2VP6A

Structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
197
structure length
197
Chain Sequence
TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
molecule keywords DEOXYNUCLEOSIDE KINASE
total genus 75
structure length 197
sequence length 197
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vp6A00
2IYUA 2IUSA 4PHTA 2IYRA 4Q01A 2P5TB 4Q4HB 1HEIA 2G0TA 4E03A 3BWDD 3OFND 3GLFE 1TX4B 2FEMA 1Q12A 2CLSA 2XB4A 1E0SA 1X8KA 3HWSA 5TMPA 4JVNA 2F43A 5F2EA 4MGZR 3TH5A 4RD4A 2GAOA 1UKEA 4TL9A 5CJPA 4X8OA 2AD5A 4JL8A 2YOFA 4US2R 1SVWA 2WBLC 2ZSBA 3ETLA 3QENA 5JJIA 1K6MA 3CF6R 2PZFA 4LOAA 4B3XA 3TW4A 1YJ5A 4BUJA 4QL3A 2O8DA 2ZI4A 2QRZA 2OESA 4XWOA 4IJMA 2VQSA 1KI6B 4US1R 4HAXA 3LRPA 1E69A 3SHWA 2ZU0C 3SBDA 3LLMA 2ZE8A 3QVVA 2OUKA 1W4RA 5L3QA 5HE8A 2MSCB 1KAOA 2IYZA 1EESA 3EARA 3RC8A 3GFPA 3P20A 3OE7D 2OAP1 3U7HB 2ZRFA 3NVAA 3PEVA 2KBEA 2D7CA 3K1JA 5KDDA 4XTCS 3WYAA 2W0MA 1IXZA 4CT5A 1QHGA 1GL6A 1PUIA 3L2OB 1F2TA 4BWYA 1Q1BA 2WIAA 1CR0A 2B92A 5DGXA 4TT3A 1V5WA 3VR6A 3TK1A 2F1HA 3ICEA 1ZYUA 2L0XA 1FQJA 3CPJB 4BRUA 3D8BA 2QPTA 2IYQA 2F9MA 1TTTA 1HTWA 1ZU4A 5JS7A 1NLFA 4U5XA 1VECA 3LAWA 3IQWA 1M1YE 4KO8A 4C0SA 4C4PA 2IS2A 4YONB 1RVDA 5GVSA 1Q22A 1T8TA 5CIWA 3V9PA 4BGDA 4BLQA 1OXXK 3BJIC 2CNWA 5TDHA 1T3HA 2JGNA 1IJEA 2CCJA 2OZEA 4D4JA 2GF9A 2ZJ5A 1J2JA 3OEHA 5B30A 1JEDA 3B1YA 1R8QA 4EUNA 4LJ6A 5AUQA 3GLHE 4M1SA 2FEOA 3EASA 2C9CA 4NU0A 1W0KD 2NPFA 3LW8A 2IW3A 4AG5A 2A5YB 3FMOB 2GK6A 1X8LA 2GAAA 3R9IA 3TUJC 4B47A 5C1BA 5DI9A 1RKBA 1KK0A 4WBSA 1JPNA 3WXMA 4LV6A 4Q1DA 2OBMA 2W2VA 4IVQA 2H1LA 2ZVQX 1DAMA 3P1JA 3SJZA 2QP4A 2HLDA 4WAUA 2BIFA 1E6CA 5KSZA 2ZYWX 2WWFA 4HDCA 3GMTA 4G5SA 4EPXA 1IN7A 3MLEA 4TL7A 3WNCA 4B44A 1HQYE 3BBPA 4HLCA 5EJEA 4GDFA 2P6UA 4NYMQ 4M0LA 4XWKA 5C2JB 2W00A 5CLLA 5JWHA 4B33A 3LWNA 1T0JB 3D3QA 2YWEA 4IDPA 1E2GA 2QENA 2G88A 1OIVA 3QSYA 2JCSA 3IEVA 1UKYA 1HT1E 3AF2A 4NCNA 1R5OA 2GJ9A 4DJTA 5DIFA 2VSXA 3EWSA 3FFAA 1NJGA 5G53C 2BBSA 2ERXA 2GXUA 2ZJ8A 4DLVA 3FKSD 4UNSA 2ATVA 3K9NA 2AK3A 4CIDA 4G0NA 5FI1B 1VHTA 2QE7D 3LBHA 2D62A 1KNXA 5H8WA 2NO0A 5DO9A 2G1KA 2PEYA 2X8AA 2DR3A 4IOKA 3KXKA 2AXNA 4MRSA 3NBYC 4Q21A 1IONA 1UBEA 1AZTA 2D06A 4F91B 2GCOA 4QM6A 2QBYB 1B0UA 1GUAA 3W90A 3KDSE 2GHIA 4Y0AA 1LNZA 1CTQA 1X3SA 2WMNB 3B2EA 4WZAE 2HUPA 2WOJA 3IIJA 2E9SA 3FVQA 4LYHA 1KMQA 5FOWA 1A2KC 2CE7A 3GLFA 1BO6A 3TIFA 2ZSAA 1XJCA 2LWIA 4DRZA 1DAEA 4JIMA 3U4QB 1G4AE 3IDQA 4LPKA 4BLOA 1FP7A 1VPLA 3QNUA 4MRNA 1YVDA 5FTMA 1MABA 3OEED 3NDPA 1GNPA 2VTKA 1KMHA 2ORVA 3AP2A 2OO7A 3EG5A 4HZIA 3REGA 2V6JA 4ILEA 3RS0A 3UMFA 1J90A 1P4SA 4RFVA 3GP8A 5DYGA 4G5RA 4XTRA 1E2PA 1N6HA 1P62B 3ASYA 4ASUD 4BFXA 1BMFD 1Z28A 4ZPXA 4G1UC 3TVTA 4KV9A 4L9WA 3VU9A 3O8BA 4JSTA 1W0JA 2XOKA 2GEDA 4ZI2A 4BZXA 1GKUB 1IHUA 1YR6A 4Q4HA 2FGKA 1NSFA 1AA9A 3CF0A 2CHGA 3GFOA 3QQ5A 4HB0A 4ZDJA 4PZLA 2XNSA 3T1TA 1B23P 2MMCA 2FGJA 1CBUA 3N2IA 1GVNB 3SFZA 2DCUA 3CX6A 4TZ0A 2O52A 1Z63A 4JT4A 3VKHA 2R2AA 1NVVR 2R6FA 1KO4A 3DM9B 3E2IA 4UNNA 3UWKA 3OIVA 2N42A 3VR4A 4AK9A 4Z8XA 4LYAA 2HCBA 3AVTA 4JLDA 3ZZTA 2GXQA 1Z0KA 1R0XA 5JLJA 3EX7C 3BRWD 1E2NA 3THXA 3W6NA 1AGPA 4BEJA 2QBYA 2GCOB 3SQXA 3AB3A 2ZI5A 4NE2A 5HE9A 3BERA 4GOJA 4PO9A 1NG9A 2JJ2A 1FMJA 3IO5A 2ZUBA 2O8DB 4JBWA 4MGIR 4MDEA 2QY9A 4NCIA 4PXAA 1ELOA 4D25A 2C03A 3B9QA 3MGCA 3QG1A 3HU1A 5IHPA 4Q9IA 1T9HA 4M8NE 3T1OA 3H84A 3K9HA 1SKYB 1TF5A 3GJ0A 4YLGA 4PAOA 2PH1A 4Q9JA 3R20A 2IWRA 3SQWA 2CCKA 3IUYA 5JRJA 3QIAA 4QXAA 1U98A 2ORIA 4GRAA 4ZCMA 3ZZ0A 4LYJA 4MYUA 3WMGA 4PR0A 3AKEA 4BLRA 1W36D 4XSHA 1EGAA 3BOSA 1ZCBA 4Q7KA 3UXMA 5E3HA 4R71A 2Z6VA 3LW7A 1W36C 4HAWA 1EWRA 5JI3E 5CYPA 4A0GA 3VKGA 4M2LA 1PUJA 1R5NA 4OK3A 3BB4A 4D4KA 4G01B 1DAHA 1ZMXA 1QHNA 1N5IA 3QVUA 2EFDB 5J4YA 1U8ZA 1XNJA 1E2MA 4GZLA 3OAAA 1U81A 4TLAA 1II8A 3P4YA 3U2QA 1OH6A 3PV0A 4JYBA 3LY5A 3RS5A 4LY6A 1XJQA 4JBYA 5G41A 5EE1A 3FHTA 4QC2A 1IN8A 2HDNB 4B3GA 5EE0A 3QEJA 4B3BA 3EW9A 4EFLA 3TUZC 2OBNA 1AS0A 1GOTA 2FU5C 4KYIB 2DFKB 3KB1A 1XCGB 3PQCA 4E07A 2YWGA 3A1TA 4IEIA 1E9EA 3CBQA 3W8NA 5EXXA 3I4LA 1OFUX 2OXCA 1TAGA 5E95A 4EPVA 2ECKA 5C4MA 3RANA 5JEEA 1E9DA 3VAAA 4DLZA 3T1VA 1XMSA 2JLVA 2EFGA 1KI2A 2ZUDA 1SVMA 1F2TB 2VF8A 2W6IA 2ZE6A 4KU4A 4B43A 1MT0A 3AVYA 4MKIA 5KSPA 1G1MA 2QTVB 4Y0VA 1G3MA 1OKKD 1Z47A 1F6BA 1M34E 3AF3A 4B3CA 1E2JA 3QOFA 2AHOA 4EDHA 4YMTA 5KPDA 1OT3A 1RJ9B 2V1XA 3EWAA 4QJ3A 2HXSA 4W5JA 3A1WA 4GOKA 1TMKA 1S4QA 3VKWA 1L7VC 4HAYA 1CEEA 2ZM5A 1E2LA 3WP1B 4DLXA 3GLGA 2OFXA 1N5JA 2YOGA 4DDVA 1Q3TA 3I5YA 4M1TA 2OG2A 2ATXA 4DEYA 2HJGA 1GTVA 3ECCA 3FYHA 1CIPA 4NZYA 4HATA 4US0R 3RC3A 4A0RA 2BJVA 4C7OA 4LHZA 1OH8A 1Q0UA 2IX3A 3RSOA 3KQKA 4HDOB 4QJ4A 3U3RA 1G41A 1NN0A 4MRVA 1KSGA 3W5JA 1IY1A 2ZIAA 1OB2A 3FHOA 4ESHA 1VKJA 3ZQ6A 1XCPA 2XXAA 4NDZA 2J41A 2JJ2D 2QI9C 4C9BA 3WNBA 3A37A 3OHMA 1C9KA 2ZPTX 1NN3A 2XEXA 3CRVA 1KJZA 2WVJA 2WAYA 1ODFA 1TQ2A 1WDTA 1DAIA 2KSQA 2XZLA 3W3ZB 4B75A 1RRPA 4D2IA 1GDDA 4JLBA 4M9ZA 3CRQA 4PQRA 4EPRA 4N0DA 4JKIA 4IDNA 1FOEB 2HCJB 1NG1A 3AH8A 2VRWA 3KB2A 4JLVA 1Z2AA 1GNRA 4B71A 4A2QA 4IDOA 3THWA 4PHHA 