2XVXA

Cobalt chelatase cbik (periplasmatic) from desulvobrio vulgaris hildenborough (native)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
262
structure length
262
Chain Sequence
QKTGILLVAFGTSVEEARPALDKMGDRVRAAHPDIPVRWAYTAKMIRAKLRAEGIAAPSPAEALAGMAEEGFTHVAVQSLHTIPGEEFHGLLETAHAFQGLPKGLTRVSVGLPLIGTTADAEAVAEALVASLPADRKPGEPVVFMGHGTPHPADICYPGLQYYLWRLDPDLLVGTVEGSPSFDNVMAELDVRKAKRVWLMPLMAVAGDHARNDMAGDEDDSWTSQLARRGIEAKPVLHGTAESDAVAAIWLRHLDDALARLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords CHELATASE, PUTATIVE
publication title Evolution in a Family of Chelatases Facilitated by the Introduction of Active Site Asymmetry and Protein Oligomerization.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
total genus 97
structure length 262
sequence length 262
ec nomenclature ec 4.99.1.3: Sirohydrochlorin cobaltochelatase.
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06180 CbiK Cobalt chelatase (CbiK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xvxA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xvxA02
2H1WA 2HREA 2JH3A 2Q2NA 2HRCA 2QD1A 1DOZA 2XVZA 3HCOA 2PO7A 2AC4A 2HK6A 1L8XA 2PO5A 2DJ5A 2QD3A 4KLRA 3W1WA 1QGOA 1HRKA 1C9EA 2XWSA 1LD3A 2C8JA 2QD5A 3AQIA 1LBQA 3HCPA 4KMMA 4CCSA 2QD2A 2XVYA 3LYHA 4MK4A 1AK1A 2Q2OA 3M4ZA 3GOQA 2Q3JA 4KLAA 2XVXA 3HCNA 2H1VA 2XWQA 2QD4A 1C1HA 2PNJA 2XWPA 1TJNA 4KLCA 1N0IA 2AC2A 4F4DA 3HCRA
chains in the Genus database with same CATH superfamily
2P27A 4KPUA 1KI9A 1U04A 3OPYA 5LYJF 4B8ZA 2Y1GA 3JZAA 1MJGA 5L95A 3EXG2 1E4EB 2B5WA 1TK9A 1UT5A 2BEUB 5DXAA 1NXTA 1CJCA 2MR5A 3GR6A 3D4LA 2BR4A 4GPZA 1DQSA 4Q7JB 5ADVA 3I62A 3P0HA 4HFRA 5K3OA 3ZCUA 3X2EA 5DBGA 5BV2P 1SOVA 2IYOA 2JIOA 3DEIA 4B48A 4JCCA 1HBJA 3ZVNA 3KZCA 2QJTA 3PUZA 5CG1A 4JHXA 2DUUA 2JEOA 4U7WA 3EUWA 3LP8A 3LX5A 5FWXA 1U8UA 2A35A 2WPNA 3AEQA 3HU5A 3ELDA 3O8CA 1Q0LA 3OZDA 4F2PA 2OAEA 3R4VA 4XVUA 1LJ8A 3ZD6A 4ZTUB 2J6BA 4GOOD 3OX3A 2PN1A 1MIHA 4K3VA 4G2TA 4YRNA 4I55A 2HU7A 2UVPA 4ZYZA 3TOCA 1P0FA 2ZFUA 3P97A 3GGCA 5FWXB 2BYTA 3KB1A 3A6EA 1ZIXA 3W9BA 3R76A 3PWSA 5EWLA 4DXAA 1UBOS 5D6OA 5KSYA 1Q3HA 3ANSA 3DFZA 5JSZB 3K8ZA 1JH8A 3WL4A 2ACEA 2PQ2A 3G79A 3P0RA 5HQJA 3TQFA 2WVJA 3EVFA 1RWQA 1I6LA 1NWCA 2GWHA 1DC5A 3RRFA 1Z28A 4OHKA 3N05A 1JEYB 4I55B 4Q9HA 1M2OB 2UVPB 2QSJA 2ZAGA 1SKYB 2P79A 1IN6A 1PGJA 1AU9A 1JNYA 3PNKA 3SOPA 4PY2A 4IH1A 5K05A 4LYDA 1E8DA 2PUGA 3HTXA 4JSRA 4EIWA 3C24A 1DRVA 4DRXA 3OE1A 2R11A 5FPHA 4WZAE 5CHYA 4DLRA 4DY4A 5IKPA 4S2UA 3FKSA 3S2YA 1J0DA 1GQ2A 1FY2A 5KU7A 2VDPB 2XUKA 3AT1A 4ECAA 2I65A 2Q5FA 3GJ8A 3LQ2A 2NXNA 4NNOA 4OYRA 3NIWA 5LYJA 1AOXA 3G0DA 2W4QA 3NBZC 3DONA 4ISCA 4RHEA 1JP7A 3AVVA 4G1CA 2YIJA 4DBZA 5JBQA 3UMVA 4QQ8A 5CD1A 3DQZA 3MTDA 3NM6B 3O95A 3PG5A 1FDWA 3AR7A 3RF6A 2QUIA 4FYIA 4WZBB 4YI3A 1Z4MA 1XA0A 4R8MA 1PFQA 1XQVA 1M33A 3FYUA 4I1OA 4AG6A 2J45A 3SP1A 4ZQGA 4XQ9A 3TSCA 2QM8A 4LF9B 2FPIB 2QD1A 3NWEA 4ARUA 3VYUB 3AEYA 4L9AA 4Z5XA 3D4PA 2FWBA 1GN9A 4NYMQ 2FMHA 3NKFA 5K6AC 1QYXA 2CNNA 4GL4A 4XWGA 3VYTB 4QVIA 1HM5A 4C0SA 3ZGVA 4TT3A 1JQLB 3L4JA 1Q0HA 2C2BA 2CEAA 4KR3A 3CEMA 5JS2A 3JARA 3KOUA 5DLYA 1IMJA 3Q3GE 1XRPA 3ZD9A 1E6WA 5LQMA 4LHVA 3G2MA 3H8VA 3QKTA 2GXAA 2OCDA 2PT6A 5ALMA 5AR1A 1QP4A 1BU8A 2X5OA 4ROTA 4EYEA 1ZJ5A 5HHTA 3VZPA 2R6JA 3ZY2A 2BGUA 4EG0A 3UAZA 1RT9A 2DBVO 1ZCZA 2I4MA 3HVUA 3WK7A 3K09A 1Q83A 3JARB 3LP5A 1EH5A 5DT2A 2EIHA 3ENWA 4BL5A 4CG0A 5H8WA 3BIFA 1GJRA 1SXPA 2C0QA 4K9QA 1L5ZA 4D81A 4DLWA 4GLLA 3AFGA 2C9MA 3IJEB 4B44A 5COBA 1WF6A 4Y6QA 1YRAA 3T94A 4D9MA 3NVKI 3KKOA 3RJ5A 3GXBA 5KOJA 3JRWA 3AHFA 1ZD3A 1FYXA 4BLSA 4A2WA 1OH8A 1GVNB 1PVDA 1R0LA 3EEYA 3OP1A 3A28A 1ZHOA 3OT5A 2QPOA 3UPUA 1I5RA 4E33A 5KVSA 1FS5A 2EWVA 3ANXA 4OQDA 3CJRA 4Q82A 2GFQA 4TXMA 4IFTA 5T67A 4G1UC 2OV2A 1DLIA 2ZCUA 1KOJA 2FKNA 2GXSA 5AVJA 2CDBA 3LXRA 1OE0A 3BWYA 3D1JA 2X0KA 4DMMA 1GLGA 1A98A 5C34B 4RIIA 1HZZA 4O2RA 3G68A 2BF7A 3ZWKA 2B4TO 3IPXA 2JAHA 1E9FA 5CK5A 3WLNA 1KJ9A 4J0IA 3EDCA 3OO1A 1UKZA 2DT8A 4ZYLA 2DTEA 1LLUA 2OZVA 4GRDA 1IJEA 2DF8A 8ATCA 5KVAA 1XRMA 3MGGA 1AH2A 3RGGA 3L0SA 3D6HA 2NU9A 1IL0A 2HQOA 3U4QA 3M4JA 4D1YA 1UKCA 5HIAA 4E0BA 3E7XA 5I3ZA 4WCFA 3IRUA 1F2DA 4TL6A 4OG2A 3L1JA 5IEJA 5KOHA 3PV0A 1IXKA 3CF6R 1DXOA 3L8ZA 4LIPD 1FQOA 2CCKA 2GZDA 3KD3A 4IR7A 3AEKB 1CT9A 4IKOA 4HB0A 1AXGA 3MRSA 1R4NA 5JNUA 3T3EA 1Y89A 1EE1A 1TPYA 1MORA 1E2MA 1X1DA 2PR7A 3I6ZA 1OUMA 2HQBA 3QV1A 1G16A 3QKSB 4QEZA 4G5QA 1EX1A 1ZSNA 4WCFB 1OREA 4MITA 4CLOA 2R8EA 5KOHB 1NV9A 2Z1MA 2AK3A 3LXMA 4UUQA 3N3BC 5JS1A 2FP4A 2R25B 2PT9A 1NIPA 3BTUA 3IBGA 4DPLA 2PUCA 2V1UA 4LTDA 3RD5A 4K88A 2JVJA 3LY5A 4HLCA 4KV7A 4F8JA 4W9MC 1SXGA 4RJJA 3VX3A 4MQMA 3PC6A 1XMSA 2IYRA 3UY4A 1BO6A 1XU9A 4CLOB 1IC6A 2OKCA 2FOIA 3THXB 3AESB 3PNLA 3RYFA 2GASA 2CK3D 1UK8A 4L75A 2Q6KA 4M8NE 3RWMB 1IU9A 2OBFA 1MC1A 4EY4A 2FP4B 1PGOA 4ICIA 5B1HA 3MEQA 3PUWA 5E38A 5IANA 3PEEA 3DKRA 2RARA 2ZREA 4LYJA 1MR3F 2NUTB 4FCVA 2G9NA 1JBKA 2NQ8A 3NZEA 3VDNB 1NPTO 3WGTA 1K97A 1PBNA 1T5SA 2AXEA 3IAHA 1XNGA 2EKPA 2LCFA 2J3MA 2GZRA 2ZJFA 3QQ5A 1JUDA 1FMCA 2FDXA 4RC9A 1Z4IA 2CJFA 3O0DA 4AJ2A 2VQ6A 1ZJ6A 4MQ4A 4D8YA 5CCXA 2BISA 