3JQFC

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 1,3,5-triazine-2,4,6-triamine (ax2)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 91
structure length 247
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqfC00
4S1VA 1VC2A 3OMLA 1GU7A 4E3ZA 4JJIA 3NDIA 2EWMA 4WCFC 5IAAA 4IIUA 4D0SA 5CEFA 2CVQA 4FFPA 1H9BA 4NJOA 2ZB4A 4DYVA 1SB9A 1RM4A 4P4NA 3JSAA 2VYND 1N9GB 4XCVA 1JVBA 4IXTA 1BG6A 2I6TA 3W4KA 4L0QA 3AUTA 1VKNA 1UXKA 2YJZA 4YRDA 4BNIA 3DTYA 4WE3A 3GAFA 1JDJA 4R1UA 4OOEA 1HRDA 1YOVB 2HU2A 5EL0A 4WLOA 1D1SA 1UUFA 1C0LA 1NQAO 3OQ1A 1E1KA 4OL9A 3GC6A 3O03A 1E5LA 4URFA 2HMUA 3IC5A 3CZMA 2QIOA 5DNAA 2CVZA 1X7HA 4BQRA 4JNKA 2AQIA 1LX6A 4F45A 4FR5A 3L0DA 2PKQP 3U09A 3HFGA 4MKRA 4XRGA 4FOSA 5FF9A 5B12A 5KJ1A 1X7DA 2D3TA 2NUAA 1Z45A 2P4HX 4NDNE 4RVGA 1DOHA 4BB5A 4DL9A 4YT2A 1N1EA 4OKNA 1HE5A 3GPIA 1B3BA 4LVCA 3GMDA 1C1DA 3ZHXA 2O4UX 5JYDA 4KUHA 4BO7A 3M2TA 4DYDA 1WW8A 1JAYA 4YYZA 4GMGA 4INAA 1A72A 2CZCA 4NU6A 2V7PA 4GGOA 4IZHA 4MVJE 1E1NA 4J91A 5U9CA 2FOIA 3OJFA 4E13A 3OF2A 1GQ2A 1ZK0A 3A14A 4XQ9A 5L7TA 3R3SA 4LISA 3DWFA 4J90A 3PLNA 1ZK1A 1EBUA 5DZSA 1FF9A 5CG2A 4FPXA 2VTEA 2QRKA 3B1KA 3NDJA 3H9JA 4II2A 1LSUA 3MJTA 2WD8A 4RPJA 1Z74A 4CR6A 3GY0A 2HQ1A 4J9UE 5TS3A 4GVXA 4RF5A 2VHZA 2GGSA 4YQZA 3GZNA 4YCAA 2HJRA 4YBZA 2ET6A 1BTOA 1P1HA 3DZKA 2PWZA 4WEOA 3BIOA 1E7WA 1Q0HA 2GZ1A 4AJNA 1PL7A 3AM3A 3PHLA 2HMSA 2O2SA 3OICA 4W6ZA 1QV7A 1EEHA 3C1AA 3QA9A 3I83A 1NP3A 3E48A 3L6OO 3PIIA 3PLRA 5COQA 3A06A 4JXKA 4ALKA 1CDOA 3GHYA 3L9WA 3ZW9A 3K31A 4CM9A 4EJMA 1WZEA 4OHUA 5I7VA 2H5LA 2Q46A 5F3RA 1TXGA 5DDIP 4Z0PA 4MDHA 3DXFA 3PHHA 4XZ3A 3RD5A 5BSEA 2BELA 1P74A 4BO8A 4L4RA 1T2DA 5JDIA 2YV2A 1Z73A 4CQLB 1T2EA 5T8KA 3ASVA 5I9MA 3TZHA 4Q3BA 3ZWOA 4CMIB 1EVZA 3V1TC 1N92A 2I5PO 5ER9A 3W8FA 3WGZA 4A03A 4B7XA 5JMPA 3JQDA 5ES3A 3V5NA 5BSHA 3WGIA 1RYDA 1R4MB 2YHUA 2DBQA 1E7RA 1R0SA 2ZQYA 3EZLA 2H9IA 3F47A 2GERA 5K9ZA 2IDZA 3IUPA 2H63A 3ABIA 4RJTA 2GN9A 1YJQA 3ZHZA 1T1RA 1LSOA 2EHDA 3ZHYA 5DOVA 4XYLA 5JO0A 1ZSYA 4CLRB 5I7EA 2DVMA 2PNFA 1PWZA 2R2GA 4I5GA 4CL3A 2ZYDA 5DCWA 1XEAA 1J4AA 3C7DB 3IQDB 2ZTLA 4DTIA 1LRJA 4ALNA 5A05A 1LLDA 4FBGA 5K6AC 2Z95A 1YL6A 4IDBA 3QWBA 4C4OA 4DIOA 1NFRA 2VHYA 5LDHA 1CQJA 3QWFA 2JFGA 4FJ2A 4OO3A 4WOJA 4BGEA 3FF4A 3GDGA 3D4PA 3HG7A 5F1OA 1ZNQO 5U4QA 3ZWBA 1K5HA 3VPGA 2VQ3A 2RAFA 4I8XA 2P2SA 1BWSA 1A4IA 1G1AA 3BMQA 5KVVA 3H2SA 2JD1A 3RVDA 5TQVA 4E5MA 3DMYA 1XIVA 3E5MA 2I99A 3NT5A 3GEGA 4JBIA 5BR7A 4CR7A 1Y9AA 3W4IA 4DLBA 2G82A 1FK8A 5C37A 1ENOA 2DKNA 3D5TA 5T6BA 5JYEA 3ENKA 4GLOA 3CH6A 3V1YA 2VWHA 2B5VA 3BTVA 1P9LA 3DC2A 4PLVA 3LQFA 2Y66A 4Y6SA 2WYWA 1QLHA 1HDRA 1NVGA 1N7GA 1YB5A 3TZQA 1WAMA 3LVFO 1XELA 3JQFA 5ENDA 4KWIA 3BHIA 2UUOA 4NR0A 1LC0A 1XYGA 3NV9A 5JDCC 4ND1A 4BNNA 2BLLA 3D3WA 2NVBA 3VAZA 2GCGA 4O5OA 2ZB3A 4Z3KA 1DB3A 1N5DA 3F46A 1AGNA 4J1TA 4DPKA 2PKQO 2PD4A 1ZKMA 3HSKA 4IDEA 1B26A 3IP1A 1C3VA 2C59A 3GNQA 1I30A 1WDLA 3NYWA 3JCZA 4NK5A 4EBFA 2P9GA 1E0DA 1ZEMA 4FQ8A 1DRUA 3U9LA 1T4DA 5C7OO 2X22A 3D7LA 5FWNA 3DZHA 5BQFA 2W2KB 2QX7A 3HDJA 1HDZA 4J9VA 1ZJYA 3WGQA 3WIEA 2AQHA 1I2CA 1MFPA 1PX0A 2BKAA 4RLSA 4A73A 4BUCA 1ZMOA 3I52A 3VTFA 4GX2A 3C24A 2X9VA 3U4CA 4BKOA 3PZBA 3BHMA 2JKVA 1XR3A 1PZEA 3I4FA 4R1NA 1PJ3A 4S3MA 3GVPA 4CMCA 4Z6KA 4UVHA 2OO5A 2OXIA 1PJSA 2Y93A 3S1LA 5KTKA 3BHJA 3C1TA 3FPCA 5A3JA 4G65A 4IY1A 4BIIA 1MXHA 5TJHA 1BDBA 1I3NA 5G4LA 1AXEA 5T5QA 2Q1UA 3GUYA 1P31A 4XWYA 4UEOA 4LN1A 3I6QA 4Z0HO 3R1IA 3G3EA 3GUCA 4RV9A 1VKOA 5T64A 3PIDA 2C29D 4LRTB 4A2CA 1PQUA 5B4UA 3KYCA 3X2EA 1K6IA 1U3UA 3U5TA 4GH5A 3UUWA 1JLLA 1ISGA 4J7XA 4AJ2A 1NQ5A 1R4MA 4MP8A 4BMSA 1E92A 4TMFA 1HT0A 2RH4A 1KEVA 3E18A 1ZMTA 2BI7A 4AICA 1X7GA 2ZYAA 3EK2A 3KSZO 3JYNA 3SXPA 1ULUA 2B4QA 4E6PA 3I3OA 3BMOA 5A5FA 1DHTA 3GGOA 5I7FA 3QY9A 4OQZA 1MGOA 2VT3A 4Y6RA 1PGOA 1KETA 1P77A 1BMDA 4QT0A 1DIBA 3S8MA 3TNLA 1YE3A 2FSSA 1DIAA 4JLWA 4QTZA 4E2XA 1C0PA 3GT0A 5JSFA 2NWQA 2AG5A 3FN4A 3BMCB 1NX6A 1GQQA 1E6EA 4FFMA 2J5KA 1YB1A 1W8DA 2ZJ0A 5A04A 1PJBA 3LU1A 3FNFA 5IJZA 5B1YA 3PP8A 4ZRNA 1NQTA 1U8XX 4R1TA 2O4CA 3R3JA 1F14A 1JVSA 1O94A 1Y8QB 1X1EA 3JQBC 4WCDA 3SX2A 3KLPX 2ZK7A 4FFLA 3ZGYA 3QWAA 4ZRMA 2NM0A 2UAGA 4I9UA 3PWZA 3EVNA 1KVUA 1YJ8A 2IZZA 4JX8A 5HA5A 4R68A 2AW5A 4MVJA 2ZIZA 4OXYA 4J6FA 4R3NA 2BFOA 1YDWA 4HNHA 3ZNNA 2BGLA 1LRKA 2DC1A 4CLXA 3QQPA 1DXYA 1T2FA 2AXQA 4II3A 1UR5A 2BGKA 3GLQA 4QECA 4DPLA 4NHEA 4AL4A 2VUSA 4K6FA 4ZU3A 1WPQA 1E3LA 3C3XA 1L7EA 2J6IA 4XQGA 1QORA 2VWGA 4BV9A 4BL5A 1ADBA 5L53A 3JQGB 3JQ7B 3RWBA 3D4NA 4O0LA 4ONEA 4AJLA 3N74A 3L07A 2HKIA 3JQAA 2Z1NA 3OH8A 1UDBA 2VT2A 1QLJA 3BTUA 4PCVA 1VM6A 4UUPA 2VWPA 1U3VA 2IODA 4HFMA 5COBA 3DONA 1A71A 2VZ0A 3LF2A 1KVSA 1Y6JA 3KOUA 1Z6ZA 3ONEA 1PGQA 3QIVA 5JC1A 3WB9A 2GNAA 4GQAA 3GEDA 4ND4A 4RPHA 4TZKA 4Q3CA 4WECA 2YZ7A 1ZEJA 3ETDA 1ZVMA 5EERA 3QV1A 5KJ6A 2X0IA 4F46A 1ZSNA 1VSVA 1QYWA 3KVOA 3E03A 5A02A 3LK7A 2XPCA 4Y67A 4E21A 2PZLA 2IXAA 1YO6A 5DBGA 1Y8RA 3QWHA 1HDYA 5GZ3A 2GR9A 1EUDA 5IXYA 3HHPA 2JL1A 2OOSA 1ZCJA 3I9KA 4TRNA 5I9NA 1T2AA 2ZB8A 4DC0A 