3JQFC

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 1,3,5-triazine-2,4,6-triamine (ax2)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
molecule tags Oxidoreductase
source organism Trypanosoma brucei
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
total genus 91
structure length 247
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqfC00
3G49A 4GSKA 3HFSA 1SZJG 4F6LA 1E3WA 3FWNA 2HMSA 2OHXA 3QWBA 4IUYA 4RJTA 8LDHA 1H5QA 1KOLA 4KWHA 2BI7A 2WWRA 3PQFA 1NFRA 5TX7A 1P9LA 2PZKA 1SC6A 1E6EA 3JQAB 4U0KA 4B79A 2VN8A 3WJ7A 2NNLD 3RAJA 2NTJA 3RC2A 3BHMA 4E5PA 3RUEA 2HJRA 3FHLA 1U28A 3JQ7A 1RM4A 2VYND 4HADA 1WPQA 4W9NA 1UZLA 3KBOA 4AG3A 5LDGA 1XG5A 5JW6A 3OM9A 2EEZA 1A7KA 4NU5A 4PG8A 2E48A 1ZSYA 4EJMA 3F5QA 1QLJA 1B14A 4LW8A 1XU7A 1LQTA 2VZ9A 3T7CA 4ZQGA 1EBFA 4W9NC 2C07A 4BNZA 2DUUA 3JQGB 5DZSA 3VKUA 2J5KA 4ALNA 2HRBA 1Z74A 1CYDA 3R3SA 1P1JA 1I3MA 1ISJA 3GR6A 4NBUA 3D0OA 1MLDA 1PR3A 2JFGA 2QQ5A 4RVSA 2IEDA 2IXAA 1BW9A 1ISGA 1NQOA 3WNQA 4ND2A 4BVAA 3DZIA 5FI5A 1W0CA 1I2CA 5AXDA 4RF4A 5KOIA 4BNMA 3OA2A 2CVZA 1B0AA 2PKQP 2P9CA 4U7WA 4TWRA 4NI5A 1SOWA 1P3DA 4WLOA 1M76A 3WOHA 4E33A 3RFXA 4U5QA 4QSMA 1ISHA 3TF5A 3I9JA 4CPDA 4BKOA 3ZWCA 4BNVA 3LF2A 4UVHA 2Q2QA 3VC7A 4IDGA 4YXFA 3ZWAA 1H2HA 4P22A 3RUDA 2TMDA 1WLYA 1BG6A 4I5GA 3OICA 4IGEA 3U49A 2J3HA 4RQTA 5DDIP 2FSSA 1LSOA 4M1QA 4PLYA 1NYTA 3G1TA 4IJKA 3WTBA 1O6ZA 3QY9A 3WR5A 1ONPA 3NV9A 4OH1A 4CUJA 1ADGA 2AE1A 3B6ZA 3D4OA 3TRIA 2JL1A 2IRWA 4DQXA 1JKFA 3LT4A 1S7CA 4YT5A 3PGJA 1WDMA 1P1HA 2B5VA 2VWQA 1XEAA 3C7CB 2I3GA 3IAHA 4Y6RA 4BO1A 1H6DA 1JWAB 4MVJH 1BWSA 3FNGA 3RBZA 2BMAA 2FPIA 3QVXA 4HFRA 5BSEA 4JBHA 1LBEA 4WCFC 1N8KA 4M54A 5JDIC 3JD1A 4NFYA 5GMOA 4OSOA 3ZWPA 1IPEA 3PTZA 4GSLA 4KDEA 4CM4A 1VM6A 3E82A 2ZB3A 3WNVA 3SX2A 3GVHA 4QUKA 1F17A 5A9SB 4IZIA 3HJAA 2O3RA 1LDYA 3LK7A 1LQUA 1NBOA 2NLOA 1P0FA 1QORA 4FN4A 3ROKA 1DHTA 4GH5A 1BVUA 2IE0A 4IZHA 5JCJD 2FY8A 3PK0A 2Y1DA 4JJFA 3DMYA 1SPXA 2PNFA 4G2NA 5EN4A 5EQFA 1YB1A 4I5EA 3GNQA 3TSCA 1VRWA 1DJQA 1ZUD1 4XA8A 3SJ7A 4ZICA 3WSWA 3KOUA 4BMNA 1ADFA 4BMVA 4J7XA 3S2IA 4ND5A 4ND1A 5CFZA 4QFDA 2J3JA 4XX0A 4CMHA 1R12A 3RASA 3AI2A 1LLUA 1ONOA 3D5QA 3JTMA 3KYDA 4NK5A 4YRBA 3MJCA 1GUYA 3DONA 3ANNA 2AE2A 4K6CA 1UXHA 4CUKA 1HE2A 1BXGB 5I8ZA 3GZNB 3ZWWA 3NGXA 3OETA 4LN1A 1I5RA 3Q3CA 2O48X 3JQCA 2YHIA 2P9EA 4LISA 5TJHA 1YL7A 4EGFA 1C0PA 3KSUA 4LVCA 4E5YA 1I2ZA 3OJ0A 1UZNA 2AQ8A 2H6EA 3JYOA 1HDCA 4FOOA 1F06A 1QYDA 1CQJA 2HMWA 3HZZA 1G0NA 4D0RA 1ISFA 1XR3A 1HLDA 1LC0A 2BI8A 1IZ9A 3JQEA 4I08A 4WNCA 4AJHA 1F0YA 1DC6A 4IQ8A 1EK6A 3EK2A 3O26A 1GPDG 4J49A 2GRAA 2EW2A 3I83A 3UVEA 1R37A 1FK8A 4PN3A 4R01A 3H2SA 3DZJA 4HUJA 2GN4A 3ZWMA 2QW8A 3U5TA 4E5NA 5I7SA 1CWUA 3STHA 2D1YA 7MDHA 3KLPX 1ONNA 2DFDA 1C1XB 2EP7A 3PRJA 3KHUA 3ZU4A 2R00A 3UCEA 4D7AA 4RPJA 4XEHA 1T4DA 3D3EA 3MTGA 4ALKA 1N7GA 2I76A 4B4OA 3DMTC 4IDCA 3IKTA 4BGUA 1PS0A 3AM3A 3OHSX 4OL9A 1ZJYA 1K2WA 1Q0LA 3NJ8A 5C7IO 3JQ9A 2CF5A 2JJYA 1NVTA 5F1PA 4BO5A 3VH4A 1KEPA 1SO8A 3EC7A 1KEUA 3QHAA 3MWDB 2CMDA 3QWIA 4WUVA 1Y8QB 1O0SA 4LSMA 1PJCA 1VJ1A 1SAYA 2I6TA 1I01A 3E8XA 1JU9A 2ZTMA 3G17A 1O8CA 4J0FA 2OL4A 2QRLA 3PWSA 3ZW9A 4BO0A 1OC2A 3G79A 3L77A 1ZZEA 2LDXA 2C7VA 3NDJA 5CP8A 3ZV3A 5HS4A 1YBAA 4HFMA 5HRUA 2Q1UA 2X1HA 3PJFA 4W6ZA 1FDVA 2EKQA 1HT0A 2W2LA 2J3KA 3WFJA 3NKLA 4LMPA 3AM4A 4DLBA 1YRLA 4O6VA 1M6WA 1HF3A 1EEHA 1SBYA 4PIVA 4YRDA 5TNXA 2DBQA 3QA9A 3S2FA 2CVQA 3H9GA 3ZNNA 3OQ1A 4RPGA 5HWSA 4TSKA 4YJFB 3ZCXA 4CLXA 3LC1O 2JCVA 4XB1A 1GFSA 3VZSA 1DDOA 1C14A 1M75A 3JQFC 3VHRA 3HDHA 2WDZA 3C3XA 3K73O 2HLPA 4Q39A 5T6BA 4BNTA 3A28A 2Y93A 2AW5A 3RBXA 1ZMTA 5B4VA 1IUKA 4XQCA 1DRVA 1I33A 1LC3A 4CM6A 2NQTA 4X54A 4DRYA 3VZRA 1G6KA 4E2YA 4XJTA 1QRRA 2IZZA 5L4NA 1SB9A 2NVUA 3FNEA 1XSEA 4HNHA 4A73A 4NBWA 2D8AA 2ZATA 3IDSA 4W99A 1UP4A 4AJOA 3VVBA 3GVPA 4WCDA 3OECA 2WD7B 2YW9A 5KNLA 1N5DA 3HB4X 4BL5A 3ENNA 2I9PA 4CR8A 3MJSA 3TZ6A 3FI9A 2Q99A 3H5RA 1A9ZA 4CLRB 1IULA 4L9RA 2NUAA 1DAPA 5K9ZA 3V2UA 1GCOA 1GD1O 1Z82A 1R0LA 3IKVA 4I9UA 4WECA 2CNBA 1M66A 4YAIA 3KETA 2GGSA 4Z9YA 4N5NA 2VYNA 1RJWA 1E92A 3Q1LA 3VTFA 4CQLA 4UVIA 4MKXA 4BB6A 1PEDA 3IP1A 3S1LA 4GX2A 1BHSA 4BNWA 5A05A 1LUAA 4KP7A 3K96A 1KBZA 4ZQFA 1MP0A 1PX0A 4OXYA 4XQ9A 4MP8A 4WLVA 2C2YA 2H1SA 3NEPX 2RH4A 3AJRA 4DLLA 1VSUA 1A71A 4MVJE 2HMTA 3I4CA 3DDNA 4NR0A 3A4VA 1YQXA 2WYWA 1JWBB 1NP3A 2X86A 4IGFA 1WXDA 4GWKA 4D42A 1P77A 2AQHA 3K30A 3ZGYA 2Q4EA 1GDHA 3RJ9A 1PJ2A 5IFLA 1NXQA 3ASVA 1LLDA 2H9IA 1PS8A 3E48A 4OO3A 2ZYDA 3OIDA 1U3UA 3QWHA 1ZMOA 2CSUA 3Q9NA 3WJAA 1F8GA 3JQBC 2EJWA 4KQWA 2GERA 3HQ4O 3KLMX 2PGLA 4W4TA 4HY3A 1HRDA 5L40A 2FHSA 2EERA 4RZHA 1DBVO 1DLIA 2E6UX 3OIFA 2I99A 3EGOA 1QSGA 2P4HX 2X5OA 2NV6A 1VL6A 4B4UA 5DOVA 1MX3A 3WWZA 4TKLA 5I9LA 4J7CA 3P2YA 1I24A 2BD0A 1I2BA 1G0OA 3NGLA 3RD5A 4BGVA 3OQBA 1IB6A 2J6IA 4OYRA 5JE8A 3TWOA 2JHGA 3KSZO 3SVTA 2P5YA 3D7LA 4MINA 5CDYA 5HTOA 1PJTA 4EJ0A 3EDMA 3U62A 5AYVA 3UGKA 3VH1A 1DIAA 1WMBA 3F9IA 3FBGA 5FWNA 4R69A 1TT7A 3R3JA 1U8FO 2XXBA 1HE5A 3VKVA 4BIIA 2OOSA 3WMWA 2VHZA 4YACA 4MP3A 3LU1A 