3JQFC

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 1,3,5-triazine-2,4,6-triamine (ax2)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 91
structure length 247
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqfC00
3ZWWA 2XPCA 3ZU2A 3FPCA 4OKIA 3ANMA 1AN9A 4GBJA 3TOXA 3HUDA 3QQPA 3RUDA 2A9FA 3S2IA 5H82A 3FI9A 4H3VA 1R12A 4MKZA 2P2SA 1KEVA 4YQYA 2VOEA 4OXYA 6LDHA 2GO1A 1WVGA 1CRWG 2OORA 3SXPA 4L76A 4U7WA 2FP4A 2YQ4A 3RAJA 3RQSA 3BTOA 4WLEA 1LSJA 3OP4A 5EINA 5G4KB 5LC1A 4WCFA 4HFJA 1SAYA 1YRLA 1PS0A 1A9ZA 2AQ8A 2BD0A 1NYTA 4FJ1A 4OO3A 3VZSA 4YRBA 4ZHSA 4E4YA 1DEHA 1I30A 3WQSB 3PDUA 1DFHA 1J0XO 1I3MA 3UCFA 2VOJA 5U4QA 5L51A 1PGOA 2AEJA 4GKVA 3ROPA 1P9LA 2X86A 3E5MA 1NWCA 4EI2A 4PZCA 4E13A 1HDGO 1ZXLA 4K9DA 4E2YA 2VNAA 3LC7O 2EP5A 4NBUA 3TFQA 3V1YA 1R0KA 2J3KA 3GUYA 4ND1A 4CMBA 1A7KA 5I9NA 1D8AA 4BKPA 1IE3A 3JQ9A 4YR9A 1NAHA 1T2DA 4MVJI 5JC8A 1ISHA 5BSHA 1O5IA 3C3XA 5CEJA 4RVHA 3LT4A 3MJ4A 3LF2A 1GY8A 3O38A 4F45A 1UP7A 3KZVA 5DDIP 1ONPA 2VHYA 2ZCVA 1TT5B 3D64A 4CLOB 4WKGA 4IDBA 1E3SA 4J2OA 4Q3DA 1T2CA 4PG7A 3D4OA 2O3JA 1OAAA 5EERA 7MDHA 1LQUA 1R66A 3DL2A 3FPLA 1BTOA 2GERA 3GFGA 3PWKA 4CLEA 1PJSA 5KJFA 5T64A 1E3IA 5C7LO 1PS9A 1X1TA 1Z45A 1ZO8A 1HLPA 3F46A 3PYXA 4LMPA 1LNQA 3ORFA 1ZSNA 3DWFA 2B37A 1PGNA 4G65A 3TSCA 3GH3A 3ONDA 2D4AA 3ZWXA 1B7GO 2O4UX 1P45A 1HWYA 4NI5A 3IP1A 2O3UA 2VT3A 4RCVA 5CDTA 1P1KA 3CTMA 3RWBA 3L4SO 3P7MA 2JJYA 1YH3A 1XA0A 5IDXA 2VN8A 3D5TA 2RBEA 3RFVA 2NU8A 3JQ8B 4BNYA 1X1EA 2YYYA 1KEWA 5ICMA 5L40A 4A0SA 4BGEA 4HADA 4XJTA 1Y8QA 2GRAA 2W4QA 3IS3A 3KTDA 1QV6A 1QV7A 2P9GA 4RF5A 5HM8A 4OHUA 3RFXA 4UUOA 2I3GA 3UAGA 5B12A 4KUEA 3TPCA 2PGDA 1MLDA 4I8XA 4RGBA 2DVMA 4R5MA 2ZB4A 1CDOA 1PGQA 1Y81A 4H15A 4MINA 3PPIA 3TQHA 1PU2A 3JQDA 3ZWYA 1KC1A 4PZEA 4BNIA 1J49A 1PJLA 4N5LA 5A1TA 1C3VA 4JX8A 1NFRA 3DFZA 4B7XA 2QRJA 4J4HA 5F1PA 2PD4A 4Z9FA 3DBHB 3JD1A 4ILKA 3WQQA 2E48A 4B4VA 4AJ2A 1ISIA 1GUFA 2OGUA 4ALJA 1P3DA 4CM7A 3H9UA 2AXQA 1LDGA 5H81A 4BO9A 1VKOA 1MG5A 1B8PA 1MB4A 3OEYA 4R5HA 1N9GA 2Y05A 3VH2A 1U9JA 1JVSA 3OJEA 2J5KA 4D3FA 1EBFA 2VNSA 3ASUA 3LSYA 4FN4A 1WDLA 5AVOA 4IQ0A 1PGJA 2B36A 3HDYA 4TROA 2GASA 1WPQA 4RZHA 5IJZA 4PG5A 1LRLA 4UVEA 3NKLA 1HF3A 1EUCA 3PLNA 4L4RA 4DWVA 3WS7A 1JW9B 2TMDA 3F5QA 1E3JA 3EMKA 2O23A 1RM0A 3NT5A 2V6FA 3EVTA 5LCXA 2DPGA 5L95A 3IP3A 1GAEO 2D1YA 3VPXA 2E82A 1NFFA 2IZ1A 4NK4A 2VYVA 3C7AA 5G0VA 2XXJA 3D0OA 3HE3A 4Q3AA 4YRDA 2PKRA 3CSDA 4DYVA 4IDDA 1DJNA 4BB6A 5A3JA 2FZEA 5JXWA 3HNPA 1QMGA 4MP8A 2AG8A 5MDHA 1NR1A 1MGOA 3MOIA 4BB5A 1E1LA 1WAMA 3ROQA 3SVTA 3DOJA 3JQAA 3W4JA 4DL9A 3LT1A 3CEAA 4YT5A 3C85A 4J1NA 3WWYA 1ONNA 2VYNA 4XYGA 4CV2A 3GVPA 1B16A 4URFA 3RUCA 1Q0QA 1I01A 5JAZA 3GGPA 2ZCUA 3GVXA 2OBYA 3UGKA 2VUSA 3QY9A 1UH5A 1HEUA 1BDMA 2J3IA 3BTSA 2Y1CA 1KVTA 4E5MA 3NGXA 5TSDA 1XDWA 3GT0A 5JYDA 2BELA 4XR9A 4EDFA 1VL0A 4O6VA 3ZWVA 1XR3A 5IXYA 3KXDA 1AXEA 5TJHA 4DREA 2CDCA 1LC0A 3H5NA 4PLGA 3BMQB 4EBFA 2OZPA 2W2LD 2FOIA 4FJ0A 1X7HA 1F17A 1A27A 5BQFA 4AJEA 2CD9A 4L4XA 4YDRA 2VRCD 4ALNA 5C7OO 5DCUA 5KTKA 2EJVA 2IYOA 3IMFA 1X14A 5DZSA 1NP3A 1Z82A 2PH3A 1X0XA 4G81A 2IXBA 4J16A 1ZUD1 3PZBA 1W6UA 1VC2A 2OL4A 4WCFC 1IL0A 1HDXA 4TRRA 4PG8A 2Y0CA 1PJQA 3PIIA 2QRLA 3QHAA 1P0CA 3KEOA 1LSSA 3DHNA 2WSBA 4TRJA 3GOHA 2ET6A 2FMUA 2NU7A 1D1SA 2BI7A 4Z9XA 4CLRB 2JL1A 3ZWOA 3OBBA 2DQ4A 4X54A 4IXTA 5ITVA 4FPXA 1SCUA 2VWQA 2JD1A 3KUXA 2Q1WA 1E7MA 4BNVA 2R6JA 1E3WB 2W8ZA 2ZYGA 4HUJA 3OFSA 3JQBA 2VHWA 3ETGA 3WGGA 3JQ9C 4B7UA 1DC5A 3NJ4A 4Z3KA 4XKJA 3F1LA 2WYWA 2NLOA 3ABIA 1RM4A 5DP1A 3X2EA 2Z95A 2EKPA 1O89A 3EW7A 3ZI0A 2P5UA 4GPD1 3E9MA 5A05A 2HO5A 5DBFA 4QO7A 3HB5X 2J5RA 2HAEA 3K9QO 4BNUA 4XWYA 3S55A 2JD0A 4QX6A 1E6EA 4CQMA 4GQAA 3DAGA 1L7DA 3N58A 5DP2A 4M87A 1V8BA 2VHXA 3ZW9A 3UKOA 2B4RO 3HDHA 3N7UA 5LDHA 3WX0A 2VWHA 2O7QA 4ND5A 4TMFA 4DC0A 3H2SA 5TX7A 3K96A 5K6AA 1UXHA 2GN6A 1EUZA 3AUAA 2ZIZA 3KYCA 4IS2A 1N1EA 2RIRA 4DXHA 1U3TA 2E6UX 2DM6A 1FMCA 4BNMA 5IN5A 3A14A 5I9LA 4YJFA 1U8FO 2FR1A 1E7WA 3JQ7B 4IDAA 3VH4A 1CQJA 4CM9D 5A9RA 2X22A 1YQXA 2QG4A 2WD8A 3MJCA 1HDZA 4KQWA 2YDYA 1X7GA 4FFPA 1YBMA 3RC1A 1UUFA 3QE3A 3WSVA 4CV3A 5TQVA 4E5YA 1PZFA 2P4QA 5FI3A 1GQQA 1GZ4A 2C0CA 1EE2A 1O0SA 5AYVA 4MVJF 3FNHA 2AA3A 3AM3A 1JWBB 4WJZA 5EJ2A 1YOVB 3G79A 5A3VA 1GADO 3CZMA 3WGQA 2P9EA 4CL8A 3GEGA 1FDTA 3COSA 2DFDA 5BT9A 2H9IA 4MVJP 4ALKA 2DFVA 1GYQA 4RJTA 1N2SA 1LSOA 1ZCJA 4DBZA 4TVOA 2D5CA 4FIZA 2VCYA 1GDHA 2BGLA 3JQEA 4PN3A 1JKIA 2BLLA 4NBVA 2RAFA 5EIOA 4OSPA 4ZRNA 3KB6A 3T4EA 3KSUA 1EDOA 5JCXA 2IZ0A 3I9JA 1BVRA 1DRUA 4K28A 2ZTUA 3HWRA 4IM7A 4CM4B 1X13A 5I8WA 3O03A 3K31A 5L4LA 3RI3A 5BSGA 3OA2A 3PRJA 2HK9A 4CQLA 4ZVVA 3ZNPA 2FR0A 3IQDB 1FF9A 3M2TA 4Q39A 4E5KA 3I9NA 3WYCA 4HFMA 4J91A 3PYMA 4CR8A 2NV6A 4MVJE 3VTZA 4AJ4A 3MTGA 3R3JA 4Q3EA 4EW6A 2A94A 1XLTA 3C7DB 4CM5A 3SJUA 1I24A 2E37A 3Q3CA 3L4BA 4J0FA 5G0WA 4E5NA 2OXIA 4BNGA 3K92A 1SMKA 1T2FA 4OOEA 1BRMA 5DCYA 3D4NA 4ONEA 5T6BA 3B20A 3LZ6A 3CZRA 4R3WA 4QEDA 4AJPA 3DMTA 4F6CA 1YS4A 1P1IA 3OMLA 2NUAA 3BMCB 4JJGA 1NQTA 1U4OA 2Q2WA 