1QTNA

Crystal structure of the complex of caspase-8 with the tetrapeptide inhibitor ace-ietd-aldehyde
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
152
Chain Sequence
DKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-8
publication title The atomic-resolution structure of human caspase-8, a key activator of apoptosis.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 152
sequence length 152
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 1999-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qtnA00
1ICEA 2XZTA 5LU9A 1SC1A 2QLJA 1BMQA 5IBRA 4NOLA 4JR2A 2XYPA 4PS0A 5IAEA 4D3XA 1SHLA 2QLBA 4AWAA 1RWXA 5IAKA 4QUIA 2CJXA 1F9EA 3R7NA 4EHNA 1RWKA 4DCOA 4N6OA 4JR1A 3EDQA 4JB8A 1JXQA 2J32A 4HVAA 2DKOA 1RWMA 1RWOA 2QL7A 3E4CA 1PAUA 3D6MA 3NKFA 3K7EA 2K7ZA 5I9BA 4IEFB 2XYGA 4JR0A 3SIRA 4QUEA 4I1PA 3V6LA 3R5KA 3S70A 2C2KA 1RWWA 1SHJA 4QU8A 2H54A 4DCPA 1RWPA 5IASA 3R6GA 4FEAA 3DEJA 3R7SA 2H4YA 5H0IA 3KJQA 4EHFA 4JJ7A 1QDUA 3P45A 3H11B 5LU8A 3UO8B 2FQQA 1I3OA 4LSZA 2Y0BA 3V4OA 4QUGA 4EJFA 3H1PA 5IABA 1NMQA 1NMEA 2C2OA 4N7MA 4PRYA 3SIPA 4M9RA 4EHDA 2CNNA 4NBLA 4FDLA 3H0EA 4AWBA 4FXOA 3GJQA 4QUAA 1I4EB 1F1JA 4AW9A 1RWNA 2Y1LA 4NOMA 4D3YA 1QTNA 1RHJA 4QUHA 2HBQA 2NN3C 1KMCA 4HQ0A 1I51A 1RHKA 3RJMA 2H4WA 2HBYA 2CNLA 2J33A 3R5JA 3PD1A 4ZVSA 4NBNA 2HBZA 3R6LA 1RHQA 3GJSA 2FUNB 3KJFA 3GJTA 3QNWA 3DEIA 4JJ8A 1RHMA 4N5DA 4NBKA 2J30A 4ZVTA 4EHKA 5IC4A 5K20A 4QUJA 1PYOA 2H5IA 2C2ZA 3OD5A 2AR9A 4QUBA 1IBCA 3IBFA 4ZVOA 2H5JA 3S8EA 3DEHA 4ZVPA 1RWVA 1NW9B 1GFWA 2QL5A 3P4UA 3GJRA 1RHUA 5IANA 3V4LA 4QU0A 4NOJA 2H51A 1K86A 3BIJA 4I1RA 4PS1A 2CNKA 4JQYA 2QLFA 4HQRA 4IYRA 5IC6A 5IBCA 2H65A 3V55A 1CP3A 3ITNA 3NR2A 5IAGA 4QU5A 4N6GA 1NMSA 4JJEA 5IBPA 3V3KA 2C2MA 2H48A 1SC4A 4JQZA 5LUBA 3D6HA 4N7JA 3PCXA 2XZDA 3UOAB 1CVRA 3NS7A 1K88A 2CNOA 4EHAA 4ZVUA 2XYHA 4QU9A 5I9TA 4QTYA 4N6NA 4ZVQA 5LUAA 4QUDA 5IARA 1I4OA 3DEKA 1RHRA 3D6FA 3H11A 3V6MA 5IAJA 4EHHA 2WDPA 4QULA 4PRZA 3R7BA 1QX3A 2C1EA 4FGUA 2QL9A 2FP3A 3H13A 1RE1A 4ZVRA 3EDRA 3IBCA 1M72A 1SC3A 2J31A 2P2CA 4QTXA 2HBRA 5JFTA 3KJNA 2CJYA 4DCJA 3PD0A 4NOKA 1GQFA 4EHLA 4D3ZA 2CDRA
chains in the Genus database with same CATH superfamily
2JVIA 2A86A 2EW1A 2Z4RA 4J07A 5A7FA 2E85A 2P7HA 1C8BA 4R40A 3USES 9ABPA 3KU4A 2GUGA 2ID8A 2X6RA 2H06A 2Q9BA 5E2AA 4AJ9A 4AX8A 5CCEA 3BWXA 4XWWA 1XRRA 1F5SA 2QY9A 3FOAA 4BLPA 4C89A 2IS2A 4DRZA 1PTKA 2NXJA 4NPAA 2AWOA 3BAZA 3GNSA 1R0CA 4Y2SA 5CDUA 1AGNA 3DLAA 3QVMA 4LHVA 4NCIA 1Q1AA 4BCBA 3AVXA 1RP7A 4HRYA 2J9RA 1LNSA 1Y8CA 4W63A 4H15A 3TW0A 3H86A 2W11A 3PQ5A 4MAAA 1VP9A 3K16A 4QOHA 3KJIA 2RKWA 2NQ8A 3K3PA 5I9MA 5A5FA 1Q1NA 3FUXA 4INOA 3E2MA 1J09A 5EFZA 1RVV1 4JVSB 4NRDA 2LE0A 3H83A 1N2GA 2IEGA 1NSYA 3TNYA 2E6UX 2GRAA 1T10A 2HMWA 3L82B 4FWIB 1DJPA 1GQQA 1UR5A 4E6EA 2ZVDA 4LSZA 3QIVA 3ZWOA 5T6BA 2GPNA 2WUWE 2Y8EA 3VBCA 5B7GA 2HCRA 4OMUA 1ORDA 1KAHA 1B15A 2CVQA 5HIKA 5IG2A 2YJNA 3TEMA 1T5LA 4PZDA 1HKUA 4UFOA 5CT5A 5REQB 2WJPA 1AQ6A 4P31A 4E33A 4QOEA 1U7UA 2CLLB 3F6BX 3ILVA 4R1OA 4YPVA 1RYMA 1LBHA 3C2QA 5EHIA 5HFAA 4HJRA 3UHFA 5JXGA 4AX4A 1G9SA 1CUUA 1GGHA 2R1UA 4OQFA 4C78A 2P6RA 1I51A 3CN9A 4JB3A 4NEQA 1UMDA 5CB4F 1TC2A 2BFEA 3E82A 2LCIA 3B13B 4BB9A 1RZ3A 1ECCA 4O59O 5FKJA 1CK4A 2R751 3N05A 3NAMA 1VG9B 1BWQA 1YJCA 1K9VF 2VZEA 1KVTA 3NHWA 2NU7B 4GXQA 4Y6LA 1ZO8A 2QW1A 3SP1A 4G2NA 1SVWA 2QN7A 4WY5A 2O0KA 3CZQA 4P54A 3T54A 3KR1A 3TK1A 3ZBPA 4CUZA 3D3WB 4OJKA 1LLFA 2G25A 3BSFA 1B23P 1ENZA 3GGCA 4E2XA 1Y9AA 3WLOA 2V55B 2YR0A 2ZJ6A 2CFCA 3VZRA 3HYTA 1WIWA 2X5KO 1QM5A 2P2DA 3JAKA 3FKSA 1V9SA 5A5DA 2ZQZA 1HX7A 2HPHA 3A6LA 2JAPA 2Q4EA 1NU8A 4ECEA 5KB3A 3TIXB 5H82A 3QBVA 4PPQA 4W8OA 1NRIA 1Y1LA 2OKGA 1EFVA 1RM5A 1Y81A 3DZ8A 1R6BX 1YL6A 1W6RA 3I0ZA 3VHLB 2E48A 2PUBA 2JLVA 3RD5A 3RPEA 5EGNA 4BZPA 2Q5CA 3AVQA 3KKZA 4DG9A 3CVWA 3CQ9A 3U7FB 4LCEA 5K0JA 1TX4B 3HDQA 1UBJS 1G63A 1GNSA 3I3OA 3VR4D 1S3GA 1U0HC 2XW6A 1NVGA 3RRZA 4DR4B 1QRAA 3RS7A 1OWMA 2WTBA 3BCRA 3G2QA 1KEUA 1Q3HA 2XOKD 1BJKA 3OIGA 2FGJA 1ESNA 2XKKA 3L7MA 3LSTA 3I01M 3A10A 3LQ1A 5A9SA 1CZKA 4ZCRA 5B6PA 1I32A 5JAIA 3AF4A 1M72A 3OQMA 1SKYE 1FFEA 3ND7A 5LLSA 2AMFA 1ONPA 5CH3A 4YMVA 3VU0A 1U9JA 2QRJA 3I4LA 4DLPA 4JC5A 2FUG1 3RRXA 4GZ6A 5AKKA 3ZY4A 2YYSA 1L4NA 4ZZIA 1NE7A 2PKRA 3VX4A 4TV8F 2YFQA 2VLBA 3Q7RA 1EWYA 2B2XA 1ZX1A 2EW2A 3KDPA 5JQGA 1R6VA 2XUPA 1KH3A 4FWTA 1PR9A 5IHXA 1L5VA 2J6BA 4MYHA 3RC2A 3RSLA 3TFQA 3GBPA 3PDUA 5ES4B 4YA6A 4DRYA 4RWZA 2IU3A 3UGQA 2HLDA 1XTQA 1VZ2A 3MINA 3OKAA 3ZZ0A 1V6CA 5ALXA 2V8OA 2GAIA 3BQ9A 4Q9NA 5AVZA 4LXIA 4V0ME 5K8CA 2A14A 5FB3A 4JEIA 5FR1A 1CY8A 4JYZA 1NI4B 2ZRNA 1C4WA 3BGIA 1HETA 1ESEA 4Z1MD 1XL1A 4EUFA 3E3LA 3DAPA 3ZH9B 5ALNA 4HXFB 1RZVA 1OI2A 1TVKA 3A3OA 5DPMA 3EVAA 5DSTA 3LOUA 4RCYA 4TMXA 3V5NA 5GONB 2IYRA 2FQQA 5HEKA 3KOZA 3LIIA 2G9QA 1P5JA 3NHLA 1ONSA 3RS5A 2OD9A 2JIBA 3WMEA 2WJHA 1H2XA 1KO8A 3SWWA 2GZAA 2MSLA 4AYXA 5K6AA 2LPMA 3EA5A 2ROQA 3LVRE 4DZZA 1MDFA 2OO5A 4R2KA 3AEKB 1RKXA 2OFPA 3AF0A 4OXKA 4EHIA 5CA1A 5HRCA 5JBIA 5JNVA 4BY9E 3ZWMA 3WRXA 1J8MF 1ZRHA 1HL3A 3RIMA 4E7OA 4ITUA 1UOOA 3U40A 