2E6UX

Crystal structure of hypothetical protein ph1109 from pyrococcus horikoshii
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
142
structure length
142
Chain Sequence
MEETRPIDGLTDEDIREILTRYKKIALVGASPKPERDANIVMKYLLEHGYDVYPVNPKYEEVLGRKCYPSVLDIPDKIEVVDLFVKPKLTMEYVEQAIKKGAKVVWFQYNTYNREASKKADEAGLIIVANRCMMREHERLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PH1109
publication title Structure determination of a novel protein by sulfur SAD using chromium radiation in combination with a new crystal-mounting method
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 48
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF13380 CoA_binding_2 CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2e6uX00
1PZGA 1LDYA 4WJZA 3GDOA 3QVXA 1GPDG 1ZK1A 3WGTA 4XQEA 3IKTA 4J7CA 3BMNB 3KXDA 3SBOA 3B1KA 4MVJM 1QYXA 1T2CA 3KM0A 5KVCA 3IUSA 4Z6KA 4XWYA 4YBZA 2D2IA 4NFSA 1E3IA 1FXSA 1PEDA 1E7MA 2WSBA 3QVWA 2X8LA 2VYND 1VJTA 1CWUA 5BSFA 1PR3A 1EBUA 3JQGB 1HKUA 5HS4A 3C24A 3C7CB 1RM4A 3VKVA 4ZD6A 3ASVA 1LBEA 2FR1A 4DPLA 3QY9A 3GUYA 1ENYA 3GHHA 1B3RA 3PWKA 2ZKLA 2IEBA 4IXTA 2Y0DA 4N5NA 4CLHA 4DQVA 4HNHA 2Y66A 4NQZA 1IL0A 2B0JA 2GERA 2OP1A 2IRWA 4CUJA 2QX7A 3VTZA 1LSSA 3OM9A 2ZCVA 3DFZA 1Q1NA 3FNEA 1MA0A 1E3EA 4IGEA 2YV1A 4OL9A 4GVLA 3U49A 4KWIA 3D5TA 2EGHA 2UUPA 1I3KA 3Q0EA 2VYVA 5B12A 3LT1A 1GV0A 1EEHA 1DLJA 4MIOA 1PQPA 4DMLA 3W8EA 1HE5A 4R68A 2YV2A 5JCJA 4TROA 3OETA 5BSEA 1KY4A 3PJEA 4B4VA 3UAGA 1ADGA 2IZ0A 4Q3CA 5A03A 2OORA 2X4GA 4D41A 4L4XA 5G0SA 3ZWMA 1B0AA 4GX0A 4W6ZA 4KTTE 4IDBA 1ZXLA 4ALJA 1KVRA 1Y81A 2B5WA 1ISFA 2PR2A 1MLDA 3JYLA 4GH5A 1ZW1A 4I9NA 1MFZA 1LEHA 2JHGA 1P74A 2GASA 3N7UA 4TSKA 4ZGWA 3F46A 1EZ4A 1P1IA 3DFUA 1Y8QA 5BSHA 1EUZA 3PJGA 1SO8A 4UEJA 5TIIA 1RJWA 4ILKA 3IOYA 4NMHA 1AN9A 4JGBA 3OQ1A 4PZEA 2WM3A 5JDIA 4RCVA 3D4NA 1F8GA 4HUJA 3KB6A 2GZ1A 3A4VA 3OF2A 4NPCA 4CQMB 4A5OA 5GZ6A 1P1KA 2HMWA 2FZEA 2PA3A 3DHNA 5EJ2A 3TN7A 1XLTA 4MVJH 4XD2A 2H5LA 4JK3A 1YWGO 5JFOA 4P4GA 3QHAA 5BNFA 1EQUA 1YS4A 4RZHA 3L6EA 1V3VA 4D0SA 2I5PO 4BL5A 3V1TC 1HSOA 3MOIA 1H2BA 4JLWA 1GTMA 4JBHA 4II2A 4UEOA 4XJTA 2O3TA 2VRCA 1BMDA 2NTNA 4J1QA 1NPYA 2C2XA 4GLLA 4CR8A 1WAMA 5ITVA 1IULA 4DIFA 2YUTA 2BFOA 4IZIA 3OIDA 2EKPA 5H82A 4BO6A 1GUYA 2AMFA 2ZB4A 3HB4X 2NVUB 5JE8A 9LDBA 5G4KA 5KNLA 3WYEA 4ALLA 1UXJA 3NDIA 4IGFA 3QJ5A 3WTBA 1V8BA 3NUGA 3H6KA 1BW9A 3E9MA 2CUKA 1XYGA 1JKJA 2EP5A 1YL5A 3BMQB 4E0BA 4J4HA 1J6UA 2X1HA 5KOIA 2J8ZA 3H5RA 3DXFA 3PFFA 1I33A 1ZSYA 3QRWA 4GWKA 4J0EA 2NV6A 5L40A 3H9GA 4MVJD 1SBYA 1D8AA 4U0JA 1UP6A 4CMKA 2JAHA 3M1AA 4UUOA 1D3AA 3E6AA 3DBHA 3TL3A 3R1IA 6LDHA 4AJKA 3NAQA 3ENKA 3QIVA 2JFGA 3CEAA 1D7OA 3DC2A 1UR5A 3CMCO 3F4BA 3RIHA 1F17A 4MP6A 3ST7A 4PG6A 3IUPA 1U7HA 4QO8A 2FSVA 4KUEA 5JCXA 1N7GA 1GZ3A 5KJFA 2Q1UA 5AYVA 4KQWA 2XAAA 1R0KA 2WD7A 2Y1EA 5KVSA 2Q1TA 2DUWA 4HV4A 4UULA 4D44A 1HE2A 2HJSA 3O4RA 3RUHA 4I8XA 3AWDA 4IIUA 3T7CA 4R9SA 4LW8A 3S2EA 4GMFA 3JQBA 1ISHA 4PGFA 1GFSA 4GLOA 5JAMA 3S2FA 1YL6A 1E7QA 1NVMB 5ES3A 4NJMB 4BGUA 2RIRA 4AICA 1SPXA 3JQ9C 4WOKA 3H65A 3PTZA 5THKA 5AQ1A 1A4IA 1TT7A 4J7XA 1SCUA 1N8KA 2BI8A 1D1TA 1NYTA 1QYWA 3AU9A 2VYVD 3GEMA 3QVTA 4IDFA 2PWZA 1DFIA 4WCFA 5DDIP 3DTYA 2DTEA 2OXIA 3ZV6A 4FGSA 3PHJA 3W1VA 5HBRA 1KYQA 1HDOA 1Y1PA 1PWZA 2PGJA 3H8VA 4Q3EA 2AW5A 5F1PA 4RLSA 5HRUA 1DJQA 4GX5A 4NI5A 1GV1A 4Y8VA 3D3WB 5JAIA 3UH1A 2C7VA 5CDYA 4R5MA 3E82A 3JYNA 2J5KA 5T57A 4YT2A 3VZPA 3PWZA 1XHLA 1R16A 3MJTA 3CXRA 3OJLA 3R6DA 1U5CA 3OA0A 1TLTA 1N1GA 4W4TA 4OM8A 2IZZA 3V2UA 3UGKA 2V6MA 3LC7O 5KJEA 3KZVA 1ID1A 1H0KA 2BI7A 3OP4A 4Q39A 3FD8A 4O6VA 4QXMA 5A05A 3GZNA 2HJRA 5KKCA 3DDNA 4AJNA 4DC1A 1C14A 4E5MA 2VQ3A 3PEFA 5U1PA 3KO8A 2G0TA 4CQLB 1E3JA 1HDGO 2CFCA 1A72A 5T5QA 1X0XA 3QWFA 4MIYA 4E2XA 4EYEA 2PD6A 4E3ZA 5A4DA 2YV3A 4RORA 3AY7A 2HMUA 5HA5A 3CUKA 1XIVA 4J3FA 3WLEA 3HUDA 2AE1A 4O5OA 4WASA 3FHLA 2CF5A 8LDHA 4PZDA 1HDYA 1GADO 3ZWOA 2RAFA 4EGFA 4WCDA 1QKIA 1HZJA 4MPDA 4WUVA 3I4FA 2JL1A 3G79A 2OUIA 4CM9D 2FMUA 2BELA 3DMYA 3C7AA 2AQHA 1OC2A 2X0NA 2Y1DA 3PXXA 1OZAA 1O8CA 1SAYA 5DF1A 4CPDA 4PG4A 3RUDA 2YQ5A 4AJIA 5TT1A 5H81A 2X0RA 4MOWA 1HF3A 4ALNA 2YYYA 5TT0A 4C7KA 4DXHA 1YO6A 5AVOA 5KJ1A 3GRPA 2NVWA 3KBOA 3QA9A 4XR4A 2E6UX 1R66A 3ICPA 1UAGA 3S2IA 1H93A 4ZQEA 4EEXA 5B1YA 4JJGA 1N7HA 1PR9A 1XSEA 3JV7A 4MP8A 4RF2A 4RPKA 3JQ7B 5CFZA 2D5CA 1DRWA 5GMOA 3ANLA 4RQUA 5DNAA 4CM6A 3TFOA 3JQGA 1LC0A 3PJDA 1LSUA 3AM4A 4Q3AA 1N92A 3PHLA 2YJZA 2J3IA 3KYDB 4TMFA 3TJRA 1PSDA 2Y67A 1NHGA 4W9NA 1TI7A 1KY5A 3AUTA 2I3AA 2X9GA 1A27A 1YBAA 1JN0A 1W0CA 1HDRA 3I6IA 4FJ0A 4W99A 2VT3A 3BTOA 4AJ4A 3L4BA 2EKQA 1U1IA 5ICSA 1V3TA 4WKGA 3FTNA 1WZIA 1RM0A 5EESA 4FOOA 4RF4A 3Q9UA 1G0OA 4JN6B 4YRAA 5BQFA 1XGKA 4L0QA 4U0KA 4Y6PA 2RHRA 3E9NA 4YVFA 5DT9A 3WGHA 1DOHA 1SEVA 4YRBA 2GF2A 3PK0A 1ML3A 2IXAA 3B6ZA 4LSWA 1ZSNA 2X22A 3RBVA 5I9MA 2EJWA 2XPCA 2ZB8A 1X7GA 2HCTA 2OFPA 2Y93A 1GEEA 4GKVA 1V6AA 1KVQA 2HK8A 1I5RA 1XQ6A 2X6TA 3PLNA 4IPTA 3W4KA 3NTRA 1KETA 4OO3A 5TJHA 2IODA 1C0PA 1B8VA 1TB4A 5EIOA 3GFBA 3DHYA 4EI2A 1FDTA 4K26A 4EJ6A 1GCOA 3WQRA 2E48A 3HB5X 3OQ6A 3ZH2A 1VL0A 2GGSA 