2B99A

Crystal structure of an archaeal pentameric riboflavin synthase complex with a substrate analog inhibitor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
146
structure length
146
Chain Sequence
TKKVGIVDTTFARVDMASIAIKKLKELSPNIKIIRKTVPGIKDLPVACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDKELDWLAKRRAEEHAENVYYLLFKPEYLTRMAGKGLRQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Riboflavin synthase
publication title Crystal Structure of an Archaeal Pentameric Riboflavin Synthase in Complex with a Substrate Analog Inhibitor: stereochemical implications
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 51
structure length 146
sequence length 146
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.9: Riboflavin synthase.
pdb deposition date 2005-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2b99A00
1KZ9A 1KYVA 5IM5A 1NQWA 2O6HA 1C2YA 1NQVA 2VI5A 2C94A 1NQXA 2I0FA 4KQ6A 2OBXA 1C41A 2A59A 1DI0A 2C9BA 1RVV1 1EJBA 1W29A 1XN1A 2B98A 2JFBA 1KZ4A 1KYYA 2C9DA 2C97A 4J07A 1KZ6A 1ZISA 1KYXA 1NQUA 1HQKA 2A58A 3NQ41 1KZ1A 1T13A 2B99A 2F59A 5IM4A 2A57A 1W19A 2C92A 3MK31
chains in the Genus database with same CATH superfamily
3UFBA 1J9GA 4AIIA 1ENZA 4ISCA 2R4UA 2YUTA 4QJBA 3AW9A 5CPBA 5JSKA 3R3SA 3EBOA 3S28A 4C4ZA 1XUOA 2ET6A 4RX1A 1ESEA 1H6CA 1N3IA 1E9AA 4ZHSA 1D7OA 2WJWA 2IX9A 3HC7A 1LXCA 4L8YA 4RIIA 4HSEA 3LY7A 4F45A 4JBLA 1YRBA 3L8GA 1JQEA 4LWPA 3EVAA 4MHOA 4NU8X 4UU1A 3RVBA 3VHQA 3EODA 3SX4A 4D97A 1M1NB 4H1TA 1C1YA 3E5HA 2HWKA 4H59A 1OKKA 1LW7A 2DC1A 1GFZA 2ODPA 2QRGA 3HQ4O 3PYMA 3S2YA 3HY6A 1RAFA 3GLQA 1BQ4A 3GJ6A 3PR2B 4Q9JA 2LDBA 4RGBA 4UE6A 5ILQA 5JXHA 1PEKE 2PUFA 3N6XA 1IOVA 1ORVA 2G17A 2JHGA 1G8AA 4C5CA 1Q50A 3ZXIA 1O08A 3QLVC 4RLSA 1YDHA 5BOSA 4YJ2B 2TMKA 4OJQA 4YMHA 1ZUNB 2GPAA 2Z0MA 2OPHA 4IIJF 4OOFA 1KH2A 1KYZA 4FGKA 4UM9D 2XVXA 3H9JA 5D00A 2HT1A 3OE5A 5CT4A 2JGKA 1O87A 2JKVA 3U4HA 2ZUCA 3ILSA 4Q3AA 5KKCA 3D5EA 4OHZA 2DFDA 1FP4A 4R71A 2CB0A 4TXLA 3O38A 4UAUA 5EJFA 3S5UA 1L4UA 4N7JA 5FLXA 1SU8A 2O06A 4JEHA 3VNVA 4WBSA 3BXXA 1IUOA 1G7SA 5FFNA 5DF1A 1NJ8A 5HVNA 4HBZA 1FU7A 4C0QC 2QAGA 1W9MA 3GEEA 1Z5PA 4OJKA 1SD5A 2CCJA 2FNAA 2P30A 3QM1A 4AXBA 3UXYA 1NMYA 3HCEA 1XCOA 5EIAA 2QG6A 1OFUX 4M8NE 1CY2A 2OMEA 4UUBA 4N5LA 4PO3X 2R84A 1DRVA 5JO9A 3KEMA 2VCYA 1N4AA 4QFDA 1OV6A 4LUCA 1QDLB 3RRYA 3R40A 1XX6A 1TEXA 3BCRA 4QTXA 1KL7A 1T9KA 2EXXA 4MW6A 1IATA 4O25A 2PA3A 3AGQA 3FMFA 3R3UA 4L5BA 1TZJA 4MVJA 1DQSA 1JZSA 5HGXA 1KTIA 2VDPB 3LCVB 1L8XA 2RHWA 3K6SA 1EVJA 3OC6A 4DMKA 1EVQA 3A9SA 1YZHA 2O0KA 4PEVA 3LS2A 4YEDA 1KQFA 3PDIA 4E2YA 3HRIA 3OM1A 5FYQA 3MYYA 4EG1A 4IGEA 5T4FA 5EEHA 2Q5CA 2YY7A 1XA0A 2RG1A 2UVQA 4G0ZA 3DBRB 2OV3A 1PBNA 1Z8HA 2DBRA 1E0DA 3NBMA 1GSHA 3Q9SA 1L5RA 1GGEA 2JANA 2QX7A 2OESA 3PPWA 2KLBA 5SYNA 4E31A 1KSFX 2MIIA 3JD1A 4G07A 4QT4A 2EEZA 2Q49A 3L8FA 1TCBA 3COZA 3M6XA 5DIZA 1UZUA 1VG9B 1RWXA 4X1YB 4MA0A 2H00A 3O90A 4B76A 1TB4A 1BXGA 1REQA 2GDJA 3GQBB 1Q7RA 1R9GA 4ZOQI 3I4FA 1SY7A 4YACA 1BRTA 1IY1A 1KXJA 3O73A 3LX8A 3L1JA 3NV9A 1Y6JA 3UCEA 4NATA 4DYVA 2EIHA 2IOFK 2OCDA 4JBNA 5EPEA 1T91A 3G88A 4CKXA 3E3AA 4GS5A 4XX1A 1AJEA 2EJCA 1P8JA 4ARUA 3HWSA 1VA4A 5CK4A 4PIPA 4RNCA 1F2UB 2BFCB 1P2FA 4OK3A 3EIWA 3V4LA 1KBOA 3HZRA 4RLFA 3GLRA 4E5MA 5IULC 1CY4A 3D3EA 1R4ZA 4UXIA 2C8LA 3ND8A 5AVKA 3L04A 4V1CA 1OVGA 2A9RA 4QSMA 4BO0A 2RGNC 3WDMA 1HE3A 3SBDA 2Q3FA 4TLAA 2R3SA 3TR0A 1FFYA 2EDCA 2SICE 1B74A 1SC1A 3P9PA 4KPUA 4CCWA 3DBVO 4EHHA 4HH3C 4X3PA 3L0CA 4NOMA 3BTVA 4PIMA 4ZAGA 1P2TA 2QP9X 3I09A 4KE8A 3TZEA 3JARB 4BX3A 3GJXC 2QGNA 3GVHA 4YRAA 5DHFA 4I5GA 5LQCA 1IH8A 2OK8A 3MBKA 4TWBA 3O6VA 5B4VA 1KR5A 2XLCA 1CETA 3DBIA 1C0KA 1VJRA 3LP6A 1NN5A 3PR3A 3TZ6A 2FKNA 1K6EA 1EXWA 3OG9A 121PA 1DWPA 1L7BA 5C7OO 3DEYX 3FZNA 4ZAWA 1LLCA 5C1DA 4QOSA 5IDYA 1YOBA 1NZFA 1R0RE 4GT1A 4D0SA 5KNLA 4AIRA 3R8CA 3MM4A 1E32A 1STOA 3M34A 2JIZD 4IH4A 5CAEB 1F1BA 4PYRA 5ALLA 1WG8A 2P2YA 3FNRA 3G6KA 4KDFA 3NYWA 2EL9A 3MJFA 3RVPA 3HKDA 4A8PA 1V8FA 4QA9A 2ZI6A 1WW3A 4ZZ0A 1AGPA 3IFSA 2MYTA 3JWGA 1M2OA 2R8YA 3PT5A 4EBFA 1LDYA 1AGNA 5BVGB 2WT8A 4MQUA 2LTAA 1E62A 1PV1A 2F4NA 3KTFA 4YECA 1GPAA 3SHFA 3HKCA 1XI2A 4MTLA 4YCMA 1EB8A 4IGKA 5IS2A 2CF5A 2RK6A 3MRTA 3R7WA 2PX8A 3W9UA 1C4XA 2I7DA 4QWMA 4ZDJA 3HVJA 3EGCA 5JWRA 1MGOA 5BVHB 5HFNA 1ODLA 3KDPA 5KX5A 1EWQA 4GPZA 3I34X 1Q84A 3TTTA 2PA0A 1BA2A 2OBLA 4BIIA 5EUQB 2WKSA 3IE0A 1II9A 1FTQA 1YE3A 3RRBA 3ANXA 3CX4A 1NBOA 3EA4A 4XQ0A 3MTQA 1YUMA 5CFZA 3NUGA 1ACMA 3AF3A 2Q50A 4PINA 1CZKA 4KRXA 3ET4A 3UYKA 4F06A 4RTRA 4FOTA 2ZYHA 1L9XA 3VMMA 5JS6A 2OCBA 2WTBA 3MZ0A 3G3EA 1Z2CA 3TFOA 2G40A 2CHQA 3SZMA 5CEEA 5ED4A 2O8DB 2F4VB 5CDUA 5AKYA 3GRAA 3WNVA 1FP4B 3AM4A 3A28A 3DTVD 4BFVA 4TL9A 1W75A 4Q1EA 5LQMA 3TH5A 1KZYC 5DNEA 3LOQA 1V8DA 2VHCA 2DYKA 1AX9A 3B7WA 3ELWA 3TOXA 4BVGA 3G1TA 4K9LA 5LB2A 4FEYA 2YCBA 5FRDA 2QAGB 3CR7A 3GGSA 1CIJA 4MYTA 1ISGA 3OJWA 3UOGA 3ZXYA 3A6HA 4UJ3A 3EHEA 2E37A 3AUYA 3M6AA 3MJRA 4FMBB 3MRVA 3BB1A 4MKIA 5DHTA 5C53B 4BO3A 4ABTA 1N6RA 3AM3A 2UXCB 1IMJA 5D1NA 4CEIB 1GTMA 1RACA 1UXHA 3RUAA 3U7IA 4I0WB 1A7KA 1JX6A 2JH9A 4UD6A 