2VP6A

Structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
197
structure length
197
Chain Sequence
TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DEOXYNUCLEOSIDE KINASE
publication title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 75
structure length 197
sequence length 197
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vp6A00
4I1SA 4PQFA 4IEEA 2CL0X 4LRWA 4URYR 2B6HA 4OI4A 2VTKA 4Q03A 1K8RA 2BM0A 4FW9A 2V1XA 4U5XA 1E94E 1ZC4A 1UEIA 2W58A 2A30A 3FMIA 4Q4HB 3SZRA 3OEEA 1LW7A 2A5GA 5FOSA 1Q22A 4TQ9A 2G6BA 3OHMA 4PPGA 2ZRPA 4JLOA 5GJCA 1SVKA 3OFNA 5GJWC 1OT3A 1CULC 4MDFA 3ETLA 1SHKA 3NBFA 4Q9HA 2D06A 2UVQA 2IUTA 2ZJBA 4NYMR 3BXZA 2J9RA 3DOEA 4XVUA 1ZIOA 2EQBA 4RZ2A 3RRYA 2QM8A 2H8KA 3L8YA 1C4OA 3OEHA 4KHZA 3TQCA 2FZLA 5LBIA 1VYVA 2MSCB 4BASA 2IX3A 5FL7A 1ZNXA 1Q20A 5TMPA 4QNMA 5CDFE 1ZU4A 4PZLA 5L3QA 1YRBA 4CRWB 2DR3A 5EXTA 4YMWA 4EUNA 3AKYA 3OE7D 1SVSA 1U8AA 4PZZA 1E2HA 3TVTA 1OIVA 4FMCF 2VHTA 3K0SA 4XTRA 4NYIQ 2QROA 1JPNA 1NLYA 2FSFA 2Q3HA 1GILA 4GOXA 3ZVLA 1I4DD 5DI3A 2GESA 4PAMA 3U4QB 1GRRA 2V55B 1GVNB 3Q5DA 1GNQA 3SHFA 3FMOB 3K0CC 1J99A 3AVWA 1JR3A 2XSZA 4LJ4A 4MA4A 3SN6A 1FMJA 1KMHB 3AEZA 2REOA 3SFZA 4BLSA 5IDVA 1TF2A 1KDOA 4FMBB 2F6RA 1MO5A 4MDEA 2QT0A 1Q1EA 2QRZA 3K8YA 2ZRNA 4GPTA 2ZRLA 4IFEA 4WXPA 3U7HB 3A4NA 4PPQA 5K8IA 1QG2A 2KWIA 4QHYA 3NHBA 2F9MA 2JEOA 2XX3A 2J3EA 3AVVA 3TMKA 3HDTA 1MRNA 4PHTA 1ZD1A 1Q57A 2OHFA 1NN0A 1JQJC 5JBQA 3T61A 1XNJA 1Z08A 1P75A 2AXNA 1A2KC 5DYGA 4D0LB 2J7PA 1E2PA 3KJEA 1ZAKA 1A7JA 1KI9A 2ZQ5A 1E4VA 2ZEJA 2B8WA 4PC3A 4B3CA 3AF2A 1K5GA 1YHNA 2PEYA 2NIPA 2GTPA 5FTNA 3ADDA 3CWQA 2O8BA 4I81A 5FUWA 3WMFA 1DO0A 1JAIA 2FSHA 3CPJB 1A2BA 2BEKA 2NO1A 4FD2A 4N3NA 4QBGB 3W3AA 3L0OA 3OAAA 1N0VC 3PIRA 2A5DA 3CH5A 4G5SA 4Q18A 2OXRA 4KITB 2XEXA 1YR8A 3IPXA 1JXOA 3CRW1 3U44B 2AXPA 5HCIA 2BC9A 4BZQA 5KNBA 1ZIPA 4FMCB 1OFIA 4IVRA 4BUJA 1N3BA 2Q3FA 3FGNA 2QAJA 1IJEA 1OXSC 4HLUC 3ICQB 3VNVA 1D9ZA 1LF5A 3IO3A 2DFLA 4JLNA 1X8LA 5EZ6B 1NSFA 3NXSA 2ZYTX 4LY6A 4Q47A 4DIDA 2ORIA 3CPHA 3PR1A 1RRFA 1FTNA 2QSYA 2XNSA 4DUGA 1UFQA 1YU9A 3FB4A 1TF5A 3U4QA 3LBNA 3F0TA 1GL9B 4OQLA 4C0HA 2WHXA 1M7GA 3MSXA 5A0FA 1KMHA 5KDOA 3RABA 2ZJ8A 4MGIR 4Q7JB 1MO4A 3WP0A 2P2LA 2B7BA 3HR8A 2NZ8A 2IXGA 3SJAA 3GQBA 5C4MA 3KQHA 4A8JB 1PV4A 2QA5A 1NNEA 1DTSA 3SC3A 1JEDA 4B3GA 4ERNA 4OJQA 3SYKA 2VHJA 1S8FA 2WIAA 2IWHA 3CX6A 2IYVA 4P33A 5FPSA 4B75A 2GVDC 3C4JA 2D4HA 4ZDWA 3CO5A 1BMFA 3KKQA 3U3RA 3CX7A 3I1FA 5E7JA 1N6NA 4BLTA 1Q1QA 1UPTA 3DHWC 5FOTA 4D4KA 1N6RA 5BN5A 4C2TA 2ANCA 4TYYA 1H65A 1CF4A 4KV9A 3U2QA 4AY2A 1XFAA 4DEXA 1QHXA 4AIIA 1M1YE 3P4YA 4QM7A 3L8ZA 1R4AA 5B57C 3QXHA 3Q9LA 3GLHE 3W3ZB 4PAOA 5ELXA 3QKRA 1OB2A 3PEUA 2D3WA 1HE8B 4XIGS 1E2GA 5D3MB 1JB1A 4HAYA 4RCYA 4B2LA 4IDOA 2QAGC 3OFND 1QVRA 3QI2A 4RKFA 4HAUA 2WKRA 2XNDA 4B74A 1YR7A 1E2KA 2O0HA 1W1WA 1AN0A 1P9RA 2ZI6A 3GFOA 1AGRA 3OEHD 3WMGA 4DLTA 2C99A 1J2JA 2CLCX 3IBGA 4UXIA 4LHWA 1ZM3A 1MKYA 1ZVQA 1QG4A 2WMOB 4EQ6B 1MT0A 1L7VC 5FL7D 4HLQB 3FE2A 1IBRA 2NO7A 3MJHA 2ASEA 3ZZ0A 1C1YA 4CW7A 2ERXA 3OZXA 3TJZA 1DAFA 1OH7A 4QNRA 3T5GA 3JVVA 1N6HA 2GCOB 1ZM2A 2C8VA 1DS6A 2J59A 5JWOA 3ADKA 3LQQA 2JJ2A 3NBZC 1L4YA 3W8NA 2R6GA 4M1KA 2QI9C 3JZAA 1J7KA 1E96A 3SFVA 3IILA 2CLDX 1TTTA 1KZ7B 3V4RA 1T5LA 1E0AA 4OL0A 1LVGA 2HT1A 1UKVY 4UQOA 2FE4A 1AIPA 2JDIA 5SZIA 5BXQC 3LX8A 1JR3D 2XSZD 2CNWA 1XDBA 1ZUNB 3F5FA 3T1TA 2XAUA 4JMPA 4LV5B 1ZW6A 4CT4B 3TLXA 3SS8A 5FTKA 3DOFA 2ZSEA 2C9CA 4Y0AA 1VYTA 1CBUA 1KO1A 2FG5A 1BS1A 1RC8A 2ZXUA 4PHFA 2QTFA 1KK3A 4QHSA 2CE7A 1W0KA 2GXUA 4OHWA 4Z54A 5K8TA 4A6PA 3BB4A 1RYFA 2MSEB 1M7HA 3AVQA 3VFDA 2W0SA 5FPHA 1ZD8A 4HZUA 3U7GA 5EUMA 4EJSC 1E2QA 4JVNA 2BJVA 1OHHA 4KLZA 4DCNA 2J7PD 2FZ4A 2ZI9A 3E2IA 1KDRA 3LW7A 2EU8A 3WP1B 3KKOA 2Q21A 2CJWB 4PO8A 1UJ2A 3LXXA 2XTNA 4UNPA 4TMWA 1G291 2IYLD 4Q7KA 1FX0B 3SNHA 3PUWA 2O8FA 1FOEB 2IXFA 4OQFA 1QHYA 2EFEB 3GJ8A 2PZFA 1FQJA 4EPVA 1G5PA 2GCOA 1XJ0A 1M8PA 4W5JA 4ZDJA 1AM4D 2HT6A 4Q1FA 4Q02A 1E9CA 4M4SA 1TMKA 3QY0A 3SI7A 1G64A 3PEWA 2IYSA 2QNRA 4D4MA 1N6PA 3GEIA 4IDQA 1NN3A 2AHOA 2DYKA 2GJ8A 3IEVA 3U3JA 1DG1G 3EA0A 3QNUA 1KI4A 4DUGD 3FHCB 2PX0A 2G9NA 3I61A 2QGNA 1JXMA 2BEJA 4PC1A 5JEEA 3WYFA 4F92B 4QOSA 3EC2A 2IS6A 1B0UA 3LAWA 4DC9A 4BRWA 2ZUDA 2OAQ1 4PO9A 4FI3C 4GBMA 4Q4AB 2W6IA 4TYQA 1GSIA 4DSOA 4HDCA 1TUIA 3NVAA 5GJVC 3PJRA 1FTSA 2Z4SA 1RRCA 2XOKA 1X1SA 2YZ2A 4YMSA 5A4JA 3ZD7A 2MSDB 1IXSB 5CJPA 3EPKA 1DARA 2YWFA 2D74A 1ZMXA 4E5UA 5C1BA 2QZ4A 2IYXA 3GLFE 4BZPA 3AUXA 2FX3A 1BMFD 1FL9A 1PJRA 1XMVA 2IF0A 4Q1EA 3BK7A 1ZCBA 3THWA 4D26A 3BS4A 1AZSC 3BOSA 5B2ZA 2V1UA 2IYQA 5AR1A 2GEDA 2P67A 4OQXA 1CR0A 3QKSB 1KGDA 2NO6A 1CJKC 3DM9B 1ZNYA 3DEFA 3LDAA 1EFHA 2QMHA 2O5VA 2KB0A 2EFHB 4NKRA 5F9FA 3OESA 2ZJ2A 3VR6A 2YC2C 4QGFA 1R5OA 3KFXA 2FDCA 1SQ5A 1XP8A 2YJTD 4EFMA 3K9GA 1XWIA 2WJYA 4QJ5A 3IPYA 3B5JA 1HQCA 2DFKB 2AWOA 2ZI7A 1SXJA 3K70B 1I4LD 5C46F 3EXAA 1NKSA 1SKYE 4EFNA 5CIQA 4A2PA 5FOVA 1GFIA 4WA7A 1S9DA 4DCUA 1Q1BA 4YMTA 4IOJA 2KE5A 3LBIA 1GNRA 1JALA 2FOLA 5DIFA 1JECA 1GRQA 2ZYVX 2ZR7A 2VP4A 5E4FA 