3QVTA 3GHYA 1DPGA 4E2WA 1YBAA 2FWMX 1M6WA 4I5FA 3DZBA 1C1DA 4WK6A 5FFFA 3JQGA 4JGBA 1UZNA 1LX6A 4FDAA 3OIFA 4FFRA 2TMGA 4MVJA 2EWMA 4N18A 3QWFA 1UXJA 1DHTA 1MG0A 4DPLA 4YJGB 5TIIA 2ZQYA 4BGVA 4G5HA 5F1OA 5B37A 2ZK7A 3TZCA 1V3TA 4NFYA 4Y98A 5B4TA 3GVHA 3DC2A 1R4NB 4CV0A 3RC7A 1N7HA 3F47A 4XR4A 1LDMA 4CLDA 2VHVA 2DTEA 1C14A 1NPDA 1IHXA 2YFHA 4BKUA 3HFGA 3D4PA 4DLLA 1YL5A 1PWZA 1U2DA 2UYYA 3DO5A 3ROKA 1CJCA 1YJ8A 2SCUA 3ZHYA 1BSVA 1C1XA 1I2CA 1R6DA 2DKNA 2IEBA 4RPHA 3WBFA 4DGSA 5CG1A 4YWJA 1EUDA 3KO8A 1YONA 1EVIA 1DIBA 3VHRA 3VPHA 1VSVA 1G6KA 2JFGA 2WMDA 2QRKA 3X2FA 1Y8RA 3DZHA 5L7YA 1IOLA 3I5MA 5EL0A 2B0JA 3W4IA 2IYPA 1I3KA 4I9NA 4B3IA 2I66A 3GZNA 3LF1A 2GPTA 2XF8A 1HE5A 2G1UA 4XGIA 3JYOA 4GI2A 4JJIA 1KY4A 3VC7A 1J5PA 3GFBA 3QVXA 4EJ0A 3I23A 4E31A 1KEPA 1YB4A 1JAXA 1XGKA 2VZ0A 3JD4A 2W2KB 2EHDA 3LC2O 1DAOA 4KOAA 3ST7A 4WPGA 3AOEA 1MUUA 2G82A 3WGIA 3BYZA 3WGZA 2YJZA 2VQ3A 3JQBC 4PVDA 1HTBA 4RL6A 5A5FA 3FBGA 1HE4A 2BGKA 3DBLA 3QLJA 4XD2A 4XIJA 2Q3EA 4B3JA 4YJHB 4BO3A 5JCJD 1P33A 2HKIA 2VWPA 4IJKA 3UCEA 3ZW8A 2NQTA 3VAZA 3T4XA 3GC6A 2F00A 4WLVA 1K6JA 1LSUA 2YDXA 3O8QA 5JO9A 4BNXA 4XGKA 2POQX 3K6JA 3G49A 2H1SA 4FS3A 3WTBA 5L3ZA 4P38A 4GVXA 1AXGA 3I4CA 2PK3A 4YAJA 2JAHA 5G0UA 4IS3A 5COBA 3F3SA 4CJXA 2JFFA 5HWSA 4XYMA 2W90A 2EEZA 3GAFA 2O48X 1XU7A 3NDRA 1WMAA 5ILOA 4UVDA 1Y7TA 1OC4A 1V9LA 4N5NA 3QW2A 4JBHA 5K6AC 4MIEA 1NQOA 1QYVA 4D79A 1ZJYA 2VT2A 5KVQA 4YAGA 1KVRA 5JFOA 3V8BA 1HDCA 3K73O 4LRSB 4PRKA 4XDZA 1IYZA 5G0SA 4GL4A 2C2XA 4LMRA 1A7AA 4IDCA 1YGYA 1RKXA 3KLPX 1OC2A 3L77A 3L6EA 3WB9A 4M55A 3VPFA 1WZIA 3R1IA 4XYEA 3PHHA 2W98A 1K6IA 4YB8A 2Y67A 1VKNA 2NTNA 3UUWA 1GEEA 3NV9A 5T67A 5BSEA 3K2BA 2Z5LA 2ZB8A 4OIMA 1WWKA 1IULA 1X7DA 1ZSVA 3CXRA 5I7SA 4J2HA 3DMYA 5JO0A 3AFNA 4YAEA 4R1TA 4CMAA 1B2LA 2Q46A 5CDUA 1QRRA 4IDFA 2I65A 3FR7A 2C82A 4GSKA 1HE3A 3B1JA 4RPJA 3I9LA 3VVBA 4WGGA 4MP6A 3L07A 4NU5A 2YY7A 4Y6PA 5TRTA 3PLRA 3F9IA 3WGYA 4IDEA 2Q2VA 1TVEA 5JLAA 3PWZA 4PLPA 5F5LA 3U3XA 3JYLA 2CDAA 2J3HA 4C7JA 5JAIA 1I36A 5JDCA 1LU9A 5I7VA 3HQ4O 1MFPA 3ZHZA 2Y68A 1LLQA 5AXBA 4W9NA 2EW8A 4KMSA 3LK7A 3AY3A 1W4ZA 1PWXA 3CH6A 2O2YA 1JQBA 4NPCA 1DLIA 4PLZA 3ZV6A 3JTMA 1UAYA 3WLEA 3VDRA 2Y93A 4HV4A 1HYGA 1ZK2A 1G1AA 4LK3A 1PL6A 1KOLA 2XAAA 3E5RA 4J4TA 4L74A 3MCVA 2G0TA 3PVZA 4CM3A 2H5LA 3SX2A 4ND3A 1LC3A 3HJAA 1WMBA 4RDIA 3HG7A 3V2GA 5TF4A 1PR9A 1E6WA 1XYGA 2PH5A 4J49A 4GGPA 1JLLA 4KUGA 4RLHA 4D42A 1GR0A 3IJPA 4YAKA 3L4BC 1TI7A 3DZGA 1DJQA 2GF2A 3H9GA 3SLGA 1PJ3A 1DLJA 1JKFA 2Y0DA 4GVLA 2EGHA 3SJ7A 2HQ1A 3BZUA 4Z6KA 5C7IO 3DMTC 1R4MB 3RC2A 4I1IA 5I8ZA 4RVDA 2YZ7A 1GV1A 4ROSA 2X58A 1H9BA 3QJ5A 3NAQA 4PFJA 4E0BA 3ITDA 1BW9B 2CUKA 2X8LA 1F12A 4CV1A 3ZU5A 1ZIDA 1GTMA 4BO2A 4E33A 4Z9YA 1H6CA 2HRBA 2Y1GA 1XKQA 2G76A 3GF4A 3U4CA 2Q49A 4CM1A 1CIVA 1T26A 1GQ2A 2I5PO 4XQCA 1UP6A 1U4SA 4EGFA 3WJAA 1T4DA 1QYXA 2OP1A 5CPFA 1E1KA 4C7KA 2NVUB 4RLSA 2Q1UA 3GLQA 3TOZA 1ZJZA 3CUKA 4CMIA 4XA8A 1EVJA 3TRIA 2HMTA 5JMPA 4AG3A 4Z0PA 2P91A 1MFZA 1NXQA 2HJRA 4OOFA 5HRUA 2J3JA 2ZB3A 2QZ9A 1M75A 3LT2A 3MJVA 4FJ2A 4Z0HO 4NMHA 5HA5A 4XQEA 1R16A 4IIUA 2V6BA 3RJ5A 3GVCA 4LCEA 4HNHA 2WD7A 4XJSA 1HDOA 3RBVA 4K26A 1NPTO 4DQUA 2X23A 1D4FA 1R0SA 4XDYA 3Q6IA 1OBFO 1V3VA 1W0CA 2WYVA 2CVQA 1DRWA 3H6KA 5IDWA 2QQ5A 2PD6A 5L7TA 1F8GA 1I10A 3IKVA 2YV3A 3ANLA 3AW9A 2HCTA 3WTCA 3OECA 4BL5A 2WDZA 1T1RA 4ZJUA 3JYQA 5G4KA 5A9SB 1VJ1A 1DHRA 2C7GA 2NSDA 3IIEA 3NTRA 2GLXA 4NDNE 4PG4A 4FQ8A 3JQAB 5JAMA 1VE9A 2JCXA 5CEEA 1U5CA 3W6ZA 2Y1FA 5G2OA 1HLDA 3G3EA 4LN1A 1RM3A 3V5NA 1YB5A 2DTDA 4OAQA 2V7PA 3HB4X 4Y6RA 3W8FA 1DAPA 1XHLA 1VL8A 3GG9A 2IODA 1D1TA 4CMGA 4ESOA 2J6IA 1XQ1A 3D3WA 4ID9A 4M1QA 3CMMA 1K5HA 3KSZO 2VWGA 5TT1A 3RROA 4XYLA 2VUTA 4GX1A 1PEDA 4M8SA 3GNTA 3V1TC 2UUPA 2CY0A 1EK6A 2B35A 1IB6A 1WZEA 3G17A 3JYPA 3GQVA 1H6DA 4FD3A 4IZIA 1QYDA 3AK4A 3MEQA 2QHXA 1H9AA 1LDYA 3M6IA 3WMXA 4XZ3A 4CLOA 3BHJA 2D2IA 3EY4A 4BO5A 4PZDA 1ENZA 3PP8A 4H16A 5CAEA 1LI4A 1ADCA 1YXMA 4PLHA 4CMEA 3BAZA 3KYDB 2H63A 4I08A 2PNFA 5ENDA 4OM8A 4BHTA 3PWSA 3ON5A 1RYDA 3FR8A 4A5OA 2PZJA 1P44A 2DC1A 4NBRA 1XIVA 4P22A 2HSDA 1Y6JA 1HXHA 3Q0EA 1ENPA 4B79A 5DBGA 1GQYA 2LDXA 4G2NA 4L9RA 3I9KA 3FD8A 2C29D 4MP3A 1E3EA 3PFFA 1UXKA 5KKAA 1N92A 2NVWA 5IFLA 1DSSG 3OETA 1YVEI 4O63O 1W73A 3E6AA 2PWZA 3PHLA 2X0JA 1Q7CA 4Y67A 3SC4A 3JQ6A 4P4NA 3JQ8A 1I3NA 4F3YA 3QVWA 4BS9A 4B3HA 4DQXA 3PJEA 5CFZA 1BXGA 1ADFA 4BV9A 4RDHA 3K8ZA 2PKQP 1E7RA 3P19A 1E77A 1WW8A 2WWRA 3KLMX 2JCYA 4M54A 4ALIA 4D45A 3VH3A 3KYBA 4L0QA 1LJ8A 5GZ6A 4IIVA 4R4JA 1E0DA 4BNNA 2D0IA 2X7HA 4FW8A 2J5QA 4UVIA 4UEOA 3ZWPA 2BH9A 3MTJA 3DBHA 5F21A 3L0DA 1A71A 1N8KA 4R9SA 3ADPA 3WWZA 4B8WA 3UH1A 4HP8A 4A03A 4YRAA 4IPTA 2JFHA 5TS3A 2I6TA 5JDCC 4CQMB 1Z73A 2C54A 3EDMA 4RO0A 5ITWA 1PIWA 3GPDG 3HSKA 1E3LA 3EC7A 4W9NC 4A27A 2W2LA 3LDHA 1MP0A 5KJCA 1JU9A 1PJBA 4HFRA 1LTHR 4YQZA 1O94A 3RU7A 5BNIA 2NU6A 3FWZA 4MIOA 1Y9EA 1LLUA 2VRCA 2EG9A 1IPEA 1C0PA 4OH1A 4RVSA 3ZNNA 3RVDA 4IUYA 2ZYDA 5FI5A 1W8DA 5ES3A 5DCWA 3A4VA 1NVGA 3KYCB 5EESA 3BIOA 1RYEA 2X9NA 