2XVXA

Cobalt chelatase cbik (periplasmatic) from desulvobrio vulgaris hildenborough (native)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
262
structure length
262
Chain Sequence
b'QKTGILLVAFGTSVEEARPALDKMGDRVRAAHPDIPVRWAYTAKMIRAKLRAEGIAAPSPAEALAGMAEEGFTHVAVQSLHTIPGEEFHGLLETAHAFQGLPKGLTRVSVGLPLIGTTADAEAVAEALVASLPADRKPGEPVVFMGHGTPHPADICYPGLQYYLWRLDPDLLVGTVEGSPSFDNVMAELDVRKAKRVWLMPLMAVAGDHARNDMAGDEDDSWTSQLARRGIEAKPVLHGTAESDAVAAIWLRHLDDALARLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHELATASE, PUTATIVE
publication title Evolution in a Family of Chelatases Facilitated by the Introduction of Active Site Asymmetry and Protein Oligomerization.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Metal binding protein
total genus 97
structure length 262
sequence length 262
ec nomenclature ec 4.99.1.3: Sirohydrochlorin cobaltochelatase.
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06180 CbiK Cobalt chelatase (CbiK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xvxA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xvxA02
3HCOA 3HCPA 2HRCA 4KMMA 2AC2A 2Q2NA 2AC4A 4KLCA 1LD3A 2H1VA 2Q3JA 3AQIA 3GOQA 4CCSA 2XWSA 1LBQA 2QD5A 2XVZA 2PO5A 2XVXA 2XWPA 2QD4A 4F4DA 2HREA 3W1WA 2QD2A 4KLRA 1TJNA 2DJ5A 1C9EA 1C1HA 3HCRA 2XWQA 3M4ZA 2HK6A 2H1WA 1N0IA 2XVYA 2PNJA 1L8XA 2Q2OA 1HRKA 2C8JA 2JH3A 2QD3A 3HCNA 1QGOA 4KLAA 4MK4A 1DOZA 3LYHA 2PO7A 2QD1A 1AK1A
chains in the Genus database with same CATH superfamily
1KJIA 1OROA 3OCCA 2IEBA 2G09A 4G9GA 2DJIA 3NH6A 2CW5A 1E9RA 1Q50A 5L7WA 3GX1A 4MKHA 3LUFA 5CA0F 3IAHA 4LRWA 1RWQA 4AJ1A 3A14A 4EB8A 3ZWCA 5DBEX 3ZEAA 1M1NA 2Z4RA 3DMTC 2B8WA 4PVCA 4NYJR 2LCQA 3GGDA 2MU1A 3WYCA 2SNIE 2V03A 4ENSA 4TXNA 1JHZA 1U8AA 3HZRA 4LJ6A 5C46F 3AZOA 2YJ3A 4NMXB 1SQ0A 4V0LA 2PKWA 4BAGA 2HBQA 3Q8XB 2L42A 2G3YA 5MGNA 4I5IA 1U8EA 4FVTA 1IEVA 1A7UA 3CYFA 1AHNA 4TT3A 1RWMA 1D1TA 1CZNA 1F8YA 1E4OA 1VBMA 3NEYA 5E9JA 4DQLA 5HK9A 2QD3A 4HPWA 8AT1A 2GPNA 3IODA 3ZI4A 2PZFA 1V7ZA 4PANA 3HG7A 2YHAA 3L0SA 1WF3A 4MH0R 4CV1A 4JI5B 3T6KA 4O4IB 5K8UA 4FBLA 1WXDA 3GLTA 3E9DA 1GTG1 4JT8A 1MIOB 2OPHA 2ID7A 5CURA 5H3HA 5GGXA 3WBJA 3VSAA 1YA8A 1P0QA 4AJ9A 4QBGB 4JL5A 4D97A 2DR2A 4TKUA 1UK8A 3DQPA 1EGMB 2VCEA 2AJBA 3TZHA 1RZRD 3OEED 1ZUIA 3AVYA 2ZYVX 2QN1A 4XB2A 4EJSC 3U6BA 2XRFA 3QNMA 4B7UA 2EJWA 2SHKA 2ZB3A 1NW3A 1HSOA 2Q3BA 4EL5A 3KR0A 1RR6A 4YAJA 4JIGA 1V1RB 1KBQA 4K40A 1CUWA 2QUAA 3D0KA 3EXG2 3CQ9A 5JNUA 5BYJA 4LHWA 1J8YF 1GQRA 2FZWA 2DGDA 3RADC 5CLGA 1GPH1 1P74A 5LMCA 1ES9A 4W4TA 2HSZA 3O8QB 1RKBA 2F8MA 2YHSA 2W2QA 2ZT7A 5HIAA 1U0JA 1J56A 5FNVF 3NUGA 4B4VA 1EM6A 2CNWA 4CM7A 1H6CA 4NU8X 5D1NA 4BFCA 2VTBB 4C7OA 5LQKA 2ZAOA 1UEJA 3MGBA 3TUIC 1Z2EA 1UDBA 2JS7A 2FVYA 2XUFA 1AB6A 3K9GA 4L4RA 3DBHA 3KLBA 5EIXA 2DMRA 2N47A 3FM9A 1N6HA 4YJ3F 2JEYA 1EA5A 4ZOCA 2B8EA 4N0EA 2ZSHA 4X44A 1B0AA 1NW5A 3BS4A 1CERA 3ONFA 1WDTA 1IZ9A 2Y1WA 4I9GA 4RK5A 5A9TA 1KE1A 3CZ4A 4E08A 1SQFA 3L7LA 5JZOA 1SVIA 1MGPA 1O6ZA 3FB4A 4RF2A 1D03A 1S4QA 2QX7A 1RRFA 3GJ7A 3GW8A 4PFQA 2D7CA 1ECPA 1UC8A 4HWRA 4EZIA 1QHHA 3WSWA 4WAUA 1RLOA 3OEHA 1XTRA 2OD7A 3GPBA 3I3SR 4GMDA 3MB8A 5LLSA 4B6FA 4P22A 1EM8B 1HDRA 3HJGA 5EHNA 3FOEC 5EMMA 121PA 3GPDG 2Q5FA 3K94A 4KVFA 4M99A 4Q82A 2O5RA 4CMKA 3CUSA 5CFOA 1YZHA 3IQGX 3C6ZA 4YCJA 2EZUA 2HI0A 2O1EA 2VT7A 1EEXB 5H3LA 4CQNA 1Z4MA 4B83A 4ZT5A 2AN4A 4D9MA 1JNYA 2IYFA 3DBRB 3NHPA 1PR4A 1R4NA 3BB1A 3I1YA 2ZSUA 3HP4A 3U3OA 1Z26A 4LVOA 3PC2A 1F4LA 5HM8A 4BGIA 5JXIA 1WUKS 4K6OA 3QQ5A 4IDCA 4RFSB 4FGKA 3FLMA 3TEJA 3Q7TA 4EDFA 1ORRA 3LOPA 4Y2XA 4DZRA 3D6JA 4FMBB 4OGKA 3ZWNA 1VQ1A 4URXR 4BMXA 4Q05A 4KU4A 1SD1A 5EWJB 3JASB 1XTVA 4MW9A 4RORA 3LHDA 4Q16A 5GOTA 3COZA 3HHEA 2AG8A 2VAWA 1HQKA 3AW9A 3ODGA 4W99A 5AK5A 5THXA 1TYBE 5HX7A 4P81A 3WJAA 4JAVC 3CV3A 4DLUA 3ZJTA 2QG4A 2C82A 1Z5PA 4G5YA 2PGLA 2POCA 3FCOA 3O4HA 4J3JA 1CS4C 2OE2A 4IQGA 4W5WA 4F21A 1I9GA 4QAQA 4QPCA 4HQ0A 2XUZA 3Q7PA 4MVJM 4OPMA 2ZPAA 4MQMA 4PTLA 1C7FA 3D4OA 1LV7A 5EXXA 2YRWA 4GG1A 1JE1A 2VF8A 3R75A 1KJZA 3MSCA 1DMSA 1G63A 2OQIA 1PFGA 1VXRA 2DX7A 1RLIA 1ZWLA 5C7YA 3UBMA 5HKBA 2V54A 1I10A 3ET4A 5JS8A 1UJNA 3LY5A 1GTL1 1R6UA 2WF6A 4ZO8A 2WI8A 2WU1A 5KC8A 5F64A 4B2PA 4PONA 4QPDA 1AUQA 1L8LA 3M6VA 3PCTA 4EJMA 3L0DA 1N3LA 4DUZB 1E5TA 2Z5FA 5AESA 5A1TA 5KVVA 4AY6A 1BXRA 3TCXB 3ZHYA 4JBXA 4LXUA 3CJRA 4K86A 4KLAA 3R4CA 2X5XA 3LW7A 1ISJA 1N92A 1GNRA 1WF6A 1Y82A 4ZIRB 2AOTA 2VQSA 4MDFA 3FX2A 4G0QA 1O6FA 2CMFA 3EEQA 3CUTA 3GDHA 3QOXA 3NOVA 1B0ZA 4RE5A 1AX9A 2C9MA 4RSRA 4JNCA 1P2DA 3DZGA 4OFXA 4TQAA 4JUAA 4U7DA 1XKXA 4YJ2F 4MHTA 5D1HA 5E3JA 2OXTA 1V39A 4Q7MB 1NQOA 4QICA 2D7JA 3LH5A 3ZI0A 1J1UA 4QVKA 1KJ9A 1TMKA 3EQ9A 5LUBA 1HGXA 4JY7A 4Q3AA 3TSAA 3QE4A 3AJ9A 4EKDA 1K6XA 2QRJA 4L0MA 5I9BA 2VP2A 4RLHA 1CE8A 1W36B 4M8KA 5B30A 1TAGA 4LZZA 1VDMA 4QT0A 4MQUA 1PK9A 1YIAA 1VZ2A 2JH8A 4KUEA 4CPDA 3BBLA 3MRVA 2Z2IA 4V3BA 3MEQA 3LV8A 5EFZA 2CNNA 3J81k 1IHXA 2V7GA 4FJ1A 4NJMA 2ZSIA 3TLAA 3WGTA 3GUCA 5JC1A 3DLBA 4RK0A 1RCTE 1Y81A 1MRZA 4R1SA 2IYSA 1REQA 3HRHA 1BQEA 4QYTA 1GGEA 5EIOA 4C4YA 3TOZA 1HM5A 1TYCA 1NATA 1YDFA 3PVCA 3QVJA 1KYWA 4JBWA 4F71A 