ZBPA 1HG0A 1BXGB 3L6BA 1VFPA 4CEJB 2PYDA 2E1RA 4YNBA 1WXIA 1YBAA 5K0SA 1KDZA 3GRVA 3R8XA 4OKNA 4P3PA 4X1KB 2VQEB 1N2GA 3CCFA 5EP2A 1LZLA 3QWFA 4Q9IA 4B71A 4Q7JB 2CLEB 3H5OA 5ALZA 1L4NA 5K9ZA 5DSZA 5BPFA 1P2VA 1O57A 3C8HA 4DB2A 4EUEA 5KWVA 3UQZA 2HJHA 1CJMA 5DLEA 1DJPA 4R1OA 1E69A 2XQJA 1JDNA 1GARA 3VX4A 3OHPA 3VJRA 1ISIA 1SBCA 1YCDA 2JFZA 5C5DA 4NC9A 3LYLA 2BP7A 3R09A 6PFKA 3BHMA 3L7IA 4M76B 2FN4A 4JJ4A 4JL6A 5CB4A 5IX8A 3ZBQA 3DFZA 3R5TA 2JJ1A 4UD6A 5JAPA 4F4FA 1YTUA 1G7RA 5JJLA 1XNQB 4WLFA 4MI6A 1Q11A 1WD7A 5KYYA 3DCJA 1KY4A 5JT1A 1TD1A 5GTDA 1OFTA 2ZUFA 3PDJA 1DX4A 3OZVA 4ZQIA 1T9AA 1YBMA 2FEWB 3BWCA 3R3YA 2ABWA 4ZPXA 4ZU6X 1UINA 1SCUB 1CQIB 3P27A 2XB8A 1KDYA 4P4UA 4AXBA 5AFSA 2AEJA 1RLTA 3ZCPA 1H4TA 3ZU3A 4F2DA 1JXMA 4KRYA 3PL5A 3LDAA 3D02A 3NRJA 4M98A 2ISQA 2IYQA 5ALXA 1VE6A 5SV2A 4CIYA 3IOCA 1K9SA 1VMEA 3E9MA 2VHQA 3GARA 4ZAWA 1PJRA 2JBAB 5MFZA 2E5FA 1UMKA 2C5LA 4G8BA 1TI7A 2AMYA 2J5KA 3HJHA 4H3KB 4KO2S 1H2FA 2P9CA 5KSPA 1KTVA 3IQXA 4I99A 3WYDA 4H6PA 2NXWA 1QTRA 5AM0A 3CHYA 4YMIA 3TEJA 2OHGA 4DCUA 4ENQA 2AN9A 4I9NA 1MC4A 2GX6A 4FZ5A 1X7GA 3M0EA 1IJEA 4WK4B 2BI8A 1DOHA 3OJXA 3VVMA 2WWVD 4DN6A 3TL2A 4HS4A 3K0BA 4JMPA 1UBGA 3SXPA 2O05A 1DX9A 1V11A 4L73A 3VSEA 2BR3A 1D9XA 1DPGA 4LBVA 2OXIA 4AECA 4ZKDA 1TNDA 4KYIB 4G41A 1G5FA 3GP3A 4KXQA 1SXJC 3F9RA 3L4SO 4R71A 2EGHA 3PUHA 2C2WA 5DX8A 4DAEA 1P2SA 1NWCA 2DOKA 2X0IA 1ATIA 1V9CA 1ZH0A 5BR4A 1NG1A 3GUYA 4PNHA 3JZAA 5DULA 2C99A 2FPSA 2REQB 4BNFA 2TMKA 1SURA 3B6MA 4NV3A 3L1IA 1XZJA 3TLKA 3B1JA 5BWCA 3ZI4A 5TJ9A 3PXUA 4UMEA 4RMIA 2UYOA 1B74A 3U19A 1RM4A 1RU3A 3MJFA 1N5MA 3RYCA 