2A4KA 1B15A 3NRCA 4YJHA 4DWVA 2NVUB 4FD3A 4XR9A 1F12A 5EJ2A 4BNGA 3DZJA 9LDTA 1N7HA 3D0OA 4RDIA 4CMHA 4ID9A 4YWJA 3VZRA 1GQYA 3JD1A 3UF0A 5G0WA 4BB6A 3JQCA 3PVZA 5L4NA 2Y68A 5DBFA 3F4BA 3STHA 4EUEA 3BMNA 2VZ8A 4RZIA 3W4JA 6LDHA 3LT2A 4QSMA 4HXYA 3FNEA 2AEFA 3PRJA 4L73A 1DPGA 3VH4A 4QX6A 3QE3A 2WD7A 1PJCA 2D1YA 3MWDB 2GN6A 3KXDA 1M6WA 2I3GA 2X0JA 4CM7A 4EZBA 3Q9NA 1SBYA 3F3SA 4F3YA 5G0UA 2WMDA 2VYVD 2AG8A 4ITUA 4L4SA 2X58A 5ILOA 1R0LA 4UUNA 4PG8A 2JAPA 4AJOA 2DFVA 3PJGA 5JC8A 2R6JA 3DBVO 3GMSA 4AVYA 1ZUD1 4IIVA 4M1QA 5C7IO 4P4GA 1ONOA 1O95A 3VH3A 3RROA 4Z3DA 1ENZA 1VL6A 1W4ZA 2JHGA 2VYVA 4W7HA 2Y05A 1O89A 2O23A 2DBZA 1OC4A 1LRLA 1X13A 2OFPA 4B4VA 1HDOA 4P4LA 4XJTA 2GASA 4M49A 3FWNA 1HETA 2BFMA 3GDOA 1HKUA 4R54A 2WYVA 4GWKA 4J49A 3QVTA 4F6CA 2VOEA 1WDKA 1NM5A 2IZ1A 4WCFA 1I8TA 3QVSA 1GR0A 1NPTO 4BVAA 2W2LA 4CUJA 4N18A 4CV3A 4YT8A 1KS9A 2X4GA 1SCUA 4R69A 3KBOA 3NTOA 2UVDA 4W82A 4GKBA 4GL4A 4J2HA 9LDBA 4XA8A 1ARZA 3COSA 1C1DB 3L4BC 4LCJA 3ZH2A 3UKOA 4NFHA 1NNUA 1E7YA 1E1LA 2AA3A 2W4QA 4LSWA 3VOSA 4BNUA 2AHRA 1SPXA 2O3JA 2PD3A 3ITDA 5DT9A 4R9RA 1H6BA 2VUUA 5H83A 4LGVA 3ZNPA 2VTDA 3G79A 4BGIA 1JKFA 1QSGA 1LDMA 2F1KA 2JHFA 2UV8A 4RCVA 3BAZA 3H9QA 1Z82A 2AEMA 1ENYA 2PGDA 5T57A 2EF1A 1UXHA 5A9SA 1XU9A 1Y5RA 2ZATA 3K92A 3RSHA 5KJEA 5L4LA 5EN4A 2PK3A 3OJLA 1YONA 3DOCA 3UN1A 4TSKA 1UP7A 3JD3A 4MIYA 4DQVA 3NEPX 1YS4A 3OEWA 5IXSA 1Z7BA 1IZ0A 3DAFA 1VLLA 5TT1A 2EKLA 3D1LA 3GZNB 4XDZA 2NTNA 3ONFA 1EBFA 3P5SA 1JU9A 4Q3DA 1D4FA 1H6CA 1XHLA 3WX0A 2Y0DA 4GI2A 3AM4A 1YVEI 2Q1SA 4A26A 1DHRA 1PGJA 1QXSA 4PLHA 4TRJA 4D0RA 5H82A 2EKQA 2AMFA 1AHIA 3NGLA 4IDGA 4NH4A 4P38A 3VPHA 1IULA 2CFCA 2OZPA 4WLFA 8LDHA 1U3TA 1KERA 3RFVA 3BZUA 1PIWA 1RM3A 4OYRA 5L40A 4EEZA 1F0YA 4ND3A 1DLIA 2C7GA 4LRSB 2HMWA 2GN4A 2IRWA 1AN9A 4CM5A 4IS2A 1NR1A 4GSLA 1OAAA 1MB4A 1G0NA 1XQ6A 1HSOA 1B8UA 1L1FA 3GVXA 3O8QA 3L4SO 2ZKLA 4E12A 1SMKA 4NFYA 4CMEC 1EDZA 1VJTA 2X8LA 5BNFA 3AWDA 3K8ZA 2FZWA 2ZYGA 4WLVA 4XQCA 5LC1A 1DLJA 3WQRA 2JFFA 1WLYA 1EK5A 3VKVA 3INGA 3OJ0A 4RLHA 4PN3A 4DBVO 4W4TA 4YAIA 1QYCA 3V8BA 2QZ9A 3GRPA 5CDSA 3DHNA 3QHAA 4BO1A 3EUWA 5AXBA 2V6GA 4EGFA 4DMMA 2EJWA 2WTBA 2GF2A 5EQFA 4PRLA 5U1PA 1LLUA 1P1JA 3KSUA 2OHXA 1IB6A 3EVTA 3KEOA 1P44A 3GAZA 1BXGA 1M75A 1LTHR 4J16A 4EI2A 5JS6A 2YFHA 1CWUA 4OSOA 1V3UA 3PQEA 2P5YA 2Q4EA 1ZSVA 2R00C 3M1LA 5JY1A 1UXIA 2NSDA 3K30A 1A9YA 2D4AA 4HUJA 4PLPA 3BMQB 2VYNA 4CV1A 3OIFA 2RHCA 2Y0CA 1VE9A 2HO5A 3PQDA 4BNYA 4GWGA 4XGIA 4RVFA 2NADA 2PZMA 1J5PA 3CUKA 4MO2A 4UVGA 4U7WA 4BKRA 4I9HA 4R51A 1HDGO 4D41A 1LC3A 3HN7A 2X5KO 3RUEA 1GDHA 2PZKA 5K6AA 4ZJUA 1LBEA 4HX5A 1IPEA 1E7MA 2I65A 4BO0A 1DFIA 2H1SA 3K96A 4ALIA 5BSFA 2E82A 4WJZA 1LA2A 4GSKA 4RORA 1DO8A 2NU8A 3JD0A 2W98A 1NASA 1ISHA 2X86A 4K6CA 3LYLA 1BVUA 4J4HA 4BO2A 1HYGA 4RQUA 3G49A 3EY4A 1HE3A 3AI3A 4CMAA 5GY7A 3PWSA 2EW8A 2GDZA 2ZTUA 1J0XO 2DBRA 3D3WB 4MJLA 1PS8A 1DC6A 5G0SA 4BNXA 1I36A 3GGGA 4XJSA 4C7JA 3AFMA 2IE0A 1DBVO 1IYZA 2OMEA 2NU9A 3KV3O 4RZHA 2YFQA 4WPGA 4ZQHA 4IGFA 4TKLA 3OFSA 4XQEA 1C1XA 3RUCA 4MVJG 3RUHA 1WWKA 1ZK4A 1UZLA 3DBHA 3E9NA 1P0CA 3NT4A 2PH3A 1ZIDA 4OIMA 5JCJD 3ORFA 1MXFA 3ZWWA 1D3AA 5DCUA 3S55A 3WYBA 4DIFA 1DJNA 3AU9A 4DMLA 3I6IA 4CM6A 1R16A 5I9LA 4DC1A 5JDCA 1Q7CA 3PTZA 5ITWA 1ZBQA 3AY7A 2BD0A 1MC5A 3KTDA 3M1AA 4KTTE 1GTMA 3PFFA 5DBIA 4G5HA 1HYHA 3Q9UA 3TRIA 3ZWVA 4E5KA 5GZ1A 3IOYA 4PLYA 4GX0A 2E48A 3WGTA 4E33A 3FR7A 1BDMA 1PQWA 2O50A 4NK4A 4L4XA 5JW6A 4CR8A 3KRTA 4M87A 4L8VA 4BOYA 2O7SA 3DZIA 1PZGA 3KYCB 1HDCA 2Y1GA 1UH5A 5TIIA 1W73A 1K2WA 4KDFA 4YAGA 3IAHA 1P1IA 1NVTA 3OIGA 4RVUA 3VH2A 3WIDA 3WYEA 5L7WA 4TVOA 3VPXA 3TFOA 2EGGA 4RVDA 1E1MA 4CMJA 1C0KA 1K89A 2ZCUA 4MVJP 1LSSA 2NV6A 1LQUA 3NTQA 1XU7A 3FNHA 3L77A 3ASUA 1U5CA 3PPIA 3WSWA 3AI2A 3BMOB 3AOGA 3GFBA 3HJAA 3MEQA 3W8EA 4BKUA 1R37A 2FN7A 3ROKA 3NT2A 3LLVA 5ICMA 3Q3CA 1LJ8A 3U4IA 1GPJA 1B0AA 2PZJA 4ESOA 1DC3A 4CMBA 5L45A 3O38A 3OSUA 1T26A 1R12A 1V8BA 1SNYA 3PXXA 4CJXA 4J1SA 5EESA 3B70A 3OETA 3TZKA 1D7OA 3PJDA 2RIRA 3ZV3A 1KIFA 3IP3A 3HB5X 2G5CA 1K6XA 4OKIA 2D5CA 4DUPA 4EUFA 4BQPA 2YQ5A 4XIYA 2DBVO 1M76A 1QYXA 1HLDA 2FPIA 3DZBA 2WYUA 4HP8A 4XIJA 3MJCA 4IMRA 4X54A 4ZQEA 3SJ7A 4FJ1A 4GPD1 3HE3A 1LXCA 1G6KA 3DBRB 3ITKA 3GK3A 3BTSA 4QXMA 4Z9XA 5LCXA 4R01A 4WGGA 3JV7A 1NWCA 4BGVA 3AUSA 1BGVA 3CSDA 4AFNA 5CHEA 4D3DA 2BMAA 3PJFA 3KZVA 1KVRA 4CUKA 1RM0A 5BSGA 4LMRA 1WMBA 2FPPA 2FZEA 2BRUA 1XGKA 4R16A 2Y1DA 3WLEA 1YDEA 4J43A 2RH8A 3WOHA 1EFKA 3IS3A 4YDRA 3OECA 4NBTA 3JQ9A 4RPGA 1SZJG 2VRBA 3TDKA 4ND2A 1GZ4A 4DREA 3EHEA 3LF1A 3KM0A 3TJRA 1WMAA 4OGWA 4R3WA 5TGDA 4OJNA 4WLNA 1YB4A 3L6EA 3ZU5A 3ZWPA 3ICPA 4YACA 1MA0A 1FDUA 3JQBA 5BT9A 1MFZA 4N7RA 1PU2A 3FBTA 5KIAA 3JQAB 3RUIA 4UVIA 3DZFA 3MJEA 3KO8A 1ZK3A 2CDAA 5IZCC 3PFWO 1WVGA 3DTTA 5CFZA 2Q2VA 2DFDA 3NDRA 3VZPA 3ZU4A 5JE8A 2QQ5A 3FR8A 1LQTA 1UP6A 1KEUA 3EYWA 1LSJA 4IQ0A 5CAEA 3NAQA 1RYEA 3QJ5A 2QYTA 1I33A 1H9AA 5JAMA 3IL2A 1ZXBA 2AEJA 1V3TA 4BNTA 4YRAA 1R15A 4KP7A 3RJ9A 4FFRA 2P9EA 4IM7A 4Q9NA 2ZTMA 4PZDA 3DZGA 1YBVA 2P9CA 2PR2A 