1ECFA 4KVZA 2VR1A 1N0VC 5BVHA 2X9GA 2Z43A 1XEAA 3PR2B 1WTAA 2OA0A 3TSAA 4F5WA 2K7ZA 3N39C 5JCZA 3O3MB 1ML3A 5HIMA 1CZKA 4PC6A 3HJFA 4JV5B 5BNWA 3GVIA 4LY6A 5BQXA 3PFFA 4EGQA 3GBPA 1YCGA 5DX8A 3WP0A 2G5TA 3PNMA 1V6AA 4HADA 4L4RA 4MTLA 2D2VA 5ELMA 1OZAA 2MYNA 1IWBB 5A2GA 5J4KA 2QTWB 4QTTB 3CZMA 1E1DA 1JPUA 5A5FA 5A6SB 3SXPA 4MPJA 2H1HA 3WSWA 3ZVLA 3ETCA 2EGHA 4QOIA 3WQHA 4ZVSA 1IZ0A 3X0DA 1NBIA 1OR8A 3LAWA 4KXYA 1KBOA 5AI4A 1YR8A 2P2YA 1JXAA 1O6GA 2ZRAA 3DMYA 4H60A 4ZAXA 1R6UA 5JSQA 3G5AA 2H0AA 3IUQA 5CX4A 2BDUA 1CSEE 2HU8A 4JJAA 1E1RA 4OREX 3TBHA 3WAKA 5J4HA 2PE5A 5IVKA 3UH0A 4DANA 1NF9A 3GFTA 4JJ8A 4PE5B 2HFJA 1OXXK 3W8NA 5J43A 3GROA 4QO8A 4Q34A 2BHRA 4RHYA 3MBOA 3TSZA 3UF0A 1D1PA 1GKIA 5LDDC 1EUQA 2PMKA 4PO1A 4ALIA 1EFKA 3CLTD 1AKWA 3PICA 4DUGD 2K2WA 1KI1A 4BJHB 5KTYA 2WG2A 4OB8A 2EP5A 3RUEA 4X3CA 1E98A 1M6VA 3ZHUA 2D62A 2B9VA 4EMSA 1GITA 4C0BA 1NXOA 1Q22A 9LDBA 1NIJA 5CIYA 2ECOA 4L51A 1KDPA 4WLVA 5EJ6A 2HSEA 2XADA 1N2JA 4EY3A 4G89A 4BMNA 3DAOA 1U9IC 3CUWA 3V4PB 1Z56C 4ZGGA 3MN1A 1AJEA 4QDKA 3QX9A 1FXWA 1JE0A 2JH9A 2Q3EA 4MUFA 3LMKA 4X64B 4EB3A 5CR9A 4MQFB 2R1TB 3T7CA 4TMZA 1VCHA 2X8WA 3M4NA 3X1YA 3ITKA 1X7XA 3SC2B 3R74A 2C3OA 3JPYA 4IQ4A 4PLGA 4WEQA 1JHXA 2DUJA 4YQFA 1DO0A 3G89A 2QNBA 2VWPA 1RMQA 3OOYA 4OP2A 2G88A 2AZDA 1FNBA 2XMDA 4NL4H 1D6JA 4P4SB 4N03A 4GXRA 1RAHA 4F9GA 3D9QX 3O9MA 2B8JA 3WLLA 3ZCVA 4BVGA 1M34E 2OD9A 1WL8A 1XCJA 3FNFA 1E2KA 4W63A 5EJ8A 4JKOA 2B98A 3OJFA 1X7XB 3H1PA 4F71A 1KI7A 4QFDA 2AFHE 2UZIR 2DUMA 3UB2A 3MQ4A 1WXHA 1A4UA 3G2QA 2DBYA 3SNKA 4DYHA 1HDYA 2JIZD 4IDEA 4RGVA 1FRNA 5CCDA 2ID7A 1YL6A 3WBBA 3PUYA 2NYAA 4L85A 3WLJA 4URYR 4C0XA 4YJKA 2I2AA 3ET4A 4N3CA 1EAYA 5BWBA 2PSSA 2P2DA 3QBTA 4CM8B 2YKGA 1XZMA 3S8EA 1OFVA 1Z4PX 3MAAC 1R8YA 4NI5A 4XYEA 2PLAA 2E87A 3LWNA 4DIFA 1M1YA 3K70C 4RHTA 1ADFA 2C54A 2J6IA 4QUJA 1VJ5A 2IVFA 3C3CA 3H5OA 1COWA 2OBLA 5EGSA 5EI5A 5IBPA 3TZEA 1C0LA 2MOKA 1N0IA 3T8YA 3C41J 3KU1A 3D6JA 2CLOB 3Q3IA 1E18A 5HFJA 2EFYA 3CVJA 4LY0A 3VZSA 2FZ5A 1PV1A 5HDQA 5DRYA 4UUAA 3P2YA 4X44A 4A7PA 4XLTA 1W9MA 2IDZA 1LW7A 2MDTA 1Q7RA 3QXXA 4MW0A 4LE0A 4RETA 5F52A 2PRJA 3IRVA 1P75A 5K9ZA 3VSBA 1U7OA 2QSYA 2D1TA 3I23A 2ZIUB 4WOCA 3HXOA 4BC1A 1X0XA 3OQMA 1YSCA 1FDOA 5AUPB 1EZZA 2QE6A 2Y9PB 2AD1A 2GUWA 2EJUA 2W22A 3HKCA 3P7MA 4IOMA 5E1OA 4HUQB 4MVWA 1UWKA 5PNTA 1A95A 3T1VA 4B5LA 3ADCA 3EFHA 3Q85A 3WGQA 4CIBA 4QGFA 2EW2A 4H17A 4FQ7A 2ZSEA 1E9AA 3KFVA 4R1UA 3AU9A 2JIPA 3EWSA 3GLRA 2OEPA 2CHFA 4ARSA 5KINB 3G0CA 5JJLA 5E3IA 3FRIA 5GIOE 2JIMA 1F1BA 5EVJA 3A1VA 1K92A 2C4KA 3FBWA 5EEGA 1FFCA 5FPYA 5B57C 1NMZA 1FXUA 3LUHA 2YJNA 3CY6A 2EKZA 3GU3A 4I4CA 4JGIA 3B8HA 4LOHA 5H59A 1FNSA 5JAQA 3V4OA 1PS0A 4TQUS 1TECE 2Q5JA 3W4JA 4CCYA 2VDQB 4QFMA 3DOIA 4GS5A 2BH9A 3HHEA 1WF3A 2PZKA 2VAMA 1U2QA 4JKIA 1QFMA 3QE2A 5FYDA 3EPJA 1T9KA 3DJYA 5A71A 2XQFA 3WFZA 5DO9A 3NM5A 3Q4GA 2XXAA 4BKQA 1KDOA 3TZHA 4DV0B 1H2YA 1MB9A 1OT5A 4HB2A 5EXSA 4W1PA 4FZ3A 3SE7A 4CN8A 4FDVA 2O05A 2IODA 4DT1B 4RY8A 1R8JA 1YE8A 2Q9BA 1C2TA 4ZCSA 1LX6A 1SD2A 2FGKA 4OJMX 4AROA 1EXDA 1DL5A 2ST1A 1VCMA 2QTHA 4PHFA 5B3AA 2WNIA 1CDOA 1P19A 1P44A 4MIOA 1VG0B 3GAZA 1CB7A 3ER6A 4D8VA 3OZRA 3LPDA 4GKAA 1M0WA 5JLAA 5MFZA 1B4DA 3FX2A 3TRHA 1BGWA 1WD7A 2G4CA 3AI1A 2HPAA 3QU9A 3U3KA 1KEVA 1XRRA 1N3BA 3CIOA 3VC7A 4ZODA 1YASA 1PVOA 4C0QC 1Z0FA 2QLJA 1B26A 2GDJA 4YJ2B 4IDNA 4IJ6A 5TQ2B 1G5PA 2REXB 1DWPA 1SBCA 2H4YA 1IXRC 3HMKA 4B85A 4EPRA 1KVTA 3HLKA 2J4DA 3PENA 4I6GA 1HX7A 2VYNA 1FFHA 5ICCA 5LQCA 1HRDA 1QTNA 3RU2A 3SKXA 3M3PA 3TB6A 1FUKA 5KYWB 3K1YA 3LM8A 4TYMA 3W2FA 5KBYA 4S1WA 3DWGA 4BO9A 1P1JA 3PLNA 4FGKA 3F67A 4TLLB 2HK9A 1RBYA 3L92A 3ZDEA 2O19A 3TLEA 2RHTA 2AVDA 4DJTA 4DV5B 4MLZA 3TSWA 4G0QA 3P52A 2WKWA 4OJYA 2PZLA 5TV2A 3H8SA 3PBKA 1KR5A 3M2TA 1Z7YA 4GMHA 4MKXA 5K3FB 2J3IA 5JAIA 5AI6A 2K7FA 4A36A 1O4WA 2WU0A 4ED9A 3N3AC 1BSVA 1O77A 3OEED 3R41A 1VPLA 3LKZA 3PYLA 2QN6A 4ENUA 1V8PA 2J0UA 3NGMA 4LHZA 1SAYA 4MKIA 4RE5A 4HWRA 1ZSVA 4NCXA 2XDAA 1QH1A 4QATA 1KVQA 1G8AA 3D1LA 4H08A 1TRKA 2ZRKA 4U8GA 4AUKA 2CXOA 3H2BA 1QQ6A 3UQZA 5LL6P 4LFAB 1KYVA 4FEYA 3INNA 4J3JA 4I5FA 2AFIB 4KK3A 3N8DA 5KSZA 1J42A 5E9QA 2R8OA 2O5VA 3EQ2A 3GEPA 4IYRA 5MDHA 3BE6A 1ZGGA 3CRQA 3P0JA 4OBBA 4BDTA 1GGFA 4RD6A 1J0BA 1SY7A 3VSEA 1U4OA 5EIHA 2B7BA 2IY9A 3AZOA 3CRW1 1FDIA 4O08A 2Z8XA 5CXQA 1M5TA 1Q77A 2VRWA 1ZJWA 3E3OA 4DQXA 2HW8A 4MROA 3KALA 4NAHA 2Q6VA 2VJYA 4XEUA 1IBMB 3FYSA 3CW2A 5LYYA 3REQA 1TW2A 4HRXA 3VR5H 3DOFA 4O2BB 2H4WA 5IDYA 3L02A 2PKYX 5HQ3A 1FQKA 5I7EA 1IPEA 1CG6A 2DWQA 2UV8A 3UFBA 1PL0A 1CK4A 2Q62A 4IJWA 1P61B 3U3DA 3V4VB 3O21A 1CUFA 1EWQA 2WU4A 1U9CA 2ZI7A 2BM9A 4GR9A 1SHJA 2CLFB 3JQ8B 3LOPA 1L7EA 4Q4AB 4TL7A 3KQNA 1RHJA 4WOJA 1KK2A 2WFLB 3FPEA 3SMQA 4R8SA 1JQDA 1UP7A 3ROEA 2Q8NA 1EFUA 4AF8A 2QJWA 4E5MA 1SCDA 1E1CA 2RGBA 4RA6B 2O3QA 1VP3A 2AUNA 2ZPAA 3DNFA 4PLHA 1SM4A 4PZZA 2JGKA 2GPWA 2B36A 3EIFA 1E7QA 1VIMA 1RHQA 1SQSA 1R64A 2ACVA 2VKQA 3QKWA 3DWFA 2FHSA 1K6MA 1FRFS 4LQDA 4O29A 3TVDA 1EFVB 3CB2A 3I9V6 1B0UA 1PEYA 2DY0A 3OURA 1J20A 1RQGA 3PDWA 4UAGA 2ILTA 1SCIA 3C8UA 4IGFA 5HQTA 3SQWA 3P2EA 3PXCX 2ZUFA 3PHGA 1TZKA 3CNOA 3LJKA 5BQ3A 2NXWA 