1QTNA

Crystal structure of the complex of caspase-8 with the tetrapeptide inhibitor ace-ietd-aldehyde
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
152
Chain Sequence
b'DKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-8
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title The atomic-resolution structure of human caspase-8, a key activator of apoptosis.
pubmed doi rcsb
total genus 51
structure length 152
sequence length 152
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 1999-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qtnA00
4NOMA 3IBFA 4IEFB 1SC3A 4HQRA 3EDRA 4PS1A 2CDRA 5IAJA 1PAUA 3D6FA 1QX3A 2HBQA 2J31A 3EDQA 1I3OA 2CNKA 4N5DA 4D3YA 2HBZA 2H4YA 3KJNA 5I9BA 3K7EA 2QL9A 4FDLA 4JQYA 1RHMA 1SHJA 4EHAA 5LUAA 4LSZA 1GQFA 5LU8A 3UOAB 4QTYA 3V4OA 3NKFA 1QTNA 4N6GA 4QUJA 2CNOA 3S8EA 4EHKA 2Y1LA 3PCXA 4N7MA 1K88A 4DCPA 2J30A 3V6LA 3BIJA 3V3KA 4I1PA 2XZTA 2XYHA 2H5JA 4FEAA 4QUBA 1NMQA 3KJFA 1SC1A 4ZVQA 5IAEA 3SIPA 1RHRA 4FXOA 4JR1A 3PD1A 1RHKA 3H11B 2NN3C 5K20A 5IAGA 2C2OA 4EHLA 3GJSA 4AWBA 4ZVRA 4FGUA 3UO8B 4AW9A 5IAKA 2FUNB 3DEIA 3DEHA 3QNWA 5IBCA 1PYOA 4QUDA 4EJFA 1I4OA 4I1RA 5H0IA 2WDPA 2H5IA 3DEKA 2H4WA 4QUAA 4PRZA 4AWAA 5IARA 4JJEA 4ZVTA 2CJXA 2XZDA 1GFWA 2AR9A 1RWWA 4D3ZA 2CNLA 3GJRA 4QUIA 1M72A 1F9EA 5I9TA 2FP3A 4EHNA 2H65A 3GJTA 4ZVSA 4NBNA 1RHQA 2J32A 3H0EA 4QU5A 5LU9A 1SC4A 4DCOA 1F1JA 3E4CA 4EHDA 3H13A 3S70A 4PRYA 4QUHA 1RE1A 4PS0A 1RWKA 1RWOA 4ZVPA 3D6HA 2QLBA 3NR2A 1CP3A 2C2KA 2H48A 4JJ8A 1NMSA 4DCJA 2HBYA 1NW9B 2P2CA 1SHLA 1KMCA 4QULA 5LUBA 3GJQA 1K86A 1RHJA 1RWXA 4JR2A 3V6MA 2QL5A 4QTXA 3DEJA 2DKOA 3OD5A 3P45A 4JJ7A 2H54A 5IC4A 1I4EB 1I51A 2XYPA 5IANA 5IBRA 2H51A 4QU8A 4NOKA 4D3XA 5IC6A 4NOLA 3ITNA 2C2MA 4N7JA 3R6LA 5IBPA 2QL7A 3R5JA 3R6GA 4HQ0A 5JFTA 4NBKA 4IYRA 4EHFA 3H11A 2J33A 1QDUA 2Y0BA 1BMQA 3NS7A 4NOJA 4ZVOA 2XYGA 3V4LA 2FQQA 3SIRA 4EHHA 3V55A 1RWPA 2C2ZA 1RWMA 1RHUA 3R7BA 4QU0A 1ICEA 1RWVA 2HBRA 3KJQA 3P4UA 4N6NA 4NBLA 3RJMA 4QUGA 2K7ZA 3IBCA 3H1PA 2QLJA 4JR0A 2C1EA 4ZVUA 2CJYA 2CNNA 3R5KA 2QLFA 4M9RA 1CVRA 4JQZA 4QUEA 4HVAA 1NMEA 1IBCA 4QU9A 5IABA 3D6MA 5IASA 1RWNA 4N6OA 1JXQA 3PD0A 3R7SA 4JB8A 3R7NA
chains in the Genus database with same CATH superfamily
4UTXA 1QSGA 4KIWA 2Z83A 3UH0A 1NW6A 4RGQA 2AA3A 3IILA 1NDQA 2ZT8A 3C5VA 2RI1A 2RJ3A 3D4IA 3PFFA 4GVXA 4R51A 3UWSA 2BHLA 3R5SA 3I01A 3WA7A 2PG3A 4GXNA 2I3GA 4PLFA 4HGQA 1F1BA 1Z83A 3MOSA 1TZCA 4ZRMA 1UDCA 1A2KC 1YQUA 4ZJYA 5JDIC 2P6RA 4K8OA 1QO9A 3G9ZA 1I4LD 3U4QA 3MERA 1DHTA 3FPKA 2QRVB 1B23P 2FMHA 3I1JA 4H16A 4WKPA 3WNDA 3QXHA 2VDVE 3BCSA 2BEVA 3UZUA 4DA6A 1SUIA 4I1PA 2PUBA 4XGQA 3VHRA 3JWEA 4FEAA 3ZD6A 2C58A 1UXGA 2IP4A 3LKZA 3NHJA 4JSRA 4D4JA 2VPZA 4DIBA 3CNNA 2H31A 1B0UA 5ETJA 5EXPA 3KLMX 5T4EA 1XEXB 4HQKA 1I5RA 4ND8B 1TTHA 2RHBA 3QQPA 4FR0A 1YMVA 1IN5A 3WL5A 3KVYA 4L4UA 3KT0A 4G2TA 4EEKA 4ER7A 2ZBDA 1BOFA 2P0EA 3FBTA 3PWKA 4J2TA 4UBMA 2A1UB 2PCJA 5EG5A 2O1WA 3M2PA 3ZGLA 1H8HA 3QELB 3IP5A 1LLCA 1VGRA 1I24A 2EJVA 4G0XA 4MRVA 2AT1A 1PVOA 1MPXA 1T1EA 1ZW6A 1G16A 2G5TA 3NW9A 4FONA 3UH1A 4BQRA 1XVAA 3EE6A 3EQ7A 1WNTA 1Z5WA 3GJRA 4Z3DA 4CIVA 1PQUA 1S4QA 4QG7A 3ROMA 4ZVSA 4Q37A 4BMZA 2HAEA 4QOIA 3LUFA 1EP2B 3KR9A 3CZMA 5CM8B 3RKUA 2I2DA 4PRYA 2GJ8A 4GOND 1L4MA 3LVFO 1FDWA 2IKSA 3LK6A 4PX9A 5ECDA 4A3SA 1U0FA 3A6HA 2WIFA 3D7KA 1UKBA 3OLWA 3GEGA 4FBMA 1E98A 5C4MA 2X2EA 5FLXA 4Q9DA 3SC4A 3TXAA 1N4AA 2HK8A 3EDOA 1VL6A 2IE0A 3DDOA 4D8UA 5C1OA 4OEHA 4M7PA 3TBKA 1UXHA 4F3CA 5LOVF 3T38A 4MJLA 5D7NA 3ZPXA 4Y30A 3ZWCA 1ZL0A 1EVLA 1J49A 2QRKA 2PFKA 3SQOA 2PUEA 1GHTA 4UAGA 3G0IA 4Z7OB 1T1RA 1CUVA 5AOAA 2OHJA 4IJVA 2J3KA 4PG8A 1IXRC 3TW4A 3WZLA 5AW3A 3M6FA 2R8OA 4JWTA 4XUDA 5FBKA 2FPXA 5IEJA 2YV4A 2ONKA 2R6CA 3SCZA 5HCUA 2X4DA 2UUAB 1NBMA 5HE8A 1I7LA 3WV5A 5A4IS 2RKWA 4G1EB 1E3WA 3OIFA 3DMRA 2X6QA 4M22A 4MCJA 3TBFA 4K40A 1XROA 2AG8A 2NU6A 1ISMA 2AX3A 1VDMA 4QT4A 1XQVA 3ESYA 3FPBA 1RPJA 2IHKA 1OMOA 3FOAA 3FR8A 2IZ1A 2Z5FA 3INNA 3MJDA 1PL6A 4G4SP 2QJWA 4B79A 3BDVA 3DTNA 2PL5A 1W5AA 4XJVA 2XCQA 5BUSA 3LYAA 4XQGA 3V34A 3VQTA 5CTAA 1CPYA 2XQGA 3PD0A 4BTLA 1SIOA 3PA6A 4X63A 2AN9A 3QU9A 1FUIA 3RH0A 4ASUD 3GLGE 2FJUA 3N2GA 3EIFA 4FLFA 4U9IS 2MYUA 2WKWA 3PHBE 4TTIA 2QRNA 4LBWA 1IZ0A 4WOBA 1OREA 2FQYA 1IH8A 2QENA 4DCVA 3ESCA 1YUNA 3O2JA 1DCKA 1ESNA 1VI2A 2NU7A 3FW1A 1EFAA 4R7ZA 4YAGA 1UEXC 2IPOA 3F78A 3BB4A 3MWEA 2N46A 3H7IA 4IR7A 1R4MA 1H0SA 2XQKA 4OQYA 5AVYA 4G0VA 2QN3A 5P8WA 1YBHA 1GKLA 1ZVKA 4J9UE 3SEFA 1ESCA 5TQ0A 3OT1A 4L9WA 4LSGA 5B3AA 5KVCA 2HIAA 2BFFB 3DXZA 4JC5A 1NI4A 1ZIDA 3NORA 4W5HA 4ZVQA 1UK7A 3JQFA 4U2CA 2WILA 4LN1A 5IUJC 2H1OA 2JEYA 4V0QA 4YO7A 3VPAA 4AZTA 5LZ9A 1OWPA 3QKSA 4URFA 4F12A 2R62A 4BLVA 2FKNA 1YBFA 4C3VA 1KOFA 1O6FA 1YB1A 2W5UA 6PFKA 4UJ3A 5TVGA 2NVOA 1WTCA 1ORVA 1C14A 3PG5A 4V0KA 2F00A 5EJEA 2CLSA 2IVFA 5P21A 2Z4TA 1U0RA 3GRKA 3QKSB 5A9TA 2QQ5A 3STXA 2BDUA 3TW6A 2D1QA 5IARA 4GPEA 5DVZA 3QOFA 1VE9A 1YS6A 3HCEA 4TV9F 4AJ4A 3LQKA 4DNPA 1KYWA 1FQOA 3I09A 3ZS8A 5JXJA 3COVA 5TJ9A 1I2BA 2VHXA 4MW5A 2OXIA 2PKQP 3GNQA 5H7XA 4EG8A 4QJ5A 2CB9A 4FSHA 