2PVCA 3L0IB 1PVDA 4PSCA 4GPIB 2BP7A 2Q6LA 2PY6A 1V35A 1QIJA 3S2SA 2RJ3A 1TVEA 5J47A 3K9LA 2J59A 4KO2S 3IR7A 5CW1A 3RJ9A 4DQ0A 3K6SB 1HSOA 3OTHA 2FSPA 4A0SA 2J31A 5LSAA 2LKCA 3PDIB 4QHYA 4QQFA 3EPHA 2VAVA 3DDWA 4GBED 1W88B 3HSYA 3KYJB 5AESA 3UW3A 2QTLA 4TYPA 1NYRA 1GYQA 1T1GA 4RPHA 2VDNB 3RAEC 3ESXA 1EGQA 2JAPA 3FWZA 1CXZA 2QMUA 3L4BA 2K5UA 2VDLB 3WZ2A 2CWWA 4YRDA 2PWAA 4OQZA 4P7GA 4GR4A 4JVMA 2FX5A 4HQ6A 1VSQA 3CRRA 4GI1A 4NPHA 4TM8A 5DE3A 3G2PA 4TZ6A 2YMPA 3M89A 2PQ6A 3E9RA 1K2VN 1KPIA 2V0CA 3FBGA 4EZIA 1PWHA 4KR3A 1XZQA 4ZT5A 1BXGB 1REQB 5JXJA 3HPRA 5A4AA 3FWNA 3ZNOA 3CZCA 1ENOA 1ZOPA 3A9VA 1NN1A 3BK2A 1EE2A 3BN3A 4DPKA 1WF6A 4DRXA 3ZD7A 3MAAC 2IE0A 2OG1A 5JECA 2A4MA 1M2EA 3AG5A 3GLSA 2AFIA 2R65A 3D3NA 3G79A 4IHJA 1EGVB 1VLLA 3KLOA 1GPYA 4S1PA 3LHKA 1A8SA 2FFRA 4G8BA 5IKEA 5KEIA 1YDFA 3BT7A 3F6RA 3AM1A 5BUZA 2ZP1A 3RRNA 3JALB 3S2GA 3L7BA 4AJ9A 1XQXA 1XJQA 4BB0A 1NC3A 2V7TA 3DW3X 1WR8A 3EEOA 1Y9ZA 4RPLA 3NHLA 2C9DA 1TAQA 1CUSA 3RAJA 5EWMA 3EX7C 2WZDA 1GY8A 5E3JA 4IMIB 2XJ9A 3GGOA 3NZEA 2A5DA 4KPUB 1DXOA 2HSZA 1AZWA 2Q3CA 4QXPA 4YI5A 4ZZ2A 5CM2Z 3RJTA 1NLUA 2A5JA 2V8OA 3IMCA 3B20A 3BD8A 3KDAA 4RD2A 4FC7A 4A8HA 2QJOA 4F5WA 3AFNA 4IJQA 1KYIA 4DOMA 1YCGA 3EWNA 3Q9NA 3B5EA 4Q21A 1EEXB 3OKPA 2HBYA 4H35A 2V4ZA 3K9BA 4M54A 4WXHA 3NBQA 4CTNA 2FMFA 4L72A 5SY4A 1FVFA 2C8VA 2XQVA 1CQPA 4NJOA 3AESA 4JT8A 2OBXA 5DZSA 3S8MA 1TCVA 2X1VA 4B80A 3FYHA 2COEA 4LSWA 3P27A 3D8UA 5F7XA 5KCZA 3OT1A 4HB0A 1JLRA 1SUSA 2QKYA 5CB0A 1VZ3A 4DR2B 2PJRA 1H2AS 1PF7E 3IRUA 3C3KA 1MTOA 3HKDB 3OZXA 3QW2A 4BRUA 5CFOA 4S1NA 3TQTA 3CN9A 4IRUB 1JLHA 2R1UA 1M2OB 4XB2A 2WY2D 2B20A 3AQ4A 4X61A 3C2QA 4DYHA 4RZIA 1UJBA 4UZEA 4A10A 1NKVA 1P62B 4C7VA 3HKCB 2FPMA 4IUBS 1JFLA 1N5RA 1EFHA 2OO7A 4MJ3A 2CLEB 3L0PA 4MB2A 3WL7A 3ZWAA 3CJQA 1L3CA 4RA9B 5E2IA 4BX2A 1BKDR 4P4SA 1C3LA 1OLXA 1XZCA 2BBSA 4LHXA 3R7WB 4ZMBA 3GZNA 2PEZA 4HAXA 1LSOA 2X4DA 3H5LA 4CLRA 1BJKA 4GZ3A 3IQEA 1NFRA 4HPJB 2Q8NA 3T0GA 1G66A 3NS7A 1NVMB 3VPFA 4BC0A 1YZGA 1FTYA 4DGQA 3QWBA 3OQ6A 5KX5B 4JA0A 3HXQA 2VRBA 3WL4A 4HWKA 4LJAA 3X1WA 4JLKA 3WLEA 2V5UA 4X6XA 4EUHA 4MI3A 1OOEA 2VSQA 1UBEA 2WIJA 3HXTA 3HYTA 4OBBA 2E7ZA 1EQ2A 1UKZA 1XAJA 3VO9A 4Q9IA 5E4JA 4EJFA 1IQRA 4AZ3B 4FGZA 1U4NA 1TDJA 3GRVA 3ISVA 5TEVA 1LK5A 4EM6A 2OHIA 5I4CA 4Q9DA 2GT1A 2JKZA 2HIHA 2VOJA 2C4NA 5L45A 1BYUA 5I7SA 2NYAA 1MUUA 2CXXA 3IO5A 1WMSA 3R0IA 3MJEA 3OECA 4GDMA 3ZY3A 4ZYVA 2HHHB 3CONA 4PANA 1L6IA 4MKXA 3QBTA 3C3AA 4E1BA 1QK5A 2FP3A 2C5GA 3A37A 2MMGA 2VDWA 3QBEA 4U7GA 4XYMA 4M7PA 4B44A 5B30A 1OJLA 5FUBA 1IIBA 5TQVA 3MGKA 1SCUA 2BONA 4Q37A 3Q8KA 1G8SA 3QMWA 3ZE1B 4KBFA 2NAPA 4NXMB 1H8EA 4JJ8A 1XHEA 3WGQA 2WWFA 2JA2A 4XDGA 3B1ZA 2I62A 2R9VA 5DM4A 3WQHA 3LQRA 5BT9A 2YOFA 1AM4D 2WT9A 4J4HA 3F1KA 1P39A 1X77A 2RARA 3R2JA 4O1HA 1QZ3A 3SBEA 2BE7A 3RHTA 3OEED 4BL5A 1L5QA 2BC9A 4CM4A 5AMXA 2PUGA 4DJJA 5TS2A 1TYCA 4EGQA 1TTTA 4ZV9A 2IHBA 2BP7B 4PHGA 3NVAA 3ROTA 2ECFA 1SVIA 2V6JA 4MPPA 2QTTA 4IJWA 1W4RA 3KKKA 1RQ2A 2PQ0A 2GPWA 1CZLA 2B3DA 2II6A 5IBPA 4G5GA 2OAP1 4U2EA 1HE4A 3F7OA 1IAVA 2FSUA 3A3PA 3DZJA 4RU1A 4TXNA 4C4PA 4PRLA 2WRZA 2PKEA 1H2EA 3FGNA 3FI0A 4JH0A 4D5GA 4Y1FA 3KQTA 2BI8A 2BPOA 3TE6A 5LKAA 4O3FA 1S8FA 2XKKA 1GITA 4E5PA 2R00C 3IO3A 3UB3A 1ZM7A 3HM2A 4MW0A 2KYRA 4B82A 4WA8A 2JEOA 1JSZA 1LF5A 5KTNA 3F98A 1IC6A 3BAZA 3JQQA 2QYHA 4P80A 4BZXA 2VPIA 1H3EA 4FFBA 2DHEA 2ACVA 3WADA 4OPMA 2XTAA 1PGPA 1QGAA 4QU9A 2VA9A 2VRNA 1XRSB 3I53A 2WZBA 3H5RA 3NAZA 1SBQA 4HNSA 4FM9A 2BM0A 4EY6A 3G9ZA 1JDUA 1GZVA 3NORA 4DRXB 4EPTA 1DCTA 2CFIA 3KQNA 4AW9A 1UC9A 3ZG6A 2V59A 3GMIA 1MOSA 1HDYA 2AFIB 3I1FA 3IDFA 1HYQA 1ZZGA 2OVFA 3FNFA 4IHJB 1V1JA 2O7VA 1ECBA 2ZREA 1D1PA 3SYMA 3UV6A 3ZOKA 4L8VA 1Q92A 1N78A 1I1HA 3MSXA 5KOJA 4IIJA 3M9XA 2Y2UA 2IYZA 2AN4A 2NSYA 2XAUA 3GFRA 2BBWA 2B7CA 2XMZA 4KO1S 1TEZA 1KMIY 3MT8A 1LWNA 3H2GA 4ZAVA 1T4DA 5IASA 2QTFA 4LBVA 4NQRA 2CXUA 1QQ7A 1XZHA 3I6MA 5EWMB 3JYOA 4RDXA 1J4AA 1ZUHA 2DG2A 5DM0A 1OHHA 4WNIA 2GERA 3Q3EA 3OMXA 1PS0A 4PHFA 2QTVA 2CW5A 4PYIA 2PMWB 1E7QA 2P8JA 3HJAA 3TL2A 5B3KA 2PX3A 4C2UA 4PC2A 3GLVA 2VBCA 1NUUA 2IXBA 2C83A 2O23A 1EK6A 4E0BA 1W0KA 1GU0A 4OXQA 4ZARA 3D3KA 1BN7A 1XCGB 3ZWVA 1EX1A 2CMKA 2X7JA 4JP5A 1W30A 4P3YA 2CLKB 1SOVA 3SEFA 1DJMA 1Q0RA 4MICA 1XU4A 3N58A 5AK5A 4DGSA 3NVKI 2B5OA 2JGRA 4MJLA 1FDUA 2OBNA 2VNAA 5FDFA 3AESB 3IB3A 1C4OA 1V8ZA 1XD8A 1C1XA 2F3RA 3IBSA 2JLRA 3EY4A 1T9AA 5FTWA 4LDAA 2Y99A 2WHRA 3OT1B 3C45A 4MCJA 3A1VA 3RYFA 3N75A 2OT3B 4MDHA 3D81A 3QFTA 1SH7A 3QLVA 4QUGA 5ESXA 1IDOA 2RGCA 2YHSA 3BZWA 3CLSC 3R4CA 4L8LA 4LQLA 2X58A 1JHXA 3NGMA 1WVMA 1GNRA 3CRMA 4DKXA 2JAHA 4ND5A 1G7RA 4K9SA 2W6JA 3STYA 1ZVMA 5HUJA 1G5PA 4EUEA 3UMCA 3OTWA 4S0XA 3T7SA 2DRIA 3PC7A 2C8KA 4QTTB 1Z74A 2B34A 2PL3A 4BO5A 1JUDA 4IIUA 2VF7A 2H9AA 1UKBA 2O4CA 3U19A 3MWDB 5A6SB 5HZMA 1YQXA 3GZNB 4IVNA 3D3WA 5EE5B 4CLRB 3TQCA 3VSDA 3U17A 3F9CA 1CULC 4DC9A 1FP1D 3C1OA 2HJRA 1P1FA 3EOBI 1KYWA 3NNDA 3NWJA 1AOXA 4W1PA 2ZRIA 5H81A 4BFZA 5ETJA 1XZMA 4EFLA 6NULA 5FBVB 2OSBA 2W90A 4HCJA 3BWDD 2B61A 2ISQA 3I6ZA 3II6X 3NHWA 4JLDA 5NLLA 3UUFA 1O0SA 1O6ZA 3EZLA 2LBPA 1ZJ6A 1XNHA 