2AXQA 3QP9A 4LSMA 1LRKA 3P19A 3CIFA 2O23A 3INRA 4CLOA 2IDZA 1VRWA 3BMOA 3VPSA 1B2LA 2P9GA 2JCYA 1MB4A 1R12A 1CQJA 4W7HA 3WMWA 3K92A 4RVSA 4TRJA 1AHIA 1IHXA 2J3HA 2AA3A 4OKNA 3MJVA 1F8FA 3NT5A 2Q99A 3F5QA 4LRSB 3LU1A 4RZIA 3TRIA 4IINA 1EVJA 1EUDA 3VC7A 5CDGA 1JKFA 3RKRA 3RWBA 3GN2A 3NEPX 2PZJA 1Y8RB 4Z0HO 4XGNA 1RKXA 3NTQA 1WMAA 1WLYA 4XRRA 4CV0A 4NH4A 3IMFA 4GGOA 5L3ZA 2BLLA 1BSVA 5T6BA 1Y5RA 4GSKA 2NNLD 4B3IA 2NQTA 1HLDA 1P44A 4QT0A 5DOZA 5T8KA 3W4JA 4BNTA 1RYDA 4QSMA 2C59A 4KWHA 3PQDA 4PLZA 1QMGA 4ZQHA 4B7XA 3PZBA 4U6QA 1L7EA 1LJ8A 2DUUA 4MP3A 3U0BA 2GD1O 1YVEI 1X7DA 4FD3A 5IN4A 1M2WA 5DBGA 5JDCC 4YT8A 4R1UA 1AE1A 3NGXA 4O63O 5KCZA 4G65A 3RSHA 1LX6A 2GZ3A 4FFLA 4XGIA 2P9CA 1DHTA 2YFHA 1U9JA 3F1LA 3IC5A 3T4XA 1T2EA 4ZICA 3CH6A 4WE3A 3WGQA 1BXZA 2JHFA 2V6FA 1HYGA 1VPDA 1EE9A 3E5MA 3GT0A 1S7CA 3BMQA 4BIIA 5IF3A 1YJQA 4J1NA 4UUNA 1U3WA 4ROSA 1ZK0A 3NT2A 4D79A 3SJUA 1F0YA 1NTOA 5FFFA 4D3FA 3HADA 1WP4A 3ZU3A 5GZ1A 1GY8A 3WNVA 5HTOA 3BAZA 3GDGA 3HSKA 4O1MA 1MG0A 1ZBQA 4DREA 4YR9A 5F1KA 4OXYA 1EBFA 1DBVO 3KETA 1LUAA 1C0LA 2PZKA 1DC4A 1P1HA 1R4NB 4J4BA 4PVDA 1CETA 4XRGA 1KBZA 4R3WA 1LA2A 2I9PA 4S1VA 3FBTA 1MC5A 1H2HA 3PGXA 2I65A 4II3A 5IFLA 3WWZA 2OGUA 3TZKA 1ZCJA 7ADHA 5BNTA 2X23A 2DM6A 4PG7A 5JC1A 4UVGA 3TOZA 4GSLA 4PG5A 1ISMA 2O2YA 1JVSA 1ENOA 3KEOA 4BNXA 4BNGA 3FTPA 3E03A 1NHWA 5TRTA 5ITWA 4PLFA 3AFMA 2PLAA 3MCVA 5G0TA 4XIJA 1ZMTA 4BNNA 3I3OA 4CM1A 4DTIA 2GO1A 4PRKA 4URFA 1GQ2A 2VHXA 1FDVA 3I9OA 3KRTA 5F3RA 1MXFA 1ULSA 1YDWA 4XYEA 4ND1A 2D8AA 3PDJA 3ICCA 1X14A 4GAEA 1FDUA 1YXMA 1ZK4A 2Y99A 1VSVA 2P9EA 4BO3A 3FNHA 4CJXA 4FC7A 1LDEA 4CLRB 3E5RA 3ZGYA 4WGGA 1ZVMA 1GU7A 4IJVA 3UN1A 3SLGA 2B37A 1I2CA 3HNPA 1KEUA 1PZFA 2P4HX 1QSGA 3OECA 5CEJA 5L7TA 3AUSA 3GY0A 3F5SA 2BF7A 4YJHB 3JQDA 4PG8A 5FI3A 3ZNPA 3U4DA 2PY6A 4MO2A 3IKVA 5G0WA 5U9CA 1ORRA 5BR7A 3JQAB 4Z9XA 3DBRB 4IIVA 3RFTA 1H6BA 1NWHA 4RPJA 4BMSA 1H5QA 1MGOA 1PZEA 2VHZA 2Z1MA 3ZW8A 3ZU2A 3GG9A 2UVDA 2X5OA 2J3JA 4MIEA 3OFSA 3WQQA 2QRJA 4CMEC 3N58A 3DZKA 4CQMD 2JD2A 2YHIB 2WYWA 2GN6A 3H3JA 3H9QA 3PLRA 4FBGA 2NLOA 4JP3A 5MGBA 4PLTA 1WPQA 1Q0HA 2JD0A 3PQEA 1HXHA 2NVBA 1DLIA 4JBGA 1BXKA 1A7AA 4BNYA 6ADHA 2X5KO 4M87A 3NGLA 4JIGA 4HP8A 3CTMA 3ZCXA 2CVZA 2QZ9A 2EEZA 3AM3A 2R00C 4MVJF 1SOVA 5EPOA 4CQLA 4R4JA 2P91A 2GZ2A 4O59O 1BHSA 3FSRA 1VLLA 2YW9A 2H6EA 3MTGA 4ID9A 3SX2A 4E30A 2QRLA 5I8ZA 4UUPA 3ZZNA 5A9SA 2P68A 1YRLA 4CUKA 4MVJA 4J0FA 3VKUA 3ITKA 2Q50A 4DIOA 1EQ2A 3K30A 3MJCA 4DYDA 3GEGA 1DJNA 4E2YA 3FWZA 2B35A 3L9WA 2G5CA 1FK8A 1Q7GA 5TS3A 3QWBA 5CPFA 2DT5A 2ILTA 1NASA 4YDRA 4L73A 2WEKA 4D42A 2GRAA 4HNGA 4KUHA 4WNCA 1P9LA 5AOVA 4N7RA 3S1LA 3V2GA 4K1LA 1RYEA 4HWKA 4BNMA 2EWMA 4QUKA 4A10A 1HETA 1UZLA 4J16A 4IMPA 4EDFA 3DZIA 3E8XA 3UCXA 3ZU4A 3HQ4O 5CDSA 5DCYA 4JBIA 2D4AA 4DPKA 2PNFA 2R2GA 2FPGA 5IDYA 4BQRA 1GYQA 5AXCA 3BTVA 3WGIA 3WS7A 1U3UA 1UXIA 1I30A 3UW3A 4DBVO 3JYOA 4U6SA 3V1YA 3GK3A 1C1DB 4N54A 1MG5A 2JAPA 4F46A 4S3MA 2CDCA 2R6JA 3JQFC 5TC4A 3PJFA 4E13A 4DLAA 3EMKA 3LVFO 3N74A 5DN9A 2DQ4A 3H2ZA 4AFNA 3VZQA 1A71A 3JD2A 3MTJA 1PGQA 4B4UA 5F21A 2ZTUA 3GNSA 4I1IA 3T4EA 4IDEA 4QTZA 2W2KA 1ZXBA 1ZK3A 1E7WA 2ZK7A 5TF4A 4AJ2A 2ZQYA 4PCVA 1PGNA 4G81A 1MFPA 1O9BA 5TGDA 2H63A 1L1FA 3RFXA 1E92A 5I7EA 1EDOA 2QRKA 5L45A 3P5SA 4IDGA 3AOGA 1O0SA 2NU9A 3WDSA 4R41A 3LLVA 4KOAA 3DZFA 3TDKA 1DRVA 1U8XX 1ZK2A 4FFOA 4CM7A 2VWHA 4CLDA 1JLLA 1EE2A 3GGGA 1X15A 1PJSA 4TWRA 4AG3A 4XB1A 2B4QA 2HUNA 4EJMA 5LCXA 5EMHA 5JMPA 2HKIA 3GMSA 3OICA 1T26A 4YXFA 1E6EA 1GPJA 1P0CA 1HL3A 2IZ1A 2DTXA 3LQFA 1I32A 4QQRA 1Q2XA 2NU6A 4RLHA 4NJOA 1JTVA 4EBFA 2X0JA 5JO9A 3UHAA 8ADHA 1YOVB 3OIFA 1R4MB 1I0ZA 3OMLA 3PFWO 1E1LA 3QV1A 2H1SA 5JDIC 1I10A 2QIOA 3C85A 4FPXA 3M1LA 2WYUA 1LRJA 3ZU5A 4U7WA 3UUWA 3AM5A 1JAYA 2BRUA 5CDTA 3LLSA 1ZH8A 4I5DA 4PLVA 1NPTO 2W90A 1F12A 3PRJA 1J0XO 1N9GB 4ZRMA 2IYOA 4FS3A 3ADOA 3EZLA 3GA0A 4RVGA 1PS8A 3VDQA 1X7HA 3PIIA 4YAEA 2PKQO 3D5QA 4GMGA 1HT0A 5CDUA 2V6BA 1NAIA 2BGKA 4EUEA 1SZJG 1QP8A 1WNTA 1E3WB 1IZ0A 2CVOA 4B4OA 4CM9A 5C7IO 5IAAA 2F1KA 4Z0TA 2GN4A 2JCVA 2WDZA 5L53A 2O3JA 3L77A 2WJPA 1H6AA 4JROA 4YAJA 1PJ2A 3ZNQA 4XQGA 3WR5A 1J4AA 1G1AA 3RASA 3QVOA 2PH3A 3KYCB 4RVUA 2VT2A 3COSA 3OHSX 4L4RA 3JCZA 4CM8A 2P5YA 5L4LA 5J23A 1PX0A 5JMWA 4ND4A 4CMCA 2I76A 1XDWA 3AW9A 4QECA 4E33A 1QLHA 1XQ1A 2YDXA 3AUUA 3K96A 2JD1A 4XYMA 4Q9NA 4ZRNA 2W2LD 1C1XB 2C29D 1NXQA 4OOFA 3H9EO 5MDHA 4R1TA 1UP7A 4CL8A 1CYDA 2NACA 5EL0A 1DEHA 4FW8A 2VHWA 2WD8A 3RC9A 4ALIA 1E6WA 2Y05A 2DFVA 4BO5A 1JDJA 4IUYA 4OMUA 4KZPA 3DBLB 1NX6A 4HBGA 3PP8A 1GL3A 5TNXA 5TX7A 4NBWA 4C4OA 4UEKA 2FN7A 3GPDG 2HDHA 2AEMA 3JSAA 2LDBA 4JXKA 2QYSA 4CM4A 3BA1A 3G17A 5BNIA 1QV6A 1UAYA 1ULUA 3F4LA 3PHHA 5CG2A 2C82A 3GPIA 1LLCA 2HRBA 2PGDA 1K6IA 4A26A 4L8VA 2RH4A 4R69A 3ZDFA 3GF4A 4YWJA 4CMIA 2VUTA 2OHXA 3OBBA 1LLUA 4FJ1A 4NR0A 4ZVVA 1K3TA 4TRRA 3U9LA 3I5MA 4GQAA 4B7CA 2OZPA 1HDCA 4YJFB 3JQBC 3ITDA 4PLGA 2FZWA 2OL4A 3DOOA 3LF2A 4Y6SA 3OQBA 3BMCB 3EVNA 2Q4BA 4XQCA 4DVJA 1YKFA 3NDJA 4XZ3A 3PZRA 4GGPA 1IE3A 3DZBA 3BHJA 4J90A 1GEGA 5CHEA 2CNBA 3TQHA 1NVTA 3IP3A 3MWEB 1BXGA 4BO0A 3PDUA 