4AC9A 1DU4A 1TJNA 3PHHA 4NJMB 5AVXA 3ZBTA 1C9DB 3JQCA 3Q88A 1XHFA 4ZODA 2YW9A 5FUYA 3UKOA 5K8IA 1I7SB 4OQ4A 1PGPA 2OQ2A 5JZVA 3BB3A 4LWQA 1MH1A 2I3DA 5ALIA 4Z3DA 1R16A 3FX2A 5CYOA 4J2HA 4MJXA 1SCQA 3JQ7B 2W2OA 3AUAA 3NDRA 2C2BA 1Q6YA 4B2IA 1F6DA 5KNBD 3KQVA 3RCBA 5E3HA 3KTDA 4Y7CA 1KEWA 1CUWA 1ECPA 4OHFA 3R7FA 1YQDA 2WNSA 4QYTA 3EH1A 1IN8A 1OFUX 3KE9A 3NYWA 3Q3EA 1FUKA 3P5SA 3AVPA 3WK4A 1RWVA 2W6JA 3ET4A 4INPA 1VL6A 4KGVA 2KS6A 3ADKA 4RL4A 4ZRNA 2JZCA 4HDKA 3VOTA 5TMEA 1TM1E 2C7VA 2CCJA 3UBTA 1EFDN 4GT1A 4Q9LA 2AQKA 3OEEA 4P3KA 3UT0A 3CN7A 3WK6A 1NW6A 2D5BA 4GS5A 2YQ4A 1FE8A 3VI4B 5CVCA 4EYEA 1YQXA 5L40A 1H4TA 1M1YA 3EDYA 3ELBA 4YBZA 3KVOA 2LR0A 1FMLA 2G1AA 2R6DA 4HC4A 5HDBB 4FK8A 4K8RB 2OCAA 4YJKA 3OSUA 4WFIA 1CJMA 1NBWB 1NQWA 1V7PC 2ZJFA 3EDMA 1YVPA 2ECFA 1DT3A 4N5IX 5DCLA 1X87A 3AO0B 3AXSA 3RNLA 2XNJA 3TZBA 1SKMA 4TRNA 1IJFA 3SHFA 3RTGA 2G0NA 4GPEA 2VPQA 2Q3CA 2VT2A 2PD6A 4KGZA 1J25A 3UT5B 5CLJA 5IJ0A 2F67A 3FCAA 1Z5ZA 4C6TA 3C5EA 6GPBA 4WNIA 5B1IA 3RVDA 1OF1A 3AUJB 4GPZA 3FTFA 1M6EX 3CCBA 3EF1A 1E4VA 1U31A 5JFTA 2M6LA 3LUDA 3Q7PA 4HQNA 3FCOA 4N12A 5A4MS 4EOGA 5EWLB 3W4IA 5KYWB 1WKBA 2DKFA 3KB1A 4GZ5A 3E7WA 4L76A 5COBA 4RTRA 3LMKA 5BOSA 1K06A 1XCBA 2HV9A 2ZI6A 4JLJA 4FNMA 3QU4A 4J1NA 1ZM7A 1F3LA 2WV9A 2VUHB 3R4CA 4Q9JA 2ZAIA 3GGJA 4F84A 5HS6A 1CQIB 1J97A 2GD2A 5UKDA 4P6VF 1IUKA 2UVPA 3GV0A 3LZDA 2JI4A 4ZYXA 3P9QA 1E9DA 3HY4A 3PRKE 1BHSA 3DW3X 1AKWA 3IQGX 4RM3A 5F78A 1GZUA 2XUJA 3MAGA 4F5WA 2F64A 4GC5A 3X1YA 1T1EA 3T34A 4CF5A 5H1YA 3K6SA 1WPQA 3S70A 5ALGA 4OK6A 1RC8A 1NVMB 3D4PA 5H3CA 2WWRA 3EZXA 1PZXA 3H9CA 5DSXA 4EI7A 2EVWX 5JAMA 4D8YA 3P5BA 3WLNA 1X7XB 1AUVA 1DAGA 2Z2YA 3ABIA 1YK0A 4X9XA 4ENPA 2WD7A 2NUAB 1YVRA 2R6R1 4ID9A 2QMEA 3BXPA 1XNGA 4PYQA 3GUZA 4UTPA 3E18A 2WSSD 3JD1A 3V3TA 1I8TA 1OXUA 3I64A 3QJ5A 5DTIA 3ZD7A 2JW5A 2VDMB 3LUGA 5LIPA 3JPWA 3WLSA 4M0FA 1DG1G 2VBCA 4MQBA 1T3ZA 1XPOA 4KBFA 2JLCA 1ZNWA 3UWDA 3QM1A 1R9MA 3GDWA 1VPLA 2ZYVX 4FGLA 4INJA 1I9GA 4J90A 3UAWA 3V1MA 3RJMA 3WB2A 5BR1A 2LGJA 5IWCA 3B2EA 2XJ9A 1UBUS 1ZGHA 2PGDA 1ECGA 1VYTA 3GU3A 1NASA 2XWSA 3PBKA 4ZVNA 5TPWB 4KOEC 3S4YA 2H0RA 3GRUA 3NTLA 4CM9D 13PKA 1CDEA 3LWDA 4GBED 1CNMA 4ZC1A 4GI5A 4BRZA 3S8YA 3H2BA 3WBJA 4AMBA 4KQEA 4IDBA 5HW0A 3DHNA 1S1MA 4G01B 1GPBA 1FCJA 2ZUBA 2CVZA 4M0KA 1L0BA 3ASUA 3OT4A 2BHNA 4R9SA 1LDYA 5I47A 1NXOA 2VZ9A 2ZULA 2JI7A 1Z5PA 2EFGA 4ZU3A 5AJHA 4G89A 5FTNA 1M2EA 1D9XA 2HEGA 2QAJA 3H4MA 1AIPA 3K1JA 4HGPA 4RXUA 4DLAA 1PEYA 1EM8A 2P1RA 5AXDA 1ZL0A 1ZRNA 1HE4A 2QRNA 2WKSA 3N5CA 5AKHA 5FTMA 2W37A 2C9YA 4YEDA 2V03A 3L49A 1SXPA 3N6RA 2JZNA 3VC7A 4KDRA 4EI8A 1Z7GA 3Q3GE 4BJ1A 1DSSG 5ERYA 1EWVA 2V6JA 1HFWA 1SHZA 3DZKA 3O31A 4BLTA 5J43A 1ZGGA 3MIZA 4KPUB 3M3PA 4B84A 1YIDA 4G0PA 5A3JA 1RKQA 3MTQA 5IARA 4KQWA 2YKGA 1PJCA 4MWTA 1KERA 3JSAA 3GZ4A 3KVYA 3DYVA 4MQUA 1TF5A 5EZ5A 3RWOA 2FDCA 1EAMA 2YIVX 3CV3A 1RJEA 5ANRB 2CSUA 4J2OA 2FVXA 4PPYA 4L3VA 4REOA 1O9HA 2QVBA 1O6ZA 3KWLA 4FS3A 4XDZA 4NMLA 3UUFA 4C6SA 4XOUA 1P1HA 3FOBA 3IILA 1Z4KA 1H9BA 3BL8A 1NKSA 3GPCA 3R20A 3QLJA 3NBZC 1K8ZB 1G3UA 3I39X 3EZGA 5KMGB 1AM4D 1BYUA 5IBRA 3N6XA 1HEIA 1PL8A 1XMPA 2XECA 3JQAB 3MB5A 1XUOA 2CHEA 2I2XB 2WG2A 2ZBQA 3GIWA 3PYLA 5D5QA 5JCJA 3TLCA 3MILA 3PC4A 1MMFB 2R00A 4PYIA 2IY8A 2JF0A 3P9NA 4MS1A 1BE6A 4I66A 1LPNA 2CDBA 3EUWA 3L6DA 1Y8RA 2ZUSA 3D6AA 1RYZA 5AW5A 3LTNC 4BO0A 1W0CA 1FS5A 2DH6A 1P2UA 1G8MA 4YC7A 4YDSA 1ST2A 1KYYA 1A76A 4KLNA 4WCFA 4PHGA 1HQCA 3EVEA 4KXVA 1LGYA 3GGDA 4JJAA 1II0A 4IJ5A 4UHKA 3HCWA 4MVWA 4WUTA 2VHUA 4TRRA 2QN2A 1O5IA 1Q74A 2EQBA 4YUVA 5DHRA 5CK5A 3T5DA 1WLYA 3JZAA 2C7RA 2Y0BA 1O6GA 3BWBA 4GNRA 1UDRA 3LRTA 4X60A 4CMHA 4ZI7B 2NTYC 4LYHA 5TJHA 3CT4A 1XU9A 2QTBA 4OHXA 1X1RA 3C39A 3ZJ5A 3BGOS 1E3DA 2Z2JA 3UAYA 2CC2A 1CY1A 3EAFA 3FIUA 1AKMA 4A0FA 1U5BA 4XWOA 2MSNA 4E94A 4RM2A 3BYZA 4U7WA 3GRPA 2CJWB 1GKYA 2QJFA 4TWIA 1MQAA 2X1HA 2G67A 1RM0A 3CLKA 5DGHA 1FDTA 2CNLA 1T6NA 2OENG 3JV7A 4UOEA 4NBNA 1EQAA 3KSZO 4I08A 1FRVA 5G0VA 1ZDMA 4O4IA 4BO6A 2DH5A 1JFSA 4CIXA 1KFKB 4Q3EA 2J30A 4BMDA 1RKUA 1E3IA 3RRJA 5E9AA 5G0SA 2O2EA 3L9WA 3DE4X 4ZMRA 1TQDA 3OFJA 3QEJA 3ZUPA 3PQ3A 1P62B 2JGFA 4MUNA 1TNDA 4J3JA 4KE6A 2BM0A 3O0TA 1USKA 2UV8A 1IRIA 3OCJA 4HQLA 4G8DA 3A9RA 1E6WA 4LFBB 4XDGA 1AKUA 1XAGA 5LMUB 5E1DA 4DPMA 1JR4A 1PL7A 2PVCA 4IYRA 1ACLA 4R05A 2I2WA 4KTTE 2H65A 1RKVA 1Y48E 1Z4QA 1OUMA 1CP3A 1IUPA 3FXAA 4PGHA 1JE1A 1SQ5A 4G8CA 1E2LA 3EZNA 5TY0A 3EXIB 3H6HA 3N59A 2PD3A 3RC9A 1RQ2A 4FGKA 4W8GA 1JKFA 3A14A 3HVIA 5E9WA 2X3FA 2UYQA 4QRIA 4MA4A 1I7NA 1KGDA 2VHVA 5DIFA 2LKCA 5F12A 1LNQA 1SG0A 3SKYA 4EW1A 3PGLA 3IEIA 4I9NA 3PGMA 4QUDA 4DW8A 1Q17A 2NO0A 2BJHA 3DEKA 5JD3A 4AZ0B 3SGLA 1YAJA 4ARAA 4C20A 2COKA 3GEBA 3GLGE 1UMCB 1V7CA 3AJDA 2IFTA 3TD6A 4ZQBA 1E1DA 2PN1A 5I7WA 4W1QA 3IMEA 2BAGA 3DL0A 1CJVC 3F0TA 3ND8A 3FAKA 3NTOA 1INLA 3QPCA 4TV9B 2ZFUA 3ZQKA 1BN7A 1NAIA 2ZJAA 4LGYA 5EXPA 2EQAA 1TCUA 3R5HA 4IUYA 1SBYA 2GF0A 1NW8A 5D51S 5B36A 4I3GA 4ARZA 3ER6A 2XE6A 4OK5A 1ODIA 1UJMA 2QW8A 3C98A 3T7JA 3ERCA 4QLOA 1TTQB 1Q15A 4S04A 4BQFA 3Q2KA 2V4MA 3AU8A 3RFXA 1OILA 4O4LA 1HG1A 