4I4IA

Crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
319
structure length
319
Chain Sequence
MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDIIHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDAATSHERTYVIEVMGRHAGDIALWSGLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGFETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEALANKHTIDQRMYALSKELSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphofructokinase
publication title Redefining the Role of the Quaternary Shift in Bacillus stearothermophilus Phosphofructokinase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase
total genus 117
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.11: 6-phosphofructokinase.
pdb deposition date 2012-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i4iA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i4iA02
2F64A 2F2TA 2HIGA 1S3FA 4WL0A 4I7EA 1F8XA 1T35A 3EHDA 4U1RA 2F62A 3OPYA 2KHZA 4FYKA 1S2IA 4LJLA 3BQ9A 2F67A 4MEJA 3O8NA 3HNOA 2A33A 2PFKA 3GH1A 2KLHA 3IMKA 4P5DA 1WEKA 4LJRA 3O8OB 3PFKA 3U39A 4KXMA 1PFKA 5ITSA 3MAJA 4NPAA 6PFKA 4KXLA 3SBXA 4P5EA 1S2GA 4FYIA 4FYHA 1S2LA 3F5MA 4JENA 2NX2A 3UQZA 2Q4OA 1F8YA 4OHBA 4JEMA 4PFKA 4I36A 3O8OA 2F48A 1MTOA 4MCJA 4A3SA 3O8LA 5AJTA 4OHRA 3QUAA 4I4IA 4JELA 2Q4DA 1KZHA 2A0KA 4KXNA 1S2DA 5AJUA 3OPYB 1RCUA 2IZ7A 1ZXXA 2PMBA 4LJKA 1YDHA 3K2QA 2IZ5A 4HX9A 4RH3A 1WEHA 2IZ6A
chains in the Genus database with same CATH superfamily
3T41A 2O23A 5EHQA 5GONA 1I4LD 2F2TA 1Z16A 3F7MA 5EPEA 4EKGA 5DHUA 2XNJA 1IHPA 3N8IA 3OSUA 1S3GA 3KQKA 4F56A 1T24A 1YWGO 3G7NA 3VHRA 4RW0A 5IPFA 4IEIA 5AW9A 1Z22A 3U0VA 3P19A 4YY3B 3G2QA 3Q2KA 1KQPA 1WP9A 5LB4A 5C81A 1PQWA 4H7DA 3RU3A 2W71A 1NG1A 4AIRA 5JCPA 2ZXUA 2COKA 3HPQA 2JFXA 4BKMA 3EPPA 2Z6QA 5AIBA 2G63A 2HMWA 3K0AB 1C29B 1B74A 3JWPA 2QZ9A 1W36C 1XAJA 1DG9A 4RA6B 3WZMA 5AOAA 2Q4RA 1VG1A 3TLZA 1YFZA 3UOWA 1FU7A 4EA7A 3UK7A 1B0PA 1H5UA 4UTXA 3WL4A 3VNUA 1H66A 4E22A 4UEKA 2IF2A 2VP0A 3KQTA 4NEHB 4YHBA 4Y3UA 2I7DA 3U3RA 4LPSA 1Q7RA 5J4KA 3VOAA 1TT5B 1P1RA 3L6RA 4ZXPA 5CIYA 1SXHA 4E5PA 2WC1A 2R3SA 3Q15C 1KDOA 1C9DB 3ZKAA 4YCMA 3H5RA 4X90A 1VJCA 1U7DA 3OFJA 1P19A 1RAGA 1RXEA 3ETHA 2H57A 4GXRA 1L3BA 4CMCA 2VHXA 3R0VA 2Y68A 3OZXA 4CEJB 2YOGA 5HIJA 3UMMA 4OYYA 3U3ZA 3K9LA 4YCBA 1FDOA 4ZT6A 3O9ZA 4HDMB 5ITZA 1QGUA 1DAGA 2DUUA 1ZJZA 4JGBA 4MUBA 5CA1A 5F3DA 3IUSA 1DUIA 1IJBA 3HA2A 4JBNA 3F97A 4X66B 2HK7A 4TLBA 3KZVA 1AH2A 3SPXA 4EKDA 1VIMA 