2VP6A

Structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
197
structure length
197
Chain Sequence
b'TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE KINASE
molecule tags Transferase
source organism Drosophila melanogaster
publication title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
pubmed doi rcsb
total genus 75
structure length 197
sequence length 197
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vp6A00
2BBSA 4TSFD 2ZYVX 1D8TA 1E98A 1U8ZA 2BBOA 4Q19A 4XSGA 1AGRA 3QKTA 5ANRB 1IN7A 3RAPR 1N0UA 3X2SA 3B85A 5EE9A 1ZUNB 3PJRA 2CDNA 3CF0A 3Q8XB 4N1AA 3QXJA 1E2QA 3TRFA 1XMSA 1XZQA 4QKQA 2ZRGA 3T1VA 1Y3AA 2EFCB 1DG1G 1XXHA 1P62B 4YQFA 4PX9A 4XTCS 1E6CA 2ECKA 1SXJD 1XD8A 3K0CA 4YMWA 4DLZA 4DDWA 1NKSA 2FE4A 1W7AA 1W2HA 4IJMA 3WHKA 2YOGA 2GXUA 4B43A 1U8AA 3B13B 3F3YA 4IDPA 2NPFA 2ZS8A 1OH7A 3FMFA 1UM8A 1TX4B 2PJZA 3SC3A 5SZKB 1FZQA 2OLKA 2F3TA 2I1VB 3KFVA 3NHAA 1XU4A 1IJEA 2ONJA 5KPDA 3MWYW 1AS0A 5HE8A 3ZDQA 1KI7A 3U2QA 3DPUA 2BMFA 4PO1A 1WBBA 3MG9A 4L4UA 5J5CA 3TSOA 2PLFA 4EPVA 3CZPA 3QKRB 4HSEA 1F2TB 3B60A 5FOXA 5CDFE 1Z29A 1KJYA 4FN5A 1FMJA 3SJCA 2FPLA 2WM9B 2C5LA 3BGWA 3CWZA 5AJVB 3OEED 1Z83A 1COWA 2KI5A 4AKEA 4C0JA 2YYZA 2V8OA 3LBIA 4BEJA 2GNOA 1DEKA 1XEWX 2ZVQX 3RSOA 3GEIA 1OIXA 1P9RA 2GJSA 5D3MA 2H57A 1PV4A 2HT6A 3OFNA 3DO6A 3M4YA 4FI3C 1CP2A 2PBRA 4YMUA 2WWYA 5BYKA 2P0EA 1Z07A 3RRZA 1FW6A 1G1MA 1DAKA 4AKIA 2WWIA 4CIDA 4ZCIA 1XTJA 1U0HC 5F2EA 3NEJA 2O8DB 2XJ4A 4HLCA 4FWTA 5G3YA 2Q9CA 4FIDA 3PCRB 5J47A 5EUQB 1AGPA 1RVDA 2IYQA 4K46A 1KO4A 1Q1ZA 3G0HA 3NWJA 5FUXA 1SGWA 3I8SA 3FVQA 3QXXA 1NMZA 4Z8YA 2LKDA 5DGXA 1MOZA 4TL7A 1E94E 2C99A 5UKDA 2ZQ5A 3LBHA 1NY5A 1X86B 5EQTA 4OK3A 4RJLA 4KLNA 4QHSA 2XXAB 1P9WA 5GADl 1W47A 2OFOA 4LHYA 3REFA 3RDPA 2PX0A 3EWAA 1KK0A 4JL5A 3I4LA 3LLMA 3SZRA 5AUPB 1OXXK 1S1CA 2JLVA 1N6NA 4FCWA 5CM9C 1L4UA 2FG5A 4M21A 2XGJA 2HXYA 4U02A 5JCPA 1GOTA 1OJLA 1JXMA 2UZ3A 3K53A 4HB0A 4NHOA 4O25A 4QGGA 4TT3A 4DLYA 5GJBA 3K1JA 1Z6AA 1WDTA 2ANBA 4MRRA 3QEJA 2ORIA 1OHHD 3GD7A 1R2QA 2O0HA 1VG8A 1XDBA 2FFBA 3EX7C 1W46A 5C4MA 4G5QA 2WOOA 1KAOA 2Q9AA 5IT5A 2ZJZA 5L3QB 1ZW6A 1Z0FA 3EZ6A 4OHZA 4Q1DA 2IWRA 1Z2CA 3L2OB 2FSIA 1EFTA 4OL0A 2BBWA 2JDIA 2CHVA 2GCNA 3TK1A 4JT2A 5J4YA 1VCNA 2GESA 2ZE6A 4P4SA 4D4LA 2YV5A 2ZRFA 2RHMA 2VEDA 2QPTA 3KZ1E 4RZ3A 1YZQA 3AH8A 3D8BA 1QDEA 2FEMA 2MSCB 1ZBDA 4Q01A 2IS6A 3HU2A 4QM6A 2F1IA 4CYMA 5LB4A 3MRSA 2VP0A 2XITA 4TZ0A 1SULA 2FF7A 1NVVQ 3N2IA 1EXMA 1E9DA 3OAAA 5FL7A 5IHPA 4WBSA 3SJAA 5JI3E 4B3XA 3IEUA 3OZXA 4WOPA 1G3UA 2BV3A 2ZI4A 3IQXA 1P4SA 2FFAA 2QN6A 4G0NA 2ZREA 3C16C 3C14C 1RE0A 5C1BA 1AKEA 4HYYA 3AP1A 3P26A 1ZIOA 4C2TA 2OBLA 1KMHA 3LY5A 1ZU5A 1W1WA 5EE3A 4IFEA 1F60A 2REOA 1NN5A 2CEAA 1W5SA 3HYRA 1AIPA 1VHTA 2IXFA 3H1TA 1UBEA 2DCUA 1M1YE 5J40A 2W58A 2ZRKA 3LXRA 1OLOA 1ZM9A 2HF9A 3RS7A 3SJZA 2CK3D 2J59A 4IW3B 2NO0A 4KFSA 4RD2A 1VCMA 2D06A 5AUNB 3K9GA 2P6NA 2NIPA 1JALA 2GZAA 1S4QA 3C7KA 1K6MA 3TR5A 2IS4A 4ZDKA 1G3QA 3GLGE 2QTHA 2GZDA 4NE2A 1U94A 1SVSA 2FPMA 1JR3A 2ZROA 1GL7A 4IDOA 4D2IA 2N42A 3AKDA 3ICEA 1XFAA 2VHUA 4OBEA 3SHWA 4D4MA 3PITA 4F4JA 2PMDA 2P6UA 2QT1A 1HT1E 5H8WA 2CL7X 3B1ZA 3R9XA 1SXJB 2FMXA 1IM2A 4BZXA 4UNQA 4OQNA 1OB5A 1N6KA 2G3YA 1U9IC 1KGDA 2Q9BA 4LCBA 1KYIA 2W00A 2PZGA 4ZIRA 5M04A 2V1UA 1NY6A 3BFVA 2LCFA 1LTQA 3KDSE 3RSLA 4HAVA 4BFVA 3LQRA 4NCKA 5J4HA 2Z4SA 4C4PA 5JLJA 4US2R 4AWXA 3QBTA 3BXZA 1VYVA 2JJ1D 4LV5B 2GJ8A 5CIWA 4P4TA 1CJMA 3GLFB 5P21A 4JKIA 4PHGA 4DEXA 3VX3A 1YRAA 3TUJC 3BH0A 3DKVA 3AGQA 4XVRA 1XP8A 2IYSA 1KDOA 3GLHB 3KKPA 4PSAA 3TIFA 1P2UA 5IDVA 3OF5A 2X77A 1P2SA 3GLIE 2ONKA 4QBHA 1RRCA 3BFXA 4UXJA 3RANA 4LGMA 5EUMA 3SBEA 2DFTA 1E2FA 3KKQA 1MV5A 2K5UA 1EFCA 3EZFA 3NEYA 1Q0UA 5CJ2A 3CX8A 2PEZA 3A8TA 3QENA 1UAAA 3RC3A 5G53C 5GJCA 5JJLA 1KKMA 4LK2A 1F5NA 1T91A 4CEHA 4D6PA 2JIZD 1Q22A 4KI0A 2ZRLA 4TL8A 1P3JA 2JLRA 1OE0A 4NCJA 4D4JA 2WWGA 1J8MF 3HJNA 3JVUA 4C9BA 5DI3B 1LNZA 1HE1C 2X1VA 2P3SA 4B3DA 4CZ2A 2PX3A 3X1DA 4HUQB 2D2EA 3BB3A 2DWOA 3RS3A 1U0LA 1XEFA 4KXFB 4DC9A 4AYXA 4GFDA 1A4RA 4V03A 4ZCMA 4HUQA 2ZRHA 3OEEA 3MWJA 1W49A 4M9SA 5KO2A 5H68A 4WZBE 1ZC4A 2YC2C 4E09A 1KK2A 1Z6GA 2J9RA 4NYMR 4WVFA 2ANCA 1XZPA 4ASUA 3EA5A 4LBVA 2XOKD 1G16A 4R98A 3CNNA 1BOFA 3EWSA 4OK6A 3AVPA 1P73A 8OHMA 1YQTA 1BIFA 3P32A 5A4JA 4EJSB 4HDQB 5HZHA 1KJZA 3F5FA 1JJ7A 1TF2A 4JMPA 4PR0A 4RD4A 5CK4A 5HZKA 2ZI7A 3W6PA 2WWHA 4KYUA 4Q9LA 3WMFA 4HLUA 2J0UA 4S2EA 3VX4A 2ZSEA 3VU9A 1X8KA 2BKEA 2GCPA 2IYYA 5DH9A 3D7MA 1JBKA 1S2MA 2PCLA 2ZI5A 3LQQA 1H65A 4N0DA 2C95A 1N0VC 5L3VA 1Z08A 2IYWA 5TVKA 4A6XA 4R9UC 1ZCAA 4ZI2A 1ZNZA 1ODFA 1FP7A 5SZIA 3VU9B 3EPLA 1NJFA 5DIFA 1UDXA 2PZFA 5DE3A 3VR5A 1TU3A 1KSHA 1UKVY 4Q4HA 4UJ5A 1NN0A 2ZEJA 4EPRA 1N3BA 5CDFA 3A36A 2F1HA 3BD9A 3O8BA 2HYDA 2AXNA 2NZJA 4Q1BA 4RZ2A 4Q9JA 4NYMQ 4OQXA 3DM5A 4IOJA 4KO8A 5JS7A 1C9KA 1NRJB 1HTWA 4XOIA 2V54A 3BS4A 1XCPA 5KYKA 1B23P 3C5CA 3W9YA 4ESVA 4E5UA 2BJVA 4PHTA 2GK7A 1E2GA 1R8QA 1VHLA 4P32A 1OXUA 4UXHA 4Z54A 1US8A 1IXSB 4BEBA 1CKEA 1TTTA 4RFSA 3HR7A 2VHTA 2ZS7A 2ZI6A 4A8JC 3GEEA 2WPDA 4W5WA 