4A0SA 4ZQFA 2A94A 3LT2A 1GCUA 3Q1LA 4FR5A 4WCFC 2BFPA 3RC7A 2ZB7A 4IJUA 3SC4A 5FF9A 1QR6A 4PLWA 4R9RA 2VWGA 2HK9A 2G76A 3DONA 4RPHA 1I3LA 2XXBA 4G2NA 4YB8A 4E5PA 3ZW9A 2D3TA 5TLSA 1B16A 3FBGA 1YB5A 5A9RA 2X9VA 1EFLA 1DIGA 1T4DA 1E5QA 1X1EA 1NFQA 3IS3A 4RPLA 3VAZA 3L9XA 3F1KA 5I9LA 1J49A 4M8SA 4OYRA 1DDOA 5HM8A 1CDOA 3L6DA 1OI7A 1J5PA 1T4BA 2O50A 5IXYA 1LNQA 4CV1A 2C07A 2WMDA 1EK5A 1PJBA 1JWAB 2CVQA 2UV8A 4XYGA 3C8MA 1JWBB 1NWCA 3JQ8A 5JBIA 1FMCA 1ISJA 1Z82A 3IDSA 1QRRA 3JYPA 3W8DA 1HLPA 3AOEC 3OEWA 1GZ6A 3HFGA 3INTA 2Y68A 1FF9A 5F5NA 1C3VA 1L7DA 4E5NA 3DTTA 5DULA 1BVRA 5DOVA 3HDYA 2PD3A 4DQUA 3VTFA 1UJMA 2YHIA 1PGJA 2VZ8A 4N5MA 2HQ1A 4FQ8A 4J6FA 5KVQA 3S55A 4B4WA 3I6QA 1AHHA 4M54A 2Y1CA 1X1TA 1U2GA 3QWAA 3HDQA 4YJGB 5IZCA 3GR6A 3PYLA 1O94A 1B8PA 3DWFA 1NR1A 1PS0A 2H9IA 4E5YA 1SEPA 4XEHA 4PFJA 5THQA 5L95A 3DO5A 2DU8A 4BNVA 1ZNQO 4Y9DA 4XYLA 4KQXA 2VOEA 3FI9A 4P22A 4OQZA 2EG9A 4JJIA 3L4SO 5GY7A 3ZWNA 1NBOA 4D3SA 1UP4A 3E9QA 4PN3A 1K6XA 2E37A 2PV7A 3JYQA 2O4UX 3OIGA 4KDEA 3BMNA 1U4OA 2FR0A 4YQYA 3OEYA 4H15A 5CAEA 1GQYA 3RUIA 2AEJA 2A92A 4PLCA 3WGYA 1E6UA 2X9NA 2X5JO 4PLYA 1OAAA 3HDJA 4M1QA 5EN4A 2BHLA 3RUFA 4BO1A 3V2HA 3O9ZA 3K5PA 4WPGA 2B5VA 2TMGA 4YRDA 1EVZA 4CM5A 3H5AA 3D4PA 3GH3A 1Z75A 3UXYA 4YPOA 3RCBA 1PJQA 2C2YA 5F1OA 3QW2A 3WJ7A 5DBIA 1BTOA 4OSOA 3HN2A 1CQIA 1WMBA 3WGOA 2GSDA 5FEUA 1YONA 3KSUA 5IN5A 3GUCA 4U5QA 3PQFA 3C1OA 4WLUA 1I2BA 1H9BA 5FWNA 4OIMA 4TKLA 1KOLA 2I67A 2YY7A 3WICA 4DC0A 4EUHA 2IEDA 4QO7A 3O38A 4PZCA 4DA9A 1C1DA 2HSDA 1HYHA 4IMRA 4J9UE 4OKIA 1QG6A 2PH5A 5IZ4A 1LDMA 3BTUA 1PL6A 1UDCA 3JD0A 1SNYA 4GI2A 4QEDA 1K89A 4XYBA 3TOXA 2UUOA 5I7FA 1V0JA 1KEVA 3G1UA 3I9NA 4KP7A 4TVOA 4E32A 1EVIA 1XA0A 2WE7A 3RUEA 3ONFA 2ZJ1A 4RDHA 3ZNOA 3ZWWA 3EVTA 3EDMA 2CY0A 2ET6A 1NP3A 4K6CA 5CP8A 5LDGA 4BKOA 1SOWA 4OXKA 3WGZA 1AGNA 1JAXA 1U28A 2QZZA 3C7DB 3F9IA 2VHVA 5A5FA 2I66A 4DBZA 4YT4A 4OHUA 1C0KA 2DBRA 2EP7A 3KHUA 2CDAA 3E18A 3LYLA 4D3DA 4OSPA 1ONNA 1DAPA 4FJ2A 3K9QO 4E2ZA 3F6YA 1X13A 5TJ9A 1NR7A 3EZYA 3TZQA 2D1YA 4BNHA 4CQMA 3HWRA 3TPCA 4XKJA 1E0DA 2IXBA 1TEHA 3B1JA 4N18A 1KEPA 4Y67A 4E31A 5IDWA 4TQGA 4WK6A 5KKAA 4BO2A 4ZQBA 5CG1A 3DR3A 4LMRA 3KSDO 3E48A 4UVDA 3TL2A 5K6AA 4NBUA 1RM3A 4RF3A 3JQAD 3PVZA 1KVUA 1YDEA 1TXGA 2BH9A 2EJVA 3NRCA 4XIYA 2DPHA 5COQA 1UZMA 3BHIA 4BKPA 5IJZA 4J2HA 3Q2IA 1M6HA 3ENNA 1XU7A 1GR0A 3BTSA 4AJPA 2A9FA 1QV7A 4QFDA 3WTCA 1PJ4A 2O3RA 4B79A 1RM5A 1BW9B 4NFHA 4D45A 2NVUA 1QLJA 4JQCA 2X58A 5JDCA 1HEUA 1IYZA 4CLEA 4TRMA 1PGOA 3EUWA 2ZTMA 3EHEA 4FC6A 4TRNA 2PTGA 5T8KC 3VH1A 2TMDA 2QG4A 5I7SA 5JAZA 3O8QB 2DTDA 3RQSA 3U3XA 4ALKA 3GG2A 3NT4A 5T67A 3WYBA 4GL4A 1TT5B 3A14A 3PHGA 2Q2VA 2G82A 5ADHA 1ADFA 1BG6A 1P0FA 2HRZA 3JQCA 5JC8A 3KVOA 1LLQA 4IZHA 1T1RA 3JQ6A 1GD1O 3DOCA 4AVYA 4B3HA 1IY8A 3INGA 3W4IA 1GUZA 3ZHZA 4L9RA 3MOGA 1NFFA 5G2OA 1Z6ZA 4WEQA 1GZ4A 1T24A 2C20A 1ZKMA 1MV8A 1CJCA 2GDZA 2GYYA 4E12A 5JSFA 3M2TA 4UVEA 2VNSA 1JA9A 1I3NA 1TA4A 1C1XA 1K5HA 4J4TA 2WD7B 1KIFA 1Z74A 3NV9A 4HKTA 1S6YA 2UDPA 1UH5A 4UUMA 3UFXA 3ZHXA 5K0ZA 5DCUA 4E21A 1U2DA 3VH2A 1DIAA 1I24A 4CMAA 3Q2KA 4WOJA 2Q45A 5LDHA 3H9UA 1PTJA 2C5AA 1GQQA 2VWPA 4R54A 3FR8A 2PD4A 4L75A 4LN1A 4RDIA 3HN7A 3A1NA 2BGLA 3FN4A 1E77A 5AXAA 1CIVA 5G0UA 3DMTC 1IPFA 3SC6A 3GZ4A 4HFNA 3RROA 1Q0QA 4JJFA 3VZSA 1PJCA 4D7AA 1JKIA 3EGOA 3HG7A 4J43A 4MVJI 1WWKA 3UCEA 2QW8A 1LQUA 3H7AA 5EQFA 4NJMA 4ND5A 5A06A 4WCFB 4A73A 4CL3A 4A2CA 4DWVA 2ZYGA 1ZMOA 4BKRA 4BV9A 5A5EA 3VVCA 2FRDA 4UREA 1HWYA 4OXNA 3UVEA 4YACA 4W7IA 2Y1OA 3QVSA 4PIVA 3EK2A 1UUFA 4YJFA 2PFGA 4RV9A 4DPMA 5JYEA 4XX0A 1LTHR 2D59A 2PKQP 1K6JA 4K6FA 4R1NA 2G1UA 3I9JA 3LT4A 3TZHA 1PJLA 5F5LA 2POQX 4BGVA 5IDQA 1E3LA 4Z0PA 3I4CA 1YQXA 2OOSA 3D3WA 1U5AA 3Q11A 4ONEA 1DIHA 3MEQA 1W4ZA 1RWBA 5DCWA 2EXXA 4J91A 1KVTA 1O89A 1WW8A 4GVXA 2YFQA 1DSSG 3H9JA 4MDHA 3NJ8A 1YH3A 3SEFA 3TWOA 2DC1A 2X86A 3DHEA 4MVJE 4O0LA 3U5TA 2YZ7A 2JJYA 2Q2QA 4IDCA 1NFRA 3E1KA 3M6IA 4NBRA 2J5RA 2VTEA 1SMKA 3DL2A 3GZNB 4IDDA 1SB8A 2NU7A 4CMEA 1BDBA 4FB5A 1FDSA 2J6IA 2P4QA 3ONEA 1AXGA 3VPGA 3L07A 5JLAA 4Q3BA 1T25A 1EUCA 1N5DA 1YB4A 2GUGA 5JS6A 3ORFA 4LK3A 2DBQA 4FDAA 2BFMA 3UCFA 4R5HA 1M66A 4BNLA 3C1TA 3RJ5A 4TZTA 3K2BA 3H5NA 1VKOA 1T2DA 1AXEA 1YQGA 1DXYA 3ROPA 2OP0A 3GDFA 3ZWAA 2VRBA 4IY1A 1G6KA 3C1AA 2NWQA 4A27A 4YTEA 1JQBA 3V1UA 4GX2A 1ISIA 3OSUA 4FSHA 1K2WA 1Z7EA 2LDXA 3S8MA 1BGVA 4PLHA 3TF5A 3H4VA 2W2LA 3DAFA 5C3MA 1PQWA 2RHCA 4GX1A 4BUCA 1DHRA 5L4SA 1P1FA 3GN1A 5G4LA 3KTDA 3GVIA 3PPIA 4J7UA 1HZZA 1WXDA 5A1TA 1R37A 2AE2A 1LDBA 2AQKA 1MXHA 5EERA 3ZI0A 1UDAA 3WQSB 2NTVA 2X7HA 3RI3A 4CUZA 3GRKA 5KJ6A 4AJLA 2WTBA 1B3BA 4CV3A 1U4SA 1HE4A 3AUAA 4LRTB 3X2EA 1MX3A 1XKQA 1DO8A 2B4RO 2JKVA 2VTDA 4R01A 3ZHYA 3ABIA 4CMBA 4HFRA 4YA6A 5A3VA 3VHRA 1UXGA 4DLLA 3O26A 1DAOA 3PI7A 3R0IA 4YJDA 3C3XA 1YL7A 3JQ7A 2Q1SA 3KEQA 1JW9B 4NBTA 3CKYA 4NDNE 3V5NA 5EINA 3FPCA 3HDHA 3JQFA 1M75A 4M86A 2E82A 4IXWA 3WFJA 2B69A 3KYDA 1R6DA 2XXJA 3GGPA 3IL2A 4ALMA 3AJRA 4TKMA 3OJFA 3GAZA 3ROMA 1ENPA 1NQAO 2C54A 1O6ZA 4EW6A 3ADPA 4DGSA 3FRJA 4FFPA 1Y9EA 4I5EA 1DB3A 4DYVA 3MZ0A 1M6WA 1NNUA 1PL7A 