2XVXA

Cobalt chelatase cbik (periplasmatic) from desulvobrio vulgaris hildenborough (native)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
262
structure length
262
Chain Sequence
QKTGILLVAFGTSVEEARPALDKMGDRVRAAHPDIPVRWAYTAKMIRAKLRAEGIAAPSPAEALAGMAEEGFTHVAVQSLHTIPGEEFHGLLETAHAFQGLPKGLTRVSVGLPLIGTTADAEAVAEALVASLPADRKPGEPVVFMGHGTPHPADICYPGLQYYLWRLDPDLLVGTVEGSPSFDNVMAELDVRKAKRVWLMPLMAVAGDHARNDMAGDEDDSWTSQLARRGIEAKPVLHGTAESDAVAAIWLRHLDDALARLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHELATASE, PUTATIVE
publication title Evolution in a Family of Chelatases Facilitated by the Introduction of Active Site Asymmetry and Protein Oligomerization.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Metal binding protein
total genus 97
structure length 262
sequence length 262
ec nomenclature ec 4.99.1.3: Sirohydrochlorin cobaltochelatase.
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06180 CbiK Cobalt chelatase (CbiK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xvxA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xvxA02
2JH3A 3M4ZA 4MK4A 2PNJA 2DJ5A 3HCNA 3LYHA 2XWPA 4KMMA 4F4DA 2Q2NA 4CCSA 2HREA 2PO7A 2XVYA 1L8XA 2AC2A 2C8JA 1C9EA 3HCRA 3HCPA 1N0IA 2H1WA 2AC4A 2HK6A 2Q3JA 1LD3A 2QD2A 1C1HA 3HCOA 2HRCA 2QD1A 2QD4A 3AQIA 1LBQA 1AK1A 3GOQA 1TJNA 4KLCA 2PO5A 2XWQA 4KLAA 1HRKA 4KLRA 1QGOA 2H1VA 2XVXA 2Q2OA 2QD5A 2QD3A 2XVZA 2XWSA 3W1WA 1DOZA
chains in the Genus database with same CATH superfamily
2JFVA 1JU4A 3F6EX 3O90A 4KO3S 1C2TA 2Z8YA 3MUNA 1RLOA 3WGZA 4BP3A 5B2EA 1ZVKA 1TKAA 1R4ZA 4LVNA 3WFJA 1XMQB 1EXWA 3PHGA 3KL4A 1BS2A 4G1BA 1PJTA 1YA6A 3JQPA 1PNOA 4QWMA 3RKSA 2XYPA 2BLLA 3M83A 4DB4A 1M1NB 2OENG 4TS3A 2C77A 5DTQA 1YIDA 4ZQFA 3PDJA 5GWXA 3W2TA 3B8EA 3UK2A 4J4BA 1K6MA 4MTLA 4RQAA 3ZK7A 4ARZB 3RAJA 1E3MA 2FGKA 3I05A 4TYQA 1E1DA 3BCHA 2CL5A 2QN2A 3Q9NA 3DBHB 2G07A 1VC2A 3S8MA 2O8DB 3LZ6A 4KUGA 2PUEA 3DZKA 4CLOA 2NYRA 4A92A 2VKTA 3CLSD 3DF7A 3QEAZ 1UINA 3C6ZA 3S27A 3U60B 4HFNA 2XOXA 2O0JA 3JVVA 4CKXA 2OXRA 4QO8A 1JKMA 1KI9A 4HS9A 4X24A 2GO1A 1F8FA 2YZMA 4FB5A 3W5CA 4IRXA 3V1UA 4D81A 3V7YA 5GY7A 5GV7A 1A5SB 3QA3E 5T7BA 1BFKA 2A5FA 4XFKA 4NEGA 2BMAA 4GC9A 3KG2A 3V7WA 1VL6A 1WEHA 5T5QA 3ZU6A 2ZUUA 1SVWA 3PRJA 2Z5FA 3IIIA 2ZTMA 1OZFA 1U9JA 5FUWA 4C01A 1XQWA 3GT7A 2HNBA 1ZJ4A 3FFAA 4O4IB 1C0IA 3GL9A 4A7PA 3A6ZA 3DDNA 5B6IA 4RPIA 5CBPB 1OIXA 4WOBA 1C7EA 4WE3A 2HBRA 4R8LA 1AQNA 3A04A 3H5AA 3ISTA 3ZE8A 4AMBA 3PHHA 3AHFA 4RKYA 1OI3A 4YV7A 3EPKA 2VP5A 4NMWA 3C5CA 4QAQA 1L7EA 3U49A 4NG4A 4E5DA 1US8A 4UHHA 5AI0A 2VJMA 4RD3A 2GETA 1YI0A 3EZXA 4YJ3B 3WK4A 5JXIA 3AM1A 2IPNA 4RZUA 1PZGA 4OLJA 4IHKA 4A9AA 3CA8A 1GPAA 1EIZA 4BO7A 2Q1UA 3SEFA 4LDNA 1XEWX 2IU3A 3AR3A 3LKVA 5HKAA 3GLFB 1E66A 1P1CA 5BV8A 4L28A 2D0OB 5G0SA 1JLHA 3H11A 4LMBA 1TIBA 3K70B 3GFRA 5PNTA 1P80A 3L5OA 4ACAA 2P6PA 4BNWA 3U5TA 1XHFA 3I12A 4PLCA 1ARZA 2PS1A 1CV2A 2DH6A 3C1TA 1GLVA 3FWZA 3JPWA 3MINB 2FW6A 2QY6A 3OSZA 3TAHA 5JAMA 1H9BA 3I9V6 3TPFA 1P2DA 4ZA2A 3DLAA 4B2YA 2WOJA 721PA 2P35A 2ODBA 2Q21A 1JT9A 3OKCA 1MNQA 3B52X 3FZGA 4JZYA 3JQAD 4TKUA 5EE5B 2J3JA 5DN6D 1IK6A 1N2HA 2GHTA 4JYBA 2L69A 1ZUHA 3OM1A 4CLDA 2Z6UA 3OE5A 4G41A 8LDHA 4XH9B 4LZJA 3ANLA 4LUCA 4LYGA 4QUDA 1R5JA 1SVKA 1U9YA 4JI0B 4AY2A 2F1OA 3PEFA 4LHXA 2IHBA 3ZEAA 2ZSAA 4QM6A 5KJFA 1A8HA 4N7JA 1XZQA 1YB6A 2XDQA 5LB2A 1TAHA 2IY7A 3OP1A 2AQIA 2HXYA 2YYYA 4EHKA 4EJSA 5K99A 1G0OA 3PXAA 4G5RA 1RFLA 2ZB7A 4G9EA 2CD9A 2QZJA 5DX1A 3BD6A 1SHTX 1U2DC 3K0BA 1HZJA 1NYQA 1U1EA 2PM8A 2RHJA 2VDQB 3DQPA 3N74A 3AKZA 4KL8S 1JB9A 5C31A 2H5EA 3CXRA 4G4GA 1P6QA 4XUDA 4RVOA 3VHQA 3IT0A 4DNFA 2HEIA 1VM6A 1DXHA 3HU2A 2KJQA 4L3OA 1J9EA 3COVA 3O4HA 4G65A 3RO7A 3VUFA 4R8KA 1JG4A 3W04A 4N5DA 3I61A 2C3MA 1CTQA 1G8FA 3MIIA 5JR3A 2PH3A 1U31A 4FCVA 2IUUA 3WWDA 2WSMA 3HA3A 1NLYA 2H29A 3LDUA 2DFNA 1E3SA 3OM9A 2QUHA 4YQEA 4JU8A 1VMAA 2ZB3A 1TCAA 1QKKA 3A70A 2FHPA 2GKOA 3C7AA 4MQEA 3THYA 5HQTA 3IP7A 3ZEIA 3HJAA 3VHLB 1DC8A 3OJFA 3KR2A 5HQJA 1PJAA 3QLTA 3T94A 3TXYA 2QP9X 2C1EA 3U4DA 4FFBA 3UXEA 3HADA 5AVOA 4V3CA 5K4AA 2IKSA 4UBIA 3Q3GE 4Q9IA 3UJ7A 3RJ5A 3SU8A 1LU9A 4EY5A 2EJCA 3MWJA 1XQ6A 4I55A 121PA 1J00A 3SHOA 4EJSC 5C4IA 3DLBA 3IDQA 1IN4A 3QF7A 1VJGA 5CITA 1H9CA 5CDFA 1BRTA 1EFTA 2XNKA 3E18A 4GX1A 4EARA 1RWVA 3UPDA 1XZHA 4PBRA 1JQEA 2XD9A 4BGUA 4ZOCA 4DEYA 1Y4DE 1YI8A 3SR3A 3GWGA 3S1AB 1GZDA 3R3HA 1IM5A 1XA3A 5DHPA 2J31A 1KAQA 4D6XA 5EEGA 3HCPA 4PZAA 2IYOA 4U6QA 4F6RB 1JPVA 1OPXA 3DEKA 2JGDB 2HSEA 4NKRA 4QOJA 2JI9A 5SY4A 3CGWA 3IS3A 2QAIA 4G9BA 3F96A 3K32A 4XJTA 3B5IA 5IVDA 2IEZA 1DE0A 5E9JA 4D46A 4RACA 1QO9A 1IHOA 4MCIA 3UJNA 3JRNA 1IU9A 2CLHB 5H0IA 4YDQA 2M6SA 2QJRA 2ZBVA 2ZRDA 1RPNA 1VDZA 2CMHA 4RHXA 1U0NA 1YXMA 4NICA 5M29A 3EY4A 1K8RA 2OK7A 1NI4B 3DHNA 3EWIA 3V1KA 5T4EA 4QEKA 4OM7A 4YJGB 3EFOB 4ZI7B 1EE2A 3TRKA 2AR0A 3ICCA 1D2EA 2FR0A 3G5LA 4YBRA 1AQJA 1E79A 4R84A 1N57A 1K8YB 1XRNA 1NJSA 1KMMA 1TA4A 2PK3A 4NBTA 1DTWA 4IIGA 2FPGA 3MRSA 2VPXA 3R0IA 1PLLA 4A73A 4UOEA 3COJA 2V74B 2IH5A 3SQWA 2DFKB 3MWDB 3TKLA 4OHRA 2WF7A 1GSOA 2AOWA 4AJEA 4EAAA 1WUYA 3LL7A 3OTGA 4DWJA 4JP1A 2I67A 3BSSA 4HGPA 