4F4CA 3H84A 1U0JA 3U7GA 2A5YB 2BCJQ 3IILA 1YZTA 5DI3A 1ZC3A 4US0R 2F1JA 1CULC 1DS6A 1NBMD 1ESMA 1G8PA 1KSFX 2WKPA 2XNDD 5CK5A 3SEAA 5CITA 4H1UA 2AKAB 5A5GA 3CX7A 3DOFA 4TQAA 3B6EA 1TQDA 3V4FA 3CM0A 4W5JA 1OH5A 1KO1A 1II9A 1YE8A 1UBFA 2JCSA 1KI8A 4Q47A 4URXR 5BWMA 4D25A 2GDJA 3RRMA 4UQOA 3EPJA 2GXAA 3GLHA 4Q9KA 3GFTA 4MGKR 5LBIA 2N1BA 2Z83A 3AB3A 4IEEA 2J3EA 2XNDA 1QVRA 2RMKA 5HKKA 4OQLA 1KI3A 2WKRA 1M74A 4A2QA 2ZYTX 3AVUA 2JLYA 2CLDX 3BK7A 3ADCA 3I73A 1AS2A 5GVRA 4DLRA 3OIVA 3HDTA 1EX6A 1TAGA 4GRAA 3THYB 1N5KA 2Z43A 3EG5A 1SKQA 1II0A 1KDTA 3BAFA 1T5IA 2BDTA 4MRPA 1OFIA 3RRNA 2JDID 3WNCA 1SXJE 3G5UA 1KZGB 1MO3A 4ZDIA 3J81k 4FWIB 1AQYA 1NL3A 2BM1A 2O8BA 1KZ7B 3V4RA 4TTRA 4OQFA 2QTVB 4IDHA 4M53A 1W36D 4LJAA 4XWKA 3RS0A 4IRUB 4LHWA 3IKJA 3LWNA 3PUVA 4K8OA 1P7CA 3FFAA 2DYKA 3RYTC 4ON9A 4HLUC 5K8UA 4NP6A 2OG2A 4QGAA 1HV8A 1DAHA 4B73A 3LX5A 2QPAA 4IXNA 4BUJA 3MJHA 4DRZA 2DWPA 1X8JA 4Q1EA 1OB2A 1ETUA 4LV8B 4OK5A 2VF8A 3QSYA 2WJJA 2AK2A 3MD0A 5G3ZA 1E2IA 2GCOA 3SE0A 1E1QA 1OFHA 1OKKD 4CT5A 4IFBA 5EXTA 5B58C 2IT1A 1M8PA 1GSIA 2EW1A 2HJGA 3N70A 1O87A 4YONB 2WJGA 4KSBA 5FTKA 1DO2A 1IY2A 3DMNA 3FHCB 2ZJ8A 3QF7A 4JBWA 4MUAA 2GBLA 2GCOB 4G5OA 2ODWA 2VRWA 4CF7A 1E0AA 1X6VA 2W6JD 4KFRA 2R6FA 2JLUA 2CK3A 1ZYUA 1VIAA 2BJWA 3CONA 3LH5A 1SKYB 4D26A 4CEHB 5JS8A 2GK6A 3R9WA 1TEVA 2AFHE 1Z8FA 2AWNA 3CWQA 3PUYA 3SI7A 2CLCX 3SQXA 4BRWA 1VMAA 1RW4A 2O8EA 4BLTA 2FSGA 3LX8A 1RC8A 1ZM4A 4KU4A 3WY9A 1F2UA 5HPYB 4MYCA 1J7KA 1CJUC 3GQBA 1RIFA 3PR1A 3U7EB 1SXJC 2Y8EA 3KQNA 4GDFA 3FYHA 4OI0A 3BJIC 2JAQA 4LJ5A 4J0QA 4D81A 2ATVA 2FU5C 2XTZA 3W8RA 3R9IA 3CLVA 1M7BA 4Q1FA 4D80A 1P6XA 3U6KA 4EQ6A 1T6NA 3CRVA 1G7TA 4LWZA 1WBDA 3PXGA 1K5GA 1QVAA 4PANA 4L9WA 1FQJA 1HQCA 1OF1A 4AK9A 1GRRA 3QXSA 5FPTA 1SQ5A 4PPFA 2VHJA 1R0WA 4Q4JA 4GMXA 5B57C 4M1KA 2D2FA 3Q9LA 4HI0E 4C3ZA 1UJ2A 1L4YA 4U7DA 3PQCA 2GHIA 1E79D 4PZYA 4Q03A 3L0OA 3BIFA 2F55A 2D62A 1ZVQA 4PO9A 2I3BA 1S0UA 2OE2A 4URVR 3NDBB 5F9FA 5KHOC 3KKNA 4B35A 3SBDA 2IYLD 4TLAA 1XCGB 3K0EA 4P31A 1G19A 3BERA 3VR4A 2ZRPA 2PMKA 1M2OB 2H8KA 2QMOA 1E1QD 1S1MA 4TQ9A 3NBZC 1IN4A 5B30A 2VIIA 3B8HA 4ZPXA 1WQ1R 3QF4B 3GEHA 5JWOA 4LPSA 4XWOA 3I3SR 4HB4A 1G5TA 3KB1A 1ZIPA 4NH0A 2R6DA 3OHMA 4FW9A 1R10A 3LBNA 1X8LA 5CB6A 2AR7A 3E1SA 4D82A 4DJTA 3UG6A 4IVPA 1WMSA 1NG1A 4JLDA 4GOKA 3VR2A 1NKTA 1CJTC 4BGDA 1ZM7A 4DEYA 3IIKA 3PENA 4C7OA 4YDHB 2OZEA 1A7JA 2PT7A 3M0EA 4BFWA 6Q21A 1NLFA 2PZEA 1DARA 4L16A 3C15C 3M1IA 2ATXA 3IBYA 3UIEA 2ZR0A 4JLBA 3FKSD 4CDGA 4B6EA 1D9XA 2IYTA 2VLIA 2CL6X 4GI7A 4PO8A 1G41A 1XBTA 3I61A 2W0SA 4LJYA 2D7DA 3MCAA 2F3RA 1FPMA 3AKEA 4BRUA 3KKMA 2QNRA 2WJYA 3P4YA 3UPUA 1LB1B 4AG6A 3LNCA 1CR1A 2AXPA 1YZKA 2G83A 2REBA 1F6BA 1W0KA 2VBCA 1X3SA 5K8IA 5KNCA 2QSYA 2VO1A 3N2EA 3CZQA 4Q7JB 2BMEA 1TU4A 5HE9A 1TADA 4A0RA 5FBLB 2RAPA 1XTIA 4IEIA 1G18A 3IIMA 2IHBA 3R7WB 4DCTA 2GAOA 3DHWC 3EIHA 4M0LA 1S3SA 3U3JA 2GAAA 2BBTA 2J7KA 1XEXA 1UF9A 4ZIRB 2OBMA 2O0KA 2VL7A 2IUUA 3AF4A 3SJBA 1UKZA 1XTKA 4G1UC 3ZIAA 1YZLA 1P72A 4B6FA 4WW0A 4KVGA 2CE7A 4KBFA 3AF0A 4ZV4A 3K8YA 4A2PA 3A4NA 2N46A 3LV8A 1CRPA 1XTRA 5DLQC 4GNKA 1E0JA 3HYTA 3THOA 3NXSA 1NN1A 3GPLA 1CJVC 4NKRA 1I4TD 1IAQA 1HYQA 3I72A 3SFVA 3HPRA 2OCBA 4EDHA 1XCMA 2JJ2D 3LDAA 2Q3FA 5CYPA 1DG3A 2RH5A 4ACAA 3AUYA 4AKGA 3QJYA 4WIAA 1XPOA 4QBIA 2NO9A 5TMPA 4V0OA 3UWOA 1WCV1 2ZU0C 5TV2A 2O8EB 4C2UA 3THXA 2W2TA 5EZ6B 2Q6TA 2J7PA 2CNWA 3HU1A 3KTAA 3Q3JB 4LZZA 2NMVA 3A1VA 5CIQA 5LDDC 2BM0A 4H1VA 4Z1MD 3EAQA 3L0IB 4XJXA 2BVNA 1MO5A 3KTAB 4JSYA 4BFYA 1ZMXA 1IJFA 1TQ4A 2OLJA 1CR4A 1L7VC 2EFDB 2WAYA 4N3NA 3I62A 2HXSA 3DDCA 5BN5A 2RGNA 4TZ6A 4F4IA 1ESNA 3OEHA 2IXGA 2QAJA 4DHEA 1QG2A 1ZINA 1CLUA 1YU9A 1R0YA 3GJ4A 4I99A 5FPSA 2HEIA 1BS1A 2QQ0A 4GSYA 1US8B 2C77A 3CR8A 5A0FA 2JLWA 1ZUHA 5KDDA 4F38A 3HR8A 4ESHA 3PUWA 1DBSA 3A1SA 4W7SA 4GL2A 2RGEA 3P1JA 1G8HA 3CKLA 1OV4A 1R7RA 2ZJ5A 4NYIQ 4AIIA 3RVBA 4G3XA 1GNQA 3RLFA 1E69A 2D7CA 4EPXA 3MAAC 4P0TA 4TN1A 4EPWA 2P2LA 5JRZA 2O8FA 2F1RA 2H17A 2QAGA 5JECA 3UKDA 5FUVA 3KUDA 2OESA 3KXIA 4EFMA 1ZAKA 2WSSA 1E32A 2GF0A 3EASA 4MGZR 4IKEA 4WZAE 4KCGA 4ZCLA 1G291 3GFPA 5FR2A 2RCNA 3KX2A 4PPQA 1T3LA 4NCHA 3TGPA 4CEJA 2GWHA 3U3RA 1YR8A 1JECA 1V43A 3EC2A 1ZP6A 5JZVA 1XPUA 2X19A 4YMSA 4GZMA 1G17A 3K70B 2AK3A 1ZU4A 3MGCA 4X8MA 4LC1A 3WRYC 5L3RA 4CEJB 4LHZA 1E0SA 1KNQA 1JQLB 4LHVA 1AS3A 1ANKA 3IUYA 3U44A 4MKIA 4DB2A 2RGNC 2YZ2A 1NI3A 4C0BA 1U9IA 3NKVA 4OJKA 4QG7A 4DDTA 1R5OA 3CRQA 4XD7A 2RKOA 1E9BA 3W90A 4AYWA 1GG2A 1UFQA 4HAYA 1IY1A 4MRVA 2I4IA 3LXXA 2DPXA 5JCZA 2A78A 2FJUA 4DLSA 3DMDA 3DOEA 2R6GA 3V00A 4MGYR 1XD9A 3WXMA 2BHRA 3AQ4A 4MGIR 3SS8A 1JI0A 4H9GA 4RSGA 4JLMA 4LOAA 4RCZA 2ORVA 1EFUA 4ZKDA 1D6JA 4US1R 5FPYA 1G64A 5E4FA 2VP6A 5TXGA 4BE7B 2YWHA 1F3OA 2XZLA 1F2UB 4XIGS 1RRGA 4GP6A 1HQYE 3B1VA 2OHFA 4BQSA 5JEEA 3QVUA 4DSUA 2QP9X 2AKYA 2VP5A 2EWVA 2GJ9A 1E79A 3OIYA 3T5DA 4B2PA 3AP3A 1T3HA 3AVOA 4F92B 3VAAA 4TWZA 2IYUA 1Z63A 1PZNA 4AG5A 3EA0A 2QI9C 4PSVA 1LS6A 3UATA 2A5FA 3ZQ6A 2IEZA 4TYQA 1G5RA 5EE5B 4OHWA 5G41A 1VCOA 1ELOA 4AC9A 1KK1A 3FKQA 4DT1B 3L82B 2F6RA 