2PEYA 4MWTA 3MJTA 4I1SA 1ID1A 1AURA 2GEJA 2CUNA 3TOCA 2J09A 2X7JA 1JSCA 3C6QA 1RWKA 3JQ8B 4U9UA 3I1IA 1UDAA 4JLMA 2B8TA 4FOSA 4KIJA 2XVMA 2J6CA 4BOYA 4QHSA 4CL0A 4D2IA 1LK7A 1SC6A 1ZO8A 3RREA 5BT8A 2X40A 2CLKB 4K9SA 3K2QA 2BEKA 2WHXA 3IBYA 4LMRA 4OJKA 4R8MA 1CQIB 1GNVA 5LUBA 3TIXB 3II6X 3H0CA 4QULA 5IFKA 1JE1A 3K9GA 4EGAA 5LIRA 3R44A 3JWPA 3VYTB 2AIRA 3FWKA 4XM0A 1P3Y1 2ERYA 5EFOA 4R1QA 2FXIA 1PJ4A 1W1IA 4E5VA 1O0CA 2VDPB 4H7DA 3IFSA 4U7FA 2BLLA 5FI0B 4C0HA 1AN0A 2FCAA 1DUSA 4WCVA 5JFTA 1NVMB 3C4QA 2QDKA 1AKVA 1GD1O 3IP9A 4LJ7A 1K6MA 3WJAA 4AF7A 1J8VA 3BGIA 3SYRA 2C98A 4BNUA 1LBTA 1MQ8B 2HT6A 3SYKA 3TQIA 2K4MA 1R66A 3N75A 5DCLA 3EZGA 1GA1A 2C4UA 2O2DA 2XGOA 4AZVA 4IQFA 2NG1A 1T2NA 2V5AA 3KQUA 4DOMA 2R4UA 1NV9A 1I5OA 2HR1A 1MB3A 2ZR0A 3NXKA 4YFVA 4Y67A 3VOTA 2BTOA 3E0XA 5BT9A 3L0OA 2WTXA 2JLCA 1DV2A 1T2AA 3DE6X 3LBYA 1NAIA 2X58A 4PNZA 1TAHA 3UJ8A 3RSGA 3H6KA 2MYTA 4MTLA 3E8MA 4NEHB 3VHXA 4EH1A 2OV2A 3R7FA 4GE3A 3WMEA 4JMPA 3E8SA 4HK4A 1XA0A 1XU4A 3JV7A 4LJ4A 1OAAA 1HKHA 1QZ3A 4MCIA 3ESAA 4TZ0A 5FUVA 4EECA 2GRJA 3MNFA 4HNAA 3U56A 3VYSB 5EZSA 2B2CA 3RS5A 1GM5A 3DVQX 3IUQA 5CA0A 3GFSA 4BRUA 1VLQA 3DMGA 1UT8A 5FOSA 4R9UC 2OYCA 1E1RA 2V5UA 4RA6A 3I5AA 1S3FA 4W9NC 3ZQ4A 5FLEX 4D92A 4JLAA 2ZUEA 1UZAA 4QSMA 1A88A 3KCNA 3E58A 4BP8A 1TK2A 1B1AA 5FUXA 2H9AA 2GZDA 3PX7A 4K2HA 5DWQA 1FJGB 5CA0F 3EUWA 5BQXA 3W05A 3LF2A 2GKGA 2KS6A 1XTRA 4GICA 4HXYA 5CIWA 2ZIUB 4WIAA 3ZS9A 5KEIA 3FMGA 4OQDA 1II0A 2ZQYA 4ACAA 4Q4CA 2LTAA 5ADWA 1AKUA 4NE2A 4DLTA 3BRWD 4NR0A 3TQHA 2XNDA 2O8FA 1SXIA 1CUJA 4EQZA 1AGRA 2EU8A 3LLMA 2NO0A 1THMA 1ULBA 4L0CA 1XT6A 3UCEA 2YJZA 4J0IA 4BAGA 3NP7A 4EHLA 2R6ZA 1ZAYA 3S5JA 2YZMA 2ZSUA 2VJPA 4MYUA 4FGZA 4GBMA 2EFJA 2Q2WA 2AWOA 3C43A 1HF3A 1XWIA 3ZU3A 3ZX5A 1YFLA 4LTDA 2IXDA 3D0OA 2OAEA 3L5KA 4OSPA 4D9EA 421PA 1BH6A 3O84A 3SC3A 2IOYA 5AM0A 4TVSA 2VZLA 3AESA 4GIBA 1I2ZA 4KXMA 2IUFA 1CZOA 2YXLA 1OIVA 3DQPA 2GASA 3QY0A 5MHTA 4P93A 4BS9A 3LP6A 3PEVA 3JQGA 2HA4A 2EBFX 3DV9A 4ADSG 2RH4A 3LFTA 4J49A 2BT4A 4MVJG 1E8MA 2ZDHA 1HI9A 2GM5A 4CT4B 3R0XA 1Q91A 5EN4A 5MGBA 3ADCA 1JQDA 1P6XA 4U0JA 1OPXA 3UJNA 1JHMA 3QBEA 1E2EA 5LBIA 4HUQB 2HBYA 4OXQA 4CM7A 3OCWA 3TSYA 2MIIA 1ZK0A 3FFBA 1TC2A 3P2JA 4R1MA 3F5SA 5C53B 1R5OA 4HAVA 3VDMA 2W2MA 2VRNA 1OBFO 4ZDJA 4D44A 4DMUB 3ZNQA 1HE3A 4WESB 1YTUA 3ER8A 3X2SA 5EUBA 2H51A 4IDPA 1FP1D 3QSGA 2NPFA 3HI4A 4O2RA 3S7TA 3LLCA 4CM9D 1JECA 1YU9A 2QVCA 3MPOA 3QU4A 4WZBB 1DXYA 3L7BA 3N8IA 2AB0A 4YJGA 1WE2A 5EJ6A 1BFDA 2G83A 4MAMA 4P5EA 4LTNA 1R0RE 4IZHA 1HT2E 1WB4A 1H69A 3UJPA 4YMVA 1VBFA 1X8KA 1NUPA 3Q15C 1JEYA 1ZZGA 5JD6A 3TBHA 3GH3A 4BJHB 1PNTA 3AZOA 3DPUA 5FQNA 3WYAA 4LCBA 2XECA 1YZUA 3FMVA 4IIBA 1XX6A 1LDGA 3A25A 1NBEA 1U7PA 4A9AA 3A4LA 4RV5A 5DFAA 4YJ2B 4CEIB 2H4XA 5DHAA 3ECAA 4I9HA 3SBEA 2O9JA 3FF4A 1XNQB 1OZGA 1CT9A 2LV8A 3GIDA 5ALUA 1DJQA 4MJ3A 1QGYA 1TQHA 3HL4A 4JJZA 2O2IA 4NCKA 1LC3A 4JU9A 3KQSA 4U7TB 1KMHA 1Q1AA 3IPLA 3P0FA 3ANMA 1P7YA 1DAHA 5E3IA 5JVDF 5A4JA 1I3KA 4U7PB 2GESA 4BO2A 4GNRA 1XZIA 3GMTA 4Q4JA 4XJSA 5DE3A 5HZHA 2VHTA 4TYNA 3IT1A 1IVSA 3BF7A 3ZUGA 2QM7A 1JB9A 5TPWA 1D2EA 4B80A 3CVJA 1W5FA 3KHSA 4PICA 4ITRC 4A15A 5JANA 3TE7A 3AETB 4XASA 2W2VA 2OBMA 3GDWA 3LAWA 2DHRA 1BEEA 2HJHA 2ZRHA 1XE3A 3DO8A 2YVKA 3FKSA 4POOA 2GM4A 1K3FA 3W5DA 1MQAA 2I66A 4R16A 3G5TA 3LF1A 3QVWA 3HCCA 2F8LA 2ENWA 4DB4A 1KXZA 2IHUA 3F6PA 3OBBA 2X0DA 1E4VA 4A0HA 3OMXA 1JKMA 5IDXA 1WJGA 2NO6A 3PL5A 4JBHA 4Q16A 3FUUA 3K0FB 4OREX 3WMFA 4AS2A 3MWDA 3HXQA 4LHVA 4C0LA 1F0PA 1LWNA 1UQUA 5ALYA 4UC0A 1QGZA 4OL0A 4IV8A 1PW7A 4XX0A 3T4PA 4NK5A 1Y6FA 4Z53A 2AR7A 3WGYA 3GRUA 3HU5A 4XIIA 3PRKE 5D01A 2A5DA 1V4VA 1BDJA 4DLUA 5NLLA 1V47A 3D8RA 4KR9A 1T24A 2JKYA 2X0RA 2X5JO 2XZDA 1E6WA 1WMSA 4LMAA 4Q1EA 2RGRA 2ZB8A 1MO3A 2CDAA 2Q5JA 1X87A 7MDHA 1BHSA 2PHZA 4OHBA 3S3TA 4EY5A 1VP9A 4ZU3A 4AUKA 3KQQA 3WIEA 4DCNA 6REQA 4K81B 2ID8A 2AJCA 1QV7A 1VYUA 2B94A 4L3OA 4GMKA 3D6HA 1G3MA 4D4KA 4HSEA 1P1BA 3EPRA 4DV5B 3NOQA 1U8FO 2YHBA 4Y2HA 1FNNA 3THRA 4ARSA 1T25A 1E1CB 2FW8A 2OQIA 4IWNA 4JLUA 4A2PA 2PZAA 4MCHA 4EAQA 1WU8A 4CE6A 1GP2A 2IQ5A 1KJZA 3QX3A 5IZ4A 4Q7QA 4C5CA 2H0QA 1KA9H 4EG6A 2IYZA 3WMGA 4F5ZA 3BD9A 2D1SA 1SR8A 2YWEA 1JJVA 4N0PA 2HCBA 3QW4B 1P4HA 1SFRA 2B69A 3MSXA 1K0FA 3CGWA 3K9LA 4LJAA 3UGKA 3W2TA 1QHHA 2E5WA 2KB0A 3L4BC 5BN4A 1NX9A 1SKYB 2XCOA 2B82A 3DWFA 1BDBA 3IVGA 3IVCA 3GG2A 4MUGA 2O7SA 1PT6A 4XPIA 5CGQB 1GUBA 1A76A 2ZJ4A 1CWUA 4QXRA 3DZIA 3HCNA 2DE0X 5KCMA 4B82A 4D80A 4F1KA 3ES9A 3PJRA 3CE6A 5SZIA 2JJMA 3OP4A 4UMVA 4XCQA 2P7IA 1DS6A 4EG4A 4NRDA 1P91A 5C8YA 2NZXA 2HXGA 4BBAA 3T7KA 4EHHA 4DC0A 1TI7A 1RXVA 1DG9A 3PD7A 1XNJA 3DULA 5IXSA 2BKAA 1A9XB 2AOUB 2PUAA 2YZ7A 1OZFA 1YOBA 3I5MA 1MAVA 4RD0A 3SZOA 1TX4B 3N39C 3RTCA 1N7GA 1ST2A 3CG0A 3GL9A 5CH8A 5BR7A 1RQXA 3RFCA 1MZVA 3MUEA 5GGXA 3W2GA 1SAYA 1TYZA 3LDUA 3FPSA 4ALNA 4IHAA 4KFTA 1EINA 4ARVA 5AVQA 2CE2X 1LJUA 1ZGBA 6ADHA 1SUSA 3R7SA 3VYUB 1GGHA 4J94A 4OIFA 1TT5A 2UV8A 4KMRA 4X6XA 3DBVO 2PT5A 4BB9A 1W88B 4D3SA 5EXSA 1B0ZA 1JP7A 1MG5A 2O1SA 3E9ZA 3I28A 3EG5A 4PV7A 4A5OA 3FVRA 1GPKA 2CJWA 4Q4DA 2XKKA 1O97C 