4FYPA 1RM0A 3LQQA 4JWTA 1XZEA 4WCFB 3U3XA 2C7PA 3GLIA 3WIEA 3V4FA 4HBGA 4NDNE 1N6NA 1LVHA 3T9FA 3OTOB 1BROA 5CVDA 1X7HA 3DKRA 4MX8A 1OLSB 2I22A 3AEXA 3F5DA 5DJ5A 3EBOA 4KN5A 1VPEA 5JNSA 1N5RA 2BZSA 2DOKA 1XU9A 3KEGA 1WDMA 1NY6A 2AR7A 2GFQA 3CZ9A 2VA9A 1DAEA 1OT5A 2Y2UA 1K98A 1FUYB 1SU7A 4D8VA 4O1HA 2V6MA 1KR2A 1T8TA 3T4EA 3Q11A 8ADHA 4H0FA 1JHOA 3N70A 4GFDA 3LW8A 4C0BA 5KWVA 1R88A 4QUGA 4CUJA 3ITEA 1P9WA 2QTMA 4PY2A 1U0NA 4BNIA 1JKMA 4PO1A 1G8FA 1WUHS 3DWEX 4YJKA 2M1ZA 2EFEB 1C7IA 3O74A 3UAGA 5LU9A 1D6MA 1G98A 2OYSA 2VPZA 3PL5A 3WWEA 3BE8A 4YP7A 2WIDA 2GN9A 3B1JA 4ZYZA 4YCLA 2GAIA 1UBLS 1DNPA 1OA1A 1ZBDA 1Y3HA 2FWAA 3CMMA 3KQSA 3Q4GA 1UK9A 2AIRA 1NN3A 5JZSA 4KNYA 3COJA 3LP5A 1Y48E 2QL6A 3TUJC 3V9PA 1NSYA 3LHKA 1A9PA 3DTTA 3TRJA 1ZM3A 4GI3A 2CB0A 3VH2A 4NBRA 5AW6A 5EXDA 1O87A 4ASUA 1VSUA 2OB2A 1FFBA 1XP5A 1PKXA 2GEDA 5KTTA 1VL0A 4NULA 1NBIA 2JFOA 3ZV5A 5JVDF 3H2IA 2O0MA 3RIGA 2O3UA 4QSMA 3KL2A 1FMCA 3DNMA 1SVMA 4LOAA 4WOCA 5H1YA 4DMUB 1QB7A 3ZWYA 3GH3A 4V0OA 1VLHA 2VUSA 4F6RB 1XCBA 1L5FA 3RHFA 1LY1A 3M6AA 3I04A 5I9LA 5BP7A 5JAPA 5KNLA 1MX1A 4DRXB 3BHMA 3MWDA 4WEOA 1EFDN 3ZV7A 1YB5A 1ULUA 3QH4A 1E3QA 4L22A 3OO1A 5KQLA 3H4IA 3KPUA 3D8HA 1TDJA 4L4SA 4BNNA 3EODA 1CQJA 1NF8A 5K0EA 1T4CB 1RXEA 4UHKA 1WB4A 3T8YA 1NRJB 1CF9A 4ZOLF 2BGGA 5CA0B 1VPWA 3KFVA 2ZPUA 3DL0A 4TSFD 1IG0A 1OAAA 3T4XA 4MRPA 1I7LA 3OQOA 1C3XA 4CG0A 4DMCA 1PVOA 3ZLJA 4OJNA 3SPXA 4MR9A 4TS4A 1DHTA 4RPHA 5I4IA 4JX9A 1K7FB 3WJ1A 3ZWOA 2VC2B 5DASA 3UT5B 5JCJD 2J3IA 1ZUNA 5K45A 5HTKA 4I5FA 3UAYA 5SYNA 6NULA 1KAQA 4IYJA 1C3LA 3HXQA 3V1NA 1TM2A 4LRQA 1TEZA 1SD2A 2B4KA 5LU8A 1G21B 4GLJA 1HKUA 3Q12A 5EHIA 4DMLA 4FOLA 4JJ8A 2WOOA 1GRCA 5HIKA 3C0KA 1JV2B 1MRNA 1JJBA 1E2MA 1VG0B 2H9YA 1JFVA 2OZLB 3DDNA 4C05A 2TYSB 1EX6A 3N2NA 2P9BA 5I7AA 1NKTA 4RK7A 1N32B 2JD1A 4EHKA 1E7RA 4DKXA 3GJTA 2KM1A 4TWJA 1GPJA 3P7MA 3JX9A 2CCKA 4R2WA 4EEKA 4DA9A 5K6AA 2UUAB 5K0ZA 2IYTA 4IDNA 4YV7A 1F9AA 2AFRA 2HMYB 2R8XA 2NIPA 3IJPA 2H63A 4R4JA 2I2XB 2KLBA 1RBQA 3O26A 1C9NA 3BXGA 4DJAA 5I8PA 4LUCA 4RH0A 3RYHA 3ITNA 3TJRA 1RE1A 4QREA 3ZNQA 2HRQA 1U8XX 4C6RA 3QSYA 4LFAB 1EWTA 1SEPA 3AHCA 4B85A 4MUJA 2ZJ8A 4I55A 3NHZA 2B25A 4I3HA 4OBEA 4GWKA 2ZKLA 5EKTA 1KKUA 2QIOA 5FL7D 3ZOKA 3AYZB 4D9KA 2ZS7A 4YV2A 2W48A 3H2SA 4RVDA 1KSHA 2ZYRA 3LCJA 2XXAA 4XVRA 4D9FA 3CLRD 5FNVB 3LM8A 1FBNA 3LF2A 2IXFA 2F9LA 2YWFA 4G63A 4KPGA 1O9BA 1HL7A 2H1CA 2ZVPX 3ED5A 5KNDD 1EUCA 3VJMA 3KXDA 1CQIB 1BDBA 4KQ6A 3V6LA 1UMBA 2C3PA 1Z7GA 4DC1A 3M1LA 4FNAA 2TMYA 5FR1A 5AXDA 1PFWA 2DQSA 4OI4A 2BFDA 4X1OA 4FDLA 1N2OA 2XE6A 3DFIA 4YJ3B 3HWSA 5JV5A 1JEOA 4MRNA 3MT9A 4X97A 3GRAA 2BEWA 3P9ZA 2Y4OA 4R81A 4TLMB 4BZPA 4E3ZA 1OXKB 3D6UA 1TQDA 3K4PA 3RWMB 1WMDA 1Y5LA 2ISQA 3RJ5A 5CLJA 3IOBA 4KAAA 3WNBA 4KFSA 2WBLC 1RWWA 2FW6A 2CY0A 4ZTBA 1KVTA 5AQ1A 3U4HA 3BIJA 1KFBB 4M8IA 2V6BA 4Q9HA 4ALLA 3M9XA 4W5TA 1X8LA 2D1TA 4H16A 4YO8A 3U4IA 2WD9A 1G9XA 4Q9AA 1BTOA 1KWKA 2JASA 1IRXA 3RUPA 4AP6A 4C0XA 3D6HA 4Y1FA 4C87A 1YZ3A 5FOVA 2WHPB 4YJHB 5A5EA 3UHPA 3U4AA 3LYLA 1LPNA 3JQPA 4HDRA 4MWTA 3TD6A 3U61B 1M3SA 3P0JA 2GZMA 1KHHA 2K2WA 5GIPE 3B52X 1JH9A 4O2AF 2HQ1A 3CEJA 5FLYA 2WG0A 4FFBA 1RD4A 1JG7A 3L4JA 1P7ZA 2PSHA 1FPQA 2DFPA 3H3FA 2VRCD 4KXWA 1Z82A 2YIDA 4Y2VA 4ZVMA 1NTOA 5CX1A 5DO9A 4ZDWA 2JJ1D 2B3DA 1QOPB 2BFCA 4WJZA 4RACA 4BO0A 2P3LA 4IMRA 3WFJA 4BLOA 3SBEA 4HDKA 1W9MA 1OIVA 1MB4A 2FQXA 3S81A 4MXDA 4CNQA 3IHKA 4HNSA 4WN9B 1QNLA 3P97A 2Q3EA 3S8YA 3SJ7A 1U0BB 1JQEA 4ZVRA 4KQ1A 2VYFA 2EV9A 3I04M 3O90A 4BP1A 4GLBA 3PT5A 1PJQA 4BB6A 3P45A 3ZV4A 4GMXA 4PSDA 1Z4KA 4ZV7A 5E3IA 1PR6A 4Q7QA 1GWNA 1OZHA 2VUTA 1B43A 2ZRGA 3KFXA 1IN4A 4OD0A 4B1FA 2H5LA 3VZSA 1L7QA 4PGHA 3VXKA 1DPFA 1GLVA 2NPIA 4GC9A 1B6TA 1CUSA 1ZESA 4A2QA 1A3CA 1FW8A 4QM7A 3HGQA 3LY8A 5IAAA 2EBUA 4L07A 4JXZA 2V0CA 2CBZA 2GBLC 3ZXSA 3Q9UA 1RZVA 3R9WA 1E1LA 1QK5A 3DULA 3GUVA 4A8JA 1IOLA 2P67A 1FNMA 3HNRA 3JARA 5C5IA 2V5VA 1D3AA 4YAFA 3NIGB 5E4YA 1LD3A 2WHEA 4WTOA 2KJQA 5DHAA 1P5RA 4R71A 1U7HA 2YVLA 3R40A 2XVZA 2WY2D 3GLUA 3LA6A 5I5GA 1I4OA 3DP7A 2A9RA 2HV8A 4KO2S 2GS9A 4MA5A 4V0NA 3R8FA 2WWVD 1RACA 1HYQA 3IDAA 2OB1A 1DXHA 1OH6A 3L6CA 3G79A 2EG5A 4YJ2B 1SRQA 4LSGA 1RPZA 3LUPA 2NXNA 5C8VA 5K3EA 4M0LA 2G0AA 4HNUA 3PC7A 3KYCB 4E09A 3OM1A 4UFOA 1GNSA 2ZJ2A 3AHJA 1Y1SA 5ARBA 2O1WA 4XXHA 1NURA 2XH8A 1UXKA 3DZCA 3MXOA 3OE4A 5ER9A 3D2BA 4D8TA 4I1OA 1KEZA 2G0NA 3YASA 3CB4A 1EFRA 1JQJC 4CLOA 4P8RA 5AUOB 4LYJA 3DPUA 5HWSA 1E3WB 1XRLA 4YWHA 2VG8A 4D4HA 1M1YA 2QPOA 3MW8A 3KBOA 1Q0QA 4J76A 1KVRA 3JZDA 5E7IA 5K4AA 5CBPA 1EZZA 2HCJB 2WNIA 2GEJA 2OBNA 1J6UA 3R3UA 1EBFA 2FTKE 4A0FA 4ACBA 3U9SA 1PKEA 2HXSA 1UANA 1ND5A 2JFGA 4Y2RA 3H0CA 2PV0A 1R0LA 3NANA 2HK8A 3CR3C 3OJ0A 2RARA 1II8B 2OK7A 3ABOB 5H16A 4TYQA 1OZFA 3F5FA 3KQOA 2G76A 1XTBA 2JIZD 2ZTUA 3GVIA 2WTMA 1SUWA 1VL5A 3EX7C 3OBBA 1BKSB 2OFPA 3AXTA 3RJMA 1NW7A 1ZI8A 4IH4A 2XYVA 1W4CA 3EDMA 3N2LA 2AUNA 1BJRE 2P9TA 2PIAA 1GGKA 1PS9A 3AHHA 2Q62A 1ZIDA 4GH5A 4H35A 3JQBA 5DBFA 1OJLA 1MG0A 1VPLA 3SEAA 4G0VA 5L3QB 2CD7A 4GGOA 2ZQYA 3I42A 2AT1A 3NC0C 1DEHA 3FN4A 4DLKA 5I3ZA 1IQRA 3LC7O 5KYXA 5B1SA 3CUEF 4ENWA 2CJWB 5JRJA 3K6SB 1KMCA 2A2ZA 3IFSA 