3LXXA 1W4ZA 4G97A 3OUTA 5IJ0A 2QRLA 2PZBA 3VYRB 4IEEA 1UH5A 1KMCA 2YW2A 3K9HA 4DV7B 2NO0A 1TZJA 3NBUA 4PIPA 1HURA 4LNUB 1FFBA 1RWXA 1Q17A 4FBMA 5IAGA 4ZA2A 2D00A 3Q1LA 1XRLA 4HNSA 2JBHA 4N8SA 5IJ0B 1Z9BA 4CIVA 4JBXA 2YC4C 4M0FA 3NVAA 3PCXA 1Z16A 4MRAA 3PD0A 3ROGA 3RTGA 3SSOA 3LLUA 4EEKA 1PW5A 3BULA 1E5LA 1SEVA 2EXXA 2X9QA 3KYCA 4DJAA 4BQEA 2H1FA 1G8FA 1UDBA 1QXSA 4MQUA 2VT6A 3E35A 2EG5A 1QHEA 1CC1S 1HDIA 4JL6A 5TPWB 4AT1A 7MDHA 2P9EA 1EMDA 3BQNB 4HYEA 5IHPA 1DXQA 2Q7OE 1HY3A 3CX3A 5IJ9B 1YZLA 2ZCVA 2DBQA 4MUAA 2BKAA 1TJ3A 3QK7A 4NONA 3H9QA 4ZI2A 5L4NA 1BYIA 2RHDA 1KFBB 3HXPA 3SJZA 2FZKA 1SQFA 3P32A 4HRAA 2Z58A 1SHUX 3C0KA 3DE6X 4A03A 3FLEA 3T54A 3R6LA 5HJ5A 4L28A 5EZYB 3KE9A 4N3GA 4RLSA 5T4FA 4EJ6A 1E1YA 4ZDKA 1G5QA 5JI3E 2PFSA 3A1TA 1CNMA 4EOGA 3RSSA 1EG2A 1N3YA 4E5VA 3THRA 3G23A 4Q3KA 1OTYA 2CNWD 3MJHA 4W1QA 4H18A 1OKKD 1J1IA 2WVAA 4L08A 1P2TA 5IDQA 4MA4A 3BAZA 4IRXA 4MK4A 4AIRA 2WOJA 1GZHB 1AT1A 1I8TA 1FNMA 3R3XA 4JQOA 3THWA 4HH0A 2PXAA 2HHJA 4UOZA 2YX1A 2PRYA 2ZUCA 1J2YA 1L5MA 4PN7A 2Y1KA 1UBFA 1HEIA 3PUIA 5DSXA 3MJFA 4R8LA 1VYHA 3MT7A 4UHFA 1NJSA 4Y2TA 1XGKA 2C7RA 1JU3A 2JS7A 2H4HA 1A2KC 1X1SA 4S35A 4P33A 4R2JA 3TLMA 1U28A 4LHYA 1E6KA 2Y1FA 2BHTA 2DSNA 2FQYA 1CUZA 2FRXA 2CBGA 3GO4A 4FONA 1TVMA 4IDAA 3AIOA 1G3RA 4YAOA 1F0KA 9MHTA 1U4SA 2KI5A 1MC8A 2DULA 2XXBA 3FVRA 5CDTA 2XDWA 4CG2A 2IP1A 2BEJA 1QIDA 2UYCA 4ZEXA 2Q5IA 2VYCA 4D4GA 4NOKA 1Y8RB 4EI7A 3L0DA 5AKZA 2VJOA 3N74A 4O4JA 3T7RA 4DUYB 2ZKIA 1D1QA 2P7IA 2ZJ4A 3HSSA 2QBYA 3AVYA 2HMSA 2HY7A 2R6DA 3W2IA 1ZIYA 1O6ZA 4Z4FA 1N6IA 1JFRA 1I4LD 3LWBA 3FPFA 4WBSA 1G8KA 4CTOA 1SXQA 4UD6A 4OHRA 5ERXA 3UYKA 1GQYA 3ADKA 3BTSA 1SQ0A 1TQDA 3CZPA 3AWIA 4UBKA 4IDPA 4AO6A 5ITVA 1OLUB 5EQJB 3M5WA 4PAWA 5LMNB 3TDNA 4NKRA 2PUEA 1GU7A 4LOAA 4KOEC 4UU0A 4TLDA 2GM3A 5EHGA 4F8EA 4ZRNA 3W34A 2O1XA 3BJEA 3VR6H 2UXBB 1EGMB 2CXQA 2FG5A 2GCIA 3KRTA 5ALEA 3U9TA 1BHSA 1DKNA 1PUIA 2V6MA 2SKCA 3LZDA 3V7FA 2BFDB 3IQHX 5EZ6B 5ARCA 3U7GA 1RWMA 3CG4A 3E23A 2IUSA 1ZXLA 2OMKA 4NZPA 4D6XA 5IZCA 3PX7A 1BEEA 1CR2A 4P7GA 5FBZA 3V8BA 4E21A 2G40A 2NO9A 5DGHA 1HNWB 1XZBA 3JQDA 5JI2E 4MWBA 1WA5A 4AZ3A 3RSOA 2XZOA 3DBIA 3KZNA 4EEZA 4JI7B 3HCDA 4K05A 3WKBA 2Z2KA 3D4IA 4E5YA 1YNSA 4BTVA 5JZVA 3ND7A 3E0QA 3AEUA 4XZ3A 1J09A 3IJ5A 2NXJA 3SY8A 5LP6F 1YTUA 3AXTA 4ND8A 4DCTA 4KHPB 5TPZD 1I2BA 4Q3LA 1GIAA 4XDZA 4AQ7A 4LF4B 4QIHA 4QQNA 1KQNA 1LV8A 1P74A 4NCHA 2GRUA 2WD9A 1KMHA 4CEJA 2C3UA 1ZX1A 4IIHA 4Z1MD 2OLKA 4M88A 4KNVA 3NIGB 2QRNA 5AJVB 4E13A 2TMDA 1PLJA 3E3MA 4IH4A 1QCZA 2C5GA 1CR4A 3ZCSA 1U3DA 4UTVA 1WZCA 4EVRA 2O50A 3ME5A 3FVWA 1VKHA 2GBLA 3ZLJA 1X1CA 4MMZB 5DOVA 10MHA 1KBZA 5K8UA 2I1QA 5A3QA 3L1UA 3TQRA 3T5PA 2QGZA 5B6JA 3BA1A 1SVNA 3CRVA 1SB9A 2UYOA 2HQRA 3S68A 5E95A 1NMSA 4EATA 3TZ6A 3LHSA 2C92A 1EM8B 3MK31 1SQ5A 3WC4A 4AS1A 1C4XA 3P26A 2CHVA 1YKSA 1Q19A 3LQFA 3ODGA 4FHCA 4MYDA 3UO8B 3PC3A 3OPXA 5I7FA 1FZQA 5D8DA 1YTLA 4Q4JB 4E5DA 1H94A 3G6WA 3LW7A 4PHGA 3LC1O 4G5SA 3GUCA 1E9VA 1KC1A 2HGSA 2QD4A 3FDFA 4LXHA 4MQ6A 2HU2A 2XUJA 1JT2A 1V4VA 2CNOA 2QWXA 4JJ6A 4RCVA 1CUVA 2ZB7A 2B2CA 4YXWD 4BNDB 2HA2A 2G77B 1BW9A 4B6RA 4HNRA 2X13A 2VNHA 1TYCA 3PDIA 2W2NA 2C2OA 1U3TA 2CMFA 4BVEA 4DR6B 1TK2A 1PZHA 1R6DA 4FGJA 1WMBA 1Y6QA 1QC5A 2AKYA 3BBLA 4LVNA 4PIMA 4EO7A 4WOKA 5KTTA 1H05A 1UODA 4TTJA 1SK8A 4FS3A 3ZQ6A 1WOMA 1SKAA 2JGDA 1V71A 3BICA 3G2PA 5LQDA 4ZO7A 3GJ6A 3SF8B 3S2SA 1DV2A 2RBKA 3ROMA 1W0CA 2C9ZA 2C83A 4FFPA 4TOIA 1FXSA 1NE7A 4X20A 1ANKA 4GGMX 3W3AH 2G0NA 4Q9AA 5BV0A 1XLTC 1EEXB 2CK3A 4K9MA 4GX0A 4PGMA 5LP6A 3OT1B 4HY3A 3Q9LA 4YLGA 2QN8A 4ARAA 4HBGA 4BNWA 1GO2A 2KWIA 1CR0A 3KSBC 3OZTA 3FMFA 3NS7A 1BYUA 3UZUA 4C4OA 3F97A 4RVCA 3LG2A 2HO5A 2F64A 2RBGA 2YCLA 1PSWA 4E6EA 4WPGA 2IE8A 5IYZF 4I08A 2R68A 5AOBA 3E0XA 3NBKA 2R6AA 4RVUA 2V7TA 1BWQA 3E7PA 3DCNA 1Q12A 4RPJA 2PGJA 3DMFA 3GL9A 1A69A 1IM8A 1SU8A 3FZYA 3R5KA 4MB0A 1FOEB 3E9RA 3PRKE 4O25A 3B5EA 3SBEA 4RH1A 5KB3A 3FHTA 4DA7A 4EI2A 2BRUA 2EFGA 1I30A 2VJMA 3O4IA 2Q5QA 3TLKA 4LYHA 2BR3A 3ZR4B 1BRTA 1PG2A 2I3ZA 3MMNA 2OECA 3BREA 3V9AA 4EW6A 3KSZO 1YOVA 4ENVA 3F71A 1TT5A 1BS1A 1ND5A 1VPVA 3BXZA 4LMAA 1SC3A 3QUAA 3TI9A 1CQWA 2BGLA 4YX9A 4W5QA 3HA2A 4BFWA 5KYYB 3CUTA 3NRJA 5J2UB 3RK1A 1RP1A 3AR8A 3G9ZA 4D9EA 1Y6JA 1ZUIA 1PVVA 1QO7A 4Q18A 4JVMA 4J1QA 1N5LA 1YQUA 3JZDA 3GJYA 2DR3A 5F9MA 2PX0A 1XQ9A 2GZ2A 1M9NA 4MR7B 1Z5VA 2VSOA 1LWNA 4ZQEA 2YXEA 4PAQA 4LMPA 3PUVA 3UT6A 3WSTA 3HDGA 4MYTA 1GQRA 2RONA 3B1JA 3I72A 3T61A 2H4ZA 2KSQA 5K5EA 1AV7A 3LQRA 3VV2A 2B61A 2XZDA 1XZGA 2F7SA 3QVTA 5T4EA 2PBFA 1WZUA 2C9CA 3AJ9A 4IP0A 4OXNA 4WRRA 4Y67A 1ISHA 3T95A 1QGED 1XAIA 4WCVA 4B3FX 5BRAA 4F91B 2WG1A 3NHYA 3GCXA 3NT5A 4I0WB 4HWKA 1N2CE 2O23A 3H5LA 3FMOB 4AY4A 3JXEA 4HZUA 4IDHA 4UFPA 3TFWA 4DUGA 1Z0DA 2HPZA 2B5VA 4PXAA 3WIBA 4EHIA 5BUZA 1BHQ1 4IS3A 1XWWA 5BN4A 3F7OA 1AKQA 3RB8A 2R5NA 1U5BB 1GAEO 3KVRA 1V8BA 4ZJUA 3QSYA 1GCGA 1M54A 1RLJA 2ZJ1A 3SR4A 4CMEA 1EVEA 4B6EA 4BLOA 4IWXA 5IYZA 1Y1SA 1XHLA 4YAWA 4QKQA 1H6BA 1T1GA 2WU3A 4TLEA 4YDSA 1FSFA 1KRHA 3NC1C 5EY5B 2A7QA 4GI3A 2PPVA 3R23A 2WNSA 1Q7BA 4KN8A 4WK4B 3RKUA 4C0LA 1NTOA 1PFUA 3W1EA 1Z08A 1OI2A 1C8BA 2JAWA 