4KQ9A 4M0UA 2R6CA 4DRZA 2VK8A 4OI4A 3EBLA 3GMSA 2JLBA 2H31A 2VEDA 1ABFA 1EM8B 3NAZA 4HXEB 3NVAA 4UDOA 4QUBA 4RESA 1B23P 2PMKA 4V3BA 2CVHA 1XRJA 3THRA 5BNWA 2ZJYA 3VPFA 4NMMA 4M7OA 4BNKA 3T3MB 4W5RA 1TGYA 1VL8A 2VHQA 2QL9A 3VH2A 1H6DA 1ZVJA 3CF6R 1AN9A 3DFIA 3NHFA 3PFHA 4Y2TA 3KLOA 2P5UA 1DAOA 1DQNA 1H2WA 2Q62A 4Y18A 2OBLA 4HN4B 3TVYA 1SQ5A 1NRJB 5IKMA 4XCVA 1SC3A 2GZHA 1KZ4A 4TM7A 2J9YB 4TTVA 5IWCA 3CJQA 3E2PA 1YCGA 4QTZA 3TR6A 2EP5A 1NWCA 2JGMA 4EI8A 3KS9A 3P26A 1ULHA 2DT8A 5HVNA 5BR7A 4PAGA 1O4WA 4TMVA 3RUDA 1EA7A 2ZCJA 1FLVA 1S8FA 2AJCA 4PC1A 4AI6A 3PGXA 2IA5A 3FYHA 3K2QA 5E1OA 3FUXA 4NU0A 1WVIA 3QVOA 5EE1A 1KVUA 2CYCA 1PD0A 2FRXA 4MR8A 1G2IA 1KFJB 3CVXA 2G4LA 1QG6A 3L7OA 4AJPA 1XDWA 2TECE 3L0BA 3MYRA 4OYYA 4HLUA 1OYOA 3M1LA 5IFKA 3OE1A 5DM70 1TIPA 1H6CA 4LJ5A 4D2IA 4IHAA 3RSCA 4H1UA 3AIIA 3LAWA 4FN4A 5KC9A 1AUVA 3QE0A 4DG8A 2C98A 1VP3A 4I4CA 4JYMA 3OKPA 4MHSA 5FUQA 1ZM9A 1UBOS 3BMCA 4AZ3A 2BFAA 4KI0A 2XZOA 4Y1FA 4FD3A 1EWTA 4IIUA 5CX1B 1A9PA 4HGZA 3P4XA 5EWLB 1YAJA 2EEZA 2VF4X 3DTTA 1KWKA 1EJ6A 2ATVA 1QRTA 5LP6B 2JCVA 2X4DA 2VAVA 5F2EA 3TL6A 5J58A 5FOUA 4YRIA 4D6PA 1N1GA 2Z83A 3L4EA 2H1RA 2O9JA 1HURA 3SC3A 1OGYA 2V9CA 4I3HA 3HWRA 2ZRFA 3UB4A 4LNUB 4JI2B 1QHNA 2WPNA 1U4OA 1T36A 1PI3A 2DBYA 1BROA 2SKEA 2YASA 3BXZA 3SE7A 3VZBA 3OCUA 1EGMB 4HDQB 1FS5A 2VTBA 3TF5A 3L7LA 1XMJA 3HCOA 3OZVA 5FDFA 5CHYA 3DEZA 4FNOA 2VJLA 4ZZ1A 1UJCA 1GL3A 3CNQS 1PZHA 2POCA 2E2WA 3OTHA 4TZTA 3EBPA 3AF2A 4JJ8A 4IHQA 4JQSA 4QLOA 3ZDCA 3CX7A 3HYLA 5IZ4A 4BMPB 3RYCA 1OLXB 2F3RA 3V33A 1OYWA 4L16A 1GUDA 2GD6A 3EZ2A 5FD8A 3ZWNA 1N2GA 4YAEA 5DLQC 2WKSA 2IRWA 1XROA 3TZQA 2VIIA 1N2OA 3GJ8A 2ID4A 3SC4A 2YJGA 1QGED 2P3SA 2CE7A 2REXB 1J25A 4RA9B 2P6UA 4XRGA 3K9QO 5A5EA 3UT5A 4G97A 3OX1A 1NU8A 3VNSA 3OLYA 3NU1A 1ETUA 4CEIB 4LRUA 4C0QC 2HCFA 3Q12A 3R7NA 3Q2OA 4Y2YA 3C7CB 3QPVA 3ZV7A 2A1UA 4MQBA 3HUUA 4GVXA 1AKMA 5CA1F 2KX7A 1JG7A 1ZG3A 2FZKA 2P9JA 2YHBA 4L7QA 1NHWA 2BGMA 3BIXA 3MB5A 3GUZA 4BECA 3EZ6A 3EIXA 5REQA 5FUXA 3V4VB 4HB3A 3MMXA 3N2YA 1N6PA 3HI4A 3EARA 1LVUA 3NORA 5JMWA 3W8DA 4TMYA 1LBIA 4U7JA 4FIZA 4KWCA 3GHYA 4Q15A 3RQSA 4DPKA 4PNEA 1G9XA 1UZUA 3LKDA 3QEMA 3JTMA 4M9CA 5JANA 1I14A 4FILA 3BERA 4PC6A 2RHLA 4RZXA 3VNQA 2O2DA 3WB9A 4CKZA 3GB9A 1ULZA 3KOXA 2BR3A 3NM6B 4B85A 1WWKA 5EMLA 1N0VC 4AG3A 4L6IA 2X0EA 1UIRA 1SC6A 1NW7A 4K87A 3ZJTA 3MWEB 1EFPB 1GCGA 2B4KA 2AQHA 2J85A 3DO5A 2GBCA 3PEEA 1TUBB 2EWWA 2Z95A 5EIEA 2CMGA 3SSAA 1CY6A 2IUTA 2A5GA 2PX2A 3CR3C 4WX2B 2FX2A 4ZJUA 3OEEA 1KI3A 5HMLA 2Z2IA 3FWPA 3URMA 1A4XA 1QTNA 4IS2A 2HSGA 5SY6A 3AR7A 1D03A 1JR3A 1B8PA 3ZWBA 3VA7A 3CVVA 1ZR2A 4G0QA 1O0BA 3N86A 5F33A 2GBIA 2VHZA 3AEZA 4MVJG 2XTZA 1ZGHA 2WINI 4MVWA 5JWHA 4C4PA 2UUOA 2Z56A 1HTWA 2W6QA 5BSWA 3N8NA 4MIOA 1VPLA 5KU7A 1BAPA 1LRJA 4GM0A 4J0CA 1QZZA 1JSRA 4A16A 5C5CA 3CISA 4KFTA 3U3KA 1YJ5A 4EL5A 3GRYA 1LKZA 4XJVA 1QZ3A 4EEKA 1LNSA 5JASA 3GG9A 5CR9A 3K9LA 1LFAA 1COZA 5FNZA 4OXNA 5AESA 1UBMS 2B30A 2UZ1B 3FG9A 1UBNA 5IZCA 3UMGA 3JQ8A 4IGAA 1HUQA 3I9NA 2AT1A 3RAEC 1ZL0A 1POXA 2FFRA 4EVSA 1KE2A 3N70A 4YMSA 4P5DA 5BQ5A 4UEKA 1ISHA 1EK2A 2CXXA 3T3PB 2L2QA 3ITNA 5AW1A 2TS1A 4DDKA 4GGMX 5K01A 3WQBA 3U26A 1N0HA 4NFLA 2BTEA 1J70A 3LDHA 4R81A 4YWJA 5T57A 2BEJA 3WK9A 1IBKB 1RPJA 4V39A 2R1TB 1C3VA 2E87A 2NTVA 1ND6A 3NBKA 4L4YA 2IIBA 5AW0A 4HNAB 1VA4A 3RYFB 4UPEA 5MHTA 3SX0A 1KJYA 4GF5A 1NRIA 3RHSA 3JAWA 5DEOA 4IDEA 2FDCA 1KC1A 4E31A 4Z3KA 5BQ3A 1LVGA 1DWOA 3F6YA 3OC0A 1JI3A 1UEJA 4V2IA 1QSGA 3UGTA 1XZNA 1VIDA 1CJMA 2EKQA 2VQEB 3PCTA 3II6X 3ZCTA 1WF3A 4LK2A 4LXQA 5AJVB 2CJWA 4UUBA 3F1LA 2EG9A 4M8SA 2CUKA 3B1XA 3VGJA 4B74A 2C7BA 4E70A 4RTOA 1SBQA 4L4SA 1U2GA 5TMEA 2NXWA 2V3CC 1Z2EA 1A8PA 2FN9A 1JR6A 3IR5A 1BHQ1 3NTOA 3P9YA 4WNYA 3TLYA 4F9FA 5IZCC 1W44A 3KKZA 3O03A 4HEJA 3DZHA 4OY3A 2PLAA 5DP2A 5GIOE 3WYBA 4YCJA 1I8TA 1PVOA 3DF9A 2OBYA 3FBWA 4OXQA 2WZQA 3RVLA 5KX5B 4I5IA 4M9ZA 5AK4A 1AC5A 4FIDA 1AUPA 1IXZA 3PD1A 4EO4A 4H77A 3Q15C 1E6CA 1K6JA 1SIWA 1UJ5A 3RW9A 2WIBA 3W5SA 2V9ZA 4IZIA 1DWPA 4YP7A 1P75A 4GVPA 1PQ4A 5AOBA 1CUDA 2QVGA 2R66A 3E3LA 4LJRA 1H5QA 1EQ2A 2NXNA 2WVJA 1O6ZA 4Q9HA 1RAFA 2QYHA 4C78A 4I1IA 1NN0A 2FX3A 3NIWA 1OWOA 4Q1BA 5HS4A 3GLGE 1E18A 5AKLA 6ADHA 2QUBA 3PE4A 4YCDA 4PYIA 2OMEA 4R54A 4G26A 2GEFA 2QZZA 1XTVA 2ZR0A 4M8LA 1LH0A 3DULA 3TFQA 4I8XA 5DK4A 3S1SA 3N1UA 1PFKA 4ZQGA 4XVRA 4UBJA 3MZ0A 4EFNA 1XTIA 2J4CA 3FHOA 4HXFB 1XWIA 4DM4A 3UA3A 3NNSA 3PUYA 1FTNA 2J6HA 1BG6A 2ZJ0A 4FZJA 3S2YA 3WP0A 1MJHA 4MV4A 4ZQHA 4UM5A 3V6MA 3V2GA 1NF9A 1JE0A 5FF9A 3WR5A 4L74A 3A9WA 4DARA 3BN3A 3EQZA 4HN9A 4PRKA 1ABBA 3PFNA 2GSWA 3G6KA 4M7WA 3DONA 4H7FA 2Y4NA 1W30A 4NYIQ 1JW9B 1TZJA 3HCEA 2R2GA 2WT9A 3LX6A 2M9MA 4B81A 5JH7F 3T7AA 5DM1A 2DOKA 4DM7A 3GZ4A 4MULA 4ZCLA 2FMKA 3GCGA 1KJ8A 3BD8A 4REOA 5ALFA 2Q8PA 3LUHA 4A0RA 4H17A 1L8XA 4BNMA 2Y9MB 1N8TA 2AFHE 1W2WB 4Q4HB 2VBFA 5F1KA 5TVKA 2J7KA 3GI1A 4M53A 1M9NA 4M1MA 4TGLA 4RM3A 5MGBA 1N2BA 1UWKA 1ZRNA 2PN1A 4NZNA 3BWYA 4QYXA 4B32A 3CZRA 1ELOA 1UKAA 3LK7A 5TQ0A 3JWPA 3HJHA 3EASA 3QNUA 3LUJA 1BDJA 3Q72A 3MGCA 4RF3A 3P9SA 4OVKA 2AI1A 3PT9A 1CQJB 2WFMA 2IYTA 4XLLA 3IX7A 3IUQA 2R6GA 3C5HA 1ZLXA 4ND6A 