3F9IA 3GDFA 3ZWXA 4RDHA 3CMCO 4RPKA 4H3VA 4RVSA 2FR0A 3HN2A 3OBBA 1RM5A 4B4OA 3QSGA 4WEQA 1SEVA 1Y8RB 3IJPA 3ROQA 3ANMA 2HUNA 3U0BA 4NNJA 4NJMA 1NTOA 3JD2A 1QG6A 1NHGA 4KDEA 3UCFA 3K6JA 4PRKA 1IOLA 3WGOA 1EE2A 3PWKA 2E49A 2F00A 3ROPA 1QMGA 3UVEA 3DAPA 4YJHB 4QFDA 3VZSA 3X2FA 4ALMA 1A7AA 5L7YA 1KVTA 2B0JA 5DP2A 1PR3A 3F5SA 1V0JA 2TMGA 1DFHA 1UZNA 2B5WA 1E77A 1NFFA 4YQYA 3VC7A 3TL3A 2C0CA 3W8DA 3H5AA 3WFIA 1DDOA 3WMWA 1LLQA 3HUDA 3AUUA 2XXJA 3WJAA 2EEZA 1B2LA 4GKVA 3BMNB 3ADOA 4DPMA 4CM4A 1C0IA 3RIHA 1PTJA 2CMDA 1GCUA 2UYYA 3PYMA 2WD7B 4J3FA 1A7KA 1ONPA 2UDPA 3F4LA 4L75A 2HJSA 4MVJH 3JD4A 3V1UA 1GUYA 1PGPA 3W6ZA 1KY4A 3KLMX 3VPFA 2CSUA 1U28A 2NU7A 1S7CA 1X0VA 4XR4A 4B8ZA 3LC2O 3W6UA 1PEDA 2IZ0A 4MIEA 4M89A 3TSCA 3UCEA 1H0KA 2B35A 1Q0QA 1GUZA 3PYLA 3K9QO 2VZ9A 3VDRA 4YAEA 1Q1NA 1BSVA 1KY5A 1UAYA 1M67A 5G0VA 4XYMA 3DBRA 2ILTA 3UAGA 2Y99A 1R4NA 3FTNA 1CJCA 4KQWA 4Z9YA 1YQXA 3MTJA 3S2GA 4BNKA 4KQXA 3E8XA 1MP0A 1U4SA 1ML3A 2NQ8A 1EUCA 2J3HA 4WCFB 3CZRA 4MVJM 4IJUA 1DC5A 1P33A 1P45A 4Q3NA 1HDXA 4UAGA 5C3MA 4YJGA 4I5FA 3FWZA 3L9XA 3AOEC 5FYDA 5HRUA 1IE3A 4EJ0A 1IZ9A 3I5MA 5HBRA 2FWMX 3VZQA 1D8AA 3WTBA 3GGPA 1T25A 1PJTA 3ETEA 3GVIA 4JROA 4OH1A 4RO0A 3ZZNA 1Y1PA 3RC7A 2WSBA 5JXWA 3AY3A 3C7AA 3E9QA 4KTVE 4ALLA 5KJCA 2HDHA 2FSVA 3GZ4A 4XRRA 2PA3A 4XD2A 3HDQA 3I4CA 4FC6A 1JKJA 2I76A 3CE6A 4CM1A 3DHEA 5A9SB 2RBEA 2BH9A 3PEFA 3H9EO 1GZ6A 2HAEA 3EGOA 3NX4A 5GZ6A 7ADHA 2DTEA 2D59A 4PLFA 4UUMA 4W9NC 4TQGA 4IQ8A 3F5QA 4IPTA 5FEUA 3JYPA 4JN6B 4BNFA 1ISFA 2FPGA 4FFOA 4U0JA 3DFZA 3GNSA 4A27A 2PV7A 1NAIA 3JYQA 3L4BA 4O6VA 3TWOA 2Z1MA 4H16A 2EIHA 2AQKA 2QW8A 1YRLA 1DC4A 4IMPA 4DLLA 1GPDG 2OP0A 4OSPA 1QYDA 2O3UA 3GVCA 1HE4A 3DMTC 2X6TA 4ZQGA 1GUFA 1JWBB 4N5NA 1I5RA 3PDUA 1W6UA 2JCXA 3V2UA 4E5NA 2YDXA 1IPFA 1AXGA 5KVSA 2Q99A 2NNLD 2VNSA 1VPDA 3G1UA 1NBOA 3NGXA 4EJ6A 4ND5A 3RKUA 5EMHA 1K6JA 5H81A 2GO1A 1AUPA 3DBLA 4BGUA 2O2YA 5AOVA 3TQHA 1Q2XA 2YHIA 3LC1O 4NI5A 2DT5A 4CLOA 2BGMA 5A3VA 1NVMB 4JIGA 3UH1A 4YJFA 1U8FO 4JJFA 4DQUA 1TLTA 4PVDA 3ZWYA 3O8QB 3MJSA 5JAQA 2FRDA 2EXXA 1V9LA 1CYDA 4RQTA 3DOJA 2B83A 2IEBA 1TI7A 2C7VA 1EMDA 2E4AA 2HK7A 5L51A 1FDWA 3WG9A 3WQSB 3PGXA 5TX7A 3GQVA 2XXBA 3OJOA 1TA4A 2G76A 3CKYA 4HNGA 3TPCA 1ONNA 1O5IA 5ILGA 3WNQA 3UW3A 2C5AA 1QP8A 4PG6A 5IZ4A 1V35A 1DAPA 3CINA 1BXZA 4I1IA 4UUOA 1U4OA 2CY0A 5DF1A 4HBGA 3NKLA 2OGUA 3O26A 4E2YA 2DU8A 3FTPA 1OFGA 4RF3A 4UREA 4UULA 3RBVA 1Y7TA 1XWFA 4GBJA 1YH3A 2WDZA 4OM8A 1NAHA 1NR7A 1SOVA 1TVEA 4LSMA 1CERA 2IYPA 4D7AA 1U2GA 4GLLA 3GHHA 3OQ6A 1RKXA 4J1NA 1PGNA 1CEQA 5G0TA 1BXGB 2GRAA 1K0UA 1DEHA 3WWZA 3INTA 5EPOA 4LW8A 5JO9A 4CMEA 2FHSA 3RBXA 1U3WA 3G1TA 5JMWA 4OOFA 3VDQA 3FHLA 2I9PA 4KMSA 4EUHA 1JA9A 2V65A 1DIHA 4BMVA 5KJFA 3WXBA 4U5QA 1CQIA 4JGBA 4E0BA 2GZ3A 3ZU3A 4J0FA 5IDYA 4OXKA 1Y81A 1E7SA 1P1RA 3WFJA 3H8VA 2VCYA 1E3JA 5JAZA 4YAJA 4BV8A 3Q6IA 1H2BA 2DAPA 3WNVA 4D46A 3GPDG 1PZHA 5EIOA 1GAEO 5MDHA 3GRKA 3Q2KA 3WYCA 3GVHA 1JW9B 1H5QA 2GN8A 2HRBA 5B4VA 1DIGA 4YVFA 3LT0A 1R0KA 4YRBA 2JD0A 2R00A 3TFQA 1ISMA 2A35A 1ENPA 4YJDA 1F8FA 5TRTA 1MC4A 2OBYA 2C82A 2ZCVA 5CDGA 1GEEA 4E5YA 1FDSA 5FI5A 5CDYA 3Q0EA 4BNLA 2DQ4A 3NJ4A 5KKAA 3K2BA 4AJJA 4R5MA 4G81A 5IF3A 3TL2A 4BS9A 3UOGA 4BO4A 4YPOA 2Z5LA 2B36A 1X1TA 3N7UA 2PLAA 3EZYA 3RFXA 4EYEA 2CUKA 4QQRA 2O3TA 1C1XB 3A28A 1ZW1A 4OQYA 1I10A 3DBHB 4I5EA 3UICA 3HWRA 4LCEA 4L9RA 4H7PA 3MWEB 5K0ZA 5A03A 1LLCA 3BXXA 1JKIA 4FCCA 4GX5A 4ZGWA 1OC2A 3LSYA 3E9MA 1WZIA 4JQCA 2EG9A 1NQOA 1CRWG 4XYBA 4OXNA 2YYYA 4E2WA 1SO8A 1EQ2A 2WM3A 1LDGA 1Q7BA 1E6WA 3P2OA 4XYEA 1P3DA 4QUKA 4Y8VA 2JJYA 1SB8A 2X5JO 5KKCA 1E3WA 5TLSA 3HDYA 3F1LA 1X0XA 1P1FA 1WP4A 3H65A 4DBZA 1TT7A 5IDQA 3PK0A 4FS3A 5TNXA 3EAGA 2CDCA 2DLDA 3FRJA 4BNWA 2BFAA 5TJ9A 3I9OA 2ZQZA 7MDHA 1ID1A 5EQDA 1HLPA 3PHGA 1JQBA 2GUGA 1VJ0A 5ICSA 3T4XA 1DIRA 4KZPA 2BF7A 3DHYA 4RL6A 3FBGA 2H6EA 3TF5A 4M55A 4AJ1A 1TEHA 2X7HA 1HSZA 5DP1A 1KC1A 3RC9A 3PGJA 1ULSA 5IDWA 1DSSG 4CLDA 3ZWMA 1L7DA 3GN1A 4XX0A 3FPLA 5TSDA 3R6DA 2GSDA 5I8ZA 4BO5A 2PGJA 3WLFA 5CEJA 2DPGA 2Q2QA 1BW9A 4AG3A 3GF4A 1AHHA 1VRWA 4P22A 5G4KA 2UUPA 3WQQA 3UHAA 2WWRA 3ZV6A 3KYDA 4NZ9A 1M6HA 2TMDA 1LNQA 1TT5A 3AM5A 3CMMA 1U9JA 3OIDA 4FW8A 3ZNOA 3ZCXA 4JBHA 4XYGA 3B1FA 4BO6A 4YEDA 2A92A 1VI2A 4GMFA 3ONDA 4ZHSA 2X0RA 2NLOA 1GADO 1A5ZA 5L4SA 4E2ZA 3H9GA 4IDDA 1H6AA 2J3IA 2YDYA 2XF8A 2DM6A 5KWEA 4DQXA 1VJ1A 4IQGA 1UXGA 5F5LA 5A9RA 2PH5A 3VHRA 5HM8A 5JLAA 1T24A 5JY6A 3RBZA 4NPCA 3ZN2A 1F17A 3P19A 4PZEA 5A1TA 2SCUA 3RAJA 1RWBA 3RU9A 1FDVA 1HWYA 4MVJF 3WSVA 1B8PA 1XKQA 2W90A 4QO8A 3MZ0A 2PKRA 4IINA 2C20A 4DXHA 2PD6A 4FSHA 3ENNA 3SLGA 4CLEA 4NFSA 3BA1A 1GD1O 3GG9A 4IUYA 4DA9A 3VVCA 3LZ6A 3MJVA 5A4DA 1KEPA 4IJKA 3WGGA 5CDTA 5KNLA 2D0IA 5CPBA 2Q49A 1XQ1A 1PJ2A 3I9NA 4HY3A 1E5QA 1FJHA 3C1OA 3JQ8A 2X23A 4D42A 1KBZA 2Y67A 4ZN6A 4FGWA 4AJIA 2YV1A 3SVTA 4D3FA 4KUEA 4TWRA 4FFNA 6ADHA 1VL8A 4Y6PA 3Q2IA 4YB8A 2J3KA 3TOXA 1MUUA 3ZV4A 4CL8A 4NBRA 4MVJI 4L74A 4ILKA 4Y9DA 2NACA 1YL7A 3Q1LA 1DAOA 3GH3A 3N58A 1B7GO 4RF2A 3T4EA 3GEMA 4M54A 4TVBA 5ADHA 