4EJ6A 1F14A 4JXKA 4NG5A 3Q1LA 5ICSA 4IY1A 3BMOB 1UJMA 3AY6A 4RVGA 1P74A 2RH8A 3DR3A 5TT0A 5U1PA 3PHGA 3ZNQA 4NNJA 4JBGA 3DBVO 2DTXA 3OEWA 4RV9A 4P4GA 4LCJA 1V3UA 3PDJA 1KVSA 1ADGA 2C7VA 1P1RA 4WUVA 1XELA 1X0VA 1IPFA 4J7UA 3JD3A 1TB4A 4UEJA 5JC1A 4QXMA 2PV7A 3JQCA 2CDBA 4UREA 2E49A 2ZYAA 3UVEA 4QECA 4QT0A 1T2AA 1EVYA 2VRBA 2FPPA 2AE1A 3RUAA 4BVAA 4QFDA 4DIBA 5TLSA 1IY8A 4WEOA 1Q7GA 1SC6A 8LDHA 3BHMA 5KNLA 1GUZA 3QSGA 4BMSA 4L73A 3V1UA 3QWBA 1E1MA 3I9MA 5JNLA 4CMJA 3DBRA 3H5RA 3WICA 5F1KA 1DC4A 1YB1A 3ZU3A 2R2GA 5FYDA 4U0JA 1Y5RA 1HE2A 3AWDA 4YJDA 4BNWA 3FTNA 9LDTA 4J1TA 5EQFA 2Q1SA 2NQ8A 4JQCA 2O2SA 4P4LA 1VJTA 1DIRA 1YWGO 3A1NA 2ZTLA 2ZKLA 3NT2A 5ER6A 5KWEA 3IKTA 4NJMA 1EE9A 5ER9A 2DBVO 2GZ2A 3NEPX 3NYWA 9LDBA 3BMQA 2O3SA 2X4GA 3ZV5A 2ZQZA 3JYNA 1YBVA 4PG6A 4OQYA 3TF5A 2P4HX 3G1UA 3B1FA 1B8VA 4MVJM 4QTZA 3GVIA 4IMRA 1OOEA 1KBZA 3RCBA 5A03A 2VZ8A 4E5PA 3KV3O 3FBTA 3WDSA 4UEKA 4Y6SA 3GAZA 3UFXA 1LEHA 5ADHA 3T7CA 5TJ9A 5AXDA 4OL9A 1BVUA 2GR9A 2JCVA 2CZCA 1ULSA 1VSUA 2BFOA 4KQXA 3GNSA 1WLYA 4ALLA 4I5DA 3EGOA 4DVJA 4CM9A 4FGSA 3GDFA 4EUHA 4INAA 3RD5A 3L9WA 3W8EA 1Z75A 2WE7A 3W4KA 3LQFA 1OMOA 4CLRA 3OJ0A 4ALMA 3S1LA 3F4LA 1P31A 3E82A 4N5MA 4NR0A 4WOJA 1DC3A 2PGJA 1LQTA 1E3WA 4CMHA 1ISJA 3H9QA 1AHHA 2QYSA 5HBRA 5FF9A 4AJ1A 3KBOA 1S6YA 4FFOA 2C2YA 1ZNQO 3FSRA 1ZKMA 2PZKA 1HETA 3DTYA 4CMKA 3OH8A 3P2OA 4O0LA 1Z74A 1CERA 4B4WA 2OHXA 2X6TA 3OHSX 2C5AA 1KETA 2D3TA 3EAGA 3C7CB 5IXSA 1PQUA 3TZKA 1LBEA 2Y0EA 3EUWA 3DDNA 3EZLA 3WYBA 2YQ5A 2YV1A 2ZATA 1PSDA 3P2YA 4XYBA 4CMEC 3WOHA 3ZWAA 2GUGA 1QKIA 4LISA 4HFNA 3HFSA 3GEDA 3NT4A 4PLFA 1LXCA 4WLUA 1P1JA 1ZMOA 3A06A 4L4SA 1PTJA 2QW8A 4AJHA 3K30A 2J8ZA 3RKRA 3KRTA 1R15A 2PFGA 1L7EA 2C59A 3FF4A 5T8KA 2HMVA 5L45A 2GYYA 4CR7A 1Y8RB 4BO7A 2HK7A 4ZQEA 2OO5A 1VL6A 3ZH2A 1UDCA 3VPSA 2EIHA 4TQGA 3GZNB 1GZ3A 2PZLA 1NVTA 1U2GA 4HWKA 4UAGA 3UICA 4MOWA 2JHFA 4Q3CA 5L4NA 3INTA 1Q0LA 3BXXA 3MJEA 2BFPA 2EERA 4DPMA 1QYWA 1PL8A 4MKRA 4KZPA 2Q99A 5IDYA 3GDGA 4H7PA 4YACA 4CM8A 3PXXA 4OXNA 2NVBA 3WGTA 5TGDA 1WP4A 4EEZA 1DDOA 3DZIA 2P68A 1DIGA 1DOHA 3IUPA 3ZNOA 4PVCA 3ENNA 3PHIA 3DBLB 4FFMA 4AL4A 3MJTA 5I7FA 2CMDA 4ZQHA 4BO1A 4UUPA 2O4CA 3L6DA 1ZH8A 2GSDA 1O8CA 4NFSA 1I3LA 2VZ9A 4LVCA 1YOVA 4MVJD 4NZ9A 4OKNA 3WBBA 1U7TA 4QFCA 1KVQA 3NTOA 4WE3A 5DOVA 3RJ9A 5AXCA 5IDQA 4DRYA 5IG2A 2WTBA 4ITUA 4DIFA 2A92A 3JSAA 4UULA 4ZRMA 3VTFA 3QWHA 4XQGA 3M1LA 3A28A 4HNGA 3QRWA 4EITA 4NIMA 2YHIB 1Q7BA 3ZV3A 2XXBA 1FDVA 5HTOA 1K2WA 4DC1A 4IDGA 1J6UA 5BSFA 1LDBA 2O50A 3Q11A 1CEQA 1PZHA 5T57A 5JS6A 3AI1A 4MDHA 1E92A 4KWIA 5CPBA 3GNQA 1MXHA 5ILGA 3PI7A 4KTTE 2YFQA 4D44A 3O9ZA 3DOCA 2OFPA 3D3EA 1ZXBA 1FXSA 2G17A 5KJ1A 1JAYA 5IF3A 4I9HA 3U9LA 4A10A 4CMCA 1B8UA 4Z0TA 3F6YA 2AW5A 1MXFA 2B83A 4GMFA 4DMMA 2FY8A 3GEMA 1QXSA 3WLFA 3GRKA 3AI2A 3M2PA 3RUEA 1NQAO 1SPXA 2PZMA 4LGVA 3PTZA 3DAFA 4R3NA 1L1FA 4YCAA 1EVZA 4MIYA 1AE1A 4NBWA 4WOKA 3UW3A 1GCOA 4TZKA 2NM0A 2Y1EA 1ENOA 1YKFA 4BKQA 4E2XA 1HKUA 1QLHA 4RQTA 4GLOA 3QWIA 3WG9A 3ZHXA 4DLAA 5KIAA 3BA1A 1ENYA 3TJRA 2NTVA 1ISGA 2B4QA 4R69A 1LDEA 2D5AA 5DF1A 4TSKA 2D8AA 1NASA 4JLWA 4KDEA 4M89A 3D3WB 4PRLA 4FFLA 1HYHA 5BR7A 4NQZA 2JAPA 4BO6A 4D3DA 2EGGA 3L9XA 5GY7A 4YJGA 5KCZA 1YQGA 1U3UA 3DHYA 4WASA 3HZZA 1TA4A 4FSHA 1HZJA 5IZCA 1SNYA 1MC5A 3JD2A 3UN1A 4BIIA 1XG5A 4RQUA 1R4NA 4FB5A 1ZK3A 4J9UE 2AQKA 5HS4A 4BNJA 4R16A 3E9QA 4RZIA 1D3AA 7ADHA 3I3OA 4RVFA 1ORRA 4WCFB 2YV2A 3I83A 5EPOA 5JMWA 2G5CA 1C0KA 4XRRA 4YEDA 4Y8VA 4Q9NA 5CEFA 1QP8A 4GX5A 4UUNA 2X5OA 4BKOA 4F46A 3GUCA 4YXFA 1UAGA 4GGOA 1I33A 2DU8A 2IRWA 3U49A 2UVDA 4N54A 1OFGA 1K3TA 3GRPA 5KVCA 3D7LA 1H6AA 4D7AA 2ZJ1A 3VDQA 4TRMA 4M86A 3ZHBA 4FR5A 1H2HA 4ZU3A 5KVSA 1FJHA 1WNTA 1HSOA 2A4KA 2IXAA 2HJSA 3AU9A 3C1TA 3AOGA 2WYUA 4NU6A 1G0NA 3B6ZA 4XQ9A 3RIHA 3SLKA 3GR6A 3WIDA 2BFAA 4BNHA 1KS9A 4IXWA 1E1NA 5DBIA 4JROA 5FWNA 4P8RA 1HDYA 3KHUA 3DFUA 2EP7A 3H4VA 4PLYA 2BRUA 3TWOA 1LLDA 1JN0A 3H2ZA 1X15A 1H0KA 4ZQGA 2UAGA 1IUKA 1NVMB 1HZZA 4YJHA 2FSVA 4GLLA 4BUCA 5DT9A 1M67A 1TEHA 4R01A 2C5EA 3OICA 4YT4A 1HRDA 4GX0A 1T24A 3OSUA 3O4RA 4CUJA 4EUFA 4XRGA 4W6ZA 4ZQBA 4TWRA 4FGWA 3VZRA 4CUKA 3FNEA 1FDWA 1GUYA 1E5QA 3ETDA 3R0IA 2F1KA 1PS8A 4BMVA 1ISMA 3QWAA 5JW6A 2EKLA 4DLBA 5GMOA 4A26A 2WD7B 4Q3BA 3TFOA 3DHEA 3VOSA 3JD0A 5A02A 2C07A 2DT5A 3DOOA 2HUNA 4I5GA 5JAQA 1UZLA 2X0NA 3WFJA 2UDPA 2HRZA 2IDZA 1Y8QB 4R1NA 3CKYA 3HDQA 2CF5A 4ND2A 5EQDA 5L7WA 3F5SA 4RPLA 5T8KC 1ARZA 3PQFA 3GN1A 4GWGA 2PLAA 3GDOA 5IZ4A 2DBRA 1H6BA 3CE6A 3NJ8A 2EW2A 3H9JA 3UF0A 3BMNA 2AE2A 3ZGYA 1NM5A 1WDKA 3KM0A 3OIGA 1XCBA 2EJWA 4AJLA 2Y99A 3FRJA 3FCOA 1UDBA 4Q3NA 5F5NA 1ZW1A 2NTJA 3K2EA 5BNTA 5HS6A 4S1VA 4BO0A 1GV0A 3S2FA 1SEVA 4WEQA 2PTGA 1NNUA 4JCOA 3U4HA 4B7CA 4L75A 5JBIA 4JP2A 3W6UA 4GMGA 1QLJA 1Y5MA 1XWFA 5F3RA 1M66A 4AJJA 2FZWA 1SO8A 4IQ8A 3AUSA 3JQFA 2CVOA 3PJDA 3G1TA 1Z6ZA 1BXKA 1N9GB 1VM6A 3B1KA 3RBZA 1E7SA 4BOYA 4D41A 5JE8A 3CPSA 3NTQA 3N74A 4XB1A 2AG5A 1PJ4A 4FBGA 4GWKA 1VLLA 4HBGA 1ONOA 2IEDA 1HYEA 3LYLA 4YAIA 2QYTA 1EBUA 4M49A 2NWQA 1U7HA 1U5AA 3PJGA 