2QYOA 4GHWA 2IZ1A 4Q1BA 3MWDB 4U39A 2Q1XA 2H0RA 2UXDB 3VKFA 4U8HA 4IGEA 3V6LA 1I7NA 5GJWC 3W8DA 4YJHB 1VZ2A 1DO8A 5EA2A 5CLQA 1L4LA 4H6PA 2Y1WA 4ESEA 2H6EA 4BRWA 3VR1A 5CVVA 2CFIA 2GM9A 1MGOA 2JIZA 3L93A 4ZIRB 3K0SA 5FFFA 2F1HA 2XMQA 1PYDA 1JR3D 2WF7A 3CKLA 4HX2A 2IDKA 1C81A 1TMKA 2I0FA 3EUFA 3FWHA 2J9FB 3NHPA 2VHEA 3EULA 4UVDA 5AJYA 5FXMA 1UJ5A 2IX3A 1XVVA 4KQMA 4JR0A 2ZGVA 1LPBB 1RWPA 4P4TA 2VZ9A 2CDCA 5DYYA 3HKDB 4JROA 1XJ5A 3K8QA 2QJRA 1F8UA 2X4DA 1J07A 4HXYA 1W88A 3UMSA 5EUCA 4CIXA 1PRYA 2ATIA 4ENSA 3QEAZ 1SBHA 2PSFA 2QAGA 1GTRA 2VEOA 3CUEF 1VDMA 3C3MA 4P2BA 5EIBC 1FMLA 5TDHA 4X24A 4X1YA 3I32A 3W04A 3BGVA 4R16A 1WKBA 4FFMA 1DPGA 2CE7A 1P0IA 2W58A 4YAFA 1SUPA 2CCJA 4JUCA 3BMOB 2VDWA 2C8KA 3WGVA 1QE3A 1NGSA 2B1JA 4DXDA 1QP0A 4H59A 4YMHA 4JBIA 4OIMA 5ENVA 1J97A 4UEJA 5EXTA 1F60A 3NDPA 1NVVQ 2QAGB 1A2OA 1TIKA 2QUJA 2EL9A 2WEKA 2AJBA 3A1FA 3I09A 3K5WA 3Q0IA 1SC4A 2B69A 5D6NA 3JAKA 1M6WA 3L4SO 1AUXA 2CUZA 5CDGA 1XRNA 1WEKA 2VDWB 4MW2A 4AAYA 5B30A 1KAQA 5LQUA 5AW6A 3V4RA 2QAJA 1Z82A 4IBOA 2C7VA 3ZTTA 3A27A 3PPWA 1GNQA 3BSSA 3VI3B 1RKUA 1ID1A 1L5HA 4WKNA 1E3QA 2W4IA 2H9AA 5D3MA 5FLXA 1LK7A 3C2QA 3DHNA 4IUBS 4BNVA 1DIBA 1XXHA 3I9FA 3O3CA 4KRXA 1E2EA 3TFQA 1TK3A 2QVYX 4UUPA 1NI4B 2EZ8A 1F12A 4ZYYA 4D0NA 1H2HA 4XW2A 1YQXA 2Y6UA 1X9GA 1FLDA 1WXGA 4G3XA 4IUCS 4E4RA 1ZCBA 2Z56A 3AG5A 4H7EA 5D7BA 2ONKA 1E2JA 1GGNA 3FLMA 3H5RA 4RIFA 1DJQA 4E3WA 1TU3A 4HJXA 1QJ4A 1RYHA 4LRYA 2D0DA 4LGVA 4KTVE 4R51A 5A3VA 2VK2A 5DJ5A 1KH3A 1T3TA 1ZH8A 2DT5A 3IR5A 3SVLA 3OZBA 3T7EA 5JMWA 3MWEB 3ZE0B 4EUNA 3O9ZA 2CVPA 2PR2A 2Q5EA 3IDOA 4D4KA 2ETVA 1H9CA 2H51A 4P98A 3BXFA 3UHPA 1OVGA 4LOIA 3KZOA 2UVDA 2ZDGA 2P11A 1XAJA 3L8DA 3MMPA 4G67A 4JYMA 4UMVA 2FVYA 3VQTA 4XR9A 1AMUA 1GPNA 1BX1A 1ZVQA 4V0KA 2QT1A 1ORHA 3CG0A 3NHBA 2N3ZA 2JHAA 3FH0A 2X4IA 4FNGA 3RUIA 3W5SA 2P4HX 1QHHA 4O5AA 1Q1NA 3W5HA 5BPFA 4FYPA 4IVPA 5HFAA 4DFDA 2ZJ8A 4KQFA 2WAOA 2XF8A 3PEFA 3WGGA 4V0MA 4ZEWA 2G5CA 1E20A 1ILEA 4UCXA 2IV2X 3TQOA 2QPLA 2Q7XA 4C89A 2CC2A 1OF1A 4P53A 5BR4A 4IVRA 1X42A 1MOZA 2C3YA 3EN0A 4AYXA 4B7XA 4ZOQI 2GCOB 2LKDA 3FPGA 4ADSG 3K0BA 1GRVA 2ZTLA 3D64A 1VCIA 4HDKB 1ZHHA 3NANA 2GZHA 4IV5A 4D57A 3UUWA 3JYQA 4ZPXA 2HK7A 2R2GA 4YT4A 2A9PA 3UPDA 4FX5A 2Z2XA 4M0DA 4XSGA 1PR9A 3EGCA 4YIHA 5CA0F 1ZQ1A 1UBNA 3EZ9A 3OEEA 1MD9A 2GBGA 3FOBA 3JALA 4QTYA 7YASA 5LPNA 2R60A 1QH0A 3AM1A 3NO4A 2FJ0A 1H2WA 4H3SA 4IMJB 3F78A 3RIXA 3TR0A 1CF4A 4JLOA 2VCEA 2VP3A 1PF7E 4PSKA 3V2HA 5K7SA 1SUEA 5IUNC 4EWLA 1EB9A 2NQ2C 1GZSA 2QB5A 1NG9A 2Q1UA 3L18A 5BN3B 4RZ2A 3PF8A 4D98A 1KPIA 2FSGA 2WINI 3TEMA 4A8PA 4C4YA 4M1MA 1WG8A 3VYWA 1UKEA 2AG6A 1TKAA 1K06A 1U81A 2AI3A 2C2WA 2EIXA 3E9CA 2OTCA 2WJGA 1U0JA 2MSNA 4X93A 1C2YA 5E9WA 1H2XA 3V2IA 4UC0A 4ENTA 4ESVA 1VHLA 2XGGA 4KNWA 4MLPA 4TTIA 1FK8A 1DE0A 4B84A 4J7UA 3TQCA 1KEEB 5I9SA 2NV2B 2V59A 1JFLA 2I7XA 1Y9DA 1B0ZA 2Q3MA 1RXUA 1ZC4A 2QX4A 2OFOA 3B9RA 3F7NA 3HN7A 2VAWA 1DHRA 3HKEA 3R3VA 5AK3A 2I4IA 2OKGA 5EIAA 5TF4A 4B3SB 1NRIA 2UXCB 3JVVA 3TI7A 1UPAA 1KSFX 4QASA 5CT6A 1VCNA 1WMDA 4X63A 5F3WB 2PZGA 4LRUA 4GLFA 4LBZA 4WKPA 1H85A 1QV6A 2IYUA 3ZLBA 4K03A 4JVSB 2A9RA 3URKA 2YTZA 1A8SA 1II9A 4HGQA 4BJ3A 1W76A 2EJBA 4PZ9A 5SYNA 2GT1A 4FWIB 4DR1B 3VJRA 2JFOA 4Q4HB 4GX5A 5C7LO 2CY0A 3WRYA 5FI0B 4EG4A 2DFKB 2AN4A 2BFCA 3NHFA 1NR5A 3FFAA 3HNPA 4G86A 1IBKB 1JL3A 3MYYA 3SZLA 2QVGA 1WBDA 2BP7B 2OV6A 1BN6A 1L1RA 3G8CA 4PF1A 1RJWA 1ZMOA 4CHGA 3WGOA 1EQUA 4JP2A 3GVCA 1KOLA 1I6KA 3EXFA 3E9NA 4HDCA 2XLCA 5E4TA 2O8CA 1PN3A 1Q0TA 3IFSA 2X1VA 3TEFA 2BELA 3E9MA 4H1TA 2OORC 4YWHA 1R8QA 4IKPA 1NLZA 1CERA 3OX1A 1V5IA 5FHQA 2R7NA 3H7AA 3OE7D 3G8DA 4B34A 4G56A 2JFFA 4N41A 1Z5WA 1E89A 1LX7A 1JDSA 3HXKA 4FHFA 5F77A 4XUCA 3ONDA 3ACBA 4QPZA 3GLFB 4E5NA 3NXSA 3LCVB 3A7EA 2BW0A 3UN1A 3HNOA 4TM7A 4WJZA 4CT0A 1XTVA 2QRPA 2LPMA 4RZ3A 5AM4A 4QDJA 1SCUB 2QJOA 1GZVA 3BK2A 4II7A 3SC3A 3UNXA 1HFJA 1J25A 1FYVA 1B73A 4HXFB 1OLSB 3TAUA 5LXTF 1ZK2A 3AV3A 1U8CB 1JA1A 4MKFA 4NZZA 3TJMA 5CA0B 2OSBA 1ZJZA 2FPRA 1UXIA 4NC9A 2DECA 4HRYA 5BVGA 2OR3A 3MTGA 2YY6A 4K7JA 5FX2A 3PUXA 4J7XA 4BJ1A 3GLGE 5E0KB 3GH1A 4HVLA 1CULC 2P67A 3TGPA 2C2MA 3GT7A 1PZGA 1C7ZA 4BQRA 3UWKA 1LPMA 4ARCA 5IASA 3K8YA 5JISA 4CE6A 4WK6A 3JSAA 1GKUB 1IZ7A 1LXCA 2Y67A 5B3LA 2ZB3A 4IIUA 2Y0BA 1P1CA 4BLRA 1ZRMA 4FWTA 3I9MA 1GU0A 1LWOA 1ZZGA 3Q41A 2YYAA 3LIIA 5ALKA 5ER6A 3COSA 3ONWA 4ZC8A 4HH1A 5KYXA 1N6RA 1PTJC 2ZYGA 3CEPB 5BSTA 1PK9A 2X23A 2FZCA 3CN7A 4RE6A 1NN3A 4K46A 1UBHS 4WQMA 1GV1A 5H7XA 5LN1A 1XV5A 1XAHA 3DT9A 3R0VA 1QR2A 2PSDA 4YASA 5E9JA 3GG9A 3PITA 5HBGA 1EJ2A 1YAJA 1D5WA 4A16A 1K6JA 3MGAA 3E81A 3C87A 1YU9A 3QTBA 1A1SA 2AV6A 4IJKA 4TXNA 1XCBA 2YV5A 4INPA 3S0JA 4AG3A 2ZUBA 2QVLA 2ZE6A 3D3EA 3MGCA 2CNWA 1SIBE 2YS7A 2I1WA 4NY1A 3CNEA 4MV1A 1IBRA 1OKKA 2ZJ0A 5EP2A 3RV4A 3DWIA 1DAIA 3EBPA 1Y1QA 2RHMA 3A9TA 1JG1A 3ESQA 4PRZA 4WK2B 4YB8A 3T7KA 3FB1A 1LB1B 2PL5A 4OQNA 2QIPA 3TE7A 1LQUA 3K6KA 4PC1A 2O20A 3FHLA 4XPIA 3AOEA 2NNWB 2VP5A 3H97A 4L2IA 3TTVA 4ES6A 3C6QA 4YJGB 5FPTA 2HDWA 2KLBA 4DKJA 3OZIA 5JVDF 4E88A 2B25A 2R65A 4WGFA 5K4AA 4FZVA 5GMOA 1C7EA 1G0OA 4QVKA 3R7BA 3ZWMA 5B7GA 5HX7A 4TN5A 3VR2A 2ESRA 