5DEIA 5GJVC 3VH1A 3ZU3A 1PR0A 1T6BY 2OHHA 1ZICA 4H35A 1EVQA 1RM0A 1GITA 2D74A 3IAFA 3JQ6A 4Q9DA 5CHYA 3COPA 2PIAA 3AVWA 2YICA 3OIFA 4MS1A 3ERCA 4UOZA 2D5CA 2NGRA 4D98A 1FLVA 1KJZA 2P8JA 1L5WA 4R1PA 1YQXA 3RW9A 3W1VA 5B3AA 1MB3A 4YS6A 3GJ8A 4MQUA 5I7HA 2AUMA 1G9XA 2IDZA 4BX2A 3JQEA 2Y99A 3MBKA 5FOVA 5KOJB 1N7HA 5I4BA 2NVBA 1WUTA 3VU9A 4AURA 2XMQA 1CEXA 1Y8RB 4PZLA 4N5MA 3REQB 5ALDA 1VCMA 2DOKA 2G08A 2HK8A 4JLVA 3LKVA 5KWVA 1KEKA 1J2EA 4CQNA 1T2CA 3WVNA 1GQFA 3ASYA 3FCCA 2X0RA 3E27A 3Q6IA 4YR7A 3TS1A 2DLNA 3FNIA 4I5FA 3JD3A 3E2MA 4PXSA 2OK8A 2YIVX 1GR1A 3VSBA 3AQIA 5D00A 5A3SA 4AKHA 2A0UA 2QQ5A 4RWZA 1TVKA 1WDLA 2OZLA 4WN9B 3LHSA 5CX1A 4B6SA 4EARA 2C8VA 2F1RA 1Z07A 3KQHA 5L3ZA 2PCJA 4GMDA 1IB0A 4R83A 4ZJPA 1BXZA 4BP3A 2UU9B 2O06A 2EEPA 4F60A 2ODPA 2GKOA 3UHAA 1YKGA 1B4DA 1H2WA 2JHCA 2WB4A 2WF7A 2PMKA 3HN6A 4AJ1A 4D57A 1E6KA 2PR2A 2QQFA 3EDRA 1U0LA 3MWYW 2O6LA 1WA5A 2GAJA 2XSZD 5I9BA 2QYHA 3CVOA 2H85A 1NP3A 2VRCD 2UVPA 2IXEA 4FFBB 3GFQA 1GZ6A 1JG6A 5IANA 1DSSG 3H1BA 4EF5A 3O92A 2EC5A 2FLVA 2VF5X 3PG5A 4LMPA 1NZFA 2G1KA 4NOMA 1RKUA 1O0CA 3AKZA 1ZEMA 1UKVY 2C9DA 3SFTA 2YJ3A 5EIHA 4L2IB 3BTSA 1OR8A 3I9JA 4JEHA 2G5GX 4LF8B 2ID8A 4J43A 5K0ZA 3DPSA 4HT3B 1US8B 3MWLA 4AMVA 5I4CA 3HO1A 3HKEB 4NXNB 2GN1A 4Z7QB 2ZIUB 2JAQA 1CQJA 3L7AA 1WPGA 4C3VA 4F1JA 3ILXA 1R12A 1XHEA 1J56A 4H1VA 3P9SA 4X3OA 4DLBA 2X7HA 2A88A 1SUEA 2PT7A 1XJ0A 3PUVA 3QWIA 5P8WA 5TPWB 2DP4E 2ZI6A 3TWOA 1M6YA 4DUGD 4YT4A 3F3SA 4MYCA 4KIUA 4Z8YA 3IX7A 3RVMA 4DKJA 2QM7A 4O2AA 5BRJA 5KTMA 1A96A 1MFZA 1OFVA 5A5GA 2PN1A 3B12A 1L4YA 5DGIA 1FPMA 2FE1A 3CF6R 3JQ8B 5EIOA 3SJ7A 4MWTA 4YT8A 4FEAA 5FOQA 1T3ZA 4JB2A 1JQAA 4DC0A 4CT4B 3WNQA 3PUIA 1SY7A 1DKQA 2F8LA 3EVAA 2H31A 3LHIA 3KHTA 4I4TA 4MIEA 5AICA 1CJMA 1C8LA 3AX6A 2R6DA 1DTWA 3NNNA 1FU4A 2Q2NA 2CD7A 3NORA 5TEVA 3IHTA 5IJ9A 2Y05A 2YFQA 3ROEA 2RD2A 1UPTA 2HLDD 1V7CA 2HWYA 3ME5A 3TX6A 1RQNA 5EXDA 3ROMA 2RHJA 2GBIA 1NWHA 1U99A 1NHGA 1U9IC 2VP2A 3DBIA 4HNQA 4JLNA 3PQ5A 1ULBA 1Z35A 2CNNA 5CM2Z 3T7EA 2AUTA 4ZK2A 2Q5OA 2E1PA 2Q4BA 1UC4B 3C5EA 2P77A 3TAUA 4R69A 5BQ5A 1TZJA 5LD2B 3ZE2B 1ZM4A 1GNTA 1HLGA 1Y1TA 2XUQA 3TUJC 2RHGB 3VDMA 5CYGA 2HIAA 1LI5A 4ZEWA 3SZLA 3GGSA 4PYOA 3FCOA 2ORYA 2C92A 1XOIA 4Q1CA 1BWQA 2VYVD 4NBRA 3VTAA 3E3AA 1CS0B 3SGLA 3SI7A 4Y1RA 4DQLA 1HOTA 1VYVA 4XDYA 2BKUA 4I36A 3OE7A 1W52X 1H9CA 4PHGA 3B5IA 1H0HA 5KNDD 4DDWA 1QRDA 1CJSA 1BO6A 5ED4A 3GF4A 5FBQB 4FP9A 3EODA 5ITWA 4KO3S 2FAXA 3IT0A 3WXBA 2DFNA 1F51E 1YRLA 