4RTPA 2PL3A 4BYGA 1LWOA 1IZ0A 2NN3C 3K1TA 1T8YA 3NCTA 3RS0A 3TLBA 3V00A 5K3OA 2DFTA 1OSNA 3CO0S 3G2PA 2EIXA 4KRFA 3FZGA 5A06A 3CWZA 4XIJA 1YHZA 1YQTA 3NEJA 1FS6A 1K9VF 3E5MA 4UCFA 3S7TA 2A1UB 5K8IA 3N75A 3UTCA 2BVNA 7ADHA 1H85A 4XCXA 1CR4A 4YJGA 4U9HS 1PNOA 3I12A 3MJFA 4RABA 4XUDA 2DWUA 2Z56A 3N2KB 5EMHA 4DVJA 4BX8A 4GRDA 2P79A 2J9FA 4A5OA 1FJHA 2P4EA 4NFHA 4P84A 5CRIA 1ZXBA 4K9SA 4PRYA 3EGOA 3E35A 3K0AA 2PX8A 4BVBA 5JVDB 2GN1A 1JHXA 4A0SA 5G2OA 3NTLA 3GZTB 1T2NA 1GU7A 5TMBA 4IZHA 4ZJPA 3E23A 3KOWA 3PQ2A 4FGWA 4BKPA 1E79D 4M54A 5E6UA 5MDHA 3KPYA 1MXFA 2FSVC 4RHYA 1T0IA 3ED1A 1B42A 2PAFA 5KQGA 4MMZB 2GJ4A 1FYVA 2WQ7A 3KTAA 4FR0A 1GSAA 4OYLA 2J3JA 5BQPA 3T3OA 3L6DA 5A6SA 2ZWOA 4ER5A 5DN6A 4N1AA 3SG0A 2WJPA 4POAA 3SM9A 4DA0A 3U3JA 4ZOLB 4WINA 5ITVA 4PQYA 5JPDA 1R0BA 3BRSA 1HUQA 3GG9A 5AKJA 3SEQA 2IY8A 5HRCA 3TS1A 1PV2A 5J47A 1FFYA 4EPRA 1JG3A 1MO3A 2WWGA 1NUQA 1JXMA 1NRWA 1RAAA 2GPAA 3BKXA 1BS1A 2HU7A 1UAYA 3MRSA 5TEWA 1A5BB 3UB2A 4A7PA 3KO8A 4J3FA 4NZMA 2IL1A 5ALUA 1P45A 1QYRA 2R7MA 4XOUA 1EDZA 2WFLA 5HOQA 2RGYA 4EIWA 4OQFA 3LY9A 2IXGA 5TQ0A 1IZYA 1L7XA 3N8IA 3ZQJA 4G86A 1E3IA 2UVPA 2YV4A 3QKRB 3R9IA 4OMUA 3N2YA 1YZNA 4BGVA 4EPVA 5D85A 2ZDQA 3DKPA 4EG0A 2O8BB 2CNOA 3PGVA 3GFOA 2R6FA 2NP6A 3NBUA 5AVQA 3GC6A 2XB9A 3I6IA 5C1OA 5G02A 3GXOA 3HJNA 5ECWA 3OC0A 3AF2A 3IKLA 3KQYA 3R5KA 1NUUA 4JC4A 3D8BA 2DFVA 5DHQA 4BB9A 3KAQA 2P4SA 1YC2A 1KAEA 4RO0A 4HGYA 2FUG6 3EGVA 1FSGA 3RC9A 3TNJA 2B5WA 5K6AC 3AJRA 4RA9B 4WBSA 4QJIA 5FR2A 1XCPA 4EHAA 4RCZA 1UT8A 4OAOA 3FIJA 3BDVA 4GF5A 3WP0A 1E69A 3H5WA 1YA4A 2ACWA 3U5ZB 2FMXA 3CS3A 2PA3A 2V5UA 1HR0B 4DABA 2O5EA 3C5HA 2XJ4A 2P78A 3LQ2A 1K66A 4ZWNA 1ZD9A 2G07A 4RF4A 2W4QA 5EIBD 4RJTA 1FK8A 1BVUA 7AT1A 2CLDX 4KKXB 5BT9A 4BCBA 1E3SA 3GO4A 1YOBA 3VRHA 1SOWA 2JAQA 5K0JA 3BG5A 4CMHA 1VECA 1GPBA 4N65A 5GWXA 1VJDA 1ZSYA 4HLUA 2C5LA 1XCOA 1JS1X 4RD6A 1CHDA 3BSFA 3IILA 5KOJB 2C7OA 4HPJB 2KBEA 1TD9A 2O0LA 3ME5A 3Q1LA 5I4CA 1OR8A 2CYBA 1NVDA 2RE8A 2K87A 5J63A 3R74A 4DYVA 4F8JA 5CDTA 3ITDA 2XLCA 4GMHA 3VQTA 3RSLA 2IZ0A 2RHHA 5J4HA 5KUTA 1R0ZA 3NHKA 5AHOA 2AOUB 3ZIDA 3ZK9A 3HKDA 4JLSA 5ECGC 3GLSA 3S2IA 1YTUA 5ETJA 3GLVA 1ORTA 3QVWA 1PZFA 2HPAA 2LP4Y 5EINA 4MUXA 2VQEB 4DN6A 3F71A 2P9HA 3G85A 4R1PA 4CQMB 1VRVA 4DIBA 1NXWA 1Q84A 1R12A 1RAGA 2UUPA 2FEWB 3BRWA 1G7CA 4JVOA 1CDEA 4PYQA 2XMSA 4QO8A 4A2CA 4F5DA 2BFEB 1CZRA 3G68A 4LZAA 4QULA 4TT3D 4V0ME 5BN4B 1BVHA 3TI9A 2VNJA 1ML4A 5DK6A 3K70C 1AS0A 3OM9A 4DQKA 1L3IA 4UVEA 3IDQA 2P30A 3K0HA 1W0KA 2QT1A 1THTA 1UQRA 4JQYA 3S40A 3QLVA 2GKGA 2RAVA 3RSHA 1D6JA 4Q4HA 3AGQA 4O2AB 1Y5MA 3BXEA 4QGBA 2R86A 2I4OA 2JA2A 2B7BA 2VVTA 2WJJA 3K0KA 4IIBA 3S2FA 3T3GA 3HWWA 2O8DB 3DOIA 1CRZA 1N5LA 4PNHA 4GP7A 2HU8A 2H7YA 4IV8A 2GPBA 2H2DA 2RMKA 2OG1A 3TWOA 3KB1A 4TLEA 3CRQA 5A3JA 1I3LA 1D6NA 5GVSA 1T25A 2VH5R 1GEEA 3MD9A 3EGXA 4CLXA 3W9YA 4TV9F 3A58B 3O75A 4MKIA 5JYDA 2O54A 1NV9A 4FE7A 4IDDA 1FXUA 2NQTA 3NNSA 3KQWA 1SXHA 2CFRA 3K31A 2Z6QA 2CFTA 4TMWA 5DI3B 3PXGA 2NPOA 2GJAA 5BSMA 3KQVA 1JBKA 4IW3B 5G1PA 3UK7A 1XVTA 5EMKA 3E4CA 2VTEA 2WJZB 4HQRA 3CIOA 3LCVB 4PINA 4MUNA 4B71A 4E0BA 2YV2A 4KX5A 3PWSA 5MGBA 1FNSA 3KCNA 2CNWD 3GRRA 1KGSA 1TUBB 1ZVQA 2LNDA 4JLOA 3GEIA 2JFUA 1VKJA 3OZXA 3OLZA 1FDOA 4ZVPA 5F7XA 1JYSA 4KL8S 3BSSA 1FF9A 3FBWA 4U6SA 4YQEA 2HRZA 5KJEA 1SPBS 5BYAA 3GP3A 2NP7A 3OE7A 1EJBA 4HB4A 1DG1G 5H82A 1AUXA 3I8OA 1EE9A 3NWEA 3EVDA 1I2BA 2J5KA 3VTKA 3NGMA 4QVIA 2R8RA 2FPKA 1MOSA 4MJXA 2X22A 1FFGA 5BWBA 1AHPA 2X8BA 4Y6QA 3WIUA 1TKAA 2CEKA 3ZGYA 1GDTA 1QRRA 3JYQA 1FP4A 1J90A 4C5BA 3SLKA 2R66A 4LJ7A 1CQPA 5K4HA 5FA6A 4CR7A 4NBVA 5BSFA 3PNSA 4A23A 1U63A 4DDMA 2FSHA 5IVIA 2BEKA 3HP1A 3RC2A 4CWAA 3FOFC 1K0FA 3ETDA 4JP5A 3FLBA 2V58A 4Q1EA 1G21E 2WU4A 3NDIA 4K6FA 2ZW9A 1M7BA 5FO0A 1M5UA 3TCKA 4BVGA 3D4BA 3A26A 2X1VA 2BCEA 4NF2A 3V4LA 1YRAA 4AZVA 5U9CA 5JZBA 4EY6A 4FN4A 3AFGA 3BFXA 3KUDA 5AHRA 2DFKB 3K2IA 5B3JA 3O8DA 2PZKA 1V71A 3M5CA 1E1CA 4RHXA 4HTFB 4N48A 1UZLA 3CNEA 3D3JA 3PHCA 4IPTA 1BXGB 1T0BA 2ODTX 4B3HA 3VU9A 5BQFA 3HFSA 4QYXA 3R7BA 1Q7GA 1V47A 1ZKDA 2WJ6A 3D2CA 2BMFA 2XQKA 2C59A 2AMFA 4TXLA 4FD3A 1Z0SA 3Q3CA 1QP8A 2F3PA 2C4VA 3B6JA 1LQTA 4FSXA 4K6MA 4BNGA 4HI0E 2PWZA 1GVHA 5AOCA 2GSDA 4FLMA 4D0NA 5MFZA 4OI2A 4ZQBA 1GPWB 4PTZA 3TL2A 1GJRA 3NC4A 5LWHA 1QCCA 2QLLA 1O0BA 3LRPA 1VFPA 4L4UA 4JC5A 1WTAA 3KWLA 1BH6A 4Y1EA 2BONA 3WB9A 1MEJA 2Z83A 2HMUA 3HVKA 3JQRA 2X0EA 3G0HA 2JD2A 3DOUA 4QFCA 1EAYA 1X1QA 3QJGA 2DKFA 3IOMA 5IEBA 4R1TA 3G7UA 4CEHB 1KOGA 3L04A 1FZQA 3QVMA 8OHMA 3PSAA 5F3RA 4TM7A 3RODA 3SGLA 3X2FA 3HDYA 2R7AA 4Q7JB 1OFTA 1G6Q1 2W8BB 2PS9A 3COWA 5FUBA 4CDRA 3DC7A 4P4LA 5BVHA 3PZBA 3HY4A 1P2FA 4D3XA 4NXNB 3Q7QA 4HDNB 4FZVA 5ALLA 5JANA 1YGYA 2IKSA 3W90A 1GGNA 2DPXA 3OIGA 1ZONA 3QFRA 4Q19A 4Q15A 1JZQA 2HQOA 1P4SA 2BI7A 1U8FO 2R1VA 4Q02A 1UPXA 3WX0A 2ZK7A 1Q0TA 2E9SA 1TTPB 4A2PA 3SX2A 5KNCH 2JI6A 4WUVA 3HXMA 1G64A 1ULBA 1FVXA 1KDYA 2BPOA 5KDOA 3M83A 1GGVA 2WP0A 2P90A 4GOKA 2RGXA 3JQBC 4MWSA 4OXRA 5A4DA 2WUWE 1XDUA 4MICA 3D4NA 3BFJA 5C5CA 5KDDA 3I2HA 4IFIA 4IMPA 4GX0A 2H4WA 1PQYA 2A9PA 3H0KA 4MPRA 4D5GA 4IAOA 1RIFA 2O7SA 1M76A 2Y67A 4YROA 3EQ2A 