1J90A 1AM4D 4PGGA 2Z2YA 2ZQ5A 3NTVA 3F3MA 4EA9A 5EFZA 3GGDA 2VXOA 2WHQA 5EXTA 4EIWA 1U7OA 3CZMA 1V71A 4L78A 3IIKA 1E64A 3KT8A 5BNIA 3AJRA 4K9SA 4OATA 1RHJA 4QEKA 5A6VA 4DBLE 1NVXQ 2H54A 1UAGA 5D1NA 3TX2A 2EBFX 2C2ZA 2G83A 5BWMA 1U2QA 1Q3TA 4GH5A 1G8GA 3B1YA 4TXJA 2A4KA 3GRZA 2VTKA 3SY8A 1UMBA 1I4TD 2MSKA 3EGOA 1N9GB 1QNFA 3SFVA 1N6RA 3GPCA 4KNYA 4TUYF 1WXXA 3ZDYB 3LKDA 4BJHB 2AI2A 2C4KA 4UAUA 3LK6A 2IPOA 2H2HA 3R9XB 1GITA 1I4WA 4HS9A 1T6YA 1X3LA 1L5WA 2O0HA 1VLHA 3B36A 3E03A 1ZINA 3VR5A 2DZDA 4RKEA 1M8KA 1NC1A 2FZ4A 1GDTA 2BLNA 4PC2A 2EFYA 1XFDA 4WVFA 4EB8A 4UHBA 2VHXA 3LWZA 4BP1A 1QRSA 4GYWA 3V2UA 4XX1A 2O5RA 2E4VA 4MUJA 1BQEA 1HGXA 3TIVA 3IAS6 1NNSA 1O95A 1PJTA 3RR2A 5BYJA 2F3TA 4MW9A 4M1TA 4JJAA 2PS1A 2XNCA 5CJPA 2A35A 2HWKA 3DVAA 3GO4A 4K9LA 5GM2A 1OI7A 2MSWA 3ADCA 3VPCA 2HCRA 2IYWA 4YRZA 4XX0A 2XZTA 2JAOA 2XYHA 1JWAB 2ANCA 2NU7A 4OQZA 2RCYA 3HFGA 2WVGA 4RK6A 3VV3A 1LVGA 5IWAB 2IBMA 4V0SA 3RAGA 1QLJA 3QX7A 3MELA 3WDSA 1PSDA 4EEZA 1CZNA 2CLIB 3ICOA 1X1EA 3AEKB 3KM0A 3M4XA 3M6XA 4GQAA 2EYQA 1TX4B 2ZK7A 4PZAA 3AUKA 1ENOA 4QEZA 4WZZA 1YB6A 2DWOA 2FP3A 2NU6A 2P90A 2YS6A 4H3VA 1FX0B 1CDZA 1DC8A 2PBZA 4KE6A 2VT3A 3BL5A 4PONA 4BNLA 1U0HC 1ICIA 1S8FA 3OO1A 1EDBA 2VDNB 4QECA 4DUPA 4DV5B 1VDZA 1L5YA 1O8BA 2ODBA 1NW8A 1G3RA 3TW4A 2R2AA 4BHTA 2CE7A 4CTOA 5AP9A 3B6IA 1OBCA 4W7SA 1CS0A 2X6RA 2R48A 1B2RA 3D43A 4JNKA 4G5RA 4RCVA 1TVEA 4UC0A 1I6KA 1ZK3A 2D2FA 3W78A 3IAEA 2IP4A 3OKCA 1TM7E 3MUEA 1O03A 2XGOA 1Q2XA 2YRXA 2C59A 3BTSA 4OL9A 4W1PA 5DNDA 1E5TA 1SHUX 4RXMA 5CA0A 5IK2D 4CM8A 4GLFA 4GXQA 3B1KA 4YQYA 1FP4A 1O7JA 3B2EA 3ENWA 