1C3VA 1MPTA 3O8OA 2A9KA 4ZO8A 1WHTA 5CGQB 5DK4A 4L2IB 5LXTA 2YNMC 3V1NA 5C1BA 4TRRA 2I4NA 2XA2A 3L05A 3MA0A 3CEHA 3T34A 2GBPA 5FA8A 1BQ3A 5L3SA 4ZJPA 3VO1A 4EG5A 1NT2A 1U7ZA 3NCHA 4IIJF 5HF6A 2JFVA 1ZHFA 1B2LA 5K8LA 5K03A 4RENA 1DWOA 3KAJA 3P9ZA 4BP3A 5B12A 3IT1A 621PA 3O8OB 4R2WA 1K7CA 1E3WA 2EC5A 2FUNB 3GZJA 4OA5A 3OU7A 4NF2A 3IBYA 2NZWA 4RX1A 2XUGA 2BONA 1EFPB 4KI7A 2OXTA 3EF1A 5FBHA 4FWBA 1SPBS 1QDEA 1ZSYA 3ENKA 4TTQA 4DA0A 2PKXA 1A9PA 1Y5IA 1Z8DA 4Z2YA 5JJKA 1XMJA 2DKNA 3GJZA 1PQYA 2BZ1A 1YFZA 1L9XA 3HBMA 1DS6A 3OMXA 3PGMA 4K0RA 3V3KA 3OOSA 4ENQA 4UNNA 1Y0BA 4TZTA 4X54A 4ZT7A 2GCNA 4JB8A 5TT0A 3U7QB 3VJKA 3ZHZA 4KG7A 1KVRA 1EFTA 1Y9EA 5IAKA 1MO5A 1A9SA 5CB4B 3FCUB 5IVDA 2QD2A 4NEGA 1P2FA 2ZYIA 5KNLA 3NWOA 3QENA 3N2KB 3IKLA 3PWZA 3AZPA 4N3BA 4IDGA 5EXPA 4GC9A 4GMFA 4NU6A 4HHEA 4MVJD 4A5SA 3QVGB 4KAFA 2E1PA 5EVCA 2ZAIA 3MELA 1O5IA 2JFWA 4D6PA 4C7OA 2VP0A 2BL4A 3VR4H 5B1IA 1KI8A 1NLYA 4FFOA 4NXMB 2WJVA 2PGDA 2VC2B 4XGKA 5TMEA 3KD2A 2AN9A 3BZBA 5TPZA 5KTOA 4D0LB 2QR3A 3MJVA 3RQIA 1QGZA 3AVWA 2WJWA 3BJRA 1V7QA 2YIMA 4NATA 2XAAA 4YREA 3L6UA 4Z1MA 1Z6QA 4ODIA 1N3IA 4I1RA 3DCIA 5L6LB 4FLFA 4CR8A 3FWPA 4Z3DA 5WRFA 4EB6A 3H1BA 2D1SA 4NENB 4WKCA 4YT2A 3R5SA 1G2PA 4EUHA 3C6BA 3SHTA 5JVDB 1L4GA 1UC4B 4I9GA 4UM7A 2P1DA 3U44B 4U7JA 4L8LA 3WIVA 2ZYSA 3OF5A 2XWQA 4EY7A 3QBDA 2GEVA 3LYUA 4DQ0A 2G76A 1RVV1 2HZBA 3P9PA 3ODPA 3NNSA 2WYHA 5BXYA 4GECA 4MS4A 2BSQA 4PBTA 2Z5GA 2BFOA 2VPYA 3TD6A 4U2EA 4JYPA 3AVTA 3EGDA 3O2SB 2I2CA 4IIJB 2P9CA 2AE2A 5G1PA 2MSLA 5EPOA 1V7CA 1COZA 1X7YB 2WKPA 3AKYA 3PQ4A 4M1YA 5AYVA 3UM9A 1NF8A 3EGXA 2GTHA 5AVQA 3J80A 5CPBA 3GHHA 3D59A 1GPLA 4ZT3A 1HYGA 4YXWA 4NCKA 2BKUA 4EKIA 2RGGA 3DNMA 5K0GA 3PWTA 3TK1A 2GPJA 3F1LA 3EGDB 4L8VA 5AKHA 1GAXA 2PQMA 3HSYA 2YVQA 2XWPA 3A6DA 5DWVA 4MINA 1G20A 5LZ9A 5JYCA 1E2BA 4HUJA 3OQNA 1T9HA 3OU6A 3EGXB 4G37A 4U6NA 2JH3A 3STYA 1CR1A 3WL3A 4BO4A 1DOAA 2H5EA 1HFWA 3EVGA 4MR9A 3T3DA 1D9XA 4Z0NA 3GLIE 2DB3A 1V5FA 1N6OA 2IUYA 4DCCA 1KMMA 2VDLB 2D06A 4KTTE 2R7LA 4Y6GB 4TTAA 3LFUA 1YJCA 2OXIA 2OUKA 4DM4A 1YS2X 2Z6AA 2FFRA 1J8DA 4YT5A 4TKVA 2JRLA 2HCJB 3HXMA 1ULUA 4HFJA 5DCLA 3ZWWA 4LY9A 4GQAA 3PXBA 1HKUA 2MSKA 4J16A 2P2ZA 4J75A 2QVBA 2XZPA 3F6SA 3HBAA 3HQ4O 2OK8A 3G2HA 3HY4A 5FFNA 3AVOA 5IN5A 4YHBA 2VF2A 3U9SA 1T5LA 3HI4A 3OLZA 4QBGB 3WRWA 3RT7A 4L0QA 1L8QA 4L22A 5HKOA 2Z2JA 5BUSA 1UPFA 1FTNA 2HA7A 4XUDA 1WP9A 4CM7A 2RGWA 4GOJA 2ZAOA 4C6RA 2RGXA 3BWCA 3PK0A 2FG7C 2PD6A 5BURA 3G2KA 1C7IA 2I6GA 2OD2A 3BG5A 3GK3A 3UQYS 3WLMA 3EXHA 5F2NA 4MI9A 3PFBA 2YHIA 5E2IA 5AM3A 5IWAB 2G5GX 4MPTA 1XJWA 1T4DA 1US8B 3KL2A 4LWOA 1K68A 2AJCA 2OLJA 1G9TA 4MDHA 3TQQA 5KSWB 4LYFA 3AI2A 2VUHB 1TMGE 1YKFA 1ARZA 3OZVA 3PQFA 1E0KA 1Q0QA 3K94A 3EXEA 4FHZA 4X6LA 3NAMA 3MRXA 3BCHA 5DTRA 2D2EA 5E2AA 5REQB 1B8PA 1KAHA 4RVFA 2WFZA 5KNDD 1A7AA 2W11A 1T6BY 2D0IA 4IQ8A 4C20A 3TD2A 1JYSA 5CLJA 5GOTA 1L4BA 4JJ7A 5FFMA 3BUSA 3AF1A 2RGNC 2EBWA 3GQBB 4QOJA 4EG7A 1QF9A 4BOYA 4C6HA 1T2DA 4CF6A 3GYBA 1JQ3A 2GO7A 5SZJA 1Q0UA 6Q21A 2CVHA 4B7AA 4CKXA 1X80A 3DDWA 1I1HA 3ZV6A 3C3XA 2XJ4A 1IDOA 4PM4A 2N1MA 4CF5A 1JB9A 2E4AA 1ODSA 3EEFA 4FUQA 2ZSAA 1VI2A 4HAXA 1QR6A 4XA8A 3GZTB 4IHJB 2QZPA 2V55B 3RREA 4NE2A 2IXEA 1EDZA 2G1PA 1O97D 3SKVA 3OPMA 4C07A 3P4YA 3Q8XB 3UB3A 4F2GA 4DS3A 1F38A 4F72A 1H4SA 2GD1O 1NC1A 1Z45A 3PX2A 5EE9A 1ZL0A 2WICA 4FP9A 3LBIA 1D03A 3C3KA 4YCJA 1C4WA 5B37A 4UCWA 4D4MA 4UOEA 4XCQA 1GPUA 1H42A 3NGLA 3WYGA 3GLQA 5I3CA 5JALA 1IN5A 1TJ4A 4BEVA 5JBNA 1QOQB 2W6QA 4M0PA 5TMDA 1C1XA 3WS7A 1Y4AE 4RGQA 5CHEA 3DDSA 1CUGA 2QHXA 4L5BA 2IKQA 4UTRA 3IE1A 1G38A 3A2NA 1QIEA 2C7BA 3H0CA 1VBFA 4MRPA 3U48A 1NBAA 4X85A 5DNYB 1FFXB 1T1EA 1TMOA 4OHBA 4YGXB 3INRA 4UUBA 3VZDA 2EZUA 3B1XA 4V0SA 1O08A 2BMJA 1Z2AA 3K1AB 2GD2A 2Y71A 2J32A 3OETA 2VL7A 5C1DA 5ALJA 1ESCA 1F4LA 2ZYTX 4HDSA 4QJ3A 2H4JA 2CL6X 1A4XA 1HT3A 3H99A 4RIHA 5LBTA 1SBTA 4QG3A 5JYBA 3T41A 1PAUA 2FX2A 2JF0A 4JASB 4RWZA 1UM8A 1P1BA 4NYIR 3FXAA 4UDXX 3RSHA 1UZNA 3UJPA 4DAOA 5KNBD 3QNUA 5EESA 1JR3A 1MU0A 1IB0A 4IWYA 3TGWA 1MC5A 4QUAA 3I0MA 1PL8A 4EDHA 4B32A 1PR4A 5DEOA 1MUUA 3EIEA 1LU9A 3DGEC 1QVAA 3R5FA 1LH0A 3QELA 4LYEA 4EW1A 1AQJA 1ZGZA 2J87A 2JD2A 3CCFA 1XRSB 3KSUA 1ZOSA 2IYXA 1MAAA 4K9PA 4PG6A 1ZU4A 3LC0A 3UK2A 3RC7A 1FFWA 1KSGA 1IMOA 3ZBPA 1FDVA 2Q3HA 5AVUA 3U7FB 2PS9A 5K3AA 2C5FA 4C0KA 3FZGA 4K1LA 3RU7A 1BDJA 5JFOA 3VKHA 4RTLA 5KWSA 3EQZA 5K45A 2WUGA 2ZPUA 3W2TA 3I34X 1QU3A 2FMKA 2RMKA 2FPPA 1DPFA 2NO6A 3V00A 4FZJA 1C1HA 5FL7D 4OHYA 2J31A 2W6ID 2BJWA 4N8DA 3PGA1 4A4DA 1OZFA 1V6SA 4H1UA 3Q72A 2DLNA 3TOZA 3R0QA 5BWCA 3NJ4A 4AB1A 1X0VA 1BXZA 3CZAA 1T5OA 1UFVA 1VG1A 3QFCA 5IRCD 2JBWA 1QPGA 2OQIA 1AGPA 3VPHA 1FB5A 3ADDA 4GLOA 2BGGA 1C9YA 4H6VA 2BFFA 2FQQA 2O0HA 1GY8A 3FNHA 4L07A 5IM5A 3ZV4A 2FPPB 4BBJA 1RXEA 3ZUGA 1E6LA 5CEFA 1JT9A 2VUSA 3B36A 1GARA 1Z0UA 3OFVA 4M8KA 3TPCA 2ZZNA 1G42A 1OQAA 4M86A 5MFPA 3JD0A 3SEQA 4ASUD 1W4CA 1NW8A 1DXYA 5DSTA 4JR1A 1POWA 3ZBQA 4TWRA 5CEEA 1KYZA 3AUAA 1CJTC 3RC1A 1FTYA 4XJSA 2RBEA 4MS3A 4ATNA 1C8LA 1WP4A 2FPLA 2QX8A 5KKCA 1JA9A 1UP6A 4IRMA 2F8MA 3R5TA 4ENRA 4R2XA 5T7BA 2VJQA 4J0CA 4ZANA 2F00A 4ZI7F 1N6PA 4JNKA 