1JTFA 3QLUC 1PDOA 1QANA 3BMNA 1ZK3A 4F7WA 1CUXA 1Z83A 1TD9A 1ZJZA 5A4FS 1ZUD1 421PA 1CJCA 4RK5A 3G1TA 4UZSA 1A8IA 1YJ5A 3AUSA 1PJ8A 3M6VA 3G5AA 1SRRA 4H6XA 4HGYA 4IGAA 3WNBA 2C3UA 3DFFA 3EDQA 1CVLA 4HMOA 5CLIA 4TPKA 1Q0LA 5T41A 3KQUA 2IH5A 3O94A 3PNVA 4DMKA 1UPXA 2F1JA 1XZGA 3KEGA 3L2OB 4OJTA 3VHRA 4QG3A 1YULA 1ZI9A 1VMKA 2WA2A 3VXKA 5JQWA 1U65A 3IVCA 1LLUA 2QZJA 2WJAA 5F33A 2YJTD 4JUBA 3S2EA 4F4DA 5CDTA 5LOVA 4CQLA 2R62A 1NURA 4JBLA 1B74A 2QZ9A 4FYMA 1XYYA 3GZNA 2HO5A 3NM4A 1UK8A 4PONA 4KGDA 3GPDG 4HDCA 2BOVA 4K6KA 5FWDA 4Y9DA 4QBHA 3HCFA 2YZ7A 3G8BA 4WH0A 2C4KA 5IFLA 3KPJA 3FIJA 1MG0A 1TM3E 1VIVA 2X4GA 3DDWA 4CM7A 4TMTA 3UMVA 4CR7A 2H3HA 1U0JA 1GTZA 3DF7A 4MKXA 3LT1A 1TLTA 3FGOA 1X2BA 3UPUA 3ZNOA 5IXYA 3HJFA 4TROA 3QHQA 4ALNA 4ZI3A 4IMJB 3UK2A 4MWDA 3OO1A 4EUHA 2NO6A 3TDMA 1XEWX 1UIMA 4NEGA 2UYCA 4I1SA 3EF0A 1ISFA 2P5SA 4K6HA 2XMPA 5CM2Z 1OTHA 4K8OA 3HP1A 2R60A 3MJFA 2Q27A 2YHSA 2ZUTA 5HBGA 4ZZ0A 1RYHA 1T25A 5BN5A 1OJ7A 3G2KA 3NC1C 3EPHA 1HOTA 4NYMQ 3JQFC 4PC7A 1JG1A 3HU3A 3PRYA 4GX0A 1EUCB 3VH2A 2IX9A 2PYIA 4QQ8A 5K9ZA 4UBKA 3L6RA 4BP3A 4Z4EA 3WIUA 5F2NA 1EUQA 2Q3JA 5IDWA 5KVVA 4GUDA 1NVVQ 5HJEA 1EXMA 1N2EA 3L8FA 5C8YB 1WMFA 3A4LA 3MOGA 3PR1A 1T35A 2XQJA 4EMBA 4HNVA 1L4YA 1Y5MA 1RAEA 1J90A 2NSJA 1HEUA 1HYGA 1F60A 1BWPA 4I9GA 2CFOA 3U81A 5IF3A 1FL9A 2VJQA 4CGZA 3A6FA 4HL6A 1VFPA 4MYSA 2C1XA 4Z0NA 4ZO4A 4I5GA 4DJFC 4PE5B 4C2UA 1BXGB 4O3FA 5I9TA 4ZGBA 1KAQA 5J3JA 4P38A 4DHWA 5ITZB 5IM4A 1VXRA 1EGHA 5BMVB 2HSEA 1ZBDA 4X85A 4AUMA 2HIGA 5FNVA 3NKLA 3ZK9A 1E2MA 2REQA 5H7XA 3UWMA 5I45A 1E3TA 5BXQC 1YQ9A 1ZD4A 2EWMA 4RW0A 1JEEA 4LYEA 3O93A 3O4VA 1P1BA 2I9PA 3IEVA 4NHOA 3PDWA 2JGNA 3PPVA 4D92A 2P2CA 3DDOA 3CRRA 3RU7A 3SLRA 1DKMA 5SZIA 1U94A 4K2HA 3KDSE 2DQYA 3E3OA 2XUOA 5ALDA 3HXLA 2TMDA 1VKZA 1DC8A 1W48A 1M3SA 1GCIA 1H1LB 1X7YB 4G09A 4G5HA 4Q4JB 1XG5A 2KM1A 3HYSA 4IRMA 4KN9S 5JXWA 5EP4A 1SBZA 2ZR8A 3WK8A 4B0PA 4N41A 4ZOBA 3DFKA 2O0LA 3FPJA 3R7NA 3R3JA 3V8BA 5G41A 1FJXA 2R3SA 3SHVA 5KYXB 1A7UA 1PVOA 2G0TA 1Y0BA 3H9BA 5LZ7A 3KYJB 4DDUA 2WU1A 3CWCA 1GGKA 4MX8A 4WXYB 4PN3A 4I7EA 4EUSA 1IN1A 1XXHE 4RVNA 4YUYA 1Y4AE 4DMRA 3PDJA 2EZUA 5IDQA 7ADHA 1R7RA 3CGWA 3WLEA 4BV9A 4YIHA 3RS8A 1I6WA 1XTZA 3I2JA 1IDOA 4RCVA 3ZTWA 1CTQA 4B82A 4H59A 3UB2A 2ZYDA 3QVTA 3JQGB 5DNCA 5AVYA 2VHEA 5AW6A 3AF3A 3PTZA 4JLUA 2D4AA 4ZIRA 4BO2A 4D98A 4EVSA 5MFZA 2PLRA 3WL7A 5IAOA 1P9OA 1FS6A 4K40A 4U6QA 3GK3A 4NZ9A 3WB9A 3SIPA 4AWXA 4KU4A 1X15A 3LCUA 4HAOA 1TUGA 3HG7A 4JXKA 4B7ZA 5J4LA 1IM5A 1Y9DA 4XX1A 3GFTA 3OWHA 3SXUB 3WRVA 1WAMA 5H3LA 1ZJYA 2CUZA 2FMFA 1G2IA 1EIZA 1C29B 2R5WA 4JGIA 3OZUA 1PJRA 3KOOA 3M4NA 1L1FA 4ZO9A 1GGEA 4II7A 4Q3NA 4AU1A 5JDCC 2FPRA 4RKYA 3UTCA 1N6LA 2YVLA 1SZDA 1H6CA 4D9EA 1NBOA 2ONZA 2G5PA 4M54A 1JTVA 4E5SA 5JRZA 2QENA 1ZN8A 5D86A 1CJUC 1KJNA 1PFVA 1QCDA 2WF8A 3L0IB 1DKPA 3OZ7A 1GDDA 2VPZA 4MV9A 3CLRC 2XCQA 1ACMA 2ZXFA 3ZGLA 4BJ5A 1XWFA 5AW0A 4WJKB 2G1KA 4MB2A 1YCFA 2PSSA 2QEQA 4LMBA 5EE9A 4C7BA 4AJKA 4NXNB 2QYTA 4K9LA 2YWEA 3T1TA 1VCMA 2X7JA 2PIAA 1PWZA 3ENKA 3NGMA 4AG6A 4DM4A 4YAFA 3L1KA 4GMFA 1KTVA 1TEXA 2XA9A 3BXHA 4TS3A 4C0QC 2CBXA 4YY3B 3IQFA 4Q7EA 2VF8A 4F7DA 3OCUA 6REQB 5J4VA 5IHPA 4IFEA 4IQ4A 4EQ6A 5JI3E 1C0EA 4JI2B 1JLLB 3F6EX 4IQGA 4AIIA 3ZE6A 1YAHA 4PNEA 5K09A 4W5TA 4AKHA 2ZDHA 3X1DA 1P1KA 4L5BA 8AT1A 4ZV7A 3MWKA 3RF7A 6ABPA 1FNCA 5CXSA 2C7PA 4DQDA 4L0CA 1QCYA 3RQIA 1SUFA 5EXDA 3ZXYA 5AVQA 5I48A 1W29A 2NV2B 2GEKA 1Q7RA 4DBZA 1O5TA 3A32A 3GPBA 4JOCA 2WRZA 4WY2A 2GFHA 3A6EA 3X0DA 1WRBA 1XZHA 2I22A 3TSZA 2HJSA 4BASA 4FHCA 1OH5A 1DJOA 1Q7BA 1I7QB 9MHTA 1UPBA 4L5JA 2HA4A 4TWAA 2EKZA 4LI3X 4TKVA 1Y3BE 1FUYB 3VNSA 3B70A 5I8WA 1E79D 3L0PA 3T3GA 1IPHA 3WGNA 5DP2A 1P1FA 3F73A 1B3BA 1SC1A 2NGRA 5GINE 1YE3A 4ZQHA 4TXLA 1OLUA 5F9MA 4CM4A 1U2PA 3NBMA 1Z4OA 2CFRA 5ARBA 1NUHA 3IIJA 3NBKA 4ZCTA 1BCSB 1MW9X 2WD9A 3LKBA 4AL4A 2B4TO 1H8HD 3UC5A 2ID9A 1BMFD 2IYYA 4M4SA 3RUPA 2AWNA 1PGNA 1U2EA 2QYOA 4JEMA 5EYPB 2YXEA 1H2ZA 2BDUA 3SX4A 2I29A 2IODA 3TMKA 5GTDA 2VPIA 2R7MA 4IEFB 2A58A 1MIOB 1RJ9B 1SU7A 1SUIA 5CW2A 4ASUD 3NBAA 2MWMA 4LXGA 1VXOA 1POXA 2ODBA 3RODA 4PAWA 3AFHA 4WIAA 1R4NA 2J45A 4ER7A 4MVJI 2XDAA 3R76A 3PJEA 4CWAA 4RANA 1CJSA 3ZNQA 1S8FA 2VHJA 2RJNA 2RAVA 3QKUA 4YWHA 4YRSA 1OWNA 4U5XA 4B6OA 2VHYA 2Y1XA 2OBLA 2VT3A 3IMGA 3RV4A 1HFJA 1I2MA 1W5AA 3CLTD 2C5EA 5BNWA 2B30A 4A73A 2PLNA 1IZ8A 1FVHA 2NYRA 4HXGA 2XNDA 3CWQA 4IWXA 2FMXA 4A8TA 1NX9A 1GO2A 1Y6QA 4DV6B 1XZIA 2JGIA 1RS0A 3D8BA 3MWEA 5LC1A 3RROA 2Q3LA 4EJ2A 3GLFA 1AK1A 2ZSJA 2FW7A 2C95A 2W98A 3RO7A 5A0TA 3U3KA 4CFZA 1IC6A 4Y2XA 3EQ9A 2QD3A 1IK6A 1QH1A 4C6HA 4Q6WA 1RHMA 2XOXA 5TARA 3Q8WA 4GM0A 1Y5IA 3EEIA 1D2AA 3Q1KA 1C50A 3W7AA 3MMZA 2C82A 4DBLE 2PO7A 1O94C 3ORHA 1JFFA 4YJ3A 2J5KA 4CPDA 1YR7A 2D0IA 1KJZA 3ND6A 3WFZA 1BEEA 3WJ2A 4HMQA 2XWBF 1HLGA 1YRWA 4I1RA 4KX3A 4O2BF 3REFA 3TRHA 3UTDA 3X3HA 5D1HA 4YPOA 1NG1A 2ZG6A 4D96A 2CXOA 4H6WA 4L1KA 1G5QA 4WAUA 4DLTA 2RGBA 4GEGA 2CKDA 4KVZA 3SC2A 1NMSA 3K2BA 1R0ZA 1OZGA 4YALA 3PCXA 2MCFA 3G9UA 3L4EA 4R6XA 1PR4A 3DMNA 1H3NA 1V35A 5ER6A 2BYTA 2RH4A 5HKAA 1AO0A 2H7YA 