4K2HA 5LBUA 4JYZA 4OOEA 4BMCA 1QMPA 3WKBA 2J7KA 2OAQ1 2XYQA 3QUAA 3VYRB 1M2OA 3E9ZA 2AKAB 2XUDA 1WMBA 4TV8F 4NBNA 3OZFA 3M4ZA 1C30B 4Z4QA 4X7MA 4AIRA 1IK6A 1RHRA 3QXGA 1GRRA 1EYZA 1U9CA 1GSHA 4YEDA 5KWJA 4XYLA 4KGZA 5HKKA 5IZ4A 4ZCMA 5HQ3B 3HNOA 1CIPA 1TC1A 1X38A 4RKRA 1SCDA 2RH8A 3T1NA 3VPCA 5AM3A 3GT4A 3R7SA 4GPD1 5CDUA 3BWBA 3H99A 4OQNA 5A2GA 4EATA 3EZLA 3F5SA 4GVLA 4YP9A 3EUEA 2Q7DA 3V1KA 3FUUA 3ZD6A 3NETA 5TARA 3L0ZA 2BM8A 3QNUA 4PFJA 1UJ6A 3WP1B 3DL7A 1IU9A 4PQRA 3O2SB 4W8OA 4WMLA 1R8JA 1TQ6A 1R50A 1ZC3A 1KYYA 3QF7A 5F76A 2DAPA 1GCIA 2AG6A 1Z5NA 2VDUE 3CM0A 4IZOA 2E1PA 1NDUA 4MHOA 3TR6A 2HW8A 3PL1A 2X8AA 3A9WA 4EG7A 4WEQA 1JJFA 2J46A 5AW8A 1FRZA 1FRVA 1QC5A 2IIBA 3A4NA 4EDHA 3FKQA 4H27A 4XWKA 3BMOA 2RHRA 2OR3A 2QJWA 3Q8WA 4LI0A 5EP3A 4CI0B 4PV7A 4TS3A 2IPAB 3H65A 1V96A 2EYUA 4WK2B 3EPJA 3A25A 2RBGA 3DUFA 4DNXA 2Q29A 3S1AB 1NMQA 1I7PA 1FFWA 3L1UA 1YQXA 3MBOA 1SM4A 4IJWA 4DPLA 2C5SA 1Z5UA 3K1ZA 4QHSA 3SFTA 4DV2B 2C07A 2H2GA 3AIOA 3FHCB 4XUGB 4BMVA 4PNPA 4HH0A 4EF6A 3C8UA 4LZNA 1DQSA 2R5FA 1IAQA 4RL4A 5AP9A 1RJ9B 4KTVE 3T61A 3WIBA 4BKUA 5JSHA 4Y8VA 1XL1A 1KE2A 1I13A 4G5QA 4NI5A 1P2GA 4RS4A 5REQB 3W6PA 5HUHA 1DTEA 5D51S 1HNZB 5KC9A 1O97C 2OLJA 2ZR8A 3CNOA 4KZKA 2XMPA 5F98A 1ZCZA 2ZIXB 1UPAA 4LJAA 2LBPA 3C3DA 2QQGA 1W35A 4L2IA 4M76B 3OCXA 4MW1A 3V8RA 3OJXA 4LC1A 5L4SA 4TQUS 4UBIA 4DS3A 2QMUA 3ORFA 2NO4A 2YJ5A 2AJTA 2PTGA 1RP7A 3FUXA 3NHBA 4S0ZA 3TXAA 3V3TA 4BDSA 5IG2A 4N3GA 1ABBA 2G9QA 4XWYA 3GZNA 2VCHA 3VHRA 1WBDA 4BBZA 4OLHA 1YFLA 2OM6A 2BP7A 2NU8B 2NVUB 3SS8A 3RS3A 2CVOA 4KO8A 4HDMB 4DXDA 3A32A 4ASUD 4DDWA 3HO1A 3WDSA 1NXQA 1HORA 4AM8A 4B7XA 4RSHA 4Z9AA 1SUIA 4UPVA 2QVCA 3VSEA 2RGRA 5B7PA 4CDNA 4GWLA 5SICE 1IATA 3KYDB 3DEFA 4DV5B 3MQ4A 4XVCA 2I0FA 2CJPA 2D2FA 1GZ4A 4FFOA 4Q9KA 2GTIA 4NPAA 4WLNA 1H94A 4HNTA 1ONBA 4P1ZA 3Q3GE 2BGJA 5DM60 3V4PB 2XUAA 1GPLA 2CF5A 3MC1A 3V8QA 4HVAA 5ERYA 4N3BA 5F4BA 5K3BA 3LZ6A 3HMQA 3NZEA 1UPTA 1K4YA 4X66B 1A4IA 2CXQA 1SB8A 2QA5A 5DK4A 1WSWA 3INTA 4XW2A 4NCJA 4PTYA 2CLOB 3H9EO 3AT1A 4HLUC 2P8JA 3SYLA 2JHGA 4D42A 2PG3A 3EZ6A 1YCHA 4TN5A 3TM4A 3BIOA 3AJ8A 3MMSA 3I5AA 2DC1A 2QLFA 2YYSA 4C29A 4I9UA 4RTKA 1MPTA 1TZKA 1M1ZA 3MJDA 1YF3A 3TINA 3E84A 3KVRA 3MCAA 4R8VA 3ZZ1A 1W5EA 1LBIA 3DVSX 2W2LD 3IAFA 3L02A 5ALZA 3SS7X 5JHGB 1N2SA 1OX5A 3PNOA 1LDMA 2P6PA 3E3OA 2A84A 2R6DA 2OQVA 3G17A 1Z4JA 1AKTA 1C41A 2VAXA 2ZUCA 3X3HA 4IILA 4OV6B 3FBTA 5IBRA 3BWVA 2O50A 2FMFA 1QG6A 1FUKA 4XVHA 1C7EA 2ID4A 3NYWA 4K9KA 3F8TA 4FE3A 5T41A 4ND7A 1NNEA 1C3OA 4MR8B 1V5GA 1FS4A 1NKSA 2JFBA 1RQ7A 3BAFA 3PXCX 3QKWA 2PUEA 2OM2A 5EKXA 3LX8A 3RFXA 3DCNA 2LV8A 3QLVC 4CV2A 3RIEA 1QZUA 2CZQA 3E6AA 3GY0A 1LTKA 4GYYA 4JGIA 3W06A 3UYKA 4DCGA 1YI8A 3SC2B 4E6EA 3DKIA 5ADVA 3GLGE 3MILA 1TU3A 2AC7A 2B8NA 4WXYB 5L40A 1BWRA 1CIJA 2WKRA 4TV9B 4YLGA 2C5FA 2PL1A 3S2YA 3TFQA 4JLDA 1PYGA 3ZWKA 3LUAA 4M89A 5M5BA 3AUFA 4OUDB 5ALOA 1KXJA 1HOTA 2A59A 4C6TB 1F8FA 1QGAA 4MUEA 4M6WA 2VPIA 4FK8A 1G20A 2WP8J 4WZ6A 3ORYA 4XTCS 3VR2A 1L5QA 3FNQA 1PR0A 3HVJA 4DR6B 3JD2A 2OXCA 3PQ5A 2PZGA 4H4DA 4D79A 3KUXA 5AVTA 4B3XA 5LKAA 1D4FA 1H2YA 1RYDA 3C5CA 5ESXA 2ATIA 1AC5A 3KR1A 3QEOA 1KEUA 3D3WB 1PZXA 4F84A 1EH5A 1K7SN 2D1SA 3MQFA 2C04A 2QTBA 4ND1A 2XNKA 4NEQA 4CMIA 5DHPA 4FFPA 5U4XA 1N9ZA 2GYUA 2QXYA 1IY1A 5H59A 1P2TA 4US2R 1MVNA 3ZHSA 1F20A 4MO9A 3BYZA 1N0HA 3DOHA 3E9MA 3EE6A 3ZGNA 3ZVRA 4CFYA 1CETA 2AZ4A 5CYOA 3VJKA 1JZSA 5J40A 4DBVO 1OFHA 2N3ZA 3FCCA 4M0UA 2ZVQX 5IHPA 4DCJA 2ZSEA 2PTHA 3THYA 2BISA 3LPAA 1ORHA 3PPYA 1MAAA 2I6XA 3C39A 3K05A 4DV0B 5G3YA 1P39A 4ZZ0A 4WY5A 4WKOA 5HF9A 3GLKA 4LMAA 1P72A 1ZW1A 3M89A 1IWBB 2NTVA 2I55A 1GZ5A 4KWEA 4HFRA 3NVKI 2W6IA 4MZXA 4KUGA 2B7LA 1G42A 1RXIA 4O4LF 1YDEA 1UC9A 3IMKA 2PO7A 4IEFB 4B35A 2B5OA 2VDVE 4LHXA 5K1ZA 2NU6A 2GD2A 1W1IA 1ADYA 2PIDA 3HCDA 4NP6A 5TB5A 3N7AA 4I9HA 1XEXB 1OKKA 1WB5A 2D3WA 1QGDA 4M0CA 2DUMA 3CHYA 4ZPXA 3RT9A 1AGYA 1ECGA 1YR8A 1FSZA 4DR4B 4FOOA 2KPOA 3FPAA 1BN6A 2ZJAA 1I0IA 1KMHB 5D3KA 5TPZA 1FE8A 1PO7A 4YQFA 3ND7A 3QOYA 4D0GA 4EJSA 821PA 3AC0A 1J20A 1SXJD 1OVGA 2H2IA 3OOYA 5B3JC 1SMKA 2F3RA 4MULA 2BBTA 4OH7A 1JLSA 2I1VB 1A8HA 1YFJA 4DWVA 2RKBA 4ZXPA 4MMYB 2XNSA 4D4MA 3OJFA 2I6GA 1C50A 3ABIA 2PD6A 4AROA 3Q5GA 4A36A 2C7GA 3AZQA 5FA5A 4OCZA 2R6HA 3Q98A 1E2KA 4RC9A 5EJ4A 1G2OA 2CLEB 3EA5A 1TADA 4TYNA 1EFVB 4CT0A 3JWPA 4HJRA 4J0QA 4Q3LA 3LQKA 4B34A 5KU7A 4LVUA 2JFZA 2ZVJA 3JCZA 3G9XA 4R31A 1TJYA 2BTQB 1XAJA 3O4FA 4ZQHA 3ADCA 3UYLA 3DWGA 4ZHSA 4JBNA 3NJ8A 4R9NA 1C8KA 2P27A 3JAKA 3VDMA 2AG1A 3EJWA 4LYEA 1JDZA 2QYTA 5K0GA 5SV2A 4LISA 3U7IA 4LCJA 2PMWB 2Q50A 1A7JA 4NMWA 3FCAA 1F7VA 4MINA 3ESZA 2RGNA 1GADO 2IYUA 3N0TA 4YCAA 3PDJA 3OKAA 4IL5A 3B78A 1C1XA 4GGPA 5MHTA 3CPEA 1RABA 1Q1BA 3WHIA 4NV0A 3CNNA 1I4DD 2R96A 4JBGA 4TS1A 3S7ZA 4B0PA 2GYYA 1P0FA 1PW5A 2Q1UA 1Y63A 2AWOA 2DQZA 2UVQA 4U2CA 4YMUA 2CHEA 2ZTSA 1Y5RA 3PQ6A 5C31A 4LNUA 1KSGA 4P4GA 4WIAA 2YZ7A 1YAHA 2GXQA 5FOXA 1E2JA 4IZIA 1JSLA 4K9DA 3K8YA 3NR2A 4NX2A 4OSEA 1UM9B 3QYAA 3D1LA 3R3SA 3I09A 2O7VA 3D7SA 4PO3X 4TV8B 3VBEA 3TXYA 1WV1A 1UP7A 2P9JA 1NVFA 2IOHA 5HILA 4U2GA 4UXIA 3DE5X 4MUHA 3KYBA 3CSSA 1SGWA 3G0GA 4IJ5A 