4EI8A 1JAHA 3CEAA 4P22A 4X1OA 3OIGA 5LFAA 2GD1O 2D0DA 3E3OA 1CUUA 2OBLA 3PF9A 4B43A 3UCEA 2W2KB 3PXBA 3H0CA 3RC3A 2QOEA 4L22A 3U7QA 2SBTA 3KQMA 3GA5A 3SEQA 3T7DA 4JX9A 3QNMA 3ZBTA 3TOCA 4JXKA 3JARB 5HUHA 1I2BA 2FP4A 5EIBC 5COQA 1GEEA 5DTRA 1ORIA 3EXIA 3GLVA 4YJ3B 5E38A 2E4YA 4DUZB 3T3NA 1IXZA 2Z3ZA 1ACLA 1CP2A 4FEYA 3O4JA 5B37A 3WWZA 1XTKA 2HF9A 2GA9A 1BDMA 5I5GA 2VDOB 4XQEA 4GPD1 5KZMB 3ORFA 4AS2A 1XCMA 1HLDA 3D6VA 3QVLA 3I2KA 1YZVA 3TOVA 1FFBA 2DUUA 4O4LA 5IKOA 1KC3A 2PKWA 3LLSA 2YYZA 4NJMB 1S3IA 4FD3A 2F8LA 3KQSA 1UADA 1E98A 1F2UA 1MV8A 1Y3CE 2H29A 2QSZA 2Y0CA 3A2MA 3FNFA 3NBZC 1IMOA 3WL7A 2I6XA 2X9VA 2OQIA 1EFVA 4MS4B 2FWPA 5C8YB 3VUFA 2Y4OA 4EO9A 2C20A 2Y3IA 3C5EA 2FMFA 1JZSA 4PM4A 1XTUA 2B1JA 1RWBA 3F71A 2A33A 1RQGA 3UAXA 1UDWA 3VVBA 1NT2A 3Q8XB 4E1BA 2FSVC 4WT7A 1IPEA 1YQ9A 4PG7A 4JMLA 3U1BA 2PIDA 2IXGA 3AUUA 2RHHA 4NCKA 3E53A 1P9RA 3ENVA 4I6EA 4P0TA 2OFPA 4A6EA 4KAXA 1S7CA 2P3LA 1KP3A 3IEUA 1YC2A 4JVMA 4UEOA 5KTTA 4ER6A 3K9GA 4I55F 1ADCA 3QNWA 3G8CA 3JQAA 2K5UA 4WZAE 3WGQA 4HRAA 1EE1A 2PEZA 4M38A 3I52A 2Z1DA 5BVGB 1M75A 4L8FA 3VZRA 4XRGA 1MHTA 1M2OA 4DR7B 1KRHA 3RVRA 4F4DA 2O2DA 4Q4JA 5D3ZA 3ZTTA 3N0VA 4F38A 2OZVA 4FX2A 3BJRA 1WNFA 2AG8A 2HU7A 2Y2VA 3QOWA 5BQPA 3EPHA 1RJEA 3UHAA 2XXBA 1RPNA 2VNJA 3M4ZA 1DELA 1H3FA 1VL0A 2ZRJA 4YAEA 3VNUA 2AS0A 2O6LA 1P4HA 4CJXA 4LC1A 3ZCTA 1FOEB 1S2IA 4DPKA 3ZD7A 2X9GA 2NNLD 1U2EA 4ESHA 5KQLA 4LV6A 2CJWB 3VPFA 4UU0A 1E59A 5A05A 2ZSKA 5DYWA 3BD7A 3DAOA 4PINA 4HADA 2E87A 3OSZA 4BLPA 1QHIA 1EBFA 4KITB 4EENA 4DXAA 2PMWB 3AFGA 4MPJA 5DPMA 3WAKA 4EPWA 4J16C 1KJWA 4BVGA 4HX5A 3B82A 3I9JA 