1S2NA 1NRXA 2FEMA 2QL7A 3W0LB 4E09A 4EY8A 5K0SA 3HVRA 1XDZA 1G38A 1U2ZA 3M6WA 1R00A 2FETA 3LLMA 4JBYA 1GTG1 3X0DA 1BE8A 4BCBA 2XZPA 4W5HA 1C3EA 2XHEA 3CX3A 5IUNC 1B16A 4CT5A 1VIAA 5AWFC 1KY5A 4V0MA 3UMMA 4R8KA 1F0YA 1MC4A 4GPBA 2YS6A 5LL6P 5BXYA 2ODEA 3VNBA 4MK4A 3JR7A 4EQ6A 5YASA 3A2LA 2ONCA 3P0JA 5F52A 1P9RA 3RSQA 1SXJD 1EVYA 2XYVA 4MQ4A 1NMQA 1PKEA 1R74A 1C9YA 1SCUB 1UBSB 2XQJA 2ZT8A 3NP7A 4ITVA 4UQPA 4YREA 3U2QA 4MYSA 3P4YA 4YRFA 2DERA 2JGLA 2YJTD 1ST3A 3C98A 3NT4A 4XSHA 2GZSA 1V16A 4B46A 4IXTA 5KTOA 5MF6A 3BWVA 1OVMA 2AW5A 3MTIA 4IKEA 1RWNA 3DZHA 1IBRA 3HA2A 3VI4B 1HDRA 2X86A 4L28A 2VEDA 1LF0A 3DBHA 4DCCA 1GUDA 1Z6GA 3PFGA 4JLMA 1RM5A 2WSSA 3K5PA 3LLCA 3QLUC 2FWBA 3VZQA 3N05A 3FNBA 1FX0A 1UXOA 2EX1A 1E7SA 1FX1A 1YZNA 4FKMA 4NFHA 4DVJA 4EVSA 4AROA 1MLDA 4P8RA 2PL9A 3P5BA 3PGJA 1K66A 3RFVA 4RHUA 2O6HA 3B1VA 3VPDA 1VJCA 1A1SA 4JLUA 3DHEA 3W9BA 3DMNA 3F5DA 3FMOB 2RGNA 4EI8A 1TYDE 1CF9A 2WVAA 2YWEA 1QRAA 2RK3A 2YMMA 4P7FA 4E3WA 2VK2A 2FPKA 5BQFA 3GWZA 3ZWXA 2WSIA 5F33A 1IEXA 2NXWA 3T3MB 4BN5A 5JDIC 2C9OA 1ZNQO 5EY5B 2IZ7A 3MTGA 3NM5A 4FFBB 4UTXA 3TSWA 4P1ZA 3HCCA 1WZNA 3L46A 2Z09A 2G04A 1MA3A 3ET5A 4XWYA 1JILA 2HJHA 1M1YA 3FGZA 1H2ZA 4ZEXA 2EFJA 2YWDA 2BRUC 4PGHA 3EZXA 2HJVA 2E2WA 3O8RA 1NBEA 3VPAA 4B2IA 2NO6A 2HHLA 4FZJA 3OJLA 1P80A 1U7DA 4LBWA 3UBMA 4ER7A 3THYA 2C9CA 2QRZA 1I2ZA 3FF1A 3PU6A 1UM8A 2VTEA 1P9NA 3AXSA 5IVPA 5KTPA 4GOMD 4WIAA 4G56A 5A2GA 2FF5A 3OBIA 4IIJB 5DHUA 5HMLA 2ZATA 2ZW9A 5KOJB 1ABEA 1OLOA 4LTDA 4IDCA 4V3BA 3ZGNA 3AKCA 3QI2A 1DO8A 4LAFA 1AVTA 2JL1A 2W5UA 3OOEA 5DV9A 5C32A 2IXDA 4V0NA 3U5ZB 1P4RA 4QO8A 5FA8A 1QQAA 2QX8A 1SHTX 4H18A 4X1KA 4EHIA 4W5NA 4WZBA 1U7OA 1N0HA 2YASA 2ODQA 4UZSA 3U81A 1XAGA 4B85A 2QTVB 4EFDA 3QNUA 4DAOA 1OX4A 2QSUA 3FKSD 4MARA 4NNJA 5KDDA 2EL7A 3W8FA 2UU9B 1TZKA 3R9XA 1QHXA 3EDRA 4K9OA 1OU4A 2BF4A 4AJ2A 1Y8AA 2Z4SA 4NZYA 3NHKA 1KI3A 1IWPB 5AVZA 2ABWA 5HKKD 1XQ1A 4JQCA 3WLHA 2X5OA 4E5YA 4F2DA 3KAQA 5JNUA 1QUFA 1WCXA 1TIPA 1FOEB 1M67A 2Q4DA 4RETA 3M2PA 4AO7A 1RBMA 2OZKA 3NBXX 1C1XB 1Y7PA 4JFAA 1OI2A 3JASA 1HNXB 4A36A 1MENA 1QTRA 1HE2A 4CQMB 1G5IA 4FOOA 2X9LA 2D2IA 4BO9A 1IPEA 1JYSA 1XKTA 4CPDA 1LUAA 3RYFB 1XVTA 1A95A 1K97A 5E7JA 2DR0A 2DPHA 2DQKA 2G36A 2VH1A 4QKQA 3IDOA 1O89A 3TAXA 3ZKAA 4B31A 4Q9HA 5I4BA 4YRPA 4EFNA 4IBOA 2IV3A 3IPRA 1TO2E 4OXNA 2Q3MA 3T15A 3OIGA 3B1XA 2C94A 3VJLA 2R5NA 2QX4A 5JSHA 4XJVA 2REXB 3SYNA 2VRCD 3CLHA 1M7GA 1NBMD 2WBLC 1O94D 1ODCA 4DC0A 1OPXA 2IYTA 2P2GA 4PZEA 5DHQA 4UATA 5KI6A 4D8YA 5HM6A 1YVPA 3P2OA 1JHMA 3TDNA 2DWOA 1F4VA 2A2ZA 3D3WB 5DGDA 2I6QA 1NMXA 3WLPA 3VC1A 4QM6A 1FS4A 4FCTA 4C1BA 4CMBA 1RD4A 4CNBA 1P19A 1SUWA 4ZQBA 5BYBA 3JD0A 3PT9A 2CVHA 1XTJA 4RVNA 3N53A 3TAHA 2ZM5A 4P86A 4OUDA 5F7JA 2Z08A 4KTTE 3K9QO 2GK6A 2HDNB 2DULA 2QMEA 4CM9A 3JQRA 4QDJA 1KIFA 1W4LA 2X13A 3H2IA 3V7YA 4C05A 1V37A 4HOYA 5G3ZA 2IOFA 4R84A 3KEFA 1Y4UA 3ASUA 2DAPA 2AOVA 2IXAA 1WWKA 2P77A 4RL4A 4X0EA 3TRFA 1UWVA 3IJRA 3AHFA 2C2OA 4UHDA 2I6SA 2BUCA 2WIGA 3IUJA 4FI3C 1LU9A 4I9UA 3WLNA 5ADVA 4OHRA 1T0PA 4JVOA 5T3YA 1Z12A 4EELA 4EQ6B 2FZWA 1SRRA 2WYIA 2EFDB 2WSBA 3CCFA 1Z8NA 1A50B 2CE7A 2EDAA 2QL9A 3HFGA 3G5UA 5BQPA 4X44A 2KWIA 3TUJC 2WWWA 4WZ6A 4CL3A 2CZCA 2E21A 3EQZA 2ZWAA 5IVKA 3DGFC 4YPOA 2UXDB 3ELDA 3ZD8A 1ZVKA 3R3VA 1D7AA 5ESDA 1JFFA 3ROGA 4CUZA 1V16B 3C1TA 5F78A 4LMBA 4Q4HA 3IUBA 5LXTF 3INRA 1Q12A 2BAGA 3I30X 4OLHA 1IPHA 2QTCA 3PGA1 1E20A 2IL1A 1BFUA 4KLAA 4PZPA 4DR1B 1MC1A 2HBQA 2OR3A 2CXRA 3DBHB 4WFJA 4WJLA 1NIPA 1NAHA 1P45A 1PSWA 2R5WA 3EVDA 5BMOA 3GT7A 1NOKA 4R1QA 1FX0B 2WAMA 3OCYA 3GJ4A 4D4LA 3L1IA 3B9BA 1C2YA 2X14A 2HJSA 2W0SA 4JLOA 1GU7A 2AJCA 1E8MA 4XGRA 3PLAE 1U3WA 2WHPB 2Q5IA 2DCUA 1UPBA 2ILVA 1IZ9A 2VQSA 1R1DA 2VYVA 4IS3A 5IDWA 1DAMA 3QPDA 4FI3F 4B81A 1OH6A 4RENA 5JBQA 3NO4A 2PX4A 3DNMA 3EMDA 2Y6VA 4Q3CA 3VKFA 3DOEA 4ZK2A 3WQRA 4RYDA 4BC1A 3RKUA 1FBTA 2HSDA 4J4BA 2YJ6A 4U7TB 4IDHA 2XXJA 1PGOA 4BN0A 2VPTA 4A3SA 5INTA 1JHOA 1GQOA 3G2MA 1T6ZA 2CCKA 2D13A 4LCBA 4DCOA 1ZBDA 2AN9A 4PLTA 3D6HA 1USGA 2JLAA 2Q9BA 1M1YB 3NTRA 4H6WA 4BNDA 2G76A 3NVDA 1B8OA 1U3DA 4U2FA 2FJ0A 1N0WA 3QWFA 3KVYA 4MUFA 4X97A 4B3IA 5C7LO 1QE5A 4MEAA 3G0CA 1NZJA 1UMCA 2PD4A 2IBSA 4M9CA 1J8VA 3ICPA 2VPZA 5ITSA 2PUHA 3CBQA 1GRNA 2QM8A 4FZ5A 1FL9A 2XXBA 2XWPA 4ND8A 2CJXA 4CMGA 3C6MA 3ZWCA 4XSGA 1H4SA 2Q99A 1MR3F 3WKAA 2QRQA 2VDKB 1Q19A 3P94A 2G0TA 5HIAA 3PX3A 2QUKA 3CF0A 4JYCA 5COBA 2WEKA 3K1TA 5CT6A 2QI9C 1GQYA 4PQEA 1U7TA 1NMSA 3CRVA 2PZ8A 3P9SA 2VWHA 4F3CA 4HDNA 1ZGAA 3R0XA 1BDIA 3AWIA 2WSLA 4KK4A 4JHLA 4X1KB 1NW5A 1OLUA 3B78A 3GG2A 4KH1A 4XD7A 4MJXA 4QJ5A 2P4HX 3R44A 1OBHA 1BAPA 4DKJA 1OX4B 2E18A 3K6KA 3OFKA 1XMJA 1UOQA 3ZW9A 2OM6A 3RUPA 5FPPA 3R9XB 1ZD4A 3C97A 3D4BA 4B6GA 1NW9B 4TSFA 2J7KA 4KVFA 5LLDA 4RCZA 4HY3A 3WYEA 1KJIA 4OHXA 3PFNA 3OOHA 4HQNA 4NCJA 3ABQB 2PH1A 5IAKA 4AY2A 1VJDA 2IT1A 2I99A 3GGPA 2D4AA 1W96A 4KWEA 1BCRA 3W2IA 3JASB 2WWYA 1T9BA 4YCNA 3OCJA 5J9FA 1ULZA 4LWOA 3EH2A 5ESWA 5CTJA 2NSJA 5LBTA 3QVSA 1C7RA 2CDBA 2Q28A 2WFAA 3MTAA 4AKSA 4P93A 5FPYA 1J2RA 4QXRA 3WP1B 5JS8A 1AS0A 1IB6A 3V2IA 4AD8A 3VHRA 1LC3A 4YCBA 3RFTA 4KN9S 