4RYDA 4UZEA 1RRPA 3L1JA 1IUPA 2WJ4A 4R2JA 4K05A 4WBNA 3I9KA 2FMTA 2PUGA 2A5DA 1ZK1A 2G7ZA 4FDTA 5JJLA 2VBGA 1AF7A 2DUMA 2QGNA 2WTXA 5FBQB 3DDSA 2CNKA 3BRWA 3KVOA 4HGRA 5D01A 3DEYX 1L5NA 6ABPA 4F2DA 3UHJA 2QR3A 4JKOA 4CMKA 3T7TA 3VR5D 3QUQA 4EJFA 3HYCA 1J09A 1JLKA 1G9TA 2QSYA 2NU6B 4NU6A 3MB8A 2J32A 1L7MA 4KUEA 2I1WA 3KXKA 4R8VA 3WLPA 2CE2X 1IZZA 5B3JA 1SBYA 4EITA 4PPYA 3I9FA 1E79D 3RHFA 1E64A 3U19A 1E3DA 4YIHA 2K2WA 2RMKA 3QJ5A 4IMPA 4IVPA 1WZCA 3F97A 5ALLA 4ZEXA 5JMTA 1GGMA 2WYVA 1RXWA 4D26A 2VHJA 1B0PA 2AZTA 3DC7A 1T5BA 4M54A 2Q4RA 2O2SA 2AZDA 4AQYB 1L4UA 2WNIA 2OL4A 3NBFA 2XF2A 1KJZA 4H7EA 3NAQA 4P53A 1EBBA 5FX2A 5JRJA 1C8VB 4QU9A 3FYCA 4IF4A 4EVRA 1PTJA 1VGQA 2P2DA 5H4HA 1NW5A 2ZT8A 1KYZA 2A9PA 3OPMA 3QEJA 5ES3A 1O8BA 3SEZA 5TEVA 5EXEA 5D3ZA 3NTQA 2C96A 1OY1A 2PY6A 1JWBB 2LIVA 2ERCA 1FOEB 3D64A 4G5OA 5D7BA 4OK5A 1Y9AA 1W2GA 4PHGA 3ZWWA 5KDDA 5CURA 5I5EA 1XAHA 2FMFA 2X0IA 4HNTA 4M2LA 1X1TA 2C4MA 1MJFA 4IFBA 1FQKA 2WY2D 5DX0A 1JJBA 3G02A 3BULA 1A9OA 3TBFA 4BNHA 3TI9A 3LUKA 2G5PA 8ADHA 3G2PA 2GRAA 1YWGO 1ZCAA 2GPTA 3CH4B 3CLHA 3FYUB 1I0ZA 5LU9A 4AP5A 4D79A 4AZSA 4RPGA 3HRIA 3M82A 3QTTA 2DQ4A 2J07A 2EWMA 1RLUA 3VDQA 3NWJA 5C7IO 5KNCH 3JQGA 1D0IA 1RLMA 1WVGA 1CULC 4AZVA 4E5NA 5L9AA 5T4BA 4FMCF 1OI7A 2D2FA 4M22A 3W8RA 5G0TA 3VQTA 1O6GA 2J0QA 3D7NA 2FP4A 1MW8X 3B6JA 4Q93A 1K98A 4PYKA 3T9EA 4PC3A 1SWWA 4F93B 1XF9A 4YI5A 5KMGB 2NWQA 3A4YA 1Z5VA 1MIOB 4OSPA 1MAHA 1UCFA 3UXYA 5LQDA 1EXMA 3IAHA 4TVSA 2QMZA 3C2QA 4J7CA 2GJKA 4F7WA 1X7WB 4DV5B 4KMMA 2ILTA 3I37X 3DD1A 3FMGA 3IERA 2QM7A 3FI0A 3HU1A 4UVHA 4XYEA 5I7AA 4D0GA 1SOVA 1G64A 1X7DA 3O4JA 2JJ8A 4NENB 1T9GR 2FR1A 4E4YA 5I9MA 1A1VA 2XMDA 1MC1A 2NU8B 2C61A 1XQYA 2YJ4A 1F4LA 3VKGA 1Q0HA 1KYYA 4ZVPA 1S5PA 5DNYB 2HCJB 4IDAA 3OZAA 2VPPA 3BE4A 3GVCA 2GM3A 3SHTA 4FSXA 4Q1AA 3CNLA 1YKSA 2I33A 3MWYW 3H83A 2JKYA 2E21A 4RJ2A 4ZVRA 1TJ4A 4B6JA 2C7QA 2WKRA 3I6BA 4LI3X 1GU1A 2OLEA 2KE5A 2WP0A 2NNLD 4FKBA 4CKWA 2WWTA 1FQWA 1FP7A 1M2VA 1F51E 4NPCA 1HQKA 2PRSA 1HMYA 4HX2A 2W2LD 3SHWA 3MJDA 1YVPA 4IO0A 3PR2B 3ENQA 1D8TA 3DO8A 4TMFA 3Q41A 1SBCA 2I6TA 4UD2A 5BT9A 4CG0A 3MJSA 5AUOB 1GWNA 3R4CA 1SBNE 1ECFA 3LX4A 4GI1A 1UMCA 4JX8A 1SIUA 2O8BA 3WQRA 1I2MA 1YMVA 2R44A 3JWHA 5AW5A 3G82C 5TPWB 5KBYA 1RM0A 1LQTA 3IEIA 3BL6A 3R9IA 4L0DA 2F3PA 2HRQA 2ZVPX 4JVLA 2OQVA 4H59A 1ENZA 3QMVA 4BN0A 5G1NA 3WQQA 2DFTA 2RGWA 2NUBA 2HMUA 4NJEB 5HNKA 1IONA 4HGNA 2B35A 2CT8A 1W581 2ZYUX 2OBNA 4IJMA 3NHWA 1FFCA 1NMZA 3P2MA 4R8SA 5AYVA 1P1IA 1P5FA 3VX3A 2G1PA 5K0FA 2PJRA 1T0IA 1UT8A 3GHHA 4NMLA 1RXEA 1J0CA 3EGVA 1PR1A 5FLYA 1I5RA 3TLXA 5ILOA 2O2ZA 1TCBA 4ZZIA 1JHOA 3KTAA 4OREX 3C7TA 2IZ1A 1QS0A 3LO5A 2XQKA 3I8OA 4AUNA 2MU1A 1ORTA 3BEDA 1NRXA 1V4VA 2HK7A 3IE2A 5EPEA 2HGZA 1U0JA 4LOIA 1REQB 3MTIA 2P6NA 2JJ2D 3R24A 4NZYA 3ZGOA 3FOBA 4HP8A 2DZDA 1P2TA 2BFWA 3N3AC 4BLQA 3TBHA 1G38A 3JAMA 1DEAA 1KSHA 1N8KA 1TMYA 1ZCZA 1IYZA 1KDOA 3KCNA 1FX0A 1DQSA 1MB9A 1NXTA 4PIPA 4X6UA 3GVPA 5FEMA 1QO0A 2HO5A 1HT2E 2WFLA 3EE6A 1DIHA 3CZ4A 4LWQA 4TV9A 5F1YA 3SZRA 1PLJA 4HRXA 2SECE 1CEEA 1LXCA 1FVOA 2O8NA 3PC7A 5JG7A 5JLAA 5D3MA 1ES9A 4X3OA 3GLGA 1NBIA 1GGJA 2QJFA 3K8OE 3F5DA 1TCCA 3AUUA 2IUSA 4D8WA 2VWHA 2P9TA 5AM1A 3QMWA 2ASEA 3WADA 1PLKA 4QUHA 1BDMA 3S28A 3E9ZA 4BMXA 4W5WA 3RWBA 1YDMA 2CF6A 4HDNB 4BQQA 1N9ZA 1RRKA 2Q9BA 1CWUA 4RFSB 4JI4B 2AS0A 1VHDA 2YRXA 1SXHA 3H1AA 3H2IA 4NEQA 2RBEA 1T4BA 2A86A 3OFJA 4OKSA 4L4XA 1WMEA 1O5IA 3GJSA 3PYMA 1R6VA 4A4DA 4AY4A 1XPUA 1V96A 1SZJG 3I01M 2H1LA 1ZIXA 1SUWA 1OZHA 1PEDA 1U5CA 2BZ1A 3FPCA 4LDPA 4R2HA 4A23A 4C08A 3MTJA 1ZK4A 2DBVO 1YR2A 3AERB 2PS0A 3JQ7B 5DLPA 6NULA 3NEPX 4WCFC 3UCFA 3GU3A 4BU0A 3DVAA 2VJBA 3ROQA 5B1HA 5LQUA 2VP0A 4KJXA 4XA8A 4PAMA 2JD1A 5HTOA 1LRKA 1OH5A 5IT9A 3FTFA 1NXXA 2AYYA 3H9UA 2J4FA 3SXJA 3VBCA 3KXIA 2IIVA 4KO1S 5K1ZA 2JB9A 5EN4A 1XJ5A 1E61A 3C3KA 4DA4A 2FUNB 3IOBA 4WBNF 3IOMA 1NXOA 3HXKA 5H80A 2HIGA 4PXSA 1YTUA 3VVLA 1VLVA 1Y8AA 2BFCB 3MJ4A 4QATA 4D4HA 1UZNA 3H18A 3RJTA 2GNAA 2CSUA 3RYTC 6PFKA 5G3YA 2OAP1 1XAGA 1ULSA 2VAPA 2V6BA 5AR1A 5HIKA 4PCUA 4RTMA 1FVFA 1F6DA 2GMWA 1E2DA 1H0SA 4E12A 5I48A 5LLDA 4DUYB 1ZI9A 2GZMA 2NO5A 3GJ7A 4QJ5A 4K9KA 4HAIA 5E1DA 3WHLA 2UUAB 1PT7A 4J16A 2NUPA 1EBFA 2W2NA 1NOIA 1KGDA 2VDMB 2V58A 4PVCA 4W1QA 2IS2A 1E2GA 1T1IA 2FEKA 3PZBA 1AO0A 1G4UR 2D74A 2HYDA 2P2YA 2WPDA 3CWZA 4K6GA 2DM6A 2YMQA 3DAPA 3AR5A 1DXOA 1X7XA 4KXXA 4BNTA 1PX2A 4D8VA 2F67A 2IYWA 5HQ3B 4P22A 4R2IA 3DBLB 1AMOA 2X3YA 1I4EB 2GASA 2AR9A 3LFHA 3HZRA 2PQ6A 1NNI1 1JEAA 2I1VB 4MVJH 3WDMA 1TQ8A 1Z0ZA 1ZOIA 3GJQA 3OEWA 4PG4A 5FXMA 2HQBA 5COBA 5KWEA 1GQQA 4IILA 5LVAA 2PSEA 1IXKA 1MN6A 5FEUA 2WQZA 3UMMA 1NLUA 5TDHA 1TF7A 1UBEA 4RLFA 4YXWA 2ZUCA 4DCTA 1COWD 4C4SA 4GSYA 2X1VA 4EVIA 5KYWB 3KSUA 5ISMA 3IJEB 4IX1A 5A5GA 3AF1A 3ESDA 5DM4A 5HFJA 1NVFA 1OT5A 2BT4A 3HBMA 3PL1A 1V71A 4LJAA 3HBLA 2BM0A 4QYIA 1DTSA 4EHJA 1YJQA 1M2EA 1R50A 2YHSA 3BWDD 4LTMA 4Q4AA 4XUEA 4BWGA 5B3LA 2EX0A 2Q4BA 3P0IA 5K51A 2IWRA 1E2JA 1RHQA 1TI7A 3CY6A 4CBVA 5IJ9A 1O0CA 4A8JC 1U11A 3GJ3A 4J7XA 4YJFB 5JZBA 2J08A 3NUQA 2PUBA 1S3IA 4TXLA 4TZKA 4J16C 1J9GA 3TE7A 5JQGB 2ZJ3A 4QEZA 2PKXA 4CTKA 2LIPA 