2VA9A 3UPDA 2FUKA 3DPIA 1V11A 5TGDA 3O8RA 1U3CA 4B8YA 3S1LA 2R8OA 2G04A 3H11A 2V9PA 2G4LA 3AGQA 4AZSA 5G02A 3PJGA 2HJWA 3GUCA 4LQ4A 2ZUWA 3PX3A 4TKUA 4YUXA 5D7NA 1DRUA 4JT2A 3D7SA 4GAEA 2FP3A 2P9TA 1WSDA 3EVFA 4RY8A 3IJRA 2YHBA 3SN6A 2RGRA 4TN5A 5KC9A 4YNBA 2C3MA 4PG5A 5D3MA 3A2KA 4G5YA 3RUDA 2XHEA 4FGJA 1GFIA 2P5TB 2VTEA 3OD1A 2R79A 1BTOA 2FN7A 3DMTC 2C0QA 2FFAA 4TYQA 4PSDA 2O8EB 4JLDA 4I4CA 3WADA 1F2DA 2EKQA 5EQDA 5DGXA 2WJ4A 4NIMA 3T8YA 2QV7A 1XAJA 4B3JA 2Z5VA 3IUMA 5FUBA 1KQGA 4LOHA 2GT1A 5D87A 1HE2A 3ER9A 2XVMA 4M76B 1WU8A 3IT3A 2OXIA 3GLHE 3T5CA 5I9BA 3ZS9A 3OFSA 2QQ5A 5K99A 2XUZA 2IYWA 2W58A 2WD8A 5SY9A 1XTKA 3MS4A 4P34A 3SLGA 3EISA 1J8FA 1QIEA 2W42A 2X5XA 1XI2A 1P77A 2H2AA 1KNQA 3F71A 4JFAA 1O6FA 1NVEA 3H6GA 4HFMA 3FSGD 3CXRA 1NQAO 3G13A 3E9EA 5AK0A 2PMWB 5CVDA 3KXIA 3OE7A 3KFXA 3BCHA 3L4JA 1SXJA 4DBLC 3E0XA 4MJ7A 2B7CA 4WINA 5ED4A 5FUVA 2E4VA 1NNUA 1RWNA 2QL6A 4J76A 5KYTA 1UMBB 4KBGA 5I4KA 1ZK2A 2RHOA 4NOMA 4O4JF 5I4BA 1EDZA 4KACA 1PGQA 1NBME 3WLPA 4I2VA 3TQFA 2PA0A 3TR5A 5KDDA 3NFYA 2AYXA 1VA5A 4J6FA 5EJMA 3VU3A 4ZVLA 1WHTB 3DKPA 2BKUA 2YXPX 1M34A 3DCIA 3H8VA 4K9MA 2EV9A 4DV2B 3GEIA 1C30B 1TM4E 3BD7A 3V8EA 1JG3A 1YBFA 2E2WA 4EF5A 2BFBA 2ECOA 3CBGA 1JECA 1UCFA 3OY2A 2O2IA 4FPXA 4HYEA 2W2MA 4KXUA 2OXRA 4NFYA 2VZ8A 4OREX 2V7VA 3TECE 2XGGA 2JLSA 5IS2A 1P60A 3VJLA 1E2PA 1KGSA 4PXYA 1SUAA 4MHTA 5FBWB 2B4KA 3A25A 5GMOA 1QIKA 2H5JA 1MRSA 5HXAA 4I6GA 5DNYB 3KS9A 2X0NA 3QFSA 4D26A 4ME6A 3FPLA 5I4IA 1QZXA 5FPKA 5LJLA 5JATA 3V46A 4K3UA 1WQ4A 4ZOQI 4GQBA 1DHRA 1YA8A 2D1SA 2UVDA 4D9CA 5KQPA 1KH2A 3FWPA 2QMOA 4C0LA 2OZEA 4PYNA 1UWCA 1FP6A 1Z6PA 5IZ4A 4WQMA 3VR5A 3MUFA 3F67A 1U80A 4FW9A 4NZOA 4P2GA 4BLOA 1EYZA 1IBSA 2GCIA 4BFSA 4QZVA 1SA0A 5JJ5A 1VG8A 2ZRMA 4LMPA 4BTLA 1KEKA 1T5HX 1V6SA 3IAM6 3RSSA 4GI2A 4D02A 3FDZB 4C7VA 1R74A 1QRSA 1HT3A 1FB5A 3NTQA 4UMDA 4IDHA 3UW1A 4RDCA 2WKPA 1OX4A 3LAWA 3U7IA 1CULC 3ZU6A 4Y9TA 3AB8A 3CZCA 3WNCA 1ZR2A 3HA2A 2R7NA 4N0DA 3B12A 5EUBA 3WLLA 3NDBB 4DCJA 2BL4A 1XV5A 1O5OA 4KQ2A 4NOKA 4WADA 3D1VA 3ELWA 3EUAA 4HWRA 3TW6A 4W6QA 3RJ5A 3H1EA 2PKEA 1JDJA 1I3CA 4JAVC 1FDVA 4C4YA 2PGOA 2YV5A 1VRCA 3A1TA 3KLNA 3TLZA 1W59A 3GAFA 1GY8A 4FVTA 4A8JB 4X7MA 2ECQA 1X77A 1ODLA 1YR9A 4XFJA 2FZ4A 3WGIA 4N54A 4CRWB 4EFMA 4E3WA 1NA5A 1DRWA 3P94A 1Z8NA 4EJSA 2GNOA 4B3SB 4GBMA 1LI7A 3LK7A 2PMFA 5D00A 3WO0A 4FM9A 1TQ6A 2K6GA 3U80A 4QIHA 3VM6A 1DTEA 1Q2XA 2OC4A 3HABA 3EVTA 2QD2A 4RMHA 5TEVA 1L5WA 4HZUA 2CUTA 1EB8A 1KI6A 1N9KA 1HQKA 2MSCB 3B6JA 3BTUA 4N5HX 1Y8QA 3VC1A 2G8LA 2I91A 4DRXA 3PXDA 4FKBA 4X1IA 2QD4A 4BKMA 5LU8A 1URPA 1XO1A 4U9HS 2Q3DA 1JT9A 2QSZA 3PHGA 5MN6A 2E4YA 5JO0A 3IBGA 1YRBA 4H7JA 2VHQA 4PHFA 4RU1A 2CW5A 2G76A 5T4BA 4DA8A 4NBLA 1T5IA 3HK2A 1YIOA 1E9CA 1QLWA 1RMQA 1E89A 1KPGA 2R8ZA 1FSZA 3EQ7A 4I9UA 2V3CC 1CZHA 4I9FA 4D4IA 1BE1A 1O8CA 4TOIA 3QV2A 3ZBQA 2FWAA 2JGDB 4LRYA 4RV5A 3BIOA 4JEHA 1QV6A 2YXDA 3R3HA 4EMUA 5BSFA 2AXPA 4PU0A 4CTJA 3MUEA 3HA7A 1MXFA 3FUTA 2J33A 4QICA 5DHUA 5IYZF 1ORVA 2O07A 4KNVA 4BGVA 2AFIA 3FUCA 4JT9A 4QHSA 3DKIA 3L6UA 4C2TA 1G5IA 1NZDA 4N65A 1H9CA 2GCEA 1J1IA 3GJ5A 4YRGA 2PZEA 3MLBA 4D79A 2FWRA 2JHFA 2PPVA 1KC1A 2V65A 3AHIA 3GRAA 3JRXA 2RARA 4G9BA 4L57A 4X00A 3VDRA 2VTBA 1BJTA 1V2HE 3H9EO 4HH0A 5L3VA 1HTBA 5JBQA 2G1JA 4BNZA 3PIDA 1VB3A 3DB2A 1Y4SA 2DFLA 1RXYA 2C2XA 3EGXA 3JU3A 3K73O 3QE3A 4WTOA 3I1IA 3VC3A 4MKIA 3A4MA 1V1JA 2ORYA 2Q0HA 4ZANA 4OQMA 4KV7A 3NHSA 1DEOA 4N82A 2CCKA 4UATA 3MPUA 5BVGA 4MUHA 1TT5B 2I7VA 2UXBB 1WP9A 1HXHA 3R7WA 4B4UA 4MP8A 1B0PA 3NH6A 1JAXA 5IDXA 1TM2A 1OAKA 1W30A 3HJNA 4RQAA 5ICEA 4LF5B 3PWTA 4OU5A 3EC2A 4Q3OA 1G41A 1BXRB 4MCAA 4RJJA 5F35A 3U37A 3TVYA 3SX0A 3UG7A 4BLVA 4EDHA 5ADHA 5D84A 1MP0A 3M4ZA 2WT8A 4UD2A 2QNBA 3V7WA 4RXMA 2JGEA 2HZBA 5KOHB 3EASA 4C88A 1KI3A 2RIRA 1ULZA 1I4OA 2VJBA 2UYOA 3E23A 3M1YA 2E5LB 1YJQA 1J00A 4PGMA 3ZW7A 1YMVA 4FFMA 2C4NA 4AQDA 3LPAA 2G6BA 4ZOLF 1F2UB 2QL9A 5F7XA 4IJUA 5E8RA 2ODTX 1FIUA 5I9LA 2HHHB 1I5OA 2BGUA 1V5EA 2Y1WA 3FOWA 4U7HA 2EL9A 1R18A 3FF1A 3QELB 3TXXA 5C35A 4AMVA 1IBMB 2UKDA 4EHLA 1JLKA 1QRDA 2RKOA 1E2QA 4EZEA 4N40A 2XADA 1YA4A 4CKYA 4M53A 3RGGA 4P98A 1USIA 2OPBA 2W6NA 3Q12A 4GP6A 3HLKA 1L7BA 3TTYA 4D6XA 5B3JC 4PSCA 1OGIA 2J08A 3KTAA 2IQIA 3HKEB 1M2WA 3FWNA 1H85A 3T9AA 2MHCA 4FZ5A 1DRJA 1XOIA 2FZGA 3FDFA 3RKSA 2HSZA 3LX6A 2ODWA 3W8FA 1NR7A 5AVKA 3HY3A 4H0FA 2G83A 2CSXA 4LDZA 1M6NA 3PDHA 3V2HA 3RABA 3AOGA 2DPLA 1F5NA 2H2IA 3FDIA 1O95C 5ALLA 1EHYA 3FCSB 1T4GA 1Z13A 4BE7B 3OLYA 3C3PA 4PCUA 1N9GB 5JRJA 4JVOA 5BNFA 3Q9LA 2CV0A 1JWAB 5JTUA 3VA7A 4EDFA 2PL5A 3O74A 1QRTA 3Q6NA 1DEAA 5BWOA 4S0ZA 1XQ9A 4V3BA 3OQOA 2XT6A 5LB2A 3R74A 3WMGA 4D6YA 1FP4B 1SM4A 4UQLA 2VDPB 4UAVA 3VJKA 1IHYA 1DBQA 1T43A 4QYSA 4B6JA 4S0XA 1R66A 4LDJA 1M7BA 1AOXA 1GRCA 2YMLA 4J0DA 4EHDA 4L4UA 5F7JA 3DE5X 3EIOA 3FYUA 3KYDB 3DO6A 5EESA 3HXOA 2JD0A 3MCTA 4LDPA 1NC3A 2IA5A 1EGAA 1LNZA 2QMYA 2WC1A 3FFTA 2JA1A 2F4VB 2Q1WA 2QN6A 3QUQA 4MLDA 2AMLA 2G9RA 3QWHA 1Z0KA 3MCZA 3MJEA 5E3JA 1ZHOA 3H5IA 3KZMA 4PAMA 5EINA 4JJZA 4Y1GA 1S6YA 1TU3A 5KNCA 5K4GA 1ODKA 1BKYA 1WB6A 2AXEA 2Y1KA 