3I6ZA 3UMGA 4B4KA 2JIMA 2FGKA 2HUPA 2QUKA 4GT1A 3DW1X 3U4QA 1V6AA 3KU1A 4Z0TA 3AUTA 2W6PA 4KI7A 1NI5A 1U02A 3TEMA 1A2KC 1HFJA 1ODKA 3WYEA 3JQ7A 4AG3A 1A9YA 3F6BX 1LBTA 3RRBA 4EGFA 4NVRA 1E96A 1IDOA 1QRDA 1TMOA 3R5TA 4OQYA 5ALHA 4AKEA 3MD0A 3TYXA 4EO9A 1YSCA 4B3GA 3VR6D 4XUEA 1XBTA 3M2PA 4ZYUA 5A4AA 4G37A 2R7KA 4BVHA 5AVYA 1BKYA 5EVCA 4CTMA 4D0RA 1R18A 2GUWA 2P1ZA 4WRRA 4C03A 4MUAA 1XMPA 1JHDA 2F62A 2Y1OA 3A0UA 3RRFA 1B3BA 2ROQA 1RFLA 2JH3A 4AS2A 4XLLA 4AAYA 4J4HA 2QTRA 5IN5A 3RFTA 2JGAA 1NA5A 3Q3EA 2BELA 3SLGA 4EHBA 2O57A 2B7CA 1T15A 1VSTA 2YINC 4L8YA 5DCUA 5ESRA 2IOFK 2C0CA 2PH1A 4JT4A 1AZLA 3C6MA 4K9OA 1TRHA 1ZOOA 3NGXA 3ZCRA 4E2FA 4AYTA 2QVBA 1P8AA 3HO8A 2JIQA 1TX4B 1WVGA 2QY6A 1L1QA 1TLFA 1KI2A 5DM2A 5CFNA 5DXJA 2G25A 1UQUA 1XTUA 3EFHA 16PKA 1QYWA 2C9BA 2VNIA 2YWJA 4M37A 3VX4A 4BHTA 1U7XA 1EFTA 1YRBA 4GX1A 4A6PA 3E5RA 3ONNA 4JI6B 1E58A 1KEPA 3TMAA 3ZD9A 1PNQA 4DLZA 4UHEA 4NMHA 1SG9A 1J9GA 5L9AA 1ZC4A 2AFIE 2ENUA 1YTLA 4RPIA 4ZOEA 1JHYA 1QU3A 3WTCA 4YXFA 5LXTA 4NZOA 4KMOA 4LVCA 3IRUA 3A9VA 3SBOA 3QGMA 4OQPA 4MVJH 1WQ3A 3M3PA 1UDCA 2FSUA 3KJEA 3FOBA 1W85A 4H7PA 4K6GA 4E7OA 2AC4A 2SBTA 2JAUA 5FUMA 3C6BA 2UYOA 4DCSA 1FLDA 3AF3A 4C1BA 3HACA 5NULA 2NX2A 1H2WA 2CXHA 3X43A 1X15A 4YRGA 2ZUSA 2QV7A 3L5OA 2GO7A 4M0EA 3GRCA 3QKSB 3B6KA 5JWRA 5LDGA 1KDZA 5LNK1 1M8PA 3UAWA 2OHVA 4O2BA 4OB6A 1QV7A 5C7OO 1B8UA 1VC2A 2E89A 1CY0A 3HRKA 4HYEA 4IWYA 2VRBA 4M1EA 4OO3A 3BGIA 3UGQA 3ZTWA 1JDVA 1EFHA 4FGJA 2X3YA 3T9EA 4HL6A 1E5LA 2AL7A 4TLBA 2LKDA 1KL7A 1YBHA 3HRIA 3ELBA 3K0BA 3R7FA 2ISCA 3QEJA 2JAXA 2MTBA 4W6ZA 4ZPJA 4K6HA 5ALQA 1XE3A 4QTXA 2BRUC 4MUFA 4E6PA 1KYXA 3AR5A 1LSUA 3FW1A 3HKCB 4LC0A 1F0KA 3WQHA 4JDPA 4K9RA 4LXYA 4BXOA 3AHEA 1IOWA 4U2FA 1W0JA 4D4JA 2A4MA 4BNYA 4E5UA 1AK2A 3FVTA 2QB5A 3IJEB 2ZRLA 1ULZA 2NT4A 1LPBB 3UMRA 4UHJA 1KJYA 4KPUB 4DNQA 4Q24A 2JHPA 2QE6A 3FPCA 3RU3A 1VI5A 1RM3A 4J6FA 4RESA 1D9ZA 2DT5A 3EG9B 3H1PA 5B58T 2JHCA 4YT5A 2QNRA 2RFLA 4KQEA 5IF9A 1MT0A 3O84A 2UZ1A 3CTPA 2DTXA 4B3DA 1ZWKA 1LW6E 1E1RD 5IT0A 4JT2A 3B85A 3UCEA 5DTMA 5KOYA 1K6JA 2E55A 4TMFA 4JI4B 4HO1X 3F98A 1QJ4A 4EJ6A 3MT7A 2AV6A 3ILSA 1O6BA 3JPWA 1JQ5A 3PEEA 2H57A 1KERA 3PBKA 4UVDA 1X86B 3A7EA 3JYPA 3LO8A 1JTVA 1AGPA 2FHSA 4ZYLA 1RRKA 2EWMA 2HJSA 3CUKA 4NECA 1EDBA 1RS0A 2ZITA 2Z2JA 3EQ8A 3GA0A 2PUHA 5CTJA 4YH1A 3ZU6A 4D3DA 4F2DA 4ZAGA 4Y2TA 1X0XA 3JWGA 1M6VB 3S3TA 2DRIA 5KYWA 1SUAA 4MV1A 4RK1A 4MWZA 4RL6A 3HKEB 2DUJA 3FSRA 4R3UC 5IW8A 2BM1A 3A6ZA 1SBYA 1GDDA 1VIMA 3DNFA 5KJFA 2A94A 3D7KA 5BQ3A 1T1JA 1Z2AA 4EENA 4AW9A 1PW7A 1XLWA 4G9BA 1FYFA 2W8ZA 4A0HA 5DXAA 3NEAA 1AXEA 3B51X 1BOFA 1Z47A 2XOKA 2I2DA 3DAYA 1QRSA 4U3JB 4BRWA 1PT6A 3LWBA 3EN0A 2I7XA 1R6DA 5LP6A 3TQRA 2Z0MA 1S1MA 2NOAA 4PZLA 3ANTA 3VAAA 3CUWA 1IPHA 1A97A 3BM5A 1COZA 4G65A 5IBQA 5ESWA 2O2IA 1JN0A 3KXLA 1XEFA 4HP8A 1M2VA 4O4JF 3GWZA 3WBFA 3U44A 3KT0A 1U99A 4U7TB 1N1MA 4ZHQF 4X90A 3DKKA 2IU3A 3CH7A 5K09A 1FX0A 4BQPA 4QUEA 3W04A 4C4RA 3QE3A 4LMPA 5ELLA 1WCXA 1AXRA 4UUPA 5E1DA 4PZYA 3T3DA 2PUTA 2O05A 3OF3A 2PT9A 4JH0A 4LMRA 4UUOA 1DBPA 3U4GA 3G9TA 2EKBA 2WHQA 1XAIA 2FOXA 3HUEA 2Q3DA 3REQA 5H81A 5J2TA 1LCIA 4DLLA 1UUFA 2YWXA 4HWOA 3KSMA 4IXMA 1OFUX 2HRDA 5ALMA 3U3DA 3T0FA 1FP2A 3RRZA 3U7QA 5IM4F 2WRZA 2ZJ0A 1F1BA 2WAYA 3V7NA 4M1OA 1G8HA 4BB5A 4OJTA 3O38A 4BFYA 1SZCA 1U0FA 2C2MA 1J7KA 3IPRA 3EWAA 2DTEA 4OYHA 4J1SA 2IIQA 2FA9A 3L0CA 3QXJA 2HQBA 4XTRA 4WGFA 4BTLA 2QU7A 1QTRA 1T3TA 3WL5A 3EAGA 1ZFNA 4QTUB 1GV1A 1BJTA 1SOMA 3JQFA 4GWGA 4BP8A 3BRWD 1XD2B 4FYVA 5DULA 4NBUA 2RGAA 4O4LB 1RAEA 4U7GA 1X39A 2ODNA 2QXTA 1H2HA 3Q85A 1RT9A 3GLGA 2ZR9A 4PC2A 2H18A 1PS0A 3SIPA 1GPYA 3P9SA 1JWLA 3IUBA 2XF2A 5DPMA 2I2WA 2PX0A 4F06A 4JZYA 1QG0A 4NZ9A 1FA9A 4LX8A 3N0VA 1P0CA 4WK4B 1UKZA 1H69A 2WJVA 1BIFA 1DRUA 2G70A 2PWPA 1IVYA 1M8JA 2FPRA 2YJTD 3FYUB 4Q4LA 4UU0A 4Z4HA 1VKOA 2ZUDA 3QKIA 3EPRA 5HDQA 3EIUA 4ARBA 4JSRA 1DRJA 2CF6A 2J4CA 3AY0A 1C4KA 3QVGA 4LK3A 4KI0A 1E6CA 1Z0IA 3SHTA 2Q5LA 3GN1A 2ZCVA 3KE9A 4GLOA 2A1TR 1DB3A 4IG4A 5DTIA 4OATA 2IYVA 5EL0A 5FBLB 4Y1RA 4B74A 2HUNA 4DA6A 5A5GA 1CHNA 1SO8A 3BXZA 2Y92A 3ZDQA 4CKCB 1XWIA 3OM0A 2V4UA 5GAJA 5B7NA 3PKIA 1CJUC 1COWD 3GIWA 1J5EB 2O2HA 1A5SB 1U8UA 2GCOB 1BEEA 3FNIA 3HLTA 3U5TA 1DFIA 2VFAA 1K7XB 2X0JA 4CIBA 1SA0B 3SHFA 2BKXA 3T5CA 2QYHA 3OKPA 1DKOA 2P91A 2ZR0A 3OP1A 1M0WA 3ZE8A 2CLHB 5BN1A 2WA1A 4URVR 2L18A 2WJAA 3W5UA 3KB8A 4X92A 5HCUA 4RKWA 1T13A 2OGUA 2YVAA 1C9DB 1P1RA 2C2OA 2JBAB 2ZE8A 3OE7D 4QNRA 1ZI9A 3LA8A 1QH9A 2AJLI 5KNCD 4TLAA 1OXBB 1WP4A 2C9DA 4UNNA 4UBKA 3SJUA 1QF6A 1FX1A 2IOQA 3NMUF 4AUKA 4E30A 3H4TA 4QM6A 4Q7LA 3L4KA 2JCYA 2P6OA 3DOEA 5FBKA 4GOJA 2PXCA 4RJ2A 2RGNC 4NQRA 3N8KA 2X9QA 4ER7A 4RU1A 5HEKA 4BIMA 4PAMA 2FCRA 2LWIA 4Z3DA 4R68A 3QI2A 1FU4A 4A6DA 4KQHA 2WKPA 1R74A 1AKWA 3E82A 4MQ5A 2A0YA 4NMLA 3UY4A 4M0DA 4OH1A 3WMRA 1JYFA 3QHAA 3D8SA 3HR4A 3WDLA 1U3TA 4L7QA 2NO9A 4IQ0A 3OOWA 4G2TA 2BFBA 1P44A 2FDXA 2ZANA 2Q8QA 4A3SA 5FYQA 1PJ8A 1Z0UA 4I3FA 2X14A 4RM2A 2DHEA 2GZAA 3RIMA 5F7ZA 3S4YA 1NJSA 1JIXA 1T6YA 1ZK4A 2FFHA 3ILYA 2PWBA 3I0ZA 4Z2YA 3VNQA 3NLLA 3QTBA 3I1FA 1O94C 4DG8A 3VVCA 2DH6A 4J03A 4K1LA 2VR1A 1QQ7A 4RQTA 3SMVA 