4Q02A 4KJZA 2O8EB 2FE4A 2CBZA 4IOMA 5HCNA 4KCGA 3QXXA 4OJKA 3LO5A 4YMWA 2A78A 1Q1ZA 2B8WA 2VEDA 1XEWY 2A3RA 4KI0A 1MRNA 1MOZA 2BKEA 3AV0B 2XOKD 1ZINA 3I32A 1QHSA 4OQXA 1H65A 2IYYA 1U94A 2WM9B 3FKQA 1E99A 5JECA 3NC1C 4L4UA 1SXJA 1MRSA 2DFTA 1N6NA 1GL7A 4HYYA 4XJXA 4ABYA 3MG9A 1XB2A 5E7JA 2J87A 4KVAA 3U3JA 3IILA 4A4DA 4BFZA 1E96A 3WBKA 3KKPA 4RFSA 1SVLA 2W0SA 2EYQA 2AN9A 2LKCA 3BK7A 3LNCA 4FW9A 4V0MA 3ZDQA 1G3UA 1UJ2A 3QKRB 5J5CA 3VQTA 2ODEA 3T1QA 4G3XA 5L3RA 4DLYA 4DCTA 1E98A 2XNDD 3CPEA 4LHVA 3CRW1 1S1CA 4FD2A 4DSNA 1P9WA 3GPLA 4F4CA 3UG6A 1II9A 4Q48A 1HE8B 1Z6XA 2JAQA 3I5XA 3TR0A 4C0QC 3LDAA 2QPOA 2ZTSA 3GJ7A 2QSYA 3TQCA 4Q19A 2E87A 3PENA 3D31A 3U7EB 1ZJ6A 3PEYA 2FN4A 2G77B 1G291 2Y8EA 4CYMA 1OYWA 4FXPA 1PV4A 1D2NA 3RABA 4QJ5A 1YU9A 2VYFA 3C5CA 1SVIA 4YQFA 5H68A 3KFXA 3RAPR 4EPWA 1ZD9A 2W2XA 4IW3B 4N0EA 2J7PA 3MMPA 2ODWA 3HPQA 4OKSA 2HJVA 2P2LA 1KO7A 3WMFA 2ZVPX 4GMXA 4MDFA 3F5FA 5HZHA 3SFVA 3DZDA 4L16A 1F48A 2BJWA 5B57C 1WF3A 4QKQA 2QU8A 1G8GA 1VCOA 2DYKA 3H86A 3ADCA 1KI7A 2IXFA 2OCYC 3IPYA 1S96A 3QI2A 3NEJA 1T3SA 4Q4JB 2FFQA 2GBLA 2WKPA 5GVRA 3GCGA 3FMPB 3FMIA 3W5IA 5K8LA 2GJSA 4DEXA 3M4YA 1P2TA 2P0EA 3IPXA 2OCAA 1GKYA 1Z6YA 1BYUA 4E22A 5BN5A 1UAAA 2VP5A 2J59A 3GEIA 1W0KA 2VHTA 4JLAA 4A1FA 2E1RA 3N2EA 1S8FA 1G9XA 5CB6A 3RS2A 3NIBA 1G21E 2XGJA 3GJ3A 3FDIA 2NO1A 2GEVA 1NVXQ 3U44A 4IFBA 2IHBA 5J40A 5DLQC 4Q03A 2ZI7A 1R0ZA 2VSOA 2O8CB 3DOFA 2Q9CA 2O8BA 1Z29A 2O0JA 1P9NA 2IYVA 3L8ZA 2WJHA 3LH5A 5CK5A 4DIDA 1OIWA 1P2VA 1VIAA 4YC7A 1XTIA 1JR6A 5JI2E 2RMKA 2HT6A 1ZNWA 1AKEA 2PLFA 2AK2A 4G5OA 5L8VA 1IM2A 1NSTA 1SHKA 3BXZA 4ZDWA 1R7RA 3U3OA 3THOA 3ADBA 3IBGA 3T35A 1FPMA 4TT3D 1JXOA 2CDNA 2NOAA 4ITRC 4HAZA 4IOJA 4UNPA 2X2EA 4LV5B 4Q00A 3REFA 2D74A 4K81B 1D9ZA 2RHDA 2IK8A 2D2FA 3KQUA 3ZS9A 1NL3A 4EQ6A 4V02A 4QGFA 3OZXA 4RCYA 2UZ3A 4NYIQ 3A4NA 2OFWA 1E2FA 3PXGA 5SZKB 3SHFA 2XSZA 2ZRKA 4D26A 1L4UA 1Z6GA 4AI6A 1PLLA 2DWQA 3Q7PA 1OHHA 1HURA 3KKOA 5CITA 3DHWC 1YR8A 1H8HA 4FI3C 2ZRPA 1CP2A 3K0CA 3KJEA 1IXRC 3RS4A 3QG5A 1ZD1A 4PANA 1TADA 1PZNA 3TSOA 4K8OA 2R8RA 3DEFA 1P2UA 3HYTA 3VR5A 1E1QD 4QGHA 1J7KA 5CDFE 4C2UA 4NTZA 5EQTA 1F2UA 2QUZA 2P3SA 2NQ2C 3ZZUA 3CNLA 2YV5A 1Z6AA 1NI3A 3KKMA 3OIWA 1Y3AA 4RD0A 1H8ED 5FH9A 4LJ4A 4B34A 2WHXA 3WRXC 2JIZA 3TSWA 3T5DA 1W2HA 3VTKA 4V0ME 1KGDA 5LD2B 3VR1A 1YR7A 2C77A 3KTAA 4XVUA 4P0TA 1SZPA 1T5IA 5JSZA 2FMXA 2P5SA 4U00A 3V4RA 3OFNA 4OL0A 3LVRE 5AUOB 1M74A 3A1VA 4LJ9A 1TEXA 4V0OA 1EK0A 2A5JA 2O8FA 1EFHA 4OHWA 3NDBB 2ONKA 3VHXA 121PA 4OK5A 3SJBA 3PUVA 3AVXA 3UKDA 1XZQA 2O0KA 3SZRA 2ZE5A 5KHOC 5JHHB 2VHQA 4KVGA 1S2MA 1XP8A 4GZMA 4LJ5A 1UEIA 1JPJA 5FTLA 1GL9B 2SHKA 3QKTA 5A5GA 2W58A 1JALA 4QGAA 4OHXA 2ZS8A 5AJWA 3ZS8A 2G3YA 2REOA 2C99A 1GSIA 1KDRA 3NG1A 3W9YA 4PPFA 5BW8A 1AS3A 1DPFA 4ON9A 4QM7A 4M1MA 2AD1A 2FF7A 3CIOA 1R0YA 4XOIA 1OFHA 4RD2A 2G9NA 4TMZA 4RVCA 4MA4A 2YWFA 4HUTA 1N6OA 1U0LA 1FQKA 4D4MA 3PCRB 2P67A 2QNRA 2BCJQ 5BXQC 3CH5A 2FFBA 4FMDB 1NKSA 1EFTA 1FX0A 1QBKC 1XEXA 3FPAA 1Z0AA 1E9BA 2Q9BA 4HEJA 1RE0A 5CM9C 1ZP6A 1D5CA 5TV2A 1J8MF 4Q9KA 3RS7A 1HV8A 3HYRA 1UDXA 3ZVMA 2NTYC 4XD7A 1W46A 3NKVA 4PPNA 5HKKD 1XD2A 1E2QA 4HAUA 2XJ9A 4RD3A 1W7AA 1P72A 1G17A 1N5KA 1G4UR 2F3RA 5FUXA 3V00A 2H92A 3ZH9B 1OB5A 1OJLA 3LQRA 1RRGA 4DSUA 1PLJA 1TF7A 3AUYA 2IL1A 4HB3A 5CJ2A 1XBTA 1W5TA 1KZGB 2PJZA 2RGCA 5C4GB 4URXR 3THWB 4RKEA 2F7SA 3W3AA 1M7HA 4DUGD 5IT5A 5FPHA 1S1MA 4TLDA 4A0HA 2V4ZA 3CRMA 4NKRA 3SR0A 3QJYA 1TU3A 5F9HA 3QF4A 4TYWA 1RRFA 4M9QA 4XSGA 1X1SA 3TSZA 1XXHE 2O8FB 3NWJA 4CT4B 1M2OB 1U9IC 4BFYA 2FH5B 1G8YA 1GRNA 1O3YA 1OE0A 3DOEA 1KK3A 1EFCA 4DKXA 2ZRHA 3R8FA 2XNDA 1WB9A 1IOZA 5A0FA 2HXYA 3L0SA 4HLDA 4R98A 2WWYA 1US8A 1YQTA 4OI0A 5L3SA 1NRJB 1DARA 1NF3A 2VBCA 1LS6A 3GJ6A 3IHWA 3SJCA 4C7OB 2XZPA 1XTSA 1KTVA 3AGPA 5FBRB 4JBXA 3Q5DA 3U6BA 5G3YA 5JEDA 2BHRA 1CU1A 1YZGA 3DVLA 5H70A 1M7BA 4DIEA 2F6RA 2D7DA 1YZLA 2EVWX 2EFHB 2ZITA 4CEIA 4LI0A 2ZS7A 3MD0A 1EFUA 2Q21A 3WNDA 3ZYCA 2CE2X 1ZBDA 2ZSDA 5DYIA 4B3DA 1H8EA 4L9SA 4C0LA 5KDLA 4LBVA 4CF7A 2KE5A 4IXNA 3RRMA 4BLSA 4RKFA 4OHYA 2WZQA 2QA5A 1RJ9A 4IFEA 3UIEA 2VHCA 2C5LA 1MKYA 2VP2A 2CK3A 4DLRA 1CJKC 2CMKA 1KI9A 3KKNA 3CW2A 4JL6A 2GETA 1VCNA 1L8QA 2IYLD 4O25A 4C0BA 1UBGA 4AG6A 5JZVA 2N46A 3UG7A 4XWAA 2YYZA 2UVQA 4WVFA 4QG7A 3CR7A 2GXAA 4CEIB 4JSYA 4MITA 4Q7JB 4TTQA 3K70B 3HDTA 5JHGB 4URWR 1MO3A 2FPLA 3AVUA 1X1RA 2IA5A 3G0HA 2O0HA 5C46F 5CLQA 1QVRA 3NH9A 1XDBA 3KJGA 3B13B 4M22A 3U7GA 3B1VA 1XTQA 3GJ4A 3P4XA 1E9RA 2BCGY 4GSYA 2C95A 3TR5A 2OCPA 5JJLA 4OJQA 1BOFA 2ZRBA 4L8GA 3X2SA 1DAKA 1E0JA 4H1VA 2RGAA 3NBFA 3U7FB 2ZANA 3EPJA 5BN4A 2R9VA 2EQBA 3RVBA 5JS8A 1F3OA 3O8DA 5C18A 4LBYA 4AKGA 2OILA 4NHOA 1II8B 5FL7D 4BLPA 2REBA 3SNHA 4A82A 1G7CA 2FFHA 3H4MA 4DCSA 3U44B 1Q20A 2WWIA 1JR3D 1AJEA 3QF4B 2FWRA 1XXHB 2J7KA 4O2RA 1TEVA 1C4OA 4LZZA 4HZUA 4C2TA 2DPXA 1AS2A 3NXSA 4KSCA 1VMAA 3RWOA 4B35A 4DDTA 2RHMA 5F98A 1OXSC 1AGRA 4I1VA 4F4JA 3UWOA 4DCUA 3RHFA 1OW3B 5EUQB 4BPBA 1DELA 5CDFA 3ND8A 3SOPA 3O8CA 5FI0B 3PR1A 2CHQA 2WWXA 1E2DA 1GRRA 3C15C 2JLWA 2RCNA 1R6BX 