5IXSA 3ANNA 1ONOA 3FR7A 4Y6RA 4P4NA 4WECA 4HFJA 5IG2A 2HO5A 4AL4A 1DC3A 1DIRA 1YQDA 1H9AA 2ZATA 5JY1A 4BKUA 3RKUA 2QQ5A 1LQTA 4NBVA 5ICMA 2B36A 2GN8A 1VL8A 4KMSA 3F47A 5EQDA 1DFHA 3FNFA 2JCXA 5A3JA 3O03A 2ZIZA 1M67A 5A9TA 2I99A 2NADA 3WB9A 1ENZA 1UZNA 2V7PA 3S2GA 2J5QA 4CLOB 2HK7A 3BMOB 1LDNA 4R51A 4RO0A 1C0IA 3GFGA 5DZSA 3W6UA 2Q2WA 1ARZA 1UDBA 4K28A 3WGGA 1GAEO 3MWDB 4IDAA 4J1TA 3G0OA 4BNZA 3WXBA 3ZWYA 5L7WA 4RF5A 3BZUA 3GVCA 3D3EA 4OQYA 3ROQA 2CSUA 4JNKA 2OBYA 1M76A 4BNUA 1PJTA 4ESOA 5CEFA 3SXPA 3VPHA 2BGMA 1ISGA 1OOEA 4HADA 3PYMA 3LK7A 3LC1O 1JVBA 1OMOA 3U4IA 1B14A 2VOJA 3Q9NA 1PWXA 1QYCA 2J3KA 5L9AA 2EW2A 4K9DA 4BOYA 3AFNA 2NSDA 3UF0A 2ZYDA 1R0SA 4L76A 1Y8RA 4DQXA 1GYRA 3CE6A 5ER6A 4YAGA 3FF4A 3CZMA 2B83A 1WDKA 4D43A 1T2FA 2V6GA 1SC6A 5KTKA 5I8WA 1B26A 2EERA 3IIEA 1VKNA 5TQVA 3P7MA 1LSOA 2E4AA 2Y1GA 3D7LA 4E5KA 2AQIA 4NFYA 1VJ1A 1OBFO 2YQ4A 4XJSA 4BV8A 1QXSA 5GZ3A 3WLFA 3ZWXA 2UYYA 3EW7A 1XELA 4OH1A 4E6PA 2V65A 1E3SA 1EFKA 1CEQA 1Z45A 5H83A 2G17A 1LLDA 2CMDA 4R3NA 3WSWA 3QQPA 5C7LO 3G1TA 3ROKA 9LDTA 2Y0EA 3QWIA 3AI1A 4NHEA 2VWQA 1W8DA 3DB2A 3GAFA 1JU9A 3B1FA 3O8QA 3ULKA 1VSUA 2GN9A 1TT5A 3VH4A 1WDMA 3CZRA 3GLQA 1SB9A 1WDLA 3B20A 3LSYA 4LGVA 3Q3CA 1PZHA 3ZWCA 5JY6A 3D1LA 4M49A 4FFNA 2AG8A 2DBZA 3ZWBA 1LSJA 2FP4A 2ZYAA 1PJ3A 4BS9A 3VPXA 3ZWPA 1N2SA 2XF8A 3PWSA 3KUXA 4ND2A 3M2PA 2DLDA 4TZKA 1NQOA 3QWHA 4BB6A 1A7KA 3JQ9A 3JD4A 1KERA 3GVXA 1E5LA 2FR8A 1R4NA 1F14A 1IB6A 3EC7A 1BVUA 4RVDA 2A4KA 3WJAA 4EJ0A 1LDGA 2I6TA 3QSGA 2GPTA 3NTOA 2AEFA 2GCGA 4OAQA 1HSZA 3I9MA 1U3VA 1IPEA 7MDHA 4AJOA 3GQVA 3TZ6A 5U4QA 2DAPA 1PL8A 3G3EA 4GBJA 2EF1A 4GKBA 3VDRA 2FY8A 5HWSA 4XQ9A 3T7EA 3Q6IA 4H3VA 4Q3NA 1LXCA 2Y0CA 3WIDA 4F6CA 2O48X 4XDZA 3DBVO 1R0LA 4EZBA 3UICA 2CDBA 1MC4A 3WX0A 1VL6A 2NU8A 3CSDA 3VOSA 4CMHA 4KUGA 4DL9A 5JCJD 5CPBA 2E49A 1Q0LA 5KVVA 4F3YA 4JX8A 2VZ0A 4NU6A 5ER9A 2FWMX 4DIBA 1R15A 2W4QA 1KS9A 4E4YA 4IJWA 4Z9YA 4CLXA 4CLRA 1KC3A 5KJCA 1A9YA 5B37A 2C0CA 5BT9A 2Q1WA 4BNJA 4CMJA 5TSDA 2RCYA 4KTVE 1Z73A 2PK3A 5JYDA 3U62A 2YHUA 2XOXA 4IJKA 4YJHA 4H7PA 4B3JA 3X2FA 1ADCA 1OC4A 4H16A 3L0DA 1U7TA 3RU9A 3PIDA 3JQAA 5FYDA 1EK6A 1EVYA 1DPGA 3DQPA 3D64A 3DBRA 3EY4A 3K2EA 3NYWA 3WSVA 3RFVA 5A04A 3IP1A 1BWSA 3AOEA 2C7GA 1PQUA 4Y98A 3VZRA 5L51A 2BMAA 2O7QA 3V8BA 1HDZA 3DOJA 2NQ8A 1CERA 2DPGA 1MP0A 3DAPA 5B4VA 4BO9A 1XG5A 4ZU3A 3RBXA 4X54A 3I9LA 2EW8A 4WLNA 1KC1A 1K0UA 3IJPA 1GUFA 1NQ5A 3WFIA 3U09A 4RVFA 3ETGA 3I23A 1E1NA 2C5EA 4Q3DA 3GOHA 3AY6A 1LRLA 2VRCD 1B8UA 2O3QA 3LDHA 2RH8A 3MJSA 2F00A 2PKRA 2X0IA 3DZJA 5A9SB 5JW6A 3WWYA 1I8TA 3ZHBA 1MUUA 4XCVA 4E2WA 1T2AA 1EDZA 4BNFA 1ZFNA 4B8ZA 1OFGA 3KLMX 3ETDA 5IZCC 1Z7BA 4MKRA 4WLEA 4RL6A 4DMMA 2DFDA 4BGEA 1Q7BA 1E1KA 3IAHA 2HMVA 4PLPA 1O95A 5HS6A 3KOUA 4XDYA 2ZQZA 3JD1A 4CR6A 4J9VA 3QE3A 4I9HA 2Z1NA 5ENDA 4IM7A 1HE3A 1IHYA 3HHPA 3RU7A 1Q7CA 4YT5A 2VUUA 4P38A 3HE3A 4YAKA 1XEAA 2VUSA 3NJ4A 1Y5MA 2SCUA 4ITUA 2D5AA 2NTJA 2JFHA 5AXBA 1I01A 1I36A 2Y1FA 3SJ7A 1V35A 3UOGA 3WBFA 4N5LA 4ND3A 4KDFA 3NX4A 1V3UA 1IUKA 4NG5A 5JNLA 3MJ4A 4R16A 4Z3KA 1KEWA 1P45A 4I5GA 3ZWVA 3MJEA 4LVUA 3WIEA 5G0VA 1NPDA 4RJTA 4BNKA 3OJOA 4W82A 4AJHA 2ZTLA 4DLBA 3NDRA 1QYDA 4W9NC 5B4TA 5ENVA 3HJAA 1DC6A 3ETEA 5KIAA 3LC2O 4MVJG 2W2KB 3RBZA 1LU9A 3RVDA 2QYTA 4NNJA 4BMNA 1P1RA 4AJEA 4J2OA 1IOLA 2Z95A 1W73A 1LI4A 2EGGA 2P2SA 4F6LA 3L4BC 3KSZO 4IQ0A 4ZJUA 1X0VA 1V9LA 3JD3A 4LMPA 1PU2A 2ZCUA 4J49A 1O5IA 2WWRA 3ONDA 2O3SA 1F06A 4CR7A 1P31A 3OA2A 2IE0A 3K73O 4YQZA 1ZIDA 2O7SA 3OJ0A 2EIHA 3GVPA 1ZJYA 1HDXA 1NQTA 4UVHA 2GNAA 1Y8QB 2W8ZA 3PYXA 2O3UA 4LISA 2VHYA 3W6ZA 2D0IA 2GR9A 2HMSA 4NZ9A 5DP1A 1I3MA 3VH3A 2UAGA 4OJNA 4NK4A 1PS9A 3DZHA 3AI3A 1D4FA 2DVMA 3WYCA 3A06A 1PGPA 3TNLA 1DC5A 3PHIA 2FHSA 4HXYA 1VC2A 3WNQA 4WLOA 3KLPX 1WVGA 4EEZA 2VCYA 3IJRA 1I2ZA 1AUPA 1RPNA 5AXDA 1ADBA 4IQ8A 2NM0A 4YCAA 4RGBA 1Y7TA 3D4OA 4YEDA 1BRMA 4I08A 3D0OA 1HTBA 5CEEA 2IYPA 4GWGA 2HLPA 4R1SA 3FNGA 1UXHA 1N1EA 5IDXA 1YOVA 5C7OO 3RUAA 2HAEA 2JFFA 3GHYA 4I9UA 4C7JA 1H94A 1R4MA 2WYVA 4FFRA 3GMDA 4UVIA 1CRWG 2CZCA 2NUAA 2O4CA 4P4LA 3RJ9A 2AHRA 1DRUA 2ZJ0A 4HY3A 4WEOA 5ILOA 3RC2A 3BIOA 5K9ZA 3RD5A 1XWFA 3JTMA 1VI2A 1QYVA 1YJ8A 3NKLA 2P5UA 3ZV5A 5G4KB 4UAGA 3DZGA 1GYPA 1QORA 4MJLA 4BHTA 1ZEMA 3OH8A 4D0RA 1N9GA 4BQPA 2ZTVA 2PGLA 4XGKA 4MKZA 2QHXA 1P1JA 4G5HA 3AY3A 2YDYA 5L4NA 1YB1A 3UKOA 4PRLA 4QFCA 5K6AC 3K8ZA 4M55A 3SVTA 3HFSA 3ZV4A 4NU5A 2VZ9A 4BKQA 4BO7A 4ZN6A 1E3WA 1P3DA 2PZMA 4IS3A 4CM8B 2O2SA 5C5IA 3TFQA 2EKLA 1H6DA 3P2OA 1PIWA 5DP2A 3KV3O 1D1SA 2BD0A 5I9NA 5B4UA 4WLFA 3EAGA 1B7GO 2DKNA 3DBHB 3K31A 2AG5A 4I5FA 4AJ1A 1A4UA 3KYCA 4BMVA 1HRDA 2EV9A 2FOIA 3P2YA 2CF6A 4AJJA 4BGIA 1VJ0A 3KYBA 5T64A 1LC3A 2FPPA 2VNAA 1A9ZA 2ZB3A 4RPGA 3TSCA 4DUPA 3I52A 1XR3A 4ZA2A 4JP2A 2Q3EA 4FFMA 4OGWA 4IQGA 2I3GA 4TVBA 2VYNA 3HZZA 5DBFA 4FGWA 2DBVO 4XB2A 5COAA 4CM3A 4A7PA 1B15A 3STHA 1DFGA 3I9KA 3FWNA 3BYZA 3I83A 3W8FA 3ZNNA 1YBMA 1XCBA 4BB5A 4LCEA 4CM4B 3DBLA 5JAQA 1A5ZA 4JCOA 1CF2O 1NVGA 3WBBA 5L7YA 3DMTA 4MINA 1W6UA 5FI5A 3WMXA 4CODB 1GDHA 4D46A 4CMIB 3CINA 4QX6A 3GGOA 4DRYA 1E7RA 5ILGA 4OOEA 4ZHSA 3ON5A 