2QEQA 3A58B 1VIYA 2ZRIA 3QQ5A 1KSGA 1SVOA 3A4LA 1CU1A 5FBVB 3T1QA 4Q00A 3LVRE 1U2RA 3ZJYA 4WZ6A 2ZI9A 3NHBA 1A1VA 2KWIA 1CR2A 2JIZA 4E03A 3I8XA 1Q3TA 2WMOB 1AK2A 2G88A 2NO7A 1Q21A 4ITRC 1G6OA 4QXAA 1JEDA 3DVLA 1NIJA 1UEIA 4ZI3A 2VYFA 1KY2A 5C4GB 3CW2A 2V55B 5HR5A 4LJ7A 5E7MA 4B75A 4TYYA 2UZIR 3JZAA 3ND9A 1Z6YA 1HA3A 4PQYA 1E1RD 3ZZUA 2R6CA 2YOFA 3T15A 1H8ED 1TF5A 4R2HA 5DYGA 2OFXA 4B76A 2GRJA 4DLXA 4BLQA 3QG5A 4JL8A 4DLWA 1GL6A 1DAEA 3TQCA 2FSHA 4RVCA 1Q1EA 1E9EA 2H92A 4RY2A 4PAMA 3U61B 2BC9A 1Q1QA 1N5LA 2MSDB 1UEJA 2ZE5A 4IHQA 1VYUA 2BEKA 1JEEA 5DSZA 1F48A 2B21A 1G5PA 1TUIA 2QMUA 3CB4A 3DKPA 2ZUCA 2XB2A 3WYAA 1R4AA 1DAFA 2RGXA 1KTVA 2YINC 2YWFA 4TMWA 1VKJA 4AURA 5JRJA 2KSQA 1LF5A 3KQUA 3K0FA 521PA 2FFQA 1FP6A 3C5HA 3ZVNA 2QA5A 3EZ2A 4KAXA 5FOSA 1IN8A 2DR3A 2CNWD 5DISB 1QHHA 1KO8A 1XXHB 3T61A 2GJAA 2FWRA 2VP2A 4A9AA 3O8RA 2IX3A 4JLAA 1D5CA 3Q7PA 3EW9A 1KDRA 4ILEA 4KFTA 5JEDA 2RGCA 3HP1A 3QNUA 4NYIR 3UMRA 3IGFA 4AYTA 1E2KA 2F43B 2V6JA 1W4CA 1KI1A 2O52A 4GMDA 4KJZA 4ACBA 4TL6A 1YRBA 3NH9A 4ARZA 4NBSA 5JSZB 2ZSBA 1OH8A 4KV9A 5L3SB 4MRNA 2IL1A 1OIWA 1SHKA 1XMIA 2QPOA 3PEVA 1ZNWA 1YHNA 3FMIA 2J0SA 1ZCBA 3B5JA 4E07A 3W5JA 4ABYA 1RYHA 3K9LA 2A5DA 4BZPA 4EQ6B 5C18A 2DFNA 3GMTA 2NZ8A 4B2LA 3ICQB 4OYHA 4EKDA 3F8TA 2VQSA 4RCYA 2QG6A 1XWIA 2XSZA 3PIRA 3NC1C 4YC7A 2QT0A 3ADDA 2GZHA 3T35A 2G0NA 3ONWA 4LDJA 1JQJC 2NQ2C 3VR6A 4ZO4A 2EYQA 2PEYA 1N5IA 4POAA 2CVHA 721PA 4AD8A 1E9SA 1TEXA 3M6AA 4DBLC 5FBRB 2ZRAA 3OE7D 4DIDA 2J46A 4EPYA 1FFHA 3A1UA 4JVMA 5IF9A 4PQRA 1T9HA 4I81A 3THXB 4TYNA 4TMKA 4A15A 2ERYA 3GLFE 1NLZA 4M22A 4P33A 1DOAA 3WMGA 4FMDF 3EARA 3PEWA 2YOHA 3FMPB 5CJPA 4BLRA 4DLUA 5DNYB 3AM1A 1JB1A 1DVRA 3KB2A 4DCVA 2FEOA 3RHFA 2OSBA 2O0JA 4MKFA 1ZD8A 1R6BX 4II7A 3DL0A 4IOLA 2QGNA 4OHVA 2OEPA 4O3MA 5KU1A 4LRWA 2XXAA 121PA 4JLNA 1WE2A 3HWSA 3MLEA 4G5GA 2R62A 1G4AE 2AN9A 1I4LD 3C41J 5SZHB 1DE0A 2IYXA 421PA 2QBYB 2B7CA 1VPLA 3MJRA 1GRQA 2V1XA 1XF9A 2RGBA 3QF4A 4A0GA 2FX3A 1NF3A 1U81A 2Z5FA 4QFMA 4PTLA 3EC1A 5F9HA 1KO7A 4A8JA 2ZUDA 3SN6A 4B33A 4LHXA 2NO6A 1E2HA 1XXHE 4FMCB 1T5LA 1ZNYA 2QY9A 2XJ9A 1IQPA 5EZ5A 4E22A 4M9ZA 5KTYA 3AVTA 1TQ2A 2V4ZA 2WHXA 1GDDA 2ZI3A 1P5ZB 4EFLA 1KI6B 1OFTA 3Q5EA 4LYHA 5TARA 5C46F 3FMOB 4GZLA 1OIVA 2DFKB 2ZSDA 3VNVA 5LD2B 1Z6XA 3VKWA 3HPQA 1EG7A 1QHSA 4LJ8A 4MITA 4Q18A 2C9CA 4Q4HB 2WIBA 2ZXUA 1TQ6A 2VSFA 5JSZA 821PA 2KBFA 5J4KA 3MSXA 2O8CA 2VH5R 2G9NA 1FNNA 4XWAA 4DCUA 4DCNA 3GJ6A 2J1LA 2FGKA 3O47A 4LC0A 4XD7D 3FTQA 3ADKA 3KKOA 2ZM5A 1Q1BA 1XEXB 2WWFA 5E7JA 1Z47A 4GP7A 4CEIA 2LKCA 2NGRA 2C04A 2OFWA 4QC2A 5DN6A 2MMGA 3RS2A 1DTSA 5KPJA 1VG9B 3VKHA 1HE8B 2H7VA 2ZJ2A 5AJWA 3MUFA 2EFHB 3WYFA 3IDQA 1EFHA 4IVQA 5KSZA 2ZRJA 3TSWA 3B9PA 5FL3A 2BMJA 2GKSA 4IOMA 4C0LA 1HT2E 1G7CA 3RS5A 5BXQC 4B47A 1DPFA 1FMLA 1FX0B 2CBZA 5GJWC 2QGZA 5FPHA 3NG1A 2WWXA 4GT1A 1JAIA 3W3AA 2PT5A 1P61B 1RRFA 4HEJA 4PC1A 4NCIA 4PAOA 4MUBA 5E7IA 4GBMA 4RD1A 3O8DA 1A5TA 2OCAA 3KJHA 2RGAA 3GFOA 3NVAA 2FV8A 4HLDA 2WWWA 2G1JA 3VNUA 4UNPA 1E3MA 2YJTD 1ZUIA 4LBYA 2Z6VA 2GA8A 3QKSA 2FN4A 4Q9HA 4NYJQ 2J0QA 4PPNA 5FR1A 3O8CA 4M8NE 1NVXQ 2XTMA 3ZS9A 3TNFA 1YR6A 3T1TA 2W83A 3ZZTA 3ZZ0A 4B3FX 1BKDR 1WA5A 1E99A 5EP1A 2YKGA 5LPNA 1AQUA 1GUAA 3U3OA 4XTRA 3T5GA 1GTVA 2OBNA 4MRSA 2B8TA 1JR3D 1E2LA 2WIAA 2NPIA 5AJYA 1C1YA 3IO3A 4DSOA 5L3QA 2GXSA 3BB4A 4Q7MB 1BO6A 4I1VA 2QUZA 4UXIA 5IRCD 1JJVA 4A82A 3PEUA 1DELA 2GVDC 1OFUX 1UADA 2ZU6A 2OT3B 2ZIAA 4PZLA 1KI6A 2CE2X 1Z2AA 1Z06A 3CPJB 1JPNA 1E2JA 1BYIA 2REXB 3JVVA 4M9QA 2H1LA 4QOSA 4M2LA 2GEUA 4YLGA 5BW8A 1OYWA 3LAWA 4X8LA 4BWYA 1U98A 4D0LB 2P5SA 4DWJA 2WV9A 1IXZA 4B3CA 4UKDA 2QP3A 1MABA 1TL7C 2AHOA 4NCNA 3W8NA 4C0KA 4ERNA 4I1UA 1YJ5A 2R65A 2JJ1A 4R71A 4ARZB 3RWMB 4KSCA 3WNDA 3NH6A 1R5NA 3I5YA 2X2EA 4G01B 3ZQJA 4HATA 1XTSA 1SVIA 1F2TA 1GNPA 4JLPA 4X8HA 3GJ5A 4M4SA 4Z51A 3NIBA 2IYZA 2G1KA 3VR3A 1ZM3A 4HLQB 3B2EA 2IYRA 4QHYA 1DADA 4TMTA 2IXEA 4QBFA 1D2NA 3BWDD 4QNMA 5FUYA 3WBKA 3W6NA 1WP9A 3WRXC 1FTNA 3W3ZB 3K70C 4HB2A 3RS4A 5D3MB 5GVSA 4NPHA 4BZQA 1KI9A 3H0KA 4XSHA 1TF7A 2DWQA 1EWRA 1W4RA 2R44A 1GAJA 1B0UA 4U5XA 4CVNA 2F9LA 2A30A 3CUEF 2DB3A 1IN5A 1FUUA 1IBRA 2NG1A 3GJ3A 1GRNA 1OXTA 4L5BA 4B44A 4B32A 4RZUA 4Q66C 4A6PA 3NDPA 5G40A 4YMTA 2R2AA 2WJIA 4JYBA 2JLZA 2ZR9A 2L0XA 3FB4A 2WPDD 1R0XA 1PVOA 2IUTA 3GJ8A 3AVXA 3QBVA 4TTQA 1EFRD 2FOLA 1XD2A 5J4LA 5EXSA 4Q21A 4X8OA 3WP1B 1XJQA 1WB9A 3IHLA 3ZD7A 1T4GA 4NL4H 1E4VA 2ZE7A 3CPEA 1VG1A 2GJKA 2J87A 2BOVA 3PG5A 1KIMA 3QPUA 4Q7LA 5FOVA 3RABA 2ORWA 4MYHA 2D74A 3X1XA 3KQHA 4PSKA 1GIAA 1MO4A 2JLQA 1FNMA 2OAQ1 2IEYA 2MMCA 1DAIA 2CL0X 2GBLC 4UJ3A 2I1QA 4LUCA 4OHYA 3U60B 1Z0AA 3TUIC 3GLFA 1ZNXA 5JJIA 4B48A 3NC0C 2IC5A 3VHXA 1KKLA 1R0ZA 2WJVA 2GTPA 1R8SA 1ZD9A 4JBXA 2O8BB 4S35A 1E96A 4BFTA 3K0SA 5FL7D 3BC1A 4QGFA 2BEJA 2IS2A 2SHKA 1C4OA 5IK2A 4HB3A 3EXAA 2ZS9A 1OSNA 2ODEA 4Q4AA 1H8HA 1PLKA 3PUXA 2XSZD 2EFEB 1E9RA 4FINA 2AD5A 2C98A 2JJ8A 2J7PD 2ZRBA 2OV2A 2ZSAA 2V9PA 3OEHD 3GCGA 3QIAA 1QF9A 3CH4B 2ZUBA 3B1YA 3SR0A 3UANA 1JNYA 3TH5A 5EXPA 3B9QA 3FDIA 2ZAMA 1G8GA 3AF1A 1RFLA 3OE7A 