3AGQA 3LQQA 1K5GA 1HH4A 3W6PA 4CW7A 1NBMA 5DHFA 3TMKA 1IN4A 5GJCA 1SXJD 2W6ID 1DADA 2ZR9A 1U99A 2WPDA 1S0UA 3U3KA 2HV8A 3RRYA 3CX8A 1SVOA 1GNQA 2OE2A 3QF7A 1X8JA 4RD1A 1HA3A 1IY2A 2AL7A 4I1OA 3LXRA 4P31A 1T6NA 3E70C 1U0HC 3CZPA 3I72A 4EJSB 2FV8A 5EE9A 1LF5A 3ZJYA 1W4BA 4TLBA 4JT2A 4URUR 2YC2C 1Z0IA 2QORA 2GVZC 4NONA 4M1KA 2GCNA 3OIUA 5HR5A 4BZQA 2G83A 1E3MA 4HB2A 821PA 3T34A 3ZLJA 3B1XA 4NCKA 1G7SA 3CZQA 3TW8B 1H8HD 4BASA 4UNQA 4BECA 5TB5A 2ZQ5A 1HE1C 2J7PD 5FPSA 1UEJA 2GXSA 1P73A 1J70A 2ZS9A 4GPTA 2NO9A 2VA8A 1X86B 5KOYA 4ARZB 4DB2A 1Q1EA 2QN6A 3X1WA 4QRHA 4C0HA 2AX4A 1IN6A 3QPVA 2DFLA 1FNMA 1W49A 4HSEA 3FFBA 1XMJA 3WYGA 2OEPA 2A9KA 1X6VA 3N5CA 5AUNB 1ZM4A 3CKLA 1CRPA 4AY2A 1I2MA 4NYJQ 5SZHB 1E79D 4LJAA 1DO2A 4HLQB 3R8CA 3VU9B 4JVLA 4A2PA 3PEUA 2GCPA 2G1JA 5AR1A 3HU2A 2FZ4A 2DBYA 5LPNA 4C3ZA 1F5NA 4TYYA 4TWZA 3IGFA 4P4SB 4AC9A 2GNOA 2WOOA 4EFMA 3X1DA 3VR2A 1Y63A 3R9XA 1FTSA 3LXXA 2BEKA 4MKHA 1YR9A 1ZVQA 4B32A 4NL4H 5EZ5A 3VMFA 3E1SA 1LFDB 2IYXA 2WAXA 2Z5FA 5E7IA 1XF9A 1OYYA 2A5GA 3PUZA 4WZ6A 1XRJA 4R2IA 5FTJA 4YMUA 3AKDA 4MRPA 2IYSA 3GD7A 5CK4A 1OFTA 5KUTA 1UM8A 1IN5A 3EIEA 4PZZA 4M1WA 2QZ4A 3A58B 3W6OA 2PEZA 4LWZA 5K8UA 3A1UA 2CXXA 4H9GA 4O3MA 5KNCA 4LJYA 2ZAMA 2C2HA 2FPKA 4GFDA 1VYUA 1LTQA 3CRRA 1R10A 1JI0A 1COWA 4IDHA 1E1RD 1T0HB 3Q9LA 2A30A 2OV2A 1HY3A 2PMKA 2Q3FA 4V0KA 1MO4A 1R0WA 1TL7C 2REXB 2IC5A 5ELXA 2QAJA 2XITA 1OPXA 4RZ2A 3QBTA 4NYIR 2KBFA 3MJHA 4XVRA 2BBTA 1OSNA 2GZHA 2CJWA 4OQFA 1Z08A 1E4YA 4NCJA 2V55B 5JCPA 1OIXA 2IXEA 2V7QD 2PCJA 1SKQA 1MO6A 1G8PA 5KSOA 1XCMA 2IEZA 1NIPA 4MUAA 4C0AC 2V6IA 2BM1A 1IXSB 2W6JA 3QXJA 4YXWD 5JMTA 4MYCA 2XTMA 5EXPA 3KQLA 3ADKA 1CLUA 4A15A 3LFUA 3ZVRA 1G19A 2CVHA 2PL3A 5DNYB 2RGNA 1N6PA 2ODBA 1G7TA 2O8BB 2DY1A 3GLGB 1LF0A 5IK2D 1KO8A 2YC4C 2V9PA 3ZVLA 1ZNZA 2WTUA 1E0KA 4Q1FA 5J4LA 1ANKA 4LJ8A 2CLCX 3ONWA 3TE6A 2YHSA 1VTKA 3L0PA 4HI0E 3WY9A 1D9XA 4WA7A 5KNBA 2QP3A 5F9FA 3AF4A 2OXRA 5IK2A 4V0LA 1GFIA 3B1ZA 1KO5A 1LW7A 3GQBA 4DXAA 3LBNA 3FB4A 4A8JB 4OHVA 4AURA 1SHZA 3AF1A 1R5BA 3ZIAA 1ZIPA 1OKKA 2Q0HA 4TTPA 1XTRA 2XB2A 4FWTA 2RKOA 4KBFA 1OH5A 2DB3A 3Q7QA 4JJZA 3CLVA 1FNNA 4GMDA 4NPHA 4LUCA 3ZGXA 5KU1A 4PAMA 5FUWA 3I92A 2V7QA 3DO6A 1G5PA 1U90A 1JECA 2YJTD 3WP0A 1CJVC 3C4JA 3KZ1E 1W1WA 1U9IA 3Q85A 3VHLB 3FMFA 1Z0DA 2ZJYA 1CXZA 4PSKA 1VYVA 4LPSA 4UQOA 4PZYA 2PJRA 3THXB 5EE5B 3QXHA 2VHUA 1QZXA 1TUIA 1VG0B 2HF9A 5HCIA 5L3QB 3A4MA 4KFSA 2HLDD 4A9AA 2B7BA 1YZTA 2QQEA 3AEZA 3SC3A 1JEEA 4HB4A 5FPYA 2AR7A 2WKQA 4L15A 4Q7LA 1XD8A 4EPYA 3RS3A 2FFAA 4C0KA 3DKVA 1G7RA 1CF4A 2HYIC 1T91A 3TUIC 1NP6A 1VDZA 2GJAA 3G82C 1P2SA 1Q3HA 3QKSA 1Q1QA 3B78A 4FMCF 6Q21A 4R9UC 1SQ5A 3GLIB 2JLYA 1YZUA 3CM0A 1FFHA 4QBFA 1J8YF 3K0AA 3OEHD 4D82A 4Q47A 3QKRA 4Z51A 1PLKA 5LD2C 2JJ8A 1NMYA 5D3MA 5K8IA 2F1JA 1DO0A 1SXJC 2OAQ1 1AM4D 2CHVA 1Z2CA 5JRZA 5TY0A 1A7JA 4FCVA 2RB4A 3EZFA 2DWPA 3K0SA 5EXTA 4TQUS 2NG1A 4ZIRB 1V43A 1KMHB 1JQJC 4B6EA 1MABB 3ICQB 4EIWA 3U4QA 5AWFC 1GIAA 4HAVA 4TQ9A 3EZ2A 1AQUA 1Z8FA 1W4CA 2R6AA 3CWZA 2I3BA 4NBSA 4TMVA 4X8HA 3AQ4A 1O87A 3GLFB 1D8TA 4A6PA 1N5LA 5FOVA 3OF5A 4PPQA 1SULA 1Q44A 1N3BA 2I4IA 1GM5A 4ERNA 4DCVA 3K0FA 2IEYA 2PT5A 421PA 1E9CA 3KFVA 4M9SA 1XD9A 1T8UA 3EA5A 1QHXA 4XVQA 3SYKA 4LCBA 4QNMA 2J0UB 1XEWX 4JJKA 5AJZA 4A2WA 1A4RA 4LV8B 521PA 2WIBA 4G5GA 3JZMA 2EFCB 1S9DA 3DMNA 1NN5A 1KOFA 4URVR 3BORA 3CX7A 4AKIA 1GWNA 2X19A 4KFRA 3ZD6A 3HPRA 2FDCA 3SBEA 3V4FA 1ZNYA 2PX0A 3A36A 4FIDA 4KYUA 4ACAA 1WRBA 4HDQB 5D3MB 1UPTA 5IRCD 3BH6A 1NY6A 2OM2A 4UJ5A 4UNRA 4PC2A 3K0EA 4JLNA 1W0JD 2OT3B 1F60A 3RLFA 4A8JA 3I1FA 2IS1A 1FUKA 3WBJA 4MH0R 3THYB 1ZUIA 3K53A 4N3NA 3OAAD 1CRQA 4FCWA 1KI1A 2JLQA 2ANBA 5EE3A 4IXMA 3ZIAD 1EXMA 1OXUA 2FOLA 2K5UA 1YZKA 3MUFA 4DLWA 4NH0A 1KK1A 1AN0A 2ORWA 2C78A 4M21A 4PQYA 2V3CC 1TUEA 1KJYA 3Q3JB 1KDTA 4TLCA 2V1UA 4PC7A 5JWOA 2CLDX 4FMDF 4GOXA 3MAAC 1JJVA 4RCZA 1G20E 4PHGA 2ZRNA 5UKDA 4MKGA 3RDPA 1Z83A 2HF8A 5TARA 1DTSA 2I1VB 4AYXA 1KYIA 1JR3A 2Q3MA 2ZE7A 4Q18A 2CVFA 3B1WA 4QHSA 8OHMA 3EXAA 2YNMA 1TQ4A 5FL7A 2CL0X 3PITA 3TNFA 4HLUC 4OBEA 3THYA 2WWWA 2A2ZA 4LGMA 5LB2A 4Z54A 3I3SR 4FCTA 4YMSA 2WMOB 1KY3A 3QXCA 1NLZA 2AKAB 3KJHA 1GRQA 4OQNA 3ZQJA 5EXSA 2ZJBA 2W6JD 5EP2A 2ZXUA 4R7ZA 4TMXA 1J99A 4OYHA 3KKQA 4OQMA 4D0NA 3K09A 1EX6A 2FZLA 3T06B 2O5VA 2CCGA 3OE7A 4B73A 3CNNA 1KSHA 2UZIR 4JLOA 5B2ZA 3TQFA 3T12A 1T4GA 4JVSB 3K70C 2OSBA 1K8RA 3K9LA 4LJ7A 4UJ3A 2IWHA 1DG3A 5DISB 3MCAA 1AKYA 2JEOA 4R2HA 3KJIA 1YHNA 2J0UA 1ZC3A 3AP3A 4EKDA 3BH7A 2D2EA 2GF0A 5KPJA 2Z83A 1KK2A 4LK2A 1JJ7A 2IXGA 1ZIOA 5M04A 1CJMA 4NYJR 1UKZA 3E5HA 5L3VA 2GRJA 1G5TA 4TMKA 1KIMA 1G16A 4BLTA 1P3JA 2H18A 4B6FA 2RGXA 5DN6A 1E2IA 2PLRA 2XZOA 1VYTA 4TSFD 1FUUA 5SZIA 2OLJA 1BKDR 3I8SA 4NYMR 5GJVC 5LB4A 4U7DA 1KI6A 4W5HA 1JR3E 3CR8A 1R8SA 2WJVA 4ASUA 1EFRA 3JVVA 3PG5A 2J0VA 2FG5A 3P27A 4D0GA 3AVWA 2RAPA 2WJGA 4JL5A 3OEEA 2CNWD 4ESVA 1Z6TA 1XPUA 4RSGA 4F7WA 5EP1A 3QKUA 1OXVA 1A2BA 2QAGC 2WJIA 3U6KA 2F43B 2W2TA 1W2GA 2QSZA 3K0AB 3KX2A 3M6AA 3GLIA 1BH2A 1SXJE 4P33A 4IHQA 4B2LA 4W7SA 2X1VA 3QKSB 