3LT5A 2WOJA 2X4IA 4S04A 1RABA 4IDPA 2UXBB 1T9HA 2Q46A 4NFLA 4R8VA 3OVMA 1WMBA 1N34B 1VI5A 3KYJB 1IZZA 1QM5A 5TLSA 2PJUA 2OCPA 3K4QA 5LOVF 1ZFNA 2JGFA 1N33B 4R8KA 4X8HA 1I3KA 1EA7A 1HQCA 1UBCA 3FA2A 1JDBC 5CPFA 4L4SA 3QELA 4MVJH 3QLUA 4TKLA 2OZLA 3C41J 4K9NA 5TR9A 2A58A 5E1MA 1KTIA 1N2JA 3L02A 1XKQA 4JITA 2XXAA 3AL3A 2RKBA 1OAKA 3JWHA 5IT5A 3KQQA 3OA0A 3EN0A 3FE2A 1W9MA 3AERA 3GRFA 1P7YA 1WW8A 5FI1B 1CJBA 4A92A 5C7OO 4UQLA 2XZOA 3FNEA 4ZK2A 1KS2A 2I2WA 5LIRA 2P2YA 3GUHA 5T5QA 1NZFA 2HBYA 2REXB 4G81A 4L85A 4J94A 4J0QA 1O6ZA 3U3MA 4QDXA 2JJ2D 2Y1GA 1IZYA 1TUIA 4D82A 2RHDA 2V8OA 5BUZA 2O0MA 2UVDA 3G13A 3T3OA 3LT2A 2RGAA 2MJLA 2Y9PB 4ABTA 2NYUA 2Z1NA 4TOIA 1GL7A 3ONWA 4L8WB 4TXMA 2UZ1B 5CXSA 4X64B 3UMBA 1SG6A 3MWDA 4K9OA 4M1OA 1KMNA 2J5XA 5DBHX 3AG5A 1TPZA 1YQUA 3FYUC 3GMIA 4UVDA 3WLTA 1CDOA 3A31A 2PS9A 3GLSA 4CT5A 4DNFA 3DE7X 5ALKA 1JXAA 2I2CA 4G63A 5FEUA 4AROA 1WF3A 1P61B 1Z12A 2LBPA 2C4VA 1X1CA 5I7RA 1IXYA 5JCJD 3LS2A 3U5TA 2HJWA 3BGOS 2IXBA 5CNIA 2OFFA 3S5JA 1SEPA 1IBLB 4P4LA 2W90A 1BVHA 3BMCA 1O5TA 1XLUA 4YLGA 2GNOA 5EWLB 3CY6A 5HIIA 3KEMA 2UZAA 3OQNA 3VHRA 4R05A 1FVOA 4TMKA 1LLFA 2RBEA 1R6AA 1Y80A 2D8AA 3BWEA 2WPDD 4ZXFA 1M2VB 3ZV6A 2QI9F 1JG4A 1SQ6A 5EIHA 1NVBA 1C8VB 3G8DA 1Q6YA 2J3DA 2QL6A 1WSAA 1KXJA 3TWOA 4C7JA 2O1XA 2IWHA 3AR5A 4MPRA 1FNMA 3AWDA 1YJQA 2G72A 3SLGA 3E5RA 3KB8A 4JJIA 4Q1CA 4JFRA 3VYRB 4NJEA 5JNTA 1UBRS 4NTZA 3ZWWA 5DYGA 1L5HB 2V4UA 2ZT6A 3VU1A 1A5SB 1JVNA 1F17A 2B83A 2WJ3A 4K6HA 3S2FA 2XUDA 5JWHA 4AJ1A 4XH9B 3PIDA 4KHZA 3CTPA 3UAZA 2OCXA 3F5QA 2VP9A 1GPMA 3OZXA 4MRMB 1R4MA 4AMBA 3TPZA 3ENZA 3L06A 3UPUA 