3CRZA 2W2VA 1DZ3A 1JG2A 4RBNA 2P9GA 4BUZA 8LDHA 3RVRA 1E1QA 1EXDA 1CJTC 2UZIR 4DS3A 3W04A 1J39A 2XVAA 3GG9A 2Q7XA 1FZTA 1Z3CA 3VPXA 3PUZA 4ATNA 3EG9A 4QUBA 3IOBA 1X1AA 2O6LA 1IBCA 2BKLA 3QU2A 4QPJC 1QJCA 4YP6A 4OD0A 1B8NA 2GBGA 1IVYA 1N1EA 3B9PA 4NX2A 3PHCA 1CRWG 3CLRD 2GBPA 4PNHA 4WKNA 2OBMA 4XIIA 3G5UA 5CLLA 5AI0A 1T8PA 2NXWA 3KBOA 2ETVA 2J5RA 2VNAA 2JRCA 2ZIVB 4FBMA 4PC1A 4UVEA 3CX3A 5JNWA 1ZXLA 3TQQA 4TUYB 2PSEA 3HLYA 1NM5C 2PMBA 3RIEA 4MB0A 1Z28A 3LW8A 2HMUA 1JU9A 4LMAA 5FFNA 4HNAA 2ZYGA 4NDZA 4PLCA 1NN1A 4LXHA 2O8VA 3F7OA 3N6VA 4B09A 2ERYA 5T64A 4YQYA 3SEAA 5CFNA 1GEEA 3VV3A 3SDSA 4EKNB 2MYTA 3GFQA 2EJUA 4BXOA 4R1SA 1FP7A 1FSGA 3CRMA 2PRYA 3QF4B 1M33A 4JJGA 1SU6A 2B5WA 2FPSA 4LYAA 1LJUA 4NICA 3T5MA 3CNBA 4M1KA 2Y4NA 3B1XA 5IT4A 2Z95A 1UMDB 3GVPA 1BNCA 5B1DA 4CM8A 2PWYA 5AUPB 2CNWA 2IDMA 1H9AA 1V48A 3KAQA 4XYGA 1OTXA 3B7WA 5C5IA 4Z99A 3ZX4A 3BQMB 3PVCA 5F4BA 1EQ2A 2IP2A 5A5EA 5KJCA 4YX9A 2HX1A 2I5PO 2OCPA 3HN7A 5EY5B 4DE5A 3TSCA 3KTOA 3ROPA 1T91A 5FEMA 5E0KB 1S5PA 4Q03A 1CEXA 1IATA 2OB1A 1MW8X 5CJ2A 2M1XA 3JAKB 2GILA 1Z7BA 3CNNA 5JCOC 2IUYA 1Z8DA 4R81A 2RG1A 1COZA 2WTNA 4ROSA 3MBKA 4EGCB 4BGDA 1CB7A 2FQYA 1M74A 1SXIA 4DY6A 4QRDA 3HGTA 5MDHA 1I4WA 7REQA 1EFVB 2KSQA 4GW3A 4KC0A 1A9ZA 4G4SO 4POAA 4QFCA 1ZIDA 2PR7A 4WDQA 2N47A 1ZM9A 2VP5A 3NDIA 3TAUA 1MFPA 4OHVA 1RAFA 5JCZA 1SURA 2IELA 3WYEA 1KZHA 4QDXA 2XMSA 4KQIA 3H18A 3PHIA 2TECE 2I0FA 1D03A 1JI0A 1MC4A 3DE2X 3JS5A 3FPEA 4R1LA 4Z7OB 2A9PA 3FCYA 3U9TA 2DCMA 2QP3A 4X6XA 1K7FB 3ULKA 2X58A 2G4VA 3HKCA 4ZMSA 1ZAYA 1U2QA 5A9SB 4RDXA 4QOIA 2V7XA 1E1NA 2ZBUA 3F7MA 3ZE8A 4ZU1X 1B6RA 1KVQA 1WTAA 1GT91 2J9XB 4LE1A 2BGKA 3KQWA 3LX8A 4QUAA 5C8DA 5LWQA 5IKXA 1DQPA 1BX0A 1SGWA 3OFND 3GRYA 2I6TA 1AY0A 1UBNA 1XMQB 2CXSA 5DO9A 4RV9A 2H2FA 1KA9H 1PYDA 2EJTA 3HUDA 1J0AA 2XLBA 1TYDE 1LTQA 4HN9A 3DQPA 4H31A 5IDYA 1JWLA 5JQGB 4K81B 4CTKA 3NEPX 4CM5A 1TAUA 2A5FA 4DJ5X 1OV6A 3AI7A 3L0SA 4E3ZA 3RB8A 4AQYB 3CX7A 1Z7EA 4Q1BA 3LOPA 1AQJA 2ALJA 3QEAZ 1T2VA 3NIDB 4H3HB 4XDYA 5KVAA 3R5TA 3QTBA 3DG9A 2Z6AA 1U4SA 1XD8A 1EJ2A 2ZAGA 4KI0A 1JFRA 5U9CA 3VJMA 2JHAA 1CRPA 2D06A 3EAQA 5EZQA 2NP6A 4IS2A 4UEKA 3AHGA 3DPSA 3BJEA 3LY8A 4HXEB 2W8ZA 3V8VA 3WJAA 2EW8A 1D3AA 3AI2A 3EVBA 3IAS6 3MMNA 4DA4A 1G66A 1A50B 2VHZA 1GPAA 4ID3A 1I5RA 4F4IA 2B4RO 1EU1A 5FL7A 1HNNA 3ODGA 5KTSA 4JROA 5ESRA 3TZLA 4PG8A 1O94D 2JJ1D 1P3DA 2X86A 4EY3A 5CEEA 3LC7O 4XQ0A 2AJLI 2HK6A 2C84A 2GBLC 4BGIA 2WTXA 1M7GA 3DV0A 4Q4CA 4R3WA 1JSZA 5C1PA 1L5LA 1OR8A 5J4HA 3LUCA 1AG9A 2NQ2C 2CLOB 3AF1A 2CD9A 3K0SA 5HQJA 4TVSA 1GG2A 2FLVA 2QG4A 2Z4SA 3U9SA 1N5LA 1U8XX 2ZRCA 2FCRA 3ZOKA 4YV2A 1HDCA 1PEDA 3R3UA 4FLFA 5GM1A 1Y3IA 3AJ9A 3FF4A 1WU7A 1WM1A 3ZDDA 1SBNE 2EGGA 3DDHA 2J87A 3E61A 3PUXA 4Q1VA 5T4HA 3DAGA 1D2EA 3OCWA 4FE7A 2Y66A 5TB5A 2QTGA 4A4DA 1C41A 1T1IA 2GVZC 2FRDA 5A3VA 1Q0QA 2WNHA 3MXOA 3Q41A 5JAQA 1BHO1 2RAFA 4FYJA 4IIXA 2OYCA 2QM7A 4ALMA 4E30A 3AP3A 3UAGA 4YAIA 1PFQA 4D44A 1C9MA 2IZOA 4EB3A 1XTRA 2AMJA 3GJ7A 4LOJA 4R0NA 1XVTA 4GEKA 1Y82A 2ADFA 2PX5A 2JJYA 1QMPA 2FSVA 2K2QB 2ZPTX 3NBQA 3ZWQA 6PFKA 3GD5A 3I09A 2ZYSA 1WP4A 3VNQA 1A9SA 1HDGO 1IZYA 5L4NA 2Q2WA 1LBIA 2VRBA 3RTCA 2HL6A 3CH5A 3TG2A 1VJRA 2HY7A 2YCLA 3NVMB 2O7NA 4OF4A 2ZP1A 1YVDA 3JALB 4HTFA 4M1ZA 3UEOA 3WXMA 5K8TA 1Z34A 4MB6A 2ONYA 1Z63A 4RDIA 1YKSA 3TPCA 3S2GA 2Y1DA 1THTA 3D6JA 1NNLA 4CL8A 1NVFA 2IOQA 3OHSX 1FSFA 1SIBE 3T7KA 5IJ0B 3U3RA 1HQYE 2K7FA 4C6TB 3ZE1B 4NCBA 2HCBA 2NLOA 1VKHA 3HYCA 4CKWA 3FZNA 3HVJA 1G4HA 2PKWA 3OIUA 4MVJG 2ERCA 4FFVA 3CPEA 1C7IA 1MKYA 4FQ8A 1Y42X 4YWJA 1YB6A 4FNOA 4IW3B 5IJZA 3HCCA 5FPYA 2ETXA 4AJJA 4CE6A 3T0IA 2GB4A 5SYAA 5BOSB 2Y71A 1MC8A 3E1KA 2PWPA 2ZIEA 1EE2A 4BPBA 1SIOA 3GPIA 5K3DA 3TTWA 2BW0A 4I55A 1VB5A 3OLCX 1QUEA 2P41A 4ARVA 1AHIA 3AHEA 1BEUB 1ZI6A 2GK4A 4KQFA 1FVOA 2NZJA 3EVNA 1NW7A 3QVUA 4GP9A 1SVOA 4IDAA 4GOND 1FPQA 3AIKA 2XRMA 3OQPA 4U9IS 5DWQA 1PFWA 5T3YA 4B4DA 1T9GR 4F6LA 2OOKA 3DR3A 3HRIA 4FQ5A 5DWVA 5B2ZA 3SSNA 4XZ3A 1GZ4A 1E4OA 2A0XA 2J46A 4B74A 2P69A 5J2UA 2JK1A 1FEZA 3E70C 5KQLA 4HNTA 4JYCA 3NANA 3R9KA 3W5CA 1W1WA 1TT7A 4GHWA 2R7LA 3VVMA 5JZOA 1U6JA 4JBHA 3GEDA 3NOOA 5IMBA 3JQ9C 1BQ4A 1J0EA 1UEJA 1T3SA 3A6JA 4FN4A 5DHPA 3VKHA 4CQMD 1PJBA 1B26A 4HPJB 3AU9A 1BIFA 4MV3A 1RM3A 1LWOA 3DE3X 1RLUA 3RRBA 3T6KA 1QDLB 2ZETA 2EFJA 3H8WA 3A3PA 4N7RA 1IVSA 1USGA 2VNJA 4XE5A 1IZ7A 1E9AA 1EK1A 1AKRA 2YCBA 2R84A 5HF9A 4DV1B 2Q9UA 4OBBA 3T3EA 2NPIA 3AM3A 4D3SA 4XSGA 4HB2A 2L18A 2GMWA 1EFLA 2YIMA 3Q7TA 5KKNB 4J1TC 1C3VA 1SVSA 3K31A 4IVPA 3JYLA 3H13A 5E0OA 3RRMA 5IUNC 1PZFA 1ODFA 4L8YA 4TX1A 1PS0A 1LF0A 1W73A 1GSIA 4IJQA 1TD1A 3E9MA 4Y9UA 3IR6A 1OYOA 4Q4HA 1QC5A 3SK0A 4E11A 3C24A 4QYXA 2FYTA 3QMMA 2PFGA 4PFKA 2B83A 1RFLA 3LC2O 3PPXA 4MEJA 4Y6GB 4PNZA 1QVRA 1XWIA 3G8YA 1ZEMA 1YZGA 2ZB4A 4N48A 3U7RA 3KQHA 1MVLA 2DFDA 4IYJA 1TZKA 4LJSA 2HREA 2V0CA 4LMRA 1YZ3A 2XZOA 1DC3A 3U16A 2BFCB 2XNKA 3HUEA 1RWBA 5DYYA 2HTEA 4N6OA 1PK9A 3I9FA 4D46A 4LDQA 3C97A 3ET5A 1Z4MA 3SZMA 4KITB 1IN6A 4OHMA 5DXFA 2BTEA 1LQUA 3BF7A 1O87A 1V7ZA 2O3QA 1U81A 2A0FA 1D1PA 3GMIA 4DIDA 5KYYA 3ZY2A 3IQIX 