2E85A 1UAGA 4DZRA 3CE9A 4DCNA 4YMSA 1IUPA 2ZI3A 1EK6A 4WDRA 3F2VA 2CXXA 1P6XA 2CL7X 2NLOA 4HXEB 4MKHA 3AK4A 1XQWA 2V7UA 2H2WA 2ASVA 4CMCA 5L9AA 3WGYA 5F76A 1GCUA 4Q3CA 3KOWA 3NH9A 2HRDA 2G83A 2AG0A 1NATA 3OTGA 3FOWA 3KQQA 4OHMA 1FJ2A 3TTYA 4EH1A 3PTAA 3DDZX 1U0HC 3HDHA 1H0KA 1SUAA 3IPCA 1DEHA 4DLBA 1CY7A 3AH8A 4BVBA 2H7XA 4MMXB 4Q1VA 2QUAA 4B7CA 4JJ4A 5CDSA 2D8AA 2HLHA 3KO8A 2OXFA 4KGDA 4LXIA 4PGGA 2CLLB 2C98A 4WN9B 5F3RA 4BGUA 1PFWA 5ILOA 3FPJA 2JZNA 1TX4B 1LBQA 5CT9A 5TMBA 3SQMA 3CU5A 2GPSA 3QH4A 5EJGA 3SJBA 5FWDA 3EXIB 2ZS7A 3VYSB 2B1RA 4W5OA 3DOUA 3MFYA 3LYHA 1RE0A 3DTNA 3HDYA 3AERA 1QIHA 4DNPA 1ODKA 3DE7X 2R9VA 4ZZIA 3USCS 1KEPA 4JWKA 1K1EA 1WB5A 2OILA 5CM9C 5C9ZA 5K6AA 4WE3A 3M5CA 4AUEA 2J1LA 1B76A 3IEUA 2ORIA 1QZZA 2WA1A 2Z3ZA 1S1CA 2HMTA 2W2VA 3A4LA 3AIIA 3G1WA 2GILA 1N1EA 2QY6A 2YOGA 4WVLA 5BQPA 1J7KA 2EEPA 3R0XA 2A33A 3MUOA 3ROKA 2CFOA 2FW0A 1V8DA 2N0SA 3L6CA 2B37A 5JHHB 4D26A 3DCYA 1ST3A 1XQ1A 2J5BA 5DHAA 3VH3A 3F46A 2H4FA 1TEXA 4R2LA 3KKEA 4WOBA 2REOA 1YDMA 5KVCA 2ODNA 1M66A 1G98A 3B85A 3TLJA 4BQQA 5HFNA 2FWAA 3FOEC 1Y3AA 3CR7A 4G0PA 4Q7EA 3PFCA 4ZI7A 5BQFA 2PK3A 1OWOA 3M1IA 3DNPA 2J3HA 3WIUA 1OI7A 4C4RA 4EKGA 1NMEA 1QTQA 2XTNA 5ADUS 2IIBA 1V35A 4HVTA 1M1NA 1O4VA 2Q3DA 4RDCA 2P9YA 2FF5A 4L50A 4OQ4A 4Y9RA 4ZOEA 5TVGA 1AA6A 4MCJA 2P6NA 4DA8A 4YMIA 3CRZA 1YB2A 4NPAA 1I14A 2HWKA 1K6XA 1O2DA 3D0QA 4UKDA 5GM1A 4NBLA 4EGCB 3HUFA 1DVRA 4Y2GA 2PX4A 2F9FA 3DP9A 1KF0A 5KAPA 4EQZA 2XV1A 2P5TB 2BFMA 2D2IA 2YWRA 1ZK0A 5FBQB 4YRPA 3UV3A 1G8MA 3R09A 4FFRA 4H1HA 3Q6NA 3EA0A 3CV3A 2CHUA 4W6ZA 4FINA 1DADA 4CLDA 4C43A 3IVGA 1OASA 1QDUA 2VDJA 3VYVA 4G5HA 1E60A 1E5DA 3I3SR 2D5IA 2EJCA 4E03A 1RJGA 2HJWA 5CDHA 4FMPA 4OSEA 1G60A 1TIPA 1XIVA 2VS1A 5AXCA 2CMGA 3ICCA 3VVCA 4DEXA 4ZJZA 2I33A 1U1GA 3LKVA 4AI6A 5JSKA 4BMSA 1L7OA 3QG1A 2SCUB 1ZU5A 2ONCA 3Q3CA 3RS8A 3ADBA 4QBIA 3VHQA 3U09A 4JT8A 4S0XA 3VKVA 1X1AA 1EAMA 3OE7A 4GPTA 2ERYA 4MEBA 3Q9SA 1KPHA 2ZETA 1WLSA 1NFRA 3STVA 3VDRA 3GFQA 1ZESA 1WZIA 3RRZA 2ATEA 1TRHA 1GUAA 5CFPA 5G1OA 2CWDA 4IJVA 4B3XA 4B1FA 3KS9A 1U8YA 2ZJZA 3GZNB 4B4OA 5ALHA 5HM6A 3JWIA 1DCKA 5H3HA 2VSYA 4LRWA 4CCWA 3HFGA 1XK6A 3L7YA 2QX7A 4HV4A 4OAOA 2H1WA 3V4LA 3ZVKA 3WMWA 1VL1A 1WPQA 2RG7A 2JDID 5JY6A 5D87A 1MZVA 3ENQA 1UPXA 3PT9A 4XX1A 3PXGA 1CF9A 2A1UA 4OD0A 2FG6C 3TAHA 3INYA 4WBNF 1RCTE 4ZDJA 1XUOA 3BMNB 1JLSA 2J67A 3A31A 1VYUA 1N8NA 1B1AA 5DGXA 3U37A 5CFRA 1BJKA 2LTAA 3ZNPA 2JARA 3AVQA 3O1LA 4AECA 2UUPA 3WGKA 4QOFA 1RZUA 2I2FA 1M1XB 2MJLA 1XZIA 2RCNA 2Z09A 3R3SA 4PBSA 5ANRB 5G53C 3RC8A 3R6TA 2OXCA 1SR8A 2RH5A 3LNCA 2X8AA 2WIKA 4XH9B 3UIEA 3M1AA 1CY6A 2V9CA 1WCYA 5EWJB 2SECE 5I9TA 1ZM4A 1H9AA 2N42A 3O8NA 3HABA 4KXUA 4JQZA 4FNMA 3ZE9A 1TJYA 2J0VA 4OFWA 5DLPA 3UMYA 2JANA 3ET5A 2FRDC 2YVAA 1L7MA 2PMWB 2X4LA 5DEIA 5EIWA 3IT3A 4C7MA 1L4YA 1SOAA 2LCIA 1EK1A 3L3BA 3D3WA 4RD1A 2JLCA 5FPPA 4QUBA 3TPZA 2XHZA 3DXYA 4ZTZB 3ASYA 1JFSA 4UEKA 3V34A 3F73A 4FJ1A 3HGMA 3O82A 3Q7EA 4L8GA 5AW9A 1EG7A 3VUFA 4P0PB 2XKJE 3UHAA 3WQSB 3AWDA 4JLNA 3IAM1 2C0PA 2ZRDA 1KC3A 5TQ0B 3PJDA 2FE1A 1AX9A 4MVJF 4QYXA 4UHJA 3S44A 5JRDS 3W5UA 1JMVA 2XB9A 1YC5A 1Z8NA 3CPEA 2COUA 5EFZA 4FFBA 3GLTA 5EHXA 3TNYA 1OXUA 3TQTA 4G1FA 2O8NA 3VR0A 1E4YA 4DMCA 1T9BA 2W8BA 3DKPA 2PO5A 3L0PA 4M4SA 3ILSA 2J48A 3OIVA 5JJIA 2OZEA 2VZ0A 3ZQUA 3SZGA 1YDWA 1HR0B 2OHHA 2F8SA 4DCUA 2X41A 4MP6A 1CDZA 1HSOA 5EEHA 1WSWA 3W78A 2QMZA 2QUHA 3H13A 2V3VA 1OW3B 3EG9A 4YONB 4XYGA 3OD5A 1V8OA 2A86A 5K8JB 2EFDB 1JN0A 3GRUA 2FUKA 3BTVA 3TMKA 16PKA 2O5RA 5AHXA 3FTFA 4WBNA 4ML3A 2F1IA 4CKBA 1E9CA 1SHTX 1UDWA 2GBIA 2XGMA 5JW6A 1XTRA 3SI7A 3VPSA 1PGQA 3CPHA 3EOZA 2YDXA 3WTCA 4I1IA 4A27A 3MJDA 4PYMA 4RKFA 4BX2A 5EYPB 1WIWA 2CXRA 3UVEA 4WINA 3ZQKA 3ZI0A 2XUZA 5LJIA 4GEKA 1XCLA 3DEFA 1KIAA 1M8PA 2QTTA 3HA3A 1XP5A 3OQBA 5I9IA 5LNK1 4KFUA 4J7AA 2II6A 3IB6A 1DG1G 1DWQA 1Z0KA 4WBNB 2NTEA 3DDNA 4G9EA 4N54A 1LZLA 5C4GB 1SUFA 1DUIA 3M8KA 1TVEA 4F93B 5HOQA 2BHNA 3ECSA 3GRAA 2Y3IA 4DABA 2VNAA 3I5YA 3E8XA 2FFAA 3DC2A 2WIAA 3P94A 1BWRA 4L3WA 1U9IA 2BPOA 4PWYA 2OO5C 4MUKA 3TTUA 2HH9A 3VOBA 4B6JA 4IGAA 2JJYA 1IZ8A 2QZZA 3UAVA 1Y42X 2WTNA 3UXMA 2P9HA 2H1CA 1APBA 4M87A 2VQEB 2WSIA 1T9DA 1K5PA 2V8BA 3DZ8A 4G4IA 5GJCA 3D4OA 3WLOA 4CHTA 3OC0A 4DB2A 2O8BA 1VBKA 2AYXA 1OU4A 1HPLA 3F4BA 2W6JD 4GYJA 3PHLA 5F5XA 3ZDFA 1CY0A 4MVJA 2REQB 3LL7A 3P9XA 2PHZA 4LCBA 1J7JA 2F3SA 1E2UA 3JYLA 4OL9A 2BFEB 2BEVB 1BMDA 1ECLA 1OAKA 3WB9A 3J7TA 2H31A 2QRZA 4I4NA 1AIPA 1HG0A 1ODLA 2HLNA 4OQZA 4C7KA 2DXIA 1M8KA 2FWMX 4BCBA 5L8VA 1WZEA 3KEQA 4MPPA 2F9MA 4WXEA 4X3PA 2PQ6A 3AB7A 3NAZA 4PLFA 4B71A 4DIDA 2O8EB 1T4MA 3F9RA 3G7UA 3RARA 4KDEA 1ZWKA 2QRVB 3RHSA 4BBZA 4ZVMA 5DNWA 4HEJA 4YVFA 7AT1A 3F4LA 4LNHA 5KC9A 1L9KA 3AJRA 1J5PA 1FSZA 4RV4A 4BMDA 3JSXA 3SS9X 4KC0A 3O73A 2IYZA 5FRDA 2YC2C 4UQPA 3PU6A 4NK4A 4HPXB 4LG1A 4QC2A 1YXMA 1Q84A 2X8JA 2XUPA 2YFHA 1T0UA 2YJGA 3HXTA 2E4UA 1E62A 3PZRA 2XCUA 4OEHA 1M6EX 2VBCA 4R3UC 1L5QA 3CVVA 1QU2A 5KU1A 1FE8A 1GILA 1QRUA 3TLYA 5JSFA 5ALVA 5EIBD 3K70B 4XQ0A 2VH5R 2G0AA 5BUQA 3DE4X 4ZCLA 4Y6PA 4BQPA 3QPVA 3QZUA 1JEQA 3MT8A 1FNNA 5TRTA 1G2IA 2Z9BA 2ZIAA 4TL9A 5TQJA 2WHXA 