1MAVA 1Z37A 1MMFB 3ZWMA 5JFGA 3EXFA 1VCOA 4RSMA 1N6PA 1QPZA 3SF8B 4FWTA 2NV0A 3IV6A 2J4FA 3KZMA 3LG2A 4QFDA 3STHA 4A8HA 2IDKA 4EF4A 3WK9A 1KQFA 1FFDA 1QMGA 4UW9A 4JITA 5HJ2A 3U9LA 1MPXA 2VYCA 4NG5A 5K8VA 3TRIA 3RB8A 2WHRA 2YY5A 1TT7A 2CDAA 3KS9A 4UUAA 2ATXA 3SIWA 5HF6A 1SXJB 1ZVMA 4YMVA 5K01A 1A1VA 1M7HA 5FEMA 1VLJA 2PFGA 2QQEA 2O6HA 3OHMA 2E4UA 3E8MA 3WDKA 2HX1A 1A72A 1L7OA 4EL0A 4C43A 3F67A 3OOJA 4IIYA 1Y33E 2H17A 1UIMA 3NW9A 2JJ8A 4NS4A 2GD6A 4WESB 5IKOA 5J3JA 4ECAA 1R8SA 2YV5A 3P1JA 4O1MA 1U4SA 4IS3A 3C7TA 1Z35A 3OPYB 4KAJA 4LXTA 2P6NA 5T64A 5IASA 4OHOA 3EH1A 1MOQA 4M9UA 4BMZA 2BE9A 3O8LA 5TT1A 2XTJA 3VPFA 4C3VA 3V2GA 4CTOA 5K8CA 1NBMD 1NN0A 2PH7A 3BK1A 5LZ5A 1Z15A 1VTKA 4IVRA 3T3IA 4LF5B 1Z22A 3HBNA 2VTVA 4L57A 2IEIA 3KXPA 2BMAA 2FEKA 4E2WA 3U7HB 3RS5A 2PUBA 1ATIA 1J23A 1OIWA 1RCFA 3LCRA 2XPCA 1XKTA 4OK3A 4RJKA 4ZT4A 4KE9A 4O5OA 1MU0A 5D5QA 1XHLA 3GJRA 1UKYA 5DBHX 3Q10A 5IYZA 4QBFA 3C3MA 3LPDA 2PE5A 2QMZA 1S7CA 1U7OA 1IBCA 2RK3A 3X1YA 5HUQA 2BCGY 3LK7A 4MYDA 2J41A 2VPWA 1UK7A 3PU6A 5D7NA 3CZ5A 3BMXA 4M7PA 4QGGA 2P3OA 2ZWVA 4OB7A 5MF6A 5F51A 1LC3A 1OU0A 3RUAA 2I5PO 2ZPTX 4HLQB 4BPBA 1IQ0A 4ND6A 4EYKA 4UEQA 2WQ6A 5F35A 4AO7A 4BO2A 1ZK1A 2QZSA 2JCSA 3D5QA 4B75A 1LDBA 1P2UA 4NENA 2CV1A 2WUVA 3HQ4O 1EIZA 1WL8A 2XQIA 3LECA 4DUGA 4WNCA 4M1KA 2C5BA 3LUBA 4UOEA 4D2IA 3OT1B 1QP4A 1CBUA 4J0GA 5FPHA 4LYAA 1BU5A 4W1QA 5KQPA 1MV8A 2Z95A 3DMGA 3EQZA 4AB1A 1J2JA 5GOZA 1O57A 3EGWA 4OHPA 1HYHA 3OZDA 3C6QA 3P0EA 1NR5A 4M9QA 1Y3AA 1QE3A 3W9UA 3AF1A 3LQ4A 1J1ZA 2COUA 1Z29A 4GQBA 3TNLA 3G5UA 4J90A 4Z1MD 3Q87B 4K81B 3WL7A 3D3QA 3TFOA 2C8LA 3GBVA 5J5CA 1TJ5A 1DS6A 3Q0TA 5J5VA 5A5VA 2LCIA 5B12A 2NW6A 2OXEA 4YHHB 2BE7A 5EWLA 2EXXA 3RUEA 4C3ZA 4RH3A 2JCGA 3B36A 5EUMA 4BLVA 3EWNA 4FZJA 1GZSA 4W5JA 1E9AA 2Z43A 2Y0EA 5DNVA 4BFUA 5AM4A 1K08A 4MS3B 1EUDA 2XDAA 3ZX4A 4DIUA 4ED9A 2G5CA 4MW0A 3NDJA 3G7SA 4WVFA 3L93A 4EFDA 3E7DA 5BSVA 1EQAA 1PL6A 1VE1A 2NSYA 2GF0A 2GI4A 2IHYA 2QTGA 3OQVA 4J07A 4WSOA 4C4TA 4I9NA 3U80A 4IKOA 1YVPA 3D59A 2LVBA 1YZKA 3T4PA 1T5DX 4PEVA 3B53X 1OV6A 2CCGA 3OJLA 1ZH6A 5M2QA 1BOOA 1XA4A 2EFGA 1HTWA 3B9BA 4NL4H 1KAMA 4J0IA 3VNSA 3FWKA 4L78A 3LVBA 4KODA 3STXA 3O3CA 3UENA 4EI7A 3EZYA 2DJ5A 1KK0A 2YFHA 2ZSDA 4JUDX 4YI5A 5BSRA 2P68A 3AJAA 4ABYA 1YB1A 3GRFA 5CT9A 5CCEA 1ZIOA 5KCZA 1LU9A 5E7QA 2IBMA 4PYMA 4RVOA 2XGMA 2DBVO 3W5SA 3UUFA 2CMKA 1E3LA 2OC4A 4KBGA 2H4XA 5BW6B 3TW8A 4HVLA 4XJTA 1BO6A 1PP4A 2ICAA 1JPJA 3P94A 3QVKA 5KX5F 2R47A 1JHQA 1USVA 2GLTA 4O4JB 4IIGA 5SZKB 4MCJA 3UHFA 6ADHA 1IJEA 1P1CA 4HUQA 4ZHQB 4ETMA 4JI0B 1BMQA 1LLDA 4CM8A 3VZCA 5KSZA 3HO6A 4UHFA 8MHTA 4OHCA 3MGKA 1GITA 3MBKA 4MPDA 5HPYB 4YLYA 1XOIA 2QIPA 4G8CA 4RLSA 5EZSA 5A7GA 3LDGA 3TMKA 4DC9A 4F38A 1H4SA 4JXKA 4AY5A 5B37A 3RC1A 1E62A 3PNPA 4RPCA 3ROEA 3RPEA 4EBBA 5CBKA 3IP1A 5FOQA 3TL3A 4ND8B 1B6RA 3MYYA 2GAJA 2ZIVB 2DG2A 5EE1A 2A14A 4L02A 1ZNYA 3EUAA 3PXXA 5E9WA 2VLIA 4JROA 5A4JA 3U60B 3DVAA 3PB3A 5LM3A 4B4OA 2UV8A 4DC0A 6REQB 3H2JA 1GQYA 3OZEA 4QXPA 5BN5A 1GU0A 4WFIA 4HGQA 1YK0A 1QOQB 2II6A 3PWKA 3LD9A 4PX2A 2L2QA 4BOYA 5DW3A 1DHRA 1LSOA 1U5BA 4EELA 3GNQA 2FQWA 3C7CB 5B2EA 2AW5A 3HJFA 1FS5A 4EKGA 5DBIA 4YO7A 1QE0A 2A7QA 2XB2A 1QYIA 3C3XA 3K4QA 1GR0A 2A9KA 2WUFA 2ZWPA 3N2GB 3RS8A 3F6YA 2EW8A 4L85A 3FG9A 1PLLA 2QGNA 2ONKA 1DKPA 3I2JA 4R40A 1ACMA 1Z4PX 1NGSA 1U94A 1OZAA 1D2NA 5INTA 4Z0PA 2R00A 4QYMA 4B4UA 2Q1TA 3EVGA 2OZKA 4U8GA 1DIGA 3LUCA 4Z3KA 2W0SA 1ZK3A 1BA2A 3U39A 4E33A 1ILEA 1CR1A 2F9MA 1PQWA 2Y68A 4N49A 2J87A 1FXWA 1YACA 1EWRA 4CQJA 1J07A 1ONPA 3GUHA 3SYMA 3QJYA 4IXTA 1FDUA 3IEKA 4IIEA 2TECE 3GEBA 3H6KA 3P5SA 3H2KA 1H5NA 5IAOA 4XYMA 5KVCA 1VYTA 3P96A 4KG7A 3EVBA 4QJBA 2IJGX 1LRJA 1P3Y1 2D2XA 3HV2A 4OQMA 2YJNA 5EYPA 4B3JA 4DL9A 1U2DC 3N59A 3C8HA 4BO4A 3DE1X 4XGIA 1Y8QB 2DUWA 3P2KA 1VRCA 3PRYA 2BT4A 2BY4A 4BFLA 2FZKA 4QXAA 4Q03A 1BCRA 3IC5A 1XALA 2V6GA 1EA7A 1N75A 3TRDA 5CDSA 4ZJYA 1TO2E 3EXIB 2YOFA 4PR0A 1N2XA 1U9IC 5JISA 3EFOB 5AVXA 1R0XA 3AH8A 4FZ3A 3U7JA 2C4NA 3GFFA 3LX5A 3TLCA 3ADBA 3IMCA 4G5RA 3L6UA 4X8MA 3CURA 1YO6A 1D5CA 1PYDA 4PYIA 2C42A 1KH1A 2PH5A 2RH9B 4RDIA 2VSQA 4RIEA 5TVGA 3R8CA 4ZZ3A 1MQ8B 4YHBA 1XLVA 1ZRSA 3HV0A 2ONYA 4JLVA 4EHNA 1EFUA 2PS0A 2ZB8A 2BGNA 3NV9A 4BNXA 1ONOA 3IP6A 1P6UA 2WNHA 1Z39A 5AW1A 1PFYA 2Q5IA 4KV7A 3IAM6 1PG5A 3WZ2A 4E5SA 3A1FA 2C20A 5H8WA 2F67A 5DISB 3WBBA 3ZW7A 1NYLA 5DM0A 3ILXA 2R2AA 3UOGA 1XEWX 3CMCO 4HUJA 4LOHA 4X7RA 4YMTA 4TQ9A 4RH1A 5KMGA 1SELA 2PXXA 3Q88A 4O8CA 4P9NA 3UT6A 4B6OA 3HZOA 3GI1A 4C0KA 1CDOA 4TL9A 2O0HA 4JUBA 5SY6A 2J5QA 3ICPA 4FCWA 1T5BA 1RHKA 4BP3A 1QONA 5DM4A 3RUIA 1H93A 1PTKA 1C7ZA 1TVEA 2Q2VA 3R0JA 4OLBA 2V98A 4NEGA 3N8NA 2VZLA 3GJSA 3N2ZB 3P4UA 5AM2A 1Y9JA 1QG4A 5B1IA 3O2QB 4AZ0A 2C7QA 2QGZA 5CYGA 4NU6A 4CKBB 1U9YA 2PKYX 1SB9A 4H08A 4RADA 4X1YA 1QGZA 3V5NA 3P9QA 6Q21A 4RZ3A 3E70C 4LA4A 4XR4A 3O93A 4BZXA 3ZJYA 1P18A 3UXYA 1HNXB 3FUCA 5A03A 1L1RA 4CVNA 2GHRA 4ER6A 5KIAA 4PN7A 2ZATA 2G9UA 4MQEA 4KFTA 5GZ3A 1CR6A 1X3LA 5KCMA 5AI8A 3PYXA 3W2FA 5JCZA 2JVJA 2HWUA 4FMCF 4G84A 4CLRA 4HWGA 2A0FA 1HLGA 1JYEA 4HK4A 4QBKA 4B3FX 2VZ8A 2VH2A 1NJ8A 2MHCA 1GNVA 3PF9A 4RV4A 2KLHA 