1FJHA 2WE8A 4PVCA 4LCJA 4B7UA 3CMMA 5KWEA 4FCCA 3VVBA 3PGJA 3ASUA 4J1SA 1VE9A 4M89A 3GNTA 5JPIA 2Q46A 3ZN2A 1ZEJA 1YBVA 3AK4A 2A35A 3R3SA 3DAGA 5JO0A 4BO8A 1E1MA 3K6JA 3RC1A 1UXKA 1XU9A 4EUFA 1BXGB 3BMCA 3QLJA 1TVEA 2HU2A 5JXWA 4Z3DA 3B70A 4INAA 3DEYX 4WLVA 4WNIA 5COBA 3U4HA 4YAIA 3GEDA 4HX5A 4RVHA 4BNWA 1HYEA 2GLXA 3H2SA 5I7VA 2OO5A 1WZEA 3WOHA 3JQEA 2FPIA 3VPFA 1ZSVA 4FOSA 2AQ8A 4IBOA 3RAJA 3RUCA 3U4CA 4HFMA 3F3SA 1EMDA 3AU8A 2Q4EA 3IQDB 3I1JA 3LT0A 4CV2A 1P77A 3LZ6A 1H6CA 4XA8A 1DIBA 4XR9A 3G49A 1P33A 2EHDA 3FPLA 3SLKA 1ZZEA 4F45A 3BXXA 3GNQA 4BNIA 3FCOA 2PZLA 1IZ9A 4LVCA 4MKXA 4BO4A 4U8GA 3GC6A 4L4SA 2W98A 4MVJP 1T1SA 4A03A 1E7YA 3OJEA 4IS2A 4B8WA 3TZCA 4RQTA 4L74A 2FSSA 4ZQGA 3ZV3A 3JQ8B 1YGYA 1VM6A 4BVAA 2RBEA 3CPSA 1U3TA 3LF1A 4FIZA 5LC1A 2HMTA 2BKAA 2BFAA 4EITA 4NIMA 2R00A 1Y6JA 1E7SA 4Z9FA 2OMEA 3WG9A 1BDMA 1ONPA 4FN4A 1U8FO 3A9WA 4YYZA 1ZO8A 1KVSA 2Z5LA 4GPD1 1NM5A 5C37A 1FDWA 1G0NA 3L6OO 2B4TO 4P8RA 1Y9AA 1NAHA 5BSGA 5A02A 4CMGA 3EYWA 1YE3A 3AI2A 3A28A 3ANMA 4NK5A 2Q49A 3GVHA 1ZUD1 3H3FA 3R3JA 2CD9A 4YJGA 2OBNA 3BHMA 2VN8A 1ZJZA
chains in the Genus database with same CATH superfamily
3FSGA 1E63A 1PZGA 1U8EA 1I0IA 4C4AA 4IIBA 4U2KA 1GL9B 4WJZA 5KREA 3GDOA 3QVXA 4DNFA 4RFLA 4CN9A 3HU3A 1ZK1A 2WT8A 2BJWA 1Z18A 1OGYA 4HWPA 1DJMA 4X20A 3DBIA 3RFUA 3SBOA 3EOBI 2AN1A 1A4XA 2QQFA 5CAEB 2JFYA 3D0QA 3UWMA 2B8NA 5AVWA 4YDSA 1SUEA 1E3IA 2FX3A 1KO7A 4WN3A 1IEXA 2X8LA 2VYND 5AK4A 1CWUA 3DNFA 1Z16A 1EBUA 1N9ZA 3L4KA 4F86A 1QVRA 1YDFA 1RM4A 3VKVA 1X39A 2O8BA 2J3EA 3M81A 2O7NA 1LBEA 2QP3A 2ZI7A 4RSMA 3CB2A 1DAGA 3QY9A 4YV7A 1ENYA 1I6WA 1JZQA 1N8TA 3W77A 3A6FA 3ZJYA 1T36A 2XUFA 4B6PA 3KHSA 2BONA 2C9YA 2CB9A 4IXTA 2HSZA 4ZQCB 2DHQA 4DQVA 5DSZA 3K0KA 2C9ZA 4ZT3A 1OTYA 3Q98A 1WLSA 3F2IA 3E7PA 4CUJA 1O96A 1XD2A 4NPHA 1FE8A 4LJ5A 1REQA 1C1YA 3CCFA 5LWHA 2FMFA 2W0MA 4DCUA 1O1YA 1TAHA 2VSOA 3AR6A 1TW2A 2PKYX 3A9CA 3S7ZA 4CIYA 3DMDA 2PQ6A 3CLRC 3UAWA 5AVUA 4OL9A 7REQA 4KWIA 2FOLA 3PICA 4DSUA 1RXUA 2WNSA 5FOVA 1I3KA 5BSMA 3QF7A 3I3SR 4PQEA 2F8MA 3LT1A 3ECSA 4MIOA 1PQPA 1ZHOA 4DMLA 5BYBA 4YRTA 1CY7A 2OSVA 1CQXA 1TYAE 3MIIA 2JI4A 1G6HA 4RBNA 5H3HA 2BEVA 5J2UB 3UMGA 1IJBA 2GCEA 2VJYA 3TI7A 5ECYA 5BSEA 2J7PA 3CUTA 4YI5A 4GXRA 4RY0A 3U7JA 4B4VA 1O0CA 1CHNA 4Q3CA 2X4GA 3VYWA 2YWDA 3W05A 4EMBA 1G291 5KTPA 1QF7A 4IDBA 1ZXLA 5AM5A 1QKJA 2B5WA 3R3UA 1ISFA 2OO7A 3JYLA 5HEKA 2WJ6A 4NESA 1VPEA 4N47A 4ZGWA 4Q3KA 1T1EA 4E7OA 1Y8QA 2EARA 5GGYA 4GD3Q 4KFTA 5EEGA 1FS5A 5IC6A 5AVQA 1GLNA 1CQJB 1RJWA 1H85A 4MGKR 1MO4A 2HIGA 2ST1A 3TIGA 4AMYA 2CNLA 2J0UB 3L1VA 4IO1A 5H80A 5KX5F 1QMPA 4D8TA 3D4NA 3FNQA 1RC0A 1DKOA 1F8GA 1U2EA 5TR9A 1EUDB 4KQ6A 3OF2A 3WLJA 5CDFA 5C52B 2W42A 2BTEA 3T35A 1U0RA 1QGOA 4LQCA 4JOBA 5NLLA 1RZRD 4UKDA 2BR3A 4AQ7A 1DOZA 3ROZA 4KYVA 5ED4A 2SKEA 5KX5A 2PA3A 2FWAA 3DHNA 4G8BA 1ESMA 4ZXPA 3TN7A 4IX9A 2YWXA 3RDPA 4U9HS 3WBKA 3C3AA 2PRKA 5HCIA 1BEUB 3ZLBA 1GWNA 1U0HC 4P4GA 1JBQA 3Q7IA 4MQFB 3R7WA 1M73E 4DIEA 4LTDA 1C3JA 3ZS8A 2QXTA 3RSFA 2GSWA 4UD2A 1UBNA 1L7BA 1YCDA 4OUKX 4TSFA 5I9SA 4D0SA 1XZLA 3L1HA 1VPLA 2XYHA 1WZUA 2ZWVA 1GTMA 1NN1A 3TKLA 4AF6A 2OB2A 1E9BA 1BMDA 1JG6A 2Q8PA 3AF1A 3GFTA 1Z08A 3ZD7A 2ID4A 2C2XA 2P90A 1S7GA 1IULA 1IUNA 4INJA 2BFOA 4WDQA 3LYAA 3OPXA 5FKJA 3RIYA 2XXAB 4W9MC 3FOCA 3H5WA 1P2GA 2QRGA 3N6XA 4JA0A 4BLUA 9ABPA 1GUYA 2VLIA 3SY8A 4NX2A 4ZAGA 3ROXA 4WK4B 1WY5A 4ENPA 2LKCA 5KOHA 4FFWA 4OV6B 1D6MA 1GO2A 2BEWA 2EHJA 3F8TA 4LWPA 3SSMA 4A4DA 1U2QA 1SVOA 4ALLA 4E15A 4IGFA 2DQZA 4JR0A 3E22A 5E7IA 5BW4A 4HOYA 3K8YA 4BX3A 1BW9A 1JIIA 2YXBA 3LA6A 3PUHA 1K5DA 2C2KA 1JKJA 2X5XA 3NVAA 2PEYA 4C30A 2HJGA 4E0BA 2ASEA 1J6UA 1DIOB 2X1HA 2DPXA 3SXUB 4F4DA 8AT1A 3DXFA 5AM1A 3DZ8A 2HU5A 2HXSA 2V7BA 3WNCA 1VCIA 3QRWA 4C2AA 3AX6A 4HDNA 1A5SB 2C3OA 4J0EA 3RREA 5L40A 1VTKA 1X7WA 2XZTA 2OGSA 4OQXA 3H9GA 3WE7A 4DUGA 4BFSA 1SBNE 4HTFB 4I4TB 4M0UA 4EX7A 2JAHA 5HRCA 2RHTA 4TXMA 2HI0A 2EBFX 3KQVA 1Y6FA 2WSMA 2YUIA 1YRWA 3CR8A 3PGLA 3TL3A 1PP4A 1SIBE 4ZPXA 1P2DA 4YJ2B 4ZJYA 4ZT2A 1OFTA 3NQ41 3QIVA 2JFGA 1F0KA 3FLEA 1UR5A 1FBTA 1HKHA 1RQPA 1SBTA 2KHZA 3RIHA 4F93B 4DZRA 5JCXA 4KUEA 4NULA 5KJFA 5F9FA 1GZ3A 2W43A 3S81A 2Z1DA 1E2PA 3A9TA 3SKXA 2Z56A 3RVLA 2G3YA 3JVVA 2W6MA 4KAFA 2MOKA 3H4IA 3OX3A 4Q00A 5ALKA 5C31A 3TQTA 5FA5A 2WB2A 4H2DA 3J81k 1OU0A 1KQ3A 5FFMA 1NBEA 4D44A 1XEWY 5JQWA 2K7FA 5JIBA 4LF4B 3RUHA 4I8XA 1CB7A 1CY1A 2O5RA 1XVLA 3KJQA 3OT4A 2N0SA 4IIUA 3C16C 4XDHA 3S2EA 5F2EA 1IONA 3ZXUB 1XMQB 3AHFA 1WQ3A 4WV3A 1ISHA 2G67A 4PGFA 4MAFA 4G5OA 1FC0A 5CYFA 5JAMA 4N1AA 2OGWA 2NO6A 4U7HA 5FB3A 3ZYCA 2DETA 1YAJA 1YL6A 5BR8B 1NVMB 4HSEA 1I7NA 4NS4A 2I34A 2QD1A 5ES3A 5TB5A 4NJMB 4LOJA 3WIBA 1CQPA 4DHWA 2OHFA 3GLVA 2GZHA 3DFMA 4DLXA 1A4IA 1SC9A 4ZOEA 3CF0A 1N8KA 2BI8A 2WKWA 3PXUA 4GI1A 4LWZA 4ZPJA 2EG5A 4HUTA 1NYTA 2IEGA 2WTEA 2X8BA 2IW3A 3IO5A 4Q1DA 1UBMS 4PX5A 4WCFA 1YI8A 4FGSA 2IY8A 3PHJA 1R6XA 2XOKD 4TTIA 3QIAA 5HBRA 1P9OA 3N2LA 4FNOA 3HR8A 4S12A 1F2TA 1IHDA 1NC1A 1YU9A 3LUBA 1IZ8A 1OI3A 2JS7A 5F1PA 3PUWA 1ES9A 4F06A 1DJQA 1YJXA 5J59A 4EYKA 2WI8A 5DNVA 1QR2A 1CU1A 5BV7A 4NI5A 1K2VN 