3QA3E 3ICEA 2O59A 3AW8A 3ON5A 3ZV5A 3K4PA 1WZ2A 1B8UA 3EVFA 3IPAA 1L0BA 2GPSA 1E1YA 4IJ6A 4IVNA 4LRWA 4UMVA 2N46A 5H16A 2ZZMA 4PPNA 4JU8A 5LZ8A 2VEOA 1HTBA 3DFFA 2XUKA 1YK0A 2J08A 4ZVTA 1H3NA 4DOMA 3ZWCA 1ULAA 1AHNA 1TECE 2OBNA 2PL9A 2X14A 2Z83A 3U0BA 2CVQA 1JPNA 1WP4A 1CY7A 3A8TA 4C6TA 4NFHA 4YRTA 4G0ZA 3FROA 3T1YB 4CQMB 3R75A 3LA6A 4WIAA 1AS0A 1VHWA 4JX8A 4NU0A 4BLVA 2XA1A 4Y2PA 3C3WA 3ES9A 3JAWB 3NANA 1JEQB 1JI0A 2D62A 1G3QA 2EXXA 4LMPA 3ZEIA 5EHXA 1L4HA 3A4TA 1KQ3A 3W8EA 2L19A 1QRTA 2O1EA 4FHEA 4BWYA 3IJ5A 3U4HA 3F49S 3UA4A 4M9XA 1QH1A 3JD1A 3N07A 4A27A 4JKYA 4RH1A 4E1AA 1XUOA 1V5WA 2GEVA 3X43A 4A6XA 4G09A 4X85A 4WFJA 4F12A 1IZ9A 1EB9A 4FT4A 2H4JA 5LP6C 1SC9A 3KTDA 3WLOA 4BASA 4R6XA 1SQ5A 4B4WA 1V3UA 2HQSA 4WI1A 5JR3A 4DJ5X 2WTAA 5FL3A 3AFHA 1QH0A 2I71A 3JXEA 2AL7A 4Q1BA 1YNOA 4R9RA 5IJZA 3H3XA 4WSOA 4C88A 4UBKA 2X8AA 5DZSA 1JR4A 1PIWA 4RS3A 3GLKA 1B6RA 1GZDA 1Z2CA 3JAKB 1XA4A 2WT9A 2HJRA 3A7DA 3NVDA 3KEFA 4K2AA 1B00A 1CD5A 1KMIY 2CEAA 4NATA 3EHDA 4DJDC 1CS4C 3M4JA 4DVJA 4JC4A 4PWZA 2VK4A 3TCXB 1FPMA 3GNQA 1PEAA 4FTWA 4P08A 2A86A 4DRZA 4I4LA 4IRMA 3SZOA 3T3GA 1T13A 3QKTA 4WCFA 3BKXA 4B4OA 4E5UA 1H4QA 1YNSA 4ZARA 1ZBQA 3OWHA 2PA0A 1A1VA 3KSDO 5LYJB 3CINA 4CCYB 2G1AA 2HH9A 3R3XA 4R6WA 3RODA 5AVRA 2C78A 3A6FA 3PBKA 1G55A 4ZZ1A 3MGBA 2OC4A 4M9SA 5AI9A 5FOUA 4OA8A 3A9SA 5D6NA 3BB1A 3I1FA 4D4LA 4Y2YA 5IJ9B 2V1UA 2GM9A 4BWVA 2PN1A 1ARZA 1L8LA 2QMUA 3CJTA 1CUGA 1VRCA 2DKNA 4INPA 4QVKA 1HEIA 1R0WA 4TUYA 2CCJA 4I1YA 1J9ZA 1WTAA 3NHRA 2XLBA 3PUWA 3G89A 4IH9A 3VTZA 3W77A 1XMQB 3GDGA 1ZRHA 1RYFA 4X7BA 4HGRA 4I3HA 3B6EA 1KJYA 