2BFMA 2Y1DA 3QA9A 2CVZA 4UVHA 4WECA 1N5DA 1PZGA 3TDKA 5CDSA 1AUPA 3RUIA 3UCXA 3NDIA 4OYRA 1DXYA 4LVUA 3AM5A 1YQDA 4B4UA 2HU2A 2ZJ0A 3ENKA 3GZ4A 3UOGA 3ULKA 4OSOA 1DC6A 1JA9A 5IAAA 1J4AA 4K1LA 1YJQA 4R68A 1LRJA 5B4UA 1ZZEA 4WCDA 1PX0A 4CM6A 4GH5A 3H7AA 1WDMA 1OZAA 5JSFA 1K89A 3LU1A 5AXAA 4ZN6A 3O26A 5L4SA 3U5TA 3H8VA 2GN8A 3ZDFA 1F8FA 3TZHA 1Z7BA 1BXGB 3AOEC 1H2BA 1ZK4A 2HMSA 3R6DA 5KJ6A 1YE3A 3M1AA 5JPIA 4W82A 4E3ZA 1ZFNA 4O59O 2BF7A 4TKMA 3IJRA 4II3A 2GCGA 3OA0A 2ILTA 5JY6A 1ID1A 1R4MA 1SB9A 1PQPA 3HDJA 4WLFA 3INGA 2QIOA 4AVYA 3AI3A 4AJOA 1AHIA 1NBOA 4RF2A 1BW9A 2X5KO 1TT5A 1B3RA 2RHRA 3I6IA 4BGIA 2YW9A 2PD3A 1U1IA 3Q2IA 2XOXA 2Q4BA 1DB3A 1EQ2A 4IJWA 5U9CA 3K5PA 4FOSA 1UXIA 2UV8A 5IZCC 2NVUA 1BXZA 3DQPA 4RVUA 1IZ0A 2PY6A 4BNZA 3WNQA 3IL2A 4YTEA 4E30A 1YO6A 4HX5A 3FNGA 2FPIA 4WNCA 5C5IA 3VPGA 2AMFA 1V6AA 2VYVD 3ITKA 3RASA 1HL3A 1TT7A 1CETA 3W1VA 5TC4A 4R1SA 1YL6A 2O3QA 3LLVA 3PJFA 4ZD6A 4WNIA 3GY0A 3LVFO 2Y1OA 3OF2A 1ZEJA 4HY3A 4R54A 1V0JA 2EXXA 1I2BA 1M2WA 1NR7A 2VHZA 4ZICA 6ADHA 3ZCXA 1EFKA 2QZZA 1A5ZA 1I0ZA 3JQAD 3T7EA 1XU9A 4BKRA 5A9SA 5FEUA 1KC3A 3LLSA 5TNXA 4L8VA 2VYND 4W7IA 4BMNA 2HMWA 1ZVMA 1RM5A 3GK3A 1UXGA 2HLPA 2ZTMA 4HXYA 1UR5A 1OI7A 3ZV4A 1HSZA 2P9CA 3H65A 1RWBA 2FHSA 3WR5A 2DLDA 4MPDA 4ZGWA 3C1OA 3S2GA 5H83A 3WNVA 2Q4EA 3WQRA 5MGBA 1U3WA 1I2ZA 3OQ1A 4KUHA 1SBYA 1V35A 1R0LA 1B14A 1ZK1A 3DTTA 4MVJH 4D46A 3DBRB 4AJKA 4DYDA 4BO4A 1BGVA 4GX2A 4U6SA 1VI2A 2X5JO 5KVVA 1DFIA 3TNLA 5CHEA 4CLXA 3PYLA 3IOYA 4J1QA 2Z1NA 2O3RA 4WLOA 4E21A 4NJMB 1B26A 3EK2A 2FPGA 3IDSA 3OQBA 3E8XA 3AU8A 3RSHA 3WGHA 5JYEA 1NX6A 1H94A 1CYDA 3E18A 4J0EA 3KETA 1K6XA 3WXBA 3U4DA 1TLTA 2GN9A 4XCVA 5DNAA 3WIEA 4DTIA 3KYDA 3I6QA 2R00A 3VKVA 2P5YA 3SC6A 4ND4A 1A72A 1BG6A 1HDRA 1UP4A 3FN4A 4OQZA 2IE0A 3WFIA 4BNTA 3OIDA 3KEQA 5T5QA 4YJFB 4K6FA 4E6PA 1KIFA 3H5AA 3S8MA 3RKUA 1ZMTA 4JN6B 5A9TA 2X9VA 1JKJA 4BO8A 1P77A 2GZ1A 1I8TA 3OM9A 1EFLA 4BQRA 2QX7A 3BTUA 1SOWA 3LC1O 3I52A 1I5RA 4IJUA 3H3JA 5L53A 4PGFA 4E32A 1JWAB 3UXYA 2Y66A 2JKVA 1Q0HA 3G0OA 3RBXA 5THKA 2X0IA 3HN2A 2GD1O 1NQ5A 4R41A 3H3FA 1DBVO 1EK5A 1ZK0A 5CP8A 5BNFA 3WYEA 1XEAA 1GYPA 1ML3A 1SEPA 3FTPA 2NU9A 3MZ0A 3Q2KA 4O5OA 4B4OA 2OP0A 3S2EA 5KKCA 3L6OO 3VZQA 1P1HA 1XQ6A 3ZWCA 4KWHA 4AFNA 4EEXA 1KEUA 3EYWA 1SOVA 3INRA 3NRCA 4FOOA 1VPDA 4EUEA 1RPNA 2OBNA 3TZQA 1SZJG 3JQFC 4BV8A 1WXDA 2GGSA 3V2HA 3RUHA 5COAA 1O95A 3PIDA 5I9MA 1NWHA 4CQMD 2AEFA 2EV9A 4IGFA 4QSMA 2I3AA 3IUSA 4DA9A 3VKUA 4YBZA 3WMWA 2BHLA 1GCUA 2DPHA 3NUGA 2BMAA 3DXFA 4U8GA 3QIVA 2RHCA 3ZZNA 3WGOA 4YT8A 3NGLA 4CQLB 3U62A 1C0LA 1RJWA 2DUWA 3ZWBA 1BHSA 4YVFA 3R3SA 4MO2A 2HK8A 1DIAA 1JDJA 2WM3A 4IJVA 1U3VA 1PL7A 1PJCA 1U28A 1EQUA 4IZHA 5CDGA 3RUFA 2FR8A 2Q1TA 4J3FA 4CLHA 3VH1A 4J9VA 2H6EA 4DPKA 3JV7A 1DIHA 1T4BA 1KERA 4IGEA 5ENVA 5A06A 4J4BA 3PGJA 3EHEA 1AGNA 1K0UA 2AQIA 1KVUA 1B3BA 5EMHA 1T2EA 4MVJG 4R9RA 3BMOA 1XSEA 4U0KA 4D3SA 1YDEA 2B4TO 4EJMA 3GGGA 5IN4A 2RH4A 4ZA2A 3AM4A 1EEHA 1NPYA 3E48A 1ADBA 3E9NA 4XIYA 1DO8A 2A35A 5JDIA 2HMUA 4BNLA 4CM8B 1C1DB 3JQGB 5B1YA 1LRKA 2B5VA 3AJRA 3FNFA 1M6HA 1EMDA 4W7HA 3MWEB 1CWUA 1A4IA 3ADOA 3KOUA 3CIFA 4CPDA 4TRNA 4K6CA 1N7GA 1E7YA 4JNKA 4BQPA 5A04A 1A4UA 3IAHA 4XEHA 3STHA 2AEMA 4FC7A 2I67A 2V65A 4J43A 4O1MA 2I76A 2PGLA 3ONEA 3TZ6A 2GN4A 4IBOA 3KSDO 2I99A 4FFNA 1BMDA 2Q2QA 3E1KA 4Z3DA 2V6MA 3FHLA 3AY7A 3H9EO 3ZU4A 2UUOA 2AQHA 1GD1O 5K9ZA 1M76A 3PHJA 2Q45A 3GN2A 4RPGA 1C1XB 3F1KA 1Z7EA 3W8DA 4QQRA 1QYCA 3ZN2A 2OMEA 4DUPA 3AUUA 5C37A 4NFHA 5C3MA 3QP9A 4A7PA 3I1JA 2WEKA 1LDNA 2PA3A 2I9PA 2CNBA 3ICPA 4PLTA 1CQIA 3VZPA 5B4VA 1ISFA 4JP3A 2EF1A 1NHGA 2X9GA 4FC6A 1GPJA 1UDAA 3GA0A 3GG2A 3HN7A 4MJLA 2PKQO 1KYQA 1KY5A 4RPKA 3U09A 4GSLA 1H93A 1VJ0A 4IINA 1TXGA 3E03A 5J23A 2O3TA 3QVSA 3ETEA 4IQGA 3JQ7A 4KDFA 1Q2XA 2JHGA 1F06A 1LUAA 3C8MA 1ZBQA 2FN7A 4E12A 2GZ3A 5CG2A 4IMPA 2VTDA 3OJLA 3PQDA 3VVCA 2VUUA 4QO8A 4RF3A 4AJNA 4J7CA 3RFTA 4E2ZA 5AOVA 1PQWA 2CF6A 1EDZA 2NADA 3SEFA 4CR6A 3OJFA 2D59A 2NNLD 2ZTVA 3ROMA 2BGMA 2YHUA 3HADA 4F6LA 1ULUA 3WJ7A 3PEFA 4J1SA 2OUIA 2X0RA 2Z1MA 4BNFA 4J6FA 4NBTA 3SBOA 3ZWMA 3O8QB 4W4TA 4Y9DA 5THQA 5GZ1A 3DB2A 2DUUA 4TKLA 5A5EA 3MOGA 4A2CA 1PZEA 1GZ6A 3LT0A 2NACA 5GZ3A 1N1GA 3U4IA 1QR6A 4CODB 4GKBA 3DZFA 4J7XA 5DULA 1UZMA 4NJOA 1LA2A 4TZTA 1BWSA 5JY1A 4QUKA 1D7OA 3QV1A 1B0AA 1T1SA 1NHWA 3DZKA 1LLCA 3GHHA 3V2UA 4I9UA 4CM4A 3A9WA 3CMCO 5KJEA 1EZ4A 3P5SA 4NHEA 3PK0A 2R00C 3MJSA 1E5LA 3PZRA 1P1FA 1ZEMA 3NX4A 1DRVA 1E6UA 5A4DA 1GEGA 2AHRA 3DEYX 4NH4A 3GGOA 2O7SA 4AICA 4DMLA 2FRDA 1GL3A 3TL2A 4DBVO 3PFWO 1GYRA 4U5QA 2OOSA 3RC9A 4YPOA 2LDBA 1NFQA 2DAPA 2FSSA 5COQA 1PGPA 5DOZA 1HT0A 1GPDG 3DZJA 2BI8A 8ADHA 3ONFA 1Y9AA 3U0BA 1I32A 1P0FA 4R51A 1B15A 1U8XX 2IZZA 1H5QA 1NAIA 3BMCA 4JK3A 3ZWNA 4DIOA 5KOIA 5EN4A 1BDBA 1T25A 4NK5A 2CSUA 2X1HA 1JVBA 4LSWA 4BNKA 4U6QA 4N7RA 2GNAA 4OMUA 3QVOA 1PR3A 4OJNA 4R1UA 1C0IA 1FK8A 5JCJA 3C24A 3IC5A 4LRTB 1MX3A 1QORA 4I5EA 1MC4A 2EKQA 2V6GA 5G0TA 2B5WA 4PLVA 1S7CA 4XB2A 2E4AA 2ZB7A 4W99A 4D0RA 1GFSA 3OQ6A 3RU9A 4D0SA 4JJFA 