3B85A 4PX9A 4DHEA 3Q8XB 5BYKA 1WBBA 3Q5EA 3VNVA 4A6XA 3KUCA 1TU4A 4KHZA 3GLHA 1CKEA 2BKUA 3PUWA 5BYJA 3A4LA 2QM8A 4KLNA 3QY0A 4TL8A 4OI1A 1GKIA 1E2HA 1G3IA 1KI3A 4PQFA 2C8VA 3WMEA 3CNOA 2QE7A 4Q1BA 1JBKA 2ZSEA 1LVGA 2RGGA 2ZR7A 1NVUQ 5FPKA 3A6PC 1VG9B 1CR4A 3RRZA 4PC6A 1YKSA 2J45A 2QROA 3BFVA 2A7QA 2FX3A 2J3EA 3EZ6A 4EJSA 1VCMA 1ZM3A 4ZIRA 3BH0A 3RNLA 4JYCA 5HKKA 1WMSA 2QPAA 3SDZA 1WP9A 3SS8A 1S3GA 4Q4LA 1W36B 3WYFA 1CJUC 1OFIA 2B21A 1ZRHA 5FR1A 2HYDA 4YDHB 1W48A 1YRBA 5FUVA 2MSDB 3S1AB 2ZRIA 2FA9A 5TVKA 2N1BA 1Z07A 4TSFA 1OF1A 4URZR 5GADl 2R6GA 3K09C 1IY0A 4ZKDA 2AXPA 1XX6A 2HT1A 4PHFA 3P26A 1MO5A 4NCHA 1VIYA 2C96A 3AVPA 3GLIE 3EPKA 4ARZA 4LHXA 3ZD7A 1SGWA 2ZUCA 4V0NA 4CEHB 2BBOA 4P3YA 2ANCA 1IAQA 1RIFA 2RGBA 4RD6A 2NGRA 3EZ7A 2OHFA 2GBLC 1ZC4A 2G6BA 3X1ZA 2ZI6A 2XJ4A 2YWHA 1KAGA 2VPPA 1CS4C 2JATA 1YE8A 2QMUA 1P60A 2GVDC 2V54A 3SU8A 2B6HA 1GG2A 2R44A 3BD9A 2IS4A 2MSEB 4UXJA 1DEKA 2KWIA 3DL0A 2XX3A 3IIMA 2QQ0A 1SKYE 4WIAA 5CIQA 1CULC 2BDTA 5KDOA 1LS1A 4MYHA 2ZAOA 3CB4A 5CM8B 4OI2A 4Q5IA 2JA1A 5JBQA 5G40A 3EC2A 2CJWB 2VSFA 2QT0A 2D3WA 2J1LA 3C5HA 4O2LA 4ZV4A 1DVRA 2ZJAA 2EWWA 1SVSA 3MJRA 2QAGA 4PFSA 3AVOA 1ETUA 2Z4SA 4RY2A 2F3TA 4GP6A 4DT1B 1G8FA 2ERYA 3U5ZB 2WJYA 3HJNA 4B76A 5E4FA 3GEEA 2GJ8A 2F9LA 4E5UA 1KJWA 2VH5R 2EYUA 4LHWA 4OHZA 1XXHA 5J4VA 1WA5A 3GEHA 1KDPA 3PEWA 2VLIA 4YXWA 5JFGA 1E32A 1GITA 2ZYTX 3KL4A 3UANA 2ASEA 2BOVA 2QRNA 1EWQA 4JZKA 5EP4A 1MV5A 1WQ1R 3MRSA 1OHHD 4U02A 2J0QA 4PSVA 1KY2A 621PA 1E9AA 4W9MC 4GP7A 1ZW6A 2NIPA 3OESA 1FMLA 4JLMA 3AUXA 1D2EA 1KSFX 3EA0A 4BFUA 3EIHA 1OXTA 3L82B 4LC0A 1UADA 4MKFA 5FTNA 1XPOA 3QPWA 3GJ5A 1U2RA 1NY5A 1WXQA 4Q4AB 3KXLA 1ESNA 4P4SA 4TTRA 5G3ZA 5L3SB 1US8B 1CR2A 4M1OA 1W47A 1E1RA 1KHTA 4KBGA 3ADDA 2VP9A 2Q3HA 2VL7A 4X8MA 1E9FA 4CEJB 4PAQA 2ZU6A 4MQBA 4WXRA 3GLGE 4F92B 2WJJA 4LRWA 1QHIA 1XMIA 1QG4A 3AVQA 1JQLB 1OH7A 4PC3A 3B6EA 1FTNA 1Z3IX 4DLUA 4BFSA 2ODNA 4A92A 2ZRDA 2V8OA 2LCFA 1G5RA 3RYTC 1DS6A 2GKSA 3C7KA 2ZI9A 1I4DD 1N6RA 2ZJ2A 3RSLA 5KO2A 3X1XA 1KO1A 2QGNA 1I2DA 1KKMA 4M9XA 2PZGA 2IYTA 2BV3A 2GILA 1ZAKA 3MFYA 4J0QA 4P32A 4W5WA 1ESMA 3LD9A 2QM7A 4FWIB 1YRAA 3C16C 3QXSA 4LBWA 2P6RA 1NKTA 4MGKR 2IHYA 3WHLA 1IBRA 1XD2B 1RW4A 5FTKA 1P5ZB 1T5LA 2JLZA 2NPIA 4AKEA 4GI7A 2F55A 1PVOA 4DWJA 4F38A 5J47A 2QTHA 1XEXB 1TQ6A 1E79A 3MWKA 4LBZA 4XD7D 4UKDA 4PTLA 1Q57A 4BEBA 4DC9A 4I81A 3LX5A 3O47A 2VP6A 5BN3A 2IBMA 1E2EA 2VHJA 2I1QA 4RZUA 5ANRB 4WZBE 4ZI3A 3L0OA 3J81k 3PIRA 1HYQA 3ZVNA 1AQYA 4OI4A 4BFWA 4H1UA 3H1TA 4M4SA 3TJZA 1NJFA 1KSJA 4P4UA 3TRFA 1R2QA 2BMEA 2H16A 3EIQA 2AFIE 3R7WA 4BE7B 3AP1A 4YDSA 4HZUB 4LDJA 2Q9AA 3UATA 4II7A 4BFTA 2WSMA 5TXGA 4GBMA 4KFUA 4TZ6A 4HUQA 4TMWA 2AWOA 5EZ6B 1I4TD 3N70A 4KODA 3O8RA 1DBSA 1QHHA 1WE2A 1Z5ZA 3DKPA 1KI4A 4MYTA 3VX3A 1LB1B 2ZRMA 4C30A 2BMDA 2WPDD 1NNEA 2QG6A 1QG2A 4K46A 3EPHA 2WV9A 1R4AA 4BFVA 1NBMD 3CF2A 3ASZA 4TL6A 3KQHA 2KI5A 3KTAB 3SE0A 3VFDA 5E7MA 1FX0B 3PFIA 3M0EA 4AWXA 4Z1MD 4G5QA 4A36A 2QGZA 4JLKA 4JVMA 4QFMA 4BRWA 3I61A 2ZI3A 1FW6A 1N6LA 4Z1MA 3U60B 4DCNA 4Q9LA 1N0UA 4GL2A 5AJVB 1Z0JA 3AKCA 4EFNA 3F3YA 5CYOA 4PC1A 1YZNA 4DVGA 2CL6X 4IDQA 1Z06A 4F4IA 2JIZD 4LX0A 4KXFB 4IVRA 2C9OA 3KUDA 2ZSFA 4ZO4A 1G3QA 5FBQB 2JJ1A 2QMOA 2PCLA 3BS4A 3ND9A 2WKRA 3MWYW 3GJ8A 4C0JA 2AWNA 4DB4A 2JLSA 1KI8A 1TPZA 2PX3A 2LKDA 1E1QA 3BB1A 2NMVA 1K5DA 1NVVQ 2QMHA 3PJRA 1RRCA 4B2PA 1LY1A 1JXMA 3D7MA 4L5BA 1DG1G 2WICA 3QE0A 1VHLA 3A8TA 3B7GA 5KSYA 1RYFA 2IYWA 2W83A 3B82A 4JKYA 3U3MA 2XSZD 2XTZA 4DLSA 4QGGA 3NHBA 1N25A 2AKYA 4Z8YA 1IQPA 3SJAA 2YKGA 2WSSD 2R62A 5DI3A 3DM5A 5IF9A 5AJYA 5B58C 2CL7X 4QHTA 3K9GA 4O0MA 5KTYA 5H1YA 5J4KA 1COWD 1RYHA 2QMEA 5FBVB 4FMCB 1Z22A 1FL9A 4QNRA 2CK3D 2GA8A 4DLTA 1HUQA 3MWLA 3B8HA 2O8CA 4XH9B 2VIIA 3TLXA 1GZSA 3UMRA 3R9WA 1M8PA 4ZCIA 1EG7A 2EFEB 4BQSA 3FWYA 3CPHA 3NH6A 4IEEA 2RGNC 2ZRJA 3DPUA 5DE3A 1N2CE 4A0FA 1D2MA 2FPMA 1C1YA 2ZJOA 1MH1A 2AFHE 3T61A 1RPZA 3FGNA 4Q66C 2C98A 2FSGA 2NO6A 3BFKA 4IRUB 2ZEJA 3QPUA 2ZRAA 4A8JC 5JCZA 2NO7A 4CRWB 2H17A 5FOUA 1P7CA 3IEUA 5FOTA 1E9SA 2OFOA 1TNDA 3BB3A 2R65A 4Q4JA 5FUYA 3QBVA 4AYTA 2R6DA 2DHRA 4S2EA 3IIKA 3B5JA 221PA 1XZPA 1ZD8A 1XMVA 2P65A 1P61B 2IF0A 3L8YA 2C9YA 1KZ7B 3DZ8A 4CVNA 4X8LA 1G8HA 1RZ3A 3KQNA 3NBZC 2ONJA 4CDGA 1L4YA 2QEQA 5J4HA 5FOXA 3I73A 1G18A 1ZCAA 2B8TA 1NIJA 5DH9A 3EZ9A 1DE0A 4NP6A 2MMGA 1AK2A 3EAQA 2JDIA 2C04A 4RJLA 2F1IA 5CB8A 1U8YA 3HP1A 3KXIA 1NN1A 4EAQA 3BAFA 4DUGA 4HLUA 2IUUA 5A4JA 3CONA 4IVPA 4LYFA 1S9HA 4WW0A 1Q21A 3FHCB 2H8KA 5KYKA 1W4AA 2R6CA 1G64A 2QTFA 2D4HA 4CGZA 3M1IA 3PUYA 3W34A 1JAHA 1N6KA 2GEUA 1GP2A 3NEYA 1AIPA 2FJUA 4RZXA 4KSBA 2BEJA 2GDJA 4B74A 4DDUA 4KLZA 4KITB 3WRYC 1W5SA 2BMFA 2JDID 4B48A 2EWVA 4DZZA 4DDWA 3OIYA 4ZKEA 3LV8A 3B9PA 1N6IA 2ZRGA 4KFTA 3L43A 3S1AA 4Q7MB 2F1RA 5F3WB 3LX8A 3PUXA 3VX4A 4YMVA 1G6OA 4RFSB 3RWMB 2Q6TA 4D6PA 3B60A 5B64A 4MGYR 4NMMA 4D80A 2IS6A 4I1SA 5JSZB 2YOHA 1ZM9A 3GFTA 4PSAA 2DFNA 1SXJB 2GZAA 1JB1A 2TMKA 1XU4A 2JLRA 1II0A 1GILA 4JLPA 4KAXA 5EUMA 1XJ0A 4MRRA 4PPGA 2ZRLA 1RC8A 2VP4A 3EC1A 3F8TA 3T5GA 1QHHB 