1EESA 3C4JA 3QY0A 3BBPA 3UXMA 2CCGA 2OILA 3DZDA 3CPHA 4HAXA 3TW8B 1LVGA 2FA9A 1BH2A 5CYOA 1W4AA 1AA9A 2P67A 4RFSB 1EK0A 1NP6A 4A92A 3QE0A 4EUNA 2QE7D 3QVVA 2KB0A 3NTUA 1G8YA 3K0FB 3AGPA 2WSSD 2HDNB 2QTFA 4TLEA 2RGDA 1GWNA 3K9HA 1QG4A 2W6ID 3AP2A 4PHHA 3KXKA 4DSTA 3BRWD 2NOAA 1FX0A 2OCYC 4XH9B 3U7FB 2QSZA 3EPHA 1GKUB 3QXHA 2W6JA 3VHLB 3KQKA 3LFUA 4MKGA 3K0CC 1VDZA 2EWWA 2J45A 1E9AA 4D0GA 2CCKA 4WAUA 4Y0AA 5KDOA 2P6RA 2EU8A 3U44B 1FL9A 2UVQA 3REGA 3FOZA 3R7WA 2WMNB 5EXXA 4B2IA 2AWOA 4O2LA 4URYR 1AKYA 4IDQA 1CIPA 3MWLA 4KYIB 4LX0A 1NVVR 2QMEA 3QKRA 4JS0A 1CJKC 5L3SA 4V0LA 2ODNA 4CEIB 1HH4A 1OHHA 4JBYA 3E5HA 1AZSC 5JBQA 3AVWA 1G3RA 4KFUA 3R8FA 1I2DA 2ZSFA 3FGNA 5ELXA 4C0QC 3THYA 1MT0A 1NBME 4XVQA 4YXWA 3SNHA 4D0NA 2BWJA 1KMQA 221PA 3QPVA 2QMHA 1Z0JA 4URZR 2F43A 4F93B 4DCSA 2QM8A 1QHGA 2UKDA 3K09C 2IYVA 5AJZA 2QQEA 3ADBA 1IN6A 2H16A 4BLOA 1R5BA 3BB1A 2HLDD 1N6LA 5HCIA 5FBQB 1J99A 3FKSA 2YNMA 4M1MA 4QJ5A 1RRPA 2BIFA 3I92A 4M1YA 4LSGA 1WRBA 5LB2A 5C2JB 1GKYA 1UPTA 1ZRHA 5DHAA 4URUR 3UMFA 4R2IA 5CLLA 4F7WA 1QHNA 1L2TA 1IHUA 3TE6A 2B6HA 3V9PA 4KITB 1Y63A 1E1RA 3W34A 1S8FA 4O0MA 3WNBA 4L15A 5JHHB 4Y0VA 1FOEB 5AUQA 3THWA 2C9OA 1A82A 3HU3A 2XAUA 4JYCA 4BLSA 1CXZA 1YVDA 3D6TB 1JAHA 5K8TA 1KAGA 2FNAA 3LW8A 2W2XA 3TAUA 1NSFA 4CGZA 1E0KA 1XX6A 5CLQA 3OIUA 4M1TA 4DB4A 1W4BA 3AF3A 2QL6A 2ZE8A 3Q7QA 2GF9A 2VA8A 1YZGA 4B3BA 1LS1A 4DIEA 1N25A 1WF3A 1NVWQ 4RD0A 4ZKEA 4TYWA 1KY3A 2R9VA 1SZPA 1GZSA 3GJ0A 3ZD6A 5JWHA 4DLVA 3RRYA 1W2GA 5FI0B 5FH9A 4OHXA 1W36C 2JASA 3CR7A 2W2VA 5KNBA 3IIJA 3U3KA 4PHFA 1BMFD 1J2JA 1S3GA 4QHTA 1GM5A 4K81B 3S1AA 1XTQA 2WVJA 4OQMA 1HURA 3LRPA 4M1SA 1CS4C 4EJSC 2FFHA 3BFKA 2VF7A 1EX7A 4TLCA 3R8CA 4BFUA 1G8FA 2XB4A 4FD2A 621PA 4JVSB 3VQTA 1T8TA 3UMSA 1TNDA 4JLOA 4DUGA 3LW7A 1XRJA 4JKYA 3GJXC 3K9NA 4NDZA 1CRQA 2KE5A 1AM4D 2MSEB 2Z4RA 3VTKA 4NMMA 4W9MC 5FOWA 1E2PA 1CEEA 5CM8B 2ZR7A 4NONA 3LD9A 3CIOA 4FMDB 1NNEA 1G3MA 3NBFA 3ASYA 2C8VA 3L0SA 3L8ZA 3DEFA 4A1FA 1D2MA 1ZD1A 4OI1A 3WMEA 3CNOA 2XOKA 4HAZA 4QJ3A 3AUXA 1NN3A 2OAP1 1W44A 2ZITA 3CH5A 1X1SA 3ASZA 3H86A 2V7QA 4MKHA 1N6RA 4I1SA 4WXRA 2YC4C 1TPZA 1M6NA 4RD6A 1H8HD 2IK8A 2DY1A 2OCPA 1G4UR 4OI2A 5KOYA 1RPZA 3TVDA 2QZ4A 3EPKA 2JJ2A 5AJXA 1KI2A 2EQBA 2WTUA 4MA4A 2JA1A 3QKUA 5KNDA 4JT4A 2CVFA 3THWB 1P60A 2OM2A 1KHTA 1GL9B 2KBEA 1UBGA 4AY2A 3VMFA 1TMKA 1J70A 4F91B 1YR7A 1S96A 2ASEA 1WXQA 1KJWA 4URWR 3TBKA 1Q12A 3I5XA 2HV8A 1ONBA 3DZ8A 3JZMA 3SFZA 2HYIC 5K8LA 1BMFA 4U00A 1J8YF 3T34A 3GLGB 3U6BA 1KSJA 4HZUA 5AR1A 2Q21A 2QE7A 3L43A 3WBJA 1OT3A 1QHIA 1ZJ6A 2A5JA 3CF6R 4OI4A 5FTMA 3TKLA 2VP4A 3ZIAD 1NVUQ 2CJWB 2DHRA 4CW7A 1JPJA 1Z0DA 3D31A 2LWIA 3AKYA 2ZJAA 1BYUA 2HF8A 1KI4A 2PLRA 2W0MA 3RNLA 3CNLA 5JWRA 1Z3IX 1HEIA 4PPGA 1EFRA 1E9FA 1G3IA 1RZ3A 2G77B 2IA5A 3I1FA 4LYFA 3RC8A 1MO6A 1HUQA 4FMCF 5DYIA 1EGAA 1FTSA 2J0VA 3S1AB 4B34A 2QROA 1Q44A 1KNXA 2B92A 1XJCA 2WICA 4ZDJA 4Q4AB 5JFGA 2WZQA 3C8UA 4KBGA 1XMVA 1K8RA 5D3QA 2CHGA 1II8B 4BFSA 1AN0A 5BQ5A 3X1WA 4MH0R 3BORA 3G82C 4R7ZA 2PCJA 1NLYA 3QKSB 4DDVA 1W0KD 2F9MA 1SVWA 2QENA 3AVQA 3Q5DA 2VP9A 3IPXA 5AWFC 2QBYA 4A36A 4LJ9A 4QGHA 4G5RA 4EAQA 2CXXA 2ZANA 3CRW1 3A6PC 1J90A 4LY6A 4YXWD 4QL3A 2CMKA 3CRMA 3SU8A 2QORA 3KXLA 1N5JA 2WJHA 2C9YA 2ERXA 4A8JB 4N0EA 5B2ZA 3AKCA 3BH7A 1U90A 4IOKA 2EYUA 1IOZA 1RJ9A 1G7RA 3ND8A 5HCNA 3R20A 2OUKA 3BOSA 4HDOB 4P3YA 4V0KA 3PVSA 4HDCA 5B64A 3IEVA 2PL3A 4BASA 2JATA 2YWEA 3U3MA 4A0HA 2E9SA 5HKKD 1EWQA 3PV0A 4QM7A 1OXVA 1RJ9B 2BCGY 1E9CA 1XNJA 3K0AB 5TY0A 3VKGA 2VHCA 4TYPA 4C0AC 3D3QA 4OKSA 1OPXA 2WOJA 2WSMA 3K09A 3KJEA 5E95A 1OH6A 4JVLA 1M7HA 2Z0MA 3EIEA 4Q9IA 4FXPA 3MMPA 3SYNA 4YDSA 2YHSA 1N2CE 4Q4LA 3QOFA 5BYJA 1MABB 2HCJB 3E70C 2ZRNA 4HUTA 5KUTA 3U7HB 3N5CA 4Q4JB 1G21E 4KODA 4V0MA 1SVKA 1TUEA 3IPYA 3U5ZB 2O5VA 1G7SA 1D2EA 1X1RA 4GOJA 4LJ6A 5FUWA 4V0ME 2BMDA 1HY3A 2GETA 3EZ7A 3Q85A 4C30A 5F3WB 3IQWA 3T1OA 1S9DA 3KFXA 2HUPA 2HT1A 2G0TA 2D3WA 2J0UB 4RZXA 4BLPA 4TSFA 3GLHE 2XTNA 4B74A 2Q3MA 2QAGC 4I1OA 1MR3F 4ZDWA 3QI2A 3GP8A 1RKBA 2ZETA 3TSZA 2ZJYA 4LBWA 5FI1B 3A37A 5F98A 2O8DA 5FBWB 1QHYA 1YZUA 2E87A 5CB8A 1D9ZA 3A4MA 5JJKA 1U99A 1OW3B 2EVWX 3B7GA 4LJ4A 2QAGB 3L0PA 2QRNA 3TVTA 4NYJR 2VTKA 1XPRA 3Q72A 1QZXA 1NMXA 3L8YA 3TJZA 3TLXA 3QUSA 2AL7A 3ETLA 1VYTA 1E2NA 1SVMA 4AKHA 2CCJA 4RKFA 1CTQA 1E2DA 2YVUA 3WYGA 3VR1A 2DBYA 4LYJA 1IY0A 3TAHA 3AEZA 5BN3A 3SOPA 4W5HA 3W6OA 4ASUD 1LW7A 2XEXA 5DI9A 3QG1A 1Q3HA 4DLTA 2YWGA 2IW3A 1QHXA 3GLGA 1GFIA 2IHYA 2NTYC 2A9KA 1NG9A 1W36B 4XVUA 1JR3E 4M9XA 4WA7A 4BECA 3BE4A 2RB4A 5EE0A 1GP2A 4KVAA 2E1RA 3SYLA 1MRSA 5KSPA 1H8EA 1RYFA 3KL4A 1KOFA 5BN4A 2V7QD 3IHWA 3B1XA 3NBXX 5KSYA 2ZPTX 3I32A 5FFMA 3PUZA 1O3YA 3UG7A 3T12A 4DKXA 1UKYA 1Z28A 1OYYA 4JL6A 2Q3HA 5SZJA 2FDCA 4PXAA 2B7BA 3P4XA 1Z0IA 2H18A 4QRHA 5EE1A 5EP3A 2B8WA 2JLSA 3K0AA 1NSTA 2WKQA 2GEVA 1G9XA 4HAWA 3F0TA 4B71A 2ZTSA 5FTNA 1S9HA 5FTLA 3QPWA 1LV7A 5JMTA 1Z0KA 2Q0HA 3TMKA 4NZYA 4LV6A 1II8A 4IVRA 3E2IA 1N6HA 5TB5A 1T3SA 4L9SA 3AF2A 5JHGB 3SYKA 2HJVA 3WHLA 2C96A 1LY1A 4MYUA 4Q02A 2ZVPX 4GOXA 3CBQA 3ZS8A 4Q5IA 2VSXA 