2Z83A 3ETNA 2VJPA 1AB6A 3C3JA 1Q74A 3RHSA 1VXRA 4WQMA 1ND5A 1BEUB 1MJFA 4R8SA 3SIPA 1EXDA 4F7DA 4DG8A 1J1ZA 3N6XA 3TZ6A 4ENPA 1UT6A 3GMIA 2I4LA 5CW1A 1Z6AA 4L6CA 4NH4A 4XZ3A 4ZHQB 4O2RA 2V74B 4MK4A 3SEFA 3TLEA 1WS6A 3EIOA 3G8AA 4HFJA 3ZU5A 2SKCA 2WMYA 2UZ3A 1OKKD 3K9NA 2ESRA 2FZ4A 5IXYA 2W2QA 3RDPA 1TAGA 3EYWA 2I66A 3GNQA 3VPGA 3EA0A 3G2LA 4FLMA 5D5HA 5H9VA 1A7UA 4B40A 2ZRAA 1UFRA 5C8XA 1YDHA 2NT3A 3QPDA 4H7IA 1ZFNA 3W5HA 1R6AA 4MW0A 2G0AA 3CWZA 3OPXA 2ZYWX 4D46A 4BNWA 2LXNA 2RDMA 2JFYA 3EVGA 3B78A 4KGZA 4ND7A 4KLAA 1KJYA 2J7KA 1XDZA 3GA0A 5H8WA 2FRXA 1P45A 1Z5GA 2CLOB 2QM8A 2ZRDA 4GYJA 1G20A 3AY7A 4K03A 4QBKA 3TSWA 3HPRA 2ZBPA 3JQBC 1PYDA 4DV5B 2DVMA 3CX6A 1SU4A 4UNPA 4LC1A 2IA5A 3EEQA 2J1LA 3MUOA 1Q1AA 2H1RA 4QELA 5A03A 4C03A 5H02A 3ABSB 1V71A 2DM6A 4B2PA 4II7A 3W3AH 1USWA 4L27A 4RD2A 1JHUA 2D4HA 3S81A 1C3JA 1QP0A 2PGAA 5IK2A 4NF2A 5HILA 1W96A 3M2PA 4PTZA 2H0RA 5LLTA 3GGDA 4Q4AB 3THXA 1LLCA 1DTSA 3QX9A 2ZJ0A 3UHPA 2L17A 1FFAA 3OOYA 5K6TA 1XYGA 3MIZA 4E5NA 4EYEA 1IG0A 3F2VA 3K7EA 3O8QB 5H83A 5JMWA 2D2FA 1EJBA 3H4TA 4OA5A 4XGRA 1I80A 4BBAA 2OPHA 3CEMA 3E0QA 3TTTA 4DR6B 3HXPA 1AKNA 4G36A 4BFLA 1EK0A 5E2BA 3RSLA 3WTBA 2REOA 4MO9A 3EGXB 5JSYA 3A4LA 3NHPA 3UFBA 3MJCA 4X6XA 3KQVA 5ERGB 4G2TA 3UMYA 1RWNA 4K9NA 3G5TA 4WX2B 1F2TB 3KJQA 3LKDA 3NC4A 2NYAA 1E9DA 4L28A 4MA5A 4MVJI 3QJYA 2A9VA 4MLDA 1TO6A 3P0EA 1VL0A 2HUPA 1KFJB 3HU2A 3ZWDA 4F4UA 4GDFA 1OWOA 2YDYA 3GCDA 5TV2A 1UMDA 1P0CA 2XEXA 2X8BA 3C3CA 4ZCSA 4OUKX 3ANMA 4YJDA 4YRPA 3WE7A 5K0EA 4LHVA 4NAUA 5EJIA 3WNVA 1P5ZB 1UBMS 3R74A 1RXYA 1ZHHA 4UW9A 3LO5A 1Z7GA 2C0QA 1F5NA 4ZVKA 4EGQA 1C5KA 2J3LA 2NPIA 2EP5A 1ACMA 1EFVB 3UMBA 1JR6A 4RD1A 3DM9B 4RMHA 4V0OA 4NCNA 4WZ6A 5B1YA 1KDYA 1VGRA 1X1BA 2CLFB 1IN5A 4C0QC 2Q6OA 3P0IA 2D4AA 4UMFA 3ZGVA 4P7GA 5EN4A 4PR0A 2XSZA 1GAWA 4HLDA 3OJFA 4A3SA 2V65A 2VRCA 3CVJA 2QG9A 1ZN7A 4NWIA 1U3FA 1BC5A 1OLOA 3SYKA 3QXHA 2M2IA 4H7PA 1BH6A 2OOKA 1IY9A 2G9ZA 2OBNA 4GX2A 5I9MA 1WXXA 3QXGA 2OCKA 5JVDB 4D4JA 4IGAA 1Y3FE 2IGBA 2NZWA 2VWHA 5EKSA 3SICE 3AHCA 4DQKA 3OIYA 4AF8A 1SO8A 1SUAA 2JDIA 5EHNA 1FYWA 3EXFA 1JEQA 1JN0A 1D09A 3ILVA 3KJGA 2UUBB 2PVCA 1WRBA 2XCOA 4CDGA 1PYGA 4LN1A 1HXHA 1PS9A 3TINA 3RFFA 1Z2DA 4Q7EA 3PXXA 1YDMA 2I3DA 4LZZA 2ZDHA 1DDGA 3E9DA 3KEQA 1PIWA 3Q10A 1FYXA 4QRHA 4Z1MA 4F4DA 4YCNA 1TCUA 3U3DA 3M4ZA 1Y9ZA 5K4HA 3PFBA 3HDVA 4QODA 2VAVA 3ADKA 1U8AA 3CW9A 3KVOA 4BFUA 2LWIA 5KREA 1Y42X 2QMHA 3WYGA 2RG7A 1GSHA 5T7BA 1TTQB 1UKZA 5ALOA 3I61A 