3H5RA 5L4SA 3CONA 1U5BB 1X80B 3MJHA 2JRCA 1BOFA 2ZXFA 5DU2A 4P7FA 1YF3A 4MQ5A 2PGDA 3OTIA 3PD0A 5H3CA 3DEHA 3MMPA 3VTFA 1PR6A 3TPZA 3ZWVA 2FPIA 1Y48E 3KUKA 1LLQA 2PLFA 1SD1A 2IOYA 1EUQA 3G8AA 3TOVA 3N8GA 3MN1A 3LNCA 4E33A 4DJFC 1Z34A 4ZYXA 5E2BA 2OG2A 1KY3A 1X9IA 2ZTLA 3AX6A 1E3LA 3WQSB 2HCBA 1VJ5A 3PHBE 5EVCA 5IBQA 1GTSA 2EHJA 4G5QA 4NOJA 3ODPA 3V8PA 2DCMA 1SG9A 3CRQA 3LYHA 4I4NA 4OHPA 3X1YA 3W6ZA 2HA7A 4BN5A 4GNRA 2G72A 1RPTA 2GCEA 2YIMA 4F3YA 1C1XA 2GSDA 1Y8ZA 1DX4A 3FGPA 3GRPA 3NOVA 2ZYGA 4JHXA 1B0ZA 2OZVA 3DXZA 3FMFA 4LY6A 3ZI7A 3S3TA 3KZMA 1RZRD 3ZWKA 3NDIA 3WOVA 4Z51A 2ONKA 2RHGB 3H1GA 4Y0VA 1T2EA 1WUHS 1R0LA 1P5JA 4KC0A 2FPXA 1S96A 2AQKA 5J5AA 1B0AA 2OQIA 4KO8A 5CYFA 3R74A 3CVOA 4MKRA 3MQ2A 4X90A 4PSKA 3CMMA 3CRZA 4Q4LA 5F2OA 3ER6A 3RS2A 1CRPA 2QPTA 3T3HA 4Z7NB 1Z3IX 1XT6A 3HR7A 1H9AA 4BIIA 1IQUA 4M1WA 3NP7A 3FUCA 4O4HF 5C8XA 5C34B 4MA5A 4PZ9A 5JS1A 2DERA 1D6NA 2O7QA 2XKJE 3GEIA 3NR2A 4MV1A 4X63A 4W5QA 4IEIA 3PI7A 5FL3A 1IFXA 4W9RA 3L4KA 2R00A 3HWX1 4P0TA 4DXHA 1JR2A 2V1XA 1OWLA 3M6LA 2RH4A 4YY3B 1QQTA 3SK0A 4FDAA 2HPZA 4QBTA 2JGNA 3WNVA 2BE7A 4B6PA 3GZNB 4NDNE 5KQPA 3EVNA 5CB0A 4ARVA 2GBPA 5CCEA 2EGHA 1JVSA 4HNVA 3CRMA 2GRJA 2Q45A 4M99A 1BH2A 2WIFA 4MGKR 3OU2A 4FXPA 5F77A 4L5BA 3WHIA 4CZ2A 1YCFA 3QVMA 3PVCA 1VB5A 5JY1A 2ZI3A 4GSKA 1R8YA 1FU7A 2FDRA 2X0KA 4I5DA 5BMOA 5KYUB 4YUVA 3AESA 1ZMBA 3KAQA 3HVRA 1TRKA 4NX2A 1JBQA 4POOA 4ZT7A 1X1DA 1KPIA 1CD5A 2D06A 2GXQA 2NW6A 3KEGA 4MKZA 1WW2A 1FYEA 3E9QA 1E6EA 1KYVA 4E2FA 3BM5A 1RYNA 5DDIP 1T5SA 1YRHA 2BFDB 3WVNA 3F4KA 3JZFA 2D2EA 3D0QA 3FCSB 3GYBA 1K92A 2HRZA 3UMRA 2IHNA 4ZDJA 3PITA 3IDAA 1WS6A 4OHWA 3GH3A 3RKRA 4BQOA 4NK4A 1Y1QA 3HLTA 4U0JA 2NZ8A 4WW0A 3OIUA 3G9UA 4EG1A 3AVVA 5KSYA 1NW8A 1CB0A 1UAGA 2QX6A 3DBRB 3DOJA 4UCWA 1ZNYA 1XRPA 3ZHCA 3OLQA 1YVRA 2O6LA 3TOXA 3SOZA 1C1DA 1Q77A 4DNQA 1U7TA 1Z0FA 5CLHA 5CXXA 4CRWB 2CYAA 1DBIA 1CXZA 4D6YA 3RE1A 5JCJD 2AC4A 2C9ZA 2H4XA 4BX8A 2HK6A 3A3OA 3DE6X 5DNUA 1HZZA 3D7MA 3NC0C 2QYOA 4IEFB 2Q07A 3BQMB 1Z35A 1RYBA 1PDVA 1B0UA 1K5HA 3PUVA 5LBTA 1KVTA 1C3XA 1OX6A 2XADA 4LSGA 1M75A 4J3NA 1MENA 3ANSA 4WXYB 4UM9B 2ZS9A 1SULA 3AGPA 3N0RA 1XNJA 3E8MA 5ES4B 3IBTA 4Q3NA 1WDMA 4KSCA 4RMIA 1Q21A 2YZ2A 2OP0A 2W6IA 4ZC8A 1LQ2A 3L77A 1Q84A 2PT5A 1ECLA 2Y1CA 5JSQA 3B1VA 2RIRA 2PXXA 1H0RA 2PFGA 4G5XA 1JJ7A 4EHLA 5JUWA 3QFFA 2BFFA 1MVLA 2OB2A 2WJGA 5LM3A 3LOUA 3LBYA 4AIRA 2K5UA 3GGSA 1EVEA 1G1MA 1CUGA 4P7BA 4X54A 4X84A 5CLLA 4IIJB 3RT1A 1Y34E 4OLFA 3PKZA 1QVZA 1BJRE 5FTMA 2AXQA 2VP4A 3B9PA 3VSDA 1JNYA 4HFMA 3KTDA 2C5HA 4DTIA 1ZGCA 1ORDA 2FZWA 2P3QA 4A8HA 4YYZA 2ZJFA 4N8SA 3ZBUA 2FWNA 4WGFA 4N4AA 1VBMA 3D2BA 3GFOA 1QLHA 2RHWA 4FQ8A 4X8MA 5FYQA 1KTIA 5F9FA 3WAGA 4KDCA 2ZLBA 1AM4D 4KU4A 4YREA 1OC2A 1NUUA 4HWOA 3MRVA 4JENA 2JFPA 4OXKA 1MA0A 4PTZA 1IXSB 1JU3A 3BD9A 4LXTA 3RRNA 3VJLA 1H4QA 2WAOA 3HLYA 2E48A 3LF1A 2VDWA 4ZU6X 3ZBPA 4KPEC 1OWPA 3HMQA 2IIPA 4NU8X 2GZAA 1ZAKA 2W0MA 3T4XA 3O73A 3VV3A 1X92A 1Z2NX 3KJZA 2XGOA 2FQ1A 4L4RA 5E9AA 3FYSA 2YHAA 3NYWA 2Q6LA 1XKXA 1MDBA 4KXUA 4WASA 3W5JA 4RDCA 4WINA 3WRYA 4IR7A 1OIWA 2RG1A 5F5NA 4U00A 3AF5A 2HWUA 3QZUA 3HB0A 2JIMA 3ROPA 3VDXA 3WNCA 2JGEA 1EVYA 1SCJA 4OP1A 1KI1A 3E5RA 4WLOA 3RGGA 1HDOA 4I9UA 2AXNA 4TQ9A 4AURA 1XNRB 6REQA 4A82A 5IU6A 3HXMA 3PC8A 2C5AA 3OAAD 1ZWKA 4O4LA 3ELBA 3DE0X 3ELWA 3NIDB 1DFGA 1EK6A 4EYQA 1R3UA 3PPIA 3G0CA 4RE6A 2E4XA 2V5VA 3MJEA 2RK4A 3KQMA 2ZUDA 3KSBC 3I92A 1ZDMA 2IYSA 4BCDA 1PG2A 4WACA 3QXCA 4R0MA 4C2UA 3AB8A 4G09A 4MAFA 1UJBA 5A9SA 3S7TA 1CQZA 4A8PA 1QV9A 3L1VA 2VK1A 2V7UA 3VH1A 1T9KA 1L1RA 1VG8A 1Q57A 2W5UA 1SA0B 1JHUA 2W93A 3CNNA 3JQEA 3QE3A 1FFGA 3GGPA 4ZHQB 1FFHA 1GQ2A 3EZGA 2GBGA 1RXIA 3VUEA 4HRYA 1GR1A 2WJVA 3PRHA 1NUHA 4F84A 1O96A 4LGYA 4KQGA 2BYTA 4FINA 2H4HA 1BDHA 3O8DA 1E63A 1WZIA 5HJ7A 1UM9B 3HB7A 2Q49A 3D7LA 1IEXA 3W4IA 4DKXA 2ZWIA 4TLAA 1NQ5A 3LQFA 2HO4A 3Q10A 1LBHA 1U3VA 3GJ0A 2F4VB 4P3XA 5EFOA 3NXKA 3IXQA 4INZA 4JQOA 2PQMA 3ILYA 4YWHA 4MWDA 2PMWB 2Q1XA 5DIFA 4ZI3A 3C15C 3M3HA 2C78A 2QD3A 3F71A 2E85A 3QEBZ 5I7RA 1E7QA 1YOVA 5BOSA 4U8HA 3AW8A 4FFRA 3FPHA 2P1ZA 4M37A 4CG3A 1HSZA 2YYAA 1FZQA 4C4TA 5KQLA 3A1SA 1O95A 4DZTA 3EOBI 4GMHA 3CN9A 5EWMA 3SVZA 1UPXA 2HB6A 2X19A 4YRRA 3PE3A 3HSKA 1JFFA 5GQSA 4FHDA 1O1YA 2BFBA 2Z6AA 2J3DA 4ZAYA 4EMBA 5JAQA 1SRQA 1RAIA 2Z4TA 4JROA 1E2EA 1ZSYA 2I3BA 2ZE5A 4RPHA 4TTPA 5DGDA 5LYYA 3FPEA 3IC5A 1W34A 3HYRA 5EIWA 4GPBA 2AA3A 2L42A 1AD2A 5FIUA 3WNQA 4BO9A 1Z7GA 2Z9DA 3B89A 3QKWA 3CQ9A 3E3AA 2Q8NA 3R8FA 2CUTA 4D0RA 1QIKA 4UKDA 3T12A 1CVIA 5AI6A 3UOGA 3N2KA 1G6KA 3SKXA 4A91A 2Q9AA 2XXAA 4PM4A 1CR4A 1FSGA 4E6EA 3KFXA 4ZKDA 3I58A 5BR1A 3QX8A 3I6IA 4PO3X 2HMYB 5KB3A 1Z4KA 2ZUSA 1UPUA 3CKLA 4TZ0A 4QOSA 4YMGA 3K0AB 1ZOLA 1GUBA 4OFWA 4Q9NA 2CL7X 4JVSB 1WXWA 4PSCA 3T9BA 3TCNA 4PLHA 1PS8A 1LD3A 4NE2A 4ZP1A 1T0PA 4PVDA 4BUZA 2X8JA 5KZMB 4MJ7A 3R4VA 1U0SY 1ZJ6A 3C3CA 4LCJA 3QBJA 3C1UA 5ECDA 4V0OA 2J3KA 3M1AA 5TR9A 3KQHA 3B38A 3LGXA 4XPZA 3RIYA 4MWBA 4R2MA 3SFZA 2P65A 1T4GA 1ONOA 1O95C 1P4SA 4D3FA 3HEMA 4R1TA 4HDAA 4G1EB 1IZ8A 1E9VA 2HU7A 2ZANA 5TXGA 3R9KA 5JS6A 2DUWA 3DR3A 1H94A 5K8UA 3GJ6A 3S8YA 2D2IA 1Q15A 1YL7A 4JS0A 