5IUJC 4G09A 4JKOA 3NDPA 5AW3A 4FGLA 2MR5A 3ZBPA 1PNRA 2BFNA 2R66A 1JJFA 1LKZA 3E82A 1XF9A 4C0KA 1SXJE 4NTZA 4JMPA 4YT2A 3QTLA 3VZPA 1R16A 2QTLA 3CXRA 3MJTA 2JI9A 3OJLA 2VSFA 1U5CA 2TMKA 2UUAB 3TBHA 1N33B 1N5JA 1PJZA 2HV8A 3WWEA 4DMKA 3HCOA 4UTPA 2CXRA 1N1GA 1UK7A 1WD7A 3MBKA 2FXVA 2IZZA 1H8EA 2OQ2A 2YRWA 1NRIA 3O74A 3QXXA 4OM8A 3SVLA 1CZNA 3EIXA 3KDSE 3PGA1 2H1OA 1JLRA 2G77B 2V7EA 4TLMB 4FSDA 2WILA 3KJXA 3H1PA 3LC0A 3HBFA 4OUDA 2V4MA 3RRYA 4E94A 2BUAA 1E2NA 2JLAA 4G5GA 1XQVA 4JL8A 1WCXA 3OP4A 4NAVA 4PAMA 5AOCA 1IFXA 4U6NA 4PYNA 4B9EA 4BFVA 1KBQA 4TYQA 3OD1A 2XRYA 1WQ4A 3OESA 3ISVA 5A4FS 5A05A 1VQ1A 2HJRA 2IYAA 1H2RS 1VGQA 3P2JA 4BMOB 1CUIA 2OAQ1 2X2FA 5J4HA 2R8YA 3RAGA 1C14A 2B2CA 3OZSA 2B6NA 2IXGA 2VQ3A 3O4GA 3PC6A 3WSTA 5B55A 5JJ5A 3ZCSA 2G0AA 3RVQA 1SRQA 4QYWA 4CCYB 1ZCFA 2G0TA 2H65A 3IIKA 5JHHB 5IPFA 1X0XA 4DF3A 4KSYA 3EB9A 4OAQA 1MAAA 4OLJA 2Q6LA 1CS0B 2GN2A 2DQKA 3JQPA 3KHKA 1RRCA 2REQA 4AMGA 2VP0A 4E3ZA 1H22A 3EGVA 4A6EA 1KY2A 3HMQA 5FLYA 3NS7A 3ELBA 3AY7A 4KFUA 4RORA 4OHPA 2C7QA 1CHDA 1X94A 5TY0A 4ER7A 4HWTA 2AE1A 2P4EA 3UHOA 4GL2A 1HDYA 3KQHA 1RAAA 2YCLA 3EUEA 1BU5A 3R5XA 4RDCA 4W5QA 3J7AC 1Z22A 2OCLA 2OWDA 3PRHA 4WCDA 3VDMA 4MPDA 4FDMA 5JXIA 1Z0DA 1A8HA 2C78A 5FL3A 2HDNB 1L5HA 1RQNA 3EA0A 4LJKA 4DVGA 3MCZA 2QR2A 2X0KA 4G8JA 4UBMA 2XIJA 3UK6A 1XXHB 3OUZA 5C46F 2X0EA 2H9AA 4DW8A 1O8CA 1BWPA 5DF1A 3F3MA 5GAJA 3AT1A 3NHKA 3THWB 1JHUA 3KTAA 1RBQA 1MDBA 3V7FA 1FP7A 2YFYA 5H81A 1MQ8B 4MOWA 1TJ5A 1PT5A 3AESA 5TT0A 1YO6A 3A2NA 1JSXA 3T0FA 1GUBA 1JSRA 1X7XB 2GN0A 2NZWA 2VDJA 1NDUA 3A9UA 3C2QA 4XQ0A 1JMYA 1FY2A 4OI4A 1XC7A 3K20A 2WHEA 3O4FA 1JQLB 1R66A 1UAGA 4NE9A 3S2IA 4EEXA 4Y1RA 4JA2A 4JJGA 3NTLA 3SSOA 1IOZA 2Q9AA 5CTJA 3GGJA 4H6PA 5GGXA 3OTOB 1ODFA 1SU6A 1XSEA 2NW6A 5I4IA 5LMUB 1Z3IX 3Q8MA 5CFZA 1KKUA 4BXOA 1DRWA 1WV0A 3M5WA 4OK6A 5EXTA 3GX1A 5GMOA 1G9XA 1NULA 1I4DD 3PQ4A 1WIWA 1LSUA 4Y2JA 5L3SA 4EMSA 1P0IA 3E9RA 1GTRA 4QQFA 1EG7A 5TPZD 1M10A 1QHEA 3PHLA 1WABA 2J3IA 2PGNA 1QGUA 2E4ZA 3EGDA 4W9NA 4W9RA 5LA6F 2R7KA 1EFRA 2IWRA 1TI7A 2CZGA 5LPNA 3IUNA 2I3AA 3KKZA 5JMTA 3FUXA 1XL0A 4AIIA 3EF1A 2I7VA 3CSUA 4U4AA 3U4GA 3IQZA 5GM2A 1TYCA 2VT3A 1MGPA 5LA6A 1XRSB 3K5IA 3W34A 2EKQA 3B1VA 2WF7A 3IVMA 4K87A 1QZ3A 4Y2SA 4EK9A 5B6JA 5I45A 1ZNXA 1ZRHA 4B83A 3FTNA 1W9MA 3IP5A 1W36C 3P94A 1X8KA 1I1OA 1Q7EA 1R0BA 2XE6A 5EWJA 1O5OA 1XGKA 3ZOZA 2Q4DA 3JPYA 3MXOA 4AKIA 4DEVA 3NALA 1KMNA 4S1TA 4YVFA 5AK6A 1DOHA 3VR0A 1LPOA 2GF2A 1ML3A 2IXAA 2L2QA 2XB6A 3B6ZA 3HN6A 3CG4A 3PK0A 1ZCAA 4MS3B 4F4UA 5CD9A 2F55A 1FSPA 4L7VA 2PL3A 2XB8A 2NO7A 1JG4A 4KGXA 3UFBA 1X7GA 3IOEA 2NUTA 2YXEA 4MUIA 1BQ4A 5IC5A 1M5TA 5J2UA 1VPWA 3FCUB 3FUUA 1KVQA 1PBNA 3C3PA 4UDNA 5AW2A 1MV5A 3CLVA 3FAKA 1PR2A 2JGIA 4OO3A 3SZUA 3WBJA 3LWNA 4YP6A 2C7PA 2PSHA 3H1TA 3DHYA 1N5KA 3DVAB 1QFMA 4U9IS 1GCOA 1P3JA 2E48A 3Q87B 1OU4A 2VAXA 4A0QA 3ZH2A 4A82A 2DKOA 4F60A 3O2JA 2PS3A 3QP9A 4LSMA 4Q9DA 3SZOA 2O23A 1IN4A 1GN8A 1UDXA 3INRA 1VRWA 1K5PA 1PLKA 4GE0A 3UQZA 4F4FA 1QU2A 1GVNB 3DFFA 3WGUA 3AG6A 2P9GA 3H5OA 1MB4A 1R12A 4QU9A 1CQJA 1EIZA 4RVSA 3IAXA 2J0UA 2QI9F 2ZIWB 5KNDD 2EF0A 1AKMA 2CL7X 3MJVA 4U7FA 2GBLA 5AJVB 5BYKA 5LQKA 1EUDA 2DBYA 5IKEA 4HL6A 2I4IA 3SBDA 4V03A 1JR6A 1KYZA 3GN2A 3NEPX 2PZJA 3GYGA 2I78A 2P41A 4Z0HO 5JLJA 3LP8A 1JVNA 2E85A 4XGNA 4X3PA 3F97A 4ZYXA 1IDOA 2P65A 1NLUA 1TPZA 3AR9A 5E2AA 5DEIA 1EJ2A 3I5UA 3QVJA 2G71A 4NH4A 4D9BA 3TO5A 3KWLA 3NWJA 4YRNA 4ZTUB 2QUHA 2ZIXB 3WLKX 4ZMRA 3GFQA 2P9FA 3NOOA 2VYCA 5F9HA 5T6BA 1E5TA 3K1YA 2AIRA 1HLDA 3JASB 3LXXA 4B85A 4V1CB 3W4JA 4TLBA 4P7BA 1RYDA 2IHYA 3ZHQA 4PLZA 3DZDA 3O7MA 3UB4A 1Z6GA 1OZGA 4WUTA 2ZUDA 2ZJ6A 3W5AA 1L7EA 3U0BA 4LV6A 2GK7A 1XTKA 4JI7B 1D6JA 1YR7A 1A96A 2J48A 2P30A 5B7GA 1RQGA 2H4JA 1M2WA 3HCRA 5KYGA 4Z4IA 2OZKA 1WKBA 2VYQA 4NS1A 3TJZA 1W5FA 2PT7A 1Z7YA 3F6SA 3LY5A 4O63O 4G65A 4BPRA 2G1AA 1BN7A 1CZHA 2IEIA 2P9CA 3VU9A 3IELA 1U9JA 3F1LA 3RTGA 3T4XA 1NLYA 1J8MF 4BASA 1THTA 1X6VA 4NZZA 4ARBA 3UBMA 1IXRC 1T9DA 3Q6MA 3LCRA 4J29A 1S7CA 3HKEA 1E2FA 5DIZA 4XWTA 3WYBA 3H16A 3SXUA 2H57A 2Y4NA 5CFRA 5IAKA 4ROSA 4NOKA 2QM7A 4D79A 4YJ2F 1T4GA 3W6PA 4D9CA 3S99A 3VDNB 4EF4A 4D3FA 1R8SA 2J09A 3ZU3A 5JZ9A 4RKQA 5IYZF 2BR4A 2Z2YA 1B93A 1C0EA 3GDGA 3HSKA 1ZBQA 3PC7A 2PX5A 4IXNA 1QB8A 2JA2A 2WIDA 4OXYA 4WXYB 4E1AA 1V2GA 2H06A 2XMPA 3VJLA 5DCLA 1ZITA 1KJIA 3KETA 5IYZA 2GB4A 2WT4A 4F8JA 1C0LA 2PZKA 1R4NB 1DKQA 4XRGA 1CETA 3S2YA 1KBZA 4R3WA 3PB3A 2GRUA 2ZBQA 4M1YA 2I9PA 1ZM7A 2I65A 1HFWA 2XNDD 1PTJC 4QTXA 3TZKA 4QRIA 3F9CA 2W8BA 2PCLA 3R7DA 5B3JA 1QP7A 1C9JA 4LJRA 5EZYB 1F6DA 2O2YA 1QDUA 2HA3A 2QLTA 3CV3A 1ENOA 4UXHA 4BATA 3C6XA 4H77A 4ZJPA 4KXMA 1NHWA 5J1SB 4OY3A 2ICAA 1UM9A 5TRTA 3VSDA 3R5KA 1QPBA 1PLJA 2IGBA 3AFMA 2F4VB 3HO1A 3DE1X 1ZMTA 3TCKA 1P4HA 3I3OA 3T9BA 4JYZA 2QX8A 4Z53A 4ZV9A 1Z8HA 1L3CA 4DTIA 2WIKA 2GWRA 4URFA 1GQ2A 4UTNA 2KI5A 4BWVA 3OC0A 1FDVA 2H16A 3CNEA 4IIFA 1XRQA 1FX0B 3KR1A 2XVZA 2AFHB 1NSTA 1UADA 3O8OA 1YDWA 3Q10A 4RD3A 4ENWA 5FUYA 2RGRA 5M34A 2GHQA 4LXUA 4QWMA 3EDOA 2IOYA 4FXPA 4HEHA 4LJSA 2Q27A 1SR8A 4GAEA 5K3AA 2IH4A 2QIPA 1ZWLA 5K8CA 1MNQA 