5CDUA 4NU5A 4IDCA 4TKMA 4J0EA 4L76A 4A10A 3IDSA 4CQMD 4OMUA 2Q50A 4MKXA 1PL6A 2HK9A 1Z75A 2QHXA 2C2YA 3SC4A 5JCJA 4CM9D 4F6LA 2Q1TA 3DFUA 4EEXA 4IDFA 4LVUA 5IZCA 4J4BA 3IMFA 1DJQA 3PHJA 1I2ZA 4MP3A 2QRLA 4IXWA 3KYBA 4NJMB 3O9ZA 3SJUA 2HMVA 3OM9A 5T67A 1KOLA 4O59O 3I9MA 4LMPA 4CQMA 4EITA 3B6ZA 1K3TA 2Q2WA 2WJPA 3SC6A 1NPDA 4U8GA 5HWSA 4IJVA 3KHUA 2C54A 4ZVVA 2Y1CA 5IFLA 4BO3A 1N2SA 2EW2A 2GYYA 2ZTVA 3IKVA 2HK8A 4KWHA 4PGFA 1UDCA 5DCYA 4TROA 1EDOA 1W0CA 2PTGA 2HSDA 3C7CB 3KEQA 3V2GA 4D45A 3MTGA 3JQ6A 2IYOA 3H3JA 2DUWA 3AK4A 3PZRA 5AXCA 3ZV5A 4CM4B 3ANNA 2D2IA 3S2FA 4BKQA 2C07A 5AQ1A 1Q0LA 3IIEA 2FR1A 1GL3A 1NXQA 3QVXA 5TC4A 3HDHA 3WDSA 1F06A 1VSUA 3E6AA 4MIOA 4CM8A 2EGHA 1SC6A 2J8ZA 1PJQA 4KOAA 3WR5A 1B16A 5CPFA 3WJ7A 1CF2O 4U0KA 2X5OA 1BVRA 3ZU2A 1ADGA 2CVOA 2VRCD 4B4WA 4FC7A 2PFGA 4UVEA 3AW9A 5I8WA 2G0TA 2OUIA 2EJVA 3OA2A 1G0OA 5KVCA 3AU8A 1LU9A 4NMHA 2J5RA 4NQZA 3U3XA 1T1SA 4I9NA 2YUTA 2B69A 4YR9A 1A9ZA 2E37A 4JK3A 1N9GA 4ROSA 4R9SA 3FSRA 1IY8A 1GFSA 2VRCA 3EDMA 1D1TA 1R4NB 3U62A 2RHRA 4WKGA 4NBVA 1AE1A 4DVJA 4IJWA 3UCXA 1E3EA 4Q3EA 1GV1A 4A0SA 4B7CA 1GCOA 1YOVA 5F21A 4CPDA 1ZO8A 3A1NA 3BYZA 3INRA 2LDXA 3CIFA 1EVYA 3FNGA 1YBAA 1UJMA 4W99A 3RI3A 3W1VA 3B1JA 1YBMA 4J4TA 2Y1OA 4YJGB 4DGSA 5L3ZA 3QLJA 4GVLA 1LDYA 3S2IA 4CMKA 1X14A 1VL0A 2NTJA 1GEGA 2Q3EA 1KEWA 3M2PA 2VNAA 3E82A 2I66A 1NWHA 1O9BA 3L6DA 4WLUA 5A9TA 3DAGA 3U4DA 2EP7A 3KSDO 4P8RA 1DRWA 4N5LA 1I32A 2A94A 2Q45A 4FOOA 3SEFA 3RFTA 1A4UA 3PDJA 4BNHA 2B4TO 4WLEA 2VN8A 1YGYA 2CDBA 4QFCA 4PIVA 4NBUA 1H94A 4YXFA 3IKTA 1MX3A 3AOEA 1RJWA 4B3JA 1PQPA 1OBFO 3RCBA 3SBOA 2GLXA 2JFHA 3FCOA 3EW7A 4K9DA 1GV0A 5FFFA 3U49A 1XG5A 3ICCA 1M66A 8ADHA 5JDIC 1EE9A 4WUVA 5IN4A 1F8GA 1I24A 2HRZA 1UXJA 4ZA2A 5T8KC 4PLGA 5AXDA 2O3SA 3OJEA 5JFOA 4CMGA 4Q39A 1PJLA 1HF3A 4WOKA 4XB1A 2GZ2A 3LT4A 1LDEA 4D3SA 2JAHA 3MJ4A 5ITVA 4M8SA 2X9NA 4R4JA 3DBLB 4W9NA 3EC7A 2P91A 3U4HA 5KCZA 2OP1A 3H4VA 2YHIB 3I9LA 3P7MA 4CLOB 3DDNA 3TZ6A 1WXDA 1V3VA 3NJ8A 3Q11A 4FJ0A 4XB2A 1YQGA 1U2DA 4YJFB 1OI7A 3WTCA 4DRYA 2D8AA 3K2EA 1DRVA 1EFLA 2W8ZA 3H2ZA 4CV0A 4CUZA 4TZTA 4TRRA 1QRRA 1UAGA 1O8CA 4BNJA 2EKPA 5KVQA 1I3LA 3RASA 4CQLA 1QKIA 3KETA 5L95A 5CG1A 4GAEA 3T7CA 1YL5A 2LDBA 3DMTA 1QR6A 1ADFA 4CMIA 5AVOA 4Y98A 4I08A 4AJPA 3S2EA 1PZFA 1YQDA 5KOIA 2VHXA 3UGKA 3ZWNA 1ISIA 5DULA 4AJHA 3RUFA 1XDWA 3LT1A 1U7HA 1BHSA 4XDYA 2I3AA 5JCXA 1HZZA 1ZXLA 3RJ5A 1P1KA 3E5RA 5CP8A 3OHSX 4C7KA 1B14A 1IHXA 3MOGA 2WE8A 1MLDA 3NUGA 4CLRA 1Y5MA 4O63O 5AYVA 3TZCA 1QYVA 4Q3AA 4WNCA 3ZDFA 4ZD6A 1H6DA 3QVWA 1LEHA 1I0ZA 4DLAA 3QW2A 5C5IA 5THQA 4G2NA 4RPLA 3M6IA 2NVWA 4U6SA 4JCOA 3MOIA 3D5QA 5THKA 3JQ9C 3AI1A 3CXRA 4JP3A 3F1KA 1I3KA 4RVHA 3R0IA 3QWIA 1J49A 1R6DA 1N8KA 2NU6A 4R1SA 3JQFC 5GMOA 2EV9A 1NPYA 3VTZA 3LLSA 4RGBA 2P5UA 2WEKA 4MVJD 2J5QA 1ADCA 3OQBA 1YWGO 1E3IA 1HYEA 2YQ4A 3I9JA 3AUAA 2CF6A 2HMTA 1GYQA 1B3RA 5DOZA 4PG4A 3ULKA 4PFJA 4HFRA 2B37A 1E3SA 2YV3A 1Q7GA 3GR6A 4K28A 4MINA 1IHYA 5F5NA 3DOOA 4HFNA 4PLWA 4NG5A 2P68A 1WNTA 4A5OA 4AJEA 2DTDA 3JQAD 3I23A 1MV8A 2J3JA 1JTVA 2JCYA 2RCYA 3ZHBA 2IEDA 1PS0A 1MG0A 1GYRA 3GNTA 3K5PA 3UFXA 4J2OA 4B3IA 5J23A 4JBGA 1S6YA 2OL4A 3RQSA 3VKUA 2V6BA 2GD1O 4IS3A 4ZQFA 1JWAB 3RKRA 3CTMA 5HS6A 1FDTA 1XLTA 2Y1EA 4HV4A 3DEYX 2X9GA 1HXHA 1KYQA 5MGBA 4AJKA 5JNLA 1ZK2A 4PG5A 2FP4A 4J7UA 2C5EA 2D5AA 3LC7O 3WBBA 3AY6A 1BXKA 5IG2A 4IDAA 5EINA 4NBWA 3ETGA 2CF5A 5CEEA 4YTEA 1CIVA 3MCVA 3CPSA 1IUKA 2W2KA 4M86A 3QP9A 2AQ8A 5I7SA 1I2BA 1YXMA 5A06A 2Y0EA 5G2OA 4B79A 3B20A 1HTBA 1LDBA 1B8VA 2HLPA 3H7AA 4K1LA 1BRMA 1E3WB 4HADA 3AJRA 2QZZA 4ALJA 3WGHA 4A7PA 4B3HA 1NYTA 4E5PA 3ON5A 4J7CA 1Z7EA 1IL0A 2XOXA 5BNTA 4CV2A 5HS4A 1H93A 3WGYA 2Q4BA 1C14A 3SLKA 4E4YA 2NQTA 1NHWA 4NIMA 4W7IA 3OEYA 5L9AA 4Z9FA 1UZMA 3RU7A 1EUZA 3WBFA 2EP5A 1HL3A 1FMCA 2X0NA 3H9UA 3H5RA 4XGNA 3JQEA 5B37A 1EVJA 4N54A 5B4TA 3GG2A 4I5DA 1U5AA 1ZZEA 2P4QA 1A27A 2IXBA 3PQFA 1R66A 5TF4A 2X1HA 3C8MA 1SOWA 3GA0A 3ANLA 4YA6A 3T7EA 4MOWA 1T4BA 4BNZA 1DFGA 1P0FA 2FR8A 3PYXA 5DN9A 5ER6A 1BW9B 1KC3A 4CODB 4D43A 1O6ZA 3PJEA 1HE2A 1TB4A 1Y9EA 2XAAA 3K73O 5G4KB 4BNMA 3H5NA 3KB6A 2BHLA 3CEAA 3KYDB 4D79A 1TT5B 2OBNA 3D3EA 2DTXA 5LDGA 3AFNA 3HFSA 2HCTA 2ZB7A 3V2HA 1LUAA 2GPTA 4ZQBA 1FXSA 1UP4A 3VVBA 1PS9A 3RUAA 2EERA 1WDMA 2YY7A 3BMCA 4R41A 3F6YA 4PZCA 3GN2A 3RUDA 1M2WA 2WE7A 4N5MA 1I3MA 4HWKA 2NTVA 5IN5A 4RF4A 4E30A 4U6QA 3KUXA 2V6MA 1SEPA 4TRMA 4DIBA 4EDFA 4FB5A 1GY8A 2VHWA 3P2YA 2JD2A 3DQPA 4WASA 1UDAA 1ZFNA 1Y8QA 3ST7A 2O48X 4FGSA 4MP6A 4XGKA 4ZICA 3O4RA 2I67A 2AE1A 5AXAA 4HFJA 2W2LD 5TT0A 5C7LO 2DPHA 3D64A 3QVOA 3IJRA 4FIZA 3ZWCA 3H6KA 3GOHA 4BNVA 3NTRA 4K26A 2O7QA 1OMOA 4JP2A 1U7TA 1ISJA 3A4VA 3A9WA 3G0OA 4XEHA 2VWQA 1EK6A 2A9FA 1KVQA 3HB4X 2G1UA 2G17A 1X15A 4BO9A 1EZ4A 1PSDA 3ZNQA 1OZAA 2BI8A 3FI9A 4HKTA 1ORRA 1NFQA 1CETA 3OA0A 3RC1A 4YT4A 1ZJZA 3E1KA 1OOEA 1PL8A 3LDHA 3WICA 4FN4A 1QV6A 3WMXA 4GGPA 3JQGA 3JQ7A 1PWXA 3JQ8B 1T2CA 1SAYA 1RPNA 2POQX 3JTMA 4KUGA 3ZWAA 5IDXA 2QRJA 2PY6A 4UEKA 4BMNA 3H3FA 2CNBA 4D44A 3DR3A 1HEUA 2CD9A 