3KXIA 4DEYA 4V0OA 4NP6A 5CYPA 1R8SA 3NHAA 1IXZA 3RWMB 2JJ2D 3DKPA 2FSIA 4MRPA 2GF9A 4KYUA 4DB4A 4WZ6A 5JS7A 1NLZA 3TAUA 1QHSA 4MUBA 4RKEA 3WRYC 4IW3B 1GG2A 5G41A 4HI0E 1XZQA 3E5HA 2NMVA 4LYFA 1DAHA 1VPLA 1ZNWA 1OFHA 2JDID 4TL6A 5EP2A 2BMJA 4HB2A 5FTLA 5CM9C 2CNWD 2G88A 4N1AA 4LI0A 3RDPA 1RRPA 3QSYA 3IHWA 3NDPA 2IUUA 2ZUBA 4NZYA 5AWFC 1E2NA 3A58B 1NMXA 1U81A 4CYMA 4Q5IA 4B3BA 4Q1AA 1XTJA 2F43A 1P61B 3N5CA 4IFBA 2L0XA 3UK6A 2D62A 2H16A 1CR1A 3K1JA 1VIYA 1KNXA 4II7A 1FP6A 1W0KD 1EXMA 2BOVA 1G3MA 1XXHB 2VP6A 4JLKA 3UANA 3KJHA 3IUYA 1OW3B 1XF9A 1F2TA 1VG8A 2KBEA 1OHHD 3QENA 1ZCAA 1RJ9A 1JEEA 2OZEA 2WM9B 4NYJR 5DYIA 3Q85A 5FUXA 2EFGA 1VIAA 3I62A 2HF8A 2VSFA 3BJIC 5JWHA 3A1WA 4LCBA 1Z22A 2G0TA 3MFYA 2ZRBA 4GRAA 2NPFA 3NH6A 5JMTA 1MO6A 1U99A 3HPRA 4B6EA 4BPBA 1ETUA 4JLBA 2D7DA 4EIWA 1J8YF 4IXMA 3D3QA 4Q9KA 2BJWA 4IXNA 3O8RA 2JLUA 2GWHA 3LVQE 4IDNA 3AF0A 4RD1A 4LPKA 3NH9A 2R6CA 1Z3IX 2CCKA 2Z83A 3MLEA 1UKEA 2NPIA 3FMPB 1YZLA 3FMFA 2FFBA 1ZM9A 4LWZA 4DWJA 1JQLB 2GJ9A 1GL7A 1KDTA 2XGJA 1M7BA 2PX3A 4YDSA 2RGEA 4ASUA 1XTQA 2O8CB 2DB3A 4BFXA 1TQ2A 4FMDF 1NBMA 3TUJC 1KI6B 4C0KA 3O47A 2WICA 5BWMA 3SJCA 4W7SA 3F3YA 2CBZA 3E1SA 2J5XA 4JSYA 3CH4B 2QMEA 4B47A 1Z6GA 4DDTA 1SVLA 5KTYA 3AVTA 4ESVA 2W6ID 4GZMA 1N5KA 1N6KA 4LPSA 4F7WA 2ZR0A 1P2UA 2XOKD 4WZBE 2B21A 2IHYA 1A5TA 3KL4A 4LYHA 4TTPA 5KYKA 1XXHA 3DL0A 3BH7A 4OJKA 2FSGA 3B1YA 3VR4A 3T15A 2A5FA 2PEZA 3EZ9A 4NCIA 1E6CA 2ZPTX 3QKUA 4R2HA 3TAHA 1NVUQ 4DLUA 4HUQB 4OBEA 3U61B 2V7QA 2XXAB 2FNAA 4DSNA 4KSBA 3KXKA 3A8TA 2N46A 1BH2A 2GF0A 3PV0A 4NYMQ 4M0LA 4TMVA 1AQYA 2RGBA 4PAQA 1ZD9A 4A4DA 1OXUA 1NIJA 1QF9A 2JJ8A 4MH0R 4WW0A 1H8HA 3H4MA 2A7QA 1E1QA 4ZDIA 2OBMA 3BBPA 3B82A 1MR3F 1R6BX 1RVDA 5JECA 421PA 1EX6A 4YQFA 4MRNA 2ZREA 4NHOA 1UKYA 1U94A 2JLQA 3QXXA 5E95A 2IYYA 4OHVA 2JLSA 2WAYA 1SXJD 3VU9B 3FWYA 1DO2A 1G7TA 3JVUA 1SVMA 2RGNA 1GWNA 4FMDB 2ZSAA 3D7MA 3LBHA 5EXXA 2IHBA 3A1TA 3CF6R 1KI6A 3MG9A 2PJZA 2V4ZA 3TQFA 1XCGB 1SZPA 4CVNA 3MCAA 2N42A 3MMPA 1Q44A 4PR0A 2GXSA 4RFSB 2R44A 1ZUHA 3MAAC 3ZQ6A 2QE7A 2FFQA 1E2FA 2F3TA 4LHZA 3F8TA 3ND9A 3A4LA 1TUEA 2W0MA 3QXSA 3U3OA 1ZBDA 1MRSA 1X1RA 2XJ4A 4RY2A 4QXAA 2RCNA 1TADA 2FFAA 4JLJA 3C8UA 4B3XA 1EFRA 1KK0A 2J46A 4OHZA 4BLQA 2OUKA 2ZE7A 5CLLA 4BLPA 4KODA 4RCZA 2WWFA 3EZ6A 5TARA 2ZRKA 2CK3A 1NN1A 4CEIB 2CMKA 2FMXA 1GZSA 1G41A 4MYHA 4QFMA 3DMNA 2GEVA 3TE6A 5DNYB 3N2EA 2XXAA 2IT1A 2WVJA 1WP9A 1OSNA 1G3QA 1XD2B 1P73A 2H17A 2QPOA 4CF7A 1Z07A 3KQLA 3BFKA 2HCBA 4I1VA 5TB5A 4LYAA 3CR7A 4HZIA 2GJKA 1E2DA 1DAMA 1XB2A 2IA5A 4DRZA 3FOZA 1QRAA 4PSVA 4WOPA 1XPRA 1PLLA 3CIOA 2H1LA 5GADl 2F7SA 3TGPA 2RGXA 4WBSA 1XEXB 1AZTA 4UXHA 4PTLA 1Z6XA 2BKEA 5AJXA 4LBVA 2WPDA 3U6KA 3QXCA 3DO6A 5EE5B 2RGDA 1GNPA 3AVOA 1G4UR 2ZRGA 2ZITA 4PC2A 4X8HA 3LLMA 3VKGA 3G5UA 1XU4A 2OSBA 1BIFA 1KTVA 2O8DB 1SXJE 5GVSA 1EGAA 2FEOA 3DDCA 1RIFA 2A2ZA 2A5JA 3GLIB 2ZJZA 4UNNA 1FNMA 5JS8A 1KYIA 5JSZB 2I3BA 3THXB 1Z2CA 1S4QA 1W7AA 1KY3A 4IOKA 2HLDD 4V0MA 3TR0A 1E1RA 1KZGB 1EK0A 2O0JA 3SEAA 2WJGA 4GMDA 4LJ5A 2Q9CA 3RSOA 4EPWA 4ASUD 5G3ZA 4B2PA 1CU1A 5B58C 4TLBA 5KOYA 3ZS9A 1NBMD 1FFHA 4AKHA 1XEWX 1TU4A 4UKDA 2QPAA 1OF1A 2FH5B 5A5GA 1KY2A 2AFHE 3K0FB 4Z1MA 2VHCA 4B3DA 2W6JA 2LKDA 4P4SB 4PQYA 2GHIA 4R7ZA 2FV8A 4GFDA 1WBBA 3VX3A 2V6IA 2F1JA 3R8FA 3SBDA 1HH4A 3THYA 3EPJA 4MKGA 1AS3A 2HV8A 2V54A 4Q19A 2ZRIA 2FPMA 1GDDA 3IDQA 4NTZA 2NZJA 4NL4H 4MYTA 3BH0A 4L8GA 1CJTC 2E87A 2GZDA 2CVHA 3ONWA 1KI7A 1MABB 5EP4A 5FTMA 4F4JA 2A3RA 2DWOA 2IYWA 5CK5A 1Z0FA 1YZKA 1JI0A 5G40A 1ZU5A 2DBYA 3PG5A 1G6OA 3EAQA 1II8B 2VQSA 4RD0A 4XVQA 3WBKA 1PUIA 5KSOA 2OE2A 2YVUA 2JA1A 2VIIA 4XWKA 4PC6A 1Z2AA 5EP1A 4Q4HA 3M6AA 1JPJA 4K81B 3B85A 4M1SA 4ABYA 1RPZA 1QHHB 2G83A 2GJSA 1E69A 2OAP1 4JL8A 8OHMA 2IS4A 1H8HD 2GZAA 1E1QD 4MGZR 3B60A 2VPPA 5EE3A 2ZIAA 4TMZA 3TUIC 2ZI4A 3LFUA 3QXJA 5FBWB 4LYJA 2GA8A 1XEFA 2IK8A 5CIWA 5DLQC 3TH5A 5G53C 4WVFA 1BYUA 3DM5A 3MWKA 4L9SA 5H1YA 4CT5A 4B2IA 3I73A 5IT5A 2YWGA 2HCJB 4IDPA 1KJYA 1LFDB 1VG9B 2HJVA 4XJXA 1SGWA 3X1WA 3G82C 1O87A 5BN4A 4KSCA 4LV6A 1DVRA 4QC2A 3SBEA 2FPLA 4BLRA 4DB2A 4EPTA 1IXRC 4IEIA 4U02A 4DLSA 2ODEA 1G7CA 3T1VA 5K8LA 1Z0KA 1V5WA 1VCIA 4US2R 1HE1C 1E9DA 1QHGA 3H0KA 1U90A 2JLWA 1AA9A 2QE7D 4MGKR 4DCTA 1NVVR 1N5IA 3DZDA 3RLFA 1FPMA 4EFLA 1AQUA 2CVFA 4TMTA 4JLAA 1X86B 1NG1A 1P3JA 1NBME 4NDZA 1HT1E 2C9OA 1SXJC 1VG1A 3TKLA 3CKLA 2J87A 1R8QA 1TF7A 2BBOA 2EFCB 1EFRD 5IF9A 5KSZA 4NE2A 4RSGA 2XTZA 4XWOA 2BDTA 4ZI3A 2XB2A 1JAHA 3UMRA 2BKUA 4BRUA 3B1ZA 2SHKA 2VRWA 4DZZA 2OBNA 2Q6TA 1WB9A 1RRGA 3A4MA 4M9QA 1XJCA 5JJIA 3OIUA 3Q7QA 5C4GB 4LSGA 4EPRA 2OT3B 1IM2A 1Z8FA 4B35A 4L4UA 1XMJA 1SVWA 1G5RA 5F3WB 4JLPA 2IC5A 1S1MA 1G18A 1X6VA 2CL7X 1G1MA 1IJFA 3EA5A 3EX7C 3E70C 2P6NA 1W36D 1OJLA 1KAGA 2OFXA 3WBJA 1QHIA 2KJQA 2NQ2C 2ZS7A 4PANA 4OK6A 1KJZA 4A0RA 2JLYA 4R98A 4KU4A 3LXRA 2C95A 1NL3A 3U5ZB 4UNRA 3RS3A 3T06B 4WXRA 1OE0A 1KK1A 4PXAA 5JWRA 4DT1B 4G1UC 1SULA 2ZSFA 5JFGA 4AYXA 3JZMA 2BCGY 4LX0A 3CF2A 4PFSA 4NONA 4ZCMA 2GBLA 2RHMA 4HDQB 2J0SA 2WWXA 4ILEA 1KSFX 2YOHA 1SVOA 3OEED 5HZHA 