2FMTA 3QX3A 1TZJA 1QG4A 5SY4A 1H93A 3GGSA 5IK2A 3WK9A 2POCA 5BUZA 4Q0MA 3A4IA 1XSEA 4FEAA 6NULA 3L4BC 4BQIA 2O5VA 2RDMA 3LXXA 1NP3A 1ULBA 3ZGOA 3HE3A 1KI1A 2V0GA 3WQQA 5JVDA 3HJTA 4QNMA 2ORWA 5LXTA 2BBSA 3NWJA 3OOSA 4OBXA 3LYAA 1Z5UA 1O0SA 3JWJA 1Y7TA 3A2MA 4GYKA 4NNPA 4B3CA 1Z56C 4CU2A 1Y3CE 3L92A 1T9ZA 1IWOA 4QQRA 3SHOA 5JYCA 1R3DA 4HDSA 3LQQA 1ZQ1A 2CVPA 4LHEA 4EO9A 1MJGM 2OE2A 4RZ2A 5BN4A 2GA9A 4BFWA 5ELXA 3DTTA 1YFKA 3SJUA 2NZXA 4KQMA 4EB6B 2C61A 3ISVA 2AGVA 3JRNA 3JZFA 2Z1DA 1ZGAA 721PA 2VTDA 3HWRA 1NWCA 1G20A 3E22A 2H7CA 2FFRA 4ZVSA 1U2DA 1PJ2A 2WYUA 2P6OA 4RD2A 1JA1A 3CCFA 3W5HA 4MS1B 4PNPA 4BBPA 3FNFA 3KFVA 4ZK6A 5BR4A 1PKEA 1Y8RB 1CRQA 4DIEA 1DC7A 3ILYA 4HRXA 3AOEC 4MS4A 2ACKA 4TGLA 5HIJA 4D9NA 2V7GA 2QUAA 4AJPA 4WCFB 3COPA 3K35A 1W4LA 4XCVA 1NN0A 2FSFA 3RYFA 1R3UA 4MQ4A 3ITEA 1AT1A 221PA 3BK7A 1TFUA 2ATVA 3HDVA 3NORA 3BN3A 4QXMA 2G77B 3U26A 1JV2B 1QE5A 3BIJA 3Q7IA 2B92A 2MMGA 3BXZA 1KQFA 3HFGA 5C2JB 1O96A 3HJGA 3KHSA 1CQJA 3LBNA 3L0DA 1E7WA 3G7SA 1TVCA 2FX2A 3L7IA 4KAAA 4NCJA 4X3CA 1K4MA 1XT6A 4I6JA 5CXQA 3OM9A 3IDFA 2CVOA 3NZEA 2BKAA 3WK5A 2A9QA 4IHAA 1NFFA 3ZZ1A 4E22A 1KYZA 5TS3A 1FQKA 3ENNA 4DLSA 3JASA 3QWFA 3PHBE 4LW8A 4WL0A 1W85A 1N0VC 1YXMA 3COWA 1HOXA 3NYRA 1D6JA 4QQNA 4KI7A 4M6WA 3P2EA 4NDAA 1ZGBA 3O95A 3V6MA 3ZWBA 2XCUA 2VJNA 3LXUX 4QGBA 4PRZA 3E2PA 2VUUA 3T94A 3U3XA 4WBNB 3BE8A 1XE3A 5IXJA 5FH9A 4YAKA 4FP9A 4NHEA 4D4LA 1E2IA 3BHMA 4O4IB 4RVHA 2Z58A 1ENOA 5EIXA 2AG5A 4FI3C 4X6LA 2Q0SA 2O2XA 3V8NA 1U8YA 1QCCA 3MT8A 4BAGA 5L7YA 3LWZA 3VKFA 1U8EA 4DJJA 3BERA 2AI2A 3DSRA 2FF7A 2GZHA 2ZWMA 4URUR 4JQCA 4LJAA 4J0EA 1U3VA 1V5GA 3HVHA 3IR5A 1MTZA 4BB5A 1L7NA 2D5CA 1JXOA 2YBDA 2ZUUA 2B82A 4HDQB 2C7BA 4EEKA 1Z2PX 3C6MA 5EMKA 2Q5JA 3I2GA 2CHFA 1ZJ5A 4Q7JB 5IEBA 1KMNA 3TRFA 1Z29A 4BWYA 4HY3A 4RMGA 3DA8A 1E1KA 1PAUA 4CM3A 4G3XA 2ZSIA 5GONF 3AK4A 4FFWA 2Z3VA 4KKXB 3PNPA 3TCNA 4ZC8A 1GPNA 4NBTA 3IJ5A 3D02A 3L7DA 4LF9B 1RM4A 4UNNA 4CDGA 1G64A 1P33A 4D0RA 2VYVA 1MBZA 4TTPA 1A3CA 1O95D 5IU6A 1C7ZA 1RZRA 4X62B 5JD5A 5AUQA 4AM8A 2WIKA 1GTRA 2JFOA 4IH9A 4EGFA 1NW3A 1WUKS 4EYSA 2W8BB 2IUSA 4O2RA 1PJ4A 4QDZA 4A6PA 3LCRA 1XQXA 2C5LA 2JI8A 3C87A 4ARZB 1I4EB 2W6ID 1OFGA 5DOZA 3NIBA 4IUDS 1HLFA 1MO6A 3BJMA 3QKRA 4MGZR 3ANTA 2JAQA 2CLHB 3VR0A 3D7KA 4BHTA 3A3NA 5EZYF 1JDPA 1RE0A 1MX9A 1ULUA 1DJNA 5TMDA 2RAPA 4L6AA 2ZSAA 2H0AA 5K1ZA 3GJXC 3U2QA 1QFZA 5AMXA 1S0UA 5HCUA 1ISGA 1TO1E 1E5LA 4FB4A 4PG7A 4CMCA 5DULA 3LRXA 4JJ8A 2Y93A 3MRVA 3CZRA 3IRUA 1NUUA 3BWYA 4W5JA 3SSOA 4ZARA 4NPCA 2EP5A 2FMHA 3F5MA 3ZCQA 4D8UA 4K9SA 3GZNB 2R6GA 3BGVA 4GYWA 3OEHD 2BSXA 2Z57A 3R77A 1ETHA 2O3TA 3TEJA 1BU5A 1W76A 3EIEA 4IO1A 1OVMA 2PRJA 2GF9A 4OHRA 1EP3B 2XNCA 4QXPA 1AZLA 1HDXA 3PK0A 4IQ8A 5JSUA 5I7FA 4J16A 1X7WA 4RY2A 1GQ2A 4M7PA 4Q1CA 4Y2HA 2I80A 5H9WA 1SC4A 2C88A 3AESB 1WY5A 3I2KA 3S2IA 4ZTUB 5IPFA 1M5RA 1HDZA 1OI7A 4HZGA 1RCUA 2IYTA 2Y67A 2RGAA 3AFNA 3DP9A 3S6JA 4F9GA 5B12A 4U63A 4WCVA 1EVQA 1Z39A 5KTTA 4UFNA 4LN1A 2V54A 2JVJA 3VR6D 2FXIA 3ILSA 5AVRA 1WDMA 4KN5A 1NNSA 4ZK2A 5SYNA 4WWHA 1S01A 4ZRMA 3N86A 4JD5A 1YMQA 3AEQA 3SFVA 3WNZA 5CNIA 3KKMA 2HD4A 1OB5A 2HDNB 1FVFA 1ZCAA 1JX6A 5B2EA 5MN4A 1BEZA 1HORA 3GHYA 1CZUA 1X1SA 3I6IA 3WRWA 1UZAA 4U5QA 1P1IA 2ZIAA 5B53A 5BN5B 5BWNA 3EPRA 3M70A 3WGJA 1G291 5DVZA 3DOCA 1GCAA 3NU1A 4ISCA 2BGTA 2F8MA 5C53B 1E7MA 3PYMA 3VC2A 1XK7A 3KNZA 2R86A 2M6KA 4Q02A 3ADPA 3GN2A 3CEAA 4XFKA 5LU9A 3NIFB 1LSUA 1S2LA 1N4DA 3ED1A 1US8B 2D0PB 1QJ4A 5JANA 3UHJA 4YUWA 4YMGA 1QHFA 2WVGA 3OICA 4WMLA 3KZKA 2IW3A 3GP5A 4X1YA 3TNLA 4DXHA 2LTAA 4BQRA 1JXQA 5DSZA 1P1RA 4CNBA 2DR2A 4QYMA 2YDYA 3K0BA 2QTVA 1PTJC 1GCOA 4M22A 1BWRA 5CA0B 2EFEB 1GZVA 1JT2A 3R3WA 3KD3A 4OGKA 3WWCA 3I62A 2B3TA 1V0JA 3KKKA 5BT9A 5U1PA 2D2EA 2BGIA 2H1IA 2J9GA 1NQTA 2P5UA 2PEYA 1U8ZA 1A7JA 3CUKA 3E8MA 3HCEA 3QOWA 4PZCA 4R68A 1A96A 4RK0A 3TTTA 4C4PA 1NYRA 2I4MA 3Q8XB 4B1FA 3KP1A 3PWSA 5FNVB 2UXCB 2GXQA 2REQB 3OCCA 3QQPA 4KIGA 4GL2A 4BX9A 3U4DA 3JQ8A 4EO4A 1CLEA 2W2NA 3PF9A 1XA4A 2BGLA 4W5OA 4OQXA 3C6BA 4UBIA 1L7PA 3AILA 3HYLA 1KFBB 3MRSA 4HLUA 4N1AA 5B1EA 5H02A 3SS7X 5DX1A 2EHDA 3WIVA 7AT1A 4C0BA 2OQVA 2ORVA 2RI0A 2EJBA 3RM3A 3VZPA 5KIAA 2FLKA 3W5SA 4MV8A 1WX1A 4A8JC 1I3KA 1EX6A 3AIMA 4KUGA 3JTMA 4NQRA 4Q48A 4AXBA 1YU9A 1DIHA 2QQGA 1GA4A 4GBJA 1D07A 5CFZA 2HHLA 4WLVA 1NLUA 4JVMA 1Y33E 4AY2A 5JQGF 3WYCA 2IP4A 5IC4A 5J63A 4L28A 4P81A 5GGXA 1L5HA 4AP9A 5HF5A 3M6XA 2WAOA 4HNHA 1NQ5A 5C46F 4G9GA 4XM2A 1VG0B 3DDZX 3S0JA 4M1TA 4DLWA 1IHUA 1A27A 1NPDA 2KLBA 3NHBA 2ZRQA 4GOLD 3LYUA 3ZWNA 2Q6OA 3EWSA 5TV2A 3ZDRA 1F0KA 3QWIA 3S8EA 1A8QA 1CP2A 3TF5A 5JLAA 3CW2A 3SYMA 3DAHA 1RTKA 3EODA 3Q7SA 1BGVA 1Z75A 1XCJA 2BCJQ 2D1YA 2P1DA 4GVXA 4QODA 4U0JA 1K6XA 3O5AA 1B42A 5LJIA 3K8OE 4Q1DA 5EP3A 4TT8A 2QS9A 2PZAA 3AR7A 3FMFA 3AUKA 3KT3A 2XQGA 4BKQA 2QTMA 5P8WA 3TZQA 2H4XA 3UHPA 5DBEX 10MHA 1YACA 2WAAA 3M7IA 5WRFA 3BDAA 4C30A 3L3BA 3AGPA 3GT0A 3TIFA 3WLQA 5I7HA 2Q6TA 1CY4A 1OXMA 4PZZA 1Q0PA 5F2KA 4MQFA 3TNDA 3JQ6A 1G2OA 1BDJA 2CXRA 4R5MA 1EGQA 1DX9A 2C2GA 3N2GB 3T4UA 4A2QA 5AVVA 4X65B 4UMVA 5ARCA 3JATB 4DL9A 