1J1ZA 2DTDA 1N6OA 1AX9A 2AOTA 3BGIA 4RCZA 3TOSA 4DC0A 4EW1A 3RVPA 4DLYA 2ZCUA 3TZLA 3DUFB 4YS6A 4AWAA 4F9TA 1Z33A 2OV1A 5HCUA 2CJXA 5DK6A 2H1HA 3IDSA 1FDOA 4N3AA 2ZUFA 1AK1A 1UBKS 2XB8A 1P7VA 2R6R1 4EAQA 2C0CA 2P4QA 3WGJA 4YXWD 5JEEA 4MEJA 2QTAA 2WIJA 5HILA 3RHZA 1E60A 3TKAA 3DCIA 1Z83A 4JLAA 4WBSA 5ECWA 2C5FA 1R0ZA 3QMMA 3ZZNA 4R9UC 3ZJUA 1W1WA 1EWQA 2ZG6A 4WN3A 4DT1A 1X3SA 3OHMA 4KSYA 4AQ7A 4KBGA 4W82A 4C6TB 1RSZA 3CE6A 1CE8A 1J24A 1IG3A 1CW2B 3AR4A 1YRLA 1XL1A 1BZYA 1OLUA 3EMDA 4AJ4A 2JH9A 4YRKA 2FX5A 2I7DA 3AV3A 5DYNA 3WKAA 1QQ5A 5L3QB 2PBFA 2QJWA 2R8RA 3L7DA 1EP9A 2X23A 4M38A 2ZYTX 3C3AA 2CDAA 1JIXA 1QTRA 1SCDA 2O2YA 3AYZB 2FCAA 2GFQA 4HDMA 4N9WA 1R9JA 2GAJA 2OZLB 4CETA 3GIDA 2OBMA 3BDVA 1Y1RA 3I2IA 4JKYA 5C8VA 3RAFC 2CLKB 1K2VN 3IPRA 1YAHA 2CEKA 3NYQA 4Z1MD 3HU5A 3DYVA 4U02A 4HH3C 2I6GA 1NUQA 1I4WA 4AX4A 1MQAA 4DLVA 4UPVA 1K0UA 2AHRA 2PT7A 2LZ0A 3EQ8A 4Q24A 3U1BA 2WDZA 4O1HA 4DWVA 4G56A 4TWIA 3O9MA 3L02A 1SCIA 5JD4A 1YZLA 1YR9A 4PRLA 4C4YA 2PTGA 1P1FA 1IRIA 5AVJA 1HFWA 4L9RA 4Z9FA 4DQLA 3FWHA 1TFRA 3AFNA 1KC3A 1T5HX 4HDSB 2BJWA 1K6EA 4HAWA 1Y4SA 1FUIA 1G8YA 2QGFA 4RK5A 5CX4A 3CV3A 2VR1A 4JAVC 5IN4A 4MUKA 1G3IA 1HT3A 1X1BA 4OJQA 3SBEA 3SHQA 3UMSA 4DYHA 4BDTA 3BKWA 3OMWA 3ZN2A 3KBBA 1KP9A 3KD3A 2JCXA 3LGSA 3OPVA 5ITZA 2VZEA 4QSHA 4NU5A 3E9YA 4QTTB 2Y66A 1UL1X 2JVKA 4LVUA 2BWJA 2Z1MA 3PB3A 3TW8A 1Y3BE 4KDFA 2L0XA 1KQOA 3PX3A 5IAOA 3RNLA 2XUKA 4UNRA 2C99A 3EGDB 3WYEA 1U80A 3OJCA 2RI1A 1L5SA 2R60A 1SCQA 2ONZA 4F0JA 1Z0AA 5CFMA 1O94A 4ZVQA 1DWQA 1ZISA 4OFBA 2ZZNA 1KIAA 1VG0B 3QIAA 1KZYC 1GTL1 4MV6A 5JS2A 1GGVA 3MRTA 1BDIA 2JFQA 4UM7A 1L4BA 2ZBPA 3FTDA 1GG5A 2ECKA 3FUWA 5TJHA 2W6PA 1AGRA 5CT4A 2WLTA 5EHQA 4ENRA 4L3VA 5IYZF 2Z2YA 3BGSA 3EGWA 3LP6A 3CPSA 4K6OA 2XW6A 2N75A 3I5AA 4Z0NA 2H92A 1R6XA 2D0IA 3BXHA 4GLOA 4YECA 5LOVA 4O1IA 3OKAA 3RSGA 1LY1A 1X1AA 2YUTA 3QLVA 3R3XA 4N54A 4EUFA 4EF4A 4KNYA 5DWVA 2ZREA 2GXSA 1G42A 4LYDA 2XUDA 1ITZA 3OUZA 1FMLA 5BN3B 3AUFA 4AX8A 4HLCA 3IB6A 1GXSA 2P91A 3LLUA 1Z6TA 4ZV7A 4B73A 4CR8A 4G0VA 4Z4GA 2FRVA 4WLVA 4G01B 5EQTA 1SHLA 2ACWA 3I0MA 4GLBA 4RSHA 4UBMA 5DW3A 1WMDA 4P4TA 1GDHA 3K6SB 1T5LA 4UHBA 2P90A 4BO0A 3NTXA 4ZD6A 4WZBA 3BCRA 3RVOA 1VBKA 2N42A 1YRYE 4UEWA 1Z12A 3ESCA 3H13A 5HJEA 4Q4JA 4B3CA 2I6SA 1I3KA 4DEXA 1ZH8A 1USIA 4W7HA 1L4HA 1LF0A 4TTJA 3AJAA 4L5JA 2IY8A 1KI6B 2ZBRA 1SVOA 2IKQA 3ST7A 3LQ1A 5E3IA 4R01A 1O94C 4BMVA 4G37A 1KSGA 5DYGA 3GXBA 3N58A 4IG9A 4HQFA 3P5SA 1Q0TA 4WEQA 1CJCA 4D80A 4R40A 3VKVA 2F00A 2IDZA 4TMXA 3BMQB 1T2AA 2PL3A 4F4IA 3EGEA 1MF7A 1Q0ZA 3CRW1 2LXNA 4RLQA 5HK9A 4Q3LA 4XR9A 1J07A 1CU1A 5L3SB 3HGTA 3V4SA 3TI7A 3OZWA 4K40A 2WWVD 3W1EA 1N78A 2CLOB 2RJ3A 2XMZA 2GN0A 4EH1A 4PHCA 3WIBA 1EP1B 1QIGA 3L0DA 2XVYA 4UAVA 4FFDA 5E9QA 4K6KA 3ITDA 3P7MA 1N6LA 1OIVA 5FJJA 3N2ZB 2W8BA 1OLOA 2NO0A 2CVFA 3UQYS 2FUCA 1GSHA 1T91A 2QJOA 2W6ID 2RSLA 3AF3A 4MW4A 2JLXA 4EBFA 1JIQA 1VECA 2AG0A 4W8HA 2HHHB 2ZJ8A 3ENZA 2RDMA 3D3NA 2Q5IA 3U09A 1T1GA 3LWZA 5CT9A 3K16A 1J90A 3O4FA 4GC5A 1NFFA 2GBLA 4OQZA 3DZCA 2VRBA 5E8JA 4L15A 4D3XA 5JO0A 4Q3DA 5A4IS 2O3UA 2H1OA 2QIPA 4PXYA 4CL0A 5CCXA 1QGDA 5LKAA 3FPSA 3BMNB 2OCLA 2QW1A 4BV8A 1HL3A 3ZY2A 3QV1A 4FC7A 3M6UA 2PD4A 4MKXA 2GAFA 2WSBA 1KDZA 1L9XA 3WLTA 4CT0A 3DMYA 2QMUA 3C3JA 1RACA 4MQ6A 4PN3A 3KOMA 1PJBA 1XBTA 1THMA 4LG1A 3BK7A 5JTTA 4F1WA 4LK3A 4BMOB 2IYLD 3HKDB 4IX9A 3MHTA 4TYWA 5GJWC 4FBMA 4JXJA 4DJTA 5A1JA 1ODSA 2XHEA 3G1TA 4QXRA 2DG2A 2NU7B 5CH5A 1M0WA 1PEYA 1KETA 5LQCA 5TY0A 1T8WA 1PZFA 1ZFNA 3C48A 2AEEA 4C6SA 13PKA 1QIFA 4WZ6A 3DMRA 1WDTA 2PJZA 1BWRA 1IULA 1OC4A 1ZXXA 2GYVA 4QPJC 2R1VB 2GN8A 1NI3A 3DJFA 1IHXA 1LPPA 2H06A 2EW8A 2PL1A 3CEJA 3FMPB 7REQB 5LA6F 4PNZA 3RODA 4C0KA 3VC3A 1OV4A 1Q20A 3HTXA 5FNVA 4DJ5X 5FV4A 2AG8A 2OZEA 3DR5A 1WCXA 4J0GA 3FZQA 1SKMA 3HUDA 2W2XA 4HXYA 3TVTA 3Q40A 5KCZA 1RPAA 1E5DA 3L2OB 2PA0A 4PO9A 4D3ZA 4Q1DA 3ENKA 2BKAA 2QVBA 3QG1A 4A1OA 3VYVA 1AXGA 3CLKA 1GZ3A 3QI2A 1HBJA 1HDEA 2AK2A 4BFSA 1XDBA 4PSAA 1FFXB 5CDSA 3F47A 1W88A 3ZVRA 4NXNB 1V2HE 2SCUB 1PZMA 1U3FA 2YIVX 3MT9A 4LHVA 2JD2A 3ZY6A 1B8OA 2NU9A 8OHMA 4TS4A 5GPBA 1Z7WA 4GBED 4I14A 4D25A 1HE8B 1N4DA 1OGJA 1TKCA 2EZUA 2NPOA 5T3YA 1JHXA 4IYJA 3E9MA 4WZAB 4JSRA 4BX2A 4FN5A 2H4YA 3LT5A 2NXJA 5EUMA 2HHJA 4CLOB 2OWDA 1JAHA 2AMVA 3VH4A 3F3YA 1PZNA 1Z8HA 3FROA 1GG2A 2UYGA 3CZPA 1JDVA 1SXGA 2FQYA 3NCTA 4PANA 3T38A 1FW8A 5IJAA 3HB4X 3EJ6A 3PS9A 4GOLD 2O3RA 1ID8A 3NWOA 4YA6A 4Z53A 1BTOA 2R8XA 4INOA 4TT3A 3N6XA 4P86A 1U02A 3ZWXA 5EKDA 4YQZA 4RWZA 2HUNA 2NAPA 2QRJA 3AIKA 3O82A 4RMJA 4O2AA 3AKEA 1P7PA 4WOPA 3TSWA 3I9OA 5ETJA 1IDOA 3D6AA 3KXDA 1XEXB 2XAAA 4P32A 1II0A 1F8GA 3DXXA 2R86A 4B3MB 3D8SA 1F48A 5A3QA 4M8KA 3C3MA 4L2IB 3NYIA 4KQ1A 4U6NA 3GV0A 4YP6A 3ZHSA 1UK9A 4ES6A 5AM4A 4HT3B 1OXUA 4NF2A 1QF6A 5BW8A 1R16A 3FNFA 1ENPA 1JIVA 2X1LA 1QM5A 4KPGA 3D5EA 1WF6A 1XG5A 2D5IA 2FQWA 1CJBA 5LJIA 2WYWA 1ILWA 1US8B 1Z4OA 4D41A 2VYVA 2V7XA 1E7RA 2WJYA 3NEYA 1J2EA 3CINA 2Q3HA 4US0R 3N05A 4LJKA 3WIEA 4AYTA 4KR7A 5IDVA 1T3GA 3O4RA 2YH2A 2Z04A 4C0XA 3KYBA 5CIWA 4IZ6A 1VHQA 3ZHZA 1GSAA 4ZJZA 1NF2A 4JEHA 3RH0A 2GQ0A 2FPWA 1TYAE 1XK6A 3R3JA 2H5JA 3SC6A 