1KVSA 4KZKA 3LDAA 2HMSA 2ZJ7A 2RHHA 1P4GA 1EA5A 4DTCA 2O2IA 3COYA 1E9VA 4N1AA 2OESA 5ARDA 1N6KA 3GAZA 3LV8A 1XAGA 1HYGA 2R8YA 4M1MA 1QB8A 4HQ6A 1O7JA 5TDHA 1DMRA 1G41A 2HLDA 4BO8A 4J0FA 4UEOA 2QU8A 3ZY3A 2JFHA 2BD0A 1WNTA 3H1GA 5SYAA 2QGZA 2FR8C 5IF3A 1C9NA 1GRNA 3PXCX 1L4KA 4W9NA 1NYQA 3L5OA 5CB6A 3D7LA 1XZEA 3ZDCA 1YBFA 5AOCA 4ZQHA 1KF0A 4OLHA 3QVKA 1GCUA 1GTVA 2VZLA 5DBEX 2HNKA 1BGVA 2JGRA 1KFEB 1NV8A 4DWWA 2PPVA 4WACA 2NAFA 4ZVRA 2HLHA 1ZD3A 5EQJB 2HU5A 1TPZA 2HSJA 4DE5A 3NKVA 3A6FA 4Q93A 3HRKA 3B6IA 4MRNA 1KDVA 2OXRA 1PTJA 3B1KA 3VU8A 2A7XA 1AXRA 3OP4A 1D9XA 1GKKA 5LXTF 2O2XA 4F5ZA 1W25A 2GYVA 3ZWAA 2RGUA 3BORA 4H17A 1Z5UA 2Q4EA 4ZVVA 4II2A 1GV1A 1JPVA 3NEPX 4AS3A 2O19A 2NZXA 2Y0DA 3AB7A 2AEEA 2VH1A 2FHSA 3IILA 4RPLA 3ZGLA 4ZP1A 2A3NA 3D8UA 5KNDA 4N65A 3OI7A 2GM4A 4II3A 4B3RB 2ZG6A 3HM2A 5ALXA 3SBXA 1KJWA 4TRJA 3HH8A 5K51A 1WCV1 2C5LA 3QITA 4P5EA 3UM9A 1QU3A 4E0BA 1WPQA 3ENWA 3GK3A 3VR0A 3R9XA 1AA6A 1U2SA 1WHTA 1W30A 4G1FA 4W5JA 3WG9A 3NWJA 3PTZA 1V47A 2PWAA 5IUJC 4DSUA 4YMUA 1TJPB 1XZJA 1OXXK 4EHAA 1H94A 2PXHA 1ADBA 2RAVA 1X8XA 3DMFA 1GAEO 1QKJA 3LRPA 5D2CA 4ND5A 1RC1A 5FHRA 3WB2A 4FMPA 4P1ZA 4C6TA 3JAKA 1OKKA 2GERA 2IYQA 1G3MA 3QE3A 4L4YA 4RD4A 1LU9A 2IHUA 3ZHRA 2CT8A 1TQ4A 1HFKA 5FULA 5AK4A 2B0CA 4BCBA 1X8KA 3DDSA 2OD7A 3KEFA 4KR6A 3PR1A 4KXUA 3CMMA 2YWRA 5CRIA 4BVGA 3IIEA 4QDOA 1K9VF 5CA0A 1TUGA 1A7AA 2CBGA 4ARZB 3ELDA 1WD5A 4MV9A 2PUJA 4ND3A 5HRCA 1XXHA 1IAQA 1PFVA 4RYLA 2JEOA 2OZVA 3QK7A 5J1SB 3EPJA 3HGQA 4WKGA 1TUBB 2Q41A 1VSTA 4WOKA 1X7DA 2GRUA 3ZJTA 4QXOA 3DMTA 4NFSA 2YJGA 5EWJA 3UC9A 3NRCA 5IP5A 4BEWA 2EKPA 3F4BA 3WMXA 1SOWA 3UJ6A 2I2DA 2BJVA 2FDCA 1RRMA 1ZOSA 4YCDA 1DOZA 3ZDDA 4JVNA 2AZTA 3QVXA 4WXPA 4KUGA 1KBOA 3QLVC 1F14A 4D1YA 1XMJA 4Z5XA 5B6IA 4DPKA 2C99A 2BKVA 1D6JA 3DB1A 1LC3A 1WAMA 3GRUA 3ZTWA 3HFRA 1R15A 3U5TA 1P81A 4J07A 1TAHA 5F1KA 5AJXA 1I0LA 2OWDA 5FI3A 5SY6A 1CPYA 3SQNA 1LLDA 3CV3A 1PL6A 4Z86A 3DZ8A 1VI5A 4GG1A 3VTFA 1Q6YA 4YMLA 5LQNA 1IEWA 2Q6IA 4ER5A 2OCIA 1EHYA 3KO8A 2XCRB 3KB8A 4U1RA 4YRJA 5FUBA 1M6VB 2Q2VA 3KJNA 2XNSA 1DXOA 1PNOA 1QH8B 2AF4C 4Y7DA 4DDKA 4DLWA 5HKKA 3UAVA 2P6OA 2E87A 4TWAA 1B76A 1L9KA 2YFKA 2BHTA 4GPEA 1IC6A 3S1AB 5JAIA 1U2DA 1RCTE 1YJCA 2NSLA 4M6WA 3WK5A 4BNMA 3WK8A 4EO7A 1GPLA 2RHTA 4B7CA 5H4GA 3T5GA 2R25B 3QFRA 1CJBA 4EYOA 3JU3A 1H6DA 3HA3A 3ZLVA 2NTEA 1JNYA 2C96A 3HJRA 1BW9B 1KP2A 3I05A 4LKOA 1Z3IX 4CKBA 1QE3A 2VCHA 1EEHA 5DEOA 1JNXX 3K73O 1Z25A 4G01B 4ZAWA 2V7EA 