1LDEA 4AKSA 2R25B 1RHUA 4CM9D 1Q7RA 2ZYVX 3ZE9A 3AVUA 4FFOA 2WF6A 4GS5A 4O4HF 4RY0A 4BV3A 5E6RA 1ZD9A 3BIWA 1JR2A 2J45A 3AHHA 3BXFA 4UD2A 2C94A 4TLMB 5T41A 5TQ0A 1WUYA 1YCFA 3WLEA 4GM1A 4XEHA 4A16A 3ZH9B 3TLYA 3A9UA 4YT5A 1XEWY 3Q0EA 3LPMA 4MCHA 4YAGA 1NURA 1RJDA 3QE9Y 4OF4A 1FVFA 3E3AA 3ESZA 2YV1A 2GRAA 3Q7EA 4JR0A 4UKDA 1E8MA 2DWPA 5J23A 5F9FA 5BW6B 3OJOA 5FWNA 1IJFA 3C48A 3EXG1 2A30A 2XRYA 1OKKD 3ZE2B 4N01A 3VAYA 4FWTA 2POQX 1GG8A 3WLRA 1Q16A 3F7NA 5DO9A 3R2JA 4M89A 2ROQA 4JOBA 4LN1A 4BEWA 1KARA 4XWOA 3DBVO 3SZRA 2VDVE 1KU0A 3MGCA 3X2FA 3GJ7A 3ZVNA 1IEWA 4KE7A 5LA6A 1PS9A 4YIKA 2BYTA 4QHSA 2EKPA 2BN4A 3L5KA 1JU9A 3HBNA 3S2IA 1GY8A 1M2HA 5HQ3B 1T5TA 1X8XA 4UHJA 1PR1A 1ZGBA 4LV5B 2MTBA 1V5FA 4Y0VA 5CX4A 4YP0A 4QLOA 4ZD6A 3RJ9A 3BGDA 4KKVA 3TNYA 3N3AC 3HM9A 1FTGA 2RGCA 5FCDA 1G9TA 3ER8A 3T4UA 4OMFG 4U6QA 5FA8A 1F3OA 1AUOA 2VXBA 1AKRA 1DC3A 1GG9A 3AIMA 2FEOA 4UBOA 5FXMA 5LXTB 1GTSA 5F1KA 2ZXEA 1ZZGA 4OXKA 1I51A 1T1GA 1AKYA 4F6RB 3FPAA 2SECE 2WU4A 3H16A 2HWUA 4FJ1A 3CNBA 3PD0A 3OQPA 1JLSA 2QE7A 5F12A 5FLXA 3GJ4A 2CK3A 5KS2A 4PCUA 1UMDB 2FPGB 3MG9A 1PFYA 4CHGA 3HZRA 4WTOA 1UJCA 1VYTA 2I03A 1UPCA 3FCXA 3G2HA 3H19A 1Q1EA 3PQ2A 2E82A 2P9FA 4H77A 4IHKA 5ALUA 2AE2A 2W2MA 4F5EA 4I9UA 3DB1A 1VYVA 1EK2A 2V6IA 3OZ7A 4LOKA 1YIDA 2XQKA 1SB8A 3AY6A 4FUTA 2A5LA 4PBRA 1NNI1 3U7IA 4BNGA 5JAOA 5JY6A 3DT6A 1F38A 1JHPA 1FUEA 3CRMA 3FR8A 3PSAA 4EGQA 1ZM3A 1NUUA 2CFTA 3N0TA 4W9NA 3OM9A 4LJ6A 3QTLA 3OCJA 2CFIA 1XNJA 1NVKA 3HVIA 3FCAA 3JQBA 2B5WA 2EIXA 5KWSA 3I45A 3OJEA 5J63A 1GYQA 2A8YA 3I39X 4C6SA 1E9FA 1KP2A 1U8UA 2XYVA 1FXUA 1RWKA 2ZT8A 4X1IB 