4JDUA 3LY8A 1XCBA 4E5YA 1AK9A 2Y67A 4X8HA 2FW7A 2AFRA 5LQKA 3Q0EA 4RTQA 4POAA 3HCAA 4FDVA 5CYGA 1R9JA 3TEMA 2ZSKA 3TW8A 2JAHA 1GPBA 1LCIA 3GDOA 1NVFA 5L6LB 1T8RA 3SGLA 1D8TA 1P33A 1KHTA 2R7NA 1ZGCA 3FHLA 3T4EA 4MB6A 2OK8A 4OHPA 5CJPA 4E09A 5KDDA 3QLUA 2Z3WA 3OD1A 1OFUA 1GAJA 3LGSA 2O23A 1U81A 4Q4HA 4R69A 4DG5A 1H85A 1TUBB 5ADVA 1Q95A 1AQ6A 2V55B 2QTBA 1ZX1A 1KO8A 3D1LA 4GPBA 5HKKD 2F7SA 1SVNA 3PPWA 4B3XA 1GNQA 3AV0B 3WBJA 1G3RA 2CLCX 2BHRA 3GJXC 2EWVA 5F33A 2OXFA 2FK8A 3RUFA 1JYFA 3RSZA 5EKUA 1S9HA 5DN6D 3REFA 4EY4A 3QI7A 3VSAA 3K8OE 3TJZA 2VXBA 5CXQA 1QIMA 3SQLA 4XD7A 2X15A 5EJ2A 3TQQA 2Z1NA 4LHEA 3ZJYA 5LQAA 3NYQA 3ILSA 3LSYA 3VH3A 1SCQA 3HXOA 1XP5A 3W90A 1ZJWA 1FTWA 3DFMA 3LD9A 3PBKA 2OBBA 2Y4NA 4HLCA 4MV1A 5DOZA 4B0OA 4QUIA 1O5IA 3OIDA 1B4DA 3EIHA 4FJ0A 3AEYA 4LVNA 4UM9D 4PX2A 1MJHA 1Y89A 3SVZA 2BGKA 4K9KA 1SVOA 5K9ZA 1NVEA 3JQEA 1LPNA 5IBRA 1T4DA 1E6CA 1IN7A 2B3DA 2QX4A 2WKSA 5ILOA 4W5RA 1MP0A 3V7FA 1SO8A 3QUAA 1EX1A 2ADOA 4UBIA 2IXAA 3IQXA 5JWRA 2ZVJA 4KX5A 2GARA 2R5FA 1G8SA 3RFVA 3P9CA 4O02B 3CUEF 1OH7A 4MDYA 4LJRA 3IT3A 3BGVA 3Q3VA 3BH6A 3JASA 1ATIA 1J7KA 3ZIUA 3DAPA 3HZZA 3OTHA 1P4JA 2KE5A 3I9MA 4GKVA 4HPXB 2GTIA 4PTLA 1LDEA 3AXTA 3QA9A 5CIYA 4NBTA 5I7SA 2SBTA 4LZAA 3JCZA 1J22A 5C8DA 1MT0A 5TPZA 3LHIA 4YMWA 2BI4A 4Q4JB 3KYBA 5LL6P 2PX3A 3P9PA 4JZYA 5H4HA 5GZ3A 1CZHA 1DJLA 4LHXA 2G9ZA 3F9IA 1Q2UA 3G68A 3HL0A 3OZXA 4JB3A 3TRDA 3A4VA 4DGQA 4LPKA 1Y3HA 5K0SA 5E4TA 4R3UC 4PN3A 3PUJA 2JNWA 2QR5A 2BN4A 1DEHA 3C3MA 2GJKA 3FSRA 4YJ3B 3A70A 3TZCA 5C8YB 1CRPA 1YE5A 2ORYA 3FAKA 1C0PA 1MJNA 1YASA 3HRKA 4JP2A 4S1VA 5FPPA 3KL4A 5CFNA 4YJ2A 5IC5A 1U04A 4QXQA 4FFPA 4AG3A 1C7JA 2C9CA 3OC0A 2ID9A 2JLZA 4Y6LA 1K5PA 2JGLA 2OFWA 4Q1FA 1L7MA 1EJ0A 2EIHA 4G4SO 4Y6OA 5C18A 3L8ZA 2HJVA 4JUCA 1KSFX 3BRQA 1NBAA 4GC5A 5FWAA 3IP3A 3EXG1 2OCYC 2QGNA 3C3WA 2PSDA 4HQRA 4RVFA 1JG4A 1XEFA 2W4IA 3D0KA 3MUOA 1I36A 5CMLA 1LPPA 4YP7A 2OLJA 2WG2A 2ZPAA 3P0IA 2FOXA 4A2QA 3RUPA 3HEAA 5BYBA 5JIBA 4F4FA 1EXMA 3VKWA 2PKEA 1G6Q1 1T5TA 4HNSA 2CK3D 1K68A 4FCWA 3H75A 3BGSA 1AKNA 2MHCA 4HB2A 4RA9B 1WLSA 1V39A 2ZRDA 2QTRA 1WQ1R 4MYCA 4RD4A 3LECA 4FLMA 3EEOA 4FZVA 1MVNA 4EJSB 2FSVC 3FROA 2EBWA 2O20A 3NANA 1D1QA 2F3RA 2O06A 3GJZA 5ICGA 5IAEA 1RYBA 3N2IA 1JR3A 1GNLA 4BQEA 1YKGA 3OTGA 3BRSA 3JALB 2W83A 4NYMR 3CM0A 1QPBA 4AJJA 4DGSA 2OOSA 3DV2A 2C9YA 4ILKA 4Q19A 3P9RA 1PK8A 4XUGB 1MHPA 1XF9A 4FGSA 3ZWPA 4CEJA 2O54A 3Q4GA 3L79A 1MOQA 4WGFA 3K5WA 3QY9A 2ZIEA 3IQEA 3W5UA 3UJ6A 1U31A 3EVBA 5ERYA 1WSAA 4DV7B 4L08A 4C2AA 4ISBA 1CK4A 1G55A 3AWIA 3OIWA 3WBBA 4BGDA 4BVJA 1QH1A 2JBWA 3GEPA 2XRZA 2FZVA 1XP8A 1W581 2Q1SA 2RGNC 4PU0A 2EZ9A 2NUTA 3K6RA 2QD1A 4D02A 1FFCA 4DLKA 5E4FA 2BHTA 4ER5A 4TV8A 3TMAA 4MV5A 4MARA 3DEAA 3JAMA 2EX4A 4FMDB 1WW3A 5CH5A 4D8WA 4TWRA 4GFDA 3SQDA 4GI5A 2J07A 1WUJS 2ODBA 3VHQA 2NP7A 1EQUA 3H5RA 1KEEA 5EXTA 3EH1A 5E1BA 2LE0A 1OWMA 4PFJA 2XNKA 3EQ8A 3SBDA 1RHJA 3CEHA 1UBNA 4PC1A 4RENA 3WO1A 4UCQA 1RM0A 1ZICA 3PJEA 4N40A 4Q9LA 5FHRA 3UNXA 3WK6A 4EPXA 1M1UA 3DKIA 5EIFA 1NN0A 2J4DA 3BB3A 1ZVQA 1M6NA 1JHVA 3JQAD 3PQFA 521PA 3WHLA 1NNEA 2Q4BA 3ED5A 3OCYA 4K0RA 3IHLA 3TWOA 2XCTB 2F8TA 2YC4C 3ZDCA 2BR4A 2OAGA 2H06A 2XMQA 4Z0NA 4CEIA 1A96A 1Q0LA 5BRNA 5B3LA 5IWCA 3BWXA 1DT3A 2R4QA 4ZTUB 4BV8A 3NOOA 5AW2A 1AE1A 1ZIPA 1K6IA 2QRMA 3AG5A 3N8KA 4XIJA 4DLVA 4CL2A 1PJCA 5DTMA 5BV7A 2P41A 5FT9A 2N3ZA 1KMQA 1G17A 4M98A 4BKOA 3C5WP 1JALA 3ITEA 2Q7DA 5FEUA 5K0BA 4LNAA 2P3LA 1BHJA 1QC5A 4KUEA 3SEZA 5KWVA 2ZJ6A 1GGEA 2NTJA 1XXLA 3EHEA 3L01A 4M0DA 3WICA 4WZBA 2X3UA 3ZCRA 3M0EA 1S02A 2JK0A 1U98A 4RZXA 3HFGA 4RVSA 2H17A 3LUPA 2X5OA 4WCDA 3FCSB 4HAOA 1HG1A 3SYTA 3R0QA 3FPHA 1RWNA 2G67A 4LSZA 4RMNA 4P3KA 4HTAA 1JZQA 3GGGA 5CFPA 5LPNA 3PB3A 4QLOA 3B8EA 4JYMA 4CKEB 5DI3B 3BZWA 3DBOB 4QELA 4DCGA 2PGDA 3GP5A 3OTWA 2I2AA 1Z5NA 1UC4B 1Y8QA 1QB7A 4C2UA 3C1TA 1Y9EA 5ALKA 3WGHA 3E9DA 3LCUA 1RXYA 1SHJA 1MX5A 2AC4A 2I78A 2Z8XA 4OYRA 4UQPA 5H68A 3AJDA 3IOBA 1TFRA 2UUPA 2V8BA 1BRTA 4O4IA 3H4TA 4TROA 4C5BA 1R6TA 1EDZA 2QD3A 3T3GA 3UF0A 2VKTA 3L84A 3QVJA 2NAPA 3DFUA 3HP4A 4WFQA 5FTMA 4R3NA 4N4AA 4FFSA 3I92A 4B2PA 3T3OA 3ZHBA 4F2DA 5KS2A 1UC9A 2ICAA 3IB3A 4PYIA 3ZHVA 3TCXB 4EJ2A 5HPYB 3FRIA 1A4RA 2Z0MA 3REOA 4AECA 1TM5E 2BVNA 1XRLA 4QSHA 4W5WA 3QE9Y 3NWOA 1NT4A 4ZCTA 5HKAA 5U1PA 1ONPA 4P8RA 2HQBA 3EXEB 4UNSA 1L8OA 3DMPA 2DUMA 2IODA 3UMFA 1MU0A 3CZ5A 5EP2A 4DXHA 5B57C 3K94A 1JDPA 2PJZA 3CIFA 2XUKA 4MVJF 1Q3HA 2H4WA 4FXPA 2X13A 3CPEA 1C1XB 3NIWA 1TIPA 3ZBPA 4C21A 3PUKA 3KKPA 4UCXA 4FEYA 2QUJA 4JP8A 3L49A 1Y9ZA 1LPOA 5DXJA 4DDKA 1GQOA 1S5PA 1M72A 3QK7A 3ULKA 1FNSA 5EYPB 4F6CA 4WLNA 1S2NA 1SUFA 3ZWVA 2ZRKA 4AJ1A 1WXEA 1R8YA 2P35A 4WNCA 1MIHA 1P1RA 1XVLA 3BGWA 3NEPX 4WSOA 3KKMA 3WGVA 8ATCA 3H7AA 2B8EA 3HXPA 4I55F 1KDOA 1NW7A 2OGWA 5CT8A 4NCBA 3DL7A 3I0ZA 3OE7A 4IDEA 2VK8A 4HRXA 5EJ5A 3E48A 3BHJA 1MB2A 1PEAA 1W4ZA 5BUZA 3MEQA 1WA5A 1E4OA 3TH5A 3RJZA 4JJGA 3CNEA 3LZCA 4KHZA 1TUEA 3DBRA 3OJFA 4KAFA 4RPHA 3W9YA 4EUEA 4F91B 3AVXA 1G3IA 2AYXA 1E2MA 1J00A 5I6DA 2VWGA 3VR6A 1VA4A 2Y9PB 3OD5A 3N7AA 5KSPA 2I67A 3R20A 2XW6A 4JKIA 1N6PA 