1YZNA 3WP0A 2X8AA 4M1OA 1LF0A 1XB2A 1KMHB 3U4QB 4FCVA 3H2YA 2X2FA 2KJQA 2TMKA 5DHFA 2ZRDA 1KK3A 1T0JB 4JLVA 2G6BA 3CF2A 4BPBA 3A1WA 4PAQA 2WBLC 2ZRMA 5FTJA 4MDEA 1Z5ZA 4M1WA 4A2WA 2IBMA 1I2MA 1SVLA 4UNNA 3AVYA 4Q1CA 4TL9A 2XZOA 4TT3D 2ZAOA 2VSOA 4JJKA 1SKYE 4PC7A 3GLIB 5LD2C 4TLDA 4O2RA 2J41A 1Q20A 3OFND 4DVGA 3X1YA 3KQLA 5H1YA 3TR0A 1IONA 1N6PA 1PLLA 1UBCA 3IO5A 4Q48A 3LLUA 4TMZA 3GLIA 3FHOA 2ZYWX 2A7QA 3OIWA 4JLJA 3T06B 2JEOA 4UNSA 2QU8A 4JZKA 2GVZC 3SHFA 4DUGD 1XD2B 2F7SA 1CF4A 1XMJA 1V5WA 1W5TA 2A2ZA 4LPKA 4TQUS 2IUSA 1IXRC 1T8UA 1A2KC 3K70D 2RGGA 1G6HA 4JLKA 2GILA 2VHQA 4A0FA 1P2TA 4TTPA 1CBUA 4P4UA 3OESA 1VCIA 1P75A 2A5GA 2ODBA 1T0HB 2P5TB 4OJQA 2WAXA 5J4VA 4I4LA 1W0JD 2FZ4A 1NBMA 4TMVA 3VFDA 4G5SA 1VECA 3FPAA 2C78A 1PUJA 1AZTA 1N0WA 4C0SA 1NIPA 5FPKA 4NTZA 1NMYA 4Q7KA 3B1WA 4IDNA 5TDHA 3PEYA 2FZLA 1COWD 1Q57A 1U8YA 3TUZC 4MQBA 5L8VA 2JGNA 1CR0A 2CLSA 2VPPA 1QHHB 2OO7A 3LA6A 4PC6A 1MRNA 2IF2A 4PFSA 2R6AA 2R8RA 4NU0A 4DSNA 2JLXA 4EFNA 1A2BA 2IS1A 3CRRA 1Z6TA 3X1ZA 2W6IA 3SDZA 1UDWA 1Z22A 2FSFA 3LO5A 3H4MA 3CX6A 3DM9B 2XNSA 2J5XA 2V6IA 4DT1A 4DDUA 3CO5A 5FOTA 3IBGA 4TLBA 1LFDB 4HAUA 4JVNA 1P2VA 2GEDA 1E4YA 2C03A 4LI0A 5EP4A 2O8CB 4FMBB 4PQFA 2HCBA 3SQWA 3FHTA 3NBYC 2QP4A 1GNRA 3P20A 4RD3A 2OXRA 2ZYUX 1NJGA 3A1TA 2QRZA 4QNRA 4HZUB 2QM7A 4V0NA 4B3GA 2AFIE 4JSTA 3KUCA 1MH1A 1DAMA 4HZIA 5AK0A 3FE2A 5KDLA 1I4DD 4EIWA 2DFLA 1KO5A 1XJ0A 3OAAD 4Z1MA 1G20E 2C2HA 4UNRA 1QRAA 4EPTA 3QEOA 4RKEA 4EJSA 4WXPA 3B82A 3EIQA 5EP2A 3TQFA 2H5EA 2PH1A 1DO0A 5DN6D 1PUIA 1M7GA 1K5DA 1N6IA 1PJRA 1AJEA 4BFZA 1GITA 2PJRA 1W0JA 4C0HA 1JXOA 3FWYA 5IK2D 2AX4A 4LYAA 1GVNB 4DXAA 4Z8XA 4A4DA 4V02A 2XZPA 2EFGA 5AUOB 4QBGB 1GKIA 2AD1A 4D4KA 2FPKA 1N6OA 2FGJA 3MWKA 2CHQA 2XX3A 5GJVC 4JIMA 4AI6A 2D4HA 3ECCA 2ZJOA 3LVQE 5DO9A 3UK6A 1P9NA 4FCTA 5KSOA 1GILA 3ZVLA 3P27A 1SHZA 2RHDA 3TW4A 4C7OB 3EZ9A 4CT4B 1MKYA 2GXQA 1VTKA 3U4QA 4L8GA 4PZZA 1ZM2A 5HTKA 2V3CC 2IWHA 4PC3A 4CRWB 1YKSA 5JI2E 4KLZA 3UWKA 2P65A 3ZVRA 4MDFA 2O8FB 4Q1AA 1KDPA 2FH5B 1PLJA 3RWOA 2IF0A 3ZLJA 3KJIA 1DAGA 1FUKA 2CJWA 1VG0B 1W48A 4TMXA 5H70A 2HLDA 4GPTA 1E2MA 4PC2A 4LBZA 3ZYCA 3GJ7A 5E3HA 1OXSC 1QBKC 2ZJBA 3PFIA 2BKUA 1L8QA 3ZVMA 3KJGA 5FOUA 3ZH9B 4P4SB 3MFYA 4KHZA 1OKKA 3AV0B 4QJ4A 2OXCA 4YMVA 4RFVA 1UKEA 4JJZA 3AVVA 1M34E 4MYTA 1E2EA 1FQKA 2A3RA 3B78A 3FFBA 3BH6A 4IXMA 4DZZA 5EJEA 1SXJA 1XEWY 2ZRCA 3ZGXA 3W5IA 1YR9A 1JR6A 4BFXA 2NO1A 3QXCA
chains in the Genus database with same CATH superfamily
1T4CA 1WKCA 2ZIUB 5A6SB 3IR6A 4XSGA 1M2GA 1AGRA 4M54A 2P8SA 4OXNA 4L8LA 1DBPA 1GPUA 3RAPR 1N8SA 5EE9A 3R3SA 1PD1A 1ZSYA 1Z9BA 1ZUNB 2X6RA 2DHCA 2IPLA 3U3DA 2Y1XA 5JAPA 3HSKA 3G68A 3R09A 2ZRGA 4RA6A 2EFCB 1ESDA 2Q4DA 2MJLA 3AJDA 1LJ8A 1U2EA 3DMHA 3H5LA 1P62B 3QEMA 4PX9A 4X1IB 4XTCS 5T8KA 3KKKA 4HPWA 4KNYA 1XD8A 1DKPA 3KV1A 4UHKA 4UBKA 2J6HA 2A1IA 3WHKA 2JFPA 2P2CA 2GXUA 2H9YA 4U2GA 3U56A 4IDPA 2JD1A 2JF0A 1Y48E 5FF9A 2EGGA 4P7JA 5SZKB 4L3VA 1HG1A 1WABA 3P9QA 4BMYA 5KTNA 2W8ZA 2X15A 3C3CA 4FU0A 1DRVA 2XMQA 1FUIA 1XU4A 4MS3A 3NOVA 5KPDA 3VNBA 1XAJA 3ZDQA 1NURA 2VVTA 3U2QA 3DPUA 2BMFA 3BMCA 1AMOA 5AM5A 3TG8A 2NSLA 3MG9A 3AT1A 2JIRA 2PVPA 3FNQA 4GPBA 1U3WA 3QKRB 4JI1B 4B87A 1W4LA 3CNHA 5JCJA 4DF3A 5CH3A 4BYMA 1Z29A 1KJYA 4II2A 4CG3A 3F2VA 2X0FA 3A9UA 1YZ3A 3LQFA 3VZQA 1J22A 4FYPA 3HE3A 3FYUB 3D7SA 1G0OA 3OHPA 2ZSHA 5BT9A 2FZGA 2PBFA 3LKZA 4WESA 1BS9A 1DEKA 1EJ2A 1XDWA 3RSOA 3CVUA 4G86A 2V7UA 1QQ7A 4C6SA 4HNUA 1E5TA 1MEOA 3OFNA 5ALOA 4MEAA 1OLUB 2P4UA 1SG9A 2BKVA 2X3UA 3R8XA 5SY6A 3RM3A 1FW6A 1G1MA 1DAKA 3FPCA 4ZCIA 1KEUA 1U0HC 4D98A 2B2XA 2GPJA 1JLHA 2XJ4A 4LISA 5DFAA 5C1DA 1AK9A 1C7EA 1PT6A 5JUWA 4FWTA 3M6MD 3S44A 2CXRA 3SZLA 4PIMA 4RZIA 1YIDA 5J47A 3JRXA 3R4VA 1O6BA 4LOLA 5FUXA 3GHHA 3FVQA 2HMTA 7ABPA 3KQPA 3TCXB 1V4VA 1MLDA 2LKDA 3MJFA 1MOZA 2X5NA 3L8FA 4OM8A 4XI9A 1YBVA 3KYBA 5BQXA 4D9KA 1NU6A 4GMFA 1O2DA 2YV2A 1X86B 3CB2A 2OHOA 3RCBA 4OK3A 1EGHA 5B3AA 4KLNA 4QU5A 1U7DA 2XXAB 5C31A 4NFYA 4CV0A 5I47A 3VPXA 3N74A 2XUHA 2WWVD 5KUTA 1DMSA 1VL0A 3EWAA 1WXHA 4JA0A 4NI5A 4P7KA 4U7WA 4YAGA 3VJRA 1GARA 3SZRA 5DHUA 4G4IA 5AUPB 2JLVA 2F4VB 2YXPX 4R1SA 3N2ZB 1PUXA 1DJMA 2LTAA 2FG5A 1FPQA 1XVTA 3F46A 1CY0A 3P9RA 4M21A 3UAZA 1OJLA 1ZRSA 4I36A 5D87A 4DCCA 1JXMA 3FJOA 3ISVA 4NHOA 1BVHA 4I3FA 4QGGA 3ZTTA 3E9QA 4X20B 3OJWA 4EITA 2IE8A 2JHAA 3QU2A 7GPBA 4MRRA 3QEJA 1Y6ZA 5JATA 2O0LA 2GZ1A 3GD7A 1MEEA 2O0HA 2XUGA 4MQLA 3B3AA 3HKEA 4G5QA 4RAQA 3OZUA 3GEPA 4FGJA 5K3FB 3CF4G 5IT5A 3MQFA 5L3QB 1Z4PX 1ZK3A 3P96A 1D4FA 3NJ8A 2WG2A 4HBZA 4IX9A 4OHZA 4DY6A 1ZA2A 4ZMSA 1CY1A 1WCWA 1EFTA 2FSIA 4INJA 5EYPB 1EHCA 5KCMA 4PV7A 3Q41A 3JQ8B 3PE6A 2VQ3A 2GLTA 5J4YA 4ZHQF 3DHEA 4HV4A 5KSWB 2ZE6A 4P4SA 4ZT4A 4KR2A 1KOJA 2XDWA 2R6JA 2L82A 3KZ1E 4UW9A 3AH8A 3KPVA 1KBOA 3D8BA 2QD3A 2YR0A 3BE8A 3V7NA 1DJQA 1UC5B 2MSCB 4KTTE 3HU2A 4OKIA 2BM8A 3RYIB 4FFPA 5LB4A 4Z3KA 4BO0A 2VP0A 5FNVF 3FWPA 3L4SO 1NVVQ 3KT6A 1E9DA 1QGDA 5I7EA 3SJAA 4E70A 2XYVA 4B3XA 3EFBA 4WOPA 3U1BA 5U4QA 4ZK2A 1G3UA 3C1UA 1P4SA 3ZU2A 2X0JA 1FS5A 2X9QA 1E1NA 1J1IA 1GUYA 