4QBHA 2X2FA 3CUEF 3FE2A 1NBME 2BWJA 3IO3A 2RGDA 3T15A 1JNYA 2IT1A 2XTNA 1QF9A 2A5FA 2H5EA 4HUQB 3NHAA 4PO8A 2Z43A 1WBDA 4LSGA 2VO1A 3BGWA 4WXPA 2BC9A 3GLHB 1YZQA 3U61B 3BE4A 4TQAA 3LBIA 3H0KA 4B2IA 1U8AA 3D6TB 1DAGA 5LDDC 5D3QA 1M6NA 2NZ8A 5HPYB 3AM1A 1T3LA 2GTPA 3SN6A 3H2YA 4Q1EA 4TYPA 5FFMA 1G6HA 4I1UA 2FSHA 1N0WA 4URYR 2GK7A 4EPTA 5FBLB 1E4VA 5GJWC 3UPUA 4D0LB 2EU8A 2WSSA 2ZRCA 1NLYA 3K8YA 1N0VC 4Q1CA 2EW1A 2RGEA 1M7GA 1FP6A 4EQ6B 2VF7A 1CJTC 2BM0A 2YZ2A 2J5XA 2HEIA 1XFAA 5DSZA 2FSFA 1DOAA 2DWOA 3AKYA 1BYIA 1VCIA 4Q4AA 1A5TA 2G0NA 1BS1A 4AYWA 3TBKA 1XWIA 4UXIA 2H57A 1XEFA 1BMFA 3A1SA 4ZCLA 2ZYVX 4LHYA 1KNQA 3I8XA 4JLJA 1TQDA 4CZ2A 2NZJA 3DMDA 5SZJA 5BWMA 1GAJA 5EP3A 1QVAA 1F2UB 3NC0C 4D81A 1QRAA 5AJXA 2ZR0A 1NVWQ 4EJSC 1MR3F 2Z4RA 4Q1AA 3CO5A 2J46A 2JLXA 2X77A 1UDWA 2A5DA 5FPTA 4DBLC 2JJ1D 4S35A 3WHKA 2QT1A 2KB0A 1XTKA 2FSIA 3QEOA 4ZDKA 2PMDA 3TAHA 1E0AA 1XPRA 721PA 1P6XA 3K70D 1A1VA 3VNUA 1IJFA 3TVDA 2GJKA 3GJXC 4B3FX 3IKJA 2XAUA 1DAFA 1WCV1 1SVKA 1UKVY 3LLUA 4DT1A 4AKHA 4AD8A 3BC1A 2QAGB 4CEJA 3VR3A 4F93B 3FTQA 3IQXA 3AVVA 1UF9A 3BFXA 4DSTA 2OLKA 4QOSA 5FL3A 1TF2A 5LBIA 5K8TA 1ZUHA 2XXAB 5FOSA 4JMPA 3AF0A 4ZDIA 2J0SA 1ZU5A 4TYQA 5P21A 3FKSA 3G5UA 4FN5A 1FZQA 5GJBA 4DSOA 2PT7A 4GNKA 5DI3B 4IOLA 1P75A 2ZROA 1EX7A 1I4LD 3C14C 1LV7A 2PBRA 3MWJA 1CR1A 2OBLA 2ZETA 2ZYUX 4TMTA 3L0IB 3SYLA 1D6JA 4BZPA 3CWQA 2WWHA 4I99A 1L2TA 5FR2A 2IF2A 1ZM2A 3F0TA 5JJKA 2QL6A 4TN1A 1QHYA 3TKLA 1EFRD 4PO1A 3NBXX 5HZKA 1XTJA 4UXHA 3HU3A 5AUPB 3UMSA 3K0CC 3EPLA 1NMXA 5DN6D 4GT1A 2YVUA 2J9RA 1UFQA 1KKLA 4XIGS 1U0JA 1BIFA 1KDOA 2CEAA 3JZAA 4CEHA 1Z0FA 3I62A 1S3SA 2IUTA 2BVNA 3DDCA 4N1AA 1NMZA 1RFLA 4ACBA 2GWHA 5DHAA 4D4LA 3IBYA 1P9RA 4QHYA 2Z0MA 2QP9X 3CH4B 1UBCA 2P6NA 4RZ3A 2JLUA 3TGPA 5HTKA 1G3RA 3SYNA 4IKEA 3MSXA 2RH5A 2PZEA 1JAIA 1AZSC 3HR8A 4P4TA 4LC1A 3W8RA 3X1YA 3LA6A 1HT2E 1HQCA 4Q9HA 3C8UA 1E94E 2UKDA 2YINC 3PVSA 1VG1A 2JASA 3JVUA 3SEAA 5BQ5A 5KNDA 3P32A 1ZNXA 4M1YA 4M53A 2OCBA 4QBGB 4WOPA 4E09A 3FOZA 4POAA 3IHLA 4OK6A 5FBWB 3UK6A 1OV4A 1ONBA 4MUBA 2ZJZA 4TLEA 2FNAA 4FINA 3TAUA 3RRNA 2GZDA 1E2KA 2H7VA 2GESA 1A82A 5IDVA 1W44A 2BBWA 4V03A 3Q72A 1QDEA 1VG8A 4OQLA 5AK0A 2ZREA 1PJRA 4I4LA 3K0FB 3HR7A 3BIFA 3LVQE 1ZM7A 4FMBB 2O8EA 3R7WB 3NTUA 1OLOA 5JWRA 2VP0A 3C41J 2KJQA 1ZUNB 4JS0A 3SI7A 4QBIA 4TYNA 3QUSA 2WWGA 4AIIA 1UBFA 2B7CA 2BMJA
chains in the Genus database with same CATH superfamily
3FD8A 4J90A 5ES3A 3ZZ1A 2G0TA 3RIYA 2A1UA 2FEMA 1Q12A 3P2EA 1E0SA 4KO2S 4GQBA 3SF0A 1ES9A 3TH5A 4DV5B 4YRIA 4UHEA 1EFPA 3ADOA 4TL9A 3LHIA 1OI3A 2HU7A 3WQBA 1U4OA 1KPGA 1NUQA 4US2R 1Y0BA 2JA2A 3QENA 5E1BA 3WTBA 2VHWA 3IQDB 3CF6R 3P0RA 2C9BA 2O2SA 2PZFA 4TN5A 1B42A 1YCGA 3OMXA 1QB7A 4HGNA 5C53B 1E7YA 2VQSA 1KI6B 1PJLA 2YN0A 5D85A 2VRBA 3O9MA 2PO7A 2ZU0C 1HNNA 3M1LA 1TC1A 2A0YA 4PO3X 3R7FA 3EVFA 2D0PB 5CVDA 4CM8B 3MHTA 1XA4A 1QJ4A 2IPLA 3H65A 1N1MA 3TSAA 2QN1A 2V5UA 3TTVA 1VLJA 1EESA 3IB3A 1KZ1A 4X9XA 3K0HA 5HK8A 2IUFA 5B2FA 5E2BA 5AI4A 3R3UA 3MFQA 1GRVA 1NMEA 1BWRA 2VR1A 3A25A 5BSVA 3PEVA 1RI4A 2MYPA 2Q1XA 4KQMA 4ZHSA 1QRTA 1NQUA 3K1JA 4KO3S 3OPVA 4LVOA 4BMOB 4ENRA 2W0MA 2HA5A 2AJLI 3UW1A 3L8GA 5IG2A 1UFKA 5LC1A 1GL6A 7GPBA 1KWGA 2QYTA 3ORRA 4RSHA 5ADVA 1C9EA 2O2DA 4BC0A 1Q1BA 2GN6A 4ZT5A 5C52B 3FJ1A 2QN3A 3I83A 3PNOA 1U1EA 4K2AA 4NBRA 2O50A 5H3HA 1Z17A 3LQFA 3OT1B 5JS7A 2H4WA 2D0OB 3FWZA 4L0DA 1O89A 5E3JA 2FQXA 3TLGB 3S8YA 1AU9A 3G7NA 3HVUA 1RVDA 5K20A 1GPUA 1P4AA 2CN1A 2XZDA 5DBHX 2WUVA 4Q12A 4RF4A 1DINA 1U2DA 4RIIA 5CIWA 5DM70 3NMUF 3FF4A 3GHHA 1T3HA 1IJEA 2A57A 4JOSA 3TR6A 5B30A 5M2QA 2AC2A 3IKMB 5T4FA 3B1YA 1V11B 4RSMA 4EUNA 5BV7A 2H31A 3B3GA 2IU0A 2COEA 1AHNA 5AUQA 5T64A 2CZCA 4TVBA 4M1SA 3UWPA 2J0EA 1TIPA 1ZXBA 4MPRA 2M32A 4OAPA 2NPFA 1K2WA 3FJYA 2IW3A 3MJVA 4D44A 5KIAA 3FMOB 2GK6A 1GNSA 4B4KA 5CXQA 5K05A 2WM8A 2YZGA 3BXXA 1PL6A 1QH8B 4BCCA 2F67A 3IT1A 1U7UA 3HH8A 5DI9A 5EERA 2XUQA 1JPNA 2O5RA 4JJGA 2WTBA 3N75A 4WBSA 4LV6A 4M0CA 4Q1DA 4QNNA 3RM3A 5AM1A 3LL7A 2H1LA 4RS4A 5JPIA 4RK1A 2QP4A 4WAUA 1R0LA 2OL4A 5KSZA 3U1TA 4YRZA 5IAAA 3CLUD 3GMTA 1PFVA 2W5UA 4TL7A 5GMOA 3FOEC 2W2MA 1HQYE 3BBPA 3W06A 3WZLA 4DUZB 4GDFA 1OPRA 2P6UA 3VKHA 2C0PA 2P7HA 3BZBA 5M29A 3DG9A 3N76A 1EK1A 1M6YA 3PEEA 2A0XA 4CLOA 4PSDA 1U0EA 1BU8A 1O2DA 4F46A 3IUJA 1OLUB 5HKOA 2NTEA 4IHJB 1NPYA 3WQHA 3UEOA 3UCFA 3U4AA 2QENA 4PZUA 3BE6A 2JIQA 1UKYA 1LLDA 3AF2A 5F2OA 2GJ9A 4DJTA 1EE2A 2VTBB 2VSXA 3FFAA 2PRJA 1NJGA 5G53C 2BBSA 4DLVA 2E4UA 4UNSA 5IAKA 1K98A 3SXUA 4EI8A 2PANA 2AYZA 3SZ3A 2AK3A 1DQSA 4RPGA 3CV3A 1QTRA 4MB0A 2YN2A 2YW9A 3H5VA 3UGJA 5H8WA 1CCWA 4RH1A 4XOUA 3I9NA 3HADA 1RRVA 2X8AA 4OFZA 4MB2A 4UUOA 2C8KA 5CB4F 1TPYA 4YJHA 4TUYF 3QYJA 3AR8A 3WA6A 1B0AA 4NNOA 2IGTA 2WJZB 1MG0A 1K7YA 3W5AA 2QBYB 1GUAA 3GVIA 1M10A 2B4RO 2AOXA 4OLHA 4Y0AA 4YCAA 3EA4A 3ESCA 4GI5A 3B2EA 1JV2B 3T4PA 3SYTA 1GZ3A 1DDIA 2E9SA 4I55B 4JIGA 5K3EA 3QEBZ 2Y1EA 5FOWA 1A2KC 2CE7A 2IOYA 1U7OA 3L77A 4MWEA 3PK0A 1IOLA 2Z2JA 3D43A 3TIFA 2DFDA 1Z5WA 3HG7A 4MRAA 4DRZA 3ZNOA 2XY4A 4MV6A 5BNWA 2XRYA 