1E2JA 4NU0A 3GLGB 3Q7PA 1IN5A 1KO4A 4Q7MB 3U44A 1GL6A 4NYIR 5G3YA 5HKKA 1ZC3A 3CB4A 4MGYR 3ADCA 1I4TD 3WXMA 1L8QA 4XTCS 2Z6VA 1N6OA 1LY1A 1FNNA 2IYUA 2JAQA 3GJ6A 1GAJA 2W00A 2X8AA 3R7WB 2WWWA 5SZHB 2W2TA 4O0MA 3MWLA 5J4LA 1Z83A 3M0EA 2IS1A 1E1RD 4MUAA 3A1SA 3DPUA 2QY9A 1G7SA 2ZU6A 4KFTA 4TL8A 3AGQA 3UIEA 1T3SA 1E32A 1DELA 4FXPA 4KVGA 2GXAA 1ONBA 4C7OB 4LC1A 3VR2A 4PPFA 2DY1A 5AJZA 4A8JA 1A1VA 1YZQA 2ZETA 5TXGA 1YKSA 2J45A 4Z1MD 2W6JD 4Q9LA 5EP3A 4ACBA 4D6PA 2ATXA 4KVAA 2ZRHA 3VKWA 5JHHB 4DLYA 5EE9A 3BAFA 4BWYA 4E07A 3WNDA 3P1JA 3KQKA 3RS5A 3IBYA 4OI2A 3DZ8A 3MWYW 2ZROA 1N0UA 3TBKA 3AF4A 1C9KA 1CR4A 2CHGA 2VA8A 1UBEA 5FI0B 2J0QA 2DPXA 5KUTA 4POAA 2W83A 1T4GA 3GJ7A 5JJLA 4N0EA 1OLOA 2GK6A 1KO5A 2F1HA 1M74A 1SKQA 1N0WA 4TSFA 3SHWA 4AWXA 2ZUCA 1F2UB 2O52A 3BORA 4WIAA 4C4PA 4E03A 4TL9A 1QBKC 5FTJA 1EX7A 2OCBA 1DBSA 3QKTA 4KCGA 1P7CA 2WKQA 3HYTA 3UPUA 4ZI2A 2JLRA 3HJNA 4O2LA 3AB3A 3AUYA 3ZD6A 4D81A 3TRFA 1W49A 3OIVA 3ECCA 5H70A 1SVIA 4BFSA 1TNDA 4A2QA 4AURA 4M1YA 3RANA 5D3MA 2ZI5A 4KBFA 4UXJA 3SR0A 3CF0A 2IYRA 4YXWA 3X1XA 5BYJA 2K5UA 4GMXA 2P0EA 1YR9A 4FIDA 3R7WA 1OFUX 3NWJA 3U7EB 2ODWA 1N5JA 1RE0A 4RD3A 1P9NA 1FP7A 2NO9A 3AH8A 4MRSA 4P4UA 4OHXA 4EQ6A 4P32A 1HEIA 2YWHA 1FMLA 3OAAD 5H8WA 1KK2A 2XZLA 1TEVA 1KI3A 3K9HA 4OK3A 5CB6A 2GAAA 1COWA 1XCPA 4C7OA 1VHLA 2MMCA 5KNDA 2LWIA 2BMEA 2D7CA 1E2IA 1S2MA 2PH1A 4JL6A 3UATA 3KTAB 1KMQA 3TIFA 1NMYA 1NG9A 3SYNA 2C5LA 4HB3A 4QJ4A 4KYIB 4DHEA 1XD9A 4DLWA 4ZDKA 5AUNB 1CP2A 2CLSA 5SZKB 4I99A 1UAAA 5JZVA 1GKUB 2F1RA 2N1BA 4GP6A 5JRJA 4I4LA 1E9AA 1IOZA 2RGNC 4TLDA 2ZANA 3I3SR 5KSPA 2R2AA 5EQTA 1Z06A 4LJ7A 3L43A 1T0HB 1WCV1 4B76A 4DJTA 2NTYC 4C0SA 2O8EB 1E9SA 3I92A 3NKVA 3VR3A 5FPKA 4W5HA 1EFUA 1JR3E 1NP6A 1F3OA 3D6TB 3RRMA 4P4TA 4MKHA 5TVKA 1AS2A 2OFOA 3K0CA 1EWQA 4NYJQ 4F4IA 4LJ6A 1ESMA 4M1TA 4Q21A 1KKMA 3W5IA 3P32A 2FJUA 2EYQA 2XZPA 1LB1B 3O8CA 3BERA 2PCJA 2V9PA 3LLUA 2ERYA 3EZ2A 3MGCA 1D5CA 3KDSE 3L0IB 2CJWA 1IY1A 3SE0A 5LD2B 2KI5A 2I1VB 1W46A 1VHTA 2VBCA 1P2TA 3CNOA 3QBVA 4LJ9A 3DMDA 1S96A 2G1JA 4PO1A 1OPXA 3T1QA 2ZJOA 4NBSA 2YWEA 1FX0A 3AV0B 3FDIA 4N0DA 4PPNA 721PA 4ACAA 2RGAA 2OBLA 1JJ7A 3P26A 5FL3A 1K6MA 1T0JB 3K0AB 4PHGA 1W36C 2RGGA 4BZXA 1A4RA 1U8ZA 5FOXA 1T9HA 1ANKA 4GOJA 4DKXA 4RZUA 3ZZTA 4DDUA 2XNDD 3R9IA 2CHVA 4LHYA 2JGNA 2G1KA 4QGGA 2QENA 3A37A 4L15A 1Q12A 1G4AE 1E0KA 3QF7A 5FBRB 4A36A 5FH9A 5KO2A 3CRMA 4IOLA 3AP3A 3RS2A 4D4JA 2FWRA 1N6LA 4JS0A 2R8RA 1LF0A 4CEJB 3EASA 3SU8A 3B2EA 1F60A 5FPTA 3KKNA 1F6BA 2ZSBA 2OEPA 4AG5A 2REXB 4PZYA 2QAGB 1WA5A 1WXQA 4UNQA 4EKDA 4BGDA 3H86A 3TW8B 2OILA 3U3KA 4Q4AA 1MOZA 4D25A 3B1WA 2HYIC 2NGRA 3MWJA 4JJKA 3GMTA 4J0QA 2E9SA 3CZQA 1W0JA 1XD8A 3IIJA 3QF4B 4JBYA 4M9SA 4A92A 3LD9A 5LPNA 1G8PA 1G8HA 2MMGA 4M1OA 3O8BA 3NBXX 5F9HA 1IY2A 3I4LA 2EW1A 2ZJ5A 2WJHA 3N70A 1JNYA 5TV2A 2VSOA 2ZE6A 3AVYA 2ZU0C 2G3YA 3BD9A 5DN6A 1I2MA 4JIMA 3NEJA 1E9BA 3S1AB 3PUYA 1XPUA 3FFAA 3GJ5A 3T5DA 4G0NA 1E79A 3QKSA 4TSFD 3T34A 1ZRHA 5HCNA 4Q1BA 1CRQA 1U9IA 2YV5A 3RC8A 2XITA 2OXCA 1W5TA 3IHLA 4A82A 1G21E 2OCYC 2ZE5A 1HV8A 3C15C 2ZRDA 5DSZA 3LNCA 3KJGA 3V9PA 2Z5FA 4QBFA 5L8VA 2RGCA 5EZ5A 3VR5A 3K0AA 1Z0DA 1KSHA 1LS1A 2Q9AA 2PZGA 4IDHA 4TQUS 2XJ9A 3ZVMA 3M4YA 2J0VA 5FR1A 4Q01A 4S35A 4YXWD 2DWQA 5IRCD 4D82A 1G5TA 2VP0A 3NC1C 1OKKA 2JIZA 2BHRA 3V00A 2RAPA 1GTVA 1NN5A 3ICEA 2FU5C 4RD6A 1NJFA 6Q21A 2P5SA 1S9HA 2HEIA 1CS4C 521PA 1T3LA 1KJWA 4KO8A 2YNMA 3MD0A 3VHLB 4EJSB 1YVDA 1W5SA 3AP1A 4HSEA 3CW2A 1HT2E 3K53A 3RAPR 4A1FA 4ARZB 1COWD 2QAGA 4G5QA 3EARA 4YC7A 2YOGA 4LGMA 2WOOA 3TNFA 1HTWA 3X2SA 2FFHA 2VP2A 4D0GA 4Z51A 4DDWA 1ZNZA 3SQXA 4M53A 2BVNA 1UDWA 5FI1B 4QRHA 2CE2X 1VCOA 2G77B 3P20A 4FCTA 1P6XA 2C77A 3FPAA 4C0QC 4US1R 3RC3A 2ATVA 3MRSA 2ZJAA 2WJIA 3D31A 1Z28A 5CITA 4KXFB 4IHQA 3LA6A 2FA9A 4LV8B 1VDZA 3I72A 4QG7A 2UZ3A 1KIMA 4WZAE 3CRVA 1R0WA 3CZPA 1E2MA 1XZPA 3S1AA 1YZNA 2WMNB 4HLCA 2PJRA 4AD8A 1Q3TA 3GLHB 4RJLA 4Y0VA 3VKHA 1LV7A 1KI8A 1H8EA 4R2IA 2ONKA 1P2SA 1YR6A 2VYFA 4DSUA 2QUZA 3QIAA 2F1IA 4B44A 3AQ4A 4BEJA 2DFNA 2ORVA 4EDHA 4IJMA 2BWJA 4OQMA 4TT3A 4WAUA 3RVBA 4XWAA 4M21A 3FTQA 4XSGA 4OYHA 3ZQJA 2EFDB 3WHLA 5DH9A 4TZ0A 3KQUA 2D2FA 5JHGB 1KO7A 3PFIA 4D4LA 3GJ0A 3TVDA 1EG7A 1G3RA 3AP2A 3WNCA 3QUSA 1W2GA 4HAVA 4B73A 4DXAA 4TLAA 3DVLA 2GDJA 3I8SA 3PVSA 4DLRA 1OYWA 2QPTA 4DLVA 2V8OA 2AR7A 5DI9A 5DISB 4ARZA 2DFTA 4LC0A 1UKZA 4KFUA 4TMKA 4BEBA 4UNSA 1CIPA 4RD4A 1ZJ6A 1TL7C 4Q4JB 3ZVNA 1FW6A 2WWHA 4Q66C 1IN6A 4PC7A 1JR6A 2CCJA 1D2EA 3KUDA 4LZZA 2ZYUX 2O8CA 4P31A 1V43A 1S0UA 2GBLC 4V0KA 3U60B 2QMUA 4M1WA 2Q9BA 2R6FA 4JYCA 3O8DA 3IQWA 2OFWA 1NVWQ 3THOA 3VTKA 4B43A 2X19A 4CEHB 4YDHB 5FBQB 4MITA 1ZYUA 2GILA 3ZH9B 5EE0A 1E9EA 4ZKEA 3LW8A 3MJRA 3EZFA 2Q0HA 3GFTA 4Q7LA 1II9A 1W0JD 2P5TB 5DHFA 3UKDA 2YOFA 2FPKA 3L0SA 3I5YA 3PEVA 2WTUA 1ZUIA 2XB4A 4BECA 2WSMA 4H1VA 2AX4A 1QDEA 2Q3MA 3B7GA 1ZINA 4BFVA 1MO3A 2AK3A 4GZLA 4K8OA 3EG5A 2F9LA 3Q3JB 4LJ8A 3TSWA 5DN6D 2TMKA 2GK7A 2IWRA 3FKSA 2ZSDA 1DAKA 2ZRFA 4W5WA 4A8JC 4HUQA 1E79D 3KFVA 1EFTA 1G8YA 1E9RA 5KDDA 4JKYA 2JCSA 5FBVB 