1F0YA 2RCYA 1FDSA 3FWNA 1SB8A 2WJPA 3PGXA 4YT2A 3CINA 1FDUA 4LW8A 1MA0A 4XX0A 4OXKA 3HHPA 3GMSA 2JD2A 3D5QA 4BGUA 4KTVE 2YHIA 4WLNA 4ZQFA 4TVBA 3Q9UA 1O6ZA 1QG6A 4PIVA 4B8ZA 4LSMA 3GPIA 4EYEA 3C1AA 2CFCA 2Q50A 3DAPA 4GAEA 3AFMA 3EZYA 2YUTA 3MWDB 3Q9NA 3ASVA 3I9OA 1PJTA 3KVOA 1DFGA 1IZ9A 2PR2A 1JTVA 4UUMA 5AQ1A 1O9BA 1G0OA 3PQEA 5DN9A 2DBZA 2GDZA 4YA6A 4AJIA 4A73A 1PJ2A 4PCVA 1E7QA 4PLCA 5K0ZA 3OJOA 3BMNB 2B69A 2WE8A 2HDHA 3ANNA 1MV8A 1CF2O 1A9YA 3F4BA 3BHIA 3UHAA 2VTEA 3ICCA 4EZBA 3DONA 4C4OA 5I7EA 3JCZA 2W2KA 5JDIC 1IHYA 4HKTA 4II2A 4MKXA 4UVGA 4JIGA 4DQVA 2DBQA 3AUTA 4JBIA 5L9AA 4YYZA 4RORA 1QSGA 1VRWA 4CL3A 4S3MA 3WSWA 2C20A 4RF4A 3TL3A 1NTOA 1Y1PA 5CDYA 1GU7A 4OGWA 1YDWA 4CUZA 1Q1NA 1YL7A 4FCCA 4PLWA 5G4LA 1R37A 4D43A 3BTVA 3GMDA 3NDJA 3EVNA 3TN7A 4J90A 4KP7A 1ZSYA 3I4FA 4CMIB 5LDGA 4XGNA 2BKAA 3D1LA 3B70A
chains in the Genus database with same CATH superfamily
1QLWA 1OW3B 2H1VA 3L1HA 4XD7D 4IFTA 4WNAB 4DYHA 2B61A 3DMDA 1VOTA 5HF5A 3QQPA 4B43A 1T3LA 3QPBA 5AKZA 1XD8A 2KI5A 3YASA 1F5SA 1OTXA 2P0YA 4AMZA 1R12A 3KEGA 4N49A 1X77A 5FV7A 1J70A 2VOEA 4KX3A 1BH6A 4M21A 4EJSC 3I2YX 1RKUA 3N28A 5E7MA 1WVGA 3G8DA 1ZG3A 3SU8A 2J67A 4KE7A 3THSA 4N40A 4O4HA 4ZT4A 3RYHB 3SXPA 3R4CA 4KRYA 3RQSA 1NYRA 4WLEA 4TKVB 4MA5A 4YRMA 5G4KB 5LC1A 4W9MC 2WUFA 1QOZA 1UOEA 2AQ8A 2BD0A 3N8KA 1NYTA 1X3LA 3G8CA 3HKDB 4OO3A 4YRBA 2KMLA 5TQ2B 3WLJA 1AM4D 1MVNA 1QK3A 5G3YA 1CZLA 3BRQA 3PUHA 4DGQA 1DFHA 4LAFA 3TL6A 1DEAA 1U3FA 3UCFA 1IXRC 4FSXA 4EARA 5JJKA 2NYUA 2GBGA 3KJNA 1GFZA 4PSAA 1MW8X 1UBUS 2AR0A 2G5TA 2BJVA 3VR5D 1K7SN 2H2FA 3P9PA 4U3JB 4E13A 4E2YA 2VNAA 3LC7O 3TFQA 1AY0A 2H5JA 2G0NA 3OLCX 1KRWA 2R11A 3AI7A 3R6WA 1Z0KA 1PBNA 1F2TB 4BKPA 4GNKA 2D1QA 3S7ZA 4F72A 1Z8DA 4YR9A 2Y1WA 5CA1F 5JJ5A 3WAGA 4QUEA 4EATA 5KDOA 1D7AA 4MZXA 5BSHA 1O5IA 4RVHA 3GLKA 1KH2A 2OEPA 4O4LA 3ENWA 4TL9A 4G89A 3UHOA 1SN7A 5JT1A 4DV4B 5HMMA 2BR5A 1JXMA 4RY2A 1D6NA 4CLOB 4DJFC 4AKHA 3FMPB 4LI0A 3RFFA 4PSDA 3N8IA 1QCDA 1YRHA 5JDIA 4I5IA 3CVVA 5CAEB 2DR2A 3TLMA 4ML3A 4XM1A 1YVPA 3SDZA 2NVOA 1JP7A 3OPNA 3FPLA 1BTOA 1JVNA 1OYVA 3H84A 3A6KA 1ZOLA 5L6LB 1SVMA 1PJSA 1Z16A 1E3IA 4IZOA 1PS9A 2RGAA 5KMGA 1HLPA 1NA5A 3HP7A 1M3SA 2F3UA 1LNQA 4DLRA 2B37A 4LYAA 1DINA 2JJ1D 1U5BA 2XCUA 3H1BA 4CKXA 2YY5A 3ABOB 4GKAA 3RK4A 1TE2A 3DUFB 2OXFA 2R4UA 4YCJA 3OFVA 1KP2A 3ADBA 4X7MA 5E9JA 4COOA 4JI3B 1Z6XA 1KKMA 2O4UX 1P45A 3AL2A 3EXG2 3REQA 4GRDA 3SBEA 2MSEB 3G9ZA 4G8JA 4MH0R 1M2GA 2O3UA 1LF0A 2HWUA 3U3ZA 2HK6A 1QRSA 1A8UA 2VF7A 2C2GA 4PR0A 2J87A 4R7GA 2V6IA 4MCJA 5HJ7A 4YRQA 5SY9A 1XA0A 4ARVA 4F11A 4HO1X 5IDXA 4N76A 4BNYA 1KEWA 3EE6A 3H0EA 4QAJA 4ZYXA 4BGEA 2WJJA 2XB2A 4XJTA 1YUBA 3FHCB 1Y8QA 2D0DA 2FRDC 1A7UA 2W4QA 3IS3A 3KTDA 4FMPA 5DSZA 1SBIA 5TEWA 3SZMA 3ZQJA 5HM8A 2AZMA 4K3UA 4EQ6A 3T35A 5IEJA 4AURA 1OIXA 3GFSA 3H2KA 3O6VA 2H54A 3RHFA 3V4PB 4F60A 1Q1QA 2ID9A 3UGQA 1VPVA 1CUAA 4Q1DA 3K5IA 2G9QA 4N0DA 5BN5A 3TCKA 2IOQA 4LY3A 3K35A 5ALJA 1JFFA 4MINA 5K0TA 3PPIA 3TPFA 1PU2A 2UUAB 3WC4A 1NUUA 1UINA 2VHJA 3BD9A 5AW5A 3GO4A 5I3ZA 4MQEA 1JHXA 1PJLA 5K3DA 3UJPA 3K16A 4LDJA 1SVWA 3L46A 5J4YA 2W8BA 2BP7B 2I8CA 3KSBC 2IPXA 1B6GA 3D3KA 2PJZA 3LTNC 1GNLA 5DNEA 3LVQE 1XZGA 4RUKA 3I6YA 1ISIA 5CA1A 3EEOA 2FG5A 4RZ3A 5KOHB 4UDXX 1NE2A 1S3GA 1J33A 1PEAA 4I81A 1QZUA 2WR8A 4BO9A 4GYKA 1KFKB 2J31A 5GQSA 3SYMA 1U0BB 1B8PA 3QLUA 1D4OA 1TJ4A 1E1CB 1UJCA 1EXMA 4CTKA 3MELA 1RMYA 3JASB 1EM6A 5AVOA 4FN4A 3ZHTA 1JHZA 4EG8A 4CGYA 4KQHA 1RBMA 3NBKA 1G20B 4WK0B 4MWZA 3PLAE 1U7XA 2NU6B 2HRQA 3L49A 4RZHA 5IJZA 1LRLA 1XU4A 5DGXA 1L3BA 4B6RA 1XDBA 5K2MA 1QJCA 3H2IA 4FBMA 4F84A 1V8DA 3W7VA 2O23A 1TAUA 1L4NA 1RM0A 3D43A 3KOXA 1C2YA 3EULA 2V6FA 4JUBA 1FSGA 1OT3A 3ND7A 5J5AA 2YKGA 3LL4A 4A8PA 1PRYA 1L5NA 8ATCA 3PGKA 4QM7A 3TTXA 1NFFA 1WEHA 4NK4A 3C7AA 2O6LA 4G36A 5ECDA 3H4MA 2FX5A 2IUSA 2XXJA 4FT2A 4GRAA 4R6WA 4RH0A 3D59A 4KBFA 4YRDA 5DMHA 4UNSA 2PKRA 3CSDA 4Y1FA 4D8VA 5BMVA 4IDDA 5BQXA 1IOWA 3IVXA 1DJNA 5DFAA 1ZA2A 3HKBB 3Q6MA 3RSZA 4B6GA 4BYGA 1QMGA 3DKIA 3UJ9A 4LDNA 5MDHA 1NR1A 3ACBA 1UPTA 3MOIA 3SS7X 4YYEA 3SVTA 5LBTA 4LF6B 5IJWA 4G97A 3L79A 4XJVA 5K0LA 2GLUA 4QUHA 2FW0A 4DL9A 3L6BA 4C4TA 2XMPA 3Q0IA 4X95A 4ZKEA 2JGIA 5LN1A 3J80A 3FOEC 5H3HA 3NS7A 4XFJA 2ZWAA 3UJ6A 2FUG1 3GLHE 4J1NA 3WL5A 1ONNA 1Y4SA 3C3MA 3WWYA 2IYAA 3WAKA 5HZMA 1B16A 3OM8A 5BN4B 1QOPB 4AUMA 1I01A 5JAZA 2C04A 4K9SA 5KREA 2ZAYA 3H6HA 3UGKA 3MQ4A 3GJXC 4OL0A 5FLEX 3A10A 1W85A 4QLBA 2VUSA 3T1YB 2QENA 4FYVA 4A1FA 4D0NA 1BDMA 2J3IA 3EJ6A 5DE3A 4FYJA 5K6RA 3W3AH 3QNMA 2PFSA 2QRVB 2OXCA 3F5FA 4M9QA 1KE2A 3U4AA 4FX2A 4RU1A 1E0SA 4XJXA 2BELA 1SOUA 4E03A 4EDFA 1VL0A 4EZEA 5HHTA 2OXTA 1J90A 3L0SA 4HDNB 1NYQA 1OB5A 3KXDA 2G40A 4K81B 3M4YA 5D3ZA 4PC3A 4DREA 4Z7NB 1XP5A 3JR3A 5LXTF 4YALA 4LJSA 4KB5A 4EBFA 1GPBA 4UAVA 4Y6OA 1XCPA 1L1QA 1L5KA 1QUFA 2RGNA 1X7HA 2OCIA 3KEFA 3OZAA 1A27A 1Z2CA 4QPJC 4M0PA 1BJRE 1ONSA 2VPIA 4BFWA 4L4XA 3UO8B 3BUSA 2GCEA 4GZ6A 3HHEA 4ALNA 3OQPA 4ZGBA 3PBKA 4I9FA 3T1TA 2XUJA 4GXQA 3A05A 1QCZA 4V3BA 2PH3A 5J4KA 4OI0A 