1C3LA 4B3RB 4QXRA 3IT2A 1G8JA 3RM3A 2G6TA 3KEFA 1B00A 3DW1X 4WFQA 4BCDA 1R6TA 1CE8A 3PVCA 2JATA 4ITRC 4U9HS 4WFJA 1MXFA 2BMDA 2ZXUA 3F6EX 1WXFA 3DTTA 1NY6A 4I99A 2HSDA 2IJGX 4YECA 2GK7A 2HJHA 2MINA 2IPXA 3KKMA 1RRGA 3UHJA 4BO6A 4BV8A 4AF6A 3VZCA 2FEXA 1VDZA 2I7DA 2X76A 3Q8WA 4UDYX 3DVAA 4ZOAA 3PA6A 1JJVA 3LNTA 2FAXA 2I29A 4D5GA 2UUAB 1IY9A 1F2VA 2XQKA 1E3DA 2WWYA 3RJ9A 4QXAA 1OYYA 1RKBA 2AFVA 1NHGA 1JKJB 5DMHA 3SDBA 3BDIA 1V8ZA 5EMMA 2MINB 1G4UR 2JFZA 1AO0A 1G9XA 1MT3A 4MGZR 3FDXA 1U2EA 1QMPA 3CURA 3CZRA 1VSQA 1LDNA 5ALIA 2UUBB 4UASA 3RRMA 1JFFB 3W5DA 4QREA 1T3LA 1XOIA 4FKBA 1G7CA 2J0SA 2PFGA 1LDBA 1UWCA 1PZMA 4GXTA 4Z8XA 5DYNA 2QNIA 3A26A 4X7BA 1ISIA 2O48X 4OM7A 1OT3A 2QUBA 1REQB 3CH6A 3W8EA 3ZUPA 4CR6A 3L7OA 1A72A 2ZVDA 3B3AA 4HLDA 5LZ7A 4OFXA 5EXXA 2GK3A 1DAHA 3ZI7A 1HYHA 2AH5A 4US0R 4I4TF 4KE7A 1LA2A 2AX3A 3AI3A 3GDFA 4HQOA 1YDEA 4YP1A 4Y1GA 2JFYA 3V7YA 1XD9A 1P2SA 1IRXA 4RGBA 1J2RA 1W8IA 1ZMBA 2HJGA 1D1TA 4RD4A 3PJRA 4P34A 2CHQA 3KKKA 1IK4A 1H2FA 3K1ZA 1GZUA 4QTZA 1CETA 5D84A 3IIMA 3WDMA 1TM2A 3NPMA 1KNQA 3RVKA 3EIQA 5K0CA 2PTGA 4FMDB 3EPLA 4LYYA 4YAEA 1NFQA 1CUDA 3SKYA 1Y1LA 1FEZA 5CA1F 5TMPA 1CYDA 5KNDH 2Z9DA 5AXAA 5I7VA 5G0SA 4BV9A 5B1SA 3V55A 4KXNA 1GDHA 3NORA 1C1DA 2VDVE 5AVXA 1GGHA 2B34A 1CU1A 2I9KA 4UHBA 5JNWA 2VF4X 5KCZA 3KQKA 3BWXA 4IDDA 3DT8A 1UBRS 4RK6A 1RAFA 4YMWA 1JDUA 2IOFA 4OLJA 2VOJA 4UFOA 2CMDA 3OZFA 5E1DA 4YUYA 4TYWA 3OD1A 2FMIA 4G1MB 2ZRFA 3BL5A 5KNCH 2H9YA 2QSZA 1BQEA 4OHUA 1NC3A 4NOLA 3KWLA 1MO6A 1TM5E 2ZSDA 3DZDA 3O2JA 4DMHA 3V46A 4S05A 4N0PA 4GVLA 2PANA 1C1YA 1SU6A 3E8SA 4E2XA 2DQSA 4IXMA 2C77A 2IQIA 3LRXA 1E2NA 2VZLA 2F43A 3N8IA 3L7NA 1ONOA 3L8CA 3N2IA 1SPXA 1K2VN 2FXVA 1GPH1 4C14A 1IXYA 4UNQA 1M74A 4HDRA 3IUSA 4GU5A 4AKIA 3OPQA 4EYSA 3CUSA 3HB1A 4DTIA 1HDZA 1OA1A 3Q7QA 4EF4A 5L3QA 2NSDA 2C04A 3UMJA 1JHUA 2HDNB 1X7GA 4HRVA 4HN4B 2QMUA 4LDPA 4BN4A 2IEGA 2Z4RA 4G65A 1JHDA 1EDDA 2KJQA 1R0YA 2O2IA 1FW6A 2BGTA 5HILA 4Y2XA 4R41A 4KXFB 4ZAWA 1VOTA 1U3VA 2A78A 4HDRB 1QKKA 2A0WA 3B8EA 1KO5A 4JQSA 3IQXA 1JPJA 2ADOA 3FYCA 2OZLB 2CSXA 2GJKA 2CVFA 2W2XA 5EJEA 1M75A 1VL0A 2BLNA 1O8CA 3TRKA 3A3OA 2FZWA 2N1BA 4RPHA 5KJEA 5KNBA 3R7DA 1DBQA 3MZ0A 2MYTA 1JI0A 1H1LA 2IPOA 3HHPA 4F6RB 4LJ8A 4I4TB 5D3QA 2Z8YM 1RW4A 3AX6A 1TW3A 1LDMA 3HRHA 4B33A 2P6OA 3ZYZA 821PA 2G70A 4KRGA 4TYNA 4WJKB 1PJTA 2PWPA 2O5EA 1EFCA 1VMKA 5JWRA 3C6ZA 3PE4A 1OXKB 2MSWA 3A9SA 3PRYA 2I62A 4LBWA 1H1LB 5ELLA 1T36A 2ILVA 2NSJA 2VOEA 5K09A 5HP4A 1RYZA 1OAOC 4R81A 3U7JA 3LD9A 3P0IA 4L78A 3IYLW 3TCNA 2N9UA 3KU4A 5CA1B 1TGVA 2IY7A 2YFQA 3MIIA 4IXNA 1XTKA 3KJNA 4UM8B 3I1YA 5FPSA 3GUZA 4D02A 4YV7A 2PG3A 2ZYUX 5DXJA 3BPSA 2GF2A 3T5MA 1JG7A 4B17A 3FUVA 1CS4C 5KJFA 1YBMA 4MV5A 1LK5A 3DHVA 4WBXC 5EPEA 3WYFA 1F20A 3R40A 3ZZTA 1XDSA 4U6SA 2H11A 2NP7A 5TB5A 4XXHA 2M6KA 4FZRA 2FFHA 3Q8KA 5FL7A 2EWWA 2W6IA 4FIZA 1L0BA 5DH9A 3RPEA 3RBXA 4P7KA 4KRYA 4JI3B 2OG2A 3RUPA 3W5BA 2CHGA 1Y81A 1P0PA 3CLSC 4K8OA 5DI9A 5K6RA 2XTZA 1LTHR 3FWZA 3FFTA 3QYAA 4LPSA 4TMVA 4U2FA 1A8UA 2CDRA 2RJNA 2RD2A 3RYIA 4MR8A 1EINA 5T57A 2VT7A 5G0UA 4L4UA 2Y1EA 1USKA 2Z8YA 5IDWA 4C87A 3YASA 3H86A 4I5EA 2NUAB 4D2IA 1R37A 2VDNB 1XELA 3BCSA 5MGNA 4AJLA 1I4WA 2AX4A 3ZZUA 1Z5ZA 4UULA 3NHKA 4E07A 1XTJA 1EWKA 3SX2A 4C1NA 2V0GA 2W71A 3W06A 3PLRA 4U0KA 4D9BA 1T2AA 2B35A 3MCAA 3TLGB 3IEKA 1NXPA 4US2R 4ASUA 1NN1A 1XNHA 4MULA 3FJOA 3OE5A 4N82A 3WNVA 1KYWA 1K8XB 2R62A 3B2NA 2PAFA 3DVQX 3DV2A 3GG2A 4OV6B 4EBBA 9ABPA 5P21A 1PS8A 5FUMA 5JEDA 3PGKA 2CYBA 3A6ZA 3DKIA 4LXUA 2ORWA 3ZOZA 2GPTA 2AXQA 2IBMA 3WFJA 2IXDA 5FNVA 2QLLA 5G0VA 5FI5A 3WWDA 2YWXA 1XKTA 2FGJA 3KWFA 2BEWA 1R5BA 5GGYA 4C76A 5I8WA 4XYLA 5LD2B 1TNDA 3HCAA 3KKNA 4B3BA 3S8YA 5B4VA 1DCTA 3N8NA 3WAGA 1FSGA 4B40A 5LQAA 3IQWA 2L18A 5E6RB 2PH3A 3GX1A 3G0GA 2Z5VA 3AEXA 3HL0A 4DCSA 4ERNA 1SXJB 2GJ8A 1UBGA 1GG5A 3BORA 2Q8QA 3NEPX 1X7HA 1UWLA 3O91A 4NJEA 3RSLA 3V3TA 2D2FA 2E5FA 1TQ8A 1YZFA 2YUIA 5BXQC 5LQKA 3BKXA 3PPVA 1ATIA 1HE8B 3FTCA 1ESMA 2BJHA 4KXWA 4REOA 1QVZA 1YZYA 2PWZA 3CKYA 3I4LA 2VATA 5DCWA 3LT4A 3IBFA 1JDJA 2YMMA 2P69A 1XFDA 3ZHSA 4Z86A 2V7PA 4JP8A 4R5MA 2L17A 3T7TA 2QLMA 4Q9NA 1B0PA 4JLWA 1RRMA 3QKIA 5BO5A 5K3DA 1BFKA 1V9SA 4OAPA 1B1CA 1MENA 5I7UA 3ZD8A 3VVMA 1TM3E 2YNMD 4GE3A 1QQ7A 3ITNA 5ABPA 3P4XA 4P3KA 721PA 3MS2A 1ZUWA 1K7YA 1SKBA 3S99A 4U3JA 4WT7A 5CB0A 2FMUA 2FR8A 4GLBA 3UWSA 2IP4A 5TARA 1LQTA 1SUSA 4DMRA 3ZHYA 3DOOA 4X1KA 2O59A 4UU8A 5DWDA 5JAZA 3DHYA 3BEOA 3RADC 4E4TA 1ADCA 2I8AA 2ZTHA 2N47A 1ECGA 4NU8X 5FORA 2R7AA 5T6BA 4ZOLF 5K4HA 2D0OB 3LECA 4DSTA 3IODA 3FFWA 4F60A 3PNVA 3ZNQA 3UMMA 4R1TA 2J7PD 1TZMA 4KGZA 4XKJA 4HAIA 3RSCA 1GAWA 2P30A 1G2OA 2IE0A 2NG1A 3C6YA 3DZGA 1L5OA 4QD3A 1RWNA 1RPJA 4YBZA 5BWMA 1LTKA 3RCBA 3A4MA 3PDUA 3C14C 1IN7A 1JA0A 3OX4A 4K9NA 1OX6A 5DULA 3RC9A 1G21B 3T5GA 1ID8A 4JI0B 1KZGB 2IRWA 1B41A 2NT3A 4HDNA 1PYOA 5BSUA 3U31A 3BHJA 1T8WA 2C4NA 4K8RB 4KUHA 2ZSIA 1W36D 1TEHA 3QI7A 2ZEJA 4C4SA 3GDOA 1V9CA 5HKLA 3IIJA 3I83A 5IEBA 2Y8EA 3SJ7A 1ZK4A 2LNDA 3DXFA 3H2KA 2NAPA 1ZKMA 1U94A 4ZCPA 2GEUA 3GPLA 1TCVA 2CF6A 3CF4A 1AS3A 2IYNA 2YS6A 2IXFA 1O9BA 1XEXB 2H00A 3QNWA 1MOSA 4ZVUA 4MWSA 