4PSKA 3W6NA 4NMMA 2OV2A 4HYYA 4OK5A 3UMFA 4XOIA 2WBLC 5JCPA 3QE0A 4P3YA 1GM5A 1P2VA 1ZP6A 3B8HA 4DBLC 4URVR 4GDFA 1IONA 2JLVA 2IEYA 1WE2A 3FVQA 3HP1A 2AN9A 5L3QB 2CL6X 4OQNA 4HAWA 3ZYCA 5IK2D 3C14C 3ZS8A 3CBQA 3CNLA 1OKKD 3K70D 3VU9A 1XX6A 4ESHA 3GPLA 2R62A 3IIKA 4DCVA 5EXSA 4ZCLA 4OHYA 3C16C 4A9AA 3ASYA 5FUVA 1OXTA 1VYUA 1OIWA 3MUFA 3B78A 4A2WA 2CDNA 1IN7A 3ADBA 2EYUA 4TTQA 3EIEA 3UXMA 3EIHA 1XBTA 5CM8B 5EUQB 1RKBA 5AJWA 4RFSA 4YLGA 2QTVB 3T12A 2CHQA 3GLFB 1BOFA 4Z8XA 2YC4C 5BN3A 4QBHA 4HB0A 3CR8A 4MKFA 1E2LA 3IGFA 4L9WA 5DO9A 3RS4A 1G17A 1Z6AA 5AUOB 3TR5A 2IF2A 2C98A 1VECA 2H57A 2ZI3A 4Q4LA 1Q21A 2GZHA 3KZ1E 2EVWX 2ZRAA 3ASZA 1QZXA 2X77A 2EWVA 3PENA 4U00A 4OI0A 4C0BA 3W9YA 3NBYC 1VTKA 4CEIA 3NDBB 2BCJQ 1CR2A 3N2IA 1U0HC 1EWRA 5J4HA 1OH8A 1NF3A 3AKEA 1R5NA 1H8ED 2AK2A 1XD2A 2WWIA 3BB3A 2O8BB 4JJZA 1G20E 5JCZA 3PUVA 5F98A 3IKJA 3W6OA 1K5DA 2O0KA 4R9UC 4EPXA 1L4UA 5KPDA 2WWGA 4O25A 2F3RA 2Y8EA 3PUZA 4KBGA 2GEUA 1T5IA 4DVGA 1DAIA 1SKYB 3C7KA 4TT3D 1XTRA 5GJBA 1VMAA 4Q00A 2KBFA 1W47A 5AUPB 4TTRA 2RMKA 1XEXA 3VAAA 4ZCIA 2QL6A 4MQBA 2V7QD 3A36A 1WMSA 4HB4A 4PHHA 3D8BA 3T1OA 1CLUA 2REBA 2GVZC 4AKGA 1Q1ZA 2P6RA 2C03A 1W2HA 4X8MA 4ZV4A 1KOFA 3CRRA 2O8DA 3QPWA 3AVXA 1X8KA 2H5EA 1GOTA 3PITA 5HE8A 3P4XA 4TZ6A 5KNCA 5CJ2A 4EPYA 4YMUA 2VP5A 3GLFA 3GLIA 2FF7A 1XRJA 5JSZA 2ZRCA 4Q9JA 3THXA 3HU3A 5BW8A 4LHXA 4E09A 3EIQA 2AD5A 1OFTA 2WV9A 3H2YA 2OESA 2H92A 2W2VA 1NI3A 4G5RA 1RFLA 3X1DA 1W4CA 3B9QA 4IOMA 2OG2A 4NPHA 3L0PA 4DDVA 4TQAA 2BMDA 2GCNA 3W5JA 3RSLA 5TY0A 1AKYA 1ZM7A 4IRUB 4BFUA 2G0NA 4TYPA 5JLJA 5EE1A 4A15A 2RH5A 1P9WA 1UBCA 1OXVA 1O3YA 4KFRA 1UEJA 3K0FA 1AKEA 4P4SA 3QG1A 1JBKA 1G16A 4DLXA 4JT4A 2ZM5A 1E0SA 2QMOA 2HJGA 3B9PA 2QEQA 2V6JA 4LK2A 2A5YB 1T8TA 1EESA 2J7KA 3KUCA 3L2OB 2GNOA 1VCNA 3GJ3A 4ON9A 1YZTA 1U98A 3QKRB 1J70A 1P60A 4URWR 1DPFA 2VLIA 3A1VA 1XPOA 1MABA 1TEXA 2CK3D 4HAZA 3KB2A 3FKSD 2XTMA 4LBWA 3QG5A 1II8A 3QEJA 1CTQA 4TYNA 1XXHE 3IIMA 1NSTA 2AFIE 4Q1CA 3EZ7A 2DCUA 2X1VA 2PT5A 5L3VA 3LRPA 5FUYA 5L3RA 1NKTA 1P62B 1T3HA 3IQXA 3QVUA 1QHHA 2QBYB 1HA3A 4ITRC 3K0EA 1X3SA 3NTUA 3ZVRA 1P4SA 4V02A 5JI3E 2BBTA 3C5HA 3WNBA 3W90A 2R9VA 2NG1A 3LH5A 1KKLA 3QPUA 5LD2C 2VF7A 4OI1A 3RHFA 2GJAA 2QSZA 4LBYA 2ODNA 4URZR 121PA 2WPDD 4V03A 1U9IC 5LB4A 3RS7A 2H7VA 4C0AC 3M1IA 4D2IA 2YHSA 4LOAA 2V3CC 2VEDA 4JSTA 3RWOA 3DKVA 3W8RA 2BIFA 1HUQA 2GKSA 3NIBA 4M9XA 2CCGA 4NCKA 2JJ1A 3OF5A 5KHOC 5FOUA 4AYWA 4AYTA 1NIPA 5HTKA 3QBTA 4QGAA 4TLEA 4O3MA 3PUXA 1N25A 2Z4RA 3KKPA 1OYYA 3IEUA 2OCPA 5P21A 3R9XA 2Z43A 1E0JA 2OLKA 1U0JA 3K70C 2WJVA 1J90A 1YZUA 3W6PA 3TSOA 1NY5A 5CB8A 1E98A 1TQ6A 2VHUA 2ZVPX 4MKIA 3BE4A 4HATA 2GETA 3WYAA 2IUSA 1G3UA 3A6PC 3QJYA 4HZUB 3ZDQA 4KI0A 1Z6YA 2P65A 3SQWA 2QQEA 1G6HA 1Z6TA 3VX4A 3QVVA 3X1YA 1UBFA 3KB1A 1D8TA 1CJUC 2QN6A 2WSSA 4LBZA 2C9YA 1KDPA 4GT1A 1NVXQ 1PLKA 1D9XA 1Q0UA 2QP4A 5HPYB 2VF8A 4GOKA 1TAGA 2QBYA 3HR7A 2O8FB 3GEHA 3UG6A 4DLZA 2OLJA 3GFPA 1TU3A 3KKMA 1YE8A 3K09A 4NCHA 3TUZC 5HE9A 3UMSA 1I2DA 5J4YA 2ECKA 1G9XA 1NRJB 1KI1A 4DT1A 2ZVQX 3LWNA 2IW3A 4PX9A 3BC1A 3BRWD 1MV5A 3SJBA 2BBWA 4L5BA 1GP2A 3H1TA 4P0TA 4HAXA 2J1LA 4GP7A 2WKPA 1KSJA 4CDGA 2UKDA 4BLOA 3GLGA 2AWNA 1WDTA 3I8XA 2VP9A 3ND8A 4G01B 4QKQA 3U7FB 1HYQA 3TSZA 3BGWA 4Z8YA 1TPZA 2JASA 3HWSA 4C3ZA 1IAQA 2WOJA 4C9BA 2C96A 3AM1A 4RVCA 5BQ5A 1A82A 3GP8A 3WRXC 3AGPA 4M2LA 4S2EA 4X8LA 1XTIA 4MYCA 2HYDA 2IEZA 2F55A 1JJVA 4MRVA 5DGXA 3VHXA 1Z0IA 5D3QA 5AUQA 1VCMA 1OH5A 3THWB 4UJ5A 4V0ME 5FOWA 1BKDR 4C0JA 1XMSA 1QVAA 3CX8A 4BFZA 4QBIA 3AF3A 3I32A 3EC1A 1DADA 2ZRJA 3RNLA 2GRJA 3AVUA 4B3FX 2QTHA 2A9KA 3TW4A 1XCMA 4ZKDA 1DEKA 5AJYA 4B34A 4FINA 4FWIB 1T8UA 1KO8A 4B71A 1G7RA 2PZEA 3BH6A 4JVSB 3R8CA 3Q8XB 5DHAA 1F2UA 3LQRA 2UZIR 3CONA 3FKQA 1II0A 1QHNA 4QGHA 5UKDA 1SXJB 4FCWA 4H1UA 4G3XA 5J4KA 4M8NE 4US0R 5CYOA 2JLZA 2WWYA 3AF1A 1W4RA 4U7DA 3ZIAA 1FQKA 1UF9A 5JEDA 4CEHA 3REGA 2PBRA 4AKEA 2ZR9A 4BQSA 4V0LA 2JATA 221PA 2PT7A 4FN5A 2FGKA 1XEWY 2ODBA 3CUEF 3SYLA 2B92A 3B6EA 1E3MA 4KFSA 4BFTA 3PEYA 3G0HA 5M04A 3AKCA 1F48A 1D2MA 3HU1A 3IO5A 3GLIE 3PQCA 2OO7A 2QM7A 3CPEA 3UWOA 1KNQA 2ANBA 4I1UA 2JJ1D 1D6JA 3QQ5A 1X8JA 3LV8A 3CM0A 3KTAA 2P3SA 5HKKD 2QGZA 3K9LA 1WBDA 3BIFA 4M9ZA 2CXXA 2F43B 5GVRA 1LNZA 5JRZA 4GSYA 1AGPA 2AD1A 4XD7A 1FUUA 3LY5A 3U3MA 1IHUA 1R0ZA 1P5ZB 1R10A 2IXEA 3VR1A 3GD7A 4XVRA 1M2OB 5IK2A 4BE7B 4AI6A 3NG1A 4QM6A 3QPVA 2H18A 4HLUA 1F2TB 4RZ3A 4W9MC 2O8EA 1DG3A 2FN4A 1RJ9B 1KAOA 4GL2A 4L16A 5FBLB 3K9NA 1ESNA 2WSSD 4JL5A 5SZJA 1Z0AA 4DCSA 4HUTA 5JI2E 4XH9B 1CXZA 3HU2A 3V4FA 2VSXA 2BBSA 3WHKA 3HYRA 2GAOA 1R5BA 4QHTA 4Q1DA 2QORA 5E7IA 4D80A 4H9GA 5L3SB 4TYWA 2BM1A 2Z0MA 2QQ0A 4C30A 4YONB 4DIEA 5B64A 4C2UA 5AJVB 1DAEA 1N2CE 1R2QA 3B1VA 3W34A 2W2XA 1CKEA 1US8B 1W4AA 5AK0A 4KJZA 2AKAB 3KJIA 2CEAA 5CDFA 4B48A 4LJYA 1YQTA 5DE3A 621PA 5JJKA 3WMEA 4JLMA 2XZOA 3EPLA 3AVPA 3GCGA 1XJQA 4AG6A 2JLXA 2P6UA 2YKGA 3FFBA 1N5LA 2HF9A 1KI2A 1HURA 2ZAMA 2BV3A 2PMDA 2FGJA 1R0YA 1Q3HA 1KSGA 1D2NA 4NCNA 4URUR 3BFXA 3WYGA 1U0LA 4LDJA 4QL3A 2R6DA 4LJAA 1Y63A 3CLVA 2X2FA 5CK4A 