4XDYA 3ROQA 4UREA 3L4BC 4WASA 1SEVA 1VKNA 3F46A 4N54A 4CLEA 4CJXA 5BQFA 4Z0HO 2EKPA 1I8TA 3GPDG 2AG5A 1M67A 4M89A 3F1LA 3HE3A 1PGJA 5DCUA 4DTIA 2NU6A 4ZGWA 1R15A 3GGPA 4NDNE 4C4OA 4E5MA 3ZWYA 4ZQBA 2PD4A 1LU9A 4DIBA 2J5RA 5MDHA 2HKIA 1R6DA 4YQYA 4RCVA 4IDFA 1PWZA 4UULA 4J1QA 2FR1A 5FF9A 2EF1A 3DB2A 4A03A 3H6KA 3RROA 3UCXA 4PLGA 2I3AA 1D7OA 1V9LA 2CZCA 3FPCA 3A9WA 2QRJA 5CG2A 3O9ZA 1ADCA 3TPCA 3PGXA 3GMDA 1EFLA 2Q49A 2PGJA 2EV9A 1VJTA 4OKNA 3WYEA 3KYBA 4DA9A 1F12A 4U8GA 5TJ9A 2X5KO 2NM0A 2O7QA 2V6FA 4DXHA 2WD7A 1HSOA 2G5CA 2FOIA 4IJUA 5L4LA 4ZRMA 1X1EA 4NJMA 2QZ9A 1I0ZA 3WQRA 5L4SA 1UXKA 3GGOA 1U5AA 2X0IA 3K5PA 4WOKA 3DAFA 4MVJA 3RUIA 4GQAA 3AUSA 3SXPA 1PQUA 2WMDA 4FJ0A 2POQX 1E1LA 4J4HA 4PRKA 1HDXA 3I9LA 1RWBA 3QW2A 2NTVA 2W90A 4TRJA 4U0JA 3MOIA 1S6YA 4HNGA 3Q2KA 3RC7A 3OEYA 5FI3A 4CM9A 3FTPA 3EVNA 1WVGA 4A7PA 1OZAA 4MVJP 5JLAA 4M87A 3N58A 1EVIA 4YA6A 2YY7A 1NHGA 1GTMA 3DZGA 1QV7A 1GZ3A 4Z9XA 3GG9A 4CLHA 1IYZA 1E3WB 2IXBA 3C1OA 5G4KA 4GAEA 3BAZA 4LVUA 2XAAA 1GZ4A 4IDDA 5U4QA 3UHAA 4C7KA 4CUZA 2PA3A 4WLFA 1JDJA 4ZQHA 4R5MA 1PL7A 4BNHA 2EGHA 1HYEA 4MJLA 3GHYA 4XZ3A 4EUHA 2JHFA 2WTBA 4UUNA 5CDGA 1N9GA 3DZBA 1Q0QA 4XRGA 1B26A 3NAQA 5F3RA 3I4FA 4RDIA 2EGGA 2D2IA 3CXRA 1E3IA 1HKUA 4QXMA 1Z73A 1X7GA 3LT2A 5KTKA 5IN5A 5EESA 4OJNA 4FBGA 4A2CA 1VE9A 3DOJA 2Q2VA 1EQUA 4FJ1A 4RVDA 1ZEMA 3I9NA 5EJ2A 1PQPA 3H65A 4E30A 2NVWA 3OFSA 1M2WA 3LQFA 4E4YA 1K3TA 2YFHA 4XYBA 4BO6A 1QP8A 2JCYA 4RQUA 1B8UA 3HN7A 1CERA 2O3QA 3M2TA 4PGFA 4ZQEA 4OMUA 4YJGA 2G17A 3KXDA 5JDCA 4FGSA 1J0XO 3GRKA 4II2A 4MPDA 2CDCA 1PGPA 4Q3DA 3PZBA 4I9HA 2V7PA 3VPSA 1U4SA 2HMUA 3CEAA 1K6JA 3MJEA 4CM8B 3ADPA 4FJ2A 1QMGA 4PG4A 5CPBA 3X2EA 2Y66A 1XQ6A 3BMQB 4YRAA 3PXXA 1U1IA 4I9NA 3RFVA 3VH2A 3FWZA 2X58A 1Y8RB 3C85A 1GR0A 3JQBA 3ONDA 1GADO 4KMSA 4OOEA 3A06A 4BO9A 9LDTA 2PLAA 3KYCB 5JO9A 2FN7A 3EAGA 3I1JA 2HRZA 3JQGA 4DQUA 1R0SA 3VDQA 1NASA 2XXJA 5ER9A 2VCYA 1PQWA 3IUSA 4J9UE 4L75A 4IQGA 4O63O 3FR7A 1ZSVA 2DT5A 4HV4A 4E0BA 3GA0A 3EMKA 2FP4A 5KKAA 3RUAA 4AFNA 4UEOA 5A06A 5G4LA 2FR0A 3D3WB 2PD6A 5KCZA 3P19A 2ZK7A 4E31A 3M1LA 4R3NA 5EERA 2PGDA 1YO6A 2YDYA 2Y1FA 1B7GO 3GVCA 1A9YA 3DOCA 4TZTA 2Q45A 2DQ4A 4ZD6A 4PZCA 3RWBA 5ICSA 5TLSA 4H3VA 4HWKA 3GZNA 4HFNA 1ADBA 4EEXA 5JXWA 3GNSA 2PFGA 2GN9A 3RFTA 5G0TA 4BNJA 2CD9A 3ST7A 1BMDA 2PK3A 3JD2A 2ZCVA 5IDXA 1UAYA 2GD1O 1R4NA 4Q3BA 2X6TA 1T2FA 1R4MB 5EPOA 2YFQA 3DBHB 2HU2A 4TVBA 1LTHR 2VUSA 1HWYA 3DAGA 1I32A 2OORA 1NAHA 3EUWA 5KVVA 4AJPA 3ETEA 1XDWA 4YT4A 2P4QA 4D0SA 4DL9A 3TN7A 2Y0CA 3RQSA 4AVYA 4F45A 4Z6KA 3GK3A 3AU9A 4NMHA 2PKQO 4DIOA 3BYZA 4J43A 2P2SA 1ZW1A 1H6CA 3KTDA 3EYWA 3L4BA 2VYVD 1XCBA 4Y67A 2JKVA 4WK6A 2Q1WA 5AXBA 1GQQA 1PZFA 4CMIA 5JYDA 3C8MA 2W8ZA 1TA4A 1VKOA 3GF4A 2E37A 4JNKA 4PLHA 2DTDA 3ABIA 4YBZA 3ZWBA 1MC4A 2AEJA 5L7TA 3VPGA 1KY4A 2NVUB 4BNIA 3JQ6A 4WOJA 4PLWA 4I5DA 5EQDA 4PLFA 4P4LA 4EEZA 1E1KA 2ZKLA 3PDJA 4E32A 4A10A 5KIAA 1D1TA 3RC9A 2CDBA 3OP4A 1IOLA 3O38A 1AN9A 1KETA 1PJ4A 3NTRA 4MKRA 4GWGA 3BZUA 4AJNA 1E7MA 5DBGA 5K6AC 3WGTA 4FQ8A 4B3JA 4WEOA 3DL2A 1C3VA 2DUWA 2V6MA 3TL2A 1KIFA 3BMOB 1HYHA 5CDTA 3I6IA 4B7XA 4E6PA 4HP8A 1RKXA 4O0LA 3SC6A 4BNLA 2BFOA 3JCZA 2QYSA 1EVZA 2FZEA 1NVGA 3U4CA 3C1AA 1K89A 3FN4A 4WNIA 4YT8A 5J23A 4RF3A 2UV8A 3C7AA 3DTTA 4KZPA 5IDQA 1DEHA 1BXZA 1N2SA 3UXYA 4J16A 1MGOA 1YL5A 5L95A 3NDIA 4Z0PA 1Z7EA 1AUPA 3PJEA 5AOVA 4AICA 4IIVA 1DFGA 3WBFA 4N5MA 1E3JA 3EZLA 3FSRA 1I3LA 2FPPA 5TGDA 4PG6A 3ZHBA 1KYQA 1WAMA 5JDCC 1T2AA 2YJZA 2Q4BA 4OGWA 1LSJA 3GAFA 4B7UA 1R66A 3MJ4A 3B1JA 4J6FA 3DFZA 4O1MA 3EVTA 4TKMA 5BT9A 2VZ0A 4XCVA 4JBGA 4DYDA 1ARZA 2HAEA 4K9DA 3ZN2A 2PH3A 4IS2A 4BV9A 4EJ6A 3CPSA 1RM5A 1NWCA 2A35A 4GL4A 2VUTA 1LRLA 1PR9A 3TFQA 2UVDA 2ZTVA 3IJPA 2GNAA 1GUZA 4IDAA 1YJ8A 4XIJA 3WDSA 4JBIA 3PFFA 3WB9A 1U3VA 4UUMA 4IY1A 5JMPA 3PYMA 4IMPA 3W8FA 1GQ2A 1ULUA 5DULA 1H2BA 4AJEA 2C5EA 2ZCUA 4JN6B 4TMFA 5TIIA 2Q3EA 4ITUA 4YAEA 3PYLA 4YPOA 4L8VA 1P31A 4H7PA 5IZCA 5K0ZA 4CLRA 2DPHA 3I23A 3D1LA 4YTEA 1JN0A 3RI3A 1AHIA 3E5MA 3AI3A 1EDZA 1YB4A 4DREA 2Q1SA 3GQVA 4JROA 2Z5LA 4AJKA 1TLTA 1O9BA 1W6UA 2VHYA 3UH1A 3JQ9C 4Z9FA 3ZWXA 2OMEA 1KVRA 4CMGA 1CRWG 1UXGA 1YH3A 2O3SA 4Q3EA 1GV0A 1E77A 2JD2A 4BNYA 4BHTA 3X2FA 2EKLA 2VHVA 5C37A 3GEDA 3M1AA 1PS9A 2VNAA 4RVHA 4NJMB 2IEBA 3LT0A 3U3XA 1H94A 1BDMA 3JYQA 3C24A 3GRPA 3ZU5A 3BTSA 3FR8A 3RUHA 3HSKA 5L51A 4B3HA 4G65A 2GR9A 3BXXA 3B20A 1YL6A 1BDBA 3LLSA 1RPNA 2ZB7A 3GUCA 5G0WA 4I1IA 1E6UA 2SCUA 1NAIA 3L4SO 3Q0EA 5TS3A 4CM1A 1LEHA 3TZHA 4MOWA 1QYXA 3QRWA 4XYMA 2A4KA 3WQQA 4E5KA 2FR8A 4CM7A 5CEFA 5JDIA 1EE9A 3UFXA 6LDHA 4FC6A 2HCTA 4PG5A 5HS6A 3GFBA 3RKRA 4L73A 4B8ZA 3U0BA 5ILGA 2HK7A 3ZDFA 1SNYA 3K92A 2G1UA 1QYCA 4BUCA 3BMCA 4N5LA 4CQMA 5U9CA 1IPFA 4MVJG 2EW8A 3UUWA 4YJHA 3G3EA 3ZHYA 2BGKA 3DFUA 4R5HA 2V6GA 4Y6SA 1O5IA 3VTZA 1ZEJA 3JQFA 3ZWOA 4JCOA 3FRJA 3ZV6A 3Q2IA 4UEJA 1H9AA 3NRCA 4FFNA 4ALLA 2O2SA 2BF7A 3N74A 4YR9A 3RCBA 2VOJA 1X0VA 2YHIB 4JXKA 4QX6A 1ULSA 3I3OA 3AOEA 4U6QA 1OBFO 4IXTA 1HEUA 3AOGA 3R6DA 3ZV5A 3BMOA 4FW8A 1ZKMA 2O3UA 5T8KA 1CJCA 1LSSA 