1ZK4A 2H18A 2PX6A 4P3KA 5FLKA 1EB8A 4CJXA 1ZNWA 1AUOA 2GPAA 4FC7A 1KGDA 2KYRA 3HYSA 1UEIA 4QOJA 1QTRA 4D4JA 3DEFA 1KOGA 3HB9A 2V45A 1QRAA 2EIXA 4WGGA 3V7UA 2A3NA 3ZGYA 1IUPA 1KAHA 4Z1MD 1GU7A 4QU5A 1CUAA 2QVLA 3OLYA 3TYXA 4AIRA 2I55A 3H3XA 1PZFA 2YFKA 1AGPA 4UJ5A 1KI2A 1KOFA 1L7RA 4U63A 1RXEA 4OQMA 3AUSA 2GEFA 1IXZA 1BA3A 2I2XB 2H7XA 3CF6R 3GY0A 4KKXB 1U3CA 1YCGA 5KUTA 3V4OA 4BU1A 3HO6A 3IKVA 2UYCA 1U0JA 3ODPA 1ZJJA 3JQAB 3OOJA 4Z9XA 3TR6A 2RH5A 5AESA 1RXVA 4RJJA 3KOWA 2VHZA 2FTKE 3N0RA 5FQOA 4UDYX 3GG9A 2UVDA 5A3QA 2EU8A 3R3HA 4QODA 3F5MA 4AM8A 3TZBA 3NLLA 3OTHA 1QOPB 2QRJA 3PCTA 4MARA 3WQQA 4CMEC 1A98A 2I22A 3N58A 3VGJA 2EQBA 2JD2A 4CQMD 3UMYA 4AZ3A 2V7UA 2ZYVX 2NLOA 4MWDA 4O1HA 4EWLA 9ATCA 1E20A 1A97A 1AK2A 2JD0A 1MN6A 3PQEA 4I50B 4XJVA 5AW1A 1BCSB 3UEOA 4KITB 1PAUA 1KFJB 2NVBA 4DLUA 3SZRA 2DEUA 3ESAA 1R7RA 3HGQA 1SKQA 1UMCA 2IK8A 6ADHA 3I9V1 3B3AA 3QU7A 2Q6IA 1DRKA 4NCIA 5HF8A 1NUQA 4EKNB 2OBXA 3CLHA 1J1IA 1S3GA 4LBVA 3T4PA 4C4RA 4EMUA 4B3BA 4F5WA 1TPYA 1V2HE 3KQYA 4AZVA 4HZIA 4MVJF 1TVCA 1LVUA 4NENB 1G38A 2IGTA 1PW7A 4AUMA 4R4JA 3AF2A 1KI6B 1THZA 4O4HB 3CVYA 2GAAA 2YW9A 2H6EA 3MTGA 3SX2A 4D4MA 4E30A 4EY3A 5I8ZA 4XWOA 3OFVA 5IMSA 4LOHA 2BCGY 2P68A 3ZBQA 4RM3A 2ODQA 4MVJA 1JYEA 5I8PA 1T2UA 4DDMA 2F7SA 2Q50A 3MB5A 3NXSA 1ZISA 4L8WB 1DVRA 4HRAA 1JSCA 2XKAA 4LC9A 1JJVA 4M6WA 2KB0A 2JATA 2WFZA 3QEJA 1C2TA 1FP4B 3QKSB 4XXHA 3RU2A 2ILTA 1KXJA 1GSIA 2GXAA 2H8KA 3EQ6A 4L73A 4MCJA 4KO8A 2NYRA 5I4CA 5EY5B 1XXHA 4HNGA 1VYTA 1QH9A 1YI1A 4RNCA 4WNCA 3S1LA 1T13A 3DTVA 2I1WA 2SCUB 4FD2A 3WL3A 1JPJA 2ZS7A 3AKYA 3JATA 3BWMA 2APJA 1XVAA 1E9VA 3OU6A 4HWKA 4NF2A 2IBMA 4PCUA 3U3DA 1UZLA 3GGDA 4IMPA 2RGGA 3DZIA 4QYSA 4TV9B 3O21A 1ESCA 2HA2A 3E2MA 3LBHA 4KXFB 2FCAA 5FA8A 3T9EA 1L4UA 5A3RA 3FB4A 2R2GA 5EJAA 4BQRA 1GYQA 1K6MA 2YN4A 4P0TA 1VG9B 2ZE5A 5AXCA 3N07A 2YMMA 3UNXA 1KYWA 3BTVA 4TQAA 2WHXA 4OB6A 1W4RA 2AZ4A 1F6BA 1U3UA 3E7WA 3P9SA 2R6HA 3JYOA 4U6SA 4KR3A 2B61A 3GK3A 4QC2A 3ZQKA 1JA1A 1MG5A 4LXGA 4IGKA 3UAOA 3VNRA 3L7IA 3LW8A 4O0MA 1YS6A 4S3MA 5DX0A 4F46A 5TC4A 4LSGA 4UZSA 3N74A 5F4ZA 2DH5A 2DQ4A 5K0NA 3T1QA 3VZQA 1K6EA 1T0UA 5AKXA 3MTJA 1PGQA 4HF7A 5DM2A 1FSFA 3GNSA 4I1IA 5F21A 1U2PA 3CR3C 4KVAA 2RONA 3T4EA 4AZTA 3VC3A 3ANYB 3DL7A 4JYCA 1E7WA 1SVWA 1SKYB 4AJ2A 3H1AA 3NV7A 4BJ5A 4L8LA 4ZFNA 4PCVA 2ZZMA 4PQRA 4D82A 1X1DA 1Z0ZA 1PHPA 2AB0A 2D1TA 2VUHB 1G8AA 4IJ6A 2VNIA 1E92A 3DKKA 3BXEA 4IRMA 1EDOA 3G7SA 4PINA 3RM3A 3V1MA 4RZUA 3AOGA 4ZVTA 1Z0UA 3NCTA 4UHKA 3M4ZA 2O2EA 1SCAA 1SUIA 3HCDA 4KO1S 5B1IA 3RIGA 1MAUA 4ANFA 1YSCA 3N0XA 4FFOA 4PIPA 3I1YA 1E1RA 2VWHA 3FYSA 3K0EA 4N39A 4MR7B 5C8XA 3ORYA 3ABZA 3H2BA 1TEVA 1QO0D 1Q91A 2L19A 2XE7A 2RE8A 3PT5A 5BW5A 2JEOA 1UK6A 2JEYA 3G5UA 3T0GA 5KMGA 5KWSA 2HUNA 5G53C 1MA3A 1OFUX 5LCXA 3T7AA 2HKIA 4G56A 2DR2A 2AEEA 2OORC 1EYZA 2OK8A 1ECPA 2X15A 3A1DA 3FA2A 4XUCA 5FO0A 5K3CA 2R4UA 4YXFA 1E6EA 1TCVA 5HYVA 1LB1B 1IHUA 2IZ1A 4C5CA 5JBQA 4WX2B 5FI0B 2VIIA 1Y82A 3P20A 3TDMA 5AVZA 1GQFA 1JTVA 2V6IA 2H59A 4OGGA 2X0JA 1VCNA 5JO9A 3RC3A 5L3VA 2JJQA 2B8EA 2GEVA 8ADHA 4RGQA 1CUVA 4F8EA 3OIFA 3ZZ0A 3IUEA 1TTPB 1VIYA 3O8LA 4G1VA 1V4BA 2G7ZA 3LUJA 1W48A 3GLGB 2H1SA 5CXXA 2I1QA 3HY3A 3SX4A 1A4RA 3RS2A 3PCRB 5JDIC 2JG3A 1MAVA 3M1LA 2NUAB 4U7TB 4BJ3A 3AVUA 2CVHA 3ZU5A 5E8JA 1YZYA 4Y7DA 3WYFA 4EHBA 4OH7A 5DPMA 4JLBA 3HYNA 4W5WA 3LLSA 1A9QA 3TCNA 1Z26A 1XV5A 3UH0A 1NPTO 4DIKA 3WLRA 1Q21A 3A8TA 4DC9A 1F12A 2EZTA 1PK7A 2Y0PA 1QRUA 4YP5A 3UWDA 1SOUA 4W7SA 5H3CA 5JSZB 4Y9RA 4OHYA 4FS3A 2AF4C 5I5GA 3WHPA 3GLIA 4LZOA 2FV8A 4IL5A 1JR3D 4QU8A 5TQ2A 4REMA 4EEKA 4R05A 3VDQA 4X6YA 3M5PA 2O0HA 2PKQO 3HWX1 5CDUA 1XFAA 2XIQA 2AYXA 2BGKA 3N2GB 4UBJA 1SZJG 3G5MA 1WNTA 2R9VA 3NUQA 1A2BA 5B2ZA 1G7RA 5IBCA 4X65B 2ZWPA 1E96A 5IAAA 2W4MA 4Z0TA 3AO0B 4KW7A 1TD1A 2JCVA 4BQEA 5FUQA 1A8SA 2WJPA 1V48A 2NO5A 2RHLA 2XAUA 3L77A 3BE6A 4JROA 3ZDRA 1T29A 4OHXA 3ZNQA 1J4AA 1CZRA 1H1TA 2BMWA 3FHOA 1ZRNA 3RASA 3THOA 3KYCB 4QNRA 4DDKA 1N2CB 2J4DA 1IATA 5DWVA 4L4RA 4AP6A 3DC7A 5BVHB 2JLXA 2GPWA 2IDKA 5AHWA 4E03A 4OPMA 5HIMA 5JTTA 1Z8FA 2JFPA 3A9VA 4IYJA 1XDWA 4E4TA 1TCAA 3S28A 5JISA 2RHJA 4JBYA 5KOYA 3ZDCA 4XYMA 4ARIA 3OQPA 3LHSA 1PQYA 4B1FA 4EGAA 1VBMA 2XF2A 2RB4A 3MCUA 3L7YA 1UP7A 2LVBA 4LUCA 4CL8A 2FQXA 1C30B 2PUCA 1DEHA 4LGMA 1E0SA 3G13A 4B2LA 4HGOA 1QE5A 1E6WA 4D3XA 2Y05A 4GDFA 2G80A 4IHJB 5A0TA 3DKRA 3JRNA 4JB8A 5A4AA 4IUYA 1RXCA 2R1VB 4D6YA 4G97A 4YRQA 4MXDA 3S6JA 4EIWA 1ZCBA 3MERA 4HBGA 3CW2A 1KY3A 3F6RA 2A9VA 3FZYA 3FRIA 1JUDA 4URHA 5EP2A 2MSDB 4UEKA 4J03A 4GOLD 2FN7A 5LKAA 5EVJA 3GPDG 3H4TA 3A7DA 4RLQA 2FDRA 1MB9A 1I4TD 1WG8A 4M0MA 1TU0A 1WB6A 3G17A 3GJQA 4ATNA 1SCDA 2HIHA 4ZOLB 3PHHA 1ULUA 1WPRA 1RWMA 2QKYA 3HU5A 2HRBA 1K6IA 1K8YB 5HRAA 3KVYA 3L7OA 1SQ6A 4YUAA 4TKUB 421PA 4MR9A 2B92A 3OBBA 1XPOA 4C14A 1K3TA 2JJ2A 2QAIA 4TRRA 1JXOA 5EZYF 4GQAA 5EYPA 1QNLA 2JIZA 3R23A 1BYUA 3PJRA 3JQBC 4KGDA 4PYIA 3ZJTA 2AD1A 4PLGA 4XX0B 2FZWA 1YE5A 2A7QA 5KNBD 1FIUA 3F6CA 1E9CA 1B1CA 2AK2A 3OQBA 4Y6SA 4A0RA 4DR7B 3EVNA 2Q4BA 5EZYA 1YIOA 3TMKA 3EVAA 3PZRA 2C61A 3FNRA 1E2GA 4FEGA 4MRAA 1M2VB 3O75A 