3WGLA 2VXOA 4QPNA 3W2HA 5JATA 3TX6A 2EKBA 5G40A 5CLIA 4PFKA 3JQAD 2QLFA 1C8KA 2HKIA 2ZIXA 3U16A 4NS1A 5CAEA 1C3OA 4TX1A 1GA1A 1CZOA 1NZJA 1T3SA 1YI1A 3A6HA 2W2TA 4IIYA 1D09A 2EARA 4CT4B 2XKBA 1Z6PA 4WXYB 1X7ZB 2R6GA 3DB1A 3KPYA 3TNJA 3UGTA 1K8RA 5BV8A 2A0YA 3O90A 4RNCA 1Z0IA 2IU0A 4BVJA 1ZONA 1A76A 3LUGA 3QPUA 5AKIA 1NKSA 4C78A 1L4NA 5DGIA 4A91A 1NP6A 1XL0A 1M73E 1NVXQ 3FNEA 4RCZA 5DI3A 4LVOA 4OPMA 4NJMA 5CAEB 4NBNA 4DCGA 4N12A 3PGXA 1WMSA 2ZAYA 1IOLA 2GETA 3VM6A 2R1ZA 4L3VA 2GAAA 4M1WA 3NKVA 3TL3A 4ZOLA 3FJ1A 4CLRB 4ZEVA 2SKDA 1TAQA 2PKCA 3BH0A 3H5VA 1W73A 3VA7A 1SVKA 3EODA 4HAWA 4BX0A 1JLHA 1XVLA 5FWYA 5G4KA 3G1UA 4F92B 1N3LA 4MGIR 3F6YA 4YUZA 4KKVA 5ICFA 2JDIA 4BFUA 1I3LA 1GOTA 3AYZB 3EZXA 3BF7A 3FE2A 5B36A 1T5IA 2DFVA 1SXHA 4WEOA 3BXEA 4Q9JA 4ZOLB 4RMJA 5DN6D 5HKAA 4Y30A 1NZFA 4EHJA 3AL0C 1XZKA 3VKWA 3HZRA 4V03A 1PHPA 3A1CA 3EIXA 3VHLB 4B76A 5JXHA 1YJBA 1K8YB 1BEZA 1TTHA 2HIHA 3B51X 5TJHA 1J9GA 1GZ6A 1RS0A 1RKQA 1XVTA 1BTOA 1MO3A 5A4FS 2GAFA 2WWHA 3LQ4A 4N0EA 1WHSA 4X1IA 3T3IA 2HZ7A 5DM0A 1XLTA 2V5UA 1UBTS 1MV5A 2ZBGA 1F2UA 3KJEA 4IOJA 4XOUA 4XOIA 4UW9A 4XB1A 5B7PA 3EK2A 3ZXUB 3O8DA 2FEPA 4X8MA 3FRJA 1F8YA 4OK6A 4XM0A 1Y8QA 3LVQE 4URZR 3ENVA 4CFSA 1NI3A 5JD4A 5CVDA 1UXHA 1JYEA 2NO4A 4NQZA 1PL6A 4EA9A 1JQEA 4C29A 1PWYE 3DEYX 1F2UB 1TKBA 1U80A 2Z5FA 3KR1A 4HDOB 4LQ4A 3M4XA 3ZKWA 2R751 3TQIA 4C04A 4GGPA 1NM5C 4FYVA 1Z88A 4LJ4A 3UT5A 1CX9B 5AHWA 5BORA 1XMXA 1CUCA 1DTSA 2ZI6A 3G2JA 1YB5A 4KU4A 4P3PA 3WGNA 2ZUEA 4L7QA 3IOYA 1ZI8A 3SYTA 3FKJA 3PI7A 4LXTA 1EBBA 3DEHA 4M7OA 2P3OA 3ZKWB 4JI2B 4OHCA 3VDMA 4KQGA 5IF9A 3HUUA 1FP4B 3DBHA 3UT5B 4C5AA 2EVWX 1STOA 3H1EA 3DFMA 4G63A 1C4KA 4KSBA 4C2AA 2AKAB 2H2IA 4PHCA 1U8XX 4GX2A 4NZOA 4WY2A 1M7BA 3AR6A 3IURA 3L43A 3IIKA 1JEAA 2Z4SA 4E08A 1SD1A 3BL6A 3KXPA 4F2DA 4DBLE 5AKKA 5FPKA 2AEFA 1IZYA 1G8PA 4Q1CA 4KVGA 2B1QA 4ZAVA 2R3SA 4D3FA 3ZU2A 1VLQA 5FOWA 1P5ZB 3GEBA 1N9GA 2RHRA 1NKTA 2RIPA 3SX4A 4UDNA 2H2AA 1SURA 2PU5A 3LVRE 4IDFA 4IHAA 5TGTA 4EPYA 1E2DA 2OWDA 2ZXFA 5EOVA 2PMFA 3KYIB 3O8LA 3GFBA 2ES4A 4M9QA 2NUPA 4UPEA 4EI8A 2BHSA 2ACWA 1W94A 2RAVA 1T0IA 3KEMA 4A15A 1PR0A 1XNRB 2WVGA 2VSQA 2ZU0C 1RI1A 1CWUA 4AKTA 2GARA 1K66A 2RHOA 2WPDD 1IB6A 3NOQA 3ZHVA 1FLNA 2NSYA 5K8TA 1H4TA 2BDTA 4TSRA 1ZUNA 4GM0A 2A4KA 2NUPB 5KAMA 5G3YA 1GV0A 4LSMA 1S96A 4F0JA 5JTUA 3I58A 4ALMA 5BOVA 3ZXIA 2NAFA 5G3ZA 1MZPA 1U1DA 3HJCA 3NHSA 3PNYA 2FX3A 4BEWA 4QT0A 1QF6A 1TD9A 2W6JA 2GN2A 3NWJA 3K5HA 3KZ1E 3KTAA 1DQNA 3BFPA 2I67A 3SM3A 1GCIA 4NCIA 2OY0A 4LYAA 5CH5A 1P6UA 2IHUA 4D9KA 1OB2A 3OCZA 1H0RA 1NRXA 1OLOA 3QM1A 2GYVA 5CPFA 4Z0PA 4BNFA 2WKRA 2JH8A 2VDRB 1RQPA 4MB6A 3SLKA 3PQ8A 2Q1TA 3ETGA 4QULA 4U2GA 1T8UA 1H22A 2DFLA 4WZAB 4EMTA 1V7PC 1TKCA 2OFWA 4C08A 3OJOA 3T7SA 4J29A 3B1KA 1ISSA 1OMOA 3ANNA 5FBRB 4QODA 3U7HB 1SC9A 2REBA 3D6AA 4DCPA 4DSNA 2ZYAA 4HP8A 5J40A 3I8SA 4JNCA 5FDFA 3G88A 1EP1B 1BVYF 1G64A 3RRBA 3RFVA 3IP7A 4Z6KA 2OV8A 3A8TA 1L7NA 1GN8A 1LDEA 1UAYA 4I46A 3RSQA 2IPMA 5CVCA 4DVJA 2XVZA 1HMYA 2EBUA 3PJEA 1S89A 4QDXA 5ALDA 2Y2UA 1E5VA 2P2SA 2MMCA 4KYTA 1VSBA 4TVBA 2EHJA 3R44A 1QZUA 4YP5A 1NVKA 3HEMA 1RI4A 2WKSA 3ZV7A 2NVBA 3L5OA 1AHNA 1T10A 2QU8A 1I01A 2QMQA 1XCPA 5E6SB 4M6WA 3EPPA 5BW8A 4PLPA 5JARA 3EWAA 3MRVA 3Q8LA 2BZ0A 3ES9A 1GQQA 2KYRA 4LZZA 3ZE7A 5EJ7A 3UJBA 4F1KA 3PFGA 3V2UA 1Z68A 4IIFA 1PUJA 3WWYA 4WNCA 3TG8A 4RK7A 2E1RA 3RTAA 2HCTA 3PEWA 3HKBB 3R0ZA 4FX2A 4Z53A 4IO1A 5AJZA 3OCCA 4CG1A 1NOIA 2ZWOA 2JAXA 3BFJA 5IXJA 2RGYA 1CY1A 3AQIA 8AT1A 4O3MA 4HNGA 1D5CA 2JI4A 3LGAA 2D4AA 4TT8A 2EOAA 2ZQYA 3DOCA 3IT0A 4M9ZA 3WGMA 4OXYA 3FUTA 3EARA 3EVDA 4PQRA 1LK0A 1D7OA 1K7EB 2AHOA 1KO1A 2C96A 5KMGB 1DP4A 4YLYA 3E15A 4BFCA 1XD2B 3C45A 5E6UA 3T9EA 4DB4A 2VHXA 4LF5B 5T4HA 2XDQA 2ZSFA 2B82A 2FN4A 4TV9B 4KACA 2IW3A 2C03A 3AILA 4P3XA 4H4DA 1KSJA 3ICOA 1A8PA 3IGFA 4DWWA 5IULC 5GADl 4CUKA 5K4GA 5JG7A 1E7YA 2POQX 3G9TA 2FCAA 3P20A 5GZ6A 1RZ3A 4DA4A 3PSAA 3VSDA 5JCOC 4OYLA 1BMTA 1DAPA 5HS4A 1M3SA 4N47A 1XFAA 2F17A 2JLVA 2IZ6A 3FM9A 2ORVA 3ICWA 3QXCA 1P18A 3CUKA 1D7AA 1FBTA 2HA5A 1HG1A 4TMTA 1NJ8A 2QN3A 5GP1A 1C0EA 2R48A 3M6AA 3PEYA 1D2RA 1QK3A 4JIGA 3IELA 1KQ3A 3ZHBA 4NZNA 4BEBA 3T1QA 2WSBA 4H77A 2QTRA 4Z7JA 2YV4A 2WY2D 3C3JA 1P4RA 3LY7A 3MTEA 4LC1A 4TLCA 1TM4E 1Y1RA 2XODA 4R2HA 2BE9A 5DX0A 3L8EA 1Z6YA 2Y1DA 1HF3A 2OBBA 1U0LA 2R4UA 3N2GA 3Q3JB 5KX5F 4PGFA 2HNAA 3FTPA 5IBRA 4F86A 2JG3A 2P5UA 1LEHA 1KI3A 2C4MA 3IHWA 2P7HA 4V39A 3KYJB 2QM7A 4F3NA 1SD5A 4ZVRA 1QS0A 2EZ4A 3DB2A 3DKKA 4BLWA 4I3HA 2H85A 4J49A 3KQPA 5GVRA 3WKAA 2GO1A 3ABRB 3DHEA 3LL4A 4IJ5A 1NVWQ 4LHSA 3WLSA 4KR7A 4S1NA 3UXYA 2LR0A 3M6FA 4RM2A 4BLUA 3N2GB 1UMBB 1I13A 2I4LA 4RM3A 4DSUA 2Q0HA 1R8XA 2HSJA 5IX8A 3I9NA 3FG9A 4RVHA 1DRJA 1YI0A 2E4YA 2ZITA 3IJRA 3GVXA 3O4VA 4GNKA 1B0AA 2WSYB 5IH3A 5MGBA 2OBXA 1J0AA 4JWTA 3S1AA 1OTXA 5FBVB 3R8XA 1W96A 1M1YE 2E4XA 4K2HA 3L7JA 5AI0A 4EELA 4N9WA 1WAMA 3PKJA 1N6LA 1TOAA 1ZISA 3ELYA 4QPJC 5JT1A 4DV2B 3ZIAA 5JPDA 4L73A 2YIDA 3IERA 1G59A 2Y76A 2GKSA 1EX6A 5FO0A 1XSEA 2WWFA 2QA5A 2ZDHA 3A9VA 3HUEA 4G8JA 2OCLA 1QHSA 4KQIA 4YRLA 4PYKA 2IIQA 4JR2A 5TS3A 3H16A 4XDYA 1YB1A 3S1AB 1USUA 3AHCA 4HYTA