1GL3A 3AUTA 1QV6A 3IC5A 2VWGA 3U09A 1B16A 4TRMA 4ZA2A 1UH5A 4XJSA 2BH9A 1D4FA 1VLLA 2OZPA 2RHCA 3CTMA 3WGZA 4PRLA 1F14A 3JYLA 4NH4A 4R68A 1O89A 1FDWA 2GYYA 3GNTA 4J1TA 2GZ2A 2C7GA 3GN2A 1CEQA 1NPYA 3M2PA 4JP3A 2J3IA 3E9MA 3ZNOA 3RU7A 3FBTA 3KEQA 4IJVA 1L7DA 1ZBQA 4R4JA 2ZB8A 1YE3A 2C82A 3JD4A 1YVEI 4XB2A 3MJTA 2HSDA 1ZJZA 3UAGA 3QVTA 3WIEA 1H9BA 2ZJ0A 3BMNB 3V2GA 4FFPA 1HDOA 1O94A 2JCXA 3QWAA 3GOHA 3IL2A 1BXKA 4ALJA 2QX7A 2VRCA 2Y68A 3GDGA 2C20A 1NHWA 2WYUA 1WP4A 1ZFNA 1KVTA 3QLJA 1XWFA 1JKJA 4CMKA 2X5JO 1PJSA 3AY7A 4K26A 4D41A 3MWEB 3NTQA 5T67A 1E3SA 2DFVA 1V6AA 3FCOA 1O95A 2IDZA 1YGYA 1KVQA 3CMCO 4ZJUA 5JMWA 3WQSB 2O4UX 2B37A 5IF3A 1AXEA 5B4TA 5C3MA 2DVMA 2B4QA 5A04A 5CEJA 5COQA 1UJMA 4XQGA 3EW7A 1LDNA 2VWHA 1KC3A 2Y0DA 4YJGB 2HUNA 4B8WA 2WYVA 3HN2A 3QVSA 2EXXA 3PP8A 3F4BA 1HETA 3EZYA 1YBMA 2R00C 2W2KB 4YEDA 3WG9A 2RBEA 2BFPA 4BNFA 4JIGA 4BV8A 4E3ZA 4R1SA 4L0QA 2AG8A 2PWZA 4E12A 1T2CA 3A14A 2DBRA 2GPTA 3LZ6A 3ZV4A 4B4VA 4NNJA 4R51A 5AXAA 1U7TA 4OAQA 2DM6A 1HLPA 1VSVA 1NPDA 4PLPA 4XYLA 3PFWO 9LDBA 4DBZA 4EBFA 1V3UA 1W8DA 2B0JA 2HMVA 4WLEA 3DZFA 4DMMA 2C59A 4DYVA 1ZK3A 1D1SA 2X9NA 4XGKA 2B36A 4JJGA 5TSDA 2VNSA 2Y1OA 1P74A 1JVBA 4EW6A 2UUPA 5T8KC 3O8QB 2E4AA 2PD3A 4NZ9A 4INAA 3BMCB 5LC1A 5TT1A 4CMIB 3D3WA 3PPIA 4PVDA 1P33A 3D5TA 3FF4A 4IDBA 1YONA 2VRCD 4JX8A 3PWZA 3DMTA 3NT4A 4MP6A 1CQIA 2P91A 1EUDA 4AJIA 4XR9A 2GN6A 1UAGA 2VZ8A 3WGGA 4TVOA 5AVOA 3DC2A 3Q11A 2ZB4A 1GEEA 3VVCA 2CVOA 2QG4A 2IYOA 5H83A 4R9RA 1QKIA 2C2XA 4GLOA 3TZKA 4PFJA 1GYPA 3DZKA 3SLGA 5KVSA 3OJLA 3W6UA 4NG5A 1L1FA 2P68A 3AU8A 4NK4A 1Z75A 3KVOA 4LGVA 4CM8A 5C5IA 1KY5A 3GN1A 1R4NB 3I5MA 3V5NA 4DLAA 5BNTA 1YJQA 4PLTA 5JS6A 3MOGA 1E5QA 3H9UA 2YQ5A 3BMQA 4BO3A 1DO8A 3ZHXA 2V65A 3DBLB 4OQYA 1Y8RA 1N9GB 3IUPA 4M86A 1DPGA 3GHHA 1X13A 3RJ5A 3B1FA 3GVXA 2RH8A 1ML3A 4QEDA 4K1LA 4L4RA 4CQMD 2BRUA 3TOZA 2A9FA 4B4WA 1A4IA 1PZEA 3ETDA 3ZH2A 2W4QA 3G1UA 5JAIA 4O5OA 3GG2A 3KRTA 4XDZA 1KS9A 1CDOA 3V1YA 1N1EA 5B4UA 3A1NA 3IJRA 2DKNA 1EE2A 4QQRA 1ZSNA 3HDQA 2NU9A 5KVCA 1T4BA 2YYYA 1LJ8A 1W73A 3F47A 4CMCA 2B4RO 3W4IA 3PHIA 4E2WA 2RIRA 3DBRB 5THKA 5JO0A 1PL6A 2C29D 5EMHA 1B3BA 3GDOA 3PHLA 4XQEA 1MXHA 2HO5A 2DTEA 2OBNA 1YDEA 1I30A 5T5QA 3UOGA 2DU8A 3WFIA 4RO0A 3K9QO 3OQ6A 1MG5A 3OJEA 5L3ZA 4NBVA 5CAEA 1E5LA 5C7OO 3GUYA 4CV0A 4WCFB 1UZMA 4QECA 1HDRA 5I7EA 1NQAO 4ONEA 4OSPA 5DCWA 4L74A 1PZGA 4NFHA 5COAA 4M49A 4DC0A 3BTOA 5COBA 1H93A 4GVXA 1BGVA 1E3EA 4N18A 4S3MA 3NT5A 2W2LD 1IE3A 3WSVA 2O23A 1ZXLA 3CKYA 3S8MA 3TDKA 3GVIA 1HXHA 3JYPA 1X1TA 4E2ZA 4HKTA 1FDUA 3T7EA 2Q46A 1ZK4A 3KO8A 2OXIA 4EITA 1VL8A 3OF2A 2EIHA 4R3WA 2PR2A 2ZTUA 3ADOA 1Z6ZA 4A0SA 1Q7BA 2WE8A 4GX5A 1H6AA 2ZIZA 1DC3A 4M8SA 1GAEO 4CM5A 3NUGA 4WE3A 1J49A 1KVSA 2JAHA 1T2EA 4BKUA 4DPMA 2BELA 2B69A 4BOYA 4GLLA 3LT1A 1SOVA 1DIRA 3P7MA 4FS3A 4H16A 2PY6A 5C7LO 4NIMA 4CV2A 2V6BA 1DFHA 1D8AA 3S2EA 4BQRA 4IDEA 5AXCA 2GZ1A 1CIVA 1TI7A 3LF1A 4YJDA 2VHXA 1KVUA 4FC7A 5B37A 4EDFA 3TFOA 3GAZA 1NQ5A 2GLXA 3UW3A 3LC7O 4JJIA 3KB6A 1U2DA 2D3TA 1V3TA 1HDZA 1YQGA 5I7VA 4F6CA 4NU6A 1AHHA 2YDXA 1U3WA 1HZJA 1U7HA 4G81A 3W4JA 3RIHA 4MDHA 5CG1A 3PLNA 3H4VA 4PLZA 4QFCA 4NPCA 3JQAA 3QJ5A 5F5LA 2BFAA 2EG9A 5FFFA 3UF0A 4BNNA 1B2LA 3AY6A 5B1YA 2X0JA 1FF9A 3KZVA 4PG7A 1PWXA 2ZQYA 3QSGA 2Q50A 3U4IA 2DTXA 2NQ8A 1TVEA 4FOSA 3OA0A 4CLDA 3F6YA 4R9SA 1UXJA 3JD0A 1CETA 5CEEA 5KJEA 2ILTA 5B12A 2J5QA 3ICPA 2W98A 1T25A 3HFGA 3WWYA 1WZEA 4QT0A 1FDSA 1K6XA 3DXFA 1KEVA 1ZK2A 4MVJM 1X7HA 1MV8A 2G82A 3PLRA 3IQDB 4AJ1A 4BB5A 3IOYA 3D4PA 3DHEA 4RZIA 5F5NA 1Y81A 1TXGA 1KERA 3DHNA 1Q0HA 4TRNA 1GCUA 1U3TA 3EY4A 4FDAA 4BKRA 1E3LA 2FWMX 4W7IA 1YKFA 5ENVA 4XR4A 1NVMB 2GUGA 1DAOA 5TRTA 2X23A 4CL8A 5EIOA 1NNUA 1V8BA 1EVJA 3JQAD 1HE3A 1Q7GA 4XRRA 2O4CA 1DIHA 3DBRA 1VC2A 3TJRA 5DF1A 2QYTA 1HTBA 5IN4A 3C7DB 1P1FA 3NDRA 1JW9B 4FFMA 2O50A 4GMFA 3CZRA 2H63A 1V3VA 3L6EA 4ROSA 3AUAA 1MFZA 1LRKA 3KV3O 2AEFA 3GLQA 1NR7A 1H6BA 5IXYA 1DJNA 2X22A 1EVYA 4RV9A 1FDTA 4CMEA 5DCYA 1E0DA 4WPGA 4ILKA 1MUUA 4Y98A 4AJ2A 4Y8VA 1NFFA 4L4SA 4GI2A 1NX6A 1WW8A 2O3JA 3BIOA 4YWJA 5A3VA 3G0OA 5K6AA 4YCAA 4Z0TA 2DBZA 4R1UA 5HBRA 5L7YA 3QE3A 1HZZA 2EP5A 3DBHA 1KC1A 8ADHA 2Y99A 3QVWA 1H0KA 5KVQA 3CINA 3DBVO 1NR1A 2O3TA 1FJHA 4FFRA 1BW9B 1OFGA 4GVLA 1Z7BA 1J6UA 3WLFA 2IODA 4MVJI 4FCCA 2OUIA 2YV1A 5BNFA 4A5OA 3DAPA 3HDJA 1C1DB 3E5RA 1PTJA 1ZK0A 3CE6A 3FNFA 3INTA 4RVUA 1YBVA 1Y5MA 3HADA 3U4DA 1P0CA 4RGBA 3ZW8A 3QVOA 1JA9A 4R41A 1YOVB 3L07A 3SLKA 1EBUA 2VYVA 1JTVA 1HL3A 3BTVA 1YWGO 4IQ0A 2EHDA 3PQDA 4J4BA 2UYYA 1LSUA 3TQHA 3RUFA 3DO5A 3TL3A 2RAFA 1DRWA 4TRRA 1UUFA 3PJGA 3HG7A 4UVEA 4Y6PA 5A03A 2I67A 1Y9AA 5JAMA 4UAGA 4P38A 3QWFA 2DLDA 3JV7A 4QTZA 4FFOA 1EK5A 2OO5A 5A1TA 3E1KA 1N1GA 4JQCA 3I9OA 1Y7TA 1E7RA 1A27A 1A7AA 1MXFA 1Y6JA 4PVCA 4CV1A 5ITWA 5DP2A 3P5SA 1ZVMA 2JD0A 2JFHA 1R4MA 4ALIA 3M6IA 4YDRA 1VJ0A 1UP6A 2H5LA 5JAQA 2D5AA 4YT2A 2A92A 4WLNA 1C0IA 4ESOA 1BTOA 2Y67A 3KYDB 1LDBA 2ZQZA 3OMLA 5KJ6A 3U4HA 3LSYA 3H3JA 3HWRA 5MGBA 4JP2A 1PL8A 3ZZNA 5JC1A 5ER6A 3WYBA 1K0UA 1LRJA 4GKVA 4F46A 3HB5X 