1CEXA 3HP7A 3NIBA 2CNBA 2QL9A 2OUKA 3MWEB 3K0AA 4WDRA 2XBMA 4FEEA 1BXGA 3AUKA 5JSKA 1L0BA 4XSHA 4ZQFA 3QFHA 4YAWA 4JHXA 2ORYA 2A94A 2FPIB 2PR7A 1FMLA 2OGZA 4C1BA 3G0GA 1GCUA 2COEA 2QRHA 5TMPA 3HDGA 2OAP1 2DLCX 2PS9A 3S44A 2TECE 3UK1A 2WWYA 2QW1A 4JJ6A 3Q7TA 3U1TA 3GWGA 3WK9A 3AFIA 1SUPA 2XXBA 4YB8A 4DRXA 3S3TA 3MAJA 2XOEA 2D3TA 5BSUA 3VKWA 4MZXA 1B16A 3G89A 3K1AB 1NKTA 2ZAGA 3TG8A 3OWHA 5AM4A 5A9RA 1YZFA 5DNEA 1EFLA 1DIGA 1IJKA 1YRAA 5IK2D 1X1EA 2AL7A 3B36A 3SF0A 1TYDE 4F71A 1RXIA 2CJPA 4RPLA 2I71A 2NU7B 5DHAA 4DMCA 5IANA 2HR1A 3ZGLA 4N8EA 1UFOA 3WL4A 5I9LA 1L1QA 2CSXA 2PL5A 2I7XA 3GBSA 1BZYA 3SQDA 1G60A 1DDOA 1CDOA 1DP4A 1HE1C 1XZAA 5HM8A 5LZ7A 2WUDA 3IOBA 5IXYA 2VJLA 1ZD2P 3L5OA 5REQA 3EXFB 4ZI5A 4CV1A 1GRCA 3VNQA 4GRIA 5DNWA 4QHYA 3VZBA 3A4TA 5FXMA 1PJBA 1SC1A 3WNBA 1IM8A 2CVQA 2UV8A 1PVOA 3HB1A 3K7EA 1R18A 2ZXEA 4MRNA 1JWBB 2I9KA 2QVCA 3DR5A 5FV7A 2IV2X 1CCWA 4BX9A 1ISJA 1Z82A 3CNOA 3RWMB 4KVGA 2NP6A 5C1PA 3W8DA 1HLPA 1RLTA 1E61A 1TIPA 3INTA 2Y68A 1G5IA 1U1CA 5KQMA 1GT91 1L7DA 1OE0A 5C80A 1R5JA 3B7WA 1G16A 3IP8A 1H05A 3BB3A 4I50F 4OGKA 5DULA 4L5BA 3B7GA 3CZ9A 5LP6B 4IMIB 4K9SA 4NECA 5K01A 3NBZC 3GT3A 1OAKA 3ZCVA 3CRMA 2PSDA 2V7XA 2W6CX 2CBZA 3ER8A 1BS9A 2HQ1A 2O5VA 3IBCA 4B4WA 4Q1BA 4HGNA 5DBHX 3I6QA 4I50A 3H18A 4TXNA 1XF1A 1BCSA 2PBZA 3PX2A 3QWAA 4H4DA 5DYGA 2C9CA 5EKSA 4UPVA 5IZCA 2W83A 1YMVA 2CXTA 3REFA 121PA 1E0AA 4G0PA 4L72A 4QFMA 3E9EA 3DWFA 4O4HF 4K6OA 2XGOA 1SKBA 3WV4A 1PS0A 4E5YA 3R9KA 5LZ8A 4P7GA 3JWIA 4PFJA 2I6FA 2KQUA 2IPNA 5E7JA 1G4AE 4XYLA 4KQXA 2FK8A 2FUG6 3M1YA 3E4CA 3QPUA 3R3YA 4O4HA 3FI9A 1W4BA 5SY4A 1T9BA 3ICEA 1Z6XA 1RRFA 4GR4A 2ENUA 5FH9A 3ZWNA 1NBOA 4D3SA 2N1BA 3JYQA 2EDCA 1BX3A 1GPKA 1KQPA 2O6LA 3CX7A 3BMNA 2FR0A 3EEYA 4RZ3A 4LJLA 1JFLA 1O9HA 5FYQA 2VPTA 1ECGA 4G67A 4H15A 1TYEB 4M9QA 4YQYA 2V0GA 4QU0A 3RUIA 2AEJA 2D5LA 1Y1QA 4PLCA 4BDTA 1BEEA 2B1IA 1BS1A 2DJIA 1H8HA 2C8LA 3QKSA 2X5JO 4DV1B 2J0EA 1US8A 1D5CA 3LKZA 4HN4B 4M1QA 4RY9A 1NW9B 2RARA 2HM7A 3O9ZA 3K5PA 3L01A 1A8QA 4YRDA 1EVZA 2PWBA 3H5AA 2B6HA 5T4EA 3CT4A 4DSTA 3UXYA 1B73A 1NONA 5KTOA 1PJQA 3LXUX 3QW2A 4LOAA 4IOMA 4HTAA 2IHTA 2XWJI 3QVGB 1PG2A 1BTOA 1NNSA 3RTAA 3U7FB 5E6SA 1Y33E 1GUAA 1NI5A 4MYTA 1OTXA 3IALA 4YUYA 1LQ2A 3OO0A 3WADA 2F3SA 5FUWA 1NG1A 4BX8A 3IQWA 5KQPA 1H9BA 4CEHA 5FWNA 4OIMA 1P0PA 3B13B 4UNRA 3NHJA 4Q15A 4EUHA 5IAJA 1L2TA 4X94A 1TW3A 4PZCA 4DT1B 2O07A 2JLQA 5J2UF 4IO0A 2IYXA 2FN9A 2RGNA 2K7ZA 1HYHA 2GVNA 4FDTA 2GFHA 4XIGS 4DS3A 5AVTA 2OSBA 3O8BA 3E1GA 2ATVA 4Z0NA 3JD0A 4MICA 2ACKA 4P34A 1UFVA 1P7ZA 3I2YX 1K89A 1UBEA 2ZTHA 3D4BA 5LMNB 1K97A 1AKRA 5TQ0A 3BXHA 3PPXA 3RE1A 3C0KA 2LW7A 2UUOA 1E9RA 1PVVA 4HUQB 2OXTA 1KEVA 1OJLA 3WNDA 1X74A 1D4ZA 2FUNB 3IRVA 4KP7A 4MV1A 4LHSA 4WZZA 4JUAA 3FCSB 5AW7A 4NC9A 2D1FA 2A33A 1PCXA 2WE7A 3ONFA 1X7YA 2ZJ1A 4RDHA 1F7UA 4RKYA 4LMBA 2UZAA 2NT4A 2W6JD 3EF0A 3EVTA 4B75A 3K8OE 4GZLA 2VDKB 1RRVA 4BAZA 4JELA 1WF6A 2AG0A 2XYQA 2Z0MA 4O4IA 5CP8A 5LDGA 4MYCA 2WTMA 4PAGA 3EGWA 5K20A 1U28A 1JAXA 1JDPA 3C7DB 5KYKA 3F9IA 2JANA 4EGCB 5E7QA 3WIOA 1IM2A 2CUNA 3VO9A 1SRRA 3L02A 3VR3D 3IPCA 1FRZA 1D2RA 1Y6ZA 2RAPA 3WWCA 1UL1X 3TOSA 1JALA 3HVJA 1K3UB 1ULBA 3RWOA 2WVJA 1SVLA 2GEBA 1E5DA 4P3YA 3UKJA 5BWBA 3OJXA 1ONNA 1TF5A 1X86B 1YZHA 3NNSA 2W93A 4E2ZA 1NR7A 3CEMA 1FFXA 4GC9A 4EYOA 1HTWA 2AW3A 1P4GA 3CEPB 2IY9A 2QTVA 1BIFA 5A3SA 1E5XA 4DCVA 1E3MA 3EXHC 1OAOC 2C77A 4L8GA 1XWWA 4M1ZA 5DIFA 3SDZA 5JZOA 1TEHA 4YIHA 2HCBA 1LCIA 4B3SB 4E31A 5KKAA 4BO2A 5HJEA 4IDNA 4MSUA 3CX4A 5CG1A 3QFFA 2QPLA 4YPVA 4PONA 3SHFA 2VHCA 2ZJ7A 1CRQA 2AJ8A 3VC2A 4DLKA 2C98A 2VHEA 3QEKA 4RF3A 3WIVA 3PVZA 3NRCA 4DQXA 1TXGA 5KPDA 3BWXA 5DLYA 4ZCTA 2GQ0A 4O25A 4N0PA 5MF6A 3Q2IA 2AOUB 3ZJVA 3ENNA 1HNNA 2QG9A 1XU7A 2WHQA 3AVXA 2PX3A 1GXSB 3L18A 1WM1A 3MC1A 1Y80A 4NATA 3ICVA 4REOA 3ZDQA 1XLVA 4AY5A 3ZX5A 1G4UR 2HV9A 4P98A 5KAPA 2NVUA 4QLBA 2PIDA 3O1IC 2JBWA 2RGYA 1OY1A 3RVSA 6LDHA 1G9TA 1GLVA 5HKAA 4JI5B 1HEUA 3R7LA 5EHNA 4UC0A 1BCRB 3I6MA 3DMHA 3TVTA 3GARA 4TRMA 1O94D 1PGOA 3EHEA 3N2GA 3ZOKA 3D0KA 4CLEA 3FZGA 1KTVA 1D0IA 3FOEC 1C7IA 3EARA 3H86A 4I4NA 4FSXA 1CTQA 5CA1B 3NWPA 4KIUA 4J0QA 5T67A 1PDVA 1TT5B 3IYLW 3NORA 3PHGA 1JB1A 2ZRJA 1GNRA 5LFAA 1XP8A 1K7FB 3JQCA 3V8MA 2VP5A 3DOCA 4OFWA 4C5AA 1IY8A 4ZCIA 2O5CA 1GUZA 1IVNA 2BLNA 3IX7A 4L9RA 3MOGA 3SFVA 1IY0A 5CA0B 1GZ4A 1T24A 1OFUA 4KRXA 1QJ4A 1ZYUA 2G6BA 1U1DA 3B9PA 1SKAA 1JA9A 1RI5A 2FWBA 1K5HA 1G5FA 2NO0A 1KAOA 1MEJA 2UDPA 3UFXA 1UH5A 3IERA 3KYJB 3K72B 3GJ6A 3ZHXA 5DCUA 2GUWA 2O8FA 4E21A 3INYA 1L1RA 1QVVA 1U2DA 2CLKB 3B3FA 4HB2A 4TYPA 4XJXA 1CJBA 4O2AF 5DLQC 1ORIA 4CMAA 2Q45A 4G0WA 2QVZX 3C6YA 3H9UA 3EC1A 2R1VA 2YOHA 4MYHA 5DW0A 4N41A 4RDIA 4KQKA 4Z7OB 3GAAA 2BGLA 4PPNA 3SHQA 5AXAA 3LOUA 4BFTA 4O2AA 4F96A 3I2KA 1EK2A 3SC6A 3GZ4A 1BC5A 2YRFA 4H17A 4CTMA 4YS6A 4JJFA 3PITA 3GO4A 4PV7A 4UBKA 1DCTA 3H83A 3EGOA 3HG7A 3LX6A 1SCUB 4FYWA 3WFZA 5JZSA 3NBMA 2DOKA 4D96A 2HBYA 3ISJA 5EQFA 3ASYA 5A06A 4ZO4A 2SKCA 3THWA 2C4NA 4EJSB 4GZ5A 2NGRA 2UYGA 3I1IA 4Q7KA 2Y6UA 3FMFA 2JFWA 5ELMA 2BM9A 4YACA 3SYKA 1G8JA 2Y1OA 4IH1A 4JV5B 2WZCA 4LXQA