3LXRA 1YZQA 4KR7A 3JAWA 3IUPA 3M4YA 2IV2X 5FB3A 2AHRA 3W79A 1B0PA 1FFXA 3AVUA 2GRJA 2GCEA 2JC3A 1PT9A 1CUFA 3ZWDA 4BIIA 3HXPA 2HN9A 2G40A 3QVLA 4R01A 1K7CA 3SIXA 4JEHA 1QIFA 3QMVA 4B2LA 5FFMA 1MJNA 3CNBA 1J99A 4ZCTA 2ZRBA 2YYYA 4JP1A 1JQDA 1HT1E 4NOKA 2W98A 1UC5B 4RHUA 2BGUA 2G7MC 1AKMA 2XCQA 3NWOA 5B1EA 1PZEA 4ZVKA 1SZPA 3VR5D 4EHIA 3M33A 5BW4A 5J4KA 2ZEJA 4CUKA 3AUAA 5D5PA 1ZO8A 2B98A 3EB9A 1ZH2A 2HA3A 4REQB 3MCUA 5IVDA 2JI4A 1WBBA 4LSWA 1E5DA 1K97A 4FX2A 1KI3A 2XTMA 4L8LA 1YRHA 1CJSA 2FX2A 4PNEA 1A95A 4UQOA 4MEAA 4HCJA 1KQPA 3AL0C 3TG8A 3IA2A 4MDHA 5AVZA 2NVBA 3BL8A 1LB1B 3CO5A 3GU3A 5SYMA 4E4YA 3UK2A 3IQZA 1GNTA 2DWQA 4ZVUA 3ZJVA 2GN0A 1R16A 4MP3A 2GBGA 4MV0A 3S2SA 4KEAA 5L3RA 2O6LA 2I03A 5ICSA 4ZVQA 1NXTA 5HIMA 5C35A 2L82A 5JUWA 4QNNA 1Q1GA 1TECE 1ZM4A 3K16A 5LZ9A 1YJCA 4A0RA 2PU5A 2H3EA 2VH1A 2QZPA 1PFKA 1EQ2A 2DHCA 3D02A 4K9NA 3NHMA 3OD1A 6CHYA 3ZCUA 1YS4A 1WNFA 2P2NA 4JELA 3WMEA 4IJ6A 4CI9A 1KIMA 1Y6QA 2IXEA 2V59A 5IJ9A 5MN6A 4GZMA 1YR9A 2HBYA 4O2LA 4ZT3A 4QBTA 2GT1A 1CUUA 3DMNA 5EIWA 1F6BA 2ZQ5A 3ROZA 4A1FA 2YMMA 3QW4B 1XRQA 4F45A 4R7TA 2W58A 2X6RA 3MPUA 1R4ZA 2J5XA 1XR3A 2YWEA 2IGBA 1V6SA 4N18A 2RHGB 2Z8YA 5FOTA 1TEVA 4GOXA 3NHWA 2VUHB 3IUSA 1TT5B 3SHOA 1Y8ZA 4QDKA 1PS8A 1S8FA 1UOEA 1XVAA 4Q1CA 2GLUA 4TWAA 3ICCA 1AGXA 2Q8PA 2B4AA 4X8HA 3GDGA 2CSUA 3A9SA 1Y1QA 4B45A 3AFIA 3EF0A 1N9GB 1ZGAA 3FVQA 4GLFA 4UMFA 3O1JC 5DWDA 2ZJYA 4BNDB 1F7UA 1YOVA 1N5IA 1L4EA 1JDJA 4RGYA 1R8QA 2YNMA 4BWGA 5IU6A 2A9FA 3RRXA 5BUSA 5BV2P 1QIDA 3UAZA 2D5CA 2KB0A 1KMQA 1QKJA 2FPIA 4PAQA 2R85A 3W6ZA 4KGXA 3E9RA 2FZLA 4F7DA 1V41E 1P4GA 1M1UA 3DTYA 3OAAA 2XNCA 3VOAA 4AMVA 3TZBA 4ITRC 1F0PA 3NBXX 3FTQA 6PFKA 3NTRA 3PEYA 2VOJA 4M22A 4CJXA 2EERA 2O23A 1TMGE 2PMFA 4DREA 1WRBA 1QH0A 1TTHA 1KZ9A 2IZOA 2I6UA 3WGMA 4DT1A 3LE8A 4AN4A 1MB2A 1KS2A 1QK4A 3VBCA 4IR7A 4KX3A 1EWQA 1UP4A 1DX4A 5IC4A 2Y8EA 5KX5B 2P6UA 1TUGA 1P4AA 2NACA 4BO6A 2R84A 4GZ3A 1M75A 4LBZA 4FFSA 4OF4A 1N5OX 3OQHA 2XMZA 4KPFC 5IANA 2FETA 2Z2XA 1A8UA 2HHJA 1MO5A 5FQOA 4C4OA 3MLEA 3F6RA 2QYOA 1W0JD 2QLNA 3CLKA 5CK5A 5JH7F 3G5AA 2W2KA 3PDIA 4GR5A 4O4HF 1T8RA 1B16A 1GCUA 2OK8A 3OQNA 2GETA 4QEDA 1JJ7A 2H2WA 2QX9A 1L6RA 4Z7JA 3W4KA 2FI1A 2EEZA 3D31A 4MQFA 1JQKA 2AOWA 1RVDA 1FTSA 2ZIWB 3COYA 4B9AA 2PLAA 2QUJA 1Q91A 3MGGA 3JALB 3LDFA 3ASUA 5DLQC 2IHKA 3P9NA 5G1OA 3OFJA 4DA7A 2KMLA 1UXIA 3CXUA 3KM0A 3EF3A 3LGAA 4FYHA 3ORSA 4GHWA 4RANA 4IIFA 4PC7A 3FVRA 2RGBA 1WPGA 3OMLA 5H80A 2H1LA 5T3YA 1DEKA 3CCCA 3VHLB 5F9HA 2WF9A 1X9HA 1ADJA 5B4TA 3UGTA 1E9VA 2ETXA 1WZNA 3PSHA 1DWOA 3SX0A 1YBVA 1T6BY 2NAFA 3M6FA 4H7DA 2XQFA 2REOA 3EGDA 5FEUA 3DQZA 4UKDA 2C8JA 1U0RA 5THKA 1S4MA 3ROXA 5HMMA 5KVAA 2J4DA 2GJ8A 3AERB 3EXAA 3ZDEA 2NGRA 1Q14A 5C5EA 5IKXA 2I29A 1SBNE 5MN5A 1EVZA 2R00C 2WIBA 4I4TF 1U8CB 5FKJA 3WLAA 4ATNA 5KPJA 1EGVB 2ID8A 3L8YA 3QQPA 4FKBA 4NMMA 2HK7A 2F8LA 1BMTA 1W2GA 2JGDB 3K0FA 5FP0A 3VR4D 1W96A 3I9KA 3SZGA 4R2JA 2ZTVA 3RFCA 4EY7A 2AFVA 5PGMA 1R9NA 3N76A 2EBHX 4QDOA 1HNWB 4POOA 2VDLB 2YUTA 3GFSA 3IP9A 2P0YA 3QXCA 1X87A 3VU1A 2OORA 2ECFA 2IXBA 3AUUA 3E9NA 5DCYA 4KHPB 1SC1A 3TTWA 4GI1A 1QNFA 1OBVA 2GXUA 3Q2KA 5DTQA 3RUCA 3B1WA 5EQFA 4BZWA 3JZAA 2G28A 1UOPA 3K0CA 4QEKA 4TMVA 5TS2A 1V16B 1W5TA 3PFFA 3IYLW 1IULA 1K6MA 4KLCA 2CXSA 5CJ2A 3VSBA 5FD8A 3KNZA 3NOOA 4A2WA 4E14A 5ABPA 5C4IA 5JZ9A 1A50B 5HZKA 4OEHA 4OHRA 1Z7BA 3IKMB 1TFUA 2Z3VA 2JI9A 4PF1A 5TJHA 4E5DA 2Z8YM 1FTQA 2QJFA 2OP0A 2PUDA 4W1SA 1XF9A 2BMDA 4YRFA 2Y6UA 1C14A 3IA7A 4RV9A 3Q9SA 1N0IA 1MTOA 4LQLA 5FO1A 1RQXA 4FEEA 2FU5C 2PKEA 3CZQA 3BB4A 2ECPA 3T1TA 1PR2A 4ZAYA 1PFVA 3JQCA 4BRSA 2MR6A 5JOQA 2VXBA 2A5GA 2OHXA 2VSXA 1TTQB 2QN8A 1P4JA 3HCCA 3W5IA 3UKOA 2CFIA 1KEEB 4WVLA 2Z4SA 3TOCA 2OAGA 4DWJA 2YWRA 2JLRA 5AI0A 5CIQA 1ZICA 3B2NA 3DLAA 3THWB 3JQ6A 3UJ7A 3ZCSA 4K7JA 3HVRA 1FJ2A 3N3AC 4EFKA 2WIJA 2QBYB 4QDUA 1J2UA 1ZN8A 5EHXA 1U1CA 1Y4UA 2I4TA 1UMDA 2ZULA 1G17A 1Z7YA 3CKYA 4OQQA 1Y4ZA 4FUTA 1RYZA 2AFHA 1DI0A 2Q4DA 1SQ6A 3FYHA 5GJCA 4HNHA 4H7KA 3PI7A 4H77A 3RTEA 3IR6A 1QPGA 3TZLA 3ZV3A 1PVVA 2J3HA 4CKZA 1L5WA 3IEVA 4HDSB 2E85A 2EJUA 2PL5A 3SOZA 1HYBA 1H6DA 1P5HA 2HHAA 3T7SA 4ZC8A 4OBXA 1X7GA 2DLDA 3GGJA 3OUUA 5EP2A 1NUAA 2WWYA 5FWNA 1MIOA 2CLIB 4OLAA 2JFFA 2QLBA 3C5WP 3G88A 1K86A 1KJWA 3PQCA 1G6KA 1H6AA 2JZCA 2M6KA 1EWYA 2XB8A 2HJWA 3QITA 5BSWA 1U7PA 5T6MA 1OILA 3DOJA 4FMCB 3QJ5A 2I3DA 3GFPA 1TM3E 1FW6A 3L18A 1MV5A 2W00A 2WYHA 4Y98A 2XZLA 2WC1A 1V1RA 5SZHB 3IOYA 2WDPA 4EMUA 3ZGLA 2PMBA 3BBPA 2CZGA 2GBPA 1AHIA 4Q6WA 4YUYA 3GEPA 2GR9A 4N41A 4MGEA 4WNYA 1Y7LA 3O8QA 1QBKC 4LF4B 2ZE5A 2HT1A 3T95A 2QL5A 1KAOA 3FJOA 4UTOA 1KXZA 5A0FA 3AB7A 3EOZA 1IXRC 1NM5A 1YUMA 4C2AA 3OTQA 1AUOA 2GESA 3KALA 2PGNA 4R2XA 2XHZA 5FYDA 1CT9A 2IEGA 4RIGA 3TL6A 3W5BA 2QTNA 1HE5A 2WSMA 2CHVA 1N2IA 3GZJA 3FLEA 3QMMA 4Z0HO 2OHFA 4DILA 3FCUB 3DVLA 1Q0LA 3Q72A 4HRYA 1FSPA 2XE8A 1U5CA 1THZA 3WVNA 1RKVA 2I7VA 4UEJA 4D8WA 1E2EA 2V0NA 5BT8A 2CXRA 1A0OA 2I78A 2P2DA 1FNNA 4TVKA 3SXUB 2XQVA 1S0UA 4FHDA 1PTJC 3FTPA 2W6JD 1OC4A 3IBGA 3Q7RA 4NE7A 3LLCA 2V7BA 5F1YA 2AC2A 5LL6P 4F5ZA 3OX4A 4R05A 4D9JA 2FWBA 4F97A 3F96A 1OFGA 2C2ZA 1PJ3A 5FCDA 2VSOA 1KSFX 