3MBKA 2OCDA 4A03A 3AXSA 3VHXB 1AC5A 1HQKA 4E5KA 3U16A 3E35A 5ES3A 1WPRA 2YW2A 2F8SA 4NZPA 5JR3A 4BNZA 2VWHA 1N2BA 1MABB 1HNWB 4EG5A 2JKVA 3WB0A 4JC8A 2M9MA 2FWMX 3WVNA 1DCMA 3NT2A 1QO7A 2P2YA 4G0ZA 4RW0A 4D0SA 1P7PA 3L8FA 3NJRA 2FQQA 4XVHA 2AKAB 5J4YA 4HH4A 1T1SA 3QLEA 1ODIA 2BTQA 2VF7A 3M2TA 1Z6YA 4MB0A 1P5FA 3O8BA 4QJIA 4R5MA 4RPKA 3SJCA 1ICEA 2Y77A 5E6RA 1N3IA 1KDTA 1XCOA 2XOXA 2HCJB 2VQDA 1G19A 4ZQFA 2ZBEA 1YA6A 2ZTHA 4LOLA 5JC8A 3IV9A 3BVPA 5A0FA 4J90A 4MV3A 1JIXA 1W0KD 1HXHA 1BTOA 1CRWG 2BGNA 5E6RB 5EPUA 3R3WA 3RS2A 5LYJB 2BTQB 4LYAA 1LWOA 1JG7A 1KQPA 1HH4A 2XR1A 1WXIA 2FW0A 4HGRA 3THSA 1GGVA 3PQEA 4LK3A 2Q4EA 1E79A 1N2HA 1ZQ9A 3PDWA 1XRNA 2DLNA 2M6RA 3AC0A 3VUFA 2M32A 2PKYX 5AKGA 2ACEA 5JJIA 5CX1B 3ZVKA 2ZJ3A 2WV7A 3N3BC 3FGZA 3LPDA 4OOEA 4FSXA 4RIIA 2WUFA 2EDAA 3M1YA 5KYUA 4CCAA 4E33A 5BV8A 5CA0B 4W8GA 1YHZA 1H9BA 1SKYE 4GDMA 4HQFA 4A8JA 2D5LA 3CF4A 3D3QA 4ZAGA 2GZ3A 2WD8A 4QYTA 4ZTBA 1JI0A 4RLQA 5B4TA 2DFVA 4Q3BA 1PFYA 2E0IA 3ECCA 5HUJA 2HUPA 3HRHA 2V58A 2PYZA 5SYNA 4C22A 4CCWA 3QPAA 4M0MA 5C0OE 2PVPA 2VZ8A 3LFHA 4BO6A 3FFXA 4C4PA 1S2IA 1WF3A 2HHCA 3JVVA 3STWA 4D99A 5J2UF 2YOFA 2BEUA 2QE6A 3G88A 1XELA 4PLTA 3V1NA 4TQUS 1OFIA 1I8TA 2AOWA 3P9IA 3ZOZA 3H19A 3DPIA 2SKDA 2XUJA 4I3GA 4K0KB 2QG6A 3D0QA 4M36A 4U7DA 4MIEA 3H2SA 4WGGA 5BSVA 2BZGA 2CY0A 2JIPA 3RO7A 1X9HA 2EP8A 2L19A 5FI1B 2LVBA 5A9SA 3GCZA 1PHPA 4D3FA 1EVIA 3PYXA 1II9A 2H5EA 4Q12A 4NFSA 2O6LA 4YVFA 3QLUC 4TTSA 5K51A 1SD1A 2DH5A 4OMUA 4Z2YA 1Y4AE 2R66A 1SC4A 3LZ6A 2EG5A 3KSZO 5CITA 3DFFA 2ZKIA 2VSFA 1Z12A 4W63A 3UW1A 2VWQA 1UMCB 1HZZC 2W11A 1LLUA 3FNBA 3HABA 4FYKA 1J90A 4MHTA 4XDGA 3GCDA 3MIIA 4H7EA 2R751 3F7NA 1ZPDA 3GFRA 4UDYX 2NU9B 3Q7PA 5AOVA 4GPD1 3A32A 3GK3A 4C6SA 2PPLA 2I9KA 3KB6A 1R1DA 2VHUA 3Q7EA 3A05A 1HL7A 4XWKA 3CF6R 3KT8A 4G0NA 1E2HA 2EZTA 1N0WA 1XQYA 1SCBA 4II7A 1BGXT 1I51A 4G26A 3NCTA 3WL3A 1QK5A 4CQLB 3UBTA 2JJYA 4JNKA 2BMWA 4AY4A 4HFRA 1D2CA 2IEBA 1Z22A 2WSIA 3A1UA 2F1JA 3NDRA 1EVZA 1TAQA 2V7TA 2ZWAA 3PGA1 1FSFA 4WN9A 2BFBB 4RCZA 1O0SA 1SXJE 2EAUA 3GGSA 1X1TA 2J5QA 4ATNA 4GZ3A 5BRJA 1EVKA 2AFIE 4DIFA 2PLWA 1HYHA 2ZYGA 3THXB 2Q2QA 4N01A 3PVZA 5TMEA 4QDXA 2RHLA 1FYXA 2Y0PA 4P9NA 4CHTA 4WN3A 2BOVA 1LXCA 3IP6A 1KARA 3QYJA 4EIWA 3WSVA 1UOPA 4YMIA 1D1TA 3DT8A 3LNTA 2F1KA 4FGKA 4UVDA 4WKNA 4BKUA 1X7GA 3AERB 3UTCA 4IF6A 2LW7A 1ABFA 1N57A 3EBLA 4YRIA 3B6JA 4C88A 2B1JA 1OLXB 3CR8A 3RWOA 2IY9A 2V7QA 3ZE7A 4ZV9A 4BP3A 4M0LA 1XDGA 4Z8XA 5D5PA 4B2YA 4MI9A 4Q4AB 3RS9A 2QAJA 4ZICA 1GNSA 3FOZA 4X71A 3K0SA 2IBSA 1UANA 5LFAA 4P7JA 4G65A 3SS7X 3A9SA 3KPVA 1C1HA 1WRBA 5EQJB 3LGXA 4XLZA 1Z6GA 3MFQA 2GAFA 4M6WB 1LK5A 1VJ0A 1OB5A 1FFXA 3A1FA 1E8NA 3V7UA 2C2BA 3NTRA 4X7MA 1OCEA 1IOZA 2WZQA 4JHLA 4NBVA 1MQ9A 1SZDA 2HFJA 5E1DA 1CJUC 2XDQB 3C48A 5AI6A 4P32A 4KIFA 4B7XA 4BMXA 5C8VA 3AIOA 1FIUA 2H4ZA 1ZN2A 4Q9IA 3H5IA 5FORA 1MGPA 4U2DA 3S6JA 3HM9A 4Q9AA 4ENPA 3K9QO 1RZRA 2VJQA 3Q9SA 4FZ5A 3OJXA 4I9GA 2PX0A 3CRMA 2Q2NA 3NTVA 3T5CA 3D4LA 1XMVA 2W8BA 3VTAA 1JQEA 4YV1A 1W93A 4Q3DA 1IC6A 4E5MA 2H1HA 1ECFA 4J8PA 4YUYA 1UK9A 3G7UA 4GOMD 4P6VF 1XAHA 3MAAC 1V4NA 5B6PA 5JBIA 1AQIA 1U4OA 5F4ZA 3OTOB 3MRVA 2ZRGA 1AHPA 2WWXA 4X5OA 1CDZA 1M1YA 5EZQA 1AN9A 4UFOA 3D3JA 1SKQA 3P1JA 2SNIE 3EYWA 1GPJA 5LU9A 4PG7A 3DWGA 4UVEA 1IU9A 5CURA 2DU8A 3ILVA 3ASUA 1Y48E 2WM8A 3OECA 2QUAA 3LU1A 2UU9B 3PL1A 4JEUA 4NARA 1CS4C 1Z73A 3OU6A 5AKEA 3VSEA 3OHSX 3EWSA 2UYCA 1NM5C 2JVKA 3PUWA 3TVYA 4P4UA 5CB4F 3EZ9A 1B7GO 2PD4A 3OLCX 4P22A 1OLUB 1MTZA 3AP2A 1F9AA 1WW8A 4M1OA 4RA9A 2FEOA 2WF5A 4IDOA 4DZZA 3A6KA 1WBBA 2ZIWB 2HLDD 4F56A 3HYCA 4I1YA 2B5WA 3ZDFA 3RR2A 3FZNA 3EG9A 1K6EA 1X9IA 2BR5A 2FP4A 1W4RA 2XGMA 3NNDA 3SPXA 4C1BA 3U3MA 1T2CA 3T94A 4YMLA 4O4LB 1RCUA 2DGDA 1B41A 1P0FA 3DDNA 3Q7TA 4OB8A 4S35A 5JRZA 1P9NA 1UBJS 4FR2A 1W46A 2W6PA 1ZXXA 4LJKA 3REQB 1TZJA 4MR9A 1T3GA 2VZEA 3GMDA 2R1ZA 3E61A 4QWWA 1MJFA 1WS6A 2C2ZA 2F62A 2FK7A 3FYUC 3GY0A 1D2MA 3U39A 2PUFA 4EG7A 1HETA 4CIAA 3FUXA 3K9BA 2ZJ8A 1OI3A 3H5LA 1C3VA 1C9MA 3KOMA 3JSAA 3LC0A 4G8DA 3ZGOA 1ZXBA 3VPDA 3NHRA 2D1FA 4RQUA 2CNNA 5C3UA 5C81A 3KETA 2R8EA 5KNBD 3REGA 1BE0A 3BMOB 4KAJA 1IPEA 1MA3A 3QZUA 3TUJC 2XQFA 3NKLA 4UFNA 1BX0A 3U3OA 4OU5A 1U8YA 2VNSA 1N5RA 1I1HA 4G0YA 4OHMA 4C14A 1XGKA 4HEHA 5CDGA 3CVVA 2D7JA 4UMDA 2QBYA 2WTMA 4UVHA 5AQEA 3TQRA 3VJLA 1OHHA 4E88A 1CZNA 3GD5A 3M3DA 3QTBA 4F4HA 2BFNA 1JA1A 2GYWA 4B7UA 2PWZA 2NZJA 4Q93A 4Z7QB 2F6RA 2OQRA 2X7XA 2Y1XA 3HQ4O 4PHFA 1YK1A 3R7WB 3CLUD 2AFIA 1B15A 2R8ZA 1PJ8A 2WTNA 3AM5A 3WHIA 3LUJA 4UUPA 2GN0A 3PGJA 1J0CA 1YBVA 5IXYA 4IL5A 1K9SA 4OYHA 4ZT3A 1K7EB 2AG0A 4B8YA 3ANNA 3DCJA 5J4LA 2FETA 3KB2A 2NMVA 3BD7A 5CRIA 1EFVB 1ZN9A 2VCEA 3EWNA 4ZAXA 5K3AA 3W9SA 4AZ0B 5C5IA 2AG6A 4ZO6A 4DIDA 1XTVA 3EFEA 1LZKA 4ZQBA 1HC7A 4MWBA 2GOYA 5LKRA 2Q8NA 4L73A 3NTQA 1IXSB 3C3PA 2ORED 3GIWA 2W71A 4JX8A 1P4AA 1LSUA 3JR7A 2I4LA 2IBMA 4JWKA 2ZULA 3DMHA 1W85B 1YQWA 3GP8A 2ILVA 2JGMA 3QNMA 4RXMA 4EFNA 2WDPA 4GX5A 2NQ8A 5CHEA 5BN1A 3L7KA 3I6IA 3C1AA 1H6BA 2YN4A 4YI3A 3U9SA 4HGYA 4QXAA 4MI1A 2QXYA 3B60A 4OMDA 4YMHA 3CUKA 4EA6A 1N2CB 4CF4A 1PZNA 1GTVA 