1JAXA 5F1KA 3OP4A 3G17A 4GX1A 5COAA 5F1PA 2O3QA 1N1GA 4OAQA 4E31A 2V6FA 4H15A 4WNIA 2JCVA 1U1IA 3ROMA 4B4UA 3JYLA 1E6UA 1J6UA 1O0SA 3PI7A 1JN0A 2Y1FA 4J1QA 5A5EA 5BNIA 3D4OA 4QO7A 2YW9A 4FDAA 1H2HA 3FD8A 4PVCA 3HZZA 4CM3A 2AE2A 4BHTA 4YAKA 1YKFA 4IGEA 1GZ3A 1LDNA 2VHVA 4Z0TA 4BKPA 5JAIA 2B4RO 1ZH8A 4CLHA 1EVIA 4IBOA 4R5HA 3VPSA 4PG7A 4MPDA 5ENVA 3TOZA 2VOJA 4YT5A 3WS7A 4PLZA 5JPIA 3ZI0A 1EQUA 1V6AA 3HQ4O 4QEDA 3WWYA 5FI3A 4CQMB 4PLTA 3UXYA 2DUUA 4UVDA 2C2XA 3IUSA 2QG4A 1E7QA 1XSEA 4LK3A 3RC2A 2FY8A 2PGLA 5HTOA 3PHIA 4PLCA 3DB2A 4UEJA 3HADA 4JJGA 1I01A 1HZJA 1XA0A 3ZW8A 2NVUA 1GYPA 2QYSA 2Q1WA 1PR9A 3DL2A 3BTOA 3QRWA 1XCBA 3C85A 3I1JA 3JYOA 4IZIA 4O1MA 3VH1A 4EW6A 2OORA 3ADPA 3DO5A 1LI4A 4E32A 1MG5A 3HNPA 2VUTA 4AJ4A 3GFGA 2BFPA 5JBIA 1PJ4A 4CM8B 2FMUA 3EMKA 3TN7A 4WK6A 4XKJA 2ZJ1A 2E6UX 2O3RA 4B8WA 4B7UA 4MKZA
chains in the Genus database with same CATH superfamily
2YW2A 4XSVA 4GC9A 1CY0A 2IU3A 1JLHA 3HXMA 1GU7A 3C3KA 4TL8A 1JIKA 1EB8A 1NM5C 1T5OA 4L5IA 4QASA 4WCFC 5JRDS 5IAAA 4IIUA 4X41A 1B6GA 2ZDGA 5CEFA 3NHUA 4D0SA 3D9QX 3MJHA 4HMPA 4A6DA 4NJOA 3PC2A 1AGYA 2ZB4A 4DYVA 3VYVA 3IQIX 1Z0KA 4P4NA 4PY2A 4XCVA 4PR0A 1M5RA 3RRYA 5AM2A 3W4KA 3QW4B 2C98A 2FI1A 1DAIA 2WUDA 4LDZA 1TFUA 3T41A 3ZU6A 2Q27A 2BSXA 3K1YA 2HF2A 4OXIA 2R66A 3DM5A 4PPGA 4WE3A 2QG9A 3MOSA 4YRDA 3GAFA 5I51A 3DE4X 2RH5A 1RRCA 4LJ7A 4B34A 1H4VB 2XIJA 4HDKA 4CEIA 1CUIA 1CQZA 5HZMA 1NMEA 1ABEA 1V5GA 2C77A 3KQMA 2Q7DA 3T5DA 3RRXA 3JSAA 2IEIA 1EGMB 1NQAO 2FKAA 2QT0A 2OBFA 2HR1A 3GC6A 1E5LA 2HMUA 4RHUA 5KI6A 2JASA 3J7AC 1H5UA 4Q82A 1R6XA 2P9JA 3PNPA 5J63A 1X7HA 1I2MA 5KNDH 5LZ9A 4Y9TA 1BJKA 4RA6A 3IDFA 4PBTA 4HVCA 2D0DA 3H8JA 1CZRA 2BV3A 4NYIQ 4PZAA 1GTL1 3BILA 3U9SA 4MKRA 3QEOA 3W5UA 5HIKA 3HCFA 3ZVRA 1KPIA 3FI0A 5KJ1A 2ZYSA 2XQKA 4KI0A 1B43A 1Z16A 3WLIA 3SJAA 2GJ9A 2WR8A 1N1EA 2YYSA 4GKAA 4OKNA 4MUGA 4QVGA 4BB5A 1IZ7A 3GPIA 1B3BA 4M0KA 4TSFA 3VDNB 2GBLA 1USKA 1FDIA 2B3DA 2FH5B 1PJZA 4GI7A 1UJCA 2XGOA 1QFZA 2C8VA 3FPGA 5AQEA 5K8VA 4YAOA 4GMGA 2C9CA 4INAA 4EB0A 2YXPX 4NU6A 3WLLA 1RAAA 4ZAYA 1Z15A 1L5RA 3CWZA 4GGOA 2FPMA 1E1NA 4IZHA 4MVJE 1NXTA 4W1SA 3R4VA 5HE8A 2FOIA 4EHHA 5U9CA 5JRZA 3MGBA 1TECE 3HLKA 4V1CB 1NE2A 4JYCA 5JZBA 3EF3A 3R3SA 1T9CA 4J90A 1HH4A 4ZYUA 2NG1A 1EBUA 2JW5A 3I5AA 4JD5A 1DAMA 4Q4JB 4FPXA 1BGXT 4EMTA 3HYLA 5HZGA 2VVTA 3NDJA 3H9JA 1FTSA 4II2A 1BEEA 4EOGA 1HNZB 4EPRA 1J0CA 5D3QA 4CN9A 4CR6A 3NIDB 4J9UE 1ZCZA 4FOTA 3TZLA 3WDLA 3DMNA 3THWB 2A1UA 3L8MA 4LWZA 2GGSA 2ZRCA 3D4BA 4L1KA 4OAOA 1BH2A 2ET6A 1BTOA 1RKQA 2IYSA 2J41A 1YNSA 2Z30A 1Q0HA 4UZFA 4JI0B 3ZQ6A 3PHLA 2R8EA 4L51A 2O2SA 1Q0SA 4KQCA 1ES9A 5KEIA 3N7TA 5SV2A 1QV7A 4I3GA 4RTKA 3I83A 4OI2A 3I34X 5COQA 4JI6B 3WRWA 1T1GA 3A06A 4CDNA 1OX6A 4UQOA 1CDOA 1XWIA 4S1TA 3GNLA 5JATA 4XD7D 4JL8A 3T0GA 1KYVA 2H52A 1FIUA 5EMMA 3UMMA 4OHUA 1SH7A 5I7VA 2H5LA 1F6WA 1XN4A 2JI7A 4LC0A 5DNWA 4PWZA 2ECOA 2BFBA 4Z0PA 1JZSA 3DXFA 3HRKA 3PHHA 4DLYA 1NOKA 4XZ3A 2EFYA 2JIQA 3KTFA 2PYIA 1WUKS 3RS4A 1P74A 2Q07A 2XWQA 4OX9Y 4HTFB 1Z73A 4YHBA 3B12A 3PI6A 2ISCA 4IOJA 2DFNA 4JSRA 4DDVA 1YB7A 4V0OA 1Y7HA 4B83A 5BWBA 3KQHA 2QP9X 3GMIA 2N3ZA 2WNSA 3IT3A 1UBLS 4FD2A 5I9MA 1RHJA 4Q3BA 3TZHA 4BEVA 1EVZA 4E2FA 3G89A 3K9CA 4NCNA 4P3OA 1HURA 1B42A 4MAFA 4MYDA 1ESEA 5JMPA 5IVHA 2I2AA 4DEYA 2XBMA 2XNCA 3RGGA 4ZYZA 2IPAB 4DDMA 4GU5A 3GUUA 2XW6A 1UEJA 3EZLA 1QOQB 3NQ41 3F47A 3QZUA 1YJAA 2NSLA 3I72A 4R2LA 2X8BA 4PO1A 2EOAA 4R1OA 3EGCA 3IUPA 5GM2A 1V7PC 1BNCA 5HIIA 4FZRA 2GN9A 2Z98A 1C7RA 1LSOA 2W6QA 1Z2OX 4J6EA 3TOVA 3AHJA 2WT9A 3KDPA 3KXLA 4CLRB 1MO4A 2R1VB 2PNFA 3ET4A 4UDOA 4YRTA 1QV9A 3W90A 2NX2A 4CL3A 1R18A 2ZYDA 5LQAA 1I6WA 2F6RA 2Q6IA 3TNFA 2C4NA 2W6CX 5AKGA 4DT1A 5DBHX 4ALNA 5A05A 3WGNA 1LLDA 2IYEA 5K6AC 3LV8A 1QDUA 4MUIA 4DIOA 3BBPA 3RGWS 1BROA 2VHYA 3MQ2A 3IQEA 3L79A 4IUDS 4FJ2A 3QWFA 1XEWY 3SBXA 4BGEA 1D9XA 2IS4A 3GDGA 2QR5A 4L4YA 3O90A 2ZB2A 2QZ4A 5LB2A 3A3KA 1ZNQO 3VHXA 1GFWA 1Q7RA 4PO9A 4DM3A 3QLUA 4I6GA 2HO4A 5DGTA 1XRNA 4HGOA 2Q4RA 4O4IB 3L6BA 4HWSA 2P2SA 3A10A 4I8XA 2XMSA 1A4IA 1JHRA 1G1AA 1HE1C 1XZDA 4QKQA 5IM4F 2BGWA 3H2SA 3I2FA 5KYGA 3DNPA 4N7JA 4E5MA 1RADA 2AZ4A 5K0LA 3S8YA 2W6JA 4YCDA 4C87A 2D7DA 4JBIA 3AL2A 2Z6AA 2XTJA 3W4IA 3UG7A 4DLBA 2I8LA 3LLUA 2JJ8A 3M6UA 1B0ZA 5EJ9A 1S8OA 2O1XA 2Q3CA 2JHAA 3E1SA 2VDUE 3VU1A 1FLDA 3A25A 4GBED 4W1PA 5C37A 1ENOA 4HDMA 3UAXA 3D5TA 5BMOA 4II7A 1OU0A 3AEYA 1U65A 1GU0A 5T6BA 1A96A 2MIIA 1N6LA 5KMGA 3SQXA 4GLOA 3V1YA 2VWHA 2B5VA 3SFZA 4HH0A 1XAHA 4DQDA 3OX2A 1YI8A 3IEVA 2JVKA 3OFND 2ZE6A 3AINA 1WAMA 3MBOA 1FRVA 4G63A 1XELA 3QE2A 3L7IA 2I1WA 3D2LA 4R8KA 1FOEB 5ENDA 1KGDA 3FA2A 4NMLA 2CK3A 3R7LA 1EK2A 5BXYA 1QANA 1GVNB 4KWIA 5C2JB 1CB0A 4QYSA 4D9FA 1LC0A 3BRWA 3AHFA 3NV9A 3JTEA 1A2OA 5I48A 1V4BA 4UCWA 4BNNA 2PKYX 1KAHA 1DZ3A 3W5IA 1ZI6A 4YV1A 2GCGA 1K7CA 5FOXA 3TDMA 3ZCUA 2ZB3A 1N5DA 1YJCA 3F46A 4DRXA 3GLIE 4IDEA 3I45A 5BR1A 1B26A 1UBMS 1WSAA 3KXKA 1H0RA 4U1RA 3X1YA 1JG6A 2BR3A 4AMUA 3PNBA 4FQ8A 1DRUA 2W6ZA 3N59A 4JVMA 3ZJUA 3RVQA 3HWSA 1NTRA 2JFPA 3KJGA 