2RK4A 3SFVA 1QRTA 3GJXC 2JG3A 2W83A 1G9TA 1QHGA 4QLOA 4K9LA 2CXTA 2VN8A 2ZFUA 4JLBA 3B3JA 4G09A 4UU8A 5DHFA 5TQ2B 3BKWA 3FHTA 2HCTA 3RIHA 4OJQA 2P69A 4UM9D 1RHUA 3AONB 1B8NA 3CJQA 4BQSA 4QODA 1F14A 5D84A 2QN6A 5A9SA 4M1ZA 1N3YA 3SE7A 4BYMA 2FEXA 1NBOA 1CRWG 4FT2A 5BVGB 2XEXA 1ZQ9A 1CY1A 3DBRA 3PKZA 1MAWA 4IUCS 2E4YA 2AQ8A 3C6XA 4LJSA 1CFZA 4ZT6A 3PI6A 2CLMB 5LDDC 3BQ9A 5IAJA 4NCKA 4DCTA 1U98A 4LCBA 5F5XA 3TD9A 1PHRA 4IIJF 5B55A 1XNGA 3USES 2PCJA 4G0XA 1J5XA 1EGHA 1LTQA 1N4DA 1QBGA 1VCHA 1W4LA 3JASA 5EWJA 5LA6F 4FMPA 3FPFA 2PRZA 3L8ZA 4FTWA 2FW9A 2EAUA 4RMNA 5F12A 3SQXA 1RWOA 2WYWA 1O6GA 5H3CA 3ZWXA 4D81A 1KVQA 1XTIA 4X3PA 5EY5B 3DWFA 3PFHA 5F78A 1AY0A 2YVUA 5LLDA 2GWRA 3BPSA 3QU4A 1VYVA 2JCBA 1ZH0A 4YJFB 4YP0A 3DHYA 2XYHA 5LJIA 3ZDBA 4ZO9A 4DANA 4OXKA 3KZ1E 4XEHA 4WZAB 3TLEA 4EYGA 3DMYA 4XDHA 1Z2OX 1ULAA 3VKGA 2XUHA 1LSSA 4YPOA 2HA4A 2PO5A 3MINB 4GECA 1VIYA 3AEQB 1WZIA 3FGNA 3SOPA 1IIRA 2W37A 4A8PA 3OCVA 4KIJA 1MB0A 1RWXA 3DFUA 5CFZA 4YDQA 4D8YA 4RD3A 2YNMC 3UWOA 5IBPA 1JL3A 4MEJA 2NYAA 1XTJA 4FEGA 3FYCA 2BMEA 4CT4B 4ZGGA 4PICA 3ELUA 1DE0A 4C5CA 4EO4A 3KDAA 1DCFA 1L7DA 2HJRA 1YZGA 3DDHA 4FHEA 4FS8A 4QXOA 3UICA 3DC2A 2KSQA 3G2KA 2REQB 3LQ1A 4UTZA 1G8YA 1OTHA 3L7NA 4QXMA 4F91B 3OM8A 2YFKA 3OZGA 1GPKA 4BFXA 4ZIRA 2EU8A 4GPIB 2WT4A 1V7CA 2QROA 1IB0A 1XO1A 4HYTA 1TKRA 2VP0A 3LVQE 3L6OO 2IS4A 5KHOC 1EFPB 2JFVA 2G08A 3CG4A 4HTAA 3RLFA 1QHFA 4AKTA 3ND8A 2IP2A 5EPOA 5CB4F 5WRFA 4JJFA 1CZUA 1L4NA 2HNAA 4KXLA 5BMVA 3PLAE 3GG2A 5FXMA 2WPDA 1GNLA 2Y05A 1A1SA 1XZBA 3GQBA 4RPLA 2IDJA 3FKSD 4D6PA 5JH7B 2G88A 3T94A 4RZSA 1HDZA 3PA8A 1T1SA 2A3RA 1U11A 2JHAA 3IAAA 2CDCA 3QFHA 4O4HB 1M83A 3EEBA 4DF3A 1WXEA 2GARA 5HHTA 2XUOA 1HF3A 4YYEA 4KQGA 1UOOA 1Q3KA 2Q5OA 3KXKA 2O2ZA 4QU9A 5D86A 2NZVG 5DRYA 2I4LA 1P31A 2GSWA 2HA0A 5FTNA 4DCCA 3BH6A 3EULA 3LWDA 3PUIA 5KSOA 2ZRIA 1Z2DA 4BEBA 2O8NA 3NM4A 4CG1A 3KVNA 3KVOA 1TVCA 3I23A 3ZU4A 4BNHA 1ZJYA 2F00A 1NNUA 1K5PA 2EBWA 2OOKA 2Q1WA 1XX6A 4WCFA 4IOMA 2XWQA 4L6CA 2Z9DA 3V2IA 1Q95A 2R97A 1X7WB 4EITA 2I8AA 4ER3A 5KI6A 2WJ3A 3NKFA 1BD4A 1JECA 4HSGA 1BGWA 1E0JA 3ANXA 3FHOA 1OLSA 3INYA 4RZ2A 5U4QA 3OLVA 1O03A 2ONCA 4KO4S 1NLYA 5I4BA 5EXEA 2YXEA 4CV0A 1BDIA 2IYOA 1E8MA 4KLZA 5BN3B 4ZV4A 2OCIA 3RARA 1UFQA 1GGHA 3ZGZA 3HDJA 1NJ5A 1PQPA 2GF2A 2RI0A 1PE0A 1R9MA 3KKMA 1ORVA 4LV6A 4PC3A 5C7IO 4LBYA 3AEKB 4R1NA 1VGQA 3FNFA 1ZA2A 2FRVA 3BHIA 4I4TB 2XLBA 2FX5A 3EISA 3MYRA 3LX6A 3OFSA 2RCYA 1H1LA 2ETVA 2BSQA 3HGMA 4M46A 2EDAA 4HYYA 1EUQA 4L0CA 1YNOA 4M2LA 5IVKA 1L0BA 2P77A 2Z9BA 1UAAA 4X1KB 4BGEA 2EJBA 3DMRA 4G07A 3BJIC 4EK9A 3I9V6 4LZJA 1YZYA 1ZHFA 3FDFA 3I2GA 4ENPA 3KAJA 1ISFA 1EDEA 2CCJA 2EFCB 4OJYA 4PX9A 4ZU1X 3VKFA 4BKMA 2PJRA 4XM1A 4AMBA 1YDHA 1CFJA 2IIPA 2PZJA 4TMTA 1Y7PA 2PX2A 3OKCA 5EMNA 2C99A 2WW8A 1WMFA 2O2EA 4L95C 3JV7A 1OB2A 1J7JA 5A3RA 2ZE6A 3ADPA 1XDWA 1IQUA 2V9CA 3GCGA 4HDQB 1P3DA 2OWDA 1V5IA 4DA8A 1R6TA 1DT5A 5TRTA 3OZVA 5F9FA 1DQZA 1J0CA 1UKBA 2FZ5A 2JIRA 2VJAA 3K0CC 3O0DA 3SKYA 3J81A 1HFWA 1O5OA 3MERA 3A4VA 3AHDA 2YWCA 1GNPA 1MABB 2HGZA 2ORIA 1KYQA 1XZGA 3DAGA 2V7WA 1G0NA 1UR5A 1XJ5A 4P92A 2YWGA 1M34B 2QQFA 3NBAA 4DRXA 4JB0A 4LRSB 1CUIA 1BH2A 1BS9A 2RSLA 5DTJA 4ROTA 3UHAA 4CL8A 3NIDB 2W6MA 2CYCA 3TIGA 1IHOA 1UT5A 1N0VC 4R5HA 1CNEA 2Q99A 4X20B 1IY0A 1YGPA 3IIJA 4L9SA 4ZI7F 4TTRA 2YMPA 5A3VA 1CG6A 2PPVA 3VMMA 2E1RA 1L5VA 1SOVA 3HJBA 4TKUB 1BWPA 4LX0A 2O0KA 4WXHA 3LFTA 3E03A 1RAHA 4G1FA 5DH9A 2P2SA 5HJEA 5IM5A 1UXOA 1U2EA 3HVHA 5FPKA 1MC1A 2H1WA 2V7PA 1KFKB 2VJPA 3UT5A 1QXSA 4KUHA 2F55A 4CMAA 4U2BA 3FHJA 4AS3A 2DKOA 5GVRA 2CD9A 3CRVA 4I55F 4OKNA 4B8ZA 1KH3A 4FWIB 4DR7B 4JJEA 3F7OA 1Y1LA 3T5MA 1T9HA 3HN2A 4WZBE 1AS3A 1CF2O 1BHO1 4YUXA 1W87A 5DNCA 5F2KA 1J49A 2JAWA 3AG5A 3G59A 3FDZA 3KR2A 4JUIA 1MGOA 1I7DA 4K05A 1NP7A 1MZVA 4ZQCB 4A92A 5KNBA 1QHNA 3G5LA 3P9XA 4N7BA 4LHVA 2EDCA 3DBHB 4MKGA 2FK8A 4RHTA 5J9FA 2C7VA 1JVBA 2FJUA 2BLNA 2SECE 1BHJA 4JB2A 4JJAA 1F6WA 1K75A 4WASA 3VOBA 1S2GA 2DCUA 4Y9DA 3SVLA 5K2OA 3UMMA 4Y2HA 3FNBA 2C5HA 4ZD6A 1RXSA 2VHWA 2P0AA 1I7SB 2WJGA 3KIPA 1JEYB 3BREA 4WW0A 5AW5A 3G8BA 2HFKA 3HCAA 4FFVA 1W25A 3LBIA 3IGFA 2ZM6B 1V7QA 2V7QA 4U5QA 1YD7A 3AFNA 1WS6A 4J49A 1NI4A 4RY2A 1XTSA 3EA0A 1HT3A 5ERXA 3L9WA 4Y7DA 3O2JA 4B6PA 4YRSA 2QTWB 5L7TA 3GLHB 4U7FA 2QVGA 2VDRB 4DLAA 5FNVA 5FPQA 1SZDA 1XXHE 4BLPA 4DB2A 4K0RA 3UH1A 4CDMA 2LD4A 3ANNA 3N9IA 2HBZA 4JVNA 3D81A 1JHUA 1GRQA 1CQIA 1OASA 1BX0A 2JKYA 3M3HA 1NM5C 4L3WA 1T91A 4QPPA 5AKEA 2QMOA 4AXBA 4ES6A 3PJFA 4YJ3A 1N2CE 4P4NA 1MUUA 3WGZA 3Q2IA 4R3WA 5EZYA 3VGJA 4E51A 2YOGA 3C4VA 4YCNA 2ZLBA 3RJTA 3UMFA 4MI1A 2XRZA 2VIIA 4FYKA 2HDHA 3AVTA 1SKYE 2BKEA 2EKQA 4JUCA 4M7RA 4IFTA 2YC2C 3SQWA 1Y3FE 2CLSA 2JNWA 1OE0A 1K8QA 4WY2A 1DGQA 1U31A 1GZUA 2DCMA 1RKUA 4FNGA 3PPVA 3FWNA 2Q0HA 3EA4A 2QRKA 5DM1A 2NPFA 1DG3A 1GFZA 2YBDA 3LI2A 2BGLA 3KAKA 3O21A 1AA6A 2NSLA 4Q3CA 1LUAA 1NVBA 2WHPA 4YJHA 4BVKA 2ZCUA 5B6PA 3A11A 3AY3A 4CM9D 3T99A 5JCPA 3A6DA 1HETA 1CV2A 3TOSA 4F86A 3MJ4A 2J9ZB 4RTSA 4BJ1A 4MNTA 1R0CA 5M7EA 1RTKA 3RAPR 2LXNA 3Q6IA 3LTNC 1NIPA 1ICIA 1RAIA 2I3AA 2NO0A 2DHDA 4ETWA 4B82A 1XZMA 1WSBA 3FCSB 3KSAC 2C4TA 3R5XA 1JAZA