2PFGA 4IJMA 5KSWB 1W0JD 5CP8A 1WUTA 2FPOA 1Q19A 4GI1A 4RMGA 4MV7A 2VQ3A 4Q21A 4NHEA 2GB4A 1Y3AA 2GNAA 5ALSA 5KKCA 1WHSB 2GVDC 1U0SY 3K0AA 5B1DA 4F6RB 4CN8A 1X15A 3DG9A 4P53A 4WUVA 5HZKA 5KTYA 2I33A 1FFDA 3T1QA 4TZ6A 1BXGB 1XK7A 3GUZA 1I2MA 3BD6A 3U0BA 3FTFA 3WDLA 4HGZA 2IYQA 1Y42X 2VTKA 2W6ID 1VIDA 1M6HA 3OZGA 4DJFC 2VFAA 3U4DA 2IXFA 1KIMA 1TD9A 2PKWA 3I72A 1R0BA 1G0OA 4IHJF 4R1LA 3ZY2A 821PA 2ZFUA 3TTVA 3F3YA 2Q9CA 1KJ9A 1T2FA 3HYNA 1IY8A 2JGFA 4EF6A 1YJ5A 1NQ5A 2AI2A 3AHIA 2NQTA 1IY9A 3AUXA 3FZQA 3QVGA 3KYIB 3W8RA 4ER6A 3M9XA 1B3RA 4KQ2A 5KNCD 1WXQA 3ET4A 2HMYB 4P4SB 4ZVVA 3RRXA 2G28A 1JDJA 1YRBA 1BYIA 1US8A 2ROQA 3PC8C 3EA5A 4OXKA 4BTEA 1IY0A 4LISA 2ZBQA 1LTKA 3Q7QA 4NFYA 4R1UA 4I4IA 5BPHA 2NGRA 1JHOA 2IIBA 4KLCA 1V2GA 3UW3A 1XKTA 1TVMA 3V1YA 1Q6YA 2JLSA 3AI1A 5ICFA 4BAUA 1NQUA 1N2ZA 1NNUA 2XRMA 5CFQA 4HHEA 4P81A 5L95A 2AOUA 1A9XA 4R2HA 1FUUA 4OV6B 3DM9B 3F8SA 3V97A 1W5EA 4TOIA 4X3CA 2XD9A 1XTBA 1TQ4A 3QMVA 3WMWA 3B52X 5EZ5A 2H2FA 1K89A 3MJRA 4JSYA 5CUQA 3QFCA 3Q7RA 5DXFA 5JOQA 2ZU0C 1JN0A 2FZLA 5JNVA 1T9DA 2WP8J 4TMFA 3IXLA 3TJMA 2F1OA 1YS4A 5LZ2A 1P80A 3A9WA 2BM0A 3UCFA 3EISA 1JDBC 3R3UA 3TDMA 1HT1E 3BICA 3KOOA 3NFYA 2Q2OA 3HY4A 1DC4A 2JGEA 3HK2A 4WD3A 3V4FA 2A9KA 4WNIA 3B2EA 1U2ZA 2Q0XA 4INJA 4U6QA 4OXXA 4Z2AA 1R9MA 2O4CA 5C34B 2D8AA 5AK0A 4MEBA 2RKBA 1QTNA 2D7DA 2PLFA 3NVAA 4DIEA 4RTMA 4LGMA 4N7MA 2AFHB 1NF3A 5TDHA 2BGJA 4DILA 5TC4A 3CJQA 1V7PC 5K0JA 3SVLA 3BXOA 1A3CA 5JZVA 1P3JA 1X9GA 2OCBA 3I6MA 1P2GA 2IEDA 3C5CA 3AR5A 3LM8A 4B6RA 3F5MA 1K5GA 1AKMA 3O4IA 4ERNA 2VDWA 1LI5A 1CQXA 5CPBA 3WIUA 1J5PA 1O9HA 4ES6A 2D5AA 2O0HA 2XMDA 3CO5A 2WHEA 1O4WA 1QZXA 2HDOA 3MT9A 3I5XA 3ACCA 4FE4A 1KFKB 5LLSA 3RS3A 3W3AH 5KYYB 2Q62A 4K46A 1JQLB 4C05A 4BVBA 1EB8A 2CFIA 3NHWA 3OUTA 3OQ6A 3QVKA 1ZR2A 2XZLA 1ZNWA 1Q0PA 2W0MA 1F8YA 2CJFA 2FU5C 2OWDA 2WSSD 4L5JA 1KVQA 3NEAA 1P1HA 1EX7A 1X92A 1UDXA 2C92A 3E7XA 2CLLB 3K1JA 4BO4A 3FLMA 4JGIA 1LBEA 3O1IC 3OH8A 1V16B 2QRPA 1IONA 1O4VA 4RU1A 3RU3A 2AZDA 1FTQA 3U7EB 4DSUA 1Q0QA 4I55A 2MSLA 2BGUA 1L5HB 2QGZA 2H29A 2MYNA 3WA6A 3PR1A 4KNVA 1MO5A 3T1OA 1CSEE 1GY8A 4C0WA 3VV2A 2VSQA 1IB0A 3ZZ1A 3O75A 5J5CA 2V65A 1EK2A 2GWRA 2B7BA 4H18A 4HPWA 1SQ6A 1FFYA 1Z4IA 1H1TA 3GV0A 3W04A 4Z1MD 4NICA 4Z4EA 1D03A 1OWOA 2FR8C 3FJOA 4HL6A 1ONNA 3CX3A 3RLIA 5BXQC 4NLLA 5IZCA 5JSFA 4LXUA 4Y6GB 3FPGA 1U63A 1WTAA 3L40A 3NB0A 3P5SA 2FRDA 4FW9A 1KNQA 4HDKA 4YRKA 1KEWA 3PVSA 3N0VA 3U1VA 2IS4A 4RSHA 1G7RA 4Y1RB 3EFOA 2WFMA 3RB8A 5HRCA 3BCUA 2HEIA 4YS6A 1QZZA 2O14A 2UZ1A 2ZQ5A 1GL6A 4R68A 4UE6A 2HW8A 1SCDA 4D43A 2GQ0A 1GQYA 2BWJA 5JCPA 1BA2A 1K8RA 1VIAA 3FPAA 2FN7A 4FLEA 2AW3A 3DL0A 4X0EA 1DO8A 3MMNA 1REQB 1UZLA 2XGSA 1C41A 1L5YA 2PQ2A 1BHQ1 2QRGA 1GQSA 2CD7A 1G5IA 2ZBRA 2ZGVA 2D1TA 3C70A 4NE7A 3ZW9A 3COYA 5EESA 1V1MA 3R5KA 5JAHA 4N1AA 2WIGA 1JTFA 2PV0A 1NLMA 3PWZA 2OB1A 4TLAA 2XLCA 3DHYA 2P9BA 1YR8A 2WAAA 3WLJA 5IT9A 2JZNA 1RXUA 1KI7A 4RVDA 3VAAA 1IOVA 3VDNB 5JSZB 4TYYA 1T29A 1JEJA 4FOTA 1IVYA 2ARKA 3LDGA 1U0EA 4YQEA 3T1YB 3T7IA 4K88A 3O1JC 1KYYA 2DUJA 2DQZA 1ZD1A 2QIOA 1IJEA 3GBVA 2JEOA 1J0DA 4XDYA 4OLBA 2I6TA 2RK6A 4G5FA 1W47A 1R5BA 4J2HA 4RIEA 1DIGA 4Z9BA 1BCSB 5HMLA 2C7RA 2J4CA 4Z99A 3EWAA 2PKRA 4WESA 3V4OA 3AHHA 4C4ZA 5L4LA 4S04A 2FWPA 4BNIA 1DKUA 1RQRA 2OHXA 1O96B 4R1TA 3KX2A 5ENZA 4E5SA 3WLTA 4W1PA 4C4TA 5DLYA 4B44A 3MJCA 1JIVA 3GD7A 4LOHA 4EQ6B 1G98A 1SKUA 3TX6A 3WYGA 1UPFA 1UQTA 3VR5A 3STTA 4Y9RA 2YY5A 4RSGA 1FPMA 1IB6A 4G01B 1XZKA 2JRCA 4OJTA 5IDYA 3ZX4A 4OX9B 4G85A 4GX0A 3ROXA 3SR0A 1ISSA 5DYIA 3OZWA 3NI2A 2IITA 1PJSA 3WWEA 4DV0B 1O7JA 2JJ2A 3L6BA 3SSMA 1V3VA 1HNZB 2PJRA 3B5EA 3FUCA 2C0CA 1J97A 1WWKA 1GYRA 5JRDS 2BY4A 1U8CB 5JDIA 1E9BA 1KOLA 3GXOA 3L4SO 3ORRA 2DPXA 2V4ZA 4A26A 4BRZA 3GFTA 2ZK7A 3OZCA 4G24A 5CAEB 2C2HA 3ANXA 2WYOA 4I3HA 3SBOA 3ZVMA 3KYDA 3QPUA 4UXJA 1J8FA 1DC6A 2C2WA 3DV0A 2R8RA 4RC9A 1HV8A 2QZ9A 4LJ6A 1ZJYA 1G6HA 1JEOA 4CUZA 4BNFA 1HMPA 1FB5A 1O0BA 1B1CA 1W4AA 2GFHA 1G7CA 4XTCS 2E49A 4AJEA 4B6JA 4F71A 4WK2B 4ZJPA 2PU7A 4EVSA 2FR0A 3EHDA 3H9EO 3NETA 2BZ1A 1TPYA 4PE5B 3SZGA 1P1CA 1BS2A 1E1LA 2GNOA 4CI9A 1Q1EA 4QHYA 3OLVA 1FSZA 2CVHA 2IIVA 4FCCA 1B76A 1ONBA 4KBGA 4WEQA 5FULA 1PT7A 3ORSA 4Z4GA 1U7TA 3FDIA 3LJKA 5TY0A 5CXUA 2CHVA 4KVZA 2JIOA 3EPKA 2W8BB 2GWHA 2PGNA 3K09A 2RGXA 4ID9A 4B6GA 3IRUA 4F4IA 5C1PA 3DEFA 1GWNA 2DULA 2FX3A 4ZYUA 1QFZA 3H65A 1HLFA 3N87A 4V38A 4Q1AA 5DSXA 4OJYA 1X70A 4BKQA 4U3JB 3FI9A 4PX3A 4XXHA 2C4MA 5LDHA 1N6OA 1YVDA 2MR5A 1HYEA 3OO1A 4DADA 2OQVA 2OC4A 3O3NB 4KPEC 4OQXA 3C74A 1ESEA 4ECAA 4ZXFA 3TNYA 2MSNA 3L8GA 1DRWA 4PQRA 2D3TA 3EAQA 2VYFA 3OLQA 5THXA 1O9GA 3MMXA 1RWMA 3PC6A 5CNIA 2ACVA 5DBOA 5FF9A 4F38A 5HQ3A 1A8IA 5HJ2A 2ZJ7A 4B3MB 3VR3A 4I46A 4Q4AA 1T4BA 2HEGA 5B37A 4X8OA 1A9ZA 3TO5A 3BOSA 4RVNA 2P65A 2LP4Y 3DDHA 3LKBA 4TZTA 5H82A 2Q1XA 2BH2A 1A77A 1NWHA 1ZM3A 4QX6A 1UJ2A 3IODA 6GPBA 2HL6A 3OZAA 1SZPA 2CSUA 4FZRA 4BLSA 2Q41A 2ZBUA 1YOVB 2HZ7A 1NUAA 5ALDA 5F2NA 2J3HA 2D13A 3WP1B 4FFVA 1X2BA 3A6DA 1GLGA 4M9UA 3DJYA 5ALTA 4TMXA 1INLA 2HBZA 4WASA 1L4BA 4L5IA 1WD7A 3QYFA 5DK4A 5EY5B 4JVLA 3BZUA 3ESBA 