3GLHE 1VCIA 4EYOA 3LCRA 2JI8A 3V2UA 1PX0A 1EFVA 1WD5A 3AGQA 4BVLA 4H1VA 4TN1A 2ADFA 3LUGA 3LX8A 3A7DA 3VAYA 5G0UA 3MUOA 1SUBA 2HMWA 2XOEA 1GTVA 4MWOA 4UE6A 1MO6A 4HYTA 4Q19A 3MCTA 5BSTA 4DMFA 5A2QA 1THGA 1XV5A 1Q12A 4IV0A 2UXDB 2PA3A 1IPFA 3LHSA 5LOVF 2GILA 3KOYA 3VKHA 2NMVA 4CKEA 1NPDA 1NZJA 1EX7A 4OHKA 2Q0XA 3ZE0B 3HKEB 5IHPA 3OCZA 1I7NA 2QUIA 3A9RA 3LT4A 1NHGA 1XZGA 4FJ2A 3P0JA 4L0QA 4TLEA 4ZYWA 5BN4A 4A2PA 2W98A 4MVXA 3KYIB 3IT2A 1L5FA 4KMOA 2H7CA 3N28A 4QLBA 2ZUBA 5HCIA 1R5NA 3G2IA 5CA1B 1HQCA 1VFPA 2C97A 1SXJE 2DWUA 3D7SA 3HKBA 3NFYA 3PNBA 4JOBA 5HIJA 4RTRA 4LJ9A 2ZSBA 4ISBA 1U2QA 1KVQA 5CVCA 3NHMA 1PTKA 3IEKA 1EVZA 2HZBA 1TQ6A 3LBNA 4MQUA 3KJEA 1P1JA 1AHHA 1K3UB 4N1AA 4L76A 4KPUB 3C8UA 4BYGA 2XUOA 4AS3A 2CMFA 3E5HA 2G9QA 3T5BA 5IDQA 5IPFA 4GBJA 2XE4A 3G8BA 3BMOB 2CWWA 5CIYA 4UARA 2IHUA 5I6DA 3IUEA 2WJZB 2DR0A 3OX2A 4IG4A 1JHRA 2BIFA 3VGPA 3EDMA 4L50A 3U9LA 4AP9A 4AG6A 3VFDA 2O8FB 1U3TA 3O1LA 3RS7A 5HP4A 5AKYA 1A9ZA 4QD3A 1NYRA 3G0HA 3F6PA 2XMQA 1MP0A 1KP3A 1ECGA 4X92A 4K0RA 4LDJA 3H8VA 5JARA 2DXIA 2N1MA 2MT9A 4E0BA 2WZCA 2DHQA 2B34A 4N8EA 1QAOA 3GX1A 2VDUE 2H2GA 1IG0A 3GGDA 2BEKA 4FFBB 5LB4A 3B1JA 4IW3B 5FL7D 1DC5A 4RXMA 1IB6A 4GW3A 2R65A 3SDSA 3VR4D 4YC7A 4ODIA 3CSDA 1AKTA 4IUCS 1A82A 9ABPA 5JISA 5JAHA 2C04A 1AV6A 2VATA 3R77A 1PVDA 3WJ1A 4X85A 1L3BA 1DRWA 2Q41A 4RE5A 4FKMA 2P7HA 3L7AA 3RSFA 1Y1TA 1CUUA 3UJ6A 2M1ZA 4J2TA 2IY9A 4B33A 1TEZA 3BBLA 2Q29A 4D57A 4N40A 1JDNA 1MX3A 1V5GA 2WBLC 4IXWA 1A77A 2P11A 3IKJA 4G2TA 2QMQA 1SBHA 2WU8A 5CNJA 2DHCA 1MXFA 2XMSA 1W48A 1T2FA 1C14A 2WUVA 2QTRA 2C2HA 2FAXA 3JVIA 1RQ7A 3ND5A 3CW8X 1E1LA 2HA6A 3U62A 1NT2A 1QONA 3DMFA 4F4DA 4FHCA 1VLHA 2XB4A 3AC0A 3MM4A 1T4CA 1WR8A 3MUEA 4JB0A 4FYJA 2DTEA 2HSWA 1IEVA 2RGUA 3G2LA 3M4YA 1O97C 4OJYA 4XPIB 3AY0A 1EINA 5CNKA 1A8QA 4IXNA 1FP4A 1Z5PA 2FVXA 2VS1A 4BFWA 5LSAA 5M7EA 4WLEA 1PUJA 4ND3A 4RJJA 4JXXA 4CM1A 2PUDA 2X8LA 2OGZA 3V42A 3PQ8A 1Q83A 2RGGA 3QA9A 5DTJA 5CFRA 1UF9A 3KQOA 1B8UA 3DE7X 3KKNA 3K5IA 1C7JA 1DTWB 2NYUA 4RZ3A 2XGSA 5EFZA 3F5FA 3WLSA 2I7TA 3UBTA 2RHBA 1VI5A 2R47A 2VPTA 4DN6A 4M0KA 2IF2A 3NS7A 4IS3A 4Y6PA 2GHRA 5EZQA 1A98A 3KQTA 4R05A 3AW9A 3B1ZA 1AY0A 1NFQA 2J6BA 1X8LA 2OT3B 2A9QA 2FWPA 3GUVA 3IBGA 4PTLA 5DB4A 4FS8A 4W7IA 4ZKEA 4AL4A 4AY3A 4D9MA 5BUQA 2ZB2A 1ZPDA 2IX3A 4XWWA 3B7GA 3PX7A 3ACBA 4URVR 4QDUA 1XVTA 4ZVTA 2D2VA 4YV2A 1AK2A 1FFDA 1FTYA 4OGWA 4JSYA 2OBXA 3KQPA 4UHCA 1FA9A 1TQ4A 2VXBA 2YWHA 4JY7A 2V03A 3ZHTA 5LQRA 1RI1A 3AK4A 5KVCA 4DQKA 1KZ7B 3FE2A 1WMBA 4YRAA 2JFUA 1GPBA 1DADA 1RM5A 1GDDA 4C6HA 4LF9B 5IJZA 4BTEA 1WP4A 1VPVA 1N1MA 4D3YA 1XCMA 1OA0A 3Q1KA 3FGOA 4TRNA 2VJQA 1I3CA 2W43A 3HN7A 1LDMA 3O2QB 3T7JA 2MINB 1ZN7A 3TMAA 5CEFA 4XIIA 3UWPA 1JXAA 1WRBA 2IYNA 4B34A 4Y2HA 5L45A 4B71A 3W9UA 2DLCX 5C7LO 4MR8B 5JVDF 1IN6A 4DQ0A 4TKMA 3GFQA 4WK4B 1I1QB 1NBHA 3KALA 3ZQ4A 1E3WB 4MV7A 1VOTA 4FMPA 1GP2A 5EJ4A 1U2EA 1F06A 1Q0QA 2YY5A 4HPJB 3FDZA 1U0OC 2B61A 1U1FA 4IWNA 3ROGA 1FXWA 1G5TA 2JLVA 3OHPA 5KAMA 1F20A 4IDGA 2AEMA 4RL4A 1FDSA 1R18A 4AZ3B 3S8EA 2Z3WA 2IYVA 4JUBA 1KE1A 1D07A 3KQQA 1XZKA 4KIUA 4PLWA 4INPA 1E2BA 4V02A 2IXBA 1GA4A 4QUEA 1P9NA 4NBLA 2X0FA 2R4TA 4U7FA 1ZUD1 3D81A 4IIHA 2D1TA 1EG7A 3P9QA 2AKEA 4J9UE 1U7WA 3MMNA 1GPLA 2PSHA 4IXTA 2OB1A 4N48A 5ENVA 1G8PA 1EWVA 4TSKA 4JIMA 1Z4LA 2C58A 3O4VA 1FDWA 1GKUB 1KOJA 5JDCA 1PT6A 1NUTA 2VTBB 4N3GA 4E46A 3CJRA 3AR8A 4R3WA 1J0BA 3RCBA 4KXMA 5L7WA 1WG8A 5IXJA 3CE9A 1OXMA 1JAIA 1W85A 2D62A 1TADA 1CHDA 4FYKA 3NIGB 3W8FA 2Z43A 3HVJA 1Y6JA 1Y1KE 2PQ2A 5SV2A 3DM9B 1RQLA 1YOBA 3G0IA 3H42B 1R37A 3O5AA 4ME6A 4NI5A 4M86A 4DA9A 4HADA 4LW8A 2AI3A 2D13A 2D1RA 3GLHA 2OTCA 4MV3A 1K5DA 2LWIA 4W8OA 2OVBA 3RC3A 3ZK8A 4TT8A 1P19A 1OBOA 4HKTA 3RTGA 4DAEA 3FFBA 1GO2A 4GOND 5G02A 3MBIA 2JGIA 4FBGA 1NL3A 3TDMA 3A4VA 5K8VA 2GPJA 1P4AA 3STTA 2QA5A 2ZBUA 3UWSA 1ODJA 1QQ7A 4QU5A 3NHPA 4RIHA 3L8YA 4LWZA 3DWEX 2XYHA 4MEAA 1OASA 1XMVA 3VSBA 5TARA 3QUBA 4UNQA 5CB8A 4I3GA 2JVJA 2V7PA 4N7BA 5BSHA 4P7GA 2MMGA 4AKEA 4H35A 3Q8XB 3GT4A 3ZWCA 1XLTA 2YXNA 3P4YA 1UPCA 1A5BB 2IDKA 3CUTA 2JFOA 1M34E 2Z09A 3SS9X 4K81B 2YMMA 4BWYA 5K6AA 1W47A 1AURA 3W2HA 2AG5A 2DWQA 1GNQA 2IC5A 2I7XA 2BMWA 1IMJA 1G20E 1LX7A 3H75A 4FW8A 2PKWA 3CLUC 2Z8YM 1Y81A 2XUFA 3H2KA 3I72A 4R3NA 5LZ8A 3VNVA 2W6MA 1CUHA 3OETA 5JXWA 4CLEA 2BFOA 1FW6A 2M1XA 1W4CA 3QEMB 4TWZA 2Y1EA 1SXJA 1QHFA 1ZOPA 3GFTA 4AK9A 2F48A 5H70A 1YA8A 3KYJB 3C3XA 4XQCA 5BNIA 2QQEA 3BL5A 4B3BA 2G09A 1I3MA 2XZLA 5DHSA 3SQDA 1FTSA 3ZJ5A 2WD7A 3Q3EA 3CLVA 4CLRA 3K5HA 1W6RA 1C1HA 5KNDA 2DWCA 3QFHA 4OQFA 1QVVA 4XX1A 3OFSA 4YUWA 3RYIA 4TKVA 3RU2A 5BMVF 3P2JA 1Z5GA 1JQDA 1MX1A 3IAXA 4P1ZA 4DA0A 1A95A 1BMTA 2Q3FA 4P3NA 1E92A 2Z4RA 2Y76A 1D1TA 4D97A 4PCAA 2BZGA 1HDYA 1DAGA 4RZHA 4HDRB 2CDBA 2HJHA 5EKXA 3WX0A 2EKZA 4XQGA 4EW3A 2QZ9A 3GRRA 3QVWA 3K9BA 1XLTC 4V1CI 4J03A 2GS9A 3A9CA 4OGFA 3CFYA 4LBWA 2W2VA 3K1ZA 3ZIAA 5C5DA 1V1RA 3IQXA 4CM8B 5CNIA 1FRFS 1HKUA 1SKQA 1ULAA 1TEHA 1VCHA 1NSFA 4RFLA 5K6AC 4KIFA 2ISSD 3DUWA 3HM2A 3D9QX 3QLEA 4H3VA 1WV0A 1AUQA 2J59A 3PGLA 3EH1A 3FRHA 1LPSA 1L1EA 3ORSA 1FZTA 1LSOA 4ZALA 1SXJC 1LW6E 4Q3EA 1ST3A 4NCXA 4UUQA 1L4MA 