3PT5A 4HUQB 4B6OA 2ZZMA 2ZKIA 3ZH9B 4AWBA 2X22A 3FTCA 5IMBA 1WXIA 2IOFK 2KLHA 5JD5A 3HDJA 4BPRA 4E70A 5BYAA 4RGYA 4PAWA 4B75A 1MFPA 4N3GA 2BOVA 4P80A 1KQNA 4ID3A 1E3MA 1DIOB 1SRQA 3I52A 1N2OA 2X9VA 4MUYA 3LWBA 4EO4A 5EJEA 3U56A 3PZBA 3BHMA 2GB4A 3C8ZA 3DBOB 3OTHA 4TX1A 3I4FA 5EXSA 4YV7A 1W2GA 3AKYA 4R1NA 2YX1A 4GSYA 2WAOA 1Q91A 2DHCA 2OCXA 5F7OA 1SVSA 5DHAA 3EQ9A 5KTKA 4XWAA 3BHJA 3HV0A 4LDNA 3FPCA 2VLBA 3VOTA 1FY2A 2HSGA 1GZVA 4JUAA 4MVXA 5LMCA 3N7AA 4K9RA 1JAIA 3MPUA 2GYUA 5TJHA 3TBFA 1I3NA 3AR6A 4A8JB 1AXEA 2AFIB 5LOVB 1CV2A 3GUYA 4LN1A 3I6QA 3O2SB 2YC2C 5CUQA 3OE7D 1GFIA 3G3EA 3GUCA 2O2IA 2X7XA 2QBYB 3PIDA 1ZY2A 3MT8A 3OAAA 1TTPB 4ZOBA 1D04A 4G4SO 5B4UA 1ML4A 6GPBA 5AUNB 2HRDA 3UUWA 3NFRA 1J99A 2QJWA 3QVMA 4H1UA 1PR1A 1ISGA 2XA2A 1NRJB 2CEAA 4QWWA 1FEZA 4RSHA 5DX1A 1MABB 3WGLA 4BYGA 1YGPA 3SF8B 2AOTA 3UJ3X 2RH4A 3OSZA 1P1BA 1ZMTA 3QUSA 3M9LA 1DKPA 2VQ6A 3WB0A 1A9PA 1EFUA 2XRFA 4RHFA 5AW0A 1OBVA 2EWVA 3L1UA 5H81A 1AKWA 5LZ4A 1KSJA 5E7JA 3HYCA 2B4QA 2AI3A 3Q3GE 2WW8A 5HZHA 3AQ4A 3GGOA 1P29A 2HZBA 1WETA 3QY9A 3DMGA 4FNMA 1NBWB 1NQVA 3I2JA 4BQIA 3ERCA 3BIXA 1BMDA 1X7YA 1DIBA 2LCFA 4K87A 1N1MA 2RHHA 2HB6A 4GBMA 2FSSA 1E9DA 4JGIA 1J22A 3EOBI 2XUDA 2GCOB 3TIXB 4ZO6A 2K7FA 1WE2A 1TUIA 1GNSA 1YB2A 4Q00A 4FONA 4L2IA 3W34A 3LC0A 3B1ZA 3EISA 3UJ8A 3SZRA 3BMCB 2IY7A 4YRZA 2XMGA 1MKYA 1W8DA 1AZSC 3LU1A 1A1VA 4OMFG 1OKKD 4ZI7F 5B1YA 2XD9A 2I2WA 4I55A 4ZPXA 5ESRA 2YH2A 1NQTA 1U8XX 4CEJA 3BWXA 1V7ZA 3HZRA 4R1TA 4ZVNA 4P92A 1Z2EA 3R3JA 2YN0A 4H0FA 5KDDA 4GP9A 3E7FA 3DLTA 4R71A 2D7CA 2ZI7A 5KQGA 3HKEB 4TWZA 3I6ZA 4TXNA 3DGFC 1CEYA 3RAFC 2R7MA 3RO7A 3X1DA 1SQ5A 3JALA 1ABBA 1YC5A 3P2KA 4JMPA 2XSZA 2NM0A 3I73A 3OKCA 3UV7A 3ESBA 5JPCA 1KMNA 4KLRA 3FGPA 4JC4A 4UBLA 2CEKA 1GRNA 1M3SA 2MSDB 4RS4A 4LZJA 4OXYA 4TT8A 1F2VA 4J6FA 3REOA 1L4MA 3STVA 4AY4A 4JYBA 3ZNNA 1TVKA 2XMQA 3DLCA 2BGLA 1KJQA 4CLXA 4II3A 5C1IA 1OUMA 3GLQA 4QECA 5CM8B 1L5LA 2P2NA 4TV9A 5BMVB 4N01A 3CNBA 3DUFA 3W2IA 2QSJA 2G6TA 1U8AA 1E3LA 1WPQA 1J21A 3C3XA 4BV9A 1QORA 4BCBA 4ZJPA 4NVRA 4BL5A 3QF4A 1SK8A 1OAKA 3EN0A 3JQGB 3JQ7B 3O4GA 4U7GA 5DRTA 4JQSA 2J08A 4RH0A 3N74A 4AQYB 4F6RB 2XT0A 1YAJA 2Q5CA 4ZV9A 3GZJA 1I4LD 1HE8B 2Z43A 3B48A 3H16A 4GNKA 4B33A 4CIWA 2NMVA 1UDBA 1UBHS 4WA7A 1XAGA 1RD4A 2GM5A 4LZOA 4CG3A 1X3SA 5EVJA 3DOFA 4WESB 2NAFA 4FB4A 3H04A 3MMPA 3AEKA 3F8SA 1VM6A 5BOVA 4EJFA 2HJ9A 2IODA 1L1QA 3DONA 4RSRA 2R4QA 3LF2A 4S04A 3NM6B 3OZEA 3REQB 1V6CA 3CLRC 1VLJA 4U7JA 1ZM9A 1CP2A 1LWNA 3H4IA 5BRNA 3SEQA 5J1SB 2QNBA 4ZOLB 3RTBA 5DEOA 3UOAB 1NRIA 1Z6ZA 3ONEA 1RR6A 4FKZA 1NT2A 2G36A 3BGWA 4MGYR 1C4WA 1A5TA 2L0XA 2MWMA 3GEDA 1WSBA 4RPHA 4ZV7A 1TF5A 2FDXA 4ZHQF 1KK0A 2YZ7A 5KQPA 4ZYYA 2YOFA 4N8SA 4MYSA 5B36A 5ALHA 3U2QA 1Y3BE 2VBGA 3EYAA 4F46A 3OPYB 4N41A 1ZSNA 1VSVA 4M9CA 3VKGA 3TR5A 2AYZA 4HEQA 3KVOA 4LYFA 1LBIA 3A1CA 2B7CA 3IVMA 3NOXA 3DV0B 2XPCA 3OZFA 1OD6A 2PX2A 3LUFA 4NE7A 3D8BA 4Q4AB 4I4IA 4Q16A 4E21A 4N39A 4H0CA 1V5FA 3ANSA 4C0AC 3N2KB 3INNA 3QWHA 1HDYA 1Y5IA 5GZ3A 1EUDA 1OX4B 5HRAA 4E08A 1RZRA 2R9VA 5JUWA 4MS3A 3AB7A 2RFLA 4DIUA 1FRFS 1RKUA 1T0BA 4C04A 5A6VA 3N5KA 4G5RA 3PGVA 5ALNA 2XADA 4AYXA 1SD1A 5D01A 5EA2A 3B5IA 1YCFA 3BFPA 5EJ2A 2ZIXA 1QX4A 1T9DA 1HEIA 1N7HA 2XNHA 3D0OA 3JWGA 5DTQA 1IH8A 4OFBA 5AM1A 4CMHA 3VZRA 1RPJA 2YJ6A 3KJXA 3KPVA 3JD1A 5G0WA 4BB6A 2PTHA 2ZRLA 2IYXA 2V3WA 2J3LA 1D1PA 3STHA 2WHYA 1JG7A 1JT2A 3OD1A 4O25A 4RZIA 5BSUA 3NNSA 4NDAA 3U0VA 3CY6A 2H4WA 5FUYA 2RGWA 1XV5A 1D0VA 1U7PA 2IL1A 3G6WA 3DFFA 3M3HA 4M9UA 4C88A 4YMTA 2AEFA 2FEOA 2W6OA 3NJRA 4D8VA 3DWGA 4D9IA 4DILA 4WGFA 4F97A 1C3EA 1M10A 5AVQA 2JI9A 2OM6A 1E1RD 2YJ4A 3HWWA 4QPZA 4RMGA 4P3XA 2V5AA 4QQ8A 5I3CA 2X4LA 3Q9NA 1SBYA 1NN0A 4X1YA 4Y2QA 3SCZA 2JJ1A 2Y4NA 3T3EA 3BQNB 2P9BA 1Q3TA 4N6GA 1Z6XA 4XB6B 5T3YA 5E7IA 1LX7A 4OHCA 1NZFA 1MAWA 4JKOA 2EX4A 4C7MA 1T8PA 4CQJA 3RANA 2X0KA 5ILOA 2YVKA 2O2DA 4NQRA 5K1ZA 6REQA 4KQGA 3FHJA 1MX1A 1VBKA 4C1NA 1YFKA 3VR6A 4WZ6A 4FYPA 2QGZA 3SK0A 4B74A 4P4GA 4UE6A 2JKZA 3E7XA 3ZYZA 4WY8A 4DWJA 1VL6A 3HCWA 3HSSA 2I3ZA 2JHGA 2CBXA 5FL7D 2Y05A 3RABA 4C6TA 4I1SA 2O23A 4ZJZA 1VMKA 1XQWA 2DBZA 4QHTA 4QOEA 2QRNA 4E4RA 3EBOA 4XJTA 2GASA 4M49A 1PQYA 2J46A 9MHTA 2BFMA 3GDOA 3R5TA 1L8LA 4CN8A 2VJDA 1WDKA 2PXCA 3ADCA 4EL5A 1NM5A 2XZDA 1Z6TA 4WCFA 4FMCF 4EFLA 4BVAA 621PA 4N18A 1NV8A 2X4GA 4G0MA 4I1YA 1WVIA 5CLHA 2HUPA 3NTOA 5PNTA 4C5AA 7YASA 1F1BA 5CDFA 1GKIA 5BMVA 4GKBA 4MMXB 2IITA 3IB6A 1UFOA 5ALJA 1D2RA 1DAEA 4PRZA 4XA8A 4AF8A 4F3KA 1ARZA 1K63A 4EKNB 4B3MB 3O2JA 3TG2A 1QCZA 2QRQA 1RWWA 1C1DB 1TUBA 3HLYA 3L4BC 3QVJA 2UYCA 2QXTA 2YMQA 1TLLA 2W4QA 2YN4A 3VOSA 2AHRA 2FFJA 1NG9A 1HYBA 4PIPA 4R9RA 1RLOA 4LGVA 4UFOA 4XLTA 1JKFA 1K66A 3ETHA 5JS8A 1ZIPA 3VYSB 1LDMA 3M6AA 1AUVA 2DH6A 3WRVA 4ZEVA 4C03A 1XNJA 1TEZA 1MBZA 1TM5E 1IZYA 1NXOA 2EFDB 3AEQB 3KE8A 3O3NB 3AQIA 3K92A 3GROA 1JA1A 3W3AA 5KJEA 1E2DA 3RK1A 1DMRA 1KMHB 5L4LA 5EN4A 2PK3A 4MW5A 1E79A 3ZK9A 3DOCA 1QIMA 4XIIA 1DU4A 3AV3A 2OGZA 3JWPA 4YRCA 1O3YA 3VYWA 1VLLA 3D1LA 2A5LA 2LGJA 2GH1A 3AO0B 3MTQA 