1F2VA 4B3MB 2R85A 4ROSA 2QI9F 4OQMA 3DA8A 4HGOA 4YT8A 3WSTA 4BMYA 2BR3A 3PF9A 1U7XA 3FMVA 3DLHA 1NHGA 2PSJA 3OMWA 3FJOA 2ZVPX 3AW8A 1MC8A 1PR6A 4RF5A 4XDYA 1GT6A 3HI4A 1EVZA 2ODTX 4EHDA 3SU8A 1E99A 4PX5A 1ZGGA 2Y76A 2O0LA 3URKA 1ZXBA 5CVEA 2QTZA 2HU5A 1PGJA 1T2UA 3ND9A 2QUHA 4CDNA 3TN7A 4MEBA 1UJ5A 4ILKA 5B64A 3PFBA 4IOMA 5C80A 2GLUA 4Y2YA 2DUUA 2XMBA 3V4OA 5B1YA 3R77A 5E2AA 2QXYA 1XB2A 5KNCH 4I1UA 1LSSA 4TQGA 2C9ZA 2ONKA 1BCSA 1UBLS 1JT9A 2E3JA 4OUDB 5J2TF 1YVEI 3HH8A 4QUHA 1UDWA 5A2QA 1TEVA 4LE0A 1Z35A 2VHXA 2O0JA 2YQ4A 3HCFA 4ASUA 3GLFA 1L4NA 3WNCA 3IHWA 3ZHYA 4BGIA 1CEQA 1B6GA 3CEPB 1JA9A 3HDQA 4RPGA 4EEZA 3AV0B 5KZMB 1TQ8A 4ZQEA 5AM1A 1OKKD 4YO7A 3CN7A 3EWAA 4QTYA 1KAGA 3AVTA 3KHKA 4TVKA 5AKHA 3RIEA 2CNNA 4WHMA 1AK1A 1GWNA 2HUNA 1RP1A 4TRMA 3IEPA 3W6PA 3BREA 2RJOA 2JG3A 3AHHA 2FGJA 1Z0IA 1QFZA 3LBFA 5A4KA 3HJBA 2R00A 2V55B 1K92A 2NPIA 1U0NA 3NXKA 1FP2A 1VL2A 1E60A 4LF5B 1JN0A 1N2BA 3I0NA 1SQSA 5KNBH 4BP9A 2CLDX 5HM8A 5KDLA 3A8TA 1NVGA 1D2CA 2I7CA 1VBNA 2V65A 2EGHA 1J0BA 1E0JA 2H5JA 3IP8A 4Q7LA 3U40A 1JFFB 2Q5EA 3A4TA 4HNAA 4Q4HB 3GHYA 5HFAA 1K08A 3ROZA 3OOJA 3RRMA 2GRUA 5IT4A 1JDZA 1N2JA 3RG8A 1QO0D 3FCYA 4JASB 3ZU2A 3QVVA 1ZICA 2XOEA 2DKNA 4HWOA 1A9TA 2CUZA 4B6OA 4B3RB 1IN8A 3SFZA 1VMAA 2PFKA 3VM6A 4C89A 1QHNA 4EJ2A 4JENA 4QAQA 3RC7A 3ID6C 3L8HA 3LBAA 4LHZA 4URFA 4W63A 4MGKR 1E2BA 2IITA 3X1JA 2PWYA 2JZOA 4IJVA 4MW5A 5AI0A 4N5DA 3BUSA 4OYRA 3ICEA 16PKA 4L4XA 1VJGA 4J1QA 5KTTA 3AEKB 3H2ZA 3PHLA 4DBZA 1SEPA 4DPLA 4EHNA 2AUMA 5KDOA 3FDZA 3NPMA 4LWQA 1QNLA 4MYRA 3CLRC 4MVJD 4AP6A 4B3CA 3HKBB 3WQSB 1I7SB 2K87A 2GVZC 4YRBA 2GN6A 1ORWA 3NHBA 1EFCA 1PJSA 3WISA 5JJIA 1NNSA 1FFXA 3TW8A 5FUMA 2DGDA 3KELA 2MYPA 1P61B 2HXGA 2VSFA 3L6CA 3ZV4A 2ATEA 2ZAIA 1Z6YA 2VP2A 1QK3A 3ESCA 4J1SA 4XA8A 5DTMA 5E6UA 1QYVA 3EYAA 5ESRA 1B4DA 1C7ZA 2VBFA 3D5QA 5E2BA 2YRFA 1G98A 1ZQ9A 3PK0A 3X2FA 1PZXA 4LV8B 4C06A 3ZJUA 2PX6A 2I0FA 3C6BA 1UMCB 1PT8A 3AR7A 2WF6A 4DYDA 3AY3A 3AOEC 1V5IA 3G2LA 4UDNA 1SHZA 4ND8B 4ZRDA 3KLNA 2CWDA 2PT5A 1H2HA 2YIVX 3BXPA 3CF4A 4NCAA 2FPLA 2OORC 2H1IA 4M89A 3UV7A 2OOSA 4PONA 2CXSA 2ZGVA 5B2FA 1R5OA 3T5CA 2XUZA 3RU3A 2PDAA 3Q8WA 3B9PA 3PL1A 3WWZA 4A0QA 3LA8A 4CF6A 4CM3A 2UZ3A 2XQKA 1C1DA 3PE4A 2PSFA 1DKUA 4RSHA 1KEZA 1HG1A 1SR8A 3NYQA 2XBLA 4D41A 2REOA 3QWAA 1Y1QA 4M1WA 1OLUB 5C81A 2M6RA 1S8NA 3Q1LA 4I5DA 4ZT6A 4PNPA 3IKLA 3B2EA 4OMCA 1Q0UA 2GSDA 1U63A 2EAUA 3R3WA 4YMSA 3S8EA 2FQ1A 2K2WA 3GEDA 2J3LA 3JWEA 3M70A 4UPVA 2W2LD 3L6EA 3V42A 1KI6A 5IFLA 3DEJA 2F6RA 2YH2A 4X7RA 1WPGA 3DE0X 5HBRA 4ME6A 2DH5A 2RKWA 2P69A 4GLLA 5GQSA 2PV0A 4AMYA 4EP1A 3BWXA 3J81A 3LPCA 1FS6A 4QBHA 2RFLA 4C03A 3HCBA 3T7JA 3AK4A 1TMKA 2FSSA 3TE7A 2VC2B 5AIAA 2R4QA 2P65A 3DCYA 1ESDA 3VX4A 4DSTA 3P52A 5M2QA 2I91A 1QC5B 4AKHA 3P0IA 4TLMB 2AKYA 3AB7A 3CUKA 1NR1A 4GBMA 2NSDA 4L9WA 5LYJB 4EG8A 2G07A 2XVZA 4PWZA 1DXQA 2FW6A 3IOCA 3LCJA 4NAHA 3UJ8A 4BWYA 5AVYA 2XNHA 1RQ7A 1SK9A 1XZIA 4LXIA 3VR6D 2UAGA 3RFFA 4E13A 2IEAA 3LJKA 5HTKA 1Q1GA 2J7PA 5E95A 4K3VA 5D2CA 3TTUA 2BHSA 4JC8A 4L4UA 4E4YA 5DCYA 4LNAA 4XH9B 3UJBA 1OXSC 2RGDA 5KAPA 3WNDA 4XW2A 4RACA 3LUPA 5EIBC 3TTWA 4EF4A 1LTHR 1R5BA 4BPBA 2QN9A 4M1YA 2NT4A 2VOEA 1X14A 5DHRA 3FGOA 3KEOA 3AP3A 1WW8A 4HZUA 3ZZNA 4N3AA 3T95A 1BSVA 5LN1A 5ALXA 5CLFA 1BCSB 2V1XA 3G49A 2ZLBA 1Q0QA 2B98A 2NO4A 1E2UA 2HA7A 1QGOA 2I29A 3EULA 4FSXA 5M34A 5JEDA 3WYDA 4LF7B 4M9RA 4C7KA 1YJCA 3HDTA 3GLFB 3QLUA 5ELXA 2XDAA 3LPDA 3LYHA 2PZGA 4N8SA 4F5EA 4US0R 3R9KA 1JECA 1VM6A 1ZK2A 1LS6A 4XJTA 1IN1A 3V8EA 7ADHA 4PCAA 3L5KA 2JGEA 3FYCA 1VRWA 4KE9A 2PJUA 4N47A 1FZQA 4CN9A 1MPXA 2D5AA 5JW6A 1LB1B 1OH5A 2F7SA 1L8AA 2P35A 2OUKA 3BFXA 3OJCA 4R41A 1X1TA 2JCYA 2PCLA 4ONEA 1JTVA 1VL5A 3U1VA 5JDIA 1U2RA 3HB7A 5D86A 5LYJF 4RADA 3UMFA 5LZ5A 1ZKDA 2BHRA 5DTEA 3MNFA 1X86B 5BWLA 3VR0A 4KYTA 5BR4A 1G64A 3HB9A 3R09A 1I5OA 3ANLA 4PX3A 1KJ9A 5AKJA 4UNPA 5TGDA 4CUKA 2O2ZA 2I2AA 3ZQJA 3NEYA 3GCWA 2PRYA 1FXUA 3K0EA 1F0KA 3JQFA 1UFRA 2E85A 2GFHA 1YL7A 1Y5RA 3IESA 2A86A 3KCNA 4JOQA 4KJXA 4ZALA 4OI2A 1XRNA 1L4GA 3TQFA 1LJ8A 3UW1A 4MWGA 5G0WA 3CXUA 3FDFA 2JGFA 3GH1A 3VOBA 1U31A 1DEHA 2BRUA 3CIOA 3OEHD 3HBAA 3HGTA 5C31A 3BULA 3UG6A 2WAAA 3TLYA 3FUVA 3I2JA 4JBHA 3TCXB 3H04A 4BLQA 1ZO8A 3GIDA 4URUR 1ANKA 5JCXA 2WZQA 3L18A 4IZOA 4UUAA 1P8AA 1T4BA 1TYAE 1THMA 2QRNA 1MOPA 3U4AA 5EJ7A 4FDAA 1HDCA 3D8HA 4RXUA 5DWVA 1SC4A 3UB2A 1SVWA 1DC5A 4XCQA 2Q5OA 1RXYA 1LI4A 2OFXA 1XU7A 4FCVA 3FDZB 3ZWOA 1UANA 1TZCA 2D06A 3GPLA 4ZCLA 1OY1A 1UH5A 5AM3A 4UCXA 3UG7A 4OI0A 2O9JA 2WUVA 3KJQA 3TW8B 5AHRA 4CKBA 1XNQB 4LV6A 5DI9A 3IELA 2DWUA 1A98A 1NVKA 4QQ8A 4BMDA 3IXMA 1DJOA 1RJFA 2FWIA 3L8EA 4MO2A 1AZLA 5TT0A 4F97A 4N8DA 4PG8A 2WSYB 1SXJE 3H19A 4MQ6A 4PNHA 5JD4A 3LVBA 4PFQA 2JD2A 2F9MA 4NYIR 2YWRA 2P2NA 1PR0A 3LZDA 1ST2A 1H8HD 2E0IA 3N74A 4CT0A 1ONBA 4JP1A 3SE7A 2VT6A 1ICEA 2X6RA 5EJ5A 1WXGA 5K0CA 4L0DA 1CU1A 1ADBA 3HZHA 3SXPA 4ZXFA 2YJGA 3RNOA 1JPNA 3HUFA 4WASA 5BP7A 1H0HA 3FPEA 2ZK7A 4IOLA 4JP2A 5ALGA 1E9RA 1AQ6A 4W8OA 5K4HA 3L01A 3PSHA 5DVZA 3TQRA 1PR5A 4KLCA 1P29A 4XASA 1C1DB 3WHPA 1RKUA 5JADA 1KOJA 1NHWA 2CNWA 1XZEA 3E9MA 4WH0A 