1U4OA 1DIGA 5I7FA 1DHRA 2OBYA 1ENYA 1HE4A 1U2GA 2QIOA 4BQPA 1JVSA 5TF4A 3ROMA 3PWKA 1GEGA 3T4XA 1U9JA 4DVJA 5A3JA 5AQ1A 2X0NA 2D59A 1XLTA 4DIFA 4UEKA 5A9TA 1X15A 4HX5A 1XKQA 1QG6A 4HFJA 4MKZA 4CMAA 1LDEA 2Y1EA 3H3FA 5DN9A 4LRSB 1TT5A 2B83A 3WGHA 4R1NA 3T4EA 3WGIA 4P8RA 4AJ4A 5IG2A 5KWEA 4BKQA 5G0SA 1K5HA 5ILOA 1FXSA 1PZHA 3WGYA 2WM3A 2GZ3A 4FD3A 1I3NA 1G1AA 4KUHA 3BHIA 3IP3A 3IS3A 3RSHA 2AHRA 4A27A 1E1MA 1X14A 5BNIA 3ORFA 1IHYA 5TC4A 2VTEA 4CLOA 2DC1A 3KM0A 5GY7A 1DRUA 3LC2O 3ULKA 4I8XA 5DNAA 4FFLA 2BGLA 3E9QA 1PJ3A 1A72A 4CV3A 3PHGA 4DBVO 1T24A 5JBIA 1B3RA 1CF2O 4Q3NA 1JKIA 1ZNQO 4L4XA 5GZ3A 4YJHB 3QP9A 3CH6A 1M6HA 1NPTO 1XELA 2DBVO 2Y0EA 5EL0A 2IZ0A 3GEGA 2Z1NA 3N7UA 1BRMA 3MJVA 2W2KA 2E49A 5CDSA 3GZ4A 2TMGA 3K8ZA 4RL6A 1R16A 5IDYA 5IDWA 3AW9A 4J3FA 4FPXA 1J5PA 4BMSA 1ISMA 4RF5A 1EFKA 3F3SA 5TT0A 1LLCA 1EZ4A 2P5UA 3PQEA 4L76A 4CMBA 3F1KA 2FRDA 5G0UA 3ON5A 4GBJA 5JSFA 1OC4A 4BO2A 4OXNA 1NFQA 4XGIA 5L7WA 3I9MA 4CM4B 2G0TA 2JD1A 4OHUA 1I3KA 1SCUA 2Z1MA 2PH5A 4IXWA 1KEWA 1GU7A 4OM8A 4GKBA 5FYDA 1MFPA 4FGWA 4WKGA 4CMEC 4OQZA 3VPFA 2B35A 1BSVA 2ET6A 3O4RA 3R1IA 4GMGA 3SEFA 3UN1A 4CR6A 1XGKA 3GEMA 3H7AA 4D3DA 1MB4A 2RHRA 3AK4A 3JSAA 4Y9DA 3D64A 2OGUA 4D3FA 2D5CA 5JC8A 2HJSA 5A5EA 1E6WA 1RYEA 4MIOA 4D43A 3CZMA 3K6JA 1PGNA 1MA0A 1IL0A 3W8DA 1P1IA 4LRTB 1GQYA 1V0JA 3AUUA 1ID1A 3JD3A 4URFA 1ENPA 4J4TA 2F1KA 4BKPA 4CR7A 4GGPA 4OOFA 3R0IA 5ES3A 3S2GA 1T1SA 2XOXA 4IMRA 4JK3A 5I8WA 1TEHA 5U1PA 2I65A 3OJOA 3Q9UA 1JAYA 4RPLA 3BMNA 2LDBA 1PU2A 3W4KA 2XPCA 2CFCA 1HYGA 5LDHA 2D4AA 4D79A 3DWFA 3PHJA 2C0CA 4D44A 4PLVA 3DHYA 1EMDA 1PJLA 3GGGA 4ALMA 3BHJA 3WYCA 2Q1TA 3TOXA 4DPKA 1ENZA 1U8XX 2R6JA 1JLLA 1MG0A 3PI7A 3NYWA 1T1RA 2A94A 4RPHA 4YYZA 3WXBA 4G5HA 1N7HA 4UUPA 5JY1A 1EUZA 1E7WA 5KJFA 2YV3A 3D4NA 4W82A 4HBGA 1ZH8A 3TZQA 3LDHA 5IZ4A 5DT9A 1PJQA 3PDUA 4ND4A 1MC5A 3KUXA 3PZRA 4IINA 1RYDA 2OP1A 3GPIA 4PZDA 4DC1A 4GX1A 4OXKA 2X7HA 3LLVA 2GASA 2XF8A 2VOEA 1DB3A 3ITDA 2GF2A 3JYNA 1XA0A 2HK8A 2UUOA 1LX6A 1T2DA 1ZO8A 4PLCA 2VRBA 1C1XA 4U6SA 5L9AA 1EUCA 4J2OA 4ZU3A 2DAPA 2WE7A 4CQMB 3B1KA 4J7UA 1GPJA 3KEOA 1OI7A 2X4GA 3HUDA 4DGSA 2JAPA 2VHWA 1QR6A 2CDAA 3INGA 4J1NA 5JYEA 1VPDA 1B15A 5DP1A 3VAZA 2I5PO 3B70A 4YVFA 3ANMA 5BR7A 1WNTA 4WGGA 4XGNA 5A9SA 3ZI0A 3V1TC 2Y05A 5JAZA 4N7RA 1Y8QA 1W4ZA 1D3AA 3OBBA 5GZ6A 4P4NA 2PZMA 4BNUA 1XU9A 3IIEA 1HSZA 1LDGA 3JQ7B 5HM8A 5L53A 4J91A 4MVJD 1YB5A 5IZCC 3DBLA 5GZ1A 1UP7A 3HHPA 5IXSA 1GV1A 4AJLA 4YB8A 1E7QA 2VTDA 3V1UA 2NVBA 1JAXA 4BNGA 3ONFA 1UDBA 4DPLA 4ZN6A 5H81A 1NQTA 4LCJA 1WWKA 1FMCA 1YS4A 4B7CA 4NJOA 2F00A 1NWHA 2BLLA 3GT0A 3H5NA 1PGQA 4HXYA 1HDGO 4KUGA 4IPTA 4CMJA 3H2ZA 1Y5RA 2QZZA 4TZKA 2CUKA 1BXGA 1YXMA 4GX0A 4W7HA 3RC1A 4CL3A 4BGEA 2IYPA 3CMMA 4A26A 4EI2A 2WD8A 3H5AA 4JGBA 4EUEA 2AQKA 1DLJA 2B4TO 3NX4A 5EINA 3WTCA 1AXGA 4NFSA 6ADHA 4CODB 4Q9NA 1P45A 1HDYA 4RPKA 3TNLA 3F5SA 2VQ3A 1X7DA 2GO1A 3DZHA 2ZTLA 2GSDA 3RKUA 2WJPA 3VH3A 2UAGA 3V8BA 3VPXA 1OAAA 5LCXA 4P4GA 4BNKA 5CDUA 1DXYA 5BSGA 4WLUA 3BA1A 4Q3AA 1SB8A 5HA5A 1ZCJA 4J90A 4EZBA 2VT3A 1RM0A 1RM3A 3W8EA 4RLHA 4GGOA 3I9KA 3ENKA 1T26A 3DQPA 4R54A 2O2YA 1PGOA 5I9MA 3VPHA 3WX0A 4C7JA 4LCEA 2AA3A 1BVRA 2NWQA 2NU7A 4J9VA 2GCGA 2AQIA 3UICA 4WCFA 1C1DA 3PYXA 1I10A 2OFPA 3AOEC 5CHEA 4WEQA 1Q2XA 1WDLA 1C0KA 1YOVA 3HDYA 4J1SA 3ITKA 5A4DA 1LA2A 2ZYGA 2BGMA 3GMSA 3JQ8A 4AJJA 1E7SA 3GH3A 1J4AA 3RU9A 4FSHA 1UDCA 1U5CA 4LK3A 3I52A 5JNLA 1ENOA 3W6ZA 2O7SA 5DBFA 4F3YA 4TQGA 4D45A 1IHXA 4CM3A 5JCXA 2GN8A 1ZXBA 1UXIA 4II3A 5ENDA 3CSDA 1NM5A 1Y1PA 5FEUA 4OKIA 4M55A 3INRA 4IBOA 4D3SA 4ZHSA 1YDWA 4IS3A 1SEPA 3H8VA 1DOHA 1QXSA 4Q3CA 5TQVA 1JQBA 3PVZA 1P1RA 5F21A 1WMAA 4YQZA 2FPGA 3DR3A 1X0XA 3ICCA 3I6QA 1PIWA 4RORA 3VZPA 1N92A 2P9GA 4J2HA 3ROPA 4BO4A 5THQA 1I36A 3MTJA 2BFMA 1LXCA 1DFIA 5L45A 2R2GA 3O03A 4YAKA 3MCVA 1NTOA 3DTYA 2PV7A 1R0KA 5BSHA 3O8QA 3WMXA 5G2OA 3RUCA 2BKAA 2QHXA 4RVGA 3NTOA 5A02A 1ISIA 2C5AA 5A5FA 3GFGA 1DC4A 2QRKA 2YZ7A 3AY3A 2J8ZA 1DSSG 3GDFA 1K6IA 5G4KB 3TZCA 3WICA 1GYQA 1EDOA 1YQDA 2CY0A 2JFFA 2NU8A 2G76A 2VT2A 5ITVA 3CUKA 3SJUA 1Q7CA 5DOZA 5T57A 1QLHA 1L7EA 3COSA 4S1VA 3ASUA 4IM7A 3OEWA 1TT5B 3L0DA 4WJZA 3ZNQA 1A4UA 1VL0A 2YQ4A 2X9GA 4EUFA 4B3IA 4E13A 3PIIA 4KWIA 4QO7A 3ZWNA 2FZWA 4KQXA 2DPGA 5KJCA 4MIYA 2WSBA 4FIZA 5KKCA 5H82A 3OJFA 2ZJ1A 4E2XA 1C0LA 4Z3DA 3PIDA 4KTVE 2BHLA 3ZNPA 3H9QA 1V35A 1B8VA 4RVFA 4YAGA 4MO2A 1GUFA 4IJWA 3E18A 2GDZA 3K31A 3F4LA 4XIYA 3PJDA 3RBVA 1PSDA 2EJVA 1P44A 4MIEA 1WDKA 4R1TA 2X9VA 3WGQA 3L9WA 4XYGA 4K28A 4ID9A 4BGIA 4UVGA 1OOEA 3NJ4A 3ZHZA 4XD2A 1XQ1A 2NTNA 3H9JA 3ZU2A 4ND3A 2I66A 4TROA 3SC4A 5IJZA 2HQ1A 1LNQA 2FMUA 3P2OA 4NBTA 1DC5A 2RCYA 1GYRA 1IY8A 3QQPA 4PCVA 4XKJA 1VI2A 2HK9A 2NACA 3FNHA 3PHHA 4RDHA 4YAJA 3VOSA 3FPLA 2HDHA 3CIFA 5JFOA 3E9NA 3E03A 2Z95A 3WLEA 2AXQA 3LYLA 4BO7A 2Y1CA 2VWPA 4Z3KA 2PKRA 3OSUA 1PJBA 4NQZA 1GZ6A 3SBOA 3OIGA 3W1VA 1AGNA 4BNXA 4DWVA 5IAAA 2D0IA 1B8PA 1EQ2A 2C54A 4KUEA 1P1KA 4LSWA 4KTTE 4H15A 4DUPA 3AFMA 5DBIA 1Q1NA 2E82A 3WGOA 2PTGA 3L6DA 5G0VA 3HNPA 3FD8A 4BS9A 3RVDA 2X0RA 