5LUAA 4H9GA 5JMPA 1Y42X 2CNBA 3FGNA 3OMXA 1Y8QB 1JJAA 4IEEA 4BZXA 3TRJA 1Y5LA 4P4LA 3DKPA 4Z49A 1WBJB 2ACVA 3B8HA 4JDPA 1F6WA 1QE3A 3IO3A 5J2UB 4F5YA 3LUDA 3K92A 2VYVD 3Q6MA 4U7PB 3SOPA 1WB9A 2EF0A 4RPCA 4GL4A 2PGJA 1VLJA 2QLFA 3V7FA 3W5HA 2II6A 4P33A 4QARA 5F2KA 2RGRA 3K6KA 4WCDA 2FHSA 4RVCA 3I5MA 1M8KA 4Y1RA 2VHUA 1RBMA 3LUFA 4TM8A 4TLLB 1KEWA 2Y4OA 4D45A 1ILEA 4C7BA 1Y4AE 1D1PA 2IU4A 4GT1A 3WI7A 4DZZA 2COUA 4F4UA 2AOUA 1UOOA 3GUYA 1GPYA 3MELA 1S9HA 2BP7A 1IN5A 3HWSA 4IVNA 4PO1A 4ITVA 2PUHA 1JU9A 3K8ZA 4GX0A 4G23A 3BMXA 1SK8A 2IF0A 4M55A 4YB8A 4ZQCB 2NTEA 1KERA 4N7MA 2JDIA 3U3RA 5GONA 3TD6A 3AI2A 1XN1A 3HP1A 3L7BA 3MAGA 2QM8A 1TECE 3JAWB 3U0BA 3WLAA 2DB3A 1UJNA 4JWKA 4MS4A 5EUBA 3A2LA 3VYWA 4LYHA 3SZGA 1T9AA 4A03A 4H31A 3EEIA 4B79A 1A50B 1XRQA 1VKHA 5FWXB 1MV5A 2HBZA 2FWAA 3GZJA 2FZCA 2P5YA 4KQJA 3LPCA 2G08A 4HK4A 1Y5RA 4PCLA 3ND7A 5L4LA 1VLZA 1IZ9A 1EJ2A 3ELYA 4L85A 3GGCA 3V32A 1A9SA 4C0LA 4G0MA 3C3YA 3IJPA 4ZPJA 1ZIOA 1PWZA 4TV8F 3H9GA 2Q5CA 5JWOA 2FOXA 1ZRHA 3ZHUA 4JH0A 1ZITA 5GOTA 3RWMB 1L7BA 2X2PA 4R9VA 4WFJA 2R7LA 4B3FX 2W9XA 4YDRA 3RVJA 2CLFB 1KO1A 4MAMA 2P68A 4CMIB 1C41A 3DT9A 1E62A 1WTAA 3DE3X 2WILA 3TRIA 3HUFA 3MVEA 3SNHA 4KW7A 3U56A 3KVNA 1W5BA 5T67A 2OUKA 4F7DA 3DMNA 2GXAA 4EF6A 5BUSA 3VKWA 1UBGA 2O7VA 3QIVA 4RV9A 2XMBA 4LJ8A 4GH5A 4ZYZA 1W2HA 4ESVA 4ASUD 4TX1A 1C7ZA 4PXAA 2H8GA 1H4TA 4AS2A 1DKLA 4WA8A 4HY3A 4QJBA 2O7SA 2QX9A 1TD1A 1UP7A 1Q7GA 4DLSA 3IKTA 4UBNA 2WG1A 4C1BA 1WETA 2P27A 4GRAA 2XA2A 1E5QA 1WJGA 3PKIA 3G5MA 3MGKA 3MTAA 3NUZA 5F3WB 1NMSA 4DGSA 1NAHA 4OHBA 2J3IA 1YS7A 4MSUA 5EIBD 1O97D 2NSHA 1ODIA 1ZN9A 2OVFA 3DHYA 4YRJA 3VTAA 1DAPA 2RI6A 3R3YA 3IA7A 3OCJA 4I8DA 1ADFA 5CH8A 2DQSA 4CM9D 4YUYA 2ECOA 5ALGA 4O25A 3C6QA 4PPNA 1M2HA 3LW8A 3L18A 1PEAA 4C0AC 3IHTA 3L6OO 2H63A 3NC4A 3COZA 1R8JA 3G8YA 1F2VA 1S2IA 1GFSA 1JDZA 1I7PA 1P1RA 2COKA 4R7ZA 3T5TA 3UB3A 3AP2A 5EJ9A 5MN4A 5GGYA 5AXBA 5JYDA 1M2FA 3M5CA 2PAFA 4OSOA 1WXIA 4REQA 4CEJB 1FDTA 5TQ0B 3TEJA 4BV2A 3SZLA 3E3OA 3MILA 4DBZA 4JI8B 1WPQA 2P79A 2VDLB 5ELLA 1P2SA 1O6CA 1QGZA 4F72A 3HY6A 1V1MA 1UMDB 3H0KA 2W11A 4DLNA 2QLNA 2PVPA 4Q02A 2A1IA 3ONNA 4PEVA 2ZIAA 5HGXA 4RD0A 3NLLA 4YJ2A 4PICA 2J87A 3NHZA 4RMHA 1DC3A 3K72B 3VVMA 4WBNB 1JTVA 2WSIA 4OBXA 5KPJA 1X7ZA 5JSUA 6Q21A 2FWBA 2BL4A 1S2OA 1R0BA 3VR6D 2DGDA 4AZ0A 5IJ0A 3Q9LA 3HV0A 1WXGA 5F2NA 3ZD7A 3JVEA 1QV6A 4XIGS 4B6SA 5J2TA 1KOGA 1QCZA 4BTLA 3SF8A 3QVTA 1L7DA 3CVJA 4DSZA 1DUIA 4XTRA 1ZYUA 3DVLA 3RVBA 5DBFA 1VI6A 1YL5A 1FRZA 4MYSA 4XVHA 4G0XA 5C18A 5JFOA 3OQBA 2I4LA 3BGWA 2YCBA 3E9EA 5TF4A 1GV0A 2K2QB 3KLNA 2D1FA 4CVNA 1FDVA 4WK2B 1LDNA 1X15A 1KFBB 2EOAA 5HBRA 5TGTA 1YMUA 4O4JA 4LRWA 2GPAA 2TYSB 1RKUA 3SIWA 4MARA 1Z0SA 2IZ0A 1M2OA 1Z4MA 4ZFNA 4DSAA 1Y7LA 4RZIA 3HACA 1BXRB 4DSTA 5CDGA 2AVDA 1R4MA 3GRUA 1K6XA 3C16C 1U3CA 4UBOA 2CV0A 3E1KA 3MGBA 1AN0A 5FA8A 5KWSA 1PFVA 3D0KA 5EZYA 5IP5A 4XWKA 4U5QA 4C5AA 3MXOA 3C6MA 2PVCA 2Q9CA 2EU8A 4KQKA 1J7JA 4F3NA 3QKRA 1ZD9A 1UUFA 1IOWA 2FPSA 4OJKA 1G20A 2PMDA 3CLRC 3W3AD 5IK2A 3IJ5A 3RT7A 2WIGA 1QP4A 4B82A 4ZIRA 2KYRA 2ANBA 3RDPA 2OXEA 3T0IA 4ESEA 3IAAA 1E96A 3FNBA 1GRRA 3OT5A 4FMDF 1BE8A 2GPNA 4UZFA 4ZTZB 4JJ4A 4HTFA 2AX4A 3RC8A 4ENUA 1PD1A 1OH7A 3BWVA 2XWSA 3UCEA 4KITB 4L8GA 1Y3DE 1KZ6A 3WXBA 3ESQA 3ILSA 1NNSA 1RXSA 1W0KA 1HLPA 2I66A 5CFZA 2JAWA 3JQGB 4JLUA 1N2CA 3HDGA 3O92A 2D8MA 5KQMA 2WUDA 3T5DA 5K8IA 2OORA 4YRTA 2A3RA 3H87A 3SSMA 3JW8A 2J0VA 2CNWD 4X8OA 4PPFA 1NVTA 3EDYA 4KMSA 4PLTA 2CMDA 2ZYRA 1GFWA 1ZK3A 2YVUA 3AB3A 1POWA 3S29A 2HFKA 1DBSA 2CNLA 4B8WA 1EDOA 3GBSA 3R41A 3R7WA 1ISFA 2VNKA 2IZOA 2O2GA 8ATCA 2OPHA 2NQTA 1D4AA 3INRA 4TWAA 2W00A 1KAOA 3FIUA 2ZSEA 3ESXA 3SQOA 4Z7QB 5AK5A 1AQIA 3EIUA 1RJDA 4BEVA 1WV1A 5LZ9A 1U6IA 4KSBA 5C5IA 1DJMA 5DVZA 4MA0A 3C85A 2PANA 2DKOA 3ZZUA 3GJTA 4XCXA 2OP1A 1PO7A 4MPPA 1IM2A 4KZPA 1VPDA 5MDHA 4XGKA 4PQGA 4IICA 2PLNA 4IH1A 4H16A 1G4HA 2WF6A 3H05A 1C4KA 5GM1A 3LP5A 1YB1A 2VK4A 3HFJA 1JFVA 2VSOA 3Q7QA 2PMEA 4E4RA 1B6TA 2AJLI 3K09C 3PK0A 4YROA 3Q6IA 3U0VA 4P4SA 4CKWB 3BL8A 1NN3A 1D1SA 1RJ9A 1M2VB 2R68A 3P9IA 4NULA 5ICFA 5HA5A 4I8IA 2P8JA 3CLUD 5C81A 1I2DA 3I2YX 2Y1OA 5I4IA 4G4SO 4IM7A 1V9LA 2GDJA 3KAPA 2OORC 1KYIA 3SC2A 4QBGB 4O4HB 1RZVA 1UBLS 4ABYA 3BWCA 3C97A 5B12A 1USGA 3ETJA 4P7JA 4QREA 3E7DA 2B9VA 3TIVA 1YUMA 2P9CA 4ZGBA 4DWWA 1ESEA 2VJYA 3AY3A 1OYYA 3VI3B 4X20A 4ZRMA 4Y0AA 4DA7A 5FV7A 4DDTA 3FR8A 4RKRA 3WK5A 1VXOA 3CBQA 1XTQA 2EP8A 1JMKC 3WB0A 1C9KA 3L8DA 3ZHVA 1U3WA 4Z4FA 4QULA 3LKBA 5ENDA 3EA4A 3THXB 1XAIA 1T5OA 2YJTD 3HBJA 6LDHA 3WL7A 3C87A 3I5YA 3WTBA 4GXRA 4YIKA 4DJDC 3P19A 3S5JA 1T1JA 1HEYA 3BPSA 3CF2A 4EJ6A 1MOSA 1PIWA 1VSTA 3H4MA 4UTRA 1DAIA 1CFJA 2GA9A 3AEUA 5C8DA 4Q01A 3HVUA 1OI4A 2Q7XA 4FD2A 2FWMX 2PGLA 4UFPA 2R5NA 4R83A 1QS0B 2FH5B 2IHKA 2VPQA 3LBHA 1E1CA 3PNVA 3W6UA 2VF2A 3KZXA 1CDDA 1T9ZA 2PMCA 1OFTA 4WCFB 1HH4A 2QT1A 1QB7A 1M6EX 4WKPA 1SBIA 1ZCBA 4JLPA 4MWEA 4AKIA 1UPFA 3LY5A 2D3WA 2IXEA 2X8AA 4OXYA 3ECSA 3NJ4A 1NDUA 1L1FA 1GTJ1 3GEEA 3QX7A 3RB8A 5CFPA 3AETB 4ZT2A 4K0KB 4KLNA 2IU0A 2P67A 5EP3A 2D5LA 3ZNQA 1DJPA 3M6VA 3HEBA 2I3GA 4MUJA 1UJMA 4CDNA 4NAVA 5K2OA 1UPTA 3EXEA 3OZDA 