1EK2A 3CKKA 1WXFA 3I5MA 4R2HA 5ARDA 4AUEA 1WB9A 2WWHA 5ELMA 2DETA 4OM7A 4G36A 1IQ0A 2ON6A 3BOSA 1RE1A 2J48A 4EL5A 1PSDA 3N39C 3KKEA 3KL2A 2FHSA 1S4MA 1C8LA 1E61A 2R65A 4X84A 1MVNA 3AG6A 3K4QA 2RGNC 5KQMA 1VTKA 2B8WA 4RMNA 1R6UA 3JYHA 2B1QA 3DAYA 2QYSA 3FHOA 3O8LA 4JYPA 4P4TA 4S2UA 5KJFA 2DQZA 3O9ZA 1CWUA 5F76A 1IJEA 2IY7A 2X1MA 4I9HA 5KPDA 4MRPA 1UDWA 4BVJA 1F8GA 3M2TA 2IEDA 2VRCA 3DUFA 3EXG1 1ABFA 1EVEA 4TS9A 4E46A 4C0AC 1X3LA 4MICA 4AJ1A 4MWGA 5A0VA 2RFLA 1SKAA 4ZHQA 1F8XA 3QTLA 3THOA 1GL6A 2EX1A 4K9OA 3KZOA 1LFDB 4CMEC 1YI1A 3W6PA 1EI9A 4YUZA 5JC1A 4X44A 4MVJP 2XB2A 1CC1S 5KOJA 1SD1A 4R7GA 2VYCA 5CEJA 1TOAA 3LUPA 4QU8A 4X93A 1MO3A 2V7WA 1SO8A 1YZFA 3B52X 3TZHA 1E0JA 2NW6A 4JSTA 4S12A 3ICPA 4ZRDA 5BP7A 2R48A 4IX9A 1JVBA 3AUUA 1JEQB 2BN4A 2FHPA 4KXMA 5CLQA 2J0EA 4JJKA 3BWMA 4OFZA 3VVBA 3F2IA 2CJPA 4WXRA 3X1JA 4ALIA 1Q0SA 1OGYA 2GAOA 4IXTA 2JVKA 4H60A 4R6WA 3VDMA 2IYPA 1W581 1U7PA 3FPFA 5JADA 3IP1A 2XMBA 5H80A 1LW6E 2W83A 3O75A 2ZR0A 1PEKE 2IKSA 4HQOA 4BO9A 1CUHA 3T4XA 1ZJ4A 2QM0A 4PHHA 4QFBA 1YB1A 1X8XA 2G36A 4CKBB 1OLUB 3TSWA 5EJ5A 4CM4B 4CLRA 4F93B 1QPGA 1SUCA 2JC3A 2Z5FA 3KC2A 3PG5A 4IP0A 1SD2A 3ZWKA 1BDMA 2UUAB 1GR0A 3AH8A 2Z04A 3E9DA 4OP2A 2IEYA 4U2KA 1Q84A 3IALA 3DNPA 3L02A 3PQ8A 1YFLA 3LPDA 2HXYA 2AX3A 4N49A 2IF0A 2UAGA 2GN0A 2DY0A 2F55A 1S9DA 4QBGB 2XJ4A 4ZWNA 2ASEA 4BFZA 5EJEA 4HPWA 4NJOA 3VAAA 4KP7A 4IHQA 5DDIP 4RD4A 5E1MA 4BWGA 4YMHA 1GJRA 4JSRA 2PHZA 1U8AA 1LX6A 1RHUA 4UTOA 1WW3A 4BB6A 1LSJA 4OGWA 2D3WA 2J8ZA 4RH1A 1XZ8A 5YASA 1R4NB 4BNDA 3D0KA 5DCUA 2PH7A 4TMZA 1NRJB 4WK2B 3IJEB 4GI7A 3WRYC 5GJBA 4UULA 1CZNA 4J29A 2F3RA 3O3CA 2QF7A 2P77A 1CS4C 3U4QA 2AMYA 2WTMA 4WNAA 5CAEA 4LWZA 1VPVA 4MRSA 3D43A 2JLXA 2MJLA 3LM8A 2ZCJA 4DSOA 3UWOA 3A1VA 2O8FA 3NM6B 2JIZA 3DVRX 1DWQA 4JKOA 5GOZA 2CY0A 1C3LA 5J1SB 2FG6C 3OHPA 1MVOA 4RWEA 3GJ3A 3EF3A 2DWCA 3VR2A 1E2UA 1CUDA 5JBNA 4AKEA 3QE9Y 1FDUA 1QH1B 1TU4A 2QN1A 4L15A 1T9DA 4AYWA 1YRYE 3FLMA 4XYLA 1L7RA 3FNQA 2J3MA 2HDWA 1ZKDA 1MB3A 4HAIA 3AI1A 3I76A 2YVAA 4YJ3B 1JFFB 1XAHA 2DRIA 3W6UA 5TQVA 2ZJ8A 1ZNYA 7MHTA 2EU8A 3D8RA 5K8VA 1E94E 5CD1A 4L4ZA 2XBLA 2CMKA 5J59A 4W7IA 1KJ8A 1RQLA 2C94A 3IAAA 3IT0A 1MC5A 3MBIA 4TVOA 521PA 3KDAA 4D99A 2EZTA 2FDRA 3P19A 1FLDA 3LKVA 3ZLVA 2H1WA 2SKCA 4DAEA 1YDWA 3LBIA 1QF6A 3L46A 1M8KA 5F3RA 3SC2B 5DYIA 3AKYA 4PTYA 1YL7A 2PX3A 4UM9B 4GVLA 4QBTA 3N7TA 1SOVA 1YHYA 2NO1A 3GUVA 5LYJA 4H27A 1G1AA 1HFEL 5DEOA 1RSZA 4YLYA 4KE9A 1X1TA 4J91A 3EMKA 4R0VA 4PQFA 1J7JA 4AK9A 3U6BA 3H11B 4IIVA 3SMQA 3X2EA 3ZWWA 1XD2A 1I0LA 3NWBA 4IV0A 4BNYA 1TYEB 1R4ZA 2FJUA 4WOJA 4IQFA 3OZIA 4Q93A 4OEHA 1ZOPA 4NMHA 2JDID 4BTEA 2QUHA 3A2NA 2CFIA 1IHPA 3TIGA 2RG7A 5D3MB 1OLSB 2PKYX 1IBRA 3TLGA 2J3DA 1U4NA 1R0SA 1J0BA 1WDWB 3V1UA 5CA0F 1IU9A 1QKJA 1DIGA 2GO7A 3DTNA 4MA5A 5KJ1A 1FW8A 1L7XA 3T61A 1P0CA 3DOJA 2X22A 4F0JA 5A0FA 2FN4A 5H83A 1B8VA 2ZJOA 4TZ0A 1X80A 4G0MA 1QSGA 4AZ3A 1JZSA 3D1JA 1GUFA 2LW7A 1A72A 3QKSB 1OROA 3RHTA 1CQXA 5KKAA 2AI1A 2H11A 2WHPA 3A4NA 3T35A 4EGQA 3QNWA 4IDOA 4PXSA 1QIHA 2YMMA 1DIOB 5BQOA 2DPXA 5ADVA 5HX7A 4XIJA 4MO2A 2WYOA 5KJEA 3O8DA 1RXCA 1UDXA 2GASA 4J9VA 4OLJA 5EUCA 5C8YF 2QORA 2RD2A 2IK8A 1JI3A 3N8DA 1KBOA 5CBPA 4DAOA 4YCMA 1C0KA 3ESYA 2Q6IA 1JHPA 2A3NA 1RLIA 5ENVA 3ZWXA 3DZIA 4Q16A 3ORYA 4GOXA 4JCCA 4B35A 4KODA 1I9CA 1B2RA 5G3ZA 1I2BA 1WF3A 5IC6A 1LI5A 1PWEA 4Z7QB 2MSWA 1SXJB 2H9AA 1AZSC 3C5HA 1AHNA 1U1IA 4QU5A 4FSDA 2PXAA 5JD4A 5BMVF 1X8LA 4QSMA 3CUVA 1LJ8A 2GSDA 1GIAA 2GEJA 3SF8A 5LMZA 2I1QA 4GYYA 4MKRA 4OI0A 3S8MA 1COWD 3R9WA 1HZZA 5HILA 2NTNA 4MRMA 3AM1A 1WVIA 1ZY2A 2ECPA 3CLSC 3A58B 2Y1GA 2Z3WA 3D7LA 3HH8A 3K71B 2NMVA 5JUWA 4B40A 1PFUA 1G0OA 3GRVA 1P0IA 1RLOA 3CXUA 4UUBA 1SWWA 5ESXA 5K51A 4AROA 1N7HA 2ZKIA 3AEYA 3UICA 1XXLA 1Q0RA 1C0PA 1M34B 5JMTA 1NRWA 3N2KA 1P17A 2PRSA 3DXYA 1KZYC 1W7AA 2I87A 3I3SR 1RP1A 2ZSEA 1R6XA 2BFBB 5LP6A 4P3OA 1SUEA 1U8UA 2DYKA 2PSFA 3PLNA 4GFDA 4H1UA 1VKRA 4LYFA 1MGOA 1R6TA 3CRNA 4N3NA 5G40A 4EZIA 4AT1A 3DC7A 2WUVA 2B1JA 3GC6A 3IQEA 2OC9A 1U9CA 2G70A 3FHJA 2WYVA 4FCCA 4JB0A 4RTMA 2HHJA 3QEOA 2IYZA 3BMQB 4PS0A 2DAPA 1QB8A 2VXCA 3D3QA 5IVHA 4XPIA 5DK4A 1EDDA 1ZINA 5JH7F 1NSFA 4V1CI 3PC2A 1ZMTA 1ZK1A 2IYQA 1UBSB 4P3YA 3GEMA 3N8KA 4WBXC 3V8PA 2DLCX 5K4AA 1QHYA 1KAEA 5K6AC 4XVHA 4XWYA 5KYUB 1T2AA 3LPCA 2OO5C 1YF3A 2Y99A 3UMMA 3S68A 1N2CB 2W4QA 3VGPA 1T2NA 5TJ9A 3WRXC 1SA0B 2IL1A 4DGSA 2OXFA 3KJXA 1OTYA 2HADA 3RASA 3VYWA 3VYVA 2XRZA 4PVDA 4KSCA 2FR8A 2HJVA 1PZHA 2AFHE 2YDXA 1RLMA 3INGA 1D6SA 4LHWA 4A0RA 3ROQA 3AERA 2J3LA 4PSUA 3MWFA 3H5RA 1NQVA 3IEUA 4ZCLA 1MQSA 4G6ZA 1PWYE 4FMDB 3T0FA 1U7TA 5JZ9A 3QNUA 1OBVA 3AR5A 5ILQA 4AJEA 3C7CB 1X6VA 1FMJA 4UTVA 2HXGA 1KIAA 4YRBA 3FVWA 3DLCA 1OIVA 2HWYA 3ICQB 3ORFA 2I6XA 3C14C 3JZMA 2JHGA 5AIAA 4BJ6A 4MVJF 5J23A 1WV1A 4I4TA 3GPLA 2GBCA 2R1TB 1IXYA 4I1IA 4NAUA 2X23A 3AYZB 1YRAA 3WISA 2YQ5A 1FMTA 3CIOA 3U56A 3VO1A 3ZE0B 5MHTA 5KYKA 1UXHA 2DPMA 4OB7A 1Z62A 8ATCA 3PUKA 2VRWA 1PFGA 5ICMA 3FTNA 3UXMA 3Q8KA 1YV9A 4HX9A 2XNSA 2F1OA 1NUSA 2XSZD 1KDZA 1T6ZA 4DHEA 4EJSB 2XXBA 2XGJA 1C3XA 3FNGA 3DVAB 3GB9A 3O8QA 4YB8A 