4PZEA 4I5FA 2ZYAA 1DIBA 3OH8A 4KOAA 4CLOB 4MVJF 4DMLA 4AL4A 3S55A 4R16A 3AFNA 2PZJA 3VZQA 3JQ8B 2CF6A 3ETGA 4UUOA 3NT2A 2AMFA 2B5WA 4GPD1 4QO8A 4D46A 4JLWA 1ZIDA 3QIVA 4BO8A 4E21A 5I9NA 5JPIA 3DEYX 5JY6A 1GY8A 3MEQA 1UR5A 2FSVA 3ONEA 1TB4A 4CQLB 5ADHA 2Y1GA 4YJFA 2Q2WA 4O59O 1Z45A 4ZVVA 7ADHA 5ICMA 2VUUA 3L6OO 3VDRA 1OMOA 2UDPA 3K2EA 1LDMA 1SMKA 2AEMA 3FTNA 4FR5A 4RLSA 2WEKA 3L9XA 4RF2A 5F1OA 3DOOA 3MZ0A 2YV2A 4CM9D 2IZ1A 2NADA 1Y9EA 1UDAA 5T64A 3UKOA 5KJ1A 3BTUA 1QYVA 3KYCA 3C1TA 5BSFA 1F8FA 3KSDO 4XYEA 2PZLA 3WBBA 4FB5A 5F1KA 3AWDA 4EYEA 3Q6IA 1XYGA 3QV1A 4J0EA 4KDFA 1IZ0A 5A9RA 4NHEA 3UCFA 3E6AA 1E1NA 3IMFA 1QYWA 4OIMA 3ANLA 3PEFA 1XIVA 3GY0A 2YHUA 3K2BA 3AM5A 4IIUA 3ZU3A 3LVFO 1XHLA 4UVDA 3JQDA 5JCJA 1LLQA 1AE1A 1A5ZA 4DQVA 2OP0A 1ZK1A 2X8LA 3V2HA 1LI4A 3U9LA 3AI1A 3WS7A 2NSDA 2YUTA 3GC6A 3EHEA 4K6FA 4LMRA 1E7YA 5CPFA 4XWYA 2EWMA 3WIDA 4NBRA 4ZRNA 3ZWVA 1ORRA 3H9EO 1WZIA
chains in the Genus database with same CATH superfamily
1A8PA 4YBRA 3SX4A 4F6LA 3F78A 1E3WA 4IUYA 3BXGA 3U81A 3QWBA 2W4MA 1JEOA 1FNNA 2H8KA 8LDHA 4YAUA 2ACKA 3PQFA 1NFRA 2ZT7A 3BRWD 1WEKA 2X3UA 3D6NB 4F6RB 5HIAA 1SC6A 2DPLA 1QP7A 1E6EA 1EJ6A 3JZAA 4B79A 1SQFA 4MDFA 1RKVA 2NTJA 1Z29A 1JQKA 3RUEA 4RBNA 1RWPA 4E5UA 2VF7A 5K0SA 1Z47A 2BC9A 1FTGA 2L42A 4D57A 3SHWA 1PZNA 2L2QA 3GGSA 1A50B 3EQZA 1UZLA 1VKZA 4KLCA 3OM9A 4CYMA 3RANA 4KQ1A 2IGBA 1DKPA 2G83A 2GZMA 5KYYA 2E48A 1J8FA 1RXVA 1QLJA 1B14A 4LW8A 1JG2A 2I4LA 2QRGA 4KAXA 2JH9A 4LVOA 2MIIA 2F8SA 4IKOA 4BNZA 2VYFA 2BMJA 2QUHA 4O4LB 2J5KA 4MGHA 3P0JA 4ALNA 2F9MA 2VQDA 3KZKA 4H7KA 4FMCF 1M6NA 1NXOA 2J67A 1P1JA 4YONB 4H7EA 2P2YA 3VRHA 2QK4A 1MQSA 1W1WA 4Q34A 1J1IA 3NG1A 1Z6TA 4O02B 4EB8A 2DRIA 4D3YA 1I2AA 1ZISA 2IEDA 3N05A 2V7WA 3SVLA 2XHEA 2FI1A 4MA0A 2YN2A 2PXCA 3GLHA 3C7TA 1PUJA 2UYCA 3DOEA 1CJSA 2JAQA 3K6RA 3KJGA 5KOIA 3ZGLA 4RTLA 2OYSA 4D4JA 2JZCA 4NKRA 2CVZA 1B0AA 3RSOA 1JDSA 4BYGA 5BMVA 4W9MC 3CG4A 3K16A 4MR8B 2ZIAA 5IBRA 4JI1B 5AVWA 1T9KA 4NI5A 3OZAA 1SOWA 3T6KA 4NG4A 3E7PA 5E8JA 2I2CA 1JAHA 5HMMA 3W1WA 3A6JA 3DHVA 3QX9A 1V6CA 1L3BA 3E1GA 3SY8A 4BKOA 4CKEB 2Y9MB 3DDUA 5JI2E 2Q2QA 1EM8B 4B43A 4EY6A 4DR2B 4I3HA 3VC7A 1DCTA 1XP8A 5BWOA 3LUFA 1H2HA 4X0EA 1HR0B 1V6SA 2F48A 1E32A 1U98A 2TMDA 2X8WA 3IHKA 2WC1A 4H9GA 4JWKA 2QRPA 2W4IA 4NARA 4QLOA 4D1YA 3AVTA 3IPCA 2JKZA 4I5GA 3WDKA 4YCMA 1QCYA 3OICA 3D6HA 1EFAA 2WNHA 2ECPA 1JHUA 1ODJA 2LCFA 2Q6TA 3UGJA 3IRUA 2FSSA 2WTMA 3SYLA 3W5IA 3KQKA 3FPFA 4W8OA 1C7ZA 3BF7A 3CF4A 3FETA 3GLKA 4PLYA 4LBWA 3HXLA 4L3VA 1F8XA 1ZG3A 1NYTA 3TL6A 3O2JA 1OAOC 3WTBA 2AC2A 4F9FA 1P72A 3B3QA 3ZOKA 1ADGA 1WF3A 3DE7X 1R10A 1R74A 3B6ZA 3D4OA 5DM1A 1EVEA 1WMFA 2QTZA 4WFQA 1KRWA 2IRWA 4F86A 1JG3A 2XYPA 3ZS8A 3KSAC 2YJGA 3IEKA 1S7CA 1W94A 4WN3A 3PGJA 1P1HA 1V4BA 2B5VA 3C7CB 1JWAB 1L5GB 4MVJH 3RBZA 2EFDB 1K5DA 4JA0A 5BSEA 2VQFB 2B7LA 3EW9A 5G3YA 4Z54A 2F3TA 4LC1A 4DNOA 3UJ3X 3T3PB 2XWSA 4BNDB 2Z5FA 5JDIC 4G86A 1E20A 1RLMA 3FTDA 3O2NA 3AL2A 3BK1A 2F1HA 4P9NA 4OSOA 5DI9A 5GMOA 1T1EA 3ZWPA 1VZ2A 4FSXA 3W2IA 1EI9A 4E07A 4GNKA 4LOLA 3ZCSA 3U9SA 2OD2A 5ALLA 2OHGA 3A3YA 2ZB3A 3IEMA 2I4OA 3B5JA 3GVHA 3QITA 2XDWA 5A9SB 3NIBA 4M9CA 1G2IA 3EN0A 3T5BA 4H1VA 1ZD8A 3E5HA 3EIOA 3LVBA 1Y3IA 3CLTC 3NTUA 2FVXA 4FN4A 4H6VA 4EI8A 1BYIA 4IZHA 2DERA 1T36A 2P9HA 1TOAA 3RTAA 1SPXA 2D74A 2PNFA 3SVZA 1ND5A 3LXXA 5DLQC 4HH1A 4FKMA 1QAMA 2A5FA 3DKKA 3N2ZB 4RMIA 4F11A 1VRWA 2J9FA 5JSHA 1GFWA 3LXMA 2QGNA 1BHO1 3ZXXA 2XEXA 3Q7EA 2R79A 4ZCLA 4ZICA 4EA6A 4MS3A 1T9CA 3AR9A 1ADFA 2BFCA 3E53A 3L7KA 2WIKA 3S2IA 3LBYA 3SU8A 5CFZA 5KNBH 4Q4CA 4XX0A 2Q3BA 1Y6ZA 2WAXA 1PWHA 1RZUA 2AHOA 3D5QA 3KYDA 1E2KA 3QMMA 1RWKA 1QFSA 4JWTA 1JSXA 2X3YA 3DONA 2G9RA 5FLYA 3NUQA 1UXHA 4GXRA 4KACA 5G02A 5SYMA 5L6LB 1HE2A 1I9GA 2O2JA 3RVMA 3TKAA 3LCUA 5I9BA 5JIBA 4MRSA 3M4YA 3O8LA 5JSQA 5LD2C 1LB1B 2HLNA 3OETA 4FFSA 4LN1A 1G3IA 4QBKA 3OQPA 3QBEA 2VDVE 2P9EA 1QHFA 3KQVA 2I34A 4EGFA 1IBLB 1C0PA 2AJBA 2ZYHA 3KSUA 5J2UA 3OMXA 4MRNA 4EW1A 4DG9A 4MW0A 1I2ZA 2IXGA 3T06B 4JYAB 1SD1A 1Q91A 1W48A 4MUJA 2H1IA 4CEIA 1H5UA 1S8AA 5LZ9A 2ZULA 4CRWB 5KTRA 4TSFD 3DMPA 1O77A 1Z16A 3NHPA 3Q40A 2JBHA 1LC0A 3DE4X 3GW8A 3H7IA 2XLCA 3JQEA 6AT1A 3ESDA 2QRNA 3R7LA 3NATA 4WNCA 1DV2A 4AJHA 1F0YA 4M60A 1RYMA 1YQWA 4IQ8A 3SOZA 2ISQA 3W5AA 4ZREA 5DHPA 3N2NA 4KXQA 3BRSA 4J49A 1R6VA 2X2PA 3I83A 1CY1A 1G18A 4ASUA 2BEKA 4LV6A 4PN3A 3BJZA 3C16C 4CF4A 1N32B 2JI4A 3IBCA 4MUKA 1PDVA 3TJMA 3C3JA 4HGQA 3U5TA 10MHA 4PSAA 4EGAA 4RTSA 3KELA 3OU2A 9MHTA 2JFQA 4C5BA 1NOJA 4QPDA 1FJGB 2OXCA 3QYPA 1BGWA 7MDHA 3KLPX 1ZVQA 2NZ2A 1C1XB 4AUKA 5TPZA 5EUQB 4EIWA 3M8KA 2FQQA 5ARCA 4TOIA 4DMKA 4D7AA 2GDJA 3QNMA 5CNKA 4ALKA 4YJ2A 4Z4FA 3EGXB 4BGUA 1PS0A 4OL9A 3PIRA 1ZYUA 2VJPA 3NAZA 1N6HA 3UKDA 4RX1A 5CW2A 3H2BA 2C5HA 3AJAA 4UTNA 1K2WA 1GLNA 3NJ8A 4OSEA 2PUTA 1B8NA 1CQXA 2CF5A 2XCUA 1FBNA 2YJ3A 3UWSA 1QU2A 3F97A 3VH4A 4ABTA 2UVPA 2XF2A 4HNVA 8MHTA 3EC7A 3I9V6 3JASA 3B1WA 1O0SA 3MUFA 4ZMSA 5DBHX 1PJCA 4DWWA 4WNAB 1IIBA 2XODA 2Z8YM 1E4EA 1I01A 3E8XA 4KGDA 4UC0A 5IVDA 4LF6B 1I7LA 1C30B 5HFNA 