5TE9A 2NTNA 3B9RA 3V7UA 3QSYA 4QXQA 3MHTA 1H3FA 2ZAOA 1JU9A 5LQNA 2YXLA 4BECA 1XHLA 1QX3A 3KIPA 3WX0A 1DWPA 1YVEI 4J7AA 4MUFA 2QN7A 5B64A 2MSWA 3ZY3A 3I37X 4EFMA 2CBGA 3RS0A 2G70A 4D0RA 4DB2A 4ISCA 2I62A 1J8QA 3ADBA 1QO7A 2WT8A 1AQJA 2AW3A 3CUEF 4Q4AA 3NGLA 4RK1A 4REQA 1RU3A 3U7IA 3E61A 1OV4A 1M8GA 4OHKA 1U3TA 1X1SA 8LDHA 1JE0A 2CXSA 4G1EB 4GP6A 5DXAA 3M83A 4OYRA 3X43A 4C4XA 1P19A 1DLIA 2WKPA 3IKLA 3FDFA 2O14A 3OM1A 4ZVOA 2GEBA 3BX1A 2HMWA 2JH3A 2VK1A 4N49A 5G1PA 4KQ9A 4CBVA 5GOTA 1IVNA 2PX3A 5K99A 2PL3A 1NR1A 5I7AA 1B1AA 2B20A 4IGIA 4OKSA 1MB4A 1NJ1A 4ZREA 1HSOA 4K6GA 4AY5A 2WF8A 3A9VA 5KTPA 4W8HA 1R5JA 2BHTA 3KQSA 3HDTA 3ICOA 4KFTA 3RSFA 1TO2E 4NFYA 4RD2A 1KDYA 1VJTA 2AK3A 3B9QA 3K8ZA 4BLRA 2C3YA 4X1IB 3DMPA 4WLVA 4CIYA 2FX5A 1I7DA 2R7KA 3WQRA 4DIKA 1WLYA 2EEPA 3INGA 3L0OA 4F92B 1CPYA 4UE2A 4PN3A 4OU5A 1D8TA 3A1SA 3TW4A 2B34A 4YAIA 1QYCA 2VH2A 3NEYA 1T9AA 1H8EA 1T5TA 4KQIA 3WIBA 1JFSA 1FC0A 1ZC4A 1NVUQ 3GRPA 1XEFA 4WK2B 4DLUA 1M1ZA 4MIKA 3GARA 3HJTA 1U1EA 5MHTA 4XVRA 2W58A 3H3XA 1E2FA 3KFXA 1N2JA 2CLSA 4IDOA 3UC5A 4BO1A 3UYLA 4MVYA 5LBTA 4OQ4A 2G28A 3DEHA 3GJXC 3VV2A 2EJWA 5A4FS 2GCPA 2WSYB 4JB2A 4PRLA 1Z7GA 1LLUA 1VKRA 1G66A 3F49S 4I46A 5FBKA 1XD9A 2HRRA 4YRSA 1CF9A 3SVLA 4AROA 2JAXA 2ORIA 2QJFA 1AF7A 1XTVA 5H9WA 3CVUA 1P44A 2A5JA 3G2PA 5AM3A 3A6DA 4NYJR 1AU9A 1SIUA 1CQJB 5JS6A 5FTMA 3IEXA 3OO1A 1B6SA 4EK9A 1UXIA 2V3CC 2R8ZA 3KAPA 3ESCA 1A9YA 1YQTA 4O4LB 3PQCA 4HUJA 3UB2A 4ZVRA 1XC7A 4BC1A 2GEFA 2Q5JA 2VYNA 4NWIA 2IHKA 3OIFA 2Y0CA 4KE7A 4BNYA 3GD5A 5ECDA 1SUAA 1V16A 1OROA 1EKXA 3JZDA 2BAGA 3T7RA 2PZMA 4DMCA 2HOQA 4PBSA 4FCVA 2UYQA 1XZIA 3OWHA 1LV7A 1Y1RA 4AS2A 1RVDA 5EIFA 4F2GA 4BBPA 1ZRSA 4EQ6A 1NVVQ 2FUKA 3OIWA 3GLFB 4LF4B 2XQGA 4DLXA 2CXTA 5K6AA 3DDZX 4DBLE 2XCUA 3OU6A 1L3IA 3CLUD 4AUKA 1PKEA 4POOA 1NI4B 4MQEB 5HM6A 2I65A 3KLBA 2E82A 3H1TA 4O2LA 2SKCA 2BFCA 1MZPA 1OFTA 2P75A 2BGIA 2XUAA 3U3KA 3KCNA 3ADDA 1R1DA 4HQLA 4QYXA 1HKHA 2WUWE 2UVQA 1ZS9A 3LYLA 1T0PA 1Y9DA 3W2TA 3AI3A 5K6TA 2G06A 4CMAA 3PWSA 1TQDA 3Q8WA 1DP4A 1WMEA 2B5OA 5KINB 3JAKA 3IPCA 2P9QA 2PWAA 5T4FA 1DC6A 3HEAA 4QATA 1G18A 1I36A 3GGGA 1GCIA 2D4HA 2Q3MA 3LCVB 3MILA 4C7JA 4CTJA 2IE0A 2PRKA 1DBVO 1F2TB 2I29A 4C5BA 3KV3O 5AVTA 4RZHA 1R8XA 4YIHA 4WPGA 3EX7C 3DE1X 3DL4A 4MCAA 1GXSA 1C1XA 3RUHA 4PLVA 1Q1EA 2AF3C 3QIAA 4W5HA 5JJIA 2Q29A 1TM7E 2D74A 1QU2A 3FMIA 1N3BA 3KWJA 3VQTA 2CB0A 1UZLA 3UT0A 1KF0A 1CZKA 1P0CA 3NT4A 4NV1A 2DECA 1ZIDA 3BGSA 3TLEA 2R79A 4OIMA 2KS6A 1ZVVA 3MWEA 3EGWA 5JR3A 1VI6A 1Z34A 2QV7A 2Y1LA 3KKKA 4QXRA 2C88A 3FVVA 1TQ2A 3IMGA 5GIPE 1L1EA 2FE1A 2M9MA 4JXJA 3R8CA 5DMXA 5IAJA 1NW3A 4A23A 3OCZA 5I9LA 5D5PA 4Y6QA 1NNLA 2XKKA 5JXJA 3TTWA 2FV8A 4KTTE 2H4YA 2IOHA 3PFFA 4WN3A 2XA9A 1OXXK 1RQ2A 4TS9A 2JLCA 3F8TA 5EUMA 3TRIA 3ZWVA 2CJWB 3E9EA 4BNDA 1XQVA 2OYRA 2NYAA 3CF4G 4E33A 3FR7A 1XK6A 4FYJA 1FSFA 2P4EA 4BOYA 3P0JA 3DZIA 1K1EA 1G63A 1PZGA 3KYCB 4HVTA 1Y3HA 5TIIA 1VPWA 1W73A 1NUTA 3A3NA 3E4DA 5TPWA 3IAHA 3WIDA 1NVTA 4RVUA 4BCCA 4XWTA 1DAHA 2W6IA 2HA7A 5E1BA 4DUGA 3AL3A 2ETXA 3IESA 4KGDA 1E1MA 4D02A 3K0CC 3OLWA 1LQUA 4QUDA 4RMIA 5IVDA 1WXFA 5DHRA 2RK4A 3CZQA 3AI2A 1QZUA 4FFVA 4ZOEA 4BKUA 2FN7A 5C9ZA 2HWYA 4WJKB 3LLVA 3ROKA 3IDQA 3STXA 2PSEA 5HF5A 5ICMA 2PX5A 1GPJA 2PZJA 4BFTA 1DC3A 1V96A 4CMBA 3KYIB 1RLUA 1G3QA 3UUFA 1U3DA 4F1WA 1TF7A 4ARVA 13PKA 3K15A 4N0EA 3WAKA 3PXXA 4CJXA 2NUBA 2R6CA 1VHDA 4J1SA 4KV7A 1WU8A 3OETA 2C3UA 5AW6A 2ODWA 2P90A 1BCRB 4ZXFA 2YHAA 4PXSA 4EL0A 4C08A 2G5CA 5H70A 2OKCA 4OKIA 5P21A 1G7SA 4NYMR 3HYTA 4RE5A 1AQNA 5DNYB 4HP8A 3IHWA 2WYUA 1FP4A 4XIJA 5CRIA 4ZQEA 2RAUA 3HE3A 1LXCA 1R9GA 5KDLA 5A6SB 2M32A 2ZXEA 3DBRB 2YQZA 3GK3A 1VKZA 2GA9A 3BTSA 4QRIA 2J9FA 3TK1A 2TMKA 2Z9BA 3TFWA 3AUSA 4FIDA 3CSDA 3KJQA 4AFNA 3PJFA 4I6EA 3TRFA 1M1NA 2G3YA 1WMBA 2IK8A 2FZEA 1JBKA 3U81A 1WUHS 4FHZA 4R16A 3R7AA 3WLEA 2ZIEA 3VV3A 3WOHA 4UBKA 1Y3CE 2E6KA 3RC3A 2C7OA 3ND9A 4QUAA 3V8MA 2JDIA 1SKMA 3U61B 4DV5B 3JATB 1M2NA 2WC1A 3ASYA 4TV8F 4KIFA 4MWZA 2VRBA 1RWOA 3K6RA 4YRLA 2PBZA 1D4OA 5B1IA 2WIAA 3EHEA 2JAUA 2R7LA 3KHTA 1IJEA 1L3BA 1MJNA 2YZ2A 4QREA 3SAJA 4EKGA 5CVTA 4RAQA 2OHFA 4OGWA 3RE1A 3T3MB 1GRQA 4OJNA 4M8KA 1ZRMA 3KEMA 1IBKB 1C7EA 4DZZA 4F12A 3ISTA 4WTOA 5K0FA 2IH4A 4ME6A 3L8CA 4KPUA 2CLIB 3NOQA 4DG8A 4W5WA 2WU0A 3IILA 2MJLA 3G5AA 1PU2A 2WKRA 3FBTA 1WBDA 3RUIA 3CZPA 3OLQA 1ZNXA 3DZFA 1X8JA 4XLLA 3MJEA 4NJEA 1XRSB 2CDAA 3CLVA 2HV9A 3IOCA 3DTTA 4FYMA 4KAXA 5FTWA 2XUJA 3VZPA 5CFQA 8ATCA 2EKZA 2IOYA 3CKKA 4BFYA 1AHPA 1JHMA 4O3MA 2PUAA 3GAAA 5C32A 2ZT5A 3PG5A 2W2VA 2X14A 5CX1B 3ABZA 3JWHA 5D85A 5FULA 3DKKA 4MI9A 1RYEA 1DJOA 4H7JA 3URMA 4RMNA 2QYTA 3WC4A 4DCUA 1OT5A 1T91A 4KHZA 2FN4A 1V3TA 1E64A 1R15A 2WHRA 2NZUG 2P9EA 3PUHA 4RZSA 4GM0A 5LA6A 1QGUA 3U7QB 1YBVA 2GCEA 2PR2A 5SICE 1GQRA 1T10A 1TMGE 2QMOA 1NNSA 4ZVQA 2BFDB 4G24A 4RDHA 3CMCO 1G4UR 4OD0A 3ZVKA 4UHFA 4H3VA 1HM5A 2IS2A 2VK2A 1XJCA 2FWBA 5I7UA 2ODNA 2P4SA 3BBLA 3KELA 1E2KA 3K70D 2X6QA 2QLFA 3OKAA 4G0YA 5CFNA 1Q57A 3ZI7A 3PX2A 4E5UA 1G8GA 4ETNA 3J81k 3AL0C 