1V9CA 2EBWA 2QN6A 4MITA 2C5EA 1O8CA 2R8RA 3AGPA 1BEEA 3IDQA 3PA6A 1KU6A 4JX9A 4AULA 3Q2IA 4OB8A 6NULA 4W5QA 1QP4A 4E2XA 2A5GA 1WQ3A 2GEFA 4HNAB 1O5OA 1D3AA 2F1OA 1HDIA 2QTHA 3RRMA 3ZYCA 2C42A 1DAIA 1XVAA 2X7XA 3DFIA 1O6BA 3FA2A 3GJ3A 4NK4A 2J5KA 1Z38A 2KS6A 2A1TS 2JKVA 3OY7A 3AUFA 4YCSA 1GDHA 4CT5A 1JKJB 4PV7A 1NLUA 3RVBA 4JI3B 2IOFK 3TOVA 4EHJA 3P9CA 1LV7A 2Q27A 1HMPA 1ZMBA 3PXDA 4LAFA 2XCTB 4PG4A 4HZGA 4PYIA 4MNTA 1EWQA 1X9IA 2VR1A 4BVEA 4CKWB 9ABPA 1XELA 1YXMA 4MTCA 4UQPA 1D5CA 2Z4SA 4F3NA 5BOSA 4L4RA 4HNTA 1F9AA 1GLNA 4P4TA 2PZ8A 3AESA 1CUFA 1DHRA 2W6NA 2POQX 1RWMA 4JUBA 5CHEA 5KTTA 3WLAA 2ZRHA 3IVRA 5KYKA 4K1XA 3ZGNA 1T4CA 2N75A 4W7IA 1CJKC 1NRIA 2CZGA 8LDHA 3NAZA 2FSFA 4KIGA 2DJIA 2KMLA 3Q6MA 4CV1A 2BEVA 2XWQA 3C74A 5K0GA 3A6ZA 1SWWA 2NO6A 3GT4A 3QJ5A 4G2NA 4O3FA 4UKDA 3BH0A 4D9NA 4TRMA 5C80A 4XAQA 2KBFA 3WV5A 3DKPA 4J6EA 4B4WA 2BMFA 4RGVA 4F6RB 1R4MB 4WXMA 2PXCA 3IC5A 1YZKA 1NVMB 3DMDA 4NEGA 4DKXA 1P72A 2OTCA 1OT3A 4EHIA 3GLQA 2QGFA 1I01A 3P2YA 4NMHA 4D41A 3BJZA 3M6WA 4V0ME 1HLFA 1Y8CA 2PLAA 2J0QA 1GA1A 1DAMA 1ONPA 2PE5A 2YCBA 3WRVA 3ZVRA 4LMAA 1C1YA 5MDHA 2HTFA 3CO0S 3GEMA 3ZD7A 4AZVA 1PJSA 1I2MA 4GMHA 3FWYA 2JLWA 3FNBA 2YRFA 4GMKA 1O97C 1Z74A 1XL1A 1IMJA 2VDKB 1YZVA 1IQUA 4RE6A 5JRDS 1EZ4A 2JFUA 2PGNA 2F90A 5JFOA 4WXRA 1CUCA 1VI2A 4XM1A 1UBSB 3BILA 3BUSA 4UQOA 1JMYA 5EJFA 1N57A 1W5SA 4QVGA 5J59A 1UZAA 2OFWA 1A98A 2AMFA 3NBYC 4S0ZA 1S8FA 3W5SA 1GZHB 2FN7A 4BLSA 5DU2A 2HWXA 3LL7A 4WKOA 1COZA 4ZGGA 4M1WA 3VKHA 2Z5FA 4RNCA 4X6LA 1A9YA 3GLGE 1HZZA 1IWPB 3GAMA 1V6AA 3ZE7A 4BS9A 3PSHA 4YAJA 1RI2A 2G82A 5EIXA 4TT8A 1U0GA 2IV7A 1YDEA 4ZVQA 1NPYA 2E4ZA 4DCVA 1WV1A 3A8TA 4CETA 1ORRA 4KQ9A 2Y1CA 4JXZA 3PJGA 1AC5A 3LK6A 3NNDA 3G68A 3TTWA 1YIOA 2VQ6A 4ABYA 3TK1A 2QRQA 4PAWA 4OXXA 2O1SA 3DOOA 4QTXA 5ALFA 4J16A 3QYFA 4MB0A 3UY4A 1QK5A 1VTKA 5DW0A 1UJNA 16PKA 4X8HA 1J8QA 2ID4A 3KRTA 4TKVA 1RWOA 3LLSA 5J63A 3C16C 1OYWA 4NX2A 2NQ2C 4RHTA 1JKIA 2VF4X 4OHVA 4Q66C 1RP1A 4Y2SA 5E2AA 1W5AA 4PZPA 5LUBA 2VQ3A 5EUQB 2AL7A 4OXQA 1J7JA 4JYPA 1JG1A 4L73A 1DELA 4JLUA 3KDAA 4HH4A 1LPBB 2D2XA 3KEGA 3IURA 3FD8A 6ABPA 1B1CA 3I32A 3HP4A 4RULA 1TXGA 2O3QA 1GTSA 2JLQA 2AIRA 4HWSA 5DDIP 2XWBF 2AOXA 1O77A 2RI1A 3Q1LA 4NSNA 3KKMA 3H16A 4L9AA 1XRLA 3AR8A 4J4HA 1NVBA 4ES6A 2NW6A 4ZTZB 1W7AA 3ZE9A 3EXEA 1KYVA 4MGEA 5JPIA 2FE4A 2V4ZA 3N3AC 1JJFA 3CH5A 2WJ4A 4G4SO 1H4VB 4WXYB 4DS3A 4FSDA 2QU7A 5IC5A 5T8KC 4P0QB 3CPJB 1BD3A 2FX5A 1OX4B 5CLLA 1NT2A 1KR5A 4MW9A 