1UZUA 2VH2A 1OGJA 4GBMA 3V33A 4A6EA 3RK4A 1Y34E 1WCIA 1XRMA 3G79A 3L77A 2LDXA 5BSVA 5CP8A 1TYEB 1VBNA 1R6UA 3Q0IA 3NDBB 2HBQA 4EPYA 4HEJA 1UCFA 2Q1UA 1GPLA 2X1HA 3PJFA 4Q82A 1P7PA 1L5SA 4K3UA 2W2LA 2WWHA 4V0OA 3WFJA 1BCSA 1ZAKA 2G07A 4J75A 1FRFS 4PINA 4O6VA 1HF3A 3BUSA 4PIVA 3QA9A 3PNLA 2CVQA 3NXKA 1G1MA 2FSIA 4TSKA 4YJFB 4LX8A 4CLXA 3GLSA 3LC1O 2JCVA 1GRRA 4YRLA 1U0BB 4CHGA 4CIBA 2WHXA 3AETB 1FXWF 1M75A 1OAOA 2LCIA 4IF6A 4PONA 3VHRA 3HDHA 2TYSB 4IGAA 3VHQA 3PG5A 3VU0A 3ELYA 1NOKA 2QT1A 4LDQA 2Y93A 5KQRA 2AW5A 2MOKA 2GEVA 5B4VA 1QPGA 1LC3A 4CM6A 2QV7A 1V48A 4E2YA 2ZT5A 4IXMA 3HYCA 3U2QA 2IZZA 1WEHA 2OC4A 1BGXT 4FK8A 4YRZA 1SB9A 1U2PA 5AI4A 2G4VA 1A9PA 1PT9A 1BKYA 4B9AA 5B5SA 4RYDA 3U0VA 1J0AA 3K8YA 3SS7X 3QOYA 1EP9A 3UPUA 2XOKD 3GVPA 2QNIA 3A10A 3NONA 2C4TA 5HDQA 3KG2A 3QKIA 2WD7B 1XMPA 4O4IB 4CTKA 2YW9A 4LNHA 4CXMA 3KTAB 3M4XA 3D0KA 3HB4X 4ZHQA 3B7GA 5DW3A 1FTNA 2ACWA 3RIYA 2IQIA 4FEYA 4KE6A 4REMA 4CR8A 3KAKA 5ALNA 3FI9A 3TZ6A 4XX1A 4DV6B 3NBYC 4L9RA 1FXUA 3PGLA 4WDQA 3NQ41 3LQ1A 1DS6A 1I0IA 2IHVA 2X14A 4CF7A 1R0LA 1XNQB 1M66A 3N8IA 2LKCA 4N5NA 2W2PA 1SG6A 2CDNA 1K8RA 4GOLD 4AF8A 2WNSA 4U7FA 1E92A 3Q1LA 4YMVA 2CXXA 4XSVA 4H7HA 3AR5A 5EZ6B 1Q14A 4JUAA 1XJCA 4QLAA 4GX2A 3OT5A 4O29A 1FUYB 3L05A 1SIBE 5A05A 1N5RA 2FMKA 4RS4A 4ZQFA 1PX0A 3K5IA 1SK8A 2WT4A 3QY0A 4QTTB 4BTEA 2Q1YA 1KJYA 3F96A 2JBWA 1V11B 4CEJA 1NVBA 2C2YA 2AFHA 4JKYA 1RHUA 3NEPX 3G89A 4EYQA 4QPPA 3ED1A 1VSUA 1UBUS 5DYGA 4JAVC 3AUJB 9GPBA 2P6MA 5ERGB 4XVUA 3DDNA 1IQPA 3U7GA 2GD2A 2WYWA 1NP3A 3ICVA 3N8HA 4JS0A 2BEJA 2VUIB 4N40A 5KOJA 1QUFA 3I76A 3K0FB 2D1TA 4M8KA 4D42A 1EXNA 3FNIA 5EP1A 1NXQA 3BXOA 3EMDA 3TMAA 2H9IA 1JR3A 1Y33E 5AR1A 1FJ2A 1GGKA 2XE8A 5IEBA 1U3UA 3RO7A 3QWHA 1ZMOA 4CW7A 2CSUA 1F8GA 1OX5A 1XL0A 3JQBC 2WT9A 4AS2A 2ZWPA 1JFSA 1QB8A 3I2YX 4H0NA 4Z4GA 2XXAA 2A4MA 1YKGA 4KQWA 5J2TB 4JKIA 4EG0A 4ZYYA 4F5YA 1OKKD 5KWIA 5DFAA 1J24A 1HRDA 2B8EA 4RZHA 3OX3A 4JLVA 4DJJA 2C3UA 1L9XA 1G41A 2WMOB 3OIUA 5AJXA 2PLNA 3B1YA 4ISCA 2E6UX 2WZCA 3L8YA 3TK1A 4WXPA 2QTRA 4NULA 1T4CB 1UC4B 1KSFX 3EGOA 3NOXA 1ZH6A 3TD9A 2X0FA 2NV6A 2A59A 1PFYA 1RC0A 1Z6QA 2QF7A 2QSUA 3C6QA 2R6GA 3CPHA 1GQFA 3HB0A 3NAGA 3Q87B 1IN4A 3FZGA 4PXSA 5P21A 4KR9A 3VR5D 1F2UA 4FYVA 3THXB 3QVLA 4S24A 3ZX5A 4UFPA 1I2BA 3NGLA 1JE0A 3MMXA 4UASA 5CYGA 1IB6A 4ICIA 2XOKA 1XQ9A 4L4ZA 1VPEA 3KLNA 4OYRA 5JE8A 1WHSB 1NZFA 3MQFA 1KAMA 2RHGB 4IIYA 2OD7A 5EIFA 4EJ0A 5HTOA 1X87A 2ZI7A 4KYVA 1WMBA 2NZYA 3CR7A 3HM2A 5KCMA 4ZI7B 2V7VA 1ZD3A 5B58T 4BLSA 2FYTA 4Y1RA 1YZNA 4M21A 1ZH2A 4GYKA 1AQUA 4I1YA 1IEWA 4L02A 3MVEA 3Q98A 5AW5A 1FSGA 1FU8A 2OOSA 2ZREA 3WMWA 1CLUA 4C3OB 4MP3A 2BFFA 2EZ9A 4TYMA 4Q1CA 4UREA 2ZSHA 4WASA 1SEVA 5DT2A 4AS1A 5F78A 1CXZA 4CLEA 1X86B 2P35A 3OVMA 3BHNA 1C5KA 1M67A 1EBBA 3GEEA 2W2NA 1AQJA 1TAQA 2NU6A 3GGPA 2GEKA 1DL5A 1KARA 2A78A 1Y9DA 1G8GA 1X7XA 3R3YA 1EHYA 2FJPA 1F8UA 3BIXA 5LQNA 3R0XA 2WJ4A 1YZLA 2HKIA 2OMKA 3HRHA 2JGKA 1PBTA 4ZPJA 5K0EA 3IDQA 3SSAA 5JD6A 1O5TA 3RR2A 1RXUA 2BOVA 3IQGX 1GOTA 3R76A 4A03A 4G0ZA 3UCXA 4JI0B 2W7TA 4M6WA 2I3AA 4FZ3A 1V9LA 2OO3A 1NMXA 3FPCA 2YQZA 4NLLA 3KWLA 1CUSA 4I7EA 1NW6A 2OPHA 3VOTA 3SXUA 3VPDA 5CFOA 3DPIA 4LJAA 2COUA 3IILA 3PGXA 4RY9A 1CF9A 3TMKA 4ARZB 3S1SA 5IBQA 3TRFA 4AMUA 1FS4A 5CX1A 1NMZA 2EV9A 2ID4A 3ER6A 3HXPA 4OKNA 2IJGX 2PLRA 3WYEA 1W5EA 3W3AA 1F12A 1K7EB 3FPHA 2KSQA 2O7QA 4EYKA 1ORTA 1HSOA 3ZX4A 4IJUA 3JZFA 1V8DA 1GGVA 2BGTA 4FYPA 1F2TB 4NJMA 1TM7E 3ABOB 3GCGA 4OQFA 5E6RB 1PO7A 2R1VA 3QF4B 2QPAA 1FX0B 5J3JA 1UXKA 2GEFA 1TU4A 3EXIA 4ZODA 2YZNA 3K5PA 3RT1A 4B32A 1P1BA 4S12A 4JSTA 1FP1D 4W5NA 3MCWA 1P8JA 3DAFA 4B17A 3LDUA 4GQAA 3AUSA 3MRTA 3OFJA 4V3BA 4KWCA 4PYQA 1GA1A 5AUOB 3ZYCA 5CGZA 2WMDA 4J4HA 2WFMA 1GZVA 1N5MA 3I9LA 3I1FA 3TGWA 2J0EA 3DKPA 3TFWA 3A6HA 2NTVA 1T2UA 4DUGA 4PYMA 2I2XB 2PRKA 1LF5A 1E5DA 2OWEA 2ZIEA 4RD3A 1BN7A 4TRJA 4QGSA 1NXVA 3Q2KA 2I33A 2RONA 4WSOA 3GLVA 4EYGA 4CM9A 5GVSA 1BAPA 3KQYA 2CLHB 1EUDB 2CHUA 5JLAA 1SG0A 1PVOA 4CEHB 2Q4DA 3LP6A 4YA6A 3CJQA 3T7DA 4AO8A 1LJUA 1NHGA 3IE0A 3I6BA 3RIGA 4TYNA 4YQEA 1B0UA 1E99A 3TUZC 2DQYA 2WV7A 3KR1A 2EATA 3DV2A 1E2UA 1Z0KA 3BPSA 3GOQA 1WVIA 5BSUA 3WYNA 1TZKA 1BXRA 1PV1A 1T6XA 1DCMA 1MQ8B 1JIKA 3DTNA 4XD7A 5JSYA 1JHZA 3BAZA 4DA6A 1XTIA 5JYCA 3IV7A 4LVUA 3TMYA 1DQPA 2AB0A 3GJ6A 2OPBA 1USGA 3UHAA 4ENUA 1E59A 2PUJA 1N2CB 2WWWA 2Z8YA 3I73A 4N12A 4C7KA 3C3PA 3T8YA 4V0KA 2PA3A 2QJOA 2FW9A 4R5MA 5JXHA 3ZJTA 3FCAA 3UXHA 4BNHA 2RGXA 4OHPA 1HYEA 3GHYA 1XV5A 1RCTE 2ODEA 2JHFA 4M99A 2NPFA 3TLAA 4EUHA 3OQIA 3WMRA 1APBA 3VJKA 4WZAE 5ISMA 4FYIA 3SNHA 5GOZA 1Q0QA 4ZCTA 4S04A 2HEIA 3ZVNA 2V0GA 1OYOA 3D8HA 3RVOA 3NAQA 3I4FA 1WX1A 1PNQA 2QB5A 1AKNA 4DA7A 3K1YA 3ODGA 1WCV1 1HKUA 1E1CA 4LXGA 5ALKA 1P91A 1U65A 2F3QA 2GBLC 3CT6A 3HBAA 3U4GA 1J90A 4BRWA 5AJHA 4RTMA 3ZZ0A 3BVPA 4LOAA 5EWJA 4YHHB 3MGBA 3QLEA 4LYGA 3OLYA 4MW4A 4TSRA 2PIDA 1GFZA 4A2CA 3DOJA 1VLQA 3R5JA 2O8VA 5EHGA 3ZQ4A 4F8YA 5AM4A 3GLFB 4RA6A 1M5TA 1NVKA 4E30A 4E4YA 1M2WA 3MINA 3QKSA 1AXRA 2FJUA 2KMLA 1BFDA 2BONA 2YFHA 2JCYA 1UJ2A 4JEHA 