2QJRA 3BREA 2WFZA 2DJ5A 1II8A 1XZNA 4G81A 1S3FA 5AM0A 5FBVB 1XF1A 1AX9A 2RBGA 1W6UA 1PUJA 4WCFC 5G3ZA 2QRQA 3LX6A 4KQKA 4FDLA 2Y0CA 2BBWA 1Q11A 2H1FA 2RONA 1Q0RA 3QQ5A 4WZZA 5KYWA 1PJQA 1W6RA 3PIIA 4LF9B 3DHNA 1MH1A 1ODTC 4FX5A 1FUKA 2C9DA 3LBYA 4G5SA 1XZQA 2IH2A 1HE8B 4YMVA 3GOHA 4HSEA 5CJJA 4LX8A 3ZZ0A 3M0EA 2JI7A 1XTSA 2WT8A 3HEMA 4IJ5A 4Z9XA 4Z1MD 2PWPA 3U7EB 3OBBA 1NE7A 4J94A 4H7KA 1SCUA 4R8KA 4MGZR 3QV2A 3CEMA 1E7MA 2J59A 3LS2A 3PL1A 2ZYGA 4G4IA 2VHWA 3HA2A 5A4MS 1XB2A 3ETGA 1ECJA 3MUNA 4K05A 3R0ZA 4NE7A 4PRYA 3THXB 5ALFA 1Y7LA 3FTCA 5FI1B 1UF9A 2P1ZA 2A84A 4L95C 1IQRA 3OIWA 2I55A 2EKPA 3QLVC 4YJ3B 3X1WA 5CITA 4JC4A 1THZA 4MW4A 4GPD1 3E9MA 1EQAA 4D81A 3SYLA 3HB5X 2J5RA 1UMBB 3EGDA 5C9ZA 3QXXA 3W7AA 1YZYA 3H2GA 3IVAA 2COEA 3JR7A 3ZTWA 2Y8EA 4MQUA 1HT2E 1W0JA 3OFND 4QX6A 3WLRA 2QVZX 3KR2A 3CZ5A 3O3MB 4RX1A 1L7DA 5DP2A 2INGX 3LA6A 4M87A 1HMPA 3ZQ6A 3NV7A 3S0JA 4DSNA 2B4RO 3HDHA 1YI8A 4MB6A 2XW6A 4BX2A 5CFPA 5LDHA 5LXTA 2I2CA 4MUGA 4NYJR 4ND5A 3GRZA 4EJSB 1U3GA 4JDUA 4DC0A 3CUWA 1U3CA 1ND6A 1NRXA 2JAOA 4ITRC 3H2SA 3GP8A 1VLHA 1PLKA 1PT8A 2WAAA 1C4KA 4QGSA 5K6AA 2M6SA 5A0TA 3D6MA 1M1ZA 1U0HC 3L04A 1EUZA 2EGUA 2ZAIA 5JG7A 2BLNA 5BSUA 1SIOA 1V8PA 2ZU0C 1Y6GA 1ETUA 3OY2A 1N1EA 1RMTA 4JC8A 4IUBS 3E58A 5FOWA 4QUIA 2G6BA 4QXRA 4ENQA 2A30A 3P9NA 3CEPB 2GTPA 1FMCA 5IN5A 3A14A 1F0PA 5F9FA 3OO0A 1G66A 4IDAA 3VH4A 1C2TA 1ZRNA 4R9VA 3RFUA 3EXEA 4ID3A 3ID6C 2QG4A 3KD3A 1SQFA 5FO1A 2YDYA 3RWOA 5A4IS 4NKRA 4LXHA 2O9JA 2BGGA 2VJOA 4Q9DA 3RSSA 2GJ4A 1N5RA 4B47A 2H1LA 2O2GA 3NIDB 3QE3A 1OWMA 2PLNA 3IE2A 4CV3A 4E5YA 5FI3A 4E70A 1D2HA 2W9XA 3AVXA 3OBIA 2FVXA 3X1KA 3LBAA 3PC8A 2QNRA 3E22B 4WK4B 1HFKA 2KSQA 2YXBA 5AYVA 3UMFA 4DXAA 1CFJA 2GPNA 3TIGA 3F7NA 3KJZA 5JPCA 3AM3A 4D9IA 4D98A 4KPUB 4RK0A 3C3JA 3CZMA 3WGQA 2P9EA 1OPRA 3HM9A 1VA4A 3D2BA 3GEGA 1IOVA 2ZSDA 3DZ8A 2G1JA 3PPWA 3ZUPA 2DFDA 1XTBA 1ZD4A 1CNFA 1UMCB 2MU1A 3HU3A 3WK7A 2H9IA 3RRYA 5KSYA 5KPJA 2V1XA 1BCRB 4A6EA 1Y80A 4ALKA 4MMXB 3TZBA 4KNYA 4RJTA 2VNHA 3GLIE 4BFCA 1WHSA 5T4BA 2XGMA 2FEPA 4DA7A 2AFHE 1PWEA 4DLSA 2JIMA 4HLUA 4CCAA 5IW8A 1ZCJA 3HN6A 4DBZA 3LHIA 1YRQA 4TL7A 1GDHA 3A6ZA 4DUGD 3AF6A 1XKXA 4MQMA 4EFDA 1WMEA 3EDCA 3VGPA 2WTEA 1BDHA 1MB9A 2I4RA 4PXYA 3ZQUA 5I4CA 2AN4A 2WKWA 3CWQA 4NL4H 2MJLA 2ZXEA 3DR5A 3I9JA 4UHKA 1BVRA 1SQGA 4K28A 3DD5A 3O4HA 4KQMA 5DWDA 4LOKA 4M0UA 4QBHA 5EKDA 2ZBDA 5I9IA 5AICA 1GGJA 2JJMA 5DLYA 3RI3A 1DQPA 2HK9A 5AM5A 1Y48E 5IXJA 5EMMA 3W1EA 1QZTA 2VDPB 3ZNPA 4P08A 5IYZB 2FR0A 1YA6A 3IOBA 1FF9A 4HDSA 1QAMA 4PV7A 4UOEA 3PA8A 4PZZA 3I9NA 4N8SA 4MQLA 4CTNA 2ID7A 1ZD2P 3PE6A 3PYMA 3P9SA 2ORVA 4WBNF 2WP8J 4AJ4A 3MTGA 4EFNA 4CM5A 1DQYA 1OR8A 2EWWA 2IYTA 1CR1A 4E5NA 3HDTA 1RRCA 4QVIA 1HPLA 1E3QA 4G67A 3K2IA 3NU1A 1SMKA 4KEAA 5EIFA 4V0OA 5GJVC 1D4AA 5F2NA 5EWLA 5SY4A 2BHRA 3D4NA 4N6NA 3B20A 2QT9A 3EF1A 3CRMA 4QEDA 2VCHA 3BE6A 1HTTA 1P1IA 4F6CA 3OMLA 2Q5HA 1W48A 2NUAA 3VI3B 4C7XA 5LA6B 4U39A 3PQCA 2JFOA 3NHMA 4E2WA 3IV7A 1YBAA 1ABEA 5JVDF 2FWMX 2A9RA 5KYNA 1M6WA 3DZBA 3UA4A 1UBHS 1T15A 1UFOA 2JAQA 4JSTA 5FFFA 4LZZA 2ZJ7A 3W3AD 4LF4B 1E2JA 4RFSB 1LX6A 2HH9A 3PA6A 3NQ41 3W2GA 2Y0BA 2TMGA 2PZ8A 3OI7A 5GJBA 1II0A 3A04A 1NVBA 1GZVA 3MS2A 3TNDA 1A1VA 4WZAA 1U31A 2ZQYA 3SFTA 1QZZA 4G5HA 2GBFA 3AILA 4GWLA 3TXYA 2CLKB 2GZDA 2QN9A 3GRCA 3HWWA 3VR6A 5CXXA 2P9YA 4Y98A 2WWYA 1X1AA 3GT3A 3LY9A 1PT5A 3IBFA 1JNYA 1R4NB 1D0VA 1PNTA 1N7HA 1T0IA 3ED5A 3F47A 3OHPA 4Q93A 4F6RB 2M6RA 1D2GA 2VF2A 2BW0A 2C58A 2JEZA 1IHXA 2CLMB 4IVPA 3VMFA 3EYAA 3D4PA 4DLLA 3R7DA 2WICA 1PWZA 1M9NA 3AKDA 1A9XB 1O4VA 3DO5A 3ISTA 4ZODA 3ROKA 1XAIA 5TF0A 4HATA 4HLDA 2EFYA 2IEBA 4RGQA 3WBFA 1A9PA 1VHDA 4RHFA 1JLRA 4CKBA 1EUDA 2XMSA 4UBIA 5KKNB 4ZXFA 1GO2A 1H85A 3WLIA 4EVRA 5H16A 3OPXA 3QBEA 4UUAA 4ZMSA 3AVOA 2NYAA 5LOVA 1FLVA 4GIBA 1YONA 4DARA 2BM8A 2CXHA 2XEDA 4EKNB 1EVIA 3DL0A 4ZYZA 3NWEA 3T5DA 1TM7E 6REQB 1VSVA 1G6KA 2P75A 5LU8A 4HDRB 3AEUA 2W6ID 4JC5A 4LYYA 4XARA 3W4IA 1YS9A 1C9DB 1GNTA 1I3KA 2IYPA 2VK4A 2XQJA 3I92A 4DADA 1PV1A 2DR3A 2J9ZB 3GZNA 3LF1A 3SDBA 1E2NA 1HE5A 1NTRA 1Q44A 2AJBA 2HZ7A 3D7SA 3P2JA 4XGIA 4KGVA 5IUNC 1KY4A 5JJBA 2IYWA 3OZTA 4GD3Q 1J5PA 1ITZA 3SE7A 5AUOB 4CTJA 3L43A 5AVQA 1YB4A 4FHFA 1IN7A 5FTNA 3O3OB 3AOEA 3R9KA 3CNHA 2HMYB 3TBHA 3WGIA 2YNMD 3WGZA 3BIWA 5MGNA 1HNNA 2VQ3A 1UWKA 4I6GA 2Q3JA 3MT9A 3RS4A 2V96A 2GBIA 3FBGA 1LNZA 4I1OA 3QLJA 3UTCA 3IV9A 2HM7A 1QTQA 4LNUA 1GUDA 4X24A 1I1NA 3HB0A 2FZGA 3EPRA 4WDRA 4G8BA 3BWVA 4G5RA 3A7DA 4RCYA 3SHQA 3AHHA 4I1UA 4EFLA 3UCEA 5IASA 1BHO1 2B7CA 1JR3D 5IJAA 5BSWA 1HH4A 5K4HA 1BO6A 1UJ4A 4Z8XA 2IHUA 3T4XA 2A9QA 1P2SA 1K63A 1V6SA 4HZGA 2BSXA 3IOEA 5BT8A 1K6JA 2FWJA 4YASA 5FAXA 5JO9A 4UJ5A 4X6YA 2POQX 3EPJA 3AR5A 3G49A 4ZYYA 1JQAA 4FS3A 4P38A 1H4TA 2O0JA 1I9GA 1KZ7B 1AXGA 4IYJA 1S7GA 1Q0PA 2PK3A 3IJEB 1AA9A 1SG0A 1XL1A 2JAHA 5DHRA 5AJZA 2G80A 3Q4GA 5K0CA 3IP9A 3KKZA 2GX6A 2EEZA 3IEXA 3NDRA 3PE4A 4K87A 3U4QA 2DPXA 1GKUB 2ZVQX 2AZTA 2YQZA 2WJYA 1HA3A 3RANA 4H6PA 4PPYA 1OC4A 1HO3A 1V9LA 2BISA 3HJHA 1WCV1 3OEEA 3N87A 4N5NA 