1VFNA 3NW9A 4AZTA 4FCCA 2HO5A 3H86A 1FTNA 4KLRA 4K6MA 3T7AA 5JAMA 5F9FA 3GO4A 3GZTB 5EERA 3T94A 3OPYI 1V47A 4ITRC 4P34A 3V4FA 2H0QA 4F4JA 1CRPA 2CFOA 1CBUA 1SKAA 2EG9A 3NHRA 1KI6B 2VVTA 3PNOA 4JHXA 3TM4A 4YRSA 5HOQA 5LXTA 1A5BB 5AW8A 5G53C 5DJ5A 1GPH1 3GZ4A 2CHGA 2EZ8A 5AKGA 1CX9B 1NP7A 3LDHA 1BWSA 3T52A 3GFPA 4OREX 2FUG6 2BBOA 2GFQA 1P7PA 5FA6A 1YB7A 3LGAA 4KYIB 5CVTA 1MBZA 5TLSA 3SE0A 2GAOA 1ZJ5A 3T1YB 1NC1A 1QFXA 3QENA 4I5EA 4Z0TA 3T3EA 4Y2QA 4FFDA 4IHAA 4UMEA 2C5FA 1HGXA 3H11B 1YQUA 3FFBA 1XA4A 2GBFA 4JKIA 5LWQA 2QDXA 1HFJA 4KODA 4BMVA 2Z2IA 1RI1A 1FTWA 3NKLA 2ATVA 3N2KA 3QXGA 4ZEVA 4ETNA 2XCTB 3PG5A 3PVCA 2ENUA 2W2KA 1U94A 2IS6A 1QV6A 4JOCA 2G4LA 5LIPA 4N0EA 1ZU5A 1ITZA 3D7MA 4JK3A 1KAMA 4V0KA 5LU8A 5I9SA 4JI0B 721PA 2XF8A 3MJTA 4QXOA 5CRIA 2EQ5A 4NOKA 1BNCA 1GYRA 3QV2A 4WFQA 4G67A 4NOLA 3TX6A 4Z51A 3ESAA 3D7RA 1RBZA 3H13A 5E6RA 2Q4EA 4BV9A 3CNEA 3DYIA 3E70C 1YS9A 3KTDA 4HZUB 2B1IA 3C3YA 3L0BA 2ZYAA 2BEJA 3HUEA 4AM8A 3RJMA 1UDAA 2O2GA 2WVJA 4MLCA 2NP6A 2ARKA 1Q14A 2BELA 3FWKA 1FTSA 3GNLA 3HFJA 2O8EA 5FLKA 3AJRA 3HYCA 1CV2A 1HQKA 4FZRA 3LUKA 4KIGA 1YQ9A 1QU2A 3CR8A 3B6KA 3CYFA 5DYWA 1T1RA 3TD2A 1E7YA 5IH7A 1EFKA 3CB4A 1O5OA 1VRVA 4XKJA 3L7KA 1Y5MA 2O2IA 3Q5EA 4RTQA 2PJZA 4GM1A 4QOJA 3V8QA 1YRLA 2K2QB 3LHSA 2EZUA 2H2AA 5CURA 1MEJA 1JHAA 1YXMA 2ISCA 2WQ6A 2BTEA 5KC9A 2QM0A 3JS5A 5IJXA 3CX7A 3D0RA 3T5BA 4AJPA 3ZDDA 1VKRA 2O3RA 1B2LA 3O7MA 4EGFA 2GXAA 2BGIA 2F17A 2HQOA 2XDQA 2NAFA 4Q00A 4HFMA 4XR9A 5EXDA 3WYAA 3I2HA 3PCXA 2IEBA 4R2MA 1XDUA 3OCXA 3TLGA 4RPCA 5TQ2A 4MW4A 2C2KA 2WIKA 2VYCA 2X0JA 3LZCA 5IT0A 3GVIA 1NXSA 3AIKA 5JDCC 4O2RA 2H7VA 4FFLA 1NBAA 4G1VA 1PL8A 2F9LA 8MHTA 2YZ7A 4ZCPA 2XA9A 4CCAA 1KAQA 2QR5A 3CO0S 5HE8A 4G23A 3PIDA 3F6BX 1H2WA 1JKMA 1DUIA 3AFOA 4HXGA 3UQYS 5JSYA 4CF3A 4DV7B 4DRYA 2LKDA 3AJ9A 4F3RA 5JH7F 1AN0A 1POXA 1QYWA 3BJMA 2G0AA 1CHDA 2PUAA 2CL7X 1VPLA 5IJ0A 4CF7A 2B94A 2EHJA 2ZI7A 4OU4A 2W37A 1EP9A 5EINA 4JB3A 4QU8A 2ONJA 4UU7A 1ZIOA 3UK2A 1QHIA 5EJEA 5HQTA 1U3TA 5J58A 1G5FA 1ZSNA 4C0JA 4MQMA 3QK7A 1W52X 2ZRMA 2QWXA 5CGQB 5TF4A 3N8IA 4PLHA 1QP7A 4KNYA 2HV9A 4ODIA 2R8ZA 4B74A 5ALJA 4HH0A 4HLCA 2WTMA 4YBZA 2JDID 3IKTA 5LMCA 3PNBA 1NFQA 3D6MA 3FTFA 4O1MA 4ZK6A 4Q24A 4FGSA 4LYYA 4AX8A 3SEAA 5I7WA 4JGIA 1Q91A 3ILHA 3T7DA 2PUWA 4TV9F 1ZSVA 3RR2A 3E1SA 2SKEA 3UOAB 5JYEA 1S8AA 4LBYA 2V0GA 4RK4A 3NYIA 1PG2A 3HFRA 4R5MA 3QHAA 2J0QA 1VKJA 2CZQA 5LMNB 5ALVA 4U7JA 4RMHA 3QVKA 1XQYA 3F3KA 5AJWA 4D9BA 1KTVA 1DIOB 5CVUA 3RYCA 2QAJA 3HUDA 2DF8A 1M8GA 3IVAA 3Q85A 3DE7X 4DLUA 4KYUA 4ZIRA 1BMFA 1NL3A 3DP9A 4QYSA 5E3HA 4D8VA 2JLWA 4TYWA 1XC7A 3HJTA 1DLIA 5JRZA 2XVAA 3IVCA 3VPBA 1NQ5A 3F8SA 3MCTA 2GXSA 5JCOC 2IYLD 3R3YA 1H1DA 5LZ4A 3IUQA 1QP4A 4BECA 1AZTA 2ZTHA 1UEIA 4OSOA 3KALA 3PNPA 1KMCA 4OB6A 3U9TA 1I4DD 2WKRA 3DL7A 3N6RA 4E6EA 2JHCA 2YBDA 5FFMA 3ZDXB 3TLMA 4DLWA 1KJYA 1PRYA 4I2NA 1WKVA 3CH5A 2P3OA 3ZH2A 4F9FA 2WWTA 3D8NA 1ZMOA 4B35A 4B33A 1HL3A 3PEEA 4MUKA 4WAUA 4K3UA 3SC4A 4G63A 3RHSA 2DHCA 4HDQB 1AO0A 3HO6A 2GTPA 5HIIA 3U5TA 3KPYA 3T3DA 2DR2A 5TB5A 3SM3A 4QWWA 3U44A 3EMKA 4V0SA 1D6MA 1BS1A 4OGKA 1Z7EA 1NJ5A 2LIPA 3QQPA 4JQSA 3EBLA 4GYJA 3WL5A 1FQWA 1N32B 4UAGA 3ASYA 1SIUA 3B8EA 4JB0A 1T9CA 1Y5NA 2JFGA 1DXYA 1L7PA 1UDCA 4L8GA 4R9VA 1NYQA 4K2HA 1R5NA 3PWKA 3O4JA 2OYSA 1V39A 3HG7A 1J99A 4GMKA 1GA4A 1JR2A 3DDZX 3RT1A 1DCKA 1LPSA 5HX7A 4BE9A 2BKUA 5K0ZA 4H4EA 2ORWA 1LK7A 2PXHA 3EE6A 3N2KB 3BX1A 3P0EA 4UUNA 1GDDA 2C99A 3TIVA 3QKTA 5BV7A 2FEXA 4UHKA 1I3MA 2FUCA 1R18A 4N48A 3FBTA 2VA8A 2AUTA 5IVHA 3IBGA 4YAOA 2W2KB 3FLBA 4Q9KA 1E4EA 3TVYA 4DMCA 5A4DA 3C7CB 2Z04A 1YIDA 4YUYA 1GILA 2RGAA 1Y4SA 4IDBA 2PD6A 4EHJA 1DDOA 2VI5A 1R6VA 3GLKA 4UNRA 1IJEA 5BR7A 1LDNA 2BKLA 1RWKA 3V1YA 1QIIA 3W1EA 5E6RB 3M4YA 2ZBRA 2B8WA 3SJZA 1UJ6A 4QNRA 3A1UA 1M73E 4D79A 4MGZR 4DCTA 3OLVA 4LECA 5DXAA 1MOQA 3EGVA 2ZBEA 4OHBA 3FTCA 1BFDA 3Q9LA 2KX7A 4QHTA 4XTRA 3SDSA 2X2EA 4GKKB 3ZX5A 2O8EB 3SWWA 4R51A 3VYTB 5IJ9B 3SC2A 1SK8A 3V4PB 5MN4A 2OGUA 4NX2A 3DH0A 3BFJA 4BLTA 3QITA 3UF0A 2C92A 2J5KA 1Z2OX 3L8CA 4FYIA 1M8PA 1RBYA 1RZRA 1Z7BA 3ZVRA 3V9PA 4C3UA 5I8WA 4EYGA 3IE2A 2C3PA 3L06A 3PFWO 2CLCX 4GMGA 4KN6A 5HCIA 4DLBA 2IKSA 2Q6TA 4CTMA 1O6GA 3Q88A 3W2HA 5C5DA 3C8DA 4RELA 2YUIA 3E1KA 3I8OA 2FUKA 2Z9BA 1XCJA 3GLGA 1CUVA 1CZOA 1XF1A 3RODA 4AAYA 1XXLA 5LLTA 5DP2A 4HD8A 1ZK4A 3KHTA 1T2CA 1E2JA 2QU7A 2J30A 1SU7A 2EKBA 1FSZA 2XDQB 2E82A 4TQAA 2YXLA 2X8JA 4QUIA 5LQJA 3TLGB 3CF6R 1IY2A 2HU2A 3AIMA 5TQ2B 2WU1A 3TGWA 4C1NA 3T7CA 1WZUA 1OFHA 2H1LA 4BNFA 1KK2A 3ROKA 4PYOA 4GX2A 3DE3X 4EABA 1TO6A 1M3SA 3B3AA 2Q5QA 2NO7A 3BDAA 4GPTA 3RTDA 3WOHA 5CNIA 3CZPA 2B92A 3WLIA 1YAHA 1WUKS 2WF8A 4I50A 4A5SA 4AN4A 3ICVA 3L6OO 3A4YA 2JJ1D 4IIGA 3U4MA 3BSYA 5CGZA 3GFFA 5SY9A 1QPGA 5DDIP 2YXPX 3W4IA 1SVLA 3HEAA 3KUUA 1CP3A 4NU6A 1AA6A 5HJ2A 3WLRA 3ISJA 4MS3A 3AOEA 3U49A 1IZZA 4M0KA 3TW6A 1RLTA 5IJ0B 4P4GA 4URVR 1NAIA 1PZMA 2WWGA 1OQAA 3WY9A 1DRWA 4ZCSA 1VPDA 1XDGA 2OORA 3DV9A 3I23A 4JXZA 4EPWA 1X8JA 3AX6A 2FWJA 4G0QA 1EUQA 4G0WA 5LNK1 1VGRA 1N25A 1T5DX 2IUEA 3VR3A 2CSXA 4UE3S 4L85A 1GSIA 3BJIC 3IMKA 5BNWA 1IN7A 4U63A 5CLHA 