5F1OA 3ZNPA 2XD4A 2REQB 4TVBA 3V4ZA 4E30A 1OH5A 4MUEA 1HORA 4X3PA 4WLOA 5IK2D 1PJBA 4NNJA 4AJNA 5HBRA 3G9QA 4NC9A 3O8CA 2BF4A 1P2BA 2ATXA 4DCPA 3HU3A 5J40A 1U65A 1AA6A 2BFBA 2QP4A 3CRZA 4OQNA 4PX5A 1DEXA 3PSAA 4CKCB 2Q7XA 1M2WA 3W5AA 2OPHA 4WXEA 4R0VA 3NO4A 1OTYA 3Q8LA 1CUIA 1QRSA 2NTEA 4ZK6A 4IGEA 1ZWLA 2C2GA 3QUCA 3AMVA 1J8MF 1YA8A 2UZ3A 3H2ZA 2QRJA 3FAZA 1XCLA 2VTEA 3LX4A 3OX1A 1ORWA 4PXYA 1EWKA 3NC1C 4MO9A 4XQ9A 3WLMA 5CB0A 4OQ4A 5GVSA 3M7IA 4RE5A 1G21A 4A6XA 4YRGA 2FQXA 1DAEA 4QUAA 3UK0A 3E5MA 4KTTE 5C46F 1OFTA 2C7GA 4MR7A 1E5QA 2A9PA 5T4HA 4WE3A 4YCNA 2BFAA 3ROGA 5B3JA 3AR3A 3MWFA 3GQBA 4DVJA 3CZCA 1TADA 1JDUA 3AI7A 1LBSA 3JD1A 4LBZA 4MWDA 3GLHB 3FYHA 1EWYA 2LR0A 3IAXA 1XVVA 4RKQA 4LF6B 4KXLA 1XDZA 1RAGA 1EJBA 2W4QA 1G2OA 2XB4A 5T4BA 5ALRA 1SBTA 1T9GR 4W5NA 4AQ7A 3TL3A 3LPLA 3FPLA 1QANA 2DWCA 4OSOA 4U02A 4L75A 5LLDA 3DGEC 5AVWA 1HUQA 2FWJA 5L53A 1VKNA 3FYUB 1Z5VA 3U3DA 1K5DA 3FETA 4N7BA 4DUGA 3U7HB 5JROA 2ATIA 2R6R1 3R3SA 5KJ1A 3EEYA 2C9OA 2IP1A 1K86A 2ZAYA 2BONA 1IJBA 1R4MB 3ZJ5A 3EZXA 3H9CA 3HVIA 2CXXA 2FN3A 4RK5A 5JZBA 4ENWA 5KPJA 5AW4A 1XU9A 3KTDA 3R9KA 5KSOA 3OWOA 3PHLA 5CDUA 2ZRBA 4IGIA 3TPFA 4M4SA 2J46A 1KK0A 2QD4A 5DP2A 2I2XB 5GOZA 1XWWA 4JH0A 3OJLA 2G72A 3HKCA 4DR5B 3ZDYB 3ZWOA 1A7AA 1MLDA 2UUOA 4GLFA 2YR0A 1QYXA 2BKXA 1F3LA 1Z8DA 3OOJA 4CL3A 3BC1A 3U19A 2A5GA 2KM1A 2XTNA 5HRUA 1VG9B 1R0ZA 1VMKA 2A1TS 3KELA 5EP3A 5EZYF 3ENWA 4B2IA 4CODB 4YMUA 5KJ6A 2D6FA 3DBIA 1TCAA 3N74A 4RY0A 4CMJA 2HF8A 4P7BA 3LVRE 1JDSA 4N47A 4Q1VA 1NXXA 5ENDA 1F4VA 2WKPA 4PGFA 4QATA 1B6RA 4UHCA 3JQAB 5BSUA 3O92A 3S2ZA 1CDDA 1B6SA 1UFOA 4GE0A 4XWWA 2PIDA 4F5WA 1IN6A 2B8NA 5H3LA 2IH2A 4ZRNA 2HU8A 3G1UA 2H1FA 1VJRA 2XB9A 3ONFA 1E3WB 4G3XA 5JI3E 2MINA 3A6LA 4RTPA 3AF6A 4IGAA 3C7TA 3NMUF 3ZKWA 2IDMA 3CZQA 3LV8A 4MJXA 4N41A 3TZHA 1UXIA 3BTOA 3T3PB 3W6OA 1RKUA 1Q5PA 3VZBA 1I33A 4B8ZA 2AYZA 2HBQA 3L8EA 3Q40A 2ZIGA 3R1IA 1X13A 1ZLXA 2GPSA 3VR4H 4NG5A 4DSTA 3QTLA 4TQGA 1ENZA 1DTSA 3WO0A 1D07A 1QCCA 4KMSA 1R8XA 2TECE 2X0KA 2BM8A 1XVTA 2WUEA 3CBQA 4FKZA 4HYYA 1ECCA 3MCAA 4RTKA 4JIGA 4WKBA 1VFPA 3IXMA 3DDWA 1AGYA 2NTNA 3MAJA 2NUAA 3O74A 3E0QA 4GI2A 3TNFA 3O91A 1MV8A 3ILYA 3DDUA 4Y2QA 1ZISA 3C85A 3W3AA 4YB8A 5G0TA 4BGIA 1ZMOA 3GA5A 3M4JA 1ZRMA 5ARCA 3WGLA 1BS1A 2ZPUA 3VAZA 1I32A 2P8JA 4PGHA 1NVGA 2HF7A 4ENQA 1SGWA 4RD2A 1OGIA 1T13A 4UBLA 4I2NA 4AZ3B 4EO9A 2HRQA 4PZ0A 3QOWA 4LYDA 3V32A 4WXPA 2P79A 2YWDA 1SCIA 1FP6A 1Z4OA 4P3OA 3V42A 2OXRA 4PLWA 1NP7A 2H9IA 3EXHA 1GKUB 2FPPA 3BCRA 3NYWA 1F2DA 2Q6TA 2R6DA 4ALKA 3CNLA 4DDUA 2G17A 3UFXB 2FEPA 1F2TB 1W35A 3BS4A 1EK0A 4W1RA 4KR3A 3IP8A 3EGDB 2YRXA 2DFTA 2J41A 2EX0A 3CX6A 3FBGA 5JCZA 1M83A 3A6EA 1Z7YA 1TJ3A 1JLMA 5FFFA 1OYWA 2F43A 1LRKA 3ETJA 4MKIA 4BP9A 5KTPA 1BKYA 1DBRA 1NOKA 1H2RS 1U8TA 3SZ3A 3KQLA 3D43A 3JWHA 4D3DA 1RMQA 1V8FA 4DR4B 4BB5A 2ZCUA 2A3RA 2IDJA 1U2PA 4L72A 5KUTA 1EEHA 1ESZA 5K3BA 3LQFA 4YAIA 10MHA 4YAOA 2BFCB 2JA1A 2DOKA 3LRTA 2QA5A 3OPMA 4JNCA 3VZSA 2BUAA 4MRAA 2RI6A 3V6MA 2B5OA 3C3JA 4J9VA 2BGMA 2FE4A 5B6IA 2GF9A 4KZKA 2QW0X 3P9SA 4JLJA 1KE1A 1IEWA 4FIDA 3CV3A 4ZI3A 5A4AA 3RHFA 5L51A 4BLPA 1FY2A 3TPZA 3IDSA 4NS4A 3A9VA 2C2MA 5EXDA 4F5DA 3UPUA 4A82A 2D0OB 1JLSA 2RAPA 4D4IA 1SXQA 2HWYA 3QMPA 4IIUA 1YK0A 1QTRA 3K8YA 2FWRA 5K09A 1A27A 1DWQA 4XYMA 4HDAA 4A23A 4DCSA 3J7TA 2RDMA 4TWIA 2QTLA 3AILA 4JUBA 3VO8A 2REQA 2ZRQA 5CB4A 3ZHZA 3VBCA 1TTTA 3B6EA 2QT1A 2N1MA 4TZKA 4UCWA 3EIUA 3PI6A 5JG7A 4AUMA 1ZUD1 2YW9A 4GQBA 1M2OA 1N9KA 1KU0A 1YAJA 1XL0A 3IR5A 3STUA 3CN7A 4KDFA 4ALLA 1WB5A 2QJFA 2RI0A 3WLFA 4UU1A 1NOJA 3SQXA 1AF7A 1IEXA 1L9KA 1WXWA 1VI5A 3GFVA 5BVHB 1XNGA 1KDYA 5HS6A 2XWSA 5IS2A 2G76A 3ZU4A 5CDHA 1C3XA 4V0SA 5IZCC 2ZTMA 5BNIA 3MLEA 2PUDA 1NUHA 4YEDA 4TM8A 1DL5A 1R27A 3PSHA 3GWGA 2GPNA 3EEQA 3OZBA 4KSCA 4YGYA 3AFIA 4RXTA 5KNCA 1PWEA 4J7AA 4J0FA 1H0KA 1YBMA 2Q5OA 2VDRB 2ZR8A 3UK1A 2Z2JA 3URMA 4OL9A 4PC3A 3FYTA 5ENVA 4GWGA 1G8KA 4YDSA 5T57A 4BB6A 3U7GA 1QK4A 4BFLA 1H4VB 1YZGA 2BGIA 4H27A 4K9DA 4DLZA 4BIMA 1W7AA 1YRQA 2DJ5A 1LVUA 1KYZA 1PJAA 2VP2A 3CLKA 1U3UA 2QDXA 1RMYA 3D81A 2FSGA 3HACA 4PG6A 2WRZA 2VHYA 3TXXA 2OZVA 4D6YA 4OPMA 3GCXA 2H5JA 3QQ5A 2QUIA 5L3VA 4F45A 1HYQA 3Q3CA 4GMGA 4BVFA 3R5XA 2WPNA 3EOZA 3LOQA 4KQGA 5DHSA 4D56A 5KX5B 4S1NA 4RPLA 1SPBS 1L5MA 2A2ZA 3WRVA 4U7JA 5H70A 4RZQA 2EQ5A 4JY7A 4NDNE 4H1HA 4ESHA 3O6VA 1BD4A 3RROA 2GI4A 1ECBA 1Q0UA 1DAFA 4OK6A 4OLHA 4WFKA 1P5JA 4RBNA 5K05A 1WDMA 5EA2A 5B58C 1X1RA 2R5NA 3EBPA 5F77A 3PKIA 3SOPA 3D5EA 2JFFA 5LOVB 3QJ5A 1MVOA 1YC2A 4JI7B 4D25A 1BGWA 3DYVA 1VJTA 4OKIA 2G5GX 1Z6XA 1YHYA 4JUAA 4Y9TA 2XQIA 2EZ4A 1BSVA 1A98A 3CF4G 3VNVA 4KB5A 3CXRA 4H59A 4DNFA 3U4MA 2WOJA 3PQDA 5AW8A 3ON5A 1J42A 1QH1B 1JQKA 3KZXA 3JTEA 2W2OA 1P2SA 4P58A 3TLBA 4JLWA 5CFLA 5JS6A 1NUQA 1DJNA 2NO5A 2P9JA 1ZA1A 1ZONA 3H2YA 3OURA 4OP2A 4RF3A 2UZ4A 4KGXA 1QZUA 1NMSA 4M1QA 3IV6A 3GELA 4YO8A 3RRZA 5A3QA 1TMOA 4DJAA 2G4VA 2QMUA 1CNFA 1P62B 5JPIA 3IEUA 1C5KA 5I8ZA 1RXIA 2HMTA 5EWLA 1ZK4A 1M6WA 4PGMA 2C8JA 3TGPA 2J3QA 1KJNA 3S99A 3D02A 3IIEA 3EVEA 5JFGA 1F17A 2GBLA 1LRLA 5F51A 3AKDA 4C0JA 1FRFS 3P0JA 