1UXHA 3W34A 5LCXA 3QUSA 4BVHA 4TZKA 4CG3A 1IXRC 1ZVMA 3EW7A 3P8ZA 1O95D 2X14A 4GUDA 1N9GB 5DKFA 5AP9A 3SDSA 1P2GA 1I0IA 3DJYA 4GRDA 1NVXQ 2X0IA 1SD1A 4Q4JA 3N7UA 3FR7A 1XDWA 3AYXB 3GRRA 4L5BA 4ZU3A 2LCQA 5K8LA 1THMA 2V54A 3CS3A 3KPUA 4N5NA 1WBDA 2POCA 3BMQB 6Q21A 2W2KA 1NE2A 1YVPA 4P3KA 3VISA 1Z7YA 4YC7A 3RSHA 2EERA 2PANA 3C6QA 3LWNA 2A78A 4KACA 4KFUA 4CIBA 2XVZA 1TOAA 4V3CA 3FPSA 3NMUF 1UK7A 4OD0A 3Q5GA 2YX1A 5H3CA 3ZUPA 3EEIA 2E4XA 1YQQA 2YWXA 4PNZA 4YMWA 4L22A 2G5TA 5EZSA 1QONA 2QSZA 1XMIA 2ASVA 2F3SA 3G0OA 4I1OA 1EWVA 3KC2A 2Z5GA 3W0LB 2XGGA 4EJSA 4IDOA 2J41A 1OBVA 4NMWA 5JCJA 1ZBDA 4OQZA 5FUWA 1CSEE 3VJMA 1QHHA 4TTIA 3W06A 5HIKA 1ONOA 1Q20A 4DDVA 4MWZA 4CLRA 3SR4A 1A7KA 3D0RA 4OPMA 1U0BB 4BBJA 4RZQA 1UJ4A 1DIOB 2XF8A 3RK4A 3T7CA 1SKMA 3IALA 1M10A 2CSUA 4JB0A 1NSFA 3MTEA 1VE1A 4YTEA 2F55A 1RE1A 1KDRA 3FTQA 3QVGA 1KERA 3RTAA 4IDEA 2R8OA 1FZTA 2RGGA 4IKPA 4YRRA 3IAUA 4BFZA 2P3OA 4JJEA 5EZYF 2HQ1A 4YRQA 4ADSG 1QDEA 4CMEC 1YJBA 3AHGA 3NBUA 1RQLA 3E48A 4KGVA 2XDYA 1HKUA 3AR2A 1QR2A 4QU9A 3U44B 1FSGA 3KXIA 1I4EB 4L4ZA 2FP3A 2W90A 2WHRA 3TPCA 4EJ6A 4BYMA 3AUTA 4EA9A 1GARA 3AFIA 4JJGA 1QK3A 2ZUFA 1F48A 4Z9FA 3TEMA 1JHYA 1GZSA 1T15A 1J0EA 2IDJA 1PJRA 1WMFA 2ACWA 2P7IA 2VJAA 3OTIA 3WQHA 1IOZA 2ZVQX 2RGAA 3B3FA 1VRVA 2OECA 4MI9A 1J0AA 4NBVA 1O87A 5DF1A 2IK8A 1YTLA 5LOVA 3O31A 3S2GA 2OO5C 1L5QA 1QYIA 1CB0A 5B2ZA 1UH5A 1Q0SA 2GUWA 3CXRA 3WK4A 3F6SA 4BEVA 2HSEA 1QZZA 4NJOA 4QVIA 1XZBA 3DAFA 4BGIA 1P29A 4W5WA 3V00A 1PR6A 1PWXA 1QFYA 2R97A 2Y1LA 2ZTSA 4RY2A 4C88A 3CG4A 4FXOA 4ZMRA 4U8GA 1W0JA 2VHQA 3DZBA 5FLEX 5A0VA 2HNBA 4TVKA 4A6DA 2OG1A 2QF7A 1NIPA 2VO1A 3WZLA 4QOFA 2V7BA 2R6ZA 9GPBA 1JLKA 3V8RA 4MULA 5BRAA 4YYEA 3CH7A 3ES9A 1GSIA 3F6PA 4MQFA 4WMLA 1SBQA 3AJ8A 4E12A 4GWKA 4HQNA 4X3PA 3V4VB 4TLCA 3DBHB 2JARA 1E92A 3INYA 2EFEB 1TJ3A 1E3IA 1MGPA 2W6PA 4DHEA 1R0KA 2FB9A 3JPWA 4LNUB 2QP3A 3CKLA 3EC1A 3PX3A 2F3UA 4NAHA 5IRCD 2PRZA 1ZC4A 1G5PA 3CF0A 1J9ZA 1POXA 1SCJA 3KB1A 4WUVA 1XTKA 4TL8A 3AJRA 4RF5A 1E2KA 1JR4A 1U9JA 3PIIA 3QQPA 5A62A 5LMNB 3A1UA 5CX4A 3BSYA 3OEEA 3QM1A 2LGJA 2XY4A 1IHUA 3T9DA 2PVPA 1OFUX 2VH2A 4DAEA 4Y2JA 3CU5A 4LZAA 3T9BA 4ME6A 4R3UC 4HRAA 5K99A 1Y33E 1V2GA 1LDYA 3Q41A 5EKUA 1GTMA 1N2CB 1I5EA 4CMBA 3ZY5A 1GTRA 4BX9A 2WPDD 3L6BA 5AW5A 4Q3DA 1CP3A 2IP1A 4JLWA 1TEZA 2ZR7A 4DJTA 5HZKA 1VPWA 3WRWA 3HA5A 4RMGA 5HJ7A 3NS7A 4QE3A 5CDHA 5JADA 2BEJA 1EVKA 4IJKA 3BWEA 2OHVA 3AR9A 2J08A 2IH2A 1NXQA 3RVKA 4R6XA 2RHLA 4A36A 2W42A 