2BFFB 1G8MA 1E77A 2DY0A 1G8PA 2BH9A 3KJEA 3R3HA 4C3VA 3A1CA 2VEOA 1JHVA 2CNKA 3GN2A 3KC2A 1A9YA 1KP9A 1RYZA 2O2SA 4EGJA 1ZGCA 3NRCA 3DZ8A 4WK2B 2O3UA 4R2JA 2QIOA 3E3LA 1RVV1 1V45E 3STUA 4NBWA 4ZVQA 1A9XA 3MCUA 4OP2A 4H4CA 2ZJBA 3AYXB 4CKZA 5ITWA 5J2TB 5B1SA 4Y2VA 2H2WA 3RYCB 1LZLA 3GWGA 4H08A 1OZ0A 4B6QA 1VMKA 1I3LA 1NR7A 2BEUA 3SYKA 4GG1A 3E9CA 3A4NA 1RM4A 1VCNA 2WJPA 4KGVA 1PQPA 3IVXA 1HEYA 3KJFA 4ESVA 4TT8A 4UHCA 1TMYA 2JBAA 3F90A 1IBCA 3I2KA 4UDOA 2WJAA 4DMUB 1IXZA 1HA3A 5FA5A 4D8WA 4E32A 2P3LA 3C3EA 1VIDA 3WGHA 4HVAA 4MX8A 2Q1UA 2G9ZA 3O8BA 4CF5A 4OBWA 4DCJA 5EJ6A 2MTBA 5J23A 1AV7A 2A30A 2XMSA 3ETJA 2P5YA 3PFFA 5CBKA 4KQCA 1NQTA 4YA6A 1RRPA 3RVQA 4LEIA 3IQDB 5ADWA 5LJIA 1U0GA 5J3JA 1DDGA 1E2FA 2J41A 1YMQA 2P67A 3GJTA 4BVAA 1L5YA 3GBPA 4PZ9A 3U44B 2UYQA 4NCNA 4EZBA 3BPSA 1Z75A 1FU4A 1KR2A 4L51A 4YWHA 4ZGWA 3R5JA 3SEQA 2ERYA 2FX2A 4RK6A 3AL0C 1A2QA 4B3XA 1IVYA 2PSSA 1YZ3A 3UAZA 1WIWA 3IQXA 3AZQA 4I55F 3T7EA 2IGTA 2Q9UA 2GYVA 4TMTA 3IP6A 5BQOA 1T4CB 4Y98A 1Q0TA 4WSOA 1HKUA 5CEJA 1UJ2A 4Q19A 2Q1TA 5IAEA 2FVXA 4TSKA 3H83A 4E51A 2TECE 1ZXXA 3F9RA 1O95C 1X70A 4TV8F 4E4RA 2QMOA 3M1LA 4RHYA 2OXCA 1QGZA 3QBDA 1JSLA 3NT2A 3UAXA 4R31A 2ENWA 2JA1A 2JCSA 1NI4A 2YJ5A 2YRWA 3K8YA 5CX1A 5EXSA 2XOXA 1KMNA 2P2DA 2X7XA 3R76A 2Y71A 4C2TA 3G5LA 2NZ2A 3WYBA 1A2KC 1NXVA 2CBXA 4KXNA 1QTQA 2ACKA 3BK1A 3C8UA 3TJMA 3A7EA 5IX8A 1A9RA 5J4YA 5JFGA 1A2OA 3EFHA 2FPRA 1BE6A 4R3UC 2BMWA 2C97A 3EG9A 2C4MA 2VDJA 1A96A 3DOHA 3I12A 5KQSA 1D1QA 2I3GA 3A9UA 3IQHX 2VJDA 2ZI3A 1KJJA 2OYCA 3VTKA 3AHIA 2L17A 1VB5A 4J3JA 4TS3A 5CNMA 5TY0A 3MF4A 3ZE8A 5KSYA 1G2IA 4NR0A 4Q3BA 1FYVA 5AVUA 2X7HA 1IU9A 4DTIA 4F11A 3ORRA 4BBPA 1N6KA 2WUEA 4RFSA 2XE4A 4EKYA 1TK3A 3O1HB 1VP3A 3JQ8A 3WK6A 4B4UA 3F6CA 1P33A 2F1HA 2CMHA 2OCXA 4FEEA 4ID9A 4EEKA 1SD2A 1Z4MA 3JVEA 3QKRA 4WMLA 1YRHA 3DMRA 3LCUA 1V1MA 2IUUA 3EFBA 4UVEA 2EC5A 4QPJC 3CZMA 2GYYA 2F55A 1WX1A 1L7AA 2XBMA 5BRAA 5JRJA 4CM7A 3ZQUA 1EG2A 3KYCA 2GJ9A 1F48A 1ZUD1 4CM9D 3D0QA 5ICEA 4N76A 4I1OA 4BZQA 2HHJA 4B5KA 3G85A 3IQIX 2R7NA 1Y98A 2Z95A 3MFYA 3ENQA 3Q72A 4RXTA 5EWLA 4C3ZA 4PXAA 5ALDA 2QUAA 4Y2RA 3T4XA 5A0TA 4LF6B 1QCZA 6REQA 4ZTZB 4RHTA 3M4ZA 5FI5A 3NVMB 1I5RA 4F2PA 3TMAA 1AUQA 2ZSJA 1E1RA 2PH7A 3U48A 2D7DA 1YB6A 2FK7A 4N0PA 3TXYA 4DL9A 13PKA 1BMQA 1OZAA 4TM7A 3UN1A 3UMSA 1Q22A 1TOAA 5KJ6A 3ETNA 1YS6A 1VOTA 3OZ7A 4JP8A 4QUKA 3OE7A 3N0RA 3SQMA 3WNZA 3H9BA 3L5OA 5JNWA 3LDAA 3O4HA 3TO5A 1KAEA 5JJBA 3QE9Y 2BSQA 4MS3B 1SIWA 1TX4B 2DJ5A 2Q6KA 3OP4A 1F60A 3F67A 2HFJA 3MCZA 5F12A 2F67A 4RSMA 1QHEA 5LCXA 2VDVE 4UPDA 3AV3A 3GRFA 1ECCA 5DWDA 1OB5A 4FGUA 1L6RA 1Q7CA 3KJNA 3N2LA 4H7FA 4DA8A 1FMFA 2HF7A 1QVWA 4PG6A 1H9BA 1RABA 2QLLA 3ZD9A 3JQ7A 1VHWA 1F17A 4UCQA 4YR9A 3KFVA 5CXSA 5CFNA 2G9RA 3B6EA 2B30A 1Y3DE 3NBKA 3NHYA 3BRQA 4W1SA 3WG9A 1WOMA 1E2IA 2PRJA 2PUEA 1O6BA 3ZR4B 3WLLA 2NVOA 4CG3A 3JQGA 1WHSA 1SBHA 3LU1A 1QIFA 2W70A 1SAYA 4B2LA 6GPBA 5F5LA 2I4RA 2VYVD 4HAIA 3DOFA 4D9KA 5IEJA 3UGQA 2C7GA 3KXPA 2O59A 1A9XB 3C1AA 4S35A 1QS0A 2VNIA 3VR4H 2A9FA 2AR9A 1N3YA 2RC6A 3N2GB 2PX2A 4OJNA 4Q3EA 4RUKA 1GGMA 5F23A 2FR0A 4JROA 4BVLA 4CV0A 3IOBA 2BEUB 3VUFA 2GZMA 1UT8A 4LC9A 4J7XA 3NNNA 3GL9A 1A9SA 3EJ6A 5DW0A 4AO6A 4OGGA 4CTOA 5ICCA 1C8LA 1Y9JA 2GEKA 2C5HA 4NYIQ 4G6ZA 4RPIA 1XMVA 2JBAB 2ZBPA 4Y2JA 5GV8A 5HCUA 5BSVA 3DXZA 2J4DA 3ADDA 1B41A 1J97A 2D5BA 2VZLA 4J7AA 4KQ6A 1RXUA 3H9QA 1BH6A 4J16A 3G2KA 1C7EA 1EDDA 2JFWA 3GBSA 4TN5A 3SK0A 3DUFB 3FPAA 1ZWKA 1A7UA 3JVVA 3IUSA 2B1RA 1SOUA 1T4MA 3HJNA 2GCIA 2WFMA 2PH3A 1U0TA 4RVHA 1T9GS 1SCDA 3CNLA 5AW9A 5JZOA 1UQRA 1XRLA 5K3EA 2FCAA 4M6WB 5GONF 4DHWA 5KJ1A 1UP4A 4MROA 2XNCA 3NG1A 1QNFA 1PNTA 4FGLA 4D9IA 5IDXA 1S9DA 5E1OA 1E2KA 2F1IA 2AK3A 3OD5A 5COQA 5KJCA 4E1AA 5F3WB 4L27A 3V97A 5L4LA 4ZXPA 3PC2A 2HLPA 1J2YA 3B6ZA 3IAS1 4J6EA 4MV3A 5JH7A 3AFMA 2R8XA 5HQJA 5L51A 5IWCA 1FUEA 2XE6A 3MS7A 3ORSA 4MCIA 4YAEA 5HDQA 4CLDA 4DZRA 1B1CA 3VPSA 2ODWA 2O8NA 3V1UA 4FXPA 3KKQA 1UOEA 1GKUB 4WGFA 3BMOA 4CL0A 3SC6A 2H48A 3IIEA 4HN2A 4P7KA 4N5MA 1Z36A 2Z5VA 3JVIA 2B8JA 4HGNA 5AKLA 2I7VA 4UM5A 1I0LA 1TCUA 2YV3A 4G84A 5D6OA 2C2WA 3X1MA 3SYLA 1AG9A 1WEHA 3ZJ5A 4CDRA 5JZSA 3U9SA 2VKTA 3H8WA 2XW6A 3OJEA 1MAWA 3CMCO 1JKXA 4BPRA 1G19A 4DREA 4WBNA 1NI4B 1E3LA 5CX1B 1JLLA 4N49A 2FW8A 2OBYA 4TV9A 1ZD3A 2V74B 2IDKA 3F4BA 3T3NA 1OZFA 4LI0A 4E6PA 5KB3A 1P0QA 4NMWA 4U2GA 3MOIA 5JDCA 2GBIA 4L4SA 1S2MA 2ECQA 1SOMA 2GPTA 2IYWA 2QW1A 3VR5A 3M5DA 5AM2A 1WCWA 2HWYA 4E7OA 3AUUA 5HMMA 4WCDA 5ICFA 2VIIA 3NIGB 5C8VA 2DZDA 3SZRA 1Q7TA 3CTMA 5FAXA 3TD6A 4DR5B 1QLHA 1YA8A 3F71A 1H3NA 2CLSA 2HBZA 4YGYA 3DLIA 3HA3A 3ZNQA 3A6ZA 1N3LA 3TOSA 3WGIA 4OFXA 4RFSB 4AZ0A 5A02A 1U1GA 4NOJA 4EI9A 2DM6A 2X22A 1JJIA 3H8SA 3KOOA 4PSDA 2XYQA 3KXDA 3BXGA 1V1MB 1S7CA 1WUJS 2I7XA 4INJA 4GI5A 2O2EA 4J07A 5TPZA 5CW2A 4X9XA 1YK1A 1CEEA 1C7IA 3PA8A 3MMPA 3DWGA 3KYCB 2QA5A 1HV8A 2CXPA 2EX0A 1DAKA 2KQUA 4DB2A 3PI7A 4DSZA 2Q2OA 9MHTA 4IHKA 1NXPA 1Z6QA 4RGVA 2HYDA 4XXHA 3TMYA 2RGBA 2PGAA 1UJNA 2Z8XA 3RS5A 1E5LA 2QUZA 1WXQA 3O75A 5BSHA 3MWEA 4TMKA 1LDMA 4YMLA 5KYWA 2AMVA 3ONVA 1OBCA 2QD5A 3BL5A 2P7IA 4U2KA 1N0VC 