5E8RA 3NWJA 4LFBB 3GJQA 1D0IA 4KFSA 3DHVA 4B74A 4D79A 4FONA 1FFSA 1KVRA 1M0WA 1GTSA 3QX9A 3CRRA 5BNZA 3O1IC 2GRJA 4PRKA 1T36B 1IYZA 3F67A 1YS2X 4XDZA 5K8TA 3VM6A 5FA6A 4GL4A 2PX3A 1FQOA 3SZGA 2XUGA 1YGYA 3RC8A 4DS3A 1RKXA 5IC5A 1OC2A 3EZ2A 3L77A 3HTXA 1GARA 3L6EA 2FX3A 2KHZA 3E5HA 3EDRA 4M55A 4GYYA 2HV8A 4UBNA 4RD6A 4FDMA 1Z37A 4CFYA 1WZIA 2VDQB 1TKAA 2Z98A 2RI0A 4KO3S 1I4DD 4JI1B 1K6IA 4Z4QA 4UE3S 4UTXA 1DRKA 5T67A 5LQRA 5K0NA 3T9DA 3K2BA 2Z5LA 1QIMA 1U94A 1WWKA 1IULA 1NVVQ 3CXRA 3NIBA 1IJEA 4QC2A 3U9TA 4AMUA 1QCCA 3VI4B 1DZ3A 2Q5JA 3GP5A 3R24A 4IDOA 1T10A 2W5UA 1ZCFA 3DEHA 1TCAA 5FTJA 3C97A 1BA3A 2J6HA 1F3OA 2ZJ3A 5DHFA 3V8MA 4JXXA 2VIIA 5AHRA 5ARCA 2ZCJA 1A8PA 2I65A 1KO4A 3UB4A 1DDIA 1HE3A 3A1WA 3U39A 4S1TA 5ALDA 1UOOA 1EHCA 2QUKA 2NSJA 5CMLA 4NU5A 3R7AA 3LT5A 3TTUA 3SQOA 3ZU6A 1LF5A 3PLRA 4DVGA 2GDJA 2Q2VA 3CE9A 2DY1A 3I9V1 4H0NA 4IDEA 4LY6A 4OQLA 5K0SA 3PWZA 1F2VA 3UG6A 3KTOA 5F5LA 4KODA 2QL6A 3QW4B 2GM3A 2YN0A 4F8EA 1YB2A 1WD7A 4F3KA 2IHZA 1JHQA 4C7JA 6PFKA 1U1DA 5JDCA 1N5LA 3MT0A 2WUWE 4TQ9A 4JP5A 5BOSB 1RPTA 3HQ4O 4QBFA 2ZR8A 5GJCA 1KEKA 1GTRA 4M0MA 1UQRA 2J0UA 1ZONA 1LLQA 4L6AA 5AXBA 3WYDA 2EW8A 1YFJA 2W2PA 1ESZA 1PWXA 1W4ZA 1Q1ZA 2O2YA 3STUA 4PX5A 5EJGA 4IOMA 3GLGB 3C5VA 4MLZA 4BNDA 5AVRA 2TYSB 3D6JA 5LP6F 3OJWA 3JTMA 4UNNA 4KCGA 4X1YA 3WLEA 1JZSA 2I22A 1PFKA 1IWOA 2Y93A 4FK8A 3VDRA 1TEXA 4HV4A 3X1XA 5LM3A 3U6BA 1D5WA 3M1IA 4WAUA 2KQUA 4L74A 3MCVA 2G0TA 4N1AA 1Y98A 2H3HA 2XNJA 3FSGD 1P1BA 3JZFA 1EK2A 3PVZA 4PTZA 5CT6A 1G7TA 2CLIB 2JCSA 1FDOA 2H06A 4Z5XA 3SBDA 4U7DA 1JWLA 2GH1A 1LC3A 2ZBPA 3AFIA 2O5EA 1HYQA 3GL9A 2C57A 3LBFA 1CLEA 3FRIA 3HG7A 4RDIA 3ESXA 3V2GA 4TYWA 2PH5A 4J49A 2ZE6A 4RLHA 1XLTC 2JFBA 2IV7A 3NW9A 4DDUA 3UMSA 3A6EA 2XXAA 3HY3A 4XTCS 3C87A 1PJ3A 3G0IA 1DLJA 3ZOZA 2O2EA 4HN4B 1PDWA 2PXAA 3DNPA 4L8FA 3NASA 3ND9A 2EGHA 1Q84A 1A96A 3QENA 3SJ7A 4QWMA 4TM7A 3BZUA 1YS6A 3GGDA 4EUSA 1GZ7A 3KHTA 4DMHA 4AI6A 1N3YA 1NI4A 4BFYA 4RVDA 2ZS9A 1FJXA 1EPUA 3AESB 2F3TA 2DY0A 3FLAA 3NRJA 4LV5B 2E18A 2PTHA 3IB6A 1ZAYA 2X8LA 3G5MA 5ESRA 2AZXA 2EJCA 1ZIDA 3O9MA 4C0JA 3QX8A 1ZNZA 3SYNA 3IR7A 5CLQA 3MYRA 3C8ZA 3E2MA 5LZ8A 1MX1A 3U4CA 4Q37A 4C2TA 4K40A 4C5CA 4LGYA 4XQCA 1UP6A 1UFKA 1N9ZA 1V37A 3COPA 3LUPA 3PNSA 5KQPA 3LDAA 3WJAA 1K3UB 1IXYA 4HEQA 4B31A 3Q8XB 3NTVA 3D9QX 2X0FA 3ECAA 4RPCA 3HJCA 3TOZA 1YNSA 3GLQA 5AM3A 4XA8A 5G53C 2AZ4A 3K1ZA 3CRZA 4PZYA 5B1SA 1YJCA 4H7IA 5IM5A 1NXQA 3EMVA 3DD1A 3ILVA 4JKOA 3MJVA 5C8YF 4NMHA 3SF8A 3KT8A 4BN0A 3OLXA 3VRHA 5BN1A 5JNSA 3K9NA 3O47A 3QVGB 1MW9X 3A2LA 2C99A 4JEIA 1PYOA 1QO9A 1G3QA 1SOMA 4FYHA 4L7VA 4XQ0A 1J0EA 1ECLA 4XDYA 1OBFO 5LP6A 1V3VA 3OURA 5FP0A 1GU0A 2CHEA 4R1OA 3TXAA 2GYWA 2FFQA 3E4CA 3U3KA 2GEUA 1F60A 2PX6A 1NLYA 2QQ5A 3K0AA 4PHGA 1I10A 4E94A 3AW9A 2OHIA 4EKIA 2HCTA 4MQFB 1XLUA 1JIJA 3QKIA 3J81A 3GZTB 1K8XB 3O92A 1U2PA 3HA5A 4QNNA 2GTHA 5JEDA 4P4UA 2C7GA 4ZAYA 4C4ZA 5A6SB 5FT9A 3TEFA 1OCEA 3QHPA 4KU4A 4PG4A 2V7GA 4FQ8A 1RCUA 1HNXB 1YE8A 4JLSA 1V9CA 2JCXA 1Z4JA 4RGYA 2OWEA 1U5CA 3W6ZA 5IJ9A 4HGQA 1XTPA 3G6KA 3OTIA 1HLDA 1DQNA 2V9CA 1MDFA 1VMEA 2NO1A 3H2HA 3HBLA 1RM3A 2Q8QA 3AZPA 3V5NA 2DTDA 3O94A 4KVAA 2V7PA 3HB4X 4NJEB 3BE5A 4RAQA 5EJMA 2NZJA 1DAPA 1T9GS 1VL8A 3L93A 4GC9A 2IODA 3OZEA 1XRJA 2FLWA 3OE7A 1FP4A 4B3XA 1KSJA 1WMDA 4HWOA 4ID9A 1VYUA 4HDQB 3WGKA 2VUTA 1NL3A 1YK1A 2O8EA 3C16C 3BZWA 5I7AA 2FGKA 3HPQA 4ZVMA 2A9OA 1M34E 1I6KA 1Z12A 3EC1A 4NEQA 2ZVPX 1XZCA 2UUPA 4EIWA 3R5XA 1WZEA 4YUAA 2ECPA 4FD3A 5NLLA 3HB1A 3AVTA 1QYDA 2RG1A 3AK4A 1GA4A 3TSOA 4EWLA 1LDYA 2ZRMA 3LLMA 3LOQA 3PVSA 3WMXA 4BO5A 2VZEA 4MWDA 2I1VB 2CJXA 3TD6A 3LY7A 3FKSA 3WO1A 5FWYA 4DMCA 4U7GA 4ZI2A 4L4ZA 1T34A 2A1TS 4OB7A 4F3RA 2G8LA 4I08A 3VR3A 1HOTA 2IVFA 4ZAZA 4RTLA 2I3BA 1TCVA 3L2OB 3MVEA 5AI5A 4JYBA 2FK8A 2DLNA 3PWSA 2YY6A 3OQIB 1Y7HA 1P44A 2PZJA 1ZGGA 2DC1A 4OGKA 1R0ZA 1ENPA 2J46A 5K20A 5LYJB 4GE3A 3D7KA 5IRCD 4L9RA 2V4UA 3I9KA 3NBMA 3FD8A 4RC9A 4NICA 1CRZA 3OTHA 1HNWB 3PFFA 2GD2A 3C4VA 3E9CA 1NLMA 1YZVA 3V7YA 1E59A 2X8JA 1DSSG 3OETA 2WVAA 1YVEI 4O63O 3LRXA 3RPEA 1CTQA 2VTVA 2NN3C 3E6AA 2DWPA 2C8JA 3PHLA 1C4WA 1Q7CA 3RFCA 4CF7A 1R64A 1G1MA 2AV6A 3SC4A 3JQ6A 4V38A 3ENZA 3TI9A 3ZGXA 4P4NA 1YQWA 3SAJA 1PSZA 5AVJA 2ZUVA 3NTUA 4WKOA 2H57A 3PJEA 4ESVA 1PTKA 4K88A 4M0KA 1HQCA 3CJTA 1CUSA 2BFCA 2CB9A 3CX3A 3TNJA 1L7BA 5B2EA 1BMFA 2JB9A 5EIHA 2JPDA 4RDHA 4COKA 1D2MA 1UC4B 5JCZA 2K7ZA 2WWRA 2D00A 3ESQA 1V25A 2K5UA 3KLMX 4ZVQA 4ALIA 3P0EA 4D45A 2ZRQA 4BWYA 6ABPA 2R7KA 4L85A 1CY2A 1KEEA 4HX2A 4DNQA 3KYBA 3QK7A 4BEVA 2J08A 1AU9A 4L0QA 5E38A 2ODBA 4LWQA 4QUBA 1UBCA 5GZ6A 3HZHA 4HH4A 3R40A 2AF3C 3QOWA 1U0EA 2G07A 1OLOA 2IOFK 2X7HA 3B2NA 5D7BA 2J5QA 1M1NA 1Z25A 4UEOA 1XPRA 2OBLA 1SELA 2EQAA 4JEHA 4UHCA 1A71A 3N2IA 4BMCA 5JATA 4R9SA 3CX4A 1DG9A 3EARA 3WWZA 1OXXK 3HO1A 2B8WA 2CKDA 3B52X 3S4YA 2JFHA 1V1MA 2XJ4A 4A0RA 2I6TA 3DHWC 1L7AA 5CX1A 4WN3A 4Y30A 4FHCA 4AZ3B 5AVUA 1QV9A 3LWDA 5ITWA 2QM7A 3L0PA 1X39A 3O3CA 4N3AA 3ZVLA 3DW1X 1E3LA 2JIZD 3DPSA 1RYNA 3LDHA 3UK6A 1MP0A 3ZCRA 2O57A 