3ZCVA 1DX6A 2BKAA 5L95A 5JSZB 2PUCA 4Q9AA 5CDUA 1YQ9A 1JJIA 1ZN8A 1K89A 1K7FB 1TJNA 2Z9CA 3D3WA 2VA9A 3NAQA 3ADPA 2VLIA 4C4OA 1NM5A 1PEKE 5G0TA 2EX1A 1OTXA 4BQFA 5KOIA 3CLTC 1S6YA 3FOEC 3T12A 1GPMA 2C94A 2J6IA 1Q21A 3QYJA 1M8GA 1S2MA 3R76A 1XQ9A 1ADGA 2BM0A 2F8TA 3HBJA 1EZ1A 1PNRA 1M2FA 4ZC8A 1M6NA 1SVKA 2J4CA 3K8OE 4J0CA 1FB5A 4IV8A 4TSRA 4U0KA 4FKMA 1G8KA 2GPTA 4GEGA 3ETCA 3AFOA 1BU8A 3ZIAA 2C3YA 3OKPA 1OAOC 4NFHA 3RS3A 3DFUA 5HMMA 4PBSA 3BDIA 3ICPA 1P2SA 3N70A 4FFRA 3A05A 2Z43A 4GKKB 2WY2D 4LRUA 4FOPA 5F4ZA 4TV8F 4LQCA 3OSZA 3BDVA 1TJYA 1BX3A 4HAVA 2GR9A 3OIUA 1E2IA 2DE0X 4O6VA 1MQAA 5DTMA 1A9OA 4B3HA 2X0KA 1Z0KA 1LPAB 3DV0B 2VNIA 1AKUA 4LS3A 4RK5A 4AZSA 4ILKA 4OYLA 1KOJA 2QX9A 3SR3A 4GMGA 5TF0A 5G02A 2FZGA 3CA8A 4FOLA 3AFHA 3ZBUA 4BLTA 3HVJA 2QAJA 1K4MA 2YXPX 3SEAA 2PA0A 4G0NA 1P5JA 2VLBA 3PNKA 4NH0A 2GLTA 3I0ZA 5D8DA 2NUPA 3QUQA 3QY9A 4YJFA 3PRKE 4RGQA 1KYYA 4C5AA 4CUJA 1O95A 4B45A 2OCGA 3TTUA 1QV6A 4UOEA 4MYTA 4BZWA 1DPFA 3WB0A 4A7PA 2ATXA 4TYNA 3IAHA 2F1IA 2LRHA 2FEMA 4N0MA 3FWPA 5BN3A 5JI3E 2G17A 1PJCA 4DPMA 1ICEA 3K71B 3HB9A 3BG5A 1Z9BA 4ROSA 3QBEA 1VLLA 3UAGA 1CY7A 1N8NA 3NYQA 1MC8A 1R8XA 1CU1A 5AHOA 4UZSA 1ULTA 5FBVB 5FQOA 3FB1A 1W76A 4E03A 3VJKA 3ELYA 1C14A 3OZAA 1JIUA 4H77A 4HX2A 2GCOA 1IG3A 2C4NA 2RGDA 1DV1A 3BE6A 3X1KA 4AJHA 1E3SA 5CBPB 3W8NA 5L3SB 4DG5A 3GJ7A 3FGPA 2B83A 2CJWA 2DBYA 3R0XA 2IOQA 4LDJA 3TJRA 3D2AA 1VIDA 4YPOA 3LX6A 1HNNA 2G7MC 1Q1GA 4R5MA 2QVYX 4F5WA 4XIIA 2YZMA 4DLTA 3NJRA 1X7WB 3O8LA 2GEDA 4MA0A 3VDNB 1NMQA 3N2ZB 1NJGA 3RRZA 1HUQA 2GASA 3SM9A 1I1NA 4TGLA 5IKPA 3CR8A 4XH9B 5BSWA 4Y2HA 5GV7A 2ZB4A 1SVOA 3ET5A 4ZV9A 4JLAA 1EG7A 2A5DA 1LI7A 3K6SA 4KIJA 3V1UA 3AZOA 1FYVA 5DTJA 3ZH2A 2OQIA 3PQFA 4JP8A 2A5LA 1W29A 1IZYA 3M6VA 2CNOA 2J85A 3MYRA 3WWOA 1GCAA 1Q83A 3P32A 4HDRB 4BNYA 2AYXA 4KPGA 1IQPA 2FRDC 2IVFA 3WAGA 2DY1A 2W2LA 1OCEA 4KE6A 4C6SA 1RPNA 2VOEA 5ALHA 3A1WA 2XQKA 2CL5A 2ECQA 2GPNA 3LXXA 3PXUA 2ZZNA 1P3JA 1QTIA 5AHXA 4F45A 1A5AB 2QN9A 2X0JA 1FDSA 1TM2A 2YFYA 3PQEA 1RM4A 3IHWA 1E2NA 1BQ4A 1FBNA 1N6LA 5IVKA 1F8XA 2ORWA 5AJYA 3HACA 5D51S 3LVBA 3ANTA 2QI9C 2D0DA 2ZUVA 4UM7A 4EG8A 1EHIA 4RHUA 4L02A 3SMVA 4RHCA 2FFBA 4GVXA 3V6LA 5FPTA 4NCIA 5L53A 3MCTA 3T3OA 2NPFA 2CF5A 4CM5A 1CETA 4XQEA 1ISHA 2JFPA 4MEAA 1P1HA 2Z6VA 5IF9A 5EJ4A 4YDQA 1PVDA 4PCUA 1L6IA 3CMCO 4YAWA 1BSVA 4JR2A 4HDKB 2JFGA 3HUUA 4Z0NA 1LTQA 2C8KA 2O5VA 3TX2A 2YZNA 4MPPA 2IDMA 4B34A 1PGJA 1KSFX 3RC3A 1GNSA 5ALGA 3B3JA 2K7FA 1I5RA 