1DHTA 2XOKA 5DWDA 2D7JA 3ND9A 3A1EA 2AXQA 3WMWA 3IOYA 4L51A 2BFEB 3GGSA 2JGDA 5HM6A 3GA0A 4RYDA 3N8NA 3R5XA 2ZSHA 1E7SA 2X4DA 1DO0A 3CGGA 5D87A 5DW3A 5DSTA 4LXUA 1KZ4A 1XD8A 1JG3A 3BIOA 3GELA 1SJ9A 4ON9A 3B1ZA 4CF5A 3H97A 3PQ5A 4EH1A 5J4VA 2AFIB 5AVSA 3CLTC 3VPAA 3DLHA 3F7TA 2C42A 6NULA 1LDNA 5IUJC 4P5EA 3G49A 1VM6A 2QROA 5LZ4A 2JL1A 3EPLA 3AF6A 1PG5A 2ZUWA 4MUYA 1W96A 3IV6A 3CVXA 4G0VA 2DFNA 3H18A 3ZJ5A 2C00A 4I55A 3VZCA 4FU0A 3GUVA 1Y6FA 4N5MA 3KVNA 1Q44A 2CDCA 3F3YA 1WXDA 4CMEC 2NZJA 2R6DA 3CU5A 4XWTA 4BL5A 2ORIA 1IVNA 4WXMA 1IY9A 4NENB 1WHSB 1FTSA 3U5ZB 3AVWA 1JLMA 1KHTA 1Q7CA 4MJ7A 2IX3A 4WESA 5AIBA 2QTHA 2EGGA 2NZYA 2UVQA 3QY0A 5EMHA 3C7CB 1ZHFA 2ZRQA 1U11A 4HMQA 3GWGA 4F2HA 4YWJA 4E46A 2Q4DA 2Q6KA 1OXMA 4IJKA 1J49A 4RKYA 5TQ2B 2WV7A 3VPXA 4QUHA 1WM1A 3EXEB 1L7XA 3EWSA 4IZOA 1C9KA 1H69A 3E9YA 2RGYA 3D2BA 2O8VA 3CSDA 4W99A 1J0AA 2YWDA 4DM3A 4FFLA 1VMIA 4R8RA 3N8GA 4L8LA 4NHOA 1P7WA 2XMSA 5EXSA 3I0ZA 1KEEA 1OFHA 2H0QA 4JQOA 4LPSA 1QG6A 4FOTA 1W1UA 2OHIA 1V43A 4UU1A 3TMYA 2O8EB 3FYTA 5FLKA 3U26A 3WAGA 4YCCA 3E9QA 4DC1A 3TAUA 4OIFA 5LOVA 4WOJA 2WWRA 3KOMA 2CT8A 1U8FO 1Z06A 3OQOA 1L1RA 3NORA 3PXAA 4QUEA 3J81k 2ONZA 3GJZA 5E2BA 4X1YB 2XRZA 5ES4B 4NYIQ 1QYCA 1KI6A 1YZUA 1W52X 3ZY6A 5FBWB 4DE5A 5ALYA 3WRVA 2HK7A 3H7IA 3ZY3A 5MF6A 2IUEA 1J1UA 4DIKA 3KDSE 2VP6A 1J0BA 1BOFA 3C3PA 1ZR4A 1N6LA 4Z49A 1O1YA 3HI6A 1DJQA 3N2EA 1G41A 1JG7A 4PZEA 2DQYA 2J6IA 5F3DA 3TNFA 4D41A 1RRCA 3VJKA 4Z54A 5AK3A 4LF8B 1A76A 1F5NA 1O6FA 5A02A 5DN6A 3U80A 1NBEA 1SXJE 9LDTA 3KHTA 4B3CA 3PHIA 4BEVA 3BK7A 3K05A 4G2NA 3A2KA 5CDTA 3WGKA 2FWJA 3MINB 3DV9A