3FNQA 1MB0A 1G4AE 3LC1O 4MR9B 3UMVA 1DMRA 1MC8A 2H2DA 2LCIA 3DC7A 3PI7A 4MRNA 1YVDA 2OO3A 3B3QA 3DHNA 4AJJA 4ZYXA 1JDZA 1HRKA 3OEED 1LK7A 1GNPA 4REQB 5ESDA 3U0BA 1QQAA 2OO7A 4G56A 4HZIA 1JG2A 2V6JA 4GVXA 3JRNA 4ILEA 1SB9A 4UVGA 2QTNA 3VNAA 1UODA 4ASUD 4TWRA 1OXBB 2IOHA 4BFXA 1Z28A 4ZPXA 4PG8A 4RTNA 2PUEA 3TVTA 1N8KA 1QYCA 3H3XA 1DRJA 4RZHA 5T67A 1W0JA 2QX8A 4L4RA 3HGTA 2XOKA 2BLLA 3NCHA 4EENA 4ZI2A 1Y7IA 1LPMA 1FTWA 1UWVA 1XAJA 4KQ1A 1V6SA 1GKUB 3TZKA 4BZXA 4ZJYA 1OI7A 1JDNA 1NSFA 3GFOA 1NPTO 3GF4A 2H07A 3QQ5A 3KZNA 4HB0A 5AVQA 4F1JA 4HNUA 3T1TA 4OVKA 3COPA 3GAFA 5F4BA 4F1WA 1CBUA 2XD9A 1GVNB 1T8YA 4R68A 2CNOA 3TRHA 1P7YA 3IODA 2WFLA 1SRQA 1T0BA 3ABSB 3UFXB 1TEZA 2CSXA 1W87A 1J0AA 4PAWA 1V2GA 4JT4A 1KIAA 2R2AA 4KH0A 1NVVR 1XRLA 1U1FA 2AE1A 2R6FA 1CD5A 3E2IA 3KLNA 1KKUA 1ZK2A 4N6NA 1YUNA 2HCBA 3ME5A 3NRCA 2LVBA 2YXDA 3E82A 5JLJA 3ACBA 3C4QA 3OZBA 1AGPA 3W6NA 3SQXA 2GCOB 2I7CA 4UE6A 4UU1A 4C7JA 1AHPA 1JI3A 2ZI5A 4NCAA 2Z8YM 3JSXA 2C5BA 1KH1A 2JVIA 3BERA 4N5DA 5E6SB 5HE9A 4Z7JA 5K99A 2ZUBA 4ZV9A 2O8DB 4JBWA 4L4ZA 4MGIR 5K8JB 5JATA 4Y9UA 4N7BA 1OREA 1M72A 5ALRA 4MDEA 1BGWA 3F97A 3DFKA 4P0QB 3ZWOA 3CUTA 4DSZA 3AESA 2IYEA 1L7OA 4MUKA 1EVJA 3T7EA 2YH2A 1TYDE 2C4KA 4UVHA 2NSDA 2BP7B 1AGYA 1R88A 3BQMB 3PHCA 4YLGA 5G02A 4E2ZA 2GN9A 2I87A 3D4LA 4GPBA 4Q9JA 5BUSA 4CNBA 3WISA 1PWYE 1SIBE 1HLPA 3EVEA 4RA9B 1RAIA 3W2HA 3EHDA 1Z5OA 5JRJA 1WVMA 4LZOA 2YZMA 2DECA 1K0UA 3AKEA 4DC0A 1PX2A 3BOSA 1UBOS 3UXMA 1HE5A 3LW7A 3FVRA 4HAWA 1EWRA 4RLHA 1ZLXA 4A0GA 3ETCA 3VKGA 3LYLA 5CA0F 4FOSA 4M2LA 4RWEA 4D4KA 3JAWA 1Y9JA 3IBSA 4C20A 3D8RA 5C32A 2QLFA 2P90A 4GQAA 3UJPA 3BXHA 1TDJA 3QVUA 5IEJA 4XIIA 1E2MA 1Z9BA 3BKXA 3OAAA 4LECA 3OZ7A 5DSTA 4R0MA 1IY8A 2P4EA 3P4YA 5A3VA 2QRMA 3UH1A 5G41A 3FHTA 2PKYX 3U31A 2AN3A 1KJ8A 3W2TA 5AW5A 1CQZA 4B3GA 1NM5C 4P5DA 1PFKA 4CQJA 4DDHA 3EW9A 4QSHA 3TUZC 2JI6A 1P6UA 4RY8A 2PIDA 3KRTA 1GOTA 4DCMA 1P18A 2B5OA 1MG5A 4FHEA 1XCGB 4E07A 2HMAA 3N0TA 5LMZA 4IIVA 4M6WB 5ALSA 3H87A 1C9YA 3CBQA 4ZAXA 1QH1B 2XKBA 4W9RA 3SP1A 1FLVA 3W8NA 2QM3A 3NT2A 4QOEA 4AO6A 1NHWA 2HA6A 2DVMA 1RLOA 2ECKA 2Q5CA 1Y3FE 2D5IA 4H4CA 1INLA 5C4MA 3DT8A 2C7RA 1E9DA 5H7XA 3PC6A 4NV0A 2H9IA 5EPUA 1RHRA 3L4BC 3N3BC 3GN1A 3PQ4A 4YJKA 1KI2A 4FDUA 1I1NA 4N3GA 3VU0A 2W6IA 4G9GA 1EXVA 1SBHA 1G60A 3V7YA 1YWGO 4P36A 5KSPA 1Q95A 1V5GA 2QTVB 4XXHA 1Z47A 4TXNA 1M34E 3GLRA 4YMTA 5C8XA 5EJAA 3F4LA 4TWJA 1T3TA 2X6TA 5CNMA 3WK8A 3TE7A 3VSDA 1RLJA 3D9QX 4YT2A 2HXSA 3OKAA 2PGNA 4DRXB 1AKRA 4P7KA 4E2YA 1HBJA 2ZIFA 3ZGYA 3SS9X 4XJTA 1YR1A 3WP1B 4BV3A 4DLXA 3VAZA 3WNZA 2OFXA 3NPAA 5DLEA 5ALUA 4L75A 2PT9A 3K6RA 4M1TA 3ADCA 2ATXA 4X95A 2Y27A 3FYHA 3QPCA 1GCOA 3Q12A 4US0R 3RC3A 2VXBA 3HCRA 1Y6RA 3TDMA 3LYHA 5E38A 4LHZA 5AI6A 1BJTA 5JUWA 1X7XB 1Q0UA 4G4SP 2N0SA 3KP1A 1L8XA 2G28A 2X3FA 5DXAA 3KQKA 1XLVA 2CL5A 4HDOB 5F1OA 2OV4A 1G41A 1JWBB 3FX2A 4ETNA 1NN0A 1YJXA 4KK3A 1KSGA 3OX3A 2ZIAA 4CKWB 4BQFA 2AEMA 2XWQA 1XMPA 1QZZA 3IAUA 5JJBA 2BE7A 1XCPA 2XXAA 1W73A 5H5JA 1EFPB 2I3DA 5JSQA 4C9BA 3DLPX 3A37A 1RZVA 1XZBA 2A1IA 4WKOA 5EQDA 5LMCA 3W5VA 3LX6A 4QYMA 2HL6A 3WL7A 5ECDA 2KSQA 3MBOA 3MPUA 2BCEA 2W2LD 4A26A 1GDDA 4GKAA 4M9ZA 3DCYA 4HRYA 4S1NA 4DMMA 1F6DA 2NN3C 4CM9D 1QYDA 3BQ9A 3ISVA 1BGVA 1FOEB 1MLDA 5AM5A 3AH8A 3I37X 1XT6A 3QPBA 4K86A 2RGRA 3QY9A 1XQ9A 2PS1A 1WAMA 3THWA 4XB1A 3T7KA 4TVOA 3OIGA 4N01A 2FE4A 2O8EB 1HYBA 2CBZA 3OT5A 2R86A 4G0YA 5HCNA 2JI9A 1GGVA 1EK2A 4OJKA 4LQLA 4EBBA 4MLZA 3R7NA 3ZQKA 4D0RA 4QGSA 5EPEA 4CQMD 3I76A 3KAJA 1LWNA 1QHSA 2YL2A 3EH2A 4LFCB 4QLBA 2WM9B 3THRA 4Z2YA 4MQEB 4DAOA 3RIGA 4WXMA 5JECA 3E3NA 1U9CA 3NC1C 2I6SA 4GDMA 1VLHA 2AR0A 4X44A 4DYVA 1FFYA 1T29A 2R1TA 1N6NA 4HNAA 4JDUA 3ENZA 1B16A 1L5SA 1YK1A 1I5RA 3IX7A 3MG9A 2PKWA 1NQWA 3TPFA 1XB2A 3I0NA 3UV3A 5EJMA 1EM8B 3IILA 3U3JA 4A4DA 4EZEA 1E96A 4MINA 1JFRA 1RMYA 2V98A 4RFSA 3DONA 4EI2A 2LKCA 4ZZ3A 4ARCA 4V0MA 1WPGA 1TZ2A 3HNPA 1NURA 4OLJA 3QKRB 3FTPA 3R5SA 4YRQA 1QIMA 2IDMA 1JH8A 5J5CA 3T8YA 1U5CA 3WGLA 4E08A 5L3RA 3QJGA 5TIIA 4DCTA 4LHVA 5ENDA 3MGBA 3MTEA 3N59A 4FD2A 3GRFA 1ST3A 5SICE 3GDGA 5TQ2B 1CEXA 4LJSA 1V5EA 2EJTA 1Z6XA 3I5XA 5FBLB 1XZCA 4XD2A 3DOHA 2QPOA 2AOUB 3D3NA 4LISA 1N36B 4G84A 5EIOA 3I2GA 2G40A 2LXNA 3FSGD 1EEXB 4EF6A 3TG2A 2R1UA 4CF6A 1YD7A 1YRYE 2FPRA 2G77B 4HYEA 1WG8A 4JP1A 3DMYA 5A04A 2DXIA 1N8NA 2WC1A 1O58A 2W6NA 2XTAA 2P78A 4G5XA 3BZWA 4MVXA 2VYFA 3USES 3C5CA 1EP3B 5AXBA 3ICCA 3NS7A 4NAHA 3RAPR 1A71A 1ZD9A 2Y6UA 3R24A 4EPWA 2J7PA 4M0MA 4XR9A 1JG7A 4MYSA 2QLMA 2X5KO 4OKSA 5K51A 4DXHA 5IVKA 1KC3A 4P2BA 4RDHA 1LDEA 4L5IA 4DABA 2QRVA 5EIAA 4AN0A 3UV7A 4UAGA 5KKAA 1G5FA 4MV7A 3TLZA 3DOUA 5CRIA 1NC1A 3I6QA 4I55F 4JCOA 3RU3A 1HL7A 2JFXA 1SOVA 4FBGA 1VCOA 1BC5A 5JARA 3PNKA 3RYCB 2IXFA 3N07A 2YUIA 3BXFA 3KLPX 1JQ3A 3NEJA 3R3SA 1ESEA 4EY6A 5GVRA 2GBLA 4Z7OB 4JJAA 1ND5A 1H1DA 4O08A 3W5IA 4TS4A 4RETA 1KFJB 2BFCB 2WYUA 4RANA 5KTKA 1E8NA 3JPWA 3MTAA 4ZTZB 1AUXA 3L6OO 1NJ8A 3WAKA 5JAOA 3PP8A 1UAAA 2VP5A 4DGQA 2JIDA 3DCIA 1FYDA 2R5NA 1ZJZA 3GEIA 3P19A 4HZGA 2B3TA 4QEDA 4X85A 5A03A 