3RYHB 3QENA 1GTG1 1V5IA 1VHQA 4RDIA 5CLLA 1YE3A 4B6QA 4RYLA 2DJIA 1MO6A 1N9GB 5F7ZA 1CVIA 3CNHA 2L17A 4UEQA 1QXSA 2GEFA 2H6EA 3NWEA 4MHOA 4QDUA 3T5BA 5KQMA 5D3ZA 1PZEA 3B89A 2O0LA 2P2DA 2YWFA 4ZK2A 3RRJA 4ZO7A 3NIFB 4IDHA 4NH0A 2EBHX 4FWTA 3ZU2A 3FFTA 4AURA 3HGTA 1R88A 4DLWA 4R2JA 1A9OA 1ESMA 4W9NA 5G41A 4EB0A 3IBCA 3RLFA 1H2FA 2HV9A 2J0EA 4WLVA 1ZRHA 1VHLA 4L4RA 2BZSA 5IKXA 1SBQA 3SM9A 5FIUA 4FIZA 5A3JA 1ADGA 1O6BA 1UM9B 3ZU5A 4EUNA 1IBCA 2YS6A 4UM7A 3TZEA 2YCLA 4XVQA 2CLEB 1I1NA 4DLLA 2EARA 3FRHA 1UMBB 3DB2A 2HPAA 3AW8A 1GQ2A 1MO2A 2P3SA 3ZWAA 1ABBA 4EYEA 2XITA 1QVVA 2NO7A 4NJOA 1W5TA 3A28A 2O5RA 3DUFA 1J56A 1X7DA 5JAZA 1T5IA 1GPH1 5EQDA 5L40A 4AKHA 3L6RA 4C7OB 4LIPD 4YBZA 3R3JA 1MEJA 5JISA 3EX7C 3TB4A 3IAEA 3EPJA 2HQ1A 2VF5X 1OYVA 2ZJFA 4YQZA 4P34A 3TLEA 2GPBA 3A0RB 3D7SA 4X64B 1CE8A 4Z3OA 3RG2A 3TQSA 4ZOAA 3CX8A 3TZQA 4JODA 1GAXA 2IY8A 3JPWA 4B17A 2H2GA 3TSCA 3HWWA 3K2IA 4JA0A 3RT9A 5JCOC 3BH0A 3HVKA 4XGIA 3F3SA 4IZIA 5T8KA 3SS8A 4E2FA 1L1FA 5FNVB 3ZYCA 1DO0A 1EAYA 1ZUIA 3CLRC 2Z2YA 4P0TA 4K9MA 4LOJA 2OR3A 4ZQEA 3R75A 3WLOA 3D54D 4P1ZA 3IHKA 2PDAA 3BXHA 4P2BA 1E32A 4QUKA 1BE8A 1W0JA 3ICVA 4LE1A 1KPHA 2ZIVB 1S89A 4QTZA 5I8PA 4G9EA 1XPUA 4KPYA 3FE2A 4MDEA 2C07A 1T0HB 1UBEA 1U90A 3KG2A 1N8KA 1ZGGA 1G60A 4FGLA 3WK7A 3ZD9A 5CVCA 4MIKA 1PX0A 5CDFA 4A6PA 4HDNA 4P4LA 2GUGA 3F71A 1E3EA 1NUUA 2IPLA 1PBTA 2FQ1A 1IM2A 1MAHA 4BEJA 4OY3A 5JO0A 2HA6A 4NSNA 2ISCA 2QRUA 3E81A 4XVUA 1H8HD 1GN8A 3MRSA 1JX6A 3GEDA 3A3YA 2PGLA 3E4CA 3HP7A 2CWWA 4BLTA 2BEWB 1QRUA 1XLVA 2ATEA 3LBFA 1JKJA 2CBGA 3DO5A 3MHTA 1W87A 1IL0A 2OFFA 2Q28A 3ZZNA 1R0LA 4TKVA 1NW8A 4QPPA 1MAAA 1H8EA 5FLKA 5T6MA 4MKHA 4NBRA 1DTWA 3M5WA 4OI1A 2ZUDA 3KZVA 1BDHA 1YZLA 1YDHA 3JS5A 3G5MA 3KEQA 1CZKA 3DEJA 4PPYA 4UKDA 4AN0A 1WZCA 3QE2A 3QVXA 3ZWXA 4GH5A 4LNUB 1X0VA 4ZPJA 4DV3B 2ZITA 4M49A 5AKZA 3RNOA 5DNUA 3AVWA 1KQ3A 2PL9A 3FZGA 4HDRB 1PLKA 3GN2A 4DHWA 4ZAYA 5HK9A 1GKYA 4WW0A 1TUBA 1JR3D 1F8UA 1G8HA 3LUBA 3T9BA 1QRTA 3NC0C 3OY2A 5IWAB 3QLTA 1TZBA 2GAOA 3RWMB 2RONA 3D6TB 3HEBA 4AN1A 2AFHE 2QK4A 4B3HA 5JZMA 1MXHA 2WVHA 3EVGA 5GY7A 3T95A 1X80A 1XD8A 2ZJYA 3AZQA 1AVTA 3EEBA 4DCTA 5AM5A 2AVDA 2PKQO 5EHXA 2OHHA 3TTUA 3ZE0B 3WQHA 1ZOSA 1H1LB 1DCFA 1PQ4A 2M6SA 2IOFK 3DC7A 3HLYA 3Q11A 4HTFB 3LA6A 2CJWB 1F4PA 1XMSA 1FPQA 1IAVA 3DBHA 3EUFA 1O97D 2H00A 3AUAA 3FB1A 2NTVA 3KZKA 4OHOA 1J20A 1DQPA 1DOHA 2W37A 4RL4A 1IVNA 2E9SA 4C08A 2HSWA 1TEZA 2GBFA 4BMPB 1EESA 3F3KA 1JHUA 1FW6A 3RVOA 1CY6A 2NADA 3IP7A 2YY6A 1B8UA 3DLPX 3WK5A 3RUEA 2XV1A 4L51A 5GONB 1SVIA 1JQJC 5ITZB 3H2IA 4BFUA 5LZ4A 3WSWA 1PSWA 2DKFA 5HDQA 3BMCB 4B7CA 1E9RA 3CR3C 3L7NA 1Z13A 4J7XA 1E4YA 5LDGA 4BQPA 5CCBA 1NSYA 1QGUB 2X22A 2ZI3A 3H5AA 3HDVA 1Y8ZA 3RSCA 5HOEA 3NBMA 2ES4A 1RC0A 1WG8A 3C8UA 2O05A 4J2OA 4IOMA 5LD2B 2GZ1A 1PW5A 3E18A 1HE8B 2D5IA 2IEIA 2PA0A 3MAGA 2E5LB 1DOZA 4MV8A 3AO0B 3D6AA 1FVOA 3EXIA 3WGIA 2H3EA 4HLQB 1ULZA 4MW7A 1V25A 5IMSA 1MIOA 3ET5A 4NZZA 4B35A 1N2JA 5HA5A 3Q1LA 1XAJA 2QX8A 3BIOA 3C0KA 3ENVA 3EIEA 1TOAA 4X93A 2H92A 4EEZA 5L7WA 1GXSB 2OUIA 3U4HA 2OGZA 1JQ3A 1I7SB 5AJWA 1BRMA 3WIOA 2Q49A 2W2TA 3K20A 3ME5A 2VATA 2HX1A 2ZU6A 2PS0A 1GZ4A 3U4GA 2ZSAA 4E1VA 1GSHA 3WLIA 1V6AA 3KHKA 1FYDA 1XZDA 1IPFA 3FDXA 3RBXA 2DXIA 4PZCA 3O0TA 4INZA 3T8YA 1C8BA 4IDNA 4X00A 2M6LA 4CUKA 1H3EA 1PN3A 4HAIA 5A1TA 4L78A 5JSZA 4DY6A 1CIPA 2WC1A 4X8LA 5KYWB 5DIFA 2FSIA 3EGEA 2GXUA 2H52A 4FFRA 3WLKX 3NV7A 2CL7X 3L4BA 2R44A 4ALJA 4M1ZA 1M6EX 3JARB 4IXDA 4IXWA 3GPIA 4DCOA 1YQQA 2KSQA 4WA8A 3T0FA 2ZSBA 5DGHA 3VVLA 3ZLTA 4D0RA 3S1SA 4AY5A 4J76A 3UB3A 1XQ6A 2VJAA 3TCNA 2R7AA 5FUQA 3TIGA 1UBOS 1TCBA 3CBGA 2D2EA 3I9KA 3HBAA 1G8FA 1PZXA 2ETXA 5AIBA 1NJ5A 3NBXX 3PA8A 1OXBB 4LS3A 3GRRA 1RXCA 5DASA 1A4UA 1P31A 1RWQA 1TYCA 1OXXK 1E5XA 2DFNA 3IVMA 5JLJA 3C45A 2ZJOA 5EIOA 1QMPA 1J39A 2LCFA 1V9LA 3P4XA 2YOHA 3MWDB 1W96A 4IKEA 4PZYA 4UXHA 3TW0A 1AKQA 4QDTA 5K0ZA 2JAOA 1HE2A 5B58T 5TQ2B 3UGTA 5HF8A 1I4DD 1DC5A 3OIGA 4EVQA 5A9RA 2W00A 5THQA 3PPYA 5IC6A 3VNBA 1UZUA 2I1QA 1YQ9A 3N5CA 2VPPA 621PA 3FI0A 4MV0A 4RANA 4YHHB 4F04A 5EUCA 5L9AA 1UKZA 2PV7A 3H87A 4Z51A 1NKVA 3WXBA 3T6KA 1LSSA 5FBZA 5CVEA 1Q7GA 2II6A 1W36C 1S9DA 4MCAA 1V16A 4TX1A 3IQZA 4JT4A 1Y5MA 4KRFA 1JRLA 5CDYA 1DAPA 1I3CA 4AMVA 3A31A 2JAUA 4KBYA 1NP3A 4P5DA 4PQEA 4HJRA 5C80A 4YP5A 2OSBA 5HX7A 4AJ9A 5ICEA 4OVKA 4EATA 1DAGA 1N7HA 4ZYZA 5CBPB 4AJIA 1M2HA 1KZ6A 3QM1A 3JQ9A 3VR6H 4O4HB 1ZAKA 5IFLA 4FOLA 4B6EA 5K6TA 3OPYA 1SOVA 4QGAA 3M81A 3RT1A 2DWOA 4XYBA 5LNK6 3N0TA 2VSOA 4HX5A 3O47A 4GNKA 4WLUA 2BKVA 3HJRA 1ULTA 1I3OA 3GGPA 3IEKA 3GT4A 3MXTA 2C0PA 3EMKA 4LGYA 1CV2A 3OU2A 4BX0A 4CKYA 3B3AA 3KWMA 3N8NA 5EJ4A 5JALA 2WTAA 5K45A 1IHOA 5FKJA 1OLSA 1A8PA 1U7DA 2DVMA 2FE1A 3IERA 3L0DA 4MZXA 1XD9A 5FR2A 3OZ7A 2W70A 2OG2A 4EHKA 3L4KA 4DC9A 2PZBA 4DMKA 3EGXB 1QH8A 2FMKA 1FUKA 2J3JA 4O1HA 3SJUA 5C4GB 1GGFA 1SUBA 2AI1A 5BSMA 2QLMA 4NV1A 4AFNA 1CULC 4CTJA 3ZIAA 3TRHA 2Z8YM 1ODLA 4O4JA 5DM60 4B46A 4IJWA 5CB6A 2LDBA 3RIHA 3U60B 1OIXA 4XSHA 3OM1A 4DM3A 5CLQA 5LMZA 4MNTA 3RRBA 3RARA 2Q29A 3R0JA 1GTMA 5JBNA 1JG6A 3A06A 4XCXA 2PX6A 3UAYA 