1RE0A 1TCBA 2NQTA 1NYLA 3AHHA 3B38A 1AKEA 4K2AA 3VYTB 4EJ0A 5C1BA 3VPAA 3P26A 3R76A 5AVTA 1L7QA 3E0QA 3RSQA 2AOVA 3EQ8A 3QELA 4IDGA 5LOVF 1E62A 4B09A 2V7BA 5C8XA 1E6KA 1OAKA 1B1CA 3KEFA 2VTBB 1NN5A 4U9IS 1W5SA 3VO8A 2LRHA 5TX7A 1VJ0A 4ND1A 1RJWA 4N12A 4AXXA 2DCUA 4N49A 3MVEA 2YL2A 4HVAA 4ARUA 2QV7A 2CLFB 1FP4B 2HF9A 3MCZA 4P84A 3LLSA 1IWOA 4UFOA 2XY4A 5E6UB 1ICEA 4JJ6A 5ICFA 1GVHA 2J59A 2WMDA 2YVQA 2NO0A 1UBHS 4IW3B 4CF5A 5BSGA 1JTVA 1KFCB 3K9GA 2DSTA 1JALA 4LY3A 1IE3A 1LVUA 1S4QA 3C7KA 3TR5A 4FGWA 4ZDKA 2X5KO 2IVFA 1G8AA 1W5AA 4OY3A 1BE1A 1U94A 3TDNA 3IE1A 2IHTA 1JR3A 3D6JA 2ZROA 1ZD2P 1ESZA 3AKDA 3H9QA 3VKUA 2FB9A 2VHUA 4BNDA 2H31A 2Y1CA 1MFZA 4KK4A 4N9QA 4BMZA 4I4TB 1GV1A 4KNWA 2P6UA 2QMZA 1L4GA 2QT1A 2WIGA 3NORA 3N75A 4FI3F 4N03A 4DG8A 4U3JB 4BZXA 4CKBB 1JU9A 4UNQA 1F0YA 2G3YA 4EG8A 4OGFA 3F4BA 5FUBA 1S2GA 1U9IC 2M1ZA 4GH5A 4URFA 3RIEA 3UV7A 1VE7A 3PZRA 3VHRA 5EINA 4LCBA 1ZEMA 1KYIA 5AHWA 5J1TB 5JPCA 2RJNA 4OIFA 4ZIRA 3U4HA 2X8WA 5AW0A 2I2DA 4DUYB 1Q83A 1GZHB 3LYHA 4LF6B 4S1PA 4MTLA 5ELLA 4AZWA 1NASA 3FPGA 3WWDA 4BFVA 3T6KA 5FLXA 1AHPA 4ZAXA 5J4HA 3PEFA 3MGKA 4FXOA 4M87A 1JIXA 3UMCA 2HMUA 4Z4GA 3QI7A 4OHRA 5BV0A 2C3YA 1VYVA 4U8HA 3IUJA 1RPNA 4A10A 4RHUA 3CZRA 3ORFA 1QH0A 1V3TA 3EGXA 5ARDA 5LJLA 3H4TA 4B4KA 1RTTA 4XASA 3FDXA 2OKCA 2PT9A 3VX3A 2NLOA 3ZWXA 4TMFA 2JFQA 5H9WA 2PUCA 4CKCA 2QVLA 3LGXA 1KJNA 3BH0A 4BJ6A 3MOGA 1DTWB 2PLWA 2Z9DA 4DV5B 1Z2OX 3KKPA 3FTEA 2QN9A 4E3WA 3LWDA 4HDRA 4YP1A 3LI2A 2PMWB 5JD5A 3KXDA 3OF5A 1P2SA 1WHTA 2EKPA 1QGOA 3BFXA 3A1DA 4QXOA 4UXJA 3KIPA 4ZOLB 3QLVA 3RW9A 2DEUA 2DFTA 3HS3A 3RFTA 3IOEA 1T24A 1TKRA 3T9CA 3NEYA 4C6RA 5CJ2A 1FTQA 3QENA 5F12A 1IXKA 1TM4E 2NPOA 4BVFA 3HKDB 4Z49A 2ZBUA 1ORDA 1F5NA 4R7TA 1WD5A 4X7PA 4PN7A 3QBDA 3IODA 1Q22A 5CHYA 2ZRLA 1FYEA 3LKDA 2W2KA 4UNIA 1AXRA 4NCJA 3HNOA 1J8MF 3JVUA 1R18A 2PFKA 2Q4EA 4C9BA 1F1JA 1LNZA 2UXCB 1HE1C 3NU1A 3VNSA 1FS4A 4CZ2A 4FNGA 5BWCA 1SXGA 1M34A 4PRLA 4GL4A 3ZDAA 1V47A 1L4EA 3OQJA 1GGKA 4U7PB 3NP7A 5M29A 1GTL1 5FJJA 5LC1A 1UP4A 2IRWA 3SSAA 3TJMA 3RS3A 4DC9A 1QGUA 2VSQA 4GFDA 1A4RA 3G9UA 1M2KA 3MJ4A 1WR8A 4HGOA 3OEEA 1A71A 1O94A 4R6XA 4IY1A 2B37A 3JARB 4C06A 4RCVA 2C4MA 2A1UB 1Y8RA 5D3ZA 4WVFA 3TZCA 4E13A 4R81A 4EHKA 5BMVA 4KXVA 1SA0B 1FSFA 3DYVA 3VOTA 1ZUD1 1BOFA 4LTNA 4I4CA 3WWOA 3GT3A 4EVRA 3AVPA 1P73A 1QCYA 1LPNA 1UC8A 3P32A 4UEQA 4CL8A 1KJZA 4ZEOA 1JJ7A 4PR0A 1YRHA 1OQAA 4JQZA 5HZKA 1BZYA 5KVQA 3DTVB 2FZ5A 1I6WA 3KWFA 4KYUA 3I01A 3M4JA 1DWQA 3L4BC 1EPUA 3BGOS 2ZSEA 4S2EA 4ZARA 1OU4A 3VX4A 2SKDA 4CCSA 4PU0A 2OQ2A 3AOEA 4P0QB 1Q1GA 2IYYA 2R8BA 3QV2A 2QW8A 4AZTA 4D6XA 5K3OA 1PG0A 1T36A 1JBKA 1Q7RA 2XRZA 4N0DA 1N0VC 1RVV1 4ECEA 4YCSA 3F74A 1ODFA 3KYDB 2C2GA 5SZIA 2PGAA 3VU9B 3C3AA 4L4RA 1NJFA 3LF1A 3NCHA 1EAYA 1ZX1A 4HGPA 4FQ7A 5DHRA 2SKCA 3N6VA 5DIFA 1UDXA 5LP6A 2XMZA 3FTCA 3GUCA 1SHJA 1KSHA 3O92A 5KTPA 3G2NA 4Q4HA 3W5AA 4OFWA 4UJ5A 2JH3A 1K06A 2B4QA 2D5AA 3SQNA 2WJAA 2BGWA 1N3BA 4BX9A 5CD1A 2F1HA 2OCKA 3DBVO 3JQAB 3VYWA 2W7TA 1W1IA 1WL8A 3DM5A 3C3JA 3INGA 4ZQCB 2NXCA 3ECAA 1QLHA 4WJZA 3TRIA 5JS7A 2NX2A 3S5JA 4N76A 7ADHA 2XIJA 3T5CA 1WY7A 1XCPA 5KYKA 2DR0A 2R5WA 4ESVA 2C4KA 2C3UA 2BJVA 1S7GA 2PTGA 2VNSA 5HIAA 2GK7A 3DKRA 4NEQA 1E2GA 3FLMA 1VHLA 4P32A 1OXUA 3KR0A 3SLRA 1TTTA 1US8A 1IXSB 1CKEA 1GU7A 1RJEA 1JDJA 4IX1A 4RFSA 5LR6A 2UUAB 3ESZA 4HC4A 3WQBA 5B4TA 1WQ4A 2VBFA 3VPFA 2G82A 4UE6A 4KVZA 1JMVA 1AG9A 4BBPA 4EEXA 3H84A 3GMSA 4LQLA 4PG6A 2BCJQ 4MXDA 2O7SA 4GMGA 3WDKA 4Q9AA 1DS6A 1CE8B 1NFQA 1ESMA 1KSFX 3ZDYB 1YI0A 3RF7A 1LRKA 3U9SA 2BE9A 4NBWA 4RIEA 3DOFA 5KJ6A 1SIUA 4TQAA 1XMQB 2I8CA 4R54A 3V4FA 4AULA 3CM0A 1DINA 1PG2A 1PJBA 2P9TA 1TZJA 2VJMA 2Z2ZA 1QGUB 2WILA 1YR2A 1II9A 3OQ1A 3W2IA 1QOPB 2VHZA 1X94A 4RESA 1B8VA 1AKTA 1XQVA 2R751 3I52A 3KAJA 3PC8C 4BNUA 4D8VA 3RG8A 4D25A 1ZICA 4WNAB 1CFZA 4MTCA 1XKXA 1WZCA 4TT8A 2GXAA 1GPWB 1RTKA 3LU1A 4AS2A 4XIIA 4X6UA 3GLHA 4P2GA 1UQRA 4TXHA 4QU9A 3C7CB 5EIEA 2Z83A 5AVRA 4FZ5A 3AWIA 2XDQA 2WF5A 4IEEA 3Q10A 3WYEA 3WLNA 2XCSB 3TRJA 2ZQZA 3WMXA 3DHYA 2WKRA 1QK3A 5K0CA 4CN8A 2ZKLA 4IL5A 1JSXA 1E3QA 4LDZA 4MVJF 4PVCA 6GPBA 2CLDX 3V4OA 4H60A 1IHYA 1CDDA 1AS2A 3EQ2A 5GVRA 3TRKA 4HEA1 1VXRA 5AW3A 3AI7A 1EX6A 3THYB 1N5KA 2BZGA 2SKEA 1T5IA 1HETA 3UF0A 4MRPA 1OFIA 4JD5A 3CLHA 4ZV7A 4B31A 4BVLA 1JG3A 5EJEA 2QYTA 4D57A 1DCKA 1A8HA 3ZHUA 3G5UA 3K5PA 1KZGB 4I9FA 1MO3A 2JL1A 3FBGA 4FWIB 2Q2NA 1OWMA 1DXYA 3T54A 2FPGA 2BM1A 1TFUA 2O8BA 3DQZA 4EKNB 1DEHA 4N6OA 1I2CA 4DABA 4DM3A 3B53X 4IDHA 5B1YA 4XWKA 3SVLA 3PP8A 5IAEA 1R4NB 3PUVA 2NVBA 4R41A 3KOMA 2DYKA 4YJ2A 3VH3A 1OLXA 1V8BA 4ON9A 2W22A 3DQQA 1KYXA 4WZAA 2NT3A 1JAXA 2HMVA 2OG2A 1KEEA 1V2GA 4QGAA 2YMQA 4TX1A 3SHQA 2BI7A 2Y05A 3F90A 3LX5A 4IXNA 4UARA 3MJHA 3ZWWA 1UJCA 3TRHA 1U0EA 4Q1EA 4HT3B 3D8TA 5K4GA 1JIUA 2VF8A 3WYDA 4G56A 3ZGVA 1CVRA 1KAQA 2AK2A 3QOYA 3ZX5A 1E2IA 2GCOA 4U2CA 1E1QA 3SE0A 2P9GA 2QTMA 2VJYA 5AKEA 3TKYA 1ZIDA 2O06A 2OZVA 1ZSNA 3BYZA 3EVAA 4HWRA 4LQDA 5EXTA 5B58C 2Y0EA 4Z3OA 4PZPA 1GSIA 4YONB 4LRYA 4MQFA 2XI4A 3Q11A 3K5HA 1DO2A 4YMHA 2XADA 3QF7A 