4NH0A 1ELOA 4TLCA 2NO0A 2GXQA 2ORWA 2R65A 5J5CA 1S1CA 4JVLA 2J0UB 4CZ2A 4CEJA 1CJMA 1J8MF 4M22A 1NY6A 5CLQA 2AKYA 4FCVA 4RFVA 4D0NA 4ZIRB 3Q5EA 1VKJA 1DAGA 2IS2A 1Z0JA 1U2RA 3LX5A 4TN1A 3PXGA 1OV4A 4HLDA 5E3HA 2NOAA 2YINC 3H84A 3FHTA 2C78A 3QF4A 4JBXA 3KXLA 1OIXA 2D2EA 2HXYA 2PMKA 4KLNA 2HDNB 4E22A 2C2HA 2ZS9A 5L3SA 3B13B 3UWKA 4JVMA 1L2TA 4A0HA 3T35A 5IHPA 2IYZA 4A0FA 2C04A 4B33A 4V0NA 1RZ3A 4B6FA 2VO1A 2PL3A 4RZXA 3VQTA 1US8A 1WF3A 2DHRA 2WJJA 4PSAA 5ANRB 4A0GA 5EJEA 2WZQA 5K8UA 2HLDA 5C2JB 1Z5ZA 1E4YA 1HQYE 1MH1A 1TQ4A 2VL7A 4MYUA 5FFMA 4X8OA 1R7RA 4NCJA 5J47A 3ZLJA 4Q9IA 1LS6A 5TDHA 1AJEA 3ZIAD 1PLJA 1TQDA 2PCLA 1FUKA 1GKYA 3OE7A 1N6IA 2IYTA 3KQNA 2QU8A 2IL1A 1YRAA 2RB4A 4GNKA 1G19A 4GI7A 1P72A 3EW9A 5C18A 3GLGE 1Z47A 5LB2A 3ZGXA 4JZKA 3RS0A 4CGZA 1S3GA 2J0UA 3EWAA 5HR5A 3L82B 3LO5A 1B23P 4YMVA 2ZTSA 4EJSA 4LUCA 2ZRMA 4ZIRA 1OB5A 4HDOB 2RKOA 1W4BA 3LVRE 3QOFA 4JBWA 4IVPA 4R71A 2VHQA 2OCAA 1UADA 5KPJA 2QG6A 1Z29A 4F38A 1LTQA 3KX2A 2A78A 821PA 1GRNA 1XTKA 4C0LA 4BFYA 4CIDA 3TK1A 3R20A 1F5NA 1NJGA 2ZS8A 3B1XA 3FHOA 4MRRA 5J4VA 1IN8A 2QP9X 4XD7D 3SJZA 3R9WA 1KHTA 5FR2A 2LCFA 3BFVA 1UDXA 3UG7A 4DSTA 4EAQA 3U6BA 3I5XA 3EWSA 4URXR 2ZAOA 1W36B 1S3SA 2QT1A 1ODFA 1WQ1R 2PLRA 4UJ3A 3BB1A 3SDZA 1ZM4A 4HEJA 1AK2A 4PQRA 3OIWA 3RRNA 5B30A 4RD2A 1W48A 2I4IA 4AC9A 4TWZA 3GLHA 4K46A 1NMZA 3GJ4A 1G3IA 3VMFA 3VNUA 1E99A 1PUJA 3EPHA 1SHZA 1YZGA 2WAXA 1M34E 2IBMA 1BYIA 4Q48A 1DE0A 1HY3A 1GIAA 2X2EA 4KAXA 1IQPA 2OM2A 1BO6A 1RW4A 4G5GA 5J40A 3NC0C 1GKIA 1RYHA 2R6AA 2YYZA 5EXPA 3J81k 5F2EA 3WY9A 2ZE8A 1DOAA 4LHVA 4B32A 4AK9A 3REFA 1CJVC 1FZQA 2WIBA 1YJ5A 1Z63A 4O2RA 1T91A 4AKIA 2HXSA 3SOPA 2RHDA 4JLVA 4JKIA 3NEYA 1OH6A 4A6XA 2B8TA 3C41J 2BMFA 2ZJYA 3AKDA 4IVQA 4F93B 1AS0A 3GJXC 4M1MA 4G5OA 1R0XA 2J41A 2AL7A 1T6NA 1Y3AA 3Q72A 2B7CA 1G8GA 1UM8A 2QP3A 1WRBA 3GEEA 2ONJA 3ZJYA 1XMIA 2GCPA 4ZPXA 1UBGA 4F4CA 1E2EA 2E1RA 2PLFA 2VH5R 3A1UA 1IY0A 1VG0B 2I1QA 4JYBA 4OKSA 1NLFA 4IKEA 3BWDD 4XSHA 5BYKA 4TMXA 4I1OA 4TL7A 1PZNA 4F91B 3K09C 1M6NA 3RYTC 1GUAA 4Q4JA 5H68A 4BFWA 4ZO4A 2KSQA 2JIZD 1G8FA 1OXXK 2ZYWX 3P27A 4JLDA 3HPQA 3FYHA 5KSYA 5KU1A 4QJ3A 5HZKA 1E9FA 3PCRB 3QEOA 3RRZA 1XTSA 1U8YA 3OIYA 5DI3B 5E7MA 1EFCA 1NVVQ 3THYB 5FPYA 1GITA 2FEMA 1CEEA 2QRNA 4FWTA 4JT2A 2LKCA 1TX4B 1IN4A 3X1ZA 1W44A 3CNNA 3ZZUA 3CRQA 5KDLA 1PVOA 5LDDC 2HUPA 3C5CA 2DWPA 3CWZA 2EWWA 1CRPA
chains in the Genus database with same CATH superfamily
2OXEA 1VMKA 2QMZA 4I1SA 4XFKA 2P0AA 4LF4B 4LRWA 1O95A 3L4BA 4DMHA 3SXUA 3OX4A 3DULA 3DT8A 4Q03A 1NVGA 1VKHA 4CBVA 2BM0A 4DLNA 4MB2A 2V1XA 3JARB 1XYYA 4U5XA 5IT0A 3M9XA 3N76A 1UEIA 3KVRA 2XWJI 3PGJA 4IYRA 4KN8A 4R8RA 5LUBA 1RAAA 1I7DA 1WPGA 2H63A 3DV2A 1VE5A 2WP0A 3FMIA 4Q4HB 5C1IA 1U1EA 2A5GA 4AVYA 2QDKA 2UAGA 5LQDA 1J8FA 1U0EA 4TQ9A 1F8XA 3OHMA 1HE4A 4M0PA 1DC4A 2Y2UA 1R9MA 2B3DA 1VL0A 2ZRPA 1KBQA 4C4TA 2EFJA 3OFNA 1AGNA 3T94A 2Q4DA 1BS9A 4ADSG 5GJWC 3V7YA 4QICA 2YVKA 4HPJB 4Q9HA 3M8KA 4PIVA 4X91A 3PD1A 2J9RA 5AKKA 3MGGA 1ZIOA 1DIBA 3B1KA 4QFBA 5DM60 3O93A 2GOYA 2ZQYA 1JG4A 2FZLA 2WU1A 4J9UE 4O4IA 5SV2A 4CL2A 3T1YB 2XB6A 3GROA 2WKSA 4EJ0A 1ZL2A 5FNVB 5BN4B 5FL7A 2UUPA 2BSAA 2G09A 4IDDA 3U5TA 2PSJA 3PIIA 4H0NA 1Q20A 2OCDA 2G04A 1HSOA 3DNMA 1ZU4A 3OM0A 3SEQA 1B6TA 1YQXA 2QSUA 1YRBA 4AO8A 5B58T 2PVCA 5DK6A 2ZSJA 2KLBA 4YMWA 3AKYA 3OE7D 4U6SA 3TNJA 1QH0A 4J6FA 1DP4A 5FORA 5TS3A 2HLHA 3PXEA 4I19A 3KQMA 4I5IA 3O7WA 3G2HA 3ZVLA 1X70A 1I4DD 4HCJA 5CT9A 4QOFA 5CA1B 2QN3A 3H6GA 4KVFA 1GRRA 3ZPXA 3E8SA 1GNQA 4YP1A 3U62A 3FMOB 5K3SA 3K0CC 4DCMA 4BQIA 2WHPA 1LK5A 2BELA 1JIVA 1JR3A 1RAHA 1WCIB 2KX7A 2XUQA 3EVAA 3OE1A 3ZGYA 4GUAA 3AEZA 4WLEA 2REOA 3I0MA 5DLDA 5TQ0A 3SFZA 4EAAA 1EB8A 3GVIA 2PG3A 5IDVA 4ZVPA 4YJHA 4HFNA 2X7JA 2XWQA 3H2SA 3PF8A 1SCIA 2HRBA 5E9WA 4DMKA 3K8YA 2IHJA 4IFEA 2ODAA 3A31A 3DHEA 1IN1A 3BCSA 5K8IA 1H2RS 1ZOPA 4R9VA 2KWIA 3RBVA 3NHBA 2F9MA 4ZZ0A 1DFGA 2I62A 3TMKA 1N2JA 3UOAB 1WUIS 3G2NA 3E9CA 4BMYA 4R1QA 3JZIA 2G8LA 5HM8A 3C7TA 1P9LA 5JQGF 3I9NA 5DOZA 3T61A 3OD1A 2AXNA 2D1RA 1V9CA 2HUNA 3JWPA 3D6NB 5DYGA 1SUWA 1QYXA 4D0LB 4NE9A 1B1AA 4G5YA 4IH9A 1DHTA 3KJEA 3MLAA 2I34A 3A14A 1E4VA 3RU3A 3N2GB 3S5JA 3BGSA 4MDYA 1UQRA 1K5GA 2FAXA 1YHNA 1T3ZA 3NFRA 2GTPA 3ADDA 3CWQA 1GCAA 1PFGA 3LKVA 4J7UA 3AHHA 3OWOA 2Q5EA 4ZI7B 2ACEA 2BEKA 3VXKA 4QBGB 3W3AA 1NUTA 1NBOA 3KCNA 3L0OA 3OZ7A 3PCXA 4WV3A 5EMMA 4G5SA 4MPPA 4G85A 4FXOA 4V0SA 3RYHB 4DTIA 3P0HA 5IPFA 1ZK4A 1JXOA 1K2VN 2ALJA 2AXPA 4B80A 1XROA 2BC9A 5CVTA 4X62B 5CCXA 4IQ8A 3EXHB 4FMCB 4I50B 2OMEA 4HLUC 2ZK7A 4WXEA 2VYQA 1OXSC 2IJGX 3HSKA 1ORRA 4B87A 5JC1A 4ZMBA 3TF5A 1S3IA 4K9LA 1BDMA 3ANNA 3ILSA 1LWNA 4JLNA 5LQJA 4XGRA 2AMFA 4BU0A 2O50A 1SBQA 3E9DA 3K31A 5KKAA 1FTNA 1JPVA 3C43A 3SKXA 2XGSA 1YU9A 1TF5A 2GPAA 5EYPB 4HL6A 3F0TA 1FNBA 4OQLA 2UVPB 4C0HA 4LOIA 3MSXA 2BSXA 5A0FA 4CJXA 5AW3A 5KDOA 3RABA 1NVKA 1JMVA 1EHIA 1IHOA 3WP0A 2C20A 4DJDC 4WNCA 2C0CA 2IXGA 3SJAA 1WG8A 4D98A 1F38A 2ZCJA 1JYEA 4RIHA 4CLEA 1DTSA 4I5FA 5BURA 1CZNA 2G71A 3QYAA 4KE9A 4R0NA 4U7GA 1TTQB 1QO0A 4ERNA 5I3CA 