3JVEA 1B8UA 3HN7A 3LUHA 4HT3B 3BB3A 4OMUA 4MR7B 4TMTA 1KZ4A 4GDFA 3UYKA 4Z53A 1J0XO 1GHTA 2Y1KA 3ANSA 1PGPA 4Q3DA 4Z4QA 3FYUC 4WDRA 3F9RA 5ELXA 4I9HA 3VPSA 3L1UA 3W0LB 1F20A 1D0IA 3N39C 3R24A 3JR7A 3M6FA 2G25A 4U7TB 4AZVA 5THXA 3M6UA 2C77A 1FU4A 4PO9A 3PXXA 5K7SA 3CNHA 1R3UA 3AIIA 3GMTA 1GPYA 3RFVA 3VH2A 2O8EA 2UZ1A 3LMKA 4J0QA 4KAAA 8AT1A 2X58A 1R64A 3IAEA 4OOEA 5CH5A 4YMHA 2FP3A 2Z2ZA 3HKBB 4BO9A 1AMOA 1II0A 2H2FA 3HBJA 9LDTA 4UHDA 4UJ3A 1NSFA 2VEOA 3SD7A 1NLYA 5JO9A 3DKVA 1NATA 2D00A 2YVQA 3K32A 3I1JA 2XD9A 3NS7A 3EJWA 5CVEA 2GPNA 3A58B 3S6JA 4QKQA 4RD1A 2HRZA 3EIEA 1T36B 3JQGA 3L8FA 4WW0A 1LPMA 2PX4A 3CV3A 5FIUA 1NASA 1OYVA 2XXJA 4LJKA 3C87A 4BRZA 1NZDA 1XTVA 3V9AA 3ZHQA 5ER9A 4BE9A 2VCYA 4EG1A 4JI2B 1CP2A 1ITZA 3IUSA 1A0OA 3G0GA 3H9CA 2XCTB 5FOQA 4HV4A 2HWUA 2CV0A 4ARSA 2DQZA 1EAMA 4PQGA 3G6WA 1JAIA 1N6KA 3DEAA 3GFPA 3CZCA 4R1MA 1KAGA 4UEOA 2E7ZA 2NNWB 5HE9A 4C7OB 4C5CA 4KXWA 2H2GA 5G4LA 2FR0A 4BZWA 5D8DA 4B5LA 3P19A 2ZK7A 5LQRA 1CR0A 4WESB 3S0JA 4E31A 4ZI5A 3COYA 2AF3C 3M1LA 2PGDA 4NYIQ 3W6NA 3GVCA 1WXGA 3RWBA 4C2BA 4AX8A 2Q45A 1SXJA 2QROA 1Z0FA 2WVJA 4JBWA 3UK7A 5TLSA 2O59A 4XXHA 3L1HA 4HFNA 3AVOA 5JXWA 3KOYA 4DOMA 4O4JB 5CFRA 3PXGA 3IAFA 4KG7A 1FX0A 1XZIA 5J4LA 2ZVDA 5BOSA 3Q3IA 1BMDA 1U1EA 2OWDA 2FSFA 4FHGA 3UMSA 4NMLA 5J2UB 3OZGA 2G5PA 3U6KA 1E4EB 4U6NA 3U3KA 4TM7A 1S9HA 3GIDA 5D85A 3JQRA 2QM7A 2QX4A 4RK7A 4ZRDA 4ZU1X 3RTGA 4QXRA 5EPOA 2FQYA 2HJHA 4MAFA 3LA6A 4IOJA 1JS1X 3P94A 3VXKA 1JILA 4FEGA 3U7FB 3L79A 1BDIA 4D82A 2NW6A 4A6PA 4D6XA 1I32A 2SKCA 3EUWA 4IOLA 4J8PA 2Q07A 4AJPA 4P6VF 4DL9A 4Q9LA 2GAAA 3TN7A 1MD9A 3WK4A 1H2EA 5FV7A 1M1XB 4FWTA 1MA3A 2JGMA 1OJ7A 3CUUA 4JGGA 3AU9A 1NSYA 3IAUA 2EQAA 2PKQO 3QE2A 5CB8A 5FWDA 2IKSA 5CLJA 2OSBA 4RJKA 2FNAA 2G1JA 1G8YA 1RWXA 4FGJA 1OTXA 4QUDA 1JIVA 1PF7E 4XGRA 2IH4A 4HNSA 1NW7A 2JKVA 4WK6A 4DUGD 4NENB 3D8RA 3SJZA 1GLGA 1NBEA 3EZ2A 4ZT3A 1TTQB 2HFKA 1IN6A 1WZUA 5KYTA 2E37A 2YYAA 3VYVA 4KFUA 4OYLA 3O75A 5I4CA 1UKAA 2IDMA 3PENA 5LZ7A 1E9DA 1NI5A 1XVAA 3KZOA 1P6QA 1FFGA 3JWIA 2B5OA 1UFQA 2RFLA 5AKYA 2Q6VA 2RGYA 3WZ2A 2JI8A 1BX0A 4HYQA 5K0CA 4QJBA 1MKYA 2CW5A 4PLFA 4PZ9A 1E1KA 5HSGA 4O3MA 1BWPA 4IG9A 1U04A 1F0PA 1BVHA 4TV9F 3SM9A 3TB4A 4PRYA 2VRWA 4MKFA 4HNUA 2XE6A 4Z2AA 1V5EA 4MKRA 4QBTA 5J9FA 3MQ4A 3E7XA 1Z5UA 1D0SA 2ZI9A 3PUJA 4HD8A 1JHVA 5DBGA 3EXFA 1T6BY 4M38A 1L5KA 2WWVD 1E94E 1RYZA 3WGTA 3M9WA 2IHTA 3BC1A 4RHXA 2NO6A 4NMXB 1ESZA 3HGTA 3RSLA 5CNIA 1W0KA 3JTEA 4F3TA 1W76A 1U9IA 4IG4A 1KY3A 2C8LA 4TLBA 3ISTA 3K1TA 4E6PA 1R6TA 4PW0A 4QPCA 4BNLA 2VQEB 2QYSA 1EVZA 2FZEA 1NVGA 3BWMA 3PNYA 3U4CA 1K89A 2ZSFA 4YT8A 4I36A 3IAAA 2Z56A 4BEBA 3ACDA 1P0QA 2J33A 3IALA 5TVGA 4F0JA 3TVDA 4KZPA 4FB4A 2XQKA 3DJFA 4Q47A 1BXZA 1N2SA 4HUQB 5CLIA 3UXYA 4FLFA 1UJ4A 1A9OA 1XRPA 3NDIA 5L95A 1AUPA 1ZRSA 4IIVA 1SM4A 3WBFA 2NN3C 2Q8PA 4G5XA 4F4DA 4DB4A 3LY8A 1E3JA 3EZLA 3CUYA 5BN5B 3UY4A 1AF7A 2OBXA 2PAFA 5TGDA 2XE4A 1ZGJA 4RTRA 5IBPA 1OXVA 4L5CA 1KYQA 4P7FA 1WAMA 4Q4JA 5IU6A 5JDCC 3RAEC 4HNAB 4B31A 2YZ2A 3C70A 1SOUA 2HJVA 2Q4BA 1ZJ4A 5A3RA 1CUWA 2G8LA 3AF5A 3STYA 5KOHA 1R66A 1MW8X 3CFYA 2ZG6A 4J6FA 5EE0A 3DFZA 3EVTA 1HOXA 2FN3A 1GRVA 4XCVA 1Y3BE 4JBGA 5CA1F 2HAEA 4R8RA 3Q8LA 1JEYB 2XXAB 1NWCA 3ZLVA 4BMZA 3GYBA 2J6BA 3MQ2A 1GWNA 4H3SA 4L5AA 1LRLA 2ZVQX 3ZWQA 2G9UA 1YAHA 1QAQA 3FB1A 3IPXA 3TFQA 2ZTVA 3LCJA 3IJPA 4MV6A 1UMBA 1GUZA 1JPNA 4NONA 4XIJA 5ALFA 3WDSA 4EGJA 4GGMX 4MPPA 1U3VA 2IUYA 2RHMA 2ZJ5A 3ZD8A 1N77A 3W8FA 2XZOA 4DEYA 1ULUA 3VDNB 2C5EA 2ZCUA 1MIOA 2JZOA 3QXSA 4MYCA 4TMFA 4YAEA 3PYLA 4G4GA 4YPOA 1KEKA 5EJ5A 4CLRA 4KXUA 2VLBA 2RHTA 1P8AA 3D1LA 4CTNA 1CY2A 3PDIA 3E5MA 4ZVQA 1Q77A 1EDZA 3TEMA 1ODKA 3E2IA 3FSGD 2Q1SA 3GQVA 5TGZA 3OT1B 4AJKA 2BSAA 2Z5LA 4DREA 5BPFA 4FOTA 2H7CA 3HGMA 4NCBA 3ELBA 3HL0A 3JQ9C 3O7MA 5LZ4A 1W5SA 4UHEA 2OMEA 3HS3A 3L82B 3V7YA 2W6JD 1VHDA 3G8BA 4TN5A 1RYFA 2FWRA 5ALMA 4A2PA 1GV0A 1E77A 4BNYA 1V1RB 2ZJ4A 1MO3A 1RVDA 4M3NA 2DY0A 1L8AA 4MGEA 3X2FA 4D5EA 1K08A 2JJ8A 4HTFB 1VMKA 4KIUA 1YR6A 4HEA1 2CNOA 3GRRA 1IU9A 3DW1X 4KZKA 1JFLA 2VNAA 4EFDA 1A76A 4RVHA 2H1FA 3KEMA 4Z4EA 1RLOA 2JARA 2Q7XA 4NYJQ 1PDOA 3RM3A 1QQAA 3B5EA 3I58A 1J9GA 1NJ6A 4EL0A 2IP2A 3AXTA 4GBED 3CF4G 3GRPA 3MD9A 4KVGA 2BSQA 1SUSA 1NNI1 4AC9A 3OFNA 3R20A 3FR8A 1NN0A 2NV0A 3K0FA 3NC1C 3RUHA 4HG2A 3VVMA 5A4KA 3VU9B 1IATA 1M5RA 1Z5NA 4G65A 3N6RA 4B3HA 2I4TA 4C6TA 2GR9A 1G9SA 3LLSA 2IPOA 3GUCA 1YA8A 5FPHA 2GD0A 1E6UA 1WA5A 2CLEB 2P30A 4JB2A 1NQUA 5AQEA 2Z2XA 3I8SA 1UDXA 4Y2VA 4K9SA 3RRBA 3T1QA 4B74A 1I7DA 3K9LA 2IOFA 2ZBFA 3N75A 4XYMA 4UAJA 4JJ8A 5ILQA 1K88A 5CEFA 2XUIA 1KE1A 3G0BA 3W79A 3ZY2A 4BFWA 2AUNA 4PPYA 2HCTA 4PG5A 3D8SA 4YH1A 4BKRA 4L8WB 3L8HA 4FNAA 1E9VA 4L73A 4OD0A 1WW3A 3LNCA 1HI9A 1RXEA 4K8RB 1IWOA 1YAJA 2KX7A 5ILGA 4DRXB 1DWQA 3QEMA 1P2VA 3SCZA 4N8SA 3ZDFA 3K92A 5BWLA 1HT1E 5KSWB 2IX9A 5M29A 4N5LA 2PRIA 5CA1B 5EJ4A 5ALSA 3G3EA 4XPIB 1WNFA 2GBIA 1L6RA 2HT6A 3C6ZA 1HV8A 2G7MC 2V6GA 1Y7IA 3VTZA 1ZEJA 4JCOA 1HMPA 2EZTA 1UT6A 3S29A 4LFCB 3Q5GA 4QOHA 1KZ9A 1F2TA 3KKNA 1WDWB 2BM8A 1JLHA 4G9BA 