1JU9A 2PH7A 1PJBA 2V7QA 2YINC 1KJIA 3OM0A 4OP3A 4R1LA 4TMKA 1W4AA 3ADCA 2HREA 1Z4NA 4H7FA 3BXOA 1N25A 1YULA 4YQZA 5C18A 3FWZA 4BP8A 4KQIA 1QIJA 3L4KA 2VRCA 2EG9A 1JHAA 3EISA 5FBWB 5KX5B 2WFLA 3FPJA 3OCZA 1E5DA 4IUYA 2XMDA 3BMXA 1T5IA 5ES3A 3TM5A 4TM8A 3A4VA 1NVGA 3GRYA 5EESA 1RYEA 1CHNA 2IQ5A 1GQSA 1XCLA 3N76A 4EG4A 2BKEA 4C7BA 5FUYA 3ITNA 4JXKA 1FFHA 1KHTA 3QLTA 4DDKA 4BKMA 3G8AA 4JT9A 4BZPA 2I34A 2IL1A 4G9EA 3EZ7A 3PHGA 1G21A 2WT4A 3JRWA 3L8DA 4DCCA 2OLKA 4UTVA 4JVOA 1E61A 1NJSA 5KQMA 3E84A 4Q66C 4X3CA 4C4SA 3LUJA 3KVNA 4X85A 3DMHA 3HYLA 1IPFA 5CFQA 1TB4A 1JSCA 1YS1X 2DG2A 4TL6A 2DHRA 1JSRA 3JQCA 4Y2GA 1CJSA 4UREA 4YLEA 4LSZA 1WDTA 1TYAE 4KE9A 5CVVA 1T2AA 5C1PA 5JNUA 1EVYA 2A78A 2YXEA 2LUOA 4A8JC 3MSCA 5HDBB 1I4OA 4K9PA 3SN6A 3A36A 3CZPA 3KWFA 1QQTA 4MI1A 3SR3A 4DIBA 5TLSA 3AONB 2ZI7A 8LDHA 1MB0A 2IITA 1QE0A 3QKUA 3G88A 1GUZA 2CW5A 3QSGA 5DGIA 2PMEA 3NC4A 4QU8A 1E1MA 3SZLA 5AK4A 3A3NA 3KXPA 1ZGCA 3GJ3A 3H5RA 2IUTA 5F1KA 2W22A 4IIXA 3VOTA 3VTAA 1YB1A 2QLFA 3ZU3A 4OHBA 4U0JA 4WFKA 3X1DA 3ZDYB 5JAUA 1HE2A 3K9LA 3U17A 1ULBA 1VE3A 3FTNA 2BEUA 1KI6A 4BQNA 3CLTC 1ORIA 4DIUA 3VJMA 2N9UA 2NQ8A 2O2SA 5LQSA 3TNYA 1DIRA 3DMGA 1L7XA 4LEIA 3FOZA 4YXWD 3NT2A 1XJ5A 4NABA 1RLJA 1OZFA 3PUZA 2DBVO 4JXZA 5AVTA 1FMLA 1VKZA 3SICE 4O2LA 3BMQA 2J48A 4J0HA 2X4GA 1XTUA 3ZV5A 2W00A 4C43A 1J25A 2Q9UA 4OQYA 3TSAA 3RC3A 5JJCA 4EI9A 1VLZA 1W94A 3B1FA 5IAEA 4MVJM 1DCKA 3BWXA 4FFDA 4AXXA 4TN1A 4ZV7A 4IMRA 2OCBA 4RMIA 1OOEA 4QJIA 2CE2X 3RCBA 2ZBFA 2NZUG 2QLTA 3UAYA 5F3DA 1XTKA 1Y89A 5C1IA 2J1LA 3DTVB 2MCFA 2WV9A 3ABQB 3GAZA 5TE9A 3UFXA 2PKCA 3T7CA 5TJ9A 3ZGVA 4HK4A 2CZGA 2ZRJA 4TYMA 3VKFA 5ADHA 3ZDDA 3V4SA 5BYBA 4OL9A 1XQXA 2JC3A 3CB2A 2CZCA 2Z2YA 3TDNA 3LP5A 4DM4A 4KQXA 3EF0A 4MYUA 3K72B 5T41A 3RVPA 4MCIA 3WKAA 4AKTA 4ALLA 1WVIA 1D5CA 2JLVA 4HXFB 4I5DA 2NAFA 4D2IA 3L0YA 2DYKA 1ZS9A 3RVOA 4INAA 3RD5A 3U4GA 3L9WA 2GPAA 2R6HA 2HQSA 3LQFA 1KJQA 5HR5A 1XNJA 1CRQA 3A9VA 1GSHA 4CLRA 1Y3DE 1DJOA 3OJ0A 1YZUA 4MICA 3ZLVA 4ALMA 1ETHA 1YD7A 4KYVA 4PC1A 4PFKA 2YWGA 4KXMA 1P31A 3E82A 4NR0A 4QREA 3IMKA 4WOJA 5FFNA 1ZIPA 5JFTA 2ZI3A 1LQTA 3Q2OA 2WIAA 4WFQA 4L8LA 3U40A 4CMHA 1JPUA 1H1LA 4LTMA 1AHHA 1T9HA 3D5EA 2OHFA 3ZBTA 4HDCA 5A2GA 1NF8A 3RK0A 2I33A 4FFBB 1S6YA 4LQDA 3AR6A 1RWOA 2R6AA 2CT8A 4BTVA 4DANA 2IS1A 2XUHA 4TMXA 5CJ2A 3U3RA 3ECSA 3G8YA 4CMKA 4ZVKA 4GO1A 1M5UA 4GOND 4N3CA 2VJMB 5JZ9A 2BMFA 1LW7A 1SBCA 1Z74A 1EFCA 3CR3C 3WMFA 4B4WA 2X6TA 1F4VA 1VP9A 2C5AA 3OLQA 4MUHA 1KETA 2C3MA 4ZCQA 3V9PA 4QOFA 2I6SA 3F8TA 4EVIA 2Y0EA 1BJKA 5GAJA 3WK8A 3WYBA 1H22A 1OLUB 1R1DA 2YV1A 3P2YA 3GBSA 4X20A 3T7RA 2R47A 3R5HA 4YP7A 5FOSA 1DMRA 4ER5A 1OXTA 3S68A 3EVDA 4C0KA 2B25A 4P0QB 4YMIA 1GQFA 2XBUA 4LF7B 1GU1A 3O7WA 2Q0SA 3A06A 4JEMA 4TLEA 5BW6B 1XEXA 3SR4A 1SXJA 2HA4A 2QJFA 2J8ZA 5ARDA 3FNRA 3K70C 3RVNA 2ZWPA 4M9ZA 1R15A 2PFGA 3KT3A 3DTVD 2G9ZA 1OZ0A 5T8KA 4AF7A 5BR4A 2GYYA 1QE3A 4CG2A 4BO7A 2HK7A 4YRFA 2FMFA 3GRRA 1E94E 1KYZA 4G0QA 4KXWA 4JJ8A 5IWAB 1E6LA 3SMVA 4D26A 1IAVA 4QOHA 1SUWA 2GEKA 3OJCA 5BYJA 4UAGA 2WIDA 1DT5A 4YK7A 2B9EA 2QAIA 2V7UA 5TEVA 1Q0LA 4DQ0A 4YAFA 2VHTA 1IWBB 2X42A 4LTDA 4DPMA 2A67A 4TTQA 2UVPB 1TVMA 2O2ZA 1X42A 2XMRA 4CM8A 4D80A 1FC0A 3S8EA 1RLIA 2JIQA 4OXNA 4F93B 2NVBA 3LNCA 2F2TA 4EO7A 4KN9S 4BTLA 4AK9A 1DDOA 1OXBB 1VB5A 3T0FA 4ITVA 3B6EA 5BXYA 4X7PA 4WXEA 3EQ2A 3PEVA 1EVQA 3DBLB 3VSAA 2OSVA 4FFMA 4NF2A 2VH5R 3R4VA 4YRKA 1TZCA 5I7FA 4OX9B 4KLZA 2O4CA 3KCNA 1Z5GA 1FVFA 1ZH8A 1XEWX 1I3LA 2VZ9A 2I4MA 4Q47A 1KRHA 1KE1A 1U7ZA 4LMAA 4PTLA 3HR7A 4QFCA 3TRKA 4YUYA 4H77A 2YRXA 4WE3A 1OFUX 1AQNA 3AH8A 3HL4A 3BFPA 3RJ9A 3RR2A 1VIDA 3TLAA 3RS5A 4JV5B 1XRRA 5LB4A 4ITUA 3M6UA 4D9BA 3JSAA 4DIFA 4EITA 3KQKA 1GA6A 4TN5A 3A28A 1L8OA 2E4YA 4MUYA 4N0QA 4NIMA 4B3GA 4BVKA 4AZ0A 4MVWA 1F8UA 1OI3A 3L7JA 3EPLA 3WGMA 2CHQA 4AWXA 1ILEA 4YY3B 1FDVA 3DKPA 5BN3A 2BEWA 2IY7A 3HMQA 2GEDA 3IEUA 3IALA 3UWKA 5BSFA 1EGMB 5L3QA 4AG5A 3PQ6A 1O94C 1CEQA 3VTKA 5T57A 5IJ0A 5JS6A 3Q3VA 4MDHA 2DCUA 4PGMA 3S1AA 3RF6A 1MXHA 1OZHA 1O8BA 2I91A 3QX7A 4G5OA 4O2AB 3CLHA 1ZMXA 2GVNA 1FU7A 4L9AA 4LWOA 4PHHA 1MC1A 2IXTA 1F8XA 1FXSA 2XQFA 1JV2B 1JAYA 4M7OA 5CJPA 3PGLA 5IF3A 1G4HA 1MIHA 2JFVA 4C0XA 4MGHA 5D00A 4IRUB 3UWSA 2O8DB 1YCFA 4HNVA 4YUVA 5AFSA 1N2GA 1MOQA 1QPGA 5DCLA 4Z0TA 3NHUA 4DMMA 3CNLA 1SH7A 5D8DA 5BV7A 1W2GA 1Z4PX 4JYMA 1IXKA 3C70A 1BHQ1 5GJWC 4C2UA 3ZYZA 1W9MA 8GPBA 1CUUA 1OY1A 5E9AA 4H0CA 3QLEA 3HEAA 4GOLD 3V32A 4LGVA 3PTZA 4ZZ1A 1FEZA 4YCAA 3AHFA 4MKGA 5ALOA 3UW3A 2W6MA 4B6QA 4ENTA 2NM0A 1RHKA 2R6R1 1U0JA 4PQRA 2Y1EA 3R9WA 1ENOA 4ZVSA 3IAEA 4TLBA 4BBZA 2QBYA 3FZEA 4GLOA 3SQMA 3ZHXA 2OYSA 1D07A 1TDJA 2FDXA 3OOHA 4RJLA 2QD4A 3V4LA 1ZVVA 4HJRA 3BA1A 4QBTA 4U2GA 2Q0XA 3TJRA 1YMQA 3VQTA 4G1CA 1DTWA 3R0VA 1X7YB 1DUVG 1T9ZA 5JV5A 2D5AA 2QJOA 1BZYA 5KTPA 1N75A 3AIIA 4GC5A 4KDEA 4M89A 5FNVF 4MUJA 1I1QB 2DFLA 4PM4A 5FYQA 3FYUA 1EX6A 4BO6A 1K75A 3I0MA 1LWOA 4Z86A 4PICA 3CV3A 4YJGA 3UFBA 2XCRB 3WLKX 521PA 1ZOIA 4ZEWA 5JHHB 3DHYA 4WASA 1ZHHA 4YRSA 1DVRA 5IVPA 4HQKA 1HZJA 1QX4A