5B7QA 4MUAA 1YBAA 2GZ2A 3Q9NA 3S2GA 3V3TA 4H3KB 1E0AA 1X1BA 4X71A 1RR6A 3CTPA 2Y0CA 4G5HA 5HBRA 4KFRA 1PWYE 2R6FA 4D74A 2JLUA 2J6IA 2CK3A 1ZYUA 2BJWA 1G66A 2QD4A 3AEUA 4LDNA 3LF2A 3VPBA 5KWEA 2I7CA 4HXYA 2AFHE 2FN3A 2I2XB 4GQAA 1AUOA 3V8QA 3CWQA 1OILA 3GX1A 3SQXA 4CM6A 3H1EA 1VMAA 3GEBA 4RPHA 4KQKA 1QK5A 4JJ4A 2QX4A 3DPSA 4MYCA 5I3CA 3A4YA 4F21A 1RIFA 3PR1A 4KMRA 3DLTA 2Y8EA 4EHJA 2PNJA 2E21A 2FVYA 2X0KA 3BJIC 1FP2A 3DGFC 3BG5A 2YWDA 3PL5A 4G2TA 4R01A 5EPEA 2C5GA 2Z5LA 1EE1A 2XTZA 1J1UA 4Q1FA 1YS7A 3ZWOA 2VHXA 3GROA 4LYEA 1WBDA 3AR8A 4NJMA 1K5GA 1QVAA 2UAGA 1RKXA 3F8SA 4R05A 2GKGA 2JS7A 1RQGA 4YB8A 1HQCA 3WLEA 1PR0A 3OZCA 5MN6A 5FPTA 3JAKA 4L3OA 3I9KA 1R0WA 2FLWA 2OQIA 4Q4JA 4WN9A 2ZYHA 4KKXB 2D2FA 3KT0A 4CKYA 4ETNA 2E4ZA 2P4HX 1UJ2A 3EQ9A 1L4YA 3V2GA 4U7DA 5IWCA 1IDN1 3PQCA 4CLRB 3R3HA 3UJ8A 1W4ZA 4PZYA 2GK3A 2XCOA 4HH0A 3BIFA 2BGMA 3OPYI 2K6GA 2PUJA 2C5SA 3IUQA 3CR3C 3EDMA 3PYMA 4KRGA 3THRA 2I3BA 1S0UA 2ERCA 2OE2A 4URVR 2HQBA 2EQAA 2ZAIA 5EMNA 2IYLD 3MQ2A 4EAAA 3T3DA 1T26A 4L0CA 3TB6A 3QKIA 4P31A 3CISA 4O5AA 5ILGA 1ONOA 2H8KA 1GTSA 4TQ9A 1IN4A 3RQIA 4MKZA 4NH4A 4JUDX 3DDOA 3QF4B 3V9AA 3MIZA 1WWKA 2PU5A 5B4VA 2HSEA 4WFJA 3K0HA 4XLTA 4G09A 4LPSA 3DCJA 4BVAA 3ZJTA 5E2BA 5K05A 4HB4A 3T5MA 1ZIPA 2R6DA 1DC3A 1R12A 2IITA 3GWZA 3ONEA 3WWPA 3T3OA 2WTNA 1X8LA 4M49A 1IJKA 3PWKA 4D9EA 1OXMA 4RSHA 1TK9A 4XYBA 3LNTA 2I8LA 1Y8QA 5DOZA 4KB5A 3HUEA 1NKTA 1ZCJA 2HDHA 2C20A 4ND5A 1CJTC 4P3PA 3PDIA 3DFKA 4UMVA 2ST1A 4PWYA 4EO4A 5A6VA 3L04A 1GA6A 3AZPA 2QNBA 4YDHB 4P3OA 1YQQA 3LOPA 1R4MA 2C2KA 5K45A 3U09A 1PK7A 1PFUA 2GX6A 2PZEA 3GAAA 4UEWA 3M1IA 2ATXA 2V7TA 4KMMA 1JJBA 1GNLA 3DAHA 5J2UB 2C3PA 3IQFA 1CVLA 3FKSD 1QHEA 2OO3A 1D9XA 1ADBA 2P5UA 2DH5A 2R1VB 3GJQA 4LJYA 2D7DA 2F3RA 4YR9A 3AKEA 4G37A 2G5CA 4BRUA 5AK4A 5FYDA 3OCCA 1U7ZA 1ZOPA 3I6BA 2HK7A 3U4IA 3M6UA 4B6GA 1DLIA 5JTUA 3UPUA 4KQWA 5I45A 2WQ7A 2RHOA 3ELDA 5IT4A 2ORED 2AXPA 2P90A 4ROTA 4YJHA 2A6PA 4XYEA 5K8IA 1RFGE 4UCQA 1U2SA 3HVHA 4DMMA 4HNVA 4YPVA 3FNGA 5AK3A 1QANA 1U2ZA 2OHVA 3C43A 3JWIA 5IARA 5HE9A 1XTIA 4HUJA 3P9SA 4IEIA 1G18A 2VPXA 3NBQA 4M0LA 1S3SA 2JLAA 3UXEA 4C0WA 3FRIA 2PIDA 1UODA 4MCHA 3NVMB 4PWZA 4ZIRB 1VGRA 4MUFA 4H6VA 1UKZA 1XTKA 3CX3A 1XZIA 4CT0A 4PCUA 1YZLA 2EHDA 3OT1A 2YV1A 3IVMA 3O0DA 4KVGA 2I67A 2JAHA 2NM0A 4KBFA 1MW9X 1PJAA 1ISGA 2J9FA 5GPBA 1MHTA 1F0KA 2OR3A 4ZV4A 3SQMA 1GGEA 1ZNQO 4M0CA 2N46A 3LV8A 3ZTWA 1XTRA 3SWWA 2QVCA 1EEXB 3MS4A 4IGEA 3GGSA 1J8QA 1U1IA 4RZSA 4ER5A 3UHJA 3NYQA 3NXSA 3WYCA 3GPLA 3USES 1BQ4A 1CJVC 2HSGA 4NKRA 2C7GA 3LBAA 3LGAA 4IHKA 4BQIA 1SCBA 2KMLA 4GDMA 1XCMA 3GDGA 1SIOA 1DG3A 2BELA 4N40A 1E7YA 5BORA 2C8KA 2D59A 3QJYA 2NO9A 3ZCUA 4BVHA 5BSEA 1HZZA 1WCV1 2ZU0C 5TV2A 2Q6VA 5IG2A 4KIFA 4PVDA 5A62A 4GPD1 2CNWA 1RWXA 3KB6A 3EEFA 3KTAA 4OMFG 2PSJA 2AI2A 2JI9A 2NMVA 1XELA 2RBEA 4GM1A 4DG9A 3E81A 3V7YA 1YE5A 2VFAA 1U0BB 3H9GA 1BFKA 2ADOA 2R25B 4MV9A 1ULAA 3KQQA 1Z0UA 5AQEA 4L0MA 5LKRA 1V6CA 3OQOA 5AICA 1MO5A 4YYZA 1DKUA 3RU7A 5L95A 1ZMXA 1IJFA 3DWGA 1TQ4A 3G89A 4XQ0A 1R0RE 4FTWA 1TD1A 1CX9B 3EEBA 2P9BA 4AS3A 3OWHA 5BN5A 4TZ6A 1SCNE 3OEHA 4BTVA 4GOLD 4ZCRA 1PR2A 3HA3A 1CLUA 2C9DA 2MINB 3BA1A 3DVRX 4MJ7A 1Y6FA 4QPJC 1YU9A 3EDRA 1JSZA 3LS2A 4WNIA 5DB4A 1RAHA 1UBOS 5LIRA 5FPSA 1O54A 2QQ0A 4GSYA 5CX4A 5D51S 5TPWA 5K09A 1P17A 1L4KA 2JLWA 3O2SB 4ZOLA 2CMDA 4ESHA 4QUJA 1ISMA 1QM5A 3JASA 1DBSA 3T0IA 2PX5A 4ZU1X 4BHTA 2O6HA 4I7EA 3I0MA 4W7SA 5C8DA 4GL2A 1U1GA 3GGJA 3O90A 3UJHA 3A11A 3RVBA 4G3XA 1GNQA 1GXSA 3IHTA 1I24A 4AIIA 1E69A 4EPXA 4JP3A 5FWYB 5AK5A 1J8VA 4P0TA 2P2LA 2Q1XA 2O8FA 2NTEA 2QAGA 1Y89A 5CP8A 2JH8A 1R4NA 4EFMA 2JGFA 1ZAKA 2VLBA 2BFWA 1D6NA 1NBHA 3O4IA 4MGZR 4IKEA 5JG7A 3VU3A 4AMBA 4IRXA 1GLGA 2C07A 1T1JA 2ZGVA 4I5GA 2HA7A 3KX2A 4PPQA 5FKJA 4XX0A 5FR2A 2XCRB 3TGPA 2E49A 2GWHA 3QJ5A 16PKA 1QJCA 4HY3A 5HUQA 3BMOB 1TVCA 1XDGA 2F64A 1WU8A 4IV8A 4WCFA 3NBKA 1XZKA 4MS4A 3GEDA 1K8QA 1JXQA 1RAFA 1POWA 2ROQA 4RPLA 3J7TA 3QW4B 4RMIA 3MGCA 4X8MA 5ABPA 2A9RA 4LC1A 5L3RA 1UM9A 5JIBA 3WZMA 4AJ2A 1JJFA 3GRRA 3I9OA 4LHVA 4BNNA 3IUYA 4BU0A 2HQSA 4MKIA 1SQGA 1U11A 4FEAA 5L45A 2XBMA 1T5OA 3CRQA 4X1KB 2QXTA 5JPDA 2UUBB 1NI5A 3L1UA 4AYWA 2ET6A 3ITKA 4X93A 1Y3CE 1UFQA 5AW9A 4IJ6A 8AT1A 1IY1A 1AKNA 2JJMA 1I2AA 3EXHA 4OXYA 3NPMA 4R9NA 5DGDA 3WNVA 3A0UA 3CY6A 2DPXA 3FHLA 3LXXA 3M34A 4W1RA 4Y1GA 2A78A 4DLSA 5DX8A 5EMMA 4PLVA 3V00A 4UVEA 3DLHA 1XD9A 2A9OA 4JC5A 1BWQA 2AG5A 3AQ4A 4MGIR 2HM7A 1JGTA 3TLMA 2H0QA 4JLMA 4CT5A 1M10A 5DK6A 4MS1B 3LC2O 1RYEA 2JGIA 3E03A 2ORVA 4LOAA 1SEVA 2R7AA 3KOUA 4GI3A 4YMIA 5CA1B 3KVVA 1LDEA 1C0IA 4LWQA 2VSNA 4NENA 3FCSB 4US1R 5FPYA 4TRNA 3H2KA 5E4FA 1IHXA 3WWZA 3A2MA 4XIGS 1HQYE 3KAKA 4TVBA 3B1VA 4CPDA 3B20A 4L4ZA 2G1UA 3QVUA 4HGYA 3A25A 5H7XA 4B8ZA 2AKYA 2HXGA 1LBSA 1JRLA 3OE4A 5DSTA 1GNVA 2Z2KA 1E79A 4A8PA 4G9EA 1QORA 1T3HA 2E5FA 1BGWA 3AVOA 1AB6A 1XCLA 3KCNA 5B1EA 4F92B 1IYZA 4RMHA 1U5BB 3DYIA 3OX3A 4TWZA 4RETA 1JHXA 3W9BA 3E3OA 1LSUA 5B3LA 3RSHA 1J2RA 2QI9C 1BCSA 2A5FA 2ZKIA 3AM4A 4TYQA 4Y2YA 4Z7QB 4OHWA 2RKBA 3RK4A 3OP4A 4BLUA 4AC9A 