3DR3A 4I2VA 4TMFA 4DAEA 2GZRA 2VHJA 1IEVA 2QRPA 1D7AA 4EHKA 3C3DA 1TO2E 2IWHA 3PRYA 1TOAA 1R37A 3W8EA 4LY0A 3IT1A 2ILVA 5EIAA 3KKQA 4H77A 2BF7A 2A8YA 1T5TA 1YL7A 4GI2A 1N6NA 4NCAA 4J2TA 1PNVA 1VBNA 1N6RA 2XYPA 1Q7GA 2ANCA 5K3EA 1CF4A 2DT8A 4KV9A 5ARCA 4ALIA 4BNWA 4DEXA 2GHTA 1O97C 1SXQA 4DIMA 3JPWA 2XTAA 3P4YA 1ISFA 3PPYA 1YTUA 2JK0A 1BQ4A 2QD4A 3R41A 1K7SN 1BVUA 1KBOA 1THTA 4FKMA 3TXAA 4D79A 4WBNB 4HBZA 4KNVA 1UXHA 1WV0A 3CUUA 1LBIA 4X6XA 1A98A 2P9YA 2EGGA 4BC0A 3IP1A 5LU8A 2B5WA 2J5QA 3KM0A 4Z9BA 1ICIA 4QQFA 4D3FA 1OB2A 1JIXA 2PUJA 1C9YA 2D3WA 3PEUA 4YP7A 5SY9A 3VKUA 2PE5A 3WNQA 1FXWF 2C5EA 3B6KA 1W85A 1E2GA 5FB3A 1L3IA 2Q6IA 5FFFA 2Q2WA 2JAHA 4AULA 4RCYA 1WSAA 2OBYA 2QAGC 3LGSA 1RHKA 1QVRA 3QI2A 3AY6A 4WNAA 2EX4A 1V25A 4R8KA 3U0BA 4B74A 4XUCA 3WL3A 3VAZA 1SBNE 1YR7A 1QF6A 5LA6F 3GFOA 1AN0A 1P9RA 1W73A 1YCDA 1AGRA 2ECOA 3DDZX 4Z9FA 5B37A 2JZNA 3SCZA 3WMGA 5LP1A 1W76A 2B1JA 3UPDA 1ZM3A 2JFHA 1MKYA 1JZTA 5JATA 1WW8A 2WMOB 3ROEA 4HLQB 2WD7A 4R9SA 3ZZ0A 1Z16A 2ERXA 3OZXA 4MUMA 1OH7A 1FLNA 1XNHA 3O3CA 5C8DA 4ARIA 4QNRA 3AONB 3RVPA 3E7XA 2C8VA 1Y1KE 4UBLA 4DHWA 2C1EA 1I33A 1QMGA 1ULUA 1Y6JA 1FFXB 1G8SA 2A6PA 3ADKA 3EEYA 3GLTA 3LQQA 4PNHA 1FUYB 4M1KA 1TUBA 1XKXA 2PZLA 2QI9C 3LPMA 3MTDA 1ND6A 3RU7A 4Q24A 3Q8LA 3PWKA 1E96A 4Q12A 1U9JA 1WMDA 5ALWA 5HF5A 4JBLA 1T5LA 3VU3A 1OUMA 2FTKE 2HREA 3RTEA 4BMXA 1E0AA 1VYHA 4IIJA 2FE4A 5SZIA 2EZ9A 5BWBA 1M2JA 2XSZD 2QUHA 1A76A 3QUTA 4RTOA 5D01A 1B74A 3UT5A 3GLRA 4Z4HA 1TIPA 2RBEA 2IZ0A 3SS8A 4AJOA 3K94A 5IXSA 3TQTA 3TQIA 5ABPA 5JVDA 3DOFA 4ZAWA 1QGUB 3K4HA 3H19A 1YR1A 1BS1A 1QIFA 2ZXUA 2NXCA 4FLMA 2O5RA 2Q5FA 5B53A 4Y2TA 3DTYA 3L01A 4R1OA 4Z3DA 2CW5A 3I2FA 1WUHS 2P6OA 3JWHA 3ZV7A 5EJ7A 4NFYA 2CE7A 5EJFA 1SUSA 2PUTA 4Z54A 1TA0A 5SY6A 3AVQA 1ZD8A 3U7GA 4JVNA 1P1IA 4CTNA 4DVJA 2D2VA 4J75A 4E5NA 3WLPA 4KLZA 3CEAA 1MA0A 3RSZA 3BA6A 2FZ4A 4BNFA 2ZI9A 2EU8A 3CEPB 3EYWA 4XX0B 5H4HA 3VR6H 3GMIA 3F7TA 3E23A 4AJ4A 2EIXA 2X9VA 4PO8A 3LXXA 4PYLA 4Y18A 5HFNA 2B4RO 1CHDA 4TMWA 3OU2A 1Z75A 1G59A 4CF3A 3HKEA 4MV6A 5IVHA 1G291 4RGQA 5THXA 1H6CA 1XQ9A 5B3AA 2YBDA 4UMFA 1NW4A 1ORWA 3MPOA 3IR6A 4JJ7A 4WMLA 1FOEB 4QU0A 4W5QA 1LDMA 1UAGA 3LYUA 4RHTA 4EPVA 3L8FA 4PRYA 4R8LA 5KNBD 1H93A 3LDUA 1KYWA 1ZJZA 2E5FA 1Z0ZA 2HNBA 4ODIA 1IQRA 2WT8A 5ILGA 1OX4A 4M4SA 1D2HA 1EP1B 4W8GA 4XCQA 3TRKA 4F21A 2IYSA 1FA9A 2GKOA 3HABA 5FBHA 4P0QB 2ZBRA 5JISA 1A04A 2E2WA 2XWPA 4IDQA 2GJ8A 4S1OA 1A5ZA 2R00C 3IEPA 1IYZA 2JVIA 3EA0A 4HRYA 3W9UA 5HQ3A 1Q5PA 2G9NA 2P1ZA 1YGYA 3Q88A 2JFPA 1KDVA 5LQAA 3DBLB 1MP0A 3SHTA 4RWZA 1M0EA 4GBGA 2WTMA 3FUXA 3NKLA 3WYFA 3OMLA 3DZBA 4ARUA 4YUZA 4OAOA 4HGZA 2IS6A 3M6XA 1AXGA 2ZUDA 2OAQ1 2XGMA 2B94A 1AHPA 4GC9A 3L79A 1T2CA 3E15A 4X1KB 3TNYA 1JQBA 1V4BA 2VBGA 3VSCA 3OUUA 2CYCA 4HDCA 1W9MA 1L4MA 3O3NB 5GJVC 3O8QA 2RIPA 3ZD7A 2YZ2A 3D9QX 5A4JA 1I5RA 1F9AA 1NDUA 1DARA 2NUPB 2W6MA 2D74A 2C3MA 2E4UA 1ZMXA 1QG0A 3KSUA 2X0DA 2G5PA 3UWPA 2O2EA 1M3SA 4QO7A 3VC7A 1BMFD 2L17A 2QVCA 1PQYA 1TCUA 5JNRA 2ETXA 2NSYA 2WMYA 1VI2A 4X64B 1FTYA 3CMMA 3QJGA 1UMCB 4A23A 5EZYA 3O4HA 2XODA 3DDWA 1CR0A 3WSWA 1AQIA 4KXVA 1P81A 4TKUA 4QPZA 1ZVKA 4KR7A 3M82A 1EVZA 4B8WA 1K2WA 2VKTA 2YIJA 1G5IA 2KB0A 3ROQA 3TTWA 3ZHTA 4PN7A 1E3DA 1QQ6A 3L4SO 3BWXA 4UAGA 1K27A 1PX2A 2DMRA 3KFXA 4DNPA 5IX8A 1ZCJA 1OLSA 3Q7TA 3DMGA 3TTSA 4EFMA 4FONA 3SF8B 2FFJA 3VO2A 4HPWA 2XCOA 1TD1A 4ZA2A 1HFWA 2TYSB 3IULA 4MA5A 4QJ5A 4CLXA 3EE6A 1EM8A 3NASA 1HQCA 2DPHA 3MINA 2XDAA 5EWLB 5AVYA 5DGDA 1Q1NA 2BI8A 4EECA 1T4MA 4ITUA 1CQIA 4LYDA 1KFBB 5CIQA 3RRFA 1S89A 4WA7A 4L2IB 5CX1A 4DCUA 5BQ3A 4X7PA 2KE5A 1YQEA 1S3FA 2B61A 4O5OA 1QVZA 3H9BA 1OBCA 1JJAA 1JALA 3II6X 5JCOC 4CR6A 5DIFA 1UJ6A 1VXRA 1RT9A 3JTEA 4UVGA 4G9GA 3LY7A 1MFZA 3COZA 1WD5A 1FU7A 2PD4A 1QR2A 3B12A 5IG2A 4FS3A 4MUHA 4R6WA 4MVJD 2JJ2D 4L5CA 2WDZA 1O6BA 4WZ6A 1DKLA 1PT6A 1NLZA 5I9TA 3L7OA 4DB4A 1O58A 3OC0A 3WK5A 4D3SA 4XZ3A 1FSPA 3A2MA 4KAFA 1YAJA 2LTAA 1NR5A 1Q0SA 3U3XA 2AFHA 1T0UA 2OZKA 1J1ZA 2IOFA 1LU9A 3I9LA 2HDOA 1JG6A 2BR4A 2RCYA 3E5HA 5BXYA 4CN9A 4EHDA 1OFHA 1V8BA 3D8TA 3ETEA 4HB2A 1ZPDA 5KTPA 5CM9C 3HGMA 3G9XA 4KE7A 4LI0A 4N1AA 1RWPA 1RRPA 4PY2A 1H42A 5FAXA 3NDPA 2YX1A 3LNTA 3QSYA 3L06A 5EEGA 2K87A 1E2NA 1MNAA 3QE9Y 3QMWA 4UU0A 4PS1A 4XFJA 1GG8A 1XTZA 4I9HA 1C0EA 1NHWA 4MK4A 4RV9A 5AKJA 1P61B 2AI2A 5A4AA 1E1KA 3K2IA 4P83A 1PJTA 4H31A 2PAAA 4LMRA 3VOSA 2H16A 5K6TA 4ZOBA 3V8EA 1HSZA 1KNXA 4II7A 3SF0A 3E7DA 3KEOA 1FVFA 1U7PA 3Q3VA 3AJDA 1MFPA 1EXMA 3HXPA 3DBIA 2CBGA 1ISSA 2BOVA 3SLRA 2GKGA 2GMWA 2JCGA 2WD9A 2I2BA 3VZCA 1WW2A 4AJPA 4AMBA 1XF9A 1BDHA 3OFSA 3AM3A 4I4TA 1NATA 4O08A 5ILQA 3DEKA 3C8DA 2PRYA 2POQX 3DLIA 4N5IX 4TXNA 4C7KA 3AG5A 2LCIA 5DYIA 4KWHA 5FUXA 2IRWA 1VIAA 4NJMB 4Y1GA 2L42A 2DWCA 2HF8A 3KE9A 4OOFA 2C83A 5JWHA 5B2FA 4JGBA 3I62A 1RZVA 2BZ1A 2JFFA 4IHJB 2G0TA 5IW8A 3VOBA 3TKYA 3AIIA 2B34A 2H9AA 2PO7A 2ZRBA 3EFOA 3AJEA 4GRAA 2NPFA 2EEPA 3HPRA 3H5RA 1QFJA 1FYDA 1R1DA 2R87A 1N2SA 5EG5A 2PKWA 4Q9KA 2FI1A 4BO3A 3OY2A 3OJFA 1T9KA 2QTLA 1QO9A 3ZHVA 5LM3A 2JLUA 1TC2A 1WDKA 3I6MA 