2E1RA 1O7JA 2FXIA 2XGJA 1YACA 3NIBA 3SYMA 4A16A 1DTEA 3IMKA 2ZK7A 1UJ6A 2QTRA 4FGJA 2IHBA 4FZJA 1FU4A 3IEPA 4IFBA 5DLQC 2X8WA 3DEAA 5ESXA 3RD5A 3VPFA 1XZMA 1TMYA 1TMOA 3EVTA 2A94A 1UJ4A 2Q9CA 2O0JA 4X90A 4OQEA 4Y67A 3T0GA 3ZKWA 2P6OA 2P75A 4PG7A 2WJHA 3GRPA 3LH5A 5CK5A 1VIAA 3Q3CA 3WLRA 2B9VA 1GRCA 2GYWA 2IYAA 4P82A 2JLBA 5C34B 5JI2E 5L8VA 1UXOA 3PQ7A 1NSTA 1SHKA 3UVEA 4ZDWA 4QVKA 2PD4A 3O4GA 2YIMA 3T7DA 1B1CA 5J5VA 3U3OA 3UT0A 5DLDA 3GXBA 3ADBA 3HO1A 2HZ7A 4GGOA 3E5RA 4ITRC 1XA0A 5DYNA 2CY0A 1M1YA 3I53A 3UUEA 4IOJA 1PWZA 1DQYA 5IZ4A 1OTYA 4AECA 4O4JF 1ZKMA 5AYVA 1F0KA 3REFA 3TDKA 5BPFA 1KFKB 1C1DB 1LI4A 1D9ZA 3AL3A 4K81B 2D2FA 5LIRA 3GVPA 4CIAA 1YL6A 7MDHA 2BR3A 2JFGA 3JQ7B 2D2VA 3ENWA 2CVPA 5HJ5A 3AFGA 4BCBA 1FDSA 3C7CB 7ABPA 1D0IA 2AQKA 2RK3A 3AY7A 3UK0A 1KRWA 3K5WA 1O4VA 9ABPA 3IUNA 2XSZA 4MCHA 4UEWA 4AI6A 2AFRA 3EGOA 2DWQA 1OJ7A 1O9HA 3DHWC 1YR8A 2J3DA 2Z4TA 2ZRPA 2XW6A 3HB7A 2IHNA 3FJOA 5AKYA 5FO1A 3M5WA 3VO2A 3H0EA 3CZ9A 3DDUA 3KJEA 1IXRC 5E1MA 5EIWA 2VA9A 1CUAA 1PZNA 3CC8A 3PYLA 4D9MA 3DEFA 4OU5A 5IWAB 2XMGA 1P7WA 1CQPA 4EARA 2VDKB 1J7KA 3MTIA 5AI8A 3E61A 1IWOA 2BEUA 1TK3A 2CLMB 4GSLA 1EUDA 2PX8A 4UPDA 3DMRA 2JBHA 2Q4BA 2NVUA 3PRHA 4FKBA 1NI3A 3V1LA 3OIWA 3H2BA 5FNZA 1KZ9A 2V7TA 3PKIA 1LPAB 3P9QA 1FMTA 2Z57A 1R0KA 1V48A 3U13A 5DX1A 4MAMA 1W2HA 5CXXA 1KGDA 1YR7A 1L6IA 3A10A 3H5RA 3DBLB 4D9HA 2P8JA 3AUJB 4PLPA 2P5SA 3B52X 2QTMA 4OA8A 4U00A 1Z8NA 2FN9A 4XYEA 5HIJA 1DHTA 1R0RE 2VJOA 2VG8A 3LVRE 4OL0A 2ZATA 4DQUA 1KAQA 3RS9A 5AUOB 4MS3A 5I7SA 1GUBA 2QTWB 3K15A 3E8XA 4ARBA 3ZE0B 4LJ9A 4ND1A 1APBA 3JWJA 4ROSA 4I4NA 2A5JA 2O8FA 1HETA 1QKJA 2ZYAA 3VHXA 4L22A 121PA 1ZD3A 2IPNA 1RP1A 4X0EA 4KBYA 3SJBA 3PUVA 4F06A 4RJIA 1CPYA 1PYGA 5JCJA 3OMWA 3U5TA 4IAOA 4CKBB 4ZK6A 5D1NA 2DU8A 1A5SB 4KVGA 1XTBA 2GASA 1WKCA 1UEIA 3A2NA 5FTLA 1T1EA 1KOJA 2SHKA 4DNPA 5A5GA 3AZPA 1QC5B 4GYWA 1F1JA 3ZS8A 1JDJA 4F9EA 2G3YA 3KVNA 4B17A 5LOVF 2NXCA 1X1CA 2XUAA 4IHJF 2DR0A 1AS3A 1GKLA 3KZCA 3T9DA 1WD5A 1NTRA 1DTWA 1E3EA 1I01A 1R0YA 1BNCA 4FMPA 5GONF 5JYEA 1UZMA 3ABIA 4MUJA 1JJBA 4NMHA 5AW8A 4HPXB 1JHZA 3VNSA 2EBUA 3E7XA 4LWOA 1M2NA 3VPGA 4MA4A 2Z5LA 1TO2E 1MDBA 1AURA 3VZCA 2QY6A 4PYMA 1GPNA 2ZYHA 4JR1A 2B35A 3CH5A 4TZTA 5KTNA 1WU7A 3HA3A 5HEKA 3RS8A 4HK4A 1JYFA 2PWAA 1BE0A 3TOSA 1HFKA 3BWCA 3L4KA 3NDJA 4UPVA 1T2AA 3L7JA 4K87A 2P6PA 2PU5A 2ZIUB 1E4EA 3UJDA 3T3OA 3RTCA 1RE0A 3AEKB 3L93A 1WS6A 5TV2A 1J8MF 3AHHA 3RS7A 1U2TA 1NP7A 4J2HA 2O2EA 2YWDA 3KIPA 1W46A 4OH7A 1T5HX 2VT3A 3RSFA 1YZYA 1PD0A 3ZH9B 2X5XA 2I80A 3MMSA 2GWRA 3K9WA 3W2GA 4TRMA 4TV9F 2PE5A 3J80A 3UZUA 4EHHA 1N2HA 4LXGA 2W42A 3GUYA 4HDRB 3SE7A 4OBXA 4F2DA 3TCNA 2DUNA 4Y7CA 3RVDA 3U7RA 1S1MA 1SY7A 3KB8A 2OHHA 1VL5A 3KUUA 2V4ZA 3LO8A 5C1IA 3AJAA 2OZLB 3QYFA 2C29D 1AUPA 4MWTA 4NKRA 1I6LA 1I7PA 1M2KA 3GLUA 3P2OA 4MW5A 1GGKA 1XTZA 1SC3A 3R7AA 3WSTA 1J24A 1JIUA 4RFLA 5F9HA 3W2EA 1RRFA 4M9QA 2HJHA 1KP2A 2O2IA 4JEUA 1EX9A 3VYUB 4WKPA 3WLOA 3VYSB 1M2OB 1NWCA 4BFYA 5CYGA 2FH5B 5KQLA 4L3VA 1J6UA 4D98A 1M8KA 3U60B 4DKXA 3C3DA 1L1QA 2Q5IA 4IV8A 1WB9A 1IOZA 4R98A 3L0SA 5BPHA 2FMKA 1ICIA 3KVRA 4QJBA 1NRJB 4PG4A 4B82A 1IZYA 5DNDA 3KUKA 1JQEA 4KGXA 1FVXA 1NF3A 4X7BA 1GXSA 1R50A 4KMOA 2VBCA 1ZA2A 2AG1A 2Q07A 3IHWA 1TA4A 1V5IA 2OHJA 2Z95A 4XVHA 3RVSA 2XZPA 3NB0A 3SJCA 2BKXA 3IT2A 1T6YA 2YV1A 4BX8A 2XMDA 5JEDA 2BHRA 5BR8B 1Y82A 1HDOA 1OBHA 2IU4A 5H70A 1EBBA 1ZEJA 4WOCA 2YVAA 3MWDB 3SDBA 3AEUA 2HJWA 1JHYA 2A84A 3DSRA 4OHCA 4UCFA 2O14A 4RTOA 2EFHB 4XE5A 5K0CA 1J06A 1E1LA 4GG1A 5J2TF 2X8JA 1ZBDA 2PZKA 1DUIA 3EJ6A 3IP7A 3MOSA 5DYIA 5FLXA 1D6NA 3HCEA 4IXNA 1FMFA 4XKJA 2QA5A 4AY3A 2G80A 4Z0HO 1RLMA 2VHCA 3L07A 4E13A 5DTIA 3FCOA 1MKYA 3OZDA 2EEPA 3MJ4A 3RFXA 1NXSA 3UQZA 3OQMA 2WSBA 5ARDA 5EXDA 1UFOA 4JL6A 1VSUA 3K0KA 5IYZA 2IYLD 4O1HA 3QFFA 3IUQA 4K9MA 1T4CB 4AG3A 1PJ4A 1OBOA 1QO0A 1IVNA 3MB8A 2Y0CA 3DPSA 3OZWA 1CEQA 1PGQA 4MI9A 3UG7A 5ELMA 5JZVA 1QIJA 2YYZA 1MZPA 1RJWA 3IESA 3B1JA 3NATA 2GXAA 4JSYA 2OHXA 4CEIB 4E33A 1NXWA 1Z5NA 4C6RA 3HDTA 2XH8A 3O4FA 4B6GA 3RYCA 3AVUA 1DEAA 1TM3E 2GLXA 3FA2A 3L1IA 3OU7A 5GY7A 1IH8A 2GPAA 5TQVA 3OX2A 1H2AS 4QPZA 4BKRA 4C4OA 4M0FA 3C7AA 2BFDA 2QXUA 3K4HA 3Q7SA 1OGIA 3DDHA 1FP2A 3KSAC 2C2OA 2C95A 2G76A 2H00A 3DCJA 4L8VA 4P53A 3RYHB 4EATA 5JJLA 2ZRBA 1QKIA 2FG7C 2HTFA 3ONEA 1AO3A 2QF7A 3D1VA 1DAKA 3LUAA 3UV6A 1Y3DE 2Q3JA 1LSSA 2B5WA 3P45A 3SVTA 1AQLA 1B41A 4ZAFA 2VRCD 3O8DA 4W9NA 1IYZA 3KYBA 4YUVA 4OREX 4Z3DA 1K66A 4JA0A 3ROEA 4CMJA 1IPFA 4AKTA 1NQ5A 4BLPA 1U2SA 1P1KA 2D5CA 2VQ6A 5EAIA 3RVLA 1YNOA 1G7CA 1UBUS 2FFHA 3H4MA 4DDTA 3U44B 1JR3D 3OY2A 4GVPA 2IE8A 3FOFC 2B8EA 1IVYA 1XXHB 2YBDA 2ZIZA 4WL0A 3AJ9A 2JZOA 3WAJA 1NVFA 2R8PA 2DPXA 1AS2A 2VYNA 2ZBDA 3AZQA 3QLJA 3X3HA 1IEQA 2EP5A 2AOUA 1OI2A 2RAUA 2RHMA 1OXSC 4E70A 5F98A 1AGRA 4I1VA 4YAJA 3SZUA 4YJGA 4F4JA 4Z1OA 3RHFA 1KRXA 4B6JA 1J49A 1NE7A 3BWEA 3OZEA 1B8VA 4H77A 1WXXA 5EUQB 1YO6A 2I54A 3IHTA 3R3WA 2AI3A 5CDFA 2HHLA 3Q2KA 4WOBA 2X3YA 1JT2A 1V25A 5FYDA 3AGQA 2Y68A 1PNOA 1RI1A 3LQQA 5KQSA 4P4NA 1HH4A 2ZRQA 3W6PA 