5K20A 4G5QA 2B61A 2AJDA 4TSKA 4TTSA 2P3OA 5JJKA 2WG0A 1LPOA 4MUBA 3IA7A 3SI7A 4CDMA 2VJLA 4L0QA 4K0KB 4HZUB 3N7UA 1FTYA 3L0OA 1F38A 4ZT3A 1Y8QB 3RFFA 1XMVA 4S24A 2QVYX 3MF4A 3FSJX 3QBJA 3AKZA 1UQTA 2QAGA 3MLEA 4FMCB 4X1IB 4B4WA 4EF6A 2WF9A 1RWQA 4FR2A 1OH6A 3V42A 4CLOB 4EW3A 3CTMA 2J5BA 1RPAA 4KAXA 3P1JA 2XBMA 4W5HA 3CO0S 2HUPA 1E66A 4GVPA 4RK1A 2C4VA 3HCRA 2B2CA 5B58C 3DCJA 3LL7A 4YYEA 1GPYA 1UUFA 2BI4A 4WBSA 4B73A 3PX7A 2Z2IA 2KBFA 5F1OA 4OSPA 4B32A 4CXMA 1GKUB 1XZLA 3CW8X 4P7FA 5I7OA 3IQXA 1H0SA 4D9GA 1UZNA 4KKVA 1JR3A 1QG6A 3GOQA 4OHPA 1TRHA 2FZ5A 4I46A 4BO4A 4D9IA 2P6PA 3B5IA 1KSHA 3D6FA 3OPQA 2ODPA 4RK4A 5JNSA 1I2ZA 4HWKA 5FA6A 3QMVA 3RVNA 2QUZA 3NRCA 2AFIB 5ESDA 3QYAA 2ODQA 1HQDA 1IY1A 4J49A 4P5PA 1MIHA 2AEFA 1U1GA 1JBQA 3F1LA 4GKJB 2OCBA 1VLVA 1E5QA 4H7PA 4OYHA 1DKNA 2D0OB 2BLLA 2VTBB 1UJNA 4CTNA 5EXTA 3ABQB 1ABEA 2R6FA 3WMFA 2X8BA 3H8JA 3LQFA 2IV2X 2H9IA 3EGXB 1X2EA 1NBMD 3E1SA 1PCXA 4OH7A 1GTVA 3BFVA 2NACA 2WHYA 4PAOA 1YZQA 4ENQA 4UAGA 1WHSB 3UA4A 5BVGB 4CMBA 4LXXA 5LBTA 5L45A 5CB6A 1FFWA 1UK9A 3BD6A 3GFSA 5GAJA 5ALRA 1IY9A 3VR4A 2I54A 1WPGA 4BQOA 4NH0A 2Q8PA 4JL6A 4AF8A 3N2EA 4DCPA 1NLMA 1KEPA 4WFKA 4BNIA 2XOKA 2EYUA 3MRXA 1SOAA 5E6UA 4ILKA 5HM8A 2ENWA 5KTRA 2C5SA 3KQKA 3I1FA 3ZE7A 2KB0A 5EJFA 2IX3A 1U1FA 4PN7A 4U9UA 2SKEA 4GQAA 3VYTB 3O2QB 2H4FA 4A0QA 4YXWA 4DZRA 1PZNA 1V41E 3WL4A 5KOIA 3B8HA 4HLQB 3FI0A 3UCXA 4N0QA 4OI1A 2PUAA 4UDOA 3B3JA 4FB5A 3ESCA 4EJ6A 1BC5A 2AIRA 3C41J 2WTAA 2GPYA 1L9XA 4NL4H 5EHNA 3BE5A 1UP7A 1HH4A 2C07A 3TI7A 3ACCA 3KTAB 2DFVA 1E2EA 5DCYA 3K20A 3X1KA 1Z5OA 3ID6C 4QECA 3WGUA 5IUJC 2WJGA 3IDSA 5A2QA 1H2BA 4YDRA 5DTEA 5EWJB 5CFRA 2B8TA 5IXSA 3H1TA 2KX7A 2WI8A 1LTKA 2ZBFA 1J7KA 4C4OA 4PYOA 4PW0A 3T5PA 1H0KA 2VEOA 1TIPA 2R6ZA 3WS7A 2K2WA 1W5TA 2GZ1A 2ZEJA 4HB0A 2B35A 4HQRA 3NYIA 3KQTA 2YWRA 3ONFA 1JFTA 1ZFNA 1P73A 5FQOA 3FCCA 3OCVA 4JJFA 1F0PA 3BRCA 1U3GA 1XCGB 2RHLA 3ZCVA 2JBAA 2IEAA 3K72B 5F98A 1L6RA 3W1WA 5FPSA 3OF5A 4EHAA 5CEFA 1N6KA 1FJGB 2BEJA 3H42B 4E5VA 3ETLA 4NNJA 4IAOA 1K0FA 3I4CA 3SEZA 4N9WA 3LA8A 2ZE7A 3DO5A 4MVCA 4BVFA 1VOTA 4EM6A 4E2WA 3INYA 1QQ5A 1V4NA 2AHRA 1QWSA 2WA1A 3D3JA 2OQIA 2R00C 3ZC3A 4DLRA 5JLJA 5JPCA 1ILEA 4ND2A 4PZUA 2OAQ1 4QVKA 3DHWC 1IB0A 5A05A 2EBHX 4TL6A 4UEWA 2J7PA 2R4TA 1KPHA 4UNSA 2IHKA 4YMSA 2D62A 4KX5A 3RLIA 1KAMA 2I2DA 1WOYA 3EG9B 4A27A 5CD9A 1SK9A 3T1OA 4LNUB 5EEHA 1QIIA 1IWBB 4WCFC 1NR5A 1RI4A 5ADUS 1NYTA 1CRZA 2PGNA 4IDFA 4TS4A 5T7BA 1Y9EA 2IHBA 1YBMA 4UM8B 2IHUA 4EG4A 1DBIA 3O73A 4X64B 1Y1RA 3K5IA 4PRLA 3AFOA 3GP8A 4MOWA 3C7AA 2O7VA 3F6SA 4G07A 2FXVA 3H5NA 4D0NA 4HNAB 4FD3A 5B7NA 2IVFA 2XKJE 3NHZA 4AI6A 4A1FA 4MXDA 4G5SA 1GARA 1QGAA 4IIJA 5MGNA 5CK4A 3HXTA 4W6ZA 3QYFA 4A2WA 4MI1A 3T7IA 2UYHA 3DH0A 3ESXA 4Y30A 5FTLA 5JEDA 4GRIA 5JO9A 1KU6A 1DWUA 3UT5A 1TMKA 3KSMA 1H3FA 4L3OA 3DDNA 4TKZA 1OHHD 2A4MA 3C3MA 4GXTA 2BY4A 3B1WA 2CLSA 3DWIA 3AR8A 3HI6A 3VU9A 1NX6A 2PCJA 1EFAA 3T9DA 3AYXB 5JSZA 1OASA 4XW2A 3ENWA 4X24A 1AMOA 1WSWA 1K68A 3DEZA 2F90A 2CUKA 1ONNA 4MCIA 2QW0X 5CCDA 3JQQA 3FJYA 4UD6A 4WZAE 3SVLA 1W4ZA 2B7LA 1G21E 3AKCA 2XVYA 4BMVA 2V5VA 1TVEA 2OZPA 5E7QA 2VYNA 1E59A 2KJQA 3EULA 1QQTA 3KPWA 4INZA 4N3CA 3ZZNA 3ANLA 1PQ4A 1RI5A 4DMLA 4DIOA 1O77A 1NN3A 4FD2A 3TLBA 4CCYA 1TAHA 3ENZA 1NSTA 5C7OO 5I9IA 1JHVA 3I53A 2WSYB 2IUUA 1PW5A 5AT1A 1Q20A 4KR2A 4XB2A 3K1ZA 4IJKA 4EGSA 4MAMA 2HOQA 5IKEA 2H3EA 5CGZA 3BJIC 3LVFO 4Z54A 3ZQJA 3L8EA 4RKEA 1YQTA 1O58A 1QO0A 4XD2A 5KYVA 1UJ5A 2G5CA 4DWOA 3Q3CA 1JDTA 3BEOA 1NMYA 1U3TA 3G85A 3IT1A 2FZEA 3IVMA 4O2AA 5CHYA 3AVYA 3G8CA 2DC1A 1X7XA 1H69A 3IL2A 5BWLA 3ZDCA 5IKOA 9ATCA 5A3RA 4F4CA 1FS4A 3CSDA 2Z1MA 1FSSA 1NI3A 1RQNA 2WSSA 4YXFA 3VQTA 2QTCA 4ZYZA 1T4MA 4GWGA 4XM0A 1ZZEA 2XPCA 3OWOA 1MCZA 1N6HA 2D1FA 3HKCB 3LTEA 1WCV1 1D4OA 1JIUA 1ZEJA 4EJMA 4ENTA 2P9YA 4K0RA 2ZITA 2J9FA 4R7TA 4BUJA 2VAMA 3CINA 4HGZA 4N3BA 3ZYCA 4A1OA 4F4FA 1G5RA 3T3IA 1SBHA 3VVLA 2JGJA 4ALLA 4BB0A 2C9DA 2PKQO 3IVAA 4PO1A 4RHYA 4CM9A 1RHRA 3CR7A 1RI3A 5ETJA 4E03A 4B0OA 5LZ2A 3LDFA 4JI8B 2OWEA 2QP9X 4UUQA 4GZ3A 3F49S 1QU3A 4KFUA 1ADJA 3P2JA 1L4KA 2R6AA 2WU8A 1K92A 3L7OA 3Q98A 5FBLB 4YP7A 5AHKA 5JNLA 5JJIA 3DTVD 2BMVA 3CF6R 2HSDA 5DRYA 1MV5A 1L3BA 3OOWA 1ZG3A 2CK3A 5JNRA 4MEBA 1L8AA 2E4AA 5JXJA 4L50A 4DV0B 3PNYA 2B8EA 3S99A 3KU1A 1R15A 4YQZA 3ER8A 2A2ZA 4BMPB 3GLGA 2A94A 1E2JA 3BUSA 3BDIA 4IXWA 2DHQA 2UDPA 3EJ6A 4NQZA 1W6UA 3NDJA 5KCMA 2WVHA 3NRBA 4UBOA 5EJ4A 4E5YA 1A5ZA 1EE1A 2HN9A 2XD4A 3G0IA 4ZEVA 1FDOA 4R1PA 4G1BA 4CG1A 2GBIA 3WNQA 5DT2A 4KH0A 1V7QA 3OFVA 3THYB 1CETA 1T4CA 1KEEB 1RXVA 1Q1ZA 3J81A 3WX0A 3ZCTA 1XDZA 2QSJA 2C42A 4H3KB 2GZDA 3P2IA 1K3UB 4BNUA 4X66B 3LH5A 5AWFC 2B5OA 2C4HA 1JFLA 1KQNA 1ZUHA 3BB1A 5CU7A 1RT9A 4KXWA 4EB0A 2PZKA 1C7QA 2M6RA 3FNHA 2PBLA 1LX7A 5LKRA 2Q3EA 3VJRA 3TZEA 1KDVA 1SOUA 4N7MA 1G59A 2QE6A 1UPFA 3W6OA 2DBVO 2ZIUB 4MYUA 4QPCA 4MQEA 4DYVA 1Y3AA 3SZLA 1YDMA 1Z0UA 5KMGA 2ISCA 5KU7A 3NGXA 3GJQA 3Q2IA 1V9LA 4BN4A 4MS3A 3V1KA 4QOSA 3ONDA 4B5LA 1TJ3A 1IEXA 1P44A 1UZMA 5EJ6A 4PZLA 2BGWA 1IOZA 1TK3A 4MV4A 3VTKA 4WEQA 3R24A 4DJDC 4F12A 3PCRB 4YR9A