5D3MB 5AW9A 3GP5A 5KNDD 1ZQ9A 4CM4A 1XQ9A 3N7TA 4HR7A 3GLGB 2OESA 1JUDA 2H0RA 2VUUA 3KZNA 4MYCA 4HC4A 4NBKA 5DNDA 3RYHB 4EEXA 5GVSA 4ER7A 1T6ZA 3LHDA 1MOZA 4IJ5A 2FE4A 5KTOA 4EUSA 3ZCXA 2GEUA 3REOA 2VKQA 2XECA 2HDNB 4FONA 2M6LA 4HJRA 2HV9A 3LC2O 3WZMA 3G5TA 3WMFA 3WYDA 2HX1A 2KBFA 2KLBA 3A10A 9LDTA 1E2KA 4RX1A 1MB3A 2ZS7A 3DOIA 1C2YA 2DQYA 2Q0QA 4PG5A 4B7AA 1G291 4MITA 5HF5A 3V8QA 5LLTA 3PDIB 3IV7A 3K2IA 3PJEA 3ZIAD 5ICGA 2J9FB 5K20A 4EK9A 1ZD4A 3WIDA 1P2UA 2QWXA 2IYZA 4JP2A 2VJNA 4X61A 1TM7E 2Q4TA 3DVAB 2R5FA 2GVNA 3TECE 4XM2A 1NTRA 4B1FA 1SZPA 2RHRA 1LBSA 2ZK7A 3BIOA 2H9AA 4UJ5A 1ADJA 1KQNA 2AFHB 2CNNA 3MXTA 3GCWA 2GF2A 2RBGA 4FJ1A 4JGBA 2GPYA 5A05A 1QCYA 4C89A 2IH4A 3EX7C 5ESXA 3A2KA 2IDMA 2F59A 3F49S 4PG6A 3P96A 1JHPA 3B48A 2H4FA 4HH1A 3X2FA 1GILA 4G4JA 1KJJA 1SB8A 2EKLA 4CFSA 3W5UA 1QIEA 4P4UA 4E07A 4WOCA 3H8SA 3L7KA 3P1JA 1KR2A 3K20A 4LOHA 2V7EA 4TN5A 1SKBA 1KSJA 1U99A 4OUDA 4WT7A 5JFGA 3O3OB 4WXRA 1GGKA 2RH9B 4G5YA 4JODA 4YRPA 4A8JB 3WKDA 1SKUA 3M9LA 1JTEA 2O5CA 3TW0A 1AZLA 4U0KA 2NUPB 5L7TA 3DHVA 2IYAA 1K68A 4MR9B 4EQ6A 3GN1A 3TGLA 3B6EA 3K4HA 2P4UA 2NAFA 4HAYA 1YD7A 3NKFA 2PNFA 3CPHA 1E0KA 1EAYA 2I7VA 4EGSA 1GEGA 3WBFA 2FB9A 1FP2A 1L7PA 3KDPA 3VSAA 3BAZA 3WLIA 4EHNA 3EVDA 4HUJA 4NY1A 2RGAA 3X3HA 4CM5A 4L0MA 4NIMA 1Z5OA 2B7LA 1EP3B 2NV0A 3R5HA 4P3KA 2ZPTX 5I4BA 1EXDA 2IYEA 5TQVA 2O2IA 5I9TA 4C29A 2NG1A 2OFOA 3Q6NA 1MC4A 4E7PA 4J8PA 2ZAGA 3IBCA 2PPVA 4HDCA 4UUMA 1N5IA 4ILKA 3CNHA 1I4OA 1CEYA 1GGFA 1QMPA 1K4YA 5HRUA 1PNQA 4BCBA 1R9MA 4BHTA 1YCHA 4OLAA 1LI4A 4LHEA 4MKHA 1N5MA 3EY9A 4PQFA 4MPRA 1Z22A 4IKOA 4WY2A 2VLIA 5EP1A 5DM2A 3VPBA 2PZAA 4GKKB 1FFBA 4QYIB 2ZYDA 1TJPB 3ASVA 4ZYTA 1T2VA 4M9UA 1CEQA 2EKBA 1S2MA 3FHJA 2WMOB 3D3KA 1VCNA 3OIGA 3OX4A 4J90A 4Q4AB 5ARCA 3MTGA 5J59A 3RAPR 3RIMA 1WHSA 4GDMA 4FFOA 4C7MA 4G6ZA 2W7TA 3P2EA 4KV9A 5E6RA 4Q3CA 3EG9A 3IUSA 1K89A 3R23A 1N2IA 1VYTA 4BQFA 4YT2A 1R7RA 4EYSA 4O59O 1J0EA 2ZRQA 3ZWDA 2BFEB 5BVHA 2RE8A 1MJGA 3ZQJA 4ECEA 4NTZA 4B48A 4W9NC 4TVKA 4HWTA 5TS3A 2C31A 4LHWA 4XDHA 4EG7A 4BXOA 4M8NE 1KY5A 3TB4A 4LOKA 1BHJA 3CF4A 3LBIA 1EFDN 1SUAA 2C2ZA 1NIPA 2HFJA 3EEQA 4OGKA 2EFYA 4WCVA 1GNSA 3W2GA 4KP7A 1FX1A 1Z29A 3C6BA 4M76B 3TRDA 2F3TA 1JIIA 3E05A 5ALSA 2EFHB 3C5WP 4HL6A 2DFPA 3FHTA 4IV5A 3CCCA 4N6NA 2F6RA 5L7YA 4I36A 2WT8A 2GZDA 2ZIXB 3NDRA 2YRWA 1Z26A 3FOWA 4UOZA 3WV4A 1Y3FE 2UYHA 4QGFA 1YZVA 5DBIA 3LMKA 1JDTA 2O2JA 5FQOA 4ZV4A 4EF5A 3EWSA 4EL0A 5K5EA 2VH1A 1E6KA 3O2JA 2I03A 3V1NA 1PV4A 5KEIA 4MDFA 1C1XB 4LCBA 3S70A 3WLRA 4ETWA 1HT1E 1WOMA 1XMXA 1DS6A 4B17A 2I0FA 3VOBA 1JKJB 4JIGA 4UJ3A 2ONCA 2X5XA 4TXMA 1D7OA 4OF4A 1X94A 1OLSB 3L6DA 4KYIB 3JYLA 1D3AA 10MHA 1YV9A 4J29A 4PLZA 5F4BA 3LNTA 2AMFA 3RRFA 4MUNA 4C76A 1JDBC 1AS2A 4JUCA 4Q21A 2CMKA 5TQJA 2Y93A 2BSAA 3CU5A 4F8JA 3IGFA 1EG2A 5CFLA 1YB7A 3DVQX 3IRVA 3Q1LA 4URUR 2E0IA 2B1QA 5EZ6B 4ZVVA 1EH5A 1LK0A 3FNRA 3P94A 3R6WA 2EFJA 1ZUNA 4G1FA 2RIPA 1F3LA 4CXMA 4ZODA 1FNCA 2ATXA 3B60A 1MQ8B 3KJFA 3NHRA 4R2WA 2BR4A 4C3VA 4DIFA 4AF7A 1WDWB 2ZSKA 4S2EA 2X6TA 1WCYA 3LD9A 3LECA 4QSMA 5IT4A 3CLRD 3PTZA 3G7SA 5EESA 3EUWA 1FJHA 2XRYA 3M1IA 4K7JA 2JIZA 3VYRB 2VP2A 5ESRA 1MA3A 4P3OA 3L93A 1PL0A 2J9GA 2XJ4A 1P8JA 4R1LA 3ZIDA 4YRBA 2PSFA 3D54D 3E23A 2HQOA 1Y89A 5JNLA 2A58A 1M1ZA 3T7SA 4RZSA 1U7DA 4YN3A 2JEYA 1R0KA 3ME5A 5F98A 1J7KA 1NXQA 1NV9A 1VHWA 2K4MA 3FWYA 5CD9A 3DT8A 2GUGA 3S99A 1JPUA 1VA5A 3GEGA 3PNLA 5EGSA 4NBSA 3RU9A 4U9UA 4KR0A 1R00A 3TD9A 3HHPA 3FY4A 3OPYA 4LOLA 4ND1A 2GDZA 2QL7A 4LGCA 5AW6A 5F1OA 4A0GA 5AQEA 5JJBA 4YRDA 4J9VA 2X4IA 1E3EA 1XALA 1UOPA 1NX6A 1NG1A 4G5GA 3VPXA 3VSCA 4NRDA 4RA6B 5I7FA 3G9XA 4GMDA 3U44A 1JXOA 4KXVA 4KR9A 4R1NA 1A8SA 4A1FA 1W0JA 2CK3A 2Z8ZA 2X1HA 3L6UA 2WICA 3CBGA 3F7NA 2O5RA 3H5WA 4B2PA 3PDWA 3IPXA 4BV3A 3CEMA 1XYGA 3KSDO 2XODA 5ELXA 4AKTA 3T5AA 1KEEA 3ZW7A 2CLSA 3DQZA 1ACJA 4J4HA 4I4TF 4DY4A 2XB9A 4K5QA 4P98A 2IW1A 5KOYA 2CZGA 5IK2D 4XSGA 2Z6QA 2ZJAA 4D1YA 4L1KA 1BN6A 3ICVA 2EQAA 1MHPA 1G18A 3N8DA 1AGNA 3PCXA 1Q0SA 4YAGA 2XBMA 1CUJA 1TZCA 3R5KA 5DHUA 3WLHA 4RF4A 4LV5B 4NAUA 4LYYA 5TJ9A 3HJUA 4LBZA 3HA2A 3OLCX 4KQCA 2A9FA 2FA9A 1XXLA 2VF5X 3C3WA 3QXXA 4YJDA 4S2UA 2BDTA 2GN9A 5EHIA 1YDFA 3E2IA 1U8EA 2CXNA 1W0KD 4R3UC 2WSSA 4CKBA 4EHDA 1SO8A 4I1VA 3VR5H 2YQZA 2BBTA 2GFHA 2PAAA 2RBKA 3GEHA 3VZRA 4U7HA 2C88A 3LRTA 1C0PA 4EM6A 4M0FA 5E9WA 3M2TA 2FGJA 2VHWA 2J09A 3AI3A 3F98A 3CVUA 4TLDA 3WRWA 1DMSA 4EPRA 1GNVA 3TW6A 4DNXA 2ICAA 3LYLA 3N2LA 4YEDA 3T1YB 2C7RA 1I2AA 2PEYA 4JBLA 1ZGAA 2VDRB 5ALNA 3T5MA 3E7PA 1RAAA 1NX9A 4N6OA 1V3TA 1AQ6A 2F90A 3FSRA 4FSHA 3NOQA 4NOMA 4O63O 2VAMA 3ZWYA 1Z0IA 3GBPA 4OPMA 2V54A 3RKUA 3UUFA 5EYPA 3IPCA 2BM1A 4LDRA 2GCPA 3LCJA 4LKRA 1HWYA 2DPLA 3FCXA 1U1GA 2HNAA 4FGKA 1F5NA 4WHMA 5HXAA 1SKYE 4IGFA 1HDXA 3WSVA 3KHUA 4GMGA 1T25A 4EOGA 4M9RA 1MJNA 1VI2A 4IDCA 1TTPB 2F1HA 4FGZA 3RFCA 5ALKA 3W05A 3L7JA 1RRFA 3VR1A 3UT6A 1IJFA 3WDKA 4DMLA 5FP0A 2TMGA 3GRAA 2ZIGA 1K75A 2EX4A 2YHIB 3D6UA 3I1FA 4WNIA 3ZOZA 3R9XB 1F2UA 1E6WA 1EI9A 1GEEA 1I1OA 3N9IA 1E58A 3HCBA 1UJ4A 2A94A 2VPWA 1NC1A 3PC3A 5G4KB 3T5GA 5AM2A 1T8PA 1EEHA 1F0NA 2DU8A 2NNWB 3DKVA 4KGVA 1I51A 4E15A