4CW7A 1XV5A 5K4AA 1IN4A 1GJRA 3JX9A 1KBQA 2ZBRA 2WPDA 1CUJA 1S0UA 4XDGA 3VOTA 5BQOA 5JALA 3CX8A 2CJPA 2XUIA 1MVLA 4Q6WA 3U37A 2OE2A 4NOKA 1X8JA 2YRXA 4I4TF 2AL7A 2VEOA 4I1OA 2H85A 1Z26A 1T6NA 1RWNA 3I72A 1A8PA 1U2GC 1VPTA 5AJHA 1SCNE 2GBCA 1LPPA 3DWIA 3L01A 2P62A 3WDSA 4DTCA 3T5TA 1Z0IA 3HXLA 4BMSA 5FTWA 3YASA 2GCNA 2HHCA 3OIUA 4XFJA 3ZWWA 2VJQA 4D02A 3C5VA 4HVTA 1YIDA 3AKZA 1GR0A 3GC6A 4JI3B 1ML3A 2C5EA 3B1XA 4E5PA 1VBFA 2OECA 4TM8A 3V8VA 3K9FC 3LZ6A 2BZ1A 1G1AA 3GARA 3FUCA 4B79A 2J7PD 3ANMA 2QZSA 4WZAA 3U9SA 1G2OA 1UEJA 1EXNA 1P73A 1UWKA 2GXSA 3UHFA 4GPTA 2BLNA 3WDMA 5KX5F 3DTYA 3WA7A 4LOKA 2D5AA 2WF5A 1AKUA 1LJ8A 4ARZB 1S89A 4R0NA 1L6RA 5HF8A 3DB2A 4MLCA 4HSEA 2OEPA 2XUFA 4UTPA 3WAGA 3M89A 1ZM4A 5FWXB 1CRPA 1ISHA 4NYJQ 1B26A 3IRUA 1RHKA 5EZYA 1SOWA 2HNBA 2W8ZA 3IJRA 2ZKLA 4A2PA 1YA8A 5IM4F 1ZK3A 4BVKA 3DE0X 1JA9A 2AZDA 2IEBA 1NX6A 1JL3A 1F06A 2HB6A 4IH9A 4JSRA 2FZ4A 1OGYA 5DTEA 4CMIA 1QIIA 2R48A 3EGCA 2J9GA 3OQBA 3WMWA 1FF9A 1ECBA 2JI8A 5DRYA 4TWZA 1U2PA 1VLMA 1TEHA 4PQGA 4FB5A 2C42A 2YFKA 1J8QA 2MYTA 2BN4A 4FYXA 3ZCUA 1CUCA 5BQFA 1Z18A 3FI0A 3UJ7A 1GGFA 1BN6A 1M6WA 4EO7A 4HX9A 1B8UA 2H4JA 4MR7A 3TZLA 3UJCA 2PMEA 1SUCA 3AM4A 1QUEA 2WAXA 5EZYF 4DLPA 1HNXB 3ET5A 4UASA 1U7TA 3R5HA 1YCFA 4BMXA 5CDSA 1M2FA 1ZS9A 2XUPA 5CB4A 1BZYA 3QX7A 3W7BA 4BE9A 4TPKA 4ZVOA 2QX7A 3RSCA 1XDDA 2MWMA 3KLOA 5AVJA 4EHKA 3A58B 2MSWA 3O3MB 5EI5A 5K8UA 2QTTA 4LZNA 1CUWA 3LPLA 4O8CA 3RJ5A 1SQGA 2I2CA 2PT6A 3KR2A 4JENA 5FUMA 1VYUA 1LTQA 1HKHA 2O6LA 3GUUA 2J3LA 2WR8A 3ANTA 3I30X 3VH4A 3TLAA 4BMPB 4CV2A 1T0HB 4YV7A 2A30A 2OV2A 1TRHA 1OBFO 2PMKA 3D7KA 4V0KA 5L6LB 4EG0A 1TL7C 2IC5A 1H6BA 1V8PA 2G71A 2RGWA 3L7OA 3HUDA 1RE1A 3RVOA 1PG5A 2DP4E 3GWGA 2KBFA 1S7CA 1N2ZA 3MJHA 4NYIR 1AG9A 5CA1B 1IUNA 4ZALA 3ISTA 1T8PA 3JQ7A 4OHPA 3HEMA 1NMSA 4ZK2A 4L5CA 3PXCX 3DKIA 2WNIA 5E9AA 3GRVA 3OICA 2W2LA 5BMVA 4JXXA 4W5OA 5K7SA 3E22A 4EW1A 5DBIA 4LXXA 4NCJA 3P9NA 1EKXA 2NU8A 2IXEA 2IKQA 4HWKA 4AQ7A 5KQPA 2JIRA 4L0QA 1NIPA 4H6PA 4F85A 3WYBA 1WB4A 2DPMA 2V6IA 4N0QA 4CFSA 1XQ6A 2FLKA 3EIOA 3LQ4A 3GRCA 1J8FA 4MYCA 5JPDA 2C8JA 3KVVA 4L8LA 5TT1A 3OETA 4ZFNA 4A15A 1CLUA 1QGED 3CCBA 4YALA 5HXAA 5GPBA 1G19A 3RAGA 4ALMA 4PM4A 3ZV3A 3D7LA 5AW9A 4OH1A 2OB2A 2C2WA 1XTVA 2AZMA 2W7TA 4IG9A 2ZIVB 4F12A 4MW1A 1W52X 1NXVA 1FDVA 1NONA 1EFKA 4Q1FA 3O8QA 3QRWA 5E9JA 1DXQA 5J4LA 1I7SB 2ONZA 5KX5B 2CLCX 1M5UA 2AG0A 3I6ZA 3ONWA 4WFIA 4YJ2F 1VTKA 2LBPA 3O74A 1YJAA 3RSHA 4WGFA 4OIFA 1BCRB 5B1SA 4WA7A 1Q74A 3MA0A 1VGVA 5DYTA 3ETJA 2VDJA 1SXHA 2B4QA 3SNKA 5IULC 3AF4A 4L0CA 4FUTA 3B1ZA 3GQBA 4J4BA 1IHOA 1DEOA 4BTVA 5KYXA 1QANA 1S2LA 1V9CA 2FVYA 3CEAA 4AURA 4R8SA 4C6SA 3AF1A 4DY4A 4M7WA 4CMHA 1LH0A 2O2XA 1EUYA 1J25A 1IEVA 1E5LA 3ZY5A 2Q3CA 5THXA 3T61A 4CUKA 1FNNA 1C29B 4GMDA 4O2AA 4YFYA 3ZGXA 1G8SA 4RU1A 3EYAA 3UCXA 1CIJA 3CTMA 4L6IA 3DO6A 1JECA 4E5YA 1CJVC 4KWTA 2VDLB 3EDMA 4RHEA 2D8MA 3HBLA 1WQ4A 4DV2B 3NNSA 1K6EA 1SUPA 5DCUA 4AULA 2X1MA 3L6UA 1M1NA 4HF7A 5EZQA 1ACLA 3DHVA 3N2LA 3FIJA 2ZJYA 1ILWA 1CXZA 1KPHA 1NGSA 4JT9A 4I3GA 4Q24A 3UAZA 3GPBA 3FSJX 3FCAA 4X92A 4BNWA 3TFQA 1FRVA 5AW3A 3CVUA 3OLXA 3TX6A 3ZE6A 3AY0A 1W9MA 1QZXA 5HCIA 4J0JA 1E1DA 3GA5A 1UC4B 5FLEX 2A1TS 1E9VA 1RM3A 4A9AA 3ER8A 3TNLA 1JEEA 5FPYA 2WKQA 4WCDA 4QUBA 4Q7LA 3HDQA 2FQ1A 4EPYA 3DKVA 4G4JA 1CF4A 1YHZA 4JDPA 1E5VA 3IMCA 1Y89A 4PZCA 4F9GA 1Q3HA 3U1VA 2EZTA 1GZVA 3CR3C 3L7YA 5KVQA 1YGPA 3B78A 5LZ4A 3W2FA 2A33A 2W2QA 3QWAA 4RW0A 1SQ5A 1UOOA 2WZDA 2PL9A 5IFLA 1YZUA 3V3TA 5LL6P 5DNAA 3RHZA 1XRSB 1XLWA 3FLAA 4NF2A 5AM3A 3L40A 1J8YF 4IJWA 3OEHD 4NS4A 2PRZA 4D82A 2PPLA 1ZJYA 5LOVB 4DV1B 4UTRA 1PLKA 3RVKA 5CA0A 3KZKA 5K8IA 4M0UA 3ZV6A 7REQA 5JNSA 3C45A 2CHVA 1Z2CA 2AT1A 3DUFA 2H3EA 4FCVA 2L82A 2RB4A 2R4TA 5B4VA 3AESB 2JGIA 2BGKA 3PWSA 4JLWA 1JHUA 2YJ4A 2NG1A 1TO6A 4ZIRB 5B6PA 3C74A 1JQJC 4F8EA 1SOAA 2D1QA 1YUMA 2XUKA 3FRHA 4AMGA 3ICQB 4UW9A 4TM7A 2Z6AA 5AHKA 3CN9A 3UUGA 1DQZA 2J9FB 4HAVA 3EZ2A 3B6KA 2E4AA 1O5IA 2GN4A 3O92A 1QGYA 4YP7A 1N5LA 4ZCRA 2PA0A 4PPQA 3OM1A 1VKHA 1GM5A 4QFBA 4ERNA 3OQIA 1XCJA 3K0FA 2PT5A 2Z9DA 4G9EA 3BRQA 3NBUA 4M9SA 4ZVRA 5LDGA 2IXTA 1T8UA 1DKPA 4GD3Q 2ZTUA 1WDMA 3N6XA 5T3UA 4KFCA 3DBIA 3IJ5A 1O1YA 4R1SA 4KN9S 1QX4A 3MQ4A 4QNMA 4E5VA 1KEKA 1FE8A 1WSAA 5JYBA 4AMBA 4CQLB 4G5GA 5BV2P 4MUGA 1S9DA 3I04A 5AM0A 1NN5A 1RQ7A 3LLCA 3MJCA 3OC0A 3UA3A 1GWNA 3GEPA 3HPRA 5IDQA 1ZUWA 1TCUA 3A06A 1IQ0A 1ZNYA 2CNKA 2A7XA 1OD6A 1YL5A 1ODSA 2PUWA 4M49A 3A36A 1PNQA 2NSLA 2UDPA 1F8YA 2ZWOA 3JQGB 3PFBA 3UMBA 4D8TA 1J56A 5DNUA 4QYTA 3L02A 4CE6A 4V2UA 4RUKA 4CMKA 3ICOA 4IHJA 5ALIA 1CY2A 1HFWA 3NBMA 5CVUA 4UNRA 4ZQIA 3DDSA 4OHKA 4X1YA 1VSTA 3TTYA 3R8XA 1W0JD 2OT3B 4B9AA 2GARA 3H19A 3NASA 3RLFA 3I1FA 4AIRA 3G9ZA 4TXLA 2YJ5A 2RBKA 1X9IA 4NI5A 1M6VB 3A6ZA 3S28A 3VKFA 4B8ZA 4N3NA 4RCVA 1CRQA 4S04A 1KI1A 3CXRA 4G24A 1CDOA 1XQYA 3WFJA 4CM6A 5J2UA 3SFTA 3H1PA 3ENKA 5EE3A 3VTZA 1OXUA 3PJFA 5FF9A 1K6IA 1SEVA 3ZIAD 4TS9A 5C1PA 3COWA 3EVCA 1KK1A 1N3YA 3F96A 4UTOA 4W63A 4PE5B 3UB4A 4BNLA 2VK1A 3ROFA 1Q15A 1DC7A 3Q3JB 4TLCA 2J5BA