2WFLA 4LPKA 3NH9A 5FXMA 2NT3A 1M66A 3KVYA 2R6CA 4R8SA 4WPGA 3K1TA 4ETIA 2NU6B 4BNXA 4WOKA 1KU6A 2AJBA 1M2VB 1SHLA 4P86A 3UCEA 2PSEA 3CLSD 2GEBA 3RYFA 3EVCA 2OCXA 3FMFA 2FFBA 2A9OA 1WPXA 3D1JA 3KZKA 1SOMA 1X14A 4EY3A 1GL7A 4JJFA 1YZVA 5DCWA 2QRVA 5AT1A 5GGXA 3PL5A 3A26A 5THQA 4BJ1A 4FVTA 3WNVA 1LTKA 1QYIA 1YZFA 1TQ2A 3AERB 4P0PB 2Z8YA 4IQGA 4ZAFA 4BVLA 1FYVA 3QWBA 5A4MS 3SJCA 3BYZA 5EHIA 3VSBA 4O02B 4BVFA 4KO1S 1IVYA 2R66A 2J5XA 2GZ3A 2QVLA 1KDYA 2FPGB 3D4LA 4K6FA 4M0CA 1NDHA 1NU6A 5CYGA 1JP7A 3L7MA 4LPSA 3BILA 4JUFA 1QB8A 4F7WA 1E1CA 3H16A 3WV5A 2XOKD 1C4WA 4NARA 4DNQA 5DN9A 1LBSA 2ZXFA 1GUFA 3W06A 2AE2A 3RKUA 2WQZA 1A5TA 3DVQX 4QUBA 4BCCA 5DCUA 5IJZA 2FZEA 1YS9A 3EUFA 2AFIA 2UZAA 2YMMA 4JB3A 4Y6LA 1NHGA 3NHWA 2ZJ4A 4MRMB 1T35A 5AVVA 4AB1A 5EPOA 2GPJA 1U2DC 4BGIA 3P2JA 1GGNA 3R3JA 2ZBGA 3R8XA 3SZLA 2DSTA 3AHIA 3TAHA 4QQ8A 2PSDA 1L5GB 4FIZA 1OPRA 1XDGA 2V7QA 4DSNA 4I55F 1CC1S 3CCBA 3MJSA 3QEAZ 3A8TA 2N46A 1BH2A 4H3KB 4H7HA 3HU5A 2WYOA 1KQPA 3CH7A 1UR5A 3FNIA 1AQYA 2I5PO 3FNQA 3ZX5A 1Z6QA 2RGBA 3BXXA 1ZD9A 3D1VA 1FUEA 3KHUA 3WICA 5HZMA 2JCBA 4WW0A 3H0CA 1E1QA 4ZTUB 1M8JA 3KDPA 1EHYA 3NOVA 4G65A 4WKGA 1FFYA 421PA 4MRNA 4B3RB 2G5GX 2H7XA 4NHOA 1T9CA 3DONA 2AF4C 3QXXA 5E95A 4ZCTA 5BMVA 2IYYA 1MX3A 3UUWA 4HQKA 2WAYA 3QPDA 3SG0A 1FJGB 4YV1A 3FWYA 1DO2A 4ESEA 1SVMA 1IC6A 1PK7A 1CERA 4FFVA 2YMPA 3PLRA 3D7MA 3LBHA 4RTJA 4XLLA 2PD6A 1O2DA 3A1TA 3CF6R 1UK8A 3R44A 1XRMA 2XUKA 4N0MA 2CZQA 1XSEA 3WS7A 4INAA 5E1OA 1XCGB 1SZPA 2CJPA 4RXUA 3SMVA 3WJ1A 5F7OA 3L05A 2VHWA 4BMPB 1JHAA 3GUHA 2R44A 3MAAC 4A7PA 3WA7A 5HJ7A 2NV2B 5IC6A 4UE2A 1GN9A 1YJBA 5JTUA 3HRIA 2QU7A 3QXSA 4IICA 5L7WA 1ZBDA 1MRSA 1A2OA 3HCEA 5TF4A 2V7VA 3F73A 3Q2OA 3ZQKA 2E7ZA 5AKEA 2FFAA 4JLJA 1U3GA 1EFRA 1B41A 3IPCA 3EEIA 5GIOE 2OUKA 4PNPA 1RMTA 2WRZA 2BGGA 5INTA 3EZ6A 4YJ3B 4FNAA 3A6DA 1APBA 1NN1A 2ACVA 3A2NA 2CMKA 2FMXA 4R51A 1G41A 2HIGA 4FZ5A 2MSWA 2ZB2A 3DMNA 1NXOA 4BO8A 5AKIA 2XXAA 1R0RE 1WP9A 5LYYA 4IJUA 2I4LA 1XD2B 2K7ZA 2ZT5A 3L0ZA 4HWOA 2H17A 2W2MA 4O2BF 4EA6A 2W2LA 2AZDA 1Z07A 3G89A 3MTBA 2HCBA 4L5JA 3UCFA 4DCCA 3KQLA 1MW8X 3B2NA 2C58A 3LQ1A 1L5NA 3CNHA 4MWGA 5AK5A 3WB9A 1EKXA 4DRZA 5EJIA 4PCAA 4WFQA 2VJKA 2WP8J 2VSYA 1NW6A 3T5BA 5GADl 3L6OO 2G1AA 3H5IA 3PGA1 4M8SA 1UZUA 1V6SA 1RR6A 1ULHA 3TGPA 1KERA 1AZTA 4WCFA 1U1IA 4FHCA 3ZCTA 4JENA 4RAOA 1AGYA 2B82A 2H1CA 1LI7A 3OKAA 4GOMD 1TYBE 4LBVA 4HD8A 2OOSA 4BQPA 2IYAA 3RUDA 4REQB 3DO6A 1CRWG 3CCFA 3A4YA 1U5BA 2C1XA 2RGDA 2QRGA 4FWBA 2X1LA 2IDJA 4G4JA 3RCBA 4ZT6A 3UB4A 1UXOA 4HVAA 1PR3A 5JW6A 4YN3A 4HAOA 1SXJE 2BE7A 3A1DA 2VAVA 4S3MA 4J9VA 4Y6OA 5GVSA 3W3AH 3EEQA 1C41A 1JIIA 3R3YA 3UV3A 2VH1A 2A5JA 3NTLA 4EY5A 1JTEA 4MZDA 2GBGA 3NQ41 2NPOA 4KIJA 3VPCA 4AJEA 3H9EO 5HVNA 5JS8A 1UXJA 3SDBA 3X1MA 1Z2CA 3G7NA 1KY3A 5DX1A 3TR0A 1KF0A 1E1RA 4G86A 5LQNA 5JDCA 2IYNA 3U4CA 2E18A 1YSCA 4ASUD 3OQBA 2ZIXA 4B2PA 1ZH4A 4CFZA 1CU1A 4D6YA 1GO2A 4LF5B 5KOYA 5C9ZA 3HJFA 1PR4A 3MMZA 2OQIA 4X45A 4FGSA 1JMYA 4AKHA 2OV4A 2QS9A 4W1PA 5TQ2A 3V7FA 3ZN2A 2FDXA 2D00A 4Z1MA 4B3DA 1MXHA 5EVJA 4YT8A 1QCCA 1SO8A 3AR6A 3EXIA 2LKDA 3FD8A 4FEAA 2V98A 4N65A 4PQYA 3UXHA 4NAUA 1CDOA 1ORTA 3NDIA 2FEPA 2I2FA 2X7HA 1V3QE 2F1JA 2H85A 1TLLA 1FLVA 4UFNA 3EPJA 1UQUA 4ZOLB 4MKGA 2VNIA 3OQIB 4N18A 3THYA 4X20B 1AS3A 2V54A 2G17A 1VSQA 2PNJA 2O2GA 2IKQA 4C29A 4F6RB 1D5WA 1GDDA 1UBJS 2E82A 4FZVA 1C8VB 4LQLA 4MP8A 4NTZA 3VR4D 1C7RA 4J6EA 5TQJA 4E88A 3MCVA 1CJTC 2XGGA 3JX9A 1F06A 1Y1RA 3DMRA 2AUTA 3OZRA 4DWVA 4RHXA 2A3RA 4MW0A 4S1WA 1IBMB 1Z0FA 1VJ0A 1YZKA 2CWWA 4FDLA 4XQGA 1YS2X 3SYNA 1ZU5A 3RNOA 4XVQA 3T3NA 3P0IA 1K66A 2QRKA 1K5HA 3JARA 3K92A 4FN4A 4XAQA 3BXEA 1DQRA 2Q5CA 5ALVA 4JROA 4Q4HA 4DR2B 1H94A 1AX9A 2HMSA 3M6AA 1SHUX 4QNNA 3LE8A 5DHRA 1FX1A 4A6EA 4G4GA 4KR0A 4ABYA 1N33B 1EUCB 1E69A 5K0EA 2IH5A 2HXGA 2CMGA 3FDZB 3AWDA 1HL3A 2YQ4A 2VUHB 2BHSA 4HNAA 1H8HD 3NHFA 3TTXA 1MVNA 5AFSA 2IS4A 3GNSA 1YQGA 4H7PA 4R8MA 5EE3A 4GZ5A 3QV2A 5FO1A 2ZIAA 1K88A 3QXJA 3OQVA 4B2YA 4E0BA 1XHEA 1XRSB 4IJ6A 2IK8A 2AC4A 3U7QA 3VMMA 4CV0A 1IL0A 3ZHSA 4PFJA 3QVXA 1LFDB 3IV6A 4XJXA 3SQDA 3T0IA 3X1WA 3G82C 4GKVA 1M2KA 3ZW7A 5FNVA 5BN4A 1DVRA 4IZIA 3GAZA 3TQOA 2N75A 1JTFA 4LZWA 2FPLA 1AHIA 1BS2A 4DB2A 3U7RA 1DNPA 1MJHA 1IXRC 4IEIA 1PL8A 2ODEA 1K7YA 1Z4QA 1DEOA 3HCRA 4Q9AA 3KKLA 2VUSA 5I6DA 3DV0B 1V5WA 1JG2A 1E9DA 1XQVA 2HHLA 4UUBA 2JLWA 2J67A 1AA9A 2QE7D 5SICE 4F5DA 2OC4A 4TXLA 1Z4OA 3DZDA 3PFGA 4K9PA 1FPMA 2ZYIA 3JPYA 4P3PA 2XUPA 4P3KA 2IY9A 4R1LA 4DWOA 3DOIA 1YB7A 4G84A 2C31A 1NBME 2GYUA 3DB2A 1HT1E 4NDZA 4B09A 3TKLA 10MHA 2WYUA 3CKLA 4YEDA 2Y4NA 4C6RA 2J87A 2BEVA 1MNQA 2J31A 4OPMA 4YWHA 4ZGBA 2AZTA 3DEAA 1PGJA 2IPNA 3TPCA 4YVFA 5BSRA 3O2SB 3GT3A 3KCQA 4ZI3A 5FWYA 4OGKA 5IZCC 2XB2A 2VF4X 2Q6TA 3NGMA 5CGZA 1RRGA 4ALJA 2P35A 1XJCA 3TYXA 3IA7A 3JQEA 1EZ4A 2WWRA 4DMCA 1Y9DA 4TN5A 3LHKA 5C4GB 3WBFA 1U04A 3MCWA 4DMLA 4L4SA 5HG0A 1A71A 4S1NA 2ZSKA 4L4UA 4FNGA 1XMJA 4YAKA 3BWBA 4L28A 4NESA 4OLHA 3W5VA 5BYAA 5JQGB 2DJ5A 1S1MA 4RPJA 2UDPA 5DNDA 1ZN2A 2O2SA 4IHAA 2IUYA 1Z2PX 1Q77A 1WXHA 