5H02A 1TRKA 2DP4E 1LPNA 1KY3A 2EL7A 3ANMA 4QOIA 4BVGA 2G63A 1JEYB 4AW9A 2YWXA 1DRJA 4NNJA 4TOIA 2VP4A 1RAHA 5EZYA 1NHGA 3H1FA 2ZE7A 1QDLB 3R5HA 3TAUA 3UXEA 1EE2A 4EVQA 1QLWA 4B2IA 3U1BA 4FGUA 2RGCA 3DEKA 4U4AA 1JPUA 3VBCA 3WAGA 3NM4A 4ALMA 3HZHA 3HY4A 2BGRA 4DLRA 4YRIA 3W5VA 1PR3A 1Q11A 3F5SA 1N8TA 2TMGA 4AWAA 1UZNA 4BV3A 4RJKA 4BP9A 5C5CA 2B5WA 3GEHA 4ICIA 4X3CA 3UK0A 2C0CA 1S9HA 4KFCA 1T3SA 1FPQA 1ZLXA 2XCTB 1Z0ZA 4TTVA 4XDGA 2PJDA 4V2IA 1LLQA 1Z2NX 3OI7A 1V9SA 1KYXA 1ZBDA 2XXJA 2QTBA 2EEZA 1B2LA 1OJ7A 3DLIA 1P72A 3Q3EA 2QRVA 2XYPA 4YP6A 1K86A 2UZ4A 1FFSA 3QEMA 3ZR4B 2FZKA 1C0IA 1S89A 1OE0A 3O74A 2CMDA 1P9WA 1QMPA 1T6ZA 1U2QA 3VR4H 5A3RA 3ZWKA 4KBFA 5AK6A 1U3CA 2WD7B 1M1YA 1A7KA 4HB3A 4MK4A 4PS0A 3N2GA 1LBQA 4MVJH 4AD8A 5LQMA 3R9IA 2B30A 2COUA 1R5OA 3HBFA 5CT4A 4L3WA 3VU9B 3VPFA 4F0JA 2B8JA 2XNJA 4NATA 1Z07A 4MQEA 4LDAA 3CKLA 4TTPA 3DE2X 2HEGA 5J5AA 5AKIA 2ZSKA 3QKSB 4IDNA 2W6PA 3AEXA 1NDUA 2GYVA 2VCEA 3ZD8A 1PEDA 2BUBA 4XUEA 3I4LA 3TSCA 3M4JA 5AOAA 1Z38A 3FOEC 1H0KA 1GUZA 1QRAA 3LHDA 3K9QO 3QVLA 3T7SA 3VDRA 2GKGA 4J0IA 3T5MA 4L9WA 5KYYA 2YHSA 4M60A 3AV0B 3ND8A 3PNSA 4NCIA 2W70A 3MWKA 3DBRA 2ILTA 3SYTA 3UAGA 1ZJ4A 3H19A 3UMYA 3GB9A 4DB4A 2UUAB 1XHEA 4B6EA 3NTLA 1C41A 2RJNA 4KQWA 4Z9YA 3O47A 1YQXA 2WAMA 4BTLA 1ESMA 2D1QA 2DLCX 3GJ5A 2HEIA 1IEQA 4NULA 3SC2B 2GPBA 3AFHA 3MG9A 2FK8A 4WFJA 1U4SA 4A1OA 1ML3A 1RJ9A 1UC4B 1ZZGA 2Q5HA 4CIXA 3ZVNA 1ZA2A 2V4UA 5EJ8A 1JRLA 3DE0X 3IPRA 1EGAA 1P45A 3MCAA 2FP3A 1QR2A 3CV3A 4OMDA 3T1TA 1CVIA 1REQA 5C3MA 3BE4A 4ZTZB 4PFSA 5HRUA 1PNQA 4P7JA 1DCTA 3PKZA 5J2UB 3QA3E 3IFSA 1XBTA 3AH8A 3B7PA 3MGCA 4J1TC 1ZD3A 5HBRA 3EOZA 2G6BA 3IAFA 1ISSA 2V7QA 3AXTA 4JA2A 3CC8A 4M1SA 4KXVA 5IF9A 3WTBA 1WB6A 1PJTA 3GVIA 3PFIA 4FYXA 2QZPA 2FPWA 4AKTA 4EZEA 3V4VB 2II6A 3NBMA 2C7PA 4A36A 2J4CA 1C9DB 3QVGA 4KTVE 3ZE9A 3AF5A 5KQRA 4KQJA 5IT9A 3W9BA 3GZ4A 4PU0A 2PA3A 1WW3A 3I12A 4XD2A 3I4CA 1KH1A 3SQMA 3EF0A 3D59A 1CNMA 3G0GA 4BQFA 2GO7A 3DHEA 2IA5A 5H9VA 3PEFA 2ZUUA 3V8QA 3EGOA 5GZ6A 4DCTA 2L69A 2DTEA 2Y9PB 2BKLA 2PUEA 4TQGA 3CPJB 4IPTA 1Z56C 5KREA 1U94A 1QRDA 3FOCA 1SXQA 1KEEA 3BFXA 1VIMA 2I8CA 1IN1A 2W7TA 2X7JA 1XTJA 4KODA 2V98A 3QITA 1ISFA 2FPGA 2XGGA 4LX8A 5DTMA 5ILQA 3DFZA 2PV7A 3L4BA 3ODPA 4Q9AA 5JPDA 3AKZA 1JTEA 2YNMC 3TWOA 2O54A 5F3DA 3VC3A 4DVGA 2VNKA 2QW8A 3IPLA 1DC4A 4C0KA 2HLDD 4CCSA 3A58B 3L8YA 2OP0A 2A9KA 1EG7A 2B1QA 3IKMB 5MGNA 4B87A 3UC9A 4ZQGA 3EEQA 1YRAA 2OCIA 3LL7A 4N5NA 1S2DA 1W6UA 2AUMA 3GEIA 4H59A 4N3BA 2B3TA 5KYXA 3DJYA 1IPFA 1AXGA 4EUSA 5KVSA 5DGDA 2NNLD 2J87A 3BZWA 2Q3FA 2XKJE 4V0QA 5LBIA 4NZOA 3K6SB 1EP3B 4KXUA 4MCIA 3SNHA 1MD9A 4ND5A 5HCUA 4DE5A 3DE7X 4EA8A 4WZBE 3OZXA 4KPFC 4IJMA 2OCKA 1ZN2A 4RVNA 4XTCS 4JH0A 1M33A 3TQHA 1FYEA 1W5FA 5EMLA 1BYIA 1R0ZA 1HZZC 2ZSUA 4OBBA 3TJMA 1NVMB 3OTOB 4AKIA 3WIVA 3CF6R 1UQRA 2JLBA 1U8FO 2QTGA 4JJFA 4CIVA 4DQUA 4OY3A 3DP7A 4MGZR 4PVDA 3VR3A 4AZWA 5DPMA 2UXCB 4FDTA 2Y27A 5JAQA 4BUZA 5EE9A 3IEUA 1DUSA 4JLMA 1CYDA 3DOJA 2IEBA 1AV7A 1GU1A 1EMDA 1MF7A 4K88A 4MX8A 3DC7A 5DHTA 4F11A 4K9KA 1J70A 1I5OA 1PX2A 4MGKR 5DNDA 4TYNA 4HN9A 4QLOA 1NQWA 4UM7A 4OGFA 5DMHA 3KUDA 3UW1A 4WDQA 5BQXA 4JFAA 4CYMA 5IC4A 3GQVA 3OJOA 3FTFA 1VL5A 3EMBA 5CBPB 4HNGA 2HGSA 1JFTA 1ONNA 1ND6A 1O5IA 2P6NA 3SDBA 1QP8A 3KXPA 4PG6A 1T13A 4URYR 5LDDC 2C95A 4YUAA 1B0UA 1ZQ1A 1GA6A 3GXOA 3LPLA 4R8VA 1SUPA 3S0JA 3W9UA 3OUTA 3EODA 1TMYA 2GJAA 2ZYIA 1D03A 1GT91 3O26A 3AUYA 4UATA 3VU9A 4R8RA 1WZUA 2C5SA 1OU4A 2LKDA 4UNRA 1DUIA 3ENQA 5C35A 3FY4A 1CUAA 1NR7A 1SOVA 1TVEA 4UM5A 4KXYA 4D7AA 4GLLA 3AZPA 2IXEA 1JP7A 2BEKA 1MO6A 1RKXA 1DO2A 2R44A 5BWOA 1WD5A 3WNBA 2L17A 1ECGA 4A9AA 3P9ZA 2NT4A 1YSCA 4Y6GB 4D4IA 3H5VA 5IARA 4E7OA 1DEHA 1JLMA 3WWZA 1M8JA 2RH9B 3OT4A 4TLBA 5EPOA 5JD3A 1FFCA 1TYCA 4LY3A 1L5QA 2VK4A 5ENZA 4OG2A 5SYNA 4M7RA 4A8TA 1MENA 3VPDA 1U3WA 2P0EA 2LUOA 5JMWA 1FRNA 1SXJD 1L4LA 2NO9A 4EUHA 1DIHA 4EKEA 1PT6A 1VMEA 5BNFA 4JGBA 1N0UA 2GPYA 2BL4A 4OU4A 1TQHA 4E88A 4JWTA 3SC2A 2GZAA 1NF2A 1DXHA 1KZ9A 2AYYA 5JZMA 1E7SA 1JSLA 5JAZA 3ZDYB 3F6BX 4GLBA 4LZAA 1TM1E 3RAGA 3SZ3A 1ZW6A 2CYCA 3GPDG 1M2GA 2JCSA 1GAEO 5MDHA 1TCCA 5F3WB 1MW9X 1ONBA 3GVHA 3WYCA 4D74A 1UT6A 1H5QA 2QK4A 3EVFA 3O8OA 2ZRMA 1W581 3K7EA 5CXXA 4HDSB 3CG4A 3COVA 2RB4A 2D6FA 1DIGA 3P9IA 4OFXA 1CZNA 1YCDA 1R0KA 4D56A 4FFBA 5ESDA 1E9EA 3TFQA 2A35A 2CZQA 2RHBA 4P7BA 1F8FA 1CUZA 1FSZA 3KKMA 2OBYA 2C82A 2M1ZA 3EPPA 3LFHA 5BW8A 1JUDA 2YCBA 4REMA 5EFZA 3O4JA 4PFKA 4DLVA 3BMXA 3LUGA 3UXHA 5CDYA 1E5TA 5EC8A 3G2OA 3Q0EA 1RI4A 1RMTA 5AD1A 3SOZA 1JI3A 3PHCA 4BBAA 2ODTX 3A1DA 4BLTA 2IV2X 3LWDA 1QB7A 2BDTA 1WCWA 2AH5A 2IFTA 2CMHA 2PS9A 1SKYE 3DAHA 3KEFA 3UB4A 3RNOA 3RYFA 4YPOA 1FRQA 3I2KA 3N7UA 3UJ6A 4HEA1 3H6GA 2PGOA 3I0ZA 2PLAA 3BQMB 3EZYA 5DCLA 3G7UA 1XZKA 1L4NA 1RP7A 2CUKA 3FWKA 4IIYA 2YOHA 4B46A 4DOMA 4FE7A 3AUKA 2R6DA 4G9EA 3CCCA 5FOUA 3SG0A 1RXEA 1Q7TA 4P31A 2GJSA 1XK7A 4CCYA 3BVPA 1BRTA 4LCEA 4EX7A 5CGQB 1L5YA 2PPVA 4GMDA 3T35A 5K0ZA 1ZOSA 2PMBA 1E59A 4QU5A 3THOA 3ONNA 4C2UA 1JKIA 1W4RA 3Q7TA 1VJ5A 4R1MA 1RIIA