4MROA 4IOKA 4KAFA 4JXKA 3ZD6A 4MUIA 1IM5A 1K7CA 1XXHB 2ZJYA 1SFRA 1OBFO 5AKKA 3AOGA 3WLRA 3FZQA 4GM4A 4FW8A 3BRWA 2RHHA 2YXEA 3B60A 2WZDA 3DFIA 4Y1RB 2XGMA 4U5XA 1LSSA 3NBKA 2I8LA 1P5RA 2GK3A 3HMKA 5HG0A 3IC5A 4ZAZA 1IH8A 3Q85A 4ZA2A 2R1TB 1H05A 3OOWA 3ECCA 1RAFA 3AEXA 4PTYA 4Y1EA 3ORQA 4YCBA 2FN9A 5A7HA 4AZSA 5BURA 3A4TA 3ZTTA 3AVUA 2BEUB 4P4TA 4PRLA 3I30X 3JYLA 3SEQA 4Q9JA 5ESWA 4CL0A 1JU3A 3EIQA 2O06A 4DEVA 2GZ2A 3CNBA 1VFPA 2JFPA 1XLTC 4MI1A 1JYSA 3FPGA 2ZBPA 2Z58A 4JP3A 1U4NA 3JAWB 3ZNOA 4GRAA 3CRNA 1T34A 4OQ4A 4R4JA 4X90A 2ZB8A 1YE3A 1Z2EA 2C82A 2QP9X 1RJDA 3MJTA 1JH9A 2GBFA 2HSDA 3TSOA 4QL3A 3D7RA 1H23A 4WH0A 5F76A 1EB8A 3IVMA 4BJ1A 2HJWA 4FX5A 2CK3A 5CJJA 4GP6A 1O9GA 1E6CA 3BD7A 3G8CA 1OIXA 3MTAA 1V45E 1UBCA 2GUWA 1SD2A 4QFMA 5IT4A 4RKEA 2PCLA 4TTJA 5EXXA 5JD5A 1JR6A 4GKAA 3GDGA 4NYMR 3IURA 1M6EX 2XKAA 4HRVA 1WP4A 4MRVA 1GILA 1KI4A 1ZFNA 3BIFA 4QPZA 4EJSB 3QLJA 3L8DA 1PV2A 3G9ZA 5T41A 3IUMA 1IJKA 3AY7A 4E4TA 2OHJA 4MWCA 5EJAA 2CWWA 4KO8A 4K26A 4QXPA 3GJZA 2AOXA 4YI5A 3PUVA 5T67A 3UKJA 2DFVA 1V6AA 1HL7A 2QR3A 4DV2B 2V03A 1IHUA 4DR5B 1Z8HA 3KSBC 4H77A 3ETLA 2IDZA 3DDCA 4L50A 4RLQA 3CMCO 1GQRA 3FOCA 1XPRA 3RTEA 1UBOS 2JLAA 1W88B 4FTWA 4UNNA 1L1RA 3GJSA 1AXEA 2FFBA 1EFVB 3PCTA 2B4QA 4LY6A 4CIDA 5IF3A 3KZXA 5A04A 1MX5A 4F1JA 5COQA 3FPSA 3CB4A 4X94A 4ND8A 4NSNA 3GRVA 1H9CA 2AEEA 1M6VA 1KC3A 4B80A 3G0HA 2BKUA 1OD6A 2IE8A 1XD8A 3HN2A 4G5SA 1L5NA 4AJ2A 2ZXUA 3EZYA 2W2KB 2EDCA 4YEDA 1CS4C 3CN7A 3OZDA 3WG9A 1E79A 4JIGA 5A71A 5A3QA 3GLGB 3ZXSA 2DWOA 4X3OA 3OEEA 4R1SA 2DE0X 4L0QA 1FIUA 2PWZA 4K6HA 4E12A 3ESYA 3QJYA 3A14A 4XIGS 3LZ6A 2QQGA 1YQUA 5HK9A 1THZA 2AC4A 2OESA 4OAQA 3FOFC 3UA4A 2XUGA 3N1UA 1VSVA 3LQ2A 4LEIA 1HTTA 5FJIA 1IJBA 3M9LA 4IDNA 5DHSA 4XYLA 3GLIA 3PFWO 3ES9A 4KLZA 4PF1A 4LQLA 1V3UA 4DBZA 1N2XA 4LXIA 3PFNA 2SKEA 2Z2YA 1N5JA 4BPRA 1W8DA 2BDTA 1VG0B 4MHTA 1MRSA 1O3YA 1YMQA 3RIEA 3LOPA 1USIA 3O4FA 3S1AA 5F2NA 2B2NA 2UXBB 3HFJA 2B36A 4XGKA 1VLJA 2GM5A 2BGIA 1ZIXA 1W34A 5CIQA 2UUPA 5JSZA 3A1EA 4JLDA 1T8TA 4OHOA 2VTKA 4YIHA 2QYHA 2UU9B 2O2IA 2HBZA 1IY9A 3F7NA 4MS4A 4R8SA 1QP0A 4GE0A 3D3WA 3PPIA 4FS8A 4IDBA 4HLCA 2VRCD 4G8DA 1TAHA 3NT4A 3HRKA 2ZTSA 4NXMB 3KAJA 5ENZA 2GN6A 3BFKA 1KKUA 4RFSA 4Q03A 1RIFA 5AVOA 3Q11A 3AJDA 4DTCA 2ZB4A 3LWNA 1GEEA 3D4BA 4X8LA 5HXAA 2LIVA 1AS2A 2IYOA 5IT5A 5ITZA 1QKIA 4GLOA 2EKZA 5IFKA 2CMGA 4PFJA 1GYPA 3DZKA 3SLGA 2QVBA 4B3MB 4QQ8A 3AU8A 2X76A 4KE9A 3KVOA 2OGSA 3JQQA 4CM8A 5HP4A 3QVUA 5MHTA 1ZAYA 1GP2A 3I5MA 1R4NB 2RC5A 4D4KA 1EJ0A 1P5FA 2V45A 4FWBA 5J59A 5BNTA 1RRFA 2JRCA 1RLIA 1T8UA 4XQ0A 3VSEA 1U2TA 4LVNA 2IV2X 5M5BA 4E11A 3UH0A 3PD7A 2GFQA 1QQBA 4ZI2A 3ZHXA 3OPYA 1W36D 4IW3B 3HRIA 4FCVA 4MV8A 4FD2A 4MITA 3KPVA 2GWRA 3IUPA 1M2EA 1T5SA 1N4DA 1YZVA 2LBPA 3B1FA 5JQGB 4L78A 2EARA 1BS9A 2YYZA 3G0CA 4G97A 3BORA 2IS6A 4KLRA 3T7AA 3PR2B 3E8SA 4OF4A 1H2FA 2I3ZA 4L16A 1A4IA 1B74A 1YBFA 2PZAA 2ZIXA 2E21A 3EZ6A 1FUEA 3WVNA 1K98A 5FTLA 5L3QA 3KQHA 1FFEA 1LPBB 3TAUA 3TAHA 5AH0A 4TXHA 3QX7A 2HR1A 5ICCA 3O4VA 1R5OA 1UPAA 3Q1KA 4XM1A 1NJ2A 1RWNA 5LR6A 3Q3EA 2IKQA 3AI7A 4UHKA 1MAAA 1U8EA 4K9QA 4FYKA 4NE9A 2IYEA 3ZR4B 4KI0A 4B2IA 4IXNA 2XRYA 1EE2A 1XEXB 5TPWA 3TW0A 2O19A 4QOJA 2XUDA 5BMOA 1STOA 1U99A 3HUEA 3RS5A 3IPAA 3HDQA 3IDOA 4WMLA 5KVCA 1L4HA 3KP1A 1NDHA 1QJ4A 1LJ8A 3F47A 1L5OA 2AN1A 1M54A 3BXHA 1W9MA 1D03A 1KO4A 5JS2A 1JPUA 3PHIA 3ZBQA 4DT1B 2RIRA 2P90A 1V4NA 2GSWA 3DLAA 4MI6A 1UBGA 1U3DA 2AOWA 3TCXB 3W2EA 1USUA 1QE3A 1LD3A 2JJ1D 1PL6A 2JATA 1G3QA 1SBZA 4K3VA 3WWEA 2R8RA 3PHLA 4G0WA 1XK6A 3AL0C 1K8XB 2DY1A 5SV2A 2OBNA 1O95D 1EAYA 3SEAA 1KF0A 3NWEA 1TZJA 2EGUA 1IOVA 1Y8ZA 1XRLA 2RK3A 4F06A 1DUSA 1MG5A 3A31A 1L6IA 5DIZA 3FTCA 3UWOA 4BB0A 5LOVA 5L3ZA 2YIVX 4MEBA 3CLRD 5CMLA 4NBVA 5CLGA 3P71T 3U37A 4BEVA 4OLBA 3D3KA 2ZS7A 3OD5A 1RKUA 2F2TA 1UZMA 3DDZX 1IUPA 3MWKA 1HDRA 2W6JA 4QECA 2X0DA 1JQLB 5C46F 1PZGA 1NDUA 2CZGA 4K9MA 1KMMA 1XTKA 2Q5IA 3OCWA 3WB0A 3WNZA 5FBZA 2GEUA 3FOEC 3F98A 2OV6A 2A58A 2FN4A 4ON9A 5EJEA 2A8YA 5KDLA 3KU4A 3ACCA 3H5OA 1YHZA 3AKEA 1XTQA 5K0GA 2H1LA 1MW9X 4GEGA 4JVMA 4TMYA 4ZEMA 2BFWA 1CUCA 4BMOB 2Q3MA 2R48A 5JCOA 1Q1EA 3GVIA 3RU3A 4BXOB 1J8VA 1E1DA 1ECLA 4HKTA 2WSIA 1JH8A 4MPRA 1LZKA 3D6VA 2XVXA 2H2HA 2P0AA 2Q46A 3JR3A 3P4UA 5FA5A 3A05A 1CZRA 1D2GA 2QI9C 3AUKA 4KQMA 5JCPA 1MQ9A 2EIHA 2M6KA 5GP1A 3G8AA 2JIOA 4TWIA 1X80A 2WLTA 4C2AA 5EWMB 1Q7BA 4DR7B 2QMYA 1QIMA 5HGJA 1H6AA 2ZIZA 4FYHA 4Q3KA 4M8SA 5LP1A 1E2NA 1GAEO 1QONA 4CM5A 5ECWA 2C83A 4R98A 2POCA 4WVLA 3ZHSA 4BOYA 2QMEA 4GLLA 4LBYA 3LT1A 3RVKA 1UBEA 4IHJB 1B6RA 4Q4AA 3VKHA 1T4MA 1CUFA 4V1CI 4FS3A 4CKWB 5JAPA 4BEWA 4K7JA 2VP5A 4LF4B 4AKHA 2VEDA 2CMFA 4V02A 3S2EA 4BQRA 2GZ1A 2ZYUX 4KJXA 4PSKA 3R4CA 4X6LA 5FULA 4V24A 4D8XA 3PVCA 2DFPA 1XT6A 1WHTB 1ESDA 3TFOA 1NQ5A 1YR3A 2F6RA 2ZSEA 3DEFA 2GLXA 1CJVC 2XYGA 3IMEA 3IUNA 3R09A 1D5WA 2PZGA 4DSZA 1VIMA 4D25A 1T0PA 1LVGA 4Q6WA 2VJQA 4QULA 2YDXA 4Q01A 1QHIA 1U7HA 1HZJA 4LJ5A 3CVVA 1KHHA 3RIHA 5CG1A 4BZXA 2CLKB 4BE7B 1XYVA 2O8NA 1N3YA 1ZONA 4FE4A 2Q3LA 3JQAA 2BFAA 3F2IA 1GSAA