3I6QA 3KSDO 4GHWA 4RKWA 4BN4A 2P6NA 1W36D 3P52A 5DT9A 1OJLA 2OFXA 1JE1A 1FMCA 2C2GA 2KJQA 3G23A 4W1QA 3R7SA 3OZGA 1NXTA 2QR3A 2XNCA 4NBVA 4OK6A 3TW6A 4OQZA 4A0RA 4R0MA 4IDBA 4R98A 4LWPA 3LXRA 1WU8A 2C95A 2GLXA 2LUOA 4AF8A 5AW4A 1MAHA 3HDGA 1GSOA 1VJDA 4XYEA 3NPAA 3RS3A 4WXRA 3U5ZB 4MQ4A 4V1CB 1CT9A 4YGXB 5I7UA 1JFRA 4D8VA 2C3UA 1OTXA 3MUNA 1SULA 2FWPA 2ZP1A 3VNBA 3HYNA 5IULC 5JFGA 5K6AC 3QWIA 3JASB 4Z3KA 3E82A 4UUNA 3ZWWA 2RHMA 3VNSA 1M6WA 1YI0A 4HS9A 4W5TA 2P9TA 2YOHA 5DASA 5T3YA 3MB5A 1GPNA 4WK6A 3GLGB 2H29A 1LPAB 1N5MA 1GL3A 1V11A 3FF4A 3NOQA 5G3YA 1BTOA 5HKKA 1WOYA 5EEHA 1AE1A 1IZYA 1I4TD 1YZHA 1Z82A 4I50A 1AQLA 2VR1A 3PC6A 2IYUA 5K3AA 1MCZA 1XO1A 1RYNA 2QLTA 3TGLA 1PRYA 3GJ6A 1GAJA 2IY8A 2JGRA 1OC4A 2VPWA 2GBPA 2OO5A 2XADA 4PZAA 4WADA 5IP5A 3MWLA 4FYIA 2CXNA 4INJA 3L1JA 5EYPA 1BVHA 3WGLA 4DA4A 2VPQA 1BFUA 1OXBB 3DPIA 2UVPA 3KSMA 2H06A 2QTGA 3HCFA 4TL8A 1YBHA 1N8KA 3TDMA 4HT3B 3UIEA 1J1UA 2W6ZA 2OXFA 2CMDA 1E32A 4KVGA 1ZH6A 2QV7A 3UN1A 2GXAA 2MYNA 1ONBA 2EKDA 3HL0A 2Q8NA 3I05A 4N7RA 4UVEA 4C7OB 3FPFA 1XL0A 1X74A 5ESDA 1A1VA 1YZQA 5K45A 2GT1A 5K3FB 2JGFA 4YUYA 1Y7LA 1E64A 3DF7A 1PW7A 5KYYA 3TRIA 5JHHB 2ATXA 2LV8A 1DG9A 1PL6A 1ZWLA 4EJ6A 3NW9A 3HP7A 1KRHA 1B0ZA 1E92A 1MB0A 4I9FA 4CMIB 3QSGA 3VNAA 2W48A 3FPBA 1TM7E 2P9BA 4KNYA 4QTYA 3ABZA 2OHJA 3TBKA 3ANTA 4X6YA 4E32A 2HBYA 2O0MA 5AM4A 1LDEA 1GEGA 2UYOA 1UBEA 2J0QA 5F21A 3GFVA 4YAOA 3GFSA 2PFKA 3GG9A 2IUEA 3B70A 1XTTA 3MTGA 3NB0A 3ENVA 4IMJB 4POAA 3WGZA 7ADHA 1GDTA 1KO5A 2P9QA 3DXFA 2CKDA 1SKQA 2ISSD 4YACA 1SCQA 1T1GA 2YS7A 4Y7CA 1VZ2A 3SHWA 3E1GA 3UHAA 1Q17A 4WIAA 4C4PA 4TL9A 4R01A 1I2ZA 3HGTA 2EZUA 1U2EA 2WHRA 4KCGA 2WKQA 5HBGA 3HYTA 4P7FA 4WBNA 2X58A 1EQAA 4G0ZA 4ZI2A 2IVFA 3AB3A 5EQJB 5EXDA 3REOA 2GN0A 4D81A 2SKEA 4DV7B 1JIJA 3ENKA 1W49A 3LRTA 1JR4A 3R3HA 3EHDA 3RSFA 4DMRA 1U2SA 5H70A 2HHCA 1FSSA 5DLPA 3WQRA 4J0IA 3VJKA 2RHHA 2H07A 5IF3A 4JC0A 4M1YA 2VOJA 4KBFA 4RABA 3S5UA 1E8DA 4CIAA 1CJBA 4D42A 4CM8B 3P4UA 1HG0A 2P0EA 4FIDA 5LA6B 1RPTA 1OFUX 2PWZA 3AU8A 3RVJA 3N74A 5K7SA 4FYJA 2ODWA 4M98A 5CH5A 1R18A 1A9OA 4EGQA 1J21A 1P9NA 1DLIA 2C59A 1Y7TA 2M32A 4AO6A 5M2QA 2NO9A 3L3BA 4P4UA 2BFOA 4P32A 2YWHA 1B6RA 2NACA 4J8PA 5HMLA 1KK2A 3S2IA 3RLIA 1TEVA 3K9HA 5CB6A 2GAAA 4EGJA 1VHLA 1XTBA 4BBJA 3GLVA 4C4ZA 5KEIA 2BMEA 3L1UA 1S2MA 1E2IA 3QTLA 1V1JA 1M75A 2NZVG 4HVTA 1U6IA 2VJDA 3NHLA 2OQRA 1FFXA 3QFSA 3CF4A 4QJ4A 4RKRA 5CH8A 3FRIA 1YNOA 1XD9A 3OPXA 4HNHA 4QULA 2EW2A 3EFHA 1MX9A 3I34X 4QPCA 5SZKB 1EX9A 3DLCA 1UAAA 4JWTA 1SOWA 2XUAA 4GP6A 3ZOZA 4D1YA 2E55A 2RGNC 2Z58A 4G2TA 1GY8A 3AESB 4KL8S 4TLDA 2IDZA 5LQMA 2E0IA 3QY9A 4YQYA 1MHPA 1P29A 1J39A 1PEAA 4BN0A 2QYTA 4WT7A 1GFSA 2R2AA 4ND8A 4B6JA 2IP4A 2PUGA 3NWPA 4YJDA 4B76A 2RH8A 2ZBEA 3U4HA 4DJTA 1LLFA 1KJ9A 5AW5A 4ER6A 1QH1B 1TT5B 1E9SA 3F5QA 3H4TA 3OPNA 3V4SA 1I7QB 1DEAA 1DUSA 2ZYAA 5AXDA 3VR3A 1SU7A 1VSBA 4DM4A 4A8HA 3C87A 4FDUA 1LK7A 3ITNA 5E8JA 4MIOA 5TVKA 1AS2A 4XRGA 4KQEA 1EWQA 4NYJQ 3K71B 3ESQA 4MQ5A 4PV7A 5JY1A 3TIIA 2BE9A 1GPKA 3W5IA 2FY8A 2RB5A 1JG7A 2PL9A 1SIBE 3LOQA 2XZPA 1E6LA 1YOVA 3RJ9A 2VH2A 1MH9A 4G89A 2A1UB 4XX0A 3VR5H 3QITA 1IY1A 1R64A 3LCMA 4JP2A 3RC2A 2I1VB 3CNOA 4BUJA 5BPHA 1Q74A 1CR6A 1MDBA 2P3OA 1XZGA 3CX4A 4DV1B 1M73E 3W2TA 1WXIA 3L0YA 1HFJA 1KKUA 4TRNA 1J8VA 1PR5A 2AH5A 2ZJOA 1GFZA 2CDRA 2VTBB 4N0DA 4IV5A 3WIUA 3FWNA 4WK4B 3NTVA 4ETWA 4UAUA 4LTDA 4EA7A 2OBLA 3FB1A 5FL3A 3Q12A 1XGKA 1T0JB 3K0AB 3O2QB 1D2CA 2HMUA 3DYBA 3OUTA 4U7TB 4RIIA 4BZXA 4GOJA 1SWVA 1HLDA 2OPBA 1V3UA 3F71A 3FHLA 4NENB 3NJ4A 2NW6A 4MUEA 2JGNA 1C0LA 2G1KA 4QGGA 4L15A 1KWKA 1P4GA 1SG6A 1NBEA 1ECJA 4M60A 4XIYA 4IOLA 3AP3A 5AYVA 4JS0A 4MWBA 1CRZA 5A3RA 1X0XA 5EMNA 1PO7A 5DTMA 4YQZA 4MCJA 2LW7A 2P69A 3DBLA 2JVKA 1BXGB 4M7WA 1JAXA 4OSPA 5K20A 3KSBC 1D4FA 4AG5A 1RYYA 1VHDA 1XTVA 2REXB 2ZVDA 3C70A 1GNVA 3DSRA 4KIWA 4WASA 5C31A 2RI6A 4EKDA 5A5EA 1UC4B 4X1KA 1Q91A 2OILA 4J2HA 1M0WA 4QODA 3U3KA 5D86A 1N32B 2BLLA 4IGAA 4XI9A 5DWDA 2NGRA 1NKVA 3RUHA 5G4LA 1YVRA 4D41A 7YASA 3AVYA 1L7PA 1I6KA 1W0JA 3GC6A 3IIJA 3QF4B 4JBYA 3OPYB 4M9SA 5LPNA 3P2MA 2NUPA 2GARA 3KZXA 4YR7A 2I7VA 2Q1SA 1R6XA 4M1OA 4JI2B 2JS7A 3AFGA 3D54D 1GVHA 4IWXA 1BE6A 2RH4A 4RVFA 4ZO6A 5HF8A 5F9HA 5KQPA 1ECFA 2EW1A 2IYPA 1H6DA 1JNYA 4HSGA 2WC1A 4KLCA 3DE5X 5DN6A 1RFGE 4JIMA 3IAHA 1UMCA 2G80A 3S1AB 1XDDA 1RWNA 3MS2A 3ZXSA 2VC2B 2OV6A 1NM5A 1SVNA 4TSFD 4K6KA 5LP6C 2CGEA 1YQDA 5HCUA 1J0CA 3PGXA 2Z2KA 2BZSA 1IOLA 4YP6A 4E4RA 3KUKA 1CY6A 1CEQA 2HDHA 4IP0A 2IV3A 4O5AA 3VBCA 1RBMA 4ARSA 2OCYC 1QV6A 2AZ4A 1MB3A 2IODA 4RLFA 4CM9A 5DM70 4MPTA 4RVHA 2DBRA 2WE8A 3F7NA 3UW3A 1LS1A 3O0TA 2Q9AA 2PZGA 4IDHA 3SF8A 2XJ9A 4H2DA 3M4YA 2C9BA 4PLPA 3C5WP 2AOXA 4YXWD 5IRCD 5A4KA 3Q98A 4NNPA 4D3ZA 3K9FC 2OHOA 2VP0A 3PPVA 4P82A 2Q2NA 2Q3CA 2BHRA 2J08A 3V00A 4N5DA 3UAZA 5A5FA 1NN5A 5AW8A 3ICEA 2D8MA 3FROA 2C5BA 5LU9A 4RD6A 3BTVA 4ED9A 3RUFA 1RZUA 1S9HA 1UPBA 2HEIA 3TXXA 1WMEA 4L2IA 2QN8A 2WVHA 3LYAA 2O3UA 2IU6A 4U2GA 4KO8A 3VHLB 1IRIA 2R7AA 1GT6A 1VPTA 2JRLA 3CW2A 1HT2E 3D0KA 3PRHA 3FFWA 1COWD 4G5QA