5KYXA 3Q6NA 2XQFA 2FZKA 2HKIA 2ZRIA 4QVKA 5JC1A 1KSGA 3A4LA 1CU1A 1LDMA 5FBVB 1SUPA 3JD1A 3RYFA 1J0DA 1U2RA 1XWFA 3ZJYA 4YS6A 2ZI9A 4HYTA 4E11A 1Z5VA 3NHBA 1T1IA 4P1ZA 1A1VA 1OI3A 4YUYA 4FDUA 4MX8A 1W52X 2G71A 3AI2A 3T3HA 3H42B 1Q3TA 3NGXA 5FULA 4BV8A 1EHIA 3EOAI 1LRJA 3GGCA 4ITRC 4PG7A 5ALYA 2VF2A 5JZOA 1V7QA 5ITVA 2R60A 2AMLA 3CS3A 2QRVA 5FHQA 4DPMA 2VYFA 4D3YA 5C4GB 3ZXUB 1VZ3A 5FUQA 3JZAA 4NHEA 5E4YA 4LS3A 4BQNA 3A3YA 3CSUA 2F8MA 1HA3A 4RM3A 4R9RA 4U7GA 3TDMA 3ZZUA 2XA9A 4O4JA 4WH0A 4UOQA 3A9RA 3BDIA 4FT2A 4NAHA 2GRJA 5REQB 2PXXA 3Q7IA 4JL8A 2OP1A 1FFWA 4RK1A 1GL6A 1M2HA 1Y8QB 4LGCA 5EMKA 1D03A 5KNDD 3WAGA 1VHDA 1Q1EA 1E9EA 2H92A 4PAMA 3WIBA 3HSSA 4R3UC 3JQBA 1S3IA 1KVUA 1UEJA 3G5LA 3WLOA 4IHQA 2I76A 3SIXA 4E2ZA 3RBVA 2XMGA 4OQQA 4NNPA 1EM8A 2GERA 9LDTA 5D5HA 2VI5A 5CIYA 4HWKA 2VHYA 2ZUCA 3T3GA 1BW9B 1R27A 1L7DA 4MWGA 4MWOA 3EGDB 5C7LO 2F48A 4DYVA 1RWBA 3JPWA 1YDHA 1DAFA 1GN8A 1Q74A 3T7TA 3T94A 2D0IA 2CDAA 2GYVA 2YWFA 4FZVA 1VKJA 1Z18A 4HEQA 5ERYA 1ZY2A 3K0FA 3MM4A 4K9RA 3TFWA 1A8SA 4FGUA 1E7QA 2Y67A 2FN8A 1UZAA 3DNPA 3EXIA 4MO2A 3G2LA 4CTKA 3G88A 2AVNA 3TL6A 2QR5A 4DWOA 3BSFA 3JQRA 2HADA 2DR3A 1JEYB 3RAJA 4MMXB 1KO8A 2V3VA 1NX9A 4KGXA 3T41A 1XXHB 3DA8A 1GV0A 5H80A 3TI7A 1DT5A 1I1HA 1PV1A 4A9AA 4RTLA 2NU6B 3Q7PA 3ST7A 3LL7A 1L7EA 2X2OA 1WB5A 2FPOA 1KZ4A 1FFGA 1T8WA 1Z5WA 4G0YA 4HDAA 4NK5A 4TM7A 5ISMA 4Z9BA 1NT4A 2AI1A 4Q4CA 2E4VA 5A1TA 1E2KA 2F43B 1OLSA 4BZZA 4GMDA 1KI1A 3DP7A 4QUBA 5GJWC 4B81A 4R51A 3HBMA 4Y9TA 1H66A 3LPCA 3WIEA 1EYZA 4NBSA 1VHJA 1DEOA 1S7CA 4EGJA 5JSZB 3VZPA 5CFLA 1ISHA 3FW1A 1B41A 1IZ9A 4MRNA 1XMIA 1IUKA 2JGEA 4OFZA 3ROXA 1ZNWA 1HOXA 4E07A 4ABYA 4INAA 3E35A 1RYHA 1QVVA 4ARBA 4OGKA 2HB6A 4EQ6B 4XFKA 3GMTA 2X5XA 1D1TA 2NZ8A 5L7WA 3TG2A 1FNDA 1I3MA 2NW6A 4YRZA 3M3DA 1QO7A 1TM3E 3QQPA 4YC7A 2G08A 2QT0A 2GNPA 2WVHA 3K1TA 1DP4A 1GYQA 1QIKA 1SAYA 4FEEA 4KPUB 3VR6A 1BG6A 3ZDDA 5IDXA 3T3MB 3KQVA 1M6EX 1N5IA 2Z8XA 3KPUA 4IHJF 1DC6A 1RXEA 1U2GC 4JQCA 4POAA 4AD8A 3M6AA 4QDKA 4TXNA 4AJJA 4CETA 2WT4A 2ZRAA 3U81A 4DIDA 4V1CI 4HH3C 3WK6A 4LRUA 3A1UA 1VJDA 5A4KA 3NOXA 4QICA 4I81A 1NULA 3WKEA 4EW3A 5DM0A 2YCLA 5BVGA 4A15A 4IXDA 1GSHA 5BNZA 1JWAB 3OUUA 4M22A 1DOAA 3WMGA 3G9QA 1JKJA 1RDFA 5CMLA 1EP1B 3GEMA 4RVNA 2YASA 4ZALA 4BATA 3DE7X 1VKOA 2YOHA 3I9V6 3GCXA 2WUGA 1XQWA 3DAYA 3IUMA 4CCYB 1E20A 5LZ9A 2H5JA 4YUVA 2Y1EA 2WB2A 2XKBA 1KDYA 1JB1A 1EA5A 1SU6A 2GD0A 4IQ0A 4IIJB 3EVZA 1QIDA 2XUIA 3KEQA 4I1YA 2VK8A 4JEIA 4KYVA 4BWGA 1XKTA 1OX4B 3V7FA 1SMKA 2EW2A 1PK8A 3FOCA 4Q6WA 4RTOA 2QGNA 4O0LA 4OHVA 4WADA 4AUKA 5KU1A 1THGA 5TPZA 2PX4A 4DV7B 1TI7A 3E5RA 1Z4QA 5HRCA 5LNK6 3HFJA 5KEIA 2BKLA 1E0DA 5HK9A 3OQPA 3MLEA 3K6RA 4G5GA 1G4AE 4RA9B 1I4LD 5SZHB 4RPCA 2A59A 2Q7XA 1B26A 3FPJA 3JQAD 5JADA 1MVNA 3MJRA 2QBYB 2EBHX 2G1PA 4ZYLA 3IDOA 4H7FA 3AL0C 2RGBA 3S6JA 3LWZA 2DM6A 2J3MA 3EH1A 2Z5FA 3ZQKA 5IABA 2OM6A 3M9XA 2BEWB 1UMCA 4GHWA 1PNRA 2PKQP 2C4HA 1YVUA 1M1ZA 2YX1A 1XXHE 3BXPA 3EY4A 3FF4A 4FMCB 1EFKA 4H2DA 5DKFA 3W4IA 4KPYA 5EZ5A 5KTYA 2C5EA 4R6WA 5KKCA 3AVTA 1TQ2A 2V4ZA 5LKAA 1H4VB 3CJTA 2QLBA 1NU8A 3K6SA 2A86A 1KRHA 3DCNA 3Q5EA 1JKIA 5TARA 3UGQA 3W7BA 1ZVVA 1MX9A 1HFEL 2RE8A 1UDCA 3ND5A 1H3FA 4GZLA 1NQOA 2KYRA 1Z6XA 4U9HS 1EG7A 1ZA1A 2WHRA 1QHSA 4Q18A 4TTJA 4NFLA 2C9CA 3RBXA 2RHBA 3IOYA 2WIBA 1OVGA 3LUGA 2PAAA 3DAGA 3EQ7A 4LXUA 1P8AA 1TQ6A 4B7ZA 4TTTS 5K5EA 2KBFA 2DE0X 2J4CA 3MSXA 1GZVA 2PQ0A 2EGHA 4H59A 5JANA 2G9NA 5IKEA 1FNNA 3W06A 2PYZA 1N5RA 1X70A 3L41A 5TS2A 4DCUA 3ON5A 1P31A 3ZDZB 4DPKA 3UAGA 1XQYA 4GPEA 2J1LA 3O47A 1L9KA 4HOYA 5HW0A 3FTQA 2XNKA 3HC7A 3KKOA 1Q95A 1WMFA 3L1IA 1YFLA 1XEXB 1QWSA 5AESA 1ODCA 4GP7A 4TWAA 3LT1A 4IMJB 1O94D 1P1FA 2BFCB 4LN1A 1KZHA 5IH7A 3ESXA 4N41A 5FDFA 5G4KA 4DLAA 1DTSA 1H1TA 3NV9A 5GGYA 3VKHA 1XFDA 1TZKA 2ZJ2A 5AD1A 2WD9A 1EFHA 1SXQA 1UPUA 5BR7A 3UXHA 2WIFA 1W9MA 5IASA 4DTIA 1NRXA 3B9PA 3TIXB 2BMJA 3V1KA 1BQEA 3ZCSA 1HT2E 2AQHA 4WD3A 1OREA 1Q2XA 3RS5A 1Y5MA 5BXQC 1GQFA 1FMLA 1K7EB 5U1PA 3MN1A 5DMHA 2X0NA 2XMSA 2IDMA 3N2YA 3QWBA 4XB2A 3NG1A 2Y6VA 5FPHA 4KG7A 5CBPB 1YDGA 2Z98A 4LRSB 4DQ0A 1X1CA 1D2GA 2CWDA 3KVOA 3DC7A 4NCIA 5E7IA 1RABA 2RK3A 4RD1A 3SBEA 2WFZA 2LDXA 3KJHA 3GFOA 1JFTA 5CNIA 4LY0A 4YRPA 1EZ1A 4XQCA 1RQ2A 1W85A 2V0NA 2YJTD 4MARA 1ZUIA 3GRPA 1YA8A 2Z6VA 4DY4A 1YFJA 2FN4A 3E9EA 1WXGA 5FR1A 2BTQB 1U0SY 1TAQA 4RK0A 3DDHA 1QIMA 3EZYA 2FUEA 5BVHA 1PAUA 3ZS9A 3OJXA 3TPZA 3RBZA 1WO8A 3A05A 3DOUA 3W2GA 5JDIC 3LZCA 1ULHA 1XQ6A 1J21A 5EP1A 2YKGA 5A0VA 2O2IA 1SUCA 1GUAA 3IVAA 4G1FA 3ER9A 1XLWA 2EL9A 2OECA 4RF4A 3TZHA 4K5QA 5CLFA 1KOGA 4MRSA 2B8TA 1EK1A 1E2LA 2WM3A 2JBAA 3HHEA 1RBZA 1WM1A 2Q99A 3NNSA 2G04A 3NI2A 3QWAA 3WFZA 3TTWA 1NXVA 1QYRA 3ZCVA 5CDYA 2PO7A 4IS3A 5JC8A 2D8AA 3M8KA 3ITEA 5TGTA 4DSOA 4YRMA 1BO6A 1OA1A 2QUZA 4UXIA 5B3JC 5JISA 3IMFA 5JZMA 2GVDC 1KARA 1UADA 3BIOA 1H9BA 2QTTA 1KYVA 5FLKA 5IUKC 1T2DA 4QUGA 4ER7A 3CPJB 1CRZA 4LXQA 2IYFA 2REXB 4QOSA 3AHJA 4M2LA 4YLGA 2FEXA 1C3JA 4WFIA 3KQYA 1OYWA 4DJAA 4RSMA 3HZZA 4X8LA 2XBLA 2IZ5A 4DWJA 2I55A 2FOXA 2WYWA 3NUGA 4LIPD 2QK4A 2R1TA