3ZJUA 1KVUA 1QGUA 1Q20A 4L3WA 3OHMA 3SNHA 2ZWMA 3UMVA 4FHGA 3RQSA 4YCBA 3VYWA 4EOGA 3UUEA 4CMAA 3BL6A 3FTPA 3RK4A 2R7MA 3I9V1 2P0YA 4LHSA 4QOFA 2CJXA 4R40A 3GJ7A 5GONA 1X8XA 1YE8A 2YDYA 2B4TO 2FVXA 1L3BA 1UBRS 3DAFA 2WUVA 1C3OA 4C0AC 2J6HA 4QQ8A 1H2XA 2B6NA 2XI4A 3I12A 1SN7A 3IVXA 2PH5A 4BFXA 1F06A 2Y1OA 4NJEA 3ZC3A 3RRNA 1PV4A 4C0SA 4C7MA 4JXXA 3RF6A 1BEZA 3U7QA 2R6JA 4U1RA 5EIXA 1EX6A 2FRXA 3EARA 3PNMA 5ALEA 5B1IA 2IYSA 1KDVA 1CP3A 3WB2A 2EYQA 3N3AC 2FW1A 3AKZA 1X80B 3BSSA 3AUJB 5KPDA 3PWSA 4MI3A 4DCJA 1BMDA 1GCAA 4KE6A 3G1WA 5FCDA 4EGSA 1V9SA 2NOAA 1NC3A 4LCJA 4P4SA 5H83A 1JLLA 4FINA 3G7SA 4B3BA 1C1DA 2FY8A 1QMGA 3CX7A 1LC0A 4MS4A 1D6MA 2FPUA 4HWPA 3RJ5A 2O8BA 3CO0S 5K2MA 5DIZA 1DAIA 3G2OA 4G5RA 1TF7A 3VZRA 1XXHB 1HT0A 2WHRA 2ZB2A 3I2IA 4E7PA 3GLGB 2FOIA 1P3DA 2HHAA 2ONZA 1UOOA 3OPVA 3BTSA 3IMEA 1C0IA 2DT8A 1ZMRA 1AB5A 1QFYA 1K27A 1RR6A 2DR3A 2DX7A 4Q39A 3VC1A 1QRDA 3PICA 5E9WA 3EZYA 4DKJA 2QQEA 5LZ7A 2FLKA 1EK5A 4K5QA 1VTKA 1IATA 3DKKA 3PNSA 4FSDA 4G9BA 1P0PA 1QM5A 4QU0A 2C78A 1T9HA 4IDAA 1VJGA 3V1TC 4CBVA 4F92B 2VJYA 4OBEA 1EDBA 4C0QC 4BMDA 2NVWA 1XUOA 3VSBA 4RCYA 3TCKA 3WZ2A 1Q17A 1NATA 1TMYA 3GAAA 4LDAA 3RC7A 4GM1A 2YICA 1CVRA 5DGCA 5CTJA 2E6KA 3G2JA 4QU9A 3U7IA 3RU7A 3J80A 1K63A 2V6JA 3VHLB 1Y1KE 2V9PA 4HDNB 4MAAA 1IEQA 2EKZA 4PAOA 4W82A 2GA9A 2FYTA 5CA1B 4D82A 4QPDA 4V02A 3DE7X 5T4FA 1AK1A 3BRCA 3OESA 4Z9XA 1HNNA 2VQSA 3EC2A 2OY0A 3GC6A 3QOYA 3PP8A 2JCYA 5CVTA 4QYSA 4MXDA 4KEAA 4MLDA 4Q18A 3I4CA 4N0DA 4QTYA 3BWYA 1LK0A 1V8DA 4LHZA 2QIPA 3S8EA 1N36B 5A4DA 1YZTA 3VMFA 3SXUB 2B2NA 4DUGD 2PR7A 1T9AA 1Q92A 1WAMA 1ZL2A 4J07A 1X1DA 5DSTA 2JCGA 3TD9A 2IUTA 3ESXA 4BBJA 3FNFA 2WE8A 5LD2C 3RDPA 1RHRA 5KBYA 1O95D 4I50B 3PGKA 4D74A 2QMHA 2ZYWX 1TA9A 1JAZA 4IIDA 1FVFA 5FOXA 4B71A 2VL7A 4H0FA 2C29D 1ZH0A 1J07A 5BQFA 4KI7A 3W6ZA 5JS1A 2BE7A 2GXQA 1YDGA 2OKGA 3EUAA 3ZJ4A 4D46A 5BMVF 2G80A 1G0NA 1DFGA 1TKBA 4HVTA 5ICMA 1WMBA 1N25A 2PX8A 4G1FA 2FDCA 4EKNB 1YB6A 3OEED 1A5AB 4EKYA 5D00A 3HR7A 2VF2A 4JJEA 1F6BA 1YDWA 2CNLA 3I9V6 1KOJA 4E21A 2X2PA 1CJVC 2C5BA 3KHTA 4MRSA 1UM9A 1TB4A 4IWYA 1BCRA 1JH9A 4TL9A 3F6BX 1E7QA 5HFJA 3PCRB 1GG9A 4PVDA 1XTJA 4TLMB 3HZRA 3O2QB 3WQQA 1OYOA 1FYVA 2WWIA 4MQMA 4W7IA 4X24A 2J0UB 1Z2OX 5I7RA 3L5OA 5FV7A 3Q41A 2AZMA 4NDZA 5DGIA 5BNFA 1UL1X 5A9SB 1JFFB 1U9CA 2H48A 2XE7A 2DTXA 3A7DA 3A9CA 2GPYA 2Z2XA 4G1CA 1MOZA 4ABYA 1XQ1A 4DXDA 4RK4A 1LTHR 2KYRA 4GF5A 1KZHA 3AKCA 1J33A 2Q9BA 3I5UA 3LQ1A 3QU2A 1MTOA 5K4AA 3AVPA 1C30A 2D7CA 4DEVA 1ZH4A 2AI3A 2PQMA 2IU0A 2E5FA 3F67A 1Z4JA 2Z2ZA 4B74A 5LLTA 3ZJTA 4OFZA 3O73A 1RABA 2CDNA 3JZAA 2XTMA 3QEBZ 3HUFA 3N76A 5AOBA 3V4LA 1B42A 2C84A 1NYQA 4R71A 2NU7B 4CLDA 4AP5A 2PNJA 4UJ5A 3VPGA 3PFBA 4ZCSA 1LEHA 3P9KA 2BV3A 1L1EA 3C3YA 4PCVA 3FYSA 1AXRA 2OOKA 4BU1A 3LFUA 2D1YA 1QFJA 2HDNB 2H85A 2ZJ5A 1CRQA 2ZT7A 3FTQA 3L9XA 1OJLA 1W5SA 4GYYA 4M76B 2QTTA 3BBPA 3OE5A 4RPCA 1WZ2A 3UKOA 4R31A 1QCDA 1H6DA 2KJQA 1ND6A 4IIYA 3CQ9A 4DS3A 4LHWA 1T3TA 5FQOA 4KJZA 1B0PA 4GBED 4H77A 2ET6A 3NTUA 1T10A 4D8YA 2ORVA 1JSXA 4O4JF 1P9RA 4Q1CA 4E70A 3QVSA 2I4TA 2ZM6B 2P67A 4C04A 1U5BB 5H59A 4RJTA 4IQ4A 4BCDA 1Z0AA 4GD3Q 2MSKA 4R1PA 3IBGA 4XDZA 4M1MA 1R7RA 2WBLC 4RQBA 3RUCA 4AMGA 2OZKA 3CG4A 3IQFA 1UUFA 3OBIA 721PA 1F5SA 2QQ0A 1EK1A 2JG3A 4C6TB 2HO4A 2GD6A 4PF1A 3CN9A 1H2YA 4BUCA 2VUUA 5J1SB 7ADHA 5BPFA 4YV7A 1AS3A 3TF5A 3LHKA 5GP1A 3SY8A 3P8ZA 2WKQA 3OZIA 5A03A 1HQDA 1NULA 3BIFA 4BX3A 1Z74A 2ZZNA 3A10A 4OHYA 5IVKA 2AHRA 3KWFA 3EULA 4TWJA 4Q3NA 2OQ2A 2GHTA 5KHOC 2R6FA 1MH1A 4F86A 1BXRA 4QGSA 3CVWA 3L7JA 4M0CA 4HY3A 1EP9A 1NR1A 4JP1A 1AMNA 3OOYA 5IXJA 5EHQA 3KQHA 3FCCA 2FPWA 3FBWA 2DT5A 4GVLA 3T3HA 4ER3A 1L6RA 1OFUX 3CUWA 1KFJB 3IO5A 4GGPA 1R4NB 1VBMA 3N1UA 2VOEA 4I8IA 4O08A 4XFDA 3UC5A 5C4IA 2WG0A 4FB5A 1LX6A 2QAGA 2HPHA 3M89A 1H2HA 1U0LA 2F3SA 3U7FB 3JD3A 2PZLA 5IPFA 1JQAA 2LRHA 4KMMA 4D3ZA 2JFNA 4BNYA 1O2DA 4ZI7F 4L7VA 3UEOA 1XKLA 1FMJA 2XCUA 4HRVA 4K9NA 2A7XA 2J9ZB 2XVYA 3KKOA 5EYPA 3C4VA 3AJEA 3VGJA 4DR2B 3OQIA 2CLDX 3LK7A 4QLAA 5A6SB 4TMWA 1NW5A 4PHCA 2JCXA 5AUOB 4LJLA 2VT3A 3QE0A 3K70B 1UXOA 2X1HA 2PLAA 3KAKA 3V2HA 2VC2B 3V80A 3QELA 4FNMA 4V1CA 1RAEA 2I5PO 2O2CA 2A1UA 5IN4A 1CP2A 2DFLA 4N5HX 2P2CA 3OU7A 1FX0A 3DOJA 4RD3A 2WU8A 3G9XA 3ANSA 1CY0A 5E7QA 2IYWA 1EVYA 3H6GA 5ESXA 4MUAA 4BB0A 1YB7A 4KL8S 1Q1NA 3AYXB 3BE5A 4E51A 3BJIC 2YMLA 3C16C 1SKBA 1ZN7A 2WJVA 3TRFA 3ONDA 1UBMS 5AK4A 5ARDA 2B4YA 2V6MA 5DKFA 4I6GA 4A36A 1N0IA 2R6HA 3C7AA 1K66A 4DSNA 1Y3DE 4JROA 3LXXA 4IIHA 2GCOA 3JYHA 5AUNB 1XPRA 2E48A 1B00A 3HZOA 5CT5A 2GVNA 1ZXLA 3TFWA 1QDUA 1X14A 3PGXA 4Z7JA 3BULA 3EZ2A 1ZU4A 5J2UA 1QGDA 4IV0A 5ADUS 1O54A 2A30A 4O4IB 4B2LA 4HG2A 2GEBA 1H9AA 5LXTF 3ZH9B 1QBKC 1GFIA 4KRYA 4U5XA 3SHVA 1BHO1 5FHQA 5DMHA 2XOEA 4B85A 1NW3A 1T5DX 2YJ3A 3DEYX 3P20A 3P9NA 3H2BA 2WYUA 1LPAB 2FEAA 2NXJA 3E22A 4MGIR 2E82A 2XUDA 2HRRA 3RABA 3VNQA 3URKA 1GITA 4FVTA 4OQLA 1IHUA 1M6VB 1IY1A 1G4HA 4YIKA 2EWWA 4MW1A 1JW9B 1JU4A 2CVFA 2ZCVA 3GBSA 3H1TA 3HR4A 4R41A 2QPTA 4TS4A 3L0BA 3ONEA 1VCIA 3HYSA 4XYGA 5JNSA 3GRVA 2WMDA 3AVQA 1M5TA 3KDAA 2EJCA 4K2AA 3S2SA