1RI4A 4UEQA 3I01A 5TV2A 1JFSA 2PFGA 1FY2A 1TUIA 4NAVA 2G9VA 3C3JA 2BOVA 4FDTA 4KCGA 4XZ3A 1DBSA 3V46A 4QREA 3RANA 3QLJA 4ZD6A 1SURA 2J0SA 4JVLA 5C8YF 1Z82A 2A5FA 4EUKA 4IZIA 1DJQA 2DLNA 2H63A 3VH4A 3E18A 1NJFA 5JY1A 2QOEA 4DY6A 4LDQA 4E7PA 3BEDA 3EXEA 1IHDA 1JG7A 5ARDA 2JAWA 2WM9B 4EX7A 4EUFA 4C6HA 2XUGA 3HYNA 3OD1A 1HH4A 1GPKA 4YRLA 2XUJA 4DEXA 1BRMA 2O19A 2FPOA 3JQ7B 1YB1A 4HH4A 3MLEA 2CK3A 3WRXC 2O0HA 2A84A 4FFNA 4LHYA 5AVVA 4ZI2A 1P2DA 2RI1A 5K1ZA 3RSHA 3GJYA 1IDN1 1SCAA 4A2PA 4WKPA 5K8CA 1FJHA 1PAUA 3JQGB 1WHSB 3D3JA 4M55A 2R87A 4KW7A 2VJMA 5ENDA 3FYSA 4G9BA 4UBNA 1M2WA 5BUQA 3DV2A 3QV1A 3UMRA 5JC1A 2O3TA 2VBIA 1CF4A 2GJ4A 5C3MA 4BLRA 1OILA 4Q1BA 4LXHA 4B2PA 2JASA 3H87A 1QS0B 3E81A 1RM0A 1VGQA 4YXFA 1JXOA 2VSNA 2ATIA 1EI9A 2J46A 4KRGA 3EDYA 2X23A 1H93A 4IFEA 4NU0A 4RQBA 2WABA 2YJNA 3QF4B 1CY8A 2IH2A 1B7GO 3DKIA 3I32A 4COOA 4DLZA 4KPYA 3FDXA 4EVRA 5CA1F 1QRUA 2X5KO 1X7XA 2QTWB 5LJLA 4FHCA 3T35A 2LCIA 2DUJA 2NMVA 1ZD8A 4JX9A 4TMZA 4X64B 2GWRA 4Q7JB 1Z6PA 3COYA 3ZI7A 4R1OA 1NVFA 1PU2A 3SJ7A 4V03A 4C0SA 5LQDA 4ZAFA 4OXRA 3ZDYB 4GAEA 1HZJA 2EF1A 4PBRA 4DA7A 2W2QA 2Y2VA 3L1UA 1XMQB 1IBKB 1CR2A 3EVTA 1A88A 3WBKA 5A7GA 4OSEA 3OJFA 1JR3A 2YNMC 4XQGA 3IR5A 3G2QA 2QRMA 2ZU6A 5AYVA 3TXXA 3EEYA 4RM3A 5CDFE 3ZDEA 1T3SA 1R66A 1U80A 2R86A 2IKQA 1YR8A 3CLSD 3EWIA 4XI9A 4YP7A 3V8NA 4ZEOA 1I33A 1YC2A 5IN5A 3W90A 4DBLC 2BM9A 5G40A 2VNSA 5AQ1A 4O2AF 2QGFA 3DOIA 3OQNA 5HW0A 1N5OX 1OFTA 1JIVA 1UMDA 1A97A 3JATB 3NHMA 2V97A 4RWZA 3I8SA 4RLQA 1K8RA 4BAGA 4C0AC 2AVNA 4KXYA 2KSQA 3IT2A 4BMNA 5FNZA 1UP7A 2QN3A 1SVNA 5JH7B 3R5TA 2DFVA 5T5QA 2POCA 4GLFA 3TZHA 1F6BA 1P18A 2AN1A 2H1VA 2QROA 1E1QA 1L8QA 1IBLB 3R9WA 3UJ9A 4M8LA 4AJOA 1YH3A 3BA1A 1KDVA 1U2PA 1S2LA 2J3HA 1EHCA 2AJBA 3BMOB 1RIIA 3LLSA 3V7FA 5JV5A 1RXWA 3IP9A 3PHGA 4WV3A 2JCBA 4FHFA 5EMMA 4CFYA 2ZRKA 4IR7A 1Y6ZA 3DV0A 2VTVA 4KE7A 4NJMA 4R1UA 1E59A 3HFSA 2OD9A 3KPUA 3TBFA 2IPXA 3U4GA 5CG2A 1YFLA 1MVNA 3KSBC 2WB4A 5GOZA 1GM5A 4RH3A 4X3OA 1O9BA 1P1IA 3VYVA 1KC1A 3FOEC 1F4PA 3LNCA 3BXOA 4QVGA 3KKLA 3PTAA 1WBJB 5T64A 4TV9B 3SQDA 4FYPA 1Z8DA 2I1WA 2ZRJA 3IIKA 1ZISA 5IXSA 4B8YA 1EUZA 4ZOEA 3VH1A 5KREA 1NTRA 1XROA 1U2QA 3E61A 5CT8A 5IJAA 1Q95A 2HIAA 4F60A 1NF2A 4WPGA 1YUBA 4B0PA 4NP6A 1JEJA 1KFBB 4R68A 3DAFA 5F51A 3O83A 2J3JA 3R6GA 2EZ9A 2RG7A 8ADHA 1GRQA 2EW8A 5KAMA 2ORIA 1PO7A 1Q1NA 3KQWA 1KETA 4DEVA 1AU9A 4EYOA 2AKEA 1XT6A 4UEWA 2DPGA 4D02A 2AXPA 1ZIDA 3AEUA 4PO9A 4HWGA 5TXGA 2VCEA 3AL3A 3ZW7A 1WXIA 5EXPA 3ST7A 2XI4A 2IV7A 3NC0C 1D09A 2A58A 5GJBA 4G09A 4LSMA 2D54A 2QD4A 1VECA 5C35A 3KDSE 1TA4A 1QGUA 5FB3A 2VJBA 2G9NA 5HUQA 2XITA 3I6YA 1GUYA 4HMOA 4RZHA 4XDZA 4DG5A 3RK0A 1V26A 1NW6A 2R79A 3LQ2A 1T2AA 3R41A 3CLKA 4MXDA 3H5VA 4A8JC 1L7QA 1VMDA 3IEUA 4CI9A 2AC2A 1F6DA 1WV1A 3MWEB 4FS8A 5KYWB 4LA4A 3PEWA 1FW6A 4B48A 4QPZA 1DKRA 3KSAC 2EEPA 1XO1A 4W8GA 3DMFA 2H4YA 4HVTA 2HR1A 1HE5A 2GEFA 3PXBA 3B6MA 4HO1X 2A4KA 4QJIA 1GADO 3LTEA 4R83A 4YLEA 1CFZA 3ETCA 3F96A 3I05A 4I55A 4RK5A 2ZJFA 4REQA 2W6NA 4YQEA 1SCJA 3UHFA 2B2XA 3VVCA 5BQ3A 2RKBA 3K9FC 3KKMA 2CV0A 3GFBA 3UATA 2HMTA 4UE2A 1K98A 2Q41A 3U4IA 1BEZA 3BG5A 4YAJA 4RJ2A 3NAQA 2DE0X 3EXEB 2O7SA 1NQOA 1CVRA 3L1HA 4KFTA 2YV2A 1TF5A 4WJKB 1C4KA 1FYWA 2WP8J 5LLSA 3N2IA 2GZDA 4PIVA 2XEDA 3OPNA 4TV8A 5CEFA 1E3TA 5HNKA 1O4WA 1HK7A 5D5HA 3LBNA 4FINA 2QT1A 2CXOA 3F97A 2BUAA 3U3OA 1FXWF 1GA1A 1EK5A 3RVMA 3UB4A 1SKBA 5LKRA 4TTJA 1RPTA 1AUVA 1J9EA 2OV1A 3BH6A 2JIOA 3AB3A 3PHBE 4L4ZA 4U1RA 4XVRA 2W6OA 3WJ2A 4AYXA 2X5NA 3UT0A 3WNBA 1E8NA 4XLZA 1EE1A 1MDFA 2HMYB 4IIYA 2BKAA 2O05A 4Z7QB 1RYHA 2YXBA 3KTAA 3EIXA 1KH1A 3DC2A 5DLQC 1MB2A 3UAOA 1GEEA 1XCPA 2RCNA 1C3XA 1U9YA 2GF9A 2WFLA 1LPNA 3ECSA 4AKTA 1M2HA 2DFPA 3LYUA 2ZCJA 5IC5A 1QM5A 4NMMA 3QA9A 5FOXA 4BXOA 4FK8A 2Q2VA 2QZ9A 1C9EA 1QH0A 2ZIEA 3FYTA 3SHOA 1LJLA 3H9CA 1AB5A 2FXIA 1LZKA 3PWSA 4KG7A 3Q8MA 5FADA 1M8FA 4S0ZA 2W98A 4O2BF 4YJ3F 2V45A 3GUUA 4CM5A 1EQUA 3AF0A 4N3NA 1Y7LA 1FMJA 2Z56A 3LQ4A 2AOXA 3QVMA 4MW7A 2VHEA 5K3FA 3V8PA 1YJAA 1WUYA 2HPVA 2Q46A 3TPZA 2CYCA 4MV8A 3AKEA 3FAKA 4MV0A 4PNZA 4L78A 1H0RA 1PQ4A 2C31A 3HJGA 1O95A 3N0XA 4JYMA 1OUMA 4UVDA 2H52A 3BDIA 2R8EA 5LA6F 4A0RA 3NP9A 4DV4B 3V1NA 2JIMA 3RLFA 1CE8B 1TU4A 2DUNA 2FRDC 2JGAA 3QNMA 4MR7A 1GQRA 3TZCA 3ZCUA 4DV1B 3CJTA 3HR4A 4EJ0A 2XCOA 2ZYVX 4AFNA 2P40A 2IIPA 5K3DA 1KQNA 5I7VA 1U3GA 4CMEC 4LJSA 2YFKA 3NIDB 5IDQA 2HC9A 4I19A 4XFJA 4G8CA 3RWOA 4P7JA 2RHHA 1UMDB 2FZ4A 4Z8YA 5DX1A 4Z9XA 3T5AA 1YL6A 2ZS7A 2F1RA 3IAAA 1KFCB 2ZJ1A 5C3UA 3WJAA 2ZJ3A 3EUEA 3MTJA 2ZYTX 5CLGA 5C7YA 1N1GA 3KQKA 1PJTA 4AB1A 3UCXA 4DNXA 1JALA 1HRDA 2P9JA 3H2YA 3S81A 3H8JA 2V8BA 1ZGJA 4J2HA 3FNEA 1H66A 3HLTA 4XWGA 1EFPA 1Y1LA 1ZGHA 2WC1A 2G9QA 3Q8XB 3N2YA 3QOWA 1RBQA 4P83A 2XZOA 2YDYA 2WVGA 3DULA 1RCTE 3DV0B 4NJMB 2XNJA 3VNRA 1QLWA 3H17A 2GS9A 3O1JC 1DX9A 3LQFA 4LE2A 3T1QA 2O2JA 1H9AA 1ZCBA 2C2HA 2GJSA 3FLEA 3EVCA 2EKLA 4MP8A 4EGSA 2F8TA 1G8GA 2VPWA 4TXHA 4BGDA 5I5EA 4HK4A 1JG4A 3WGLA 1EUDA 3LUJA 2XPCA 1XEAA 1X7WA 3C74A 1R16A 2QRJA 3DM9B 4TKVA 4BS9A 1BX1A 3B3JA 4U7PB 4E03A 3T9EA 3ELBA 1Q1EA 3D1LA 3VSCA 1Z4OA 5EPUA 2P6UA 4G1UC 4MRMA 4YMVA 2QN7A 1YBFA 2E6UX 2JRLA 4DIDA 5J63A 5DTQA 2OCPA 1J2EA 5F9HA 3K2EA 3FNQA 4P3KA 5AKKA 2IS1A 3ZI0A 4ILEA 2FG7C 4Q12A 5CM9C 4XQCA 3IPLA 3MIZA 3ZY5A 4WERA 1UAAA 2FMKA 1ZEJA 1TCAA 1QG6A 4EGCB 3ZLVA 1LTKA 2D1TA 2FX3A 4P0TA 1GN9A 2IYSA 2ZQYA 3PQ5A 3U4CA 3K3PA 1D6SA 5CNKA 3BIJA 3OHSX 2QF7A 2YWHA 3GD7A 1QB7A 3AEUB 3KPJA 4MCAA 2IY7A 4TN1A 2E55A 1ACLA 2JFVA 1DFIA 3W4KA 4NICA 5KSOA 1XNJA 4M22A 1XJ0A 1ODSA 4HX2A 4Q1CA 2IW3A 1EX7A 3QXHA 4M7WA 1DBPA 3GAMA 1KI7A 2NADA 1TVMA 3EGXB 4IXMA 3VOAA 5CDGA 5GONA 2Y0BA 3GRUA 1HF3A 5ALTA 5T4BA 4R1NA 4ATNA 4UREA 3E8SA 2AFHA 3MTEA 4QYIA 3FRJA 1XXHE 5IT5A 1UC5B 3PTZA 2FW1A 4PLFA 4XCVA 3H6HA 1DKNA 2GD1O 3GUHA 3QUCA 2BFNA 2VYQA 2Q3BA 4IIDA 4NZOA 2CY0A 1E2MA 2P2LA 2ZQZA 4GSYA 1LVHA 3NHPA 4S12A 5HKOA 4G5HA 2Q3LA 3E3OA 4YV2A 3DKPA 3OY2A 4BX9A 5KWSA 1NVUQ 1MV5A 4IYRA 2ZOSA 3SHTA 1U8AA 4REQB 5CFQA 4I55B 4A2QA 1NTOA 4LIPD 2V7QD 2JFZA 1B6TA 2PRKA 3WBJA 1J5EB 5NULA 3I37X 3JZFA 3OLZA 2PE5A 3WRVA 1ZI9A 3RFUA 3IH5A 3QVWA 1VLMA 4ZU6X 3E9NA 4V0OA 2GSWA 4WK0B 4PAGA 4TV8B 1G2QA 1XOIA 3PCTA 2BGGA 4PYQA 5DT2A 3QIAA 2NACA 4AP9A 4UDXX 1QAQA 2IPOA 4H7JA 4KQ1A 3MOSA 1QIDA 2XNSA 3TZBA 1TGYA 3FVWA 3QXXA 1CRQA 2Y1GA 3I1YA 3FOWA 4PW0A 1Z7GA 2PLWA 2D0PB 3QXCA 4AMZA 1G7TA 4DAEA 2C20A 2R8OA 4UCFA 1AS3A 1BA3A 4UM8B 4LRWA 2BGTA 3JQEA 1JJVA 1RHRA 4E5UA 3DEZA 3H1FA 5B57C 5CFLA 3TL3A 1FJ2A 4ZVVA 3KTAB 3C43A 3W7VA 3GCXA 4R01A 3I9JA 2WFLB 4AICA 4L7VA 4B40A 2H0RA 1MXHA 1EFLA 1FRFS 1CK4A 1MVOA 5KOYA 3QP9A 2ZIVB 4BXOB 1G16A 1M1UA 2XE8A 2ZSKA 3HBJA 1EGAA 4K8OA 2AWOA 1O0BA 3UJCA 4O8CA 1DJLA 4JGGA 3SEZA 1JAIA 4JKOA 2QAIA 3OPXA 1M1XB 3FYUA 4I4TF 3PJFA 1Z37A 4KUEA 4OM7A 3N70A 4OU5A 4CIYA 4DPMA 5LC1A 1K6MA 2JIQA 2ZVQX 3COPA 1AKQA 4YMWA 4PBTA 5K3FB 5KNDA 3O4GA 1WZEA 1I01A 5K20A 2RHMA 4NY1A 2XUAA 1TUGA 3IMEA 2PS0A 4MWEA 4NS1A 4BGEA 1Q2UA 5FORA 3CMMA 4RBNA 3RS7A 3F6EX 3DL0A 4E30A 1JXMA 3TSOA 4C7XA 1BMFD 1AKNA 4MR7B 4BVKA 3K9NA 1NLZA 3CNHA 3IAXA 4D43A 4J0HA 2FHSA 5AKXA 2GDZA 2Y1OA 3HB4X 2PV7A 4XIJA 4A15A 1SXQA 4FU0A 2C2YA 3S99A 4X71A 1JYFA 3P1JA 1DQNA 4U4AA 5CJPA 2CUTA 3K53A 1YHYA 1ISPA 2O50A 4DDKA 3AFGA 1XDWA 1C7JA 1HNNA 2EW2A 3QQ5A 4B34A 1CP2A 4XDHA 3CRNA 1YFZA 1YQQA 1LI7A 1ZN8A 2VXCA 2C7VA 2W9XA 3MINA 3WZLA 1RE1A 2FQYA 1B14A 2OFOA 3TLBA 5C8YA 2WJVA 4IKOA 4TSRA 1TQHA 4IJ5A 5HHTA 2IIVA 3EBPA 4JXXA 1MQ9A 1NJ6A 3OPQA 1H2RS 4NF2A 1XVUA 2BSAA 1Z28A 1ZESA 1ISMA 1GCAA 4ENRA 4GOJA 4AZWA 4UTNA 3H0CA 3EAGA 1EFPB 4RABA 3CZRA 1BVRA 3KP1A 1QLJA 2D1RA 2GD2A 5AXDA 3AR8A 1RRGA 4DQVA 3OJ0A 5JSZA 1DIBA 1U2TA 3U7GA 5KNCD 1W5EA 4HQOA 3SJBA 1BVYF 4KO8A 3TIIA 2DP4E 1R8XA 4YHHB 1JAHA 2AG5A 3BE5A 1Y3HA 4MMZB 4NULA 1H1LA 1R0CA 1J1IA 2E49A 4RK1A 2EKDA 3TDMA 1D2EA 1ZU4A 2ERCA 1EUDB 4GNRA 4IIHA 1NUPA 1U98A 1V4VA 4II2A 4LS3A 4WNYA 4EPVA 1P72A 4EF5A 1P17A 3DAHA 4TKVB 1J9ZA 1XTRA 1HYBA 4OFBA 2V0NA 3R3XA 1I0ZA 4WL0A 3NBYC 4MRMB 2KBEA 4NE2A 2Z3WA 5JNSA 4NBSA 4UHHA 5G0UA 5ILOA 3I5AA 1IWOA 1BE1A 4LVNA 2SHKA 2GPBA 4QVIA 3PGLA 4ARZA 5G4KA 1O57A 1SEVA 3U4QA 1R6DA 5IH3A 5CA1A 5KNBD 1G20A 1PD0A 2AE2A 3S4YA 1SVUA 4UD2A 3MWGA 3D6UA 1B6SA 1C0IA 4LY0A 4NPCA 2FKAA 4BQEA 1Z5GA 2L18A 2JNWA 3MXTA 4TTPA 2RAPA 4WZAA 4BVBA 4EKDA 5JS1A 1T24A 1CVIA 3MUEA 1IN4A 2OGTA 4PN7A 1Z0FA 1YT5A 5KYUA 1EIWA 2C1XA 1HT0A 3N76A 3B8HA 1BGXT 1ZGBA 2HHCA 1OT5A 3QKIA 1YFKA 4WEOA 5DCWA 5FPQA 5E9AA 1VE9A 2GD6A 5CJJA 1XVLA 3BGVA 4XB1A 4MWCA 1Y1PA 4MVCA 1J90A 5GONB 3OM8A 2H2HA 2I2DA 1G0NA 1RZRD 2AIRA 3GFSA 1VLZA 3RUDA 5B7QA 2AFHB 2B9VA 1WVIA 4QYIB 1QYXA 2Q4RA 2XUIA 4O2AA 2HLDD 4B3FX 5AVSA 3ICQB 2BCGY 5K2MA 1SO8A 3ZWKA 5C8DA 4BMCA 1V8BA 2IA5A 2ZJOA 4ZTBA 2YZMA 4NHEA 2BVNA 3AHGA 3FR8A 2V7BA 2IV2X 1P73A 2BTQA 2QBYA 4MRRA 5LQSA 3TSCA 3DD1A 2R6FA 3GLIA 3VO2A 2FPXA 4GVXA 1TAGA 3LCRA 1CD5A 1EXNA 2B35A 4MRSA 3H5OA 1Y5LA 3Q41A 2WJ6A 3RPEA 2NU9B 1BWRA 1M7BA 1IEVA 1FFEA 2R1ZA 3FTQA 1DAIA 4O63O 3RV3A 1H05A 2DEUA 2HK9A 3QE3A 1CLUA 3I3SR 1XLVA 1YS2X 5ELLA 3RSZA 1GNLA 5LQKA 1X1SA 1D1TA 1ZA1A 4KH0A 3M4JA 3WLKX 3SXUA 4AJ4A 5BSFA 2VDUE 3W9YA 4QIHA 3WIVA 3NC4A 1U0FA 2D74A 3AVWA 5AXAA 4YCSA 3R1IA 3DT9A 1C9KA 2AQKA 2MINB 4EMBA 1Z2NX 2RJNA 4GQAA 4RD6A 1ES9A 3UFXA 4E08A 4G81A 4XFKA 3SGLA 5IBQA 4G4JA 2AHRA 3DVQX 1XWFA 4R0MA 4OIFA 2I6UA 2CXQA 3VVLA 3C41J 1E7MA 3UUWA 3F1LA 2D1SA 2F59A 4RTJA 1XMOB 1R10A 2X9VA 2DPXA 2IPAB 3QU4A 1N33B 5H80A 2C9YA 2OXEA 3JZMA 2BMEA 1KFKB 1DADA 1Q0SA 2EQAA 3LIPA 3MWFA 1RWQA 3O21A 3P20A 1G2PA 4I8XA 1UJCA 4MPJA 2RHDA 5LFAA 4HXFB 3GY0A 4TT3A 4V3CA 5EJMA 3ZXUB 1U7ZA 4WXMA 2PYDA 3KQVA 4WLVA 3WOVA 4BVHA 2HMAA 3FYUB 1JL3A 4LDRA 1KZ7B 3ORHA 4NCBA 1JI3A 4LXTA 4Z9YA 4GC5A 2BMVA 5JPCA 2HM7A 3WAJA 1KHTA 1XTIA 2J3DA 2A1IA 2O20A 2WIDA 1FTGA 4OIMA 2IBMA 5FUWA 5EGSA 1MQ8B 4ZYTA 1IM2A 5BO5A 1F38A 4L22A 4YDHB 2H3EA 3MMNA 4DLNA 1U4SA 4ZO9A 3UK6A 4CUJA 1RWVA 4E22A 1VBMA 3HBNA 3ZDBA 2ZI5A 1LQUA 1EK1A 10MHA 1FFCA 4HAZA 5FJIA 2LRHA 5A03A 3K4HA 2VWPA 1MW9X 6LDHA 5M29A 3O0DA 4FWIB 1NUSA 5CPFA 1XL1A 5C0OE 2C9BA 5CNJA 1S1CA 5LQNA 1NOJA 2HCJB 1J21A 1XMSA 1O9HA 5JJLA 1SBTA 3IJPA 5CA0F 2AFRA 4ZFNA 3PNMA 4YJHA 2ZRDA 2Z2YA 2NVWA 3GRZA 3MINB 4QNMA 2COKA 4RNDB 3SJUA 5C8YB 3V6LA </