1IWBB 1Q0RA 1E63A 4X44A 3IAXA 2ANBA 4N8DA 1GNRA 1XZ8A 3LI2A 4ERNA 2QHXA 3I3SR 1K7XB 5AVVA 2XTMA 2WV9A 3PICA 4DV1B 3HP1A 1JDBB 3NIFB 4HEJA 1X80A 2FUEA 1KO4A 2HK9A 3FNEA 3JSXA 4DY4A 4F5EA 1JSRA 4BO9A 2X9QA 3LQ1A 1UK8A 2WM2A 5IJXA 2CV0A 3QWFA 4UNIA 3T3PB 4OI4A 3AUYA 3K35A 4QGHA 5HK9A 5C53B 4A4DA 1VJ0A 2ZBVA 5G40A 3MJRA 3MZ0A 4RIFA 3D4IA 3K5HA 4EG1A 5AW7A 2ZYHA 3RAPR 3L6OO 2Z8YA 2AUNA 1KK2A 4QOHA 3KDPA 4QQFA 4TVBA 5JYCA 2PZMA 2DXIA 2OBMA 3KCQA 3S68A 4Z7JA 5KVQA 3L5KA 2YJNA 2J6CA 4L3WA 5H7XA 1CKEA 4CVNA 3A1SA 4Y2GA 3E7PA 3EVTA 3I2GA 1ZD1A 3VR4D 2G3YA 2QVZX 4OMFG 1TI7A 5A05A 4B4DA 4MWBA 3RV3A 3H5WA 2BCJQ 4F8JA 1FYEA 3ZE6A 1SZJG 1P80A 4GLLA 3IBSA 4KR7A 1KI8A 2WOOA 5DV9A 2R4TA 1GNQA 1G6KA 1Y5MA 2B8EA 2YQ5A 1VG8A 2GN6A 4FHFA 5ALEA 3DEZA 3ZLTA 4NPHA 1IVYA 1FE8A 1WLSA 3KNZA 2ATVA 4C43A 2ZETA 4CMIA 4H15A 3V2UA 1J90A 4KVZA 4WZBE 2VQEB 1TPYA 3WGYA 1V0JA 2V8OA 5EJEA 1EINA 2C2XA 1DEKA 2QRLA 2IODA 3EYAA 3UW3A 2JIMA 3MMZA 4FGWA 1QOQB 2D2EA 2RIRA 4ITVA 1M3SA 4O4LA 4DMCA 1M72A 1HYQA 2A58A 4BV8A 2PEYA 1DXYA 1G3QA 2YR0A 3EZ9A 4H7EA 3DNPA 3DOCA 4M54A 1YR9A 3UG7A 2J9FB 2VN8A 4KSCA 4DB4A 1D1SA 4NARA 2FGJA 3IE0A 3BXOA 3RIGA 1ENPA 2O57A 4P3YA 3DOHA 4JQOA 1O94A 2FZVA 2W2VA 2H1CA 1CP2A 3AWIA 5CNJA 3HVKA 3PDCA 1BFDA 5FOSA 1EBBA 3BMCA 3OO0A 2YC4C 1RKBA 2X8JB 3FY4A 2ZJ5A 1PUIA 1XTIA 1X7ZA 4YJ2B 1FLNA 3KQPA 1UM8A 1KXZA 2ZWVA 4P0TA 1RLJA 4FKZA 4NBUA 2F7SA 5BT8A 5C8DA 5DGHA 3WHKA 2R68A 2YVQA 3OX3A 1CUUA 1CVLA 1S2OA 2PMCA 4ZAFA 1QTNA 5LM3A 1YZTA 4JUAA 4NBTA 2VNSA 5A5FA 4M1TA 5C8YB 2H52A 3GYGA 2G5PA 1ZY2A 1QANA 4TTVA 1JPNA 2C7GA 3D1VA 1C1HA 3PHHA 1YRYE 2AHOA 1CY6A 3WWCA 1Z8DA 4MMZB 2NMVA 3DMNA 3GRPA 1PGNA 1ZXLA 2XCIA 3DFZA 2YIJA 4GWLA 2OPBA 5L6MB 1ST3A 2VHUA 2ISSD 4AF7A 4JLJA 1KIFA 2RHMA 2NOAA 1H2XA 4XFDA 4YN3A 1V8ZA 3FKJA 1E3MA 4DMKA 3BGOS 4XPIA 5C7IO 2BFPA 1L4EA 1QC5B 3LDFA 4BMDA 1XRNA 4Y2TA 1QVRA 2BHNA 3BXEA 3AM5A 4X24A 1QG2A 1XRQA 2R6HA 2WD9A 4MVJG 4KREA 3PCXA 2ZS8A 3CUWA 4WNIA 5EIFA 3I4CA 2EGHA 3QIAA 5DSXA 4PINA 4AMYA 1JAZA 3FLAA 3LQ2A 2OD2A 1OW3B 1O03A 2DETA 2EKDA 5DGCA 2C3MA 3EY9A 2A9RA 3FHLA 1CT9A 3T7DA 4MV0A 1G5HA 1E99A 3O0TA 4E4RA 4YBZA 2B2NA 3A1CA 2B1RA 3A7EA 2C5BA 4LGMA 4PIVA 1KK3A 4L7QA 1Q5PA 2WSMA 2C9CA 3RUEA 3QBJA 1A2KC 2CEAA 3RE1A 4CTNA 2NU8B 3QKIA 2BF4A 1NBAA 1I6MA 4FDAA 3FPAA 1NU6A 2FSVA 2C7OA 2BE7A 1I2CA 2FPLA 4HGZA 1ZCAA 5ADWA 4YMIA 5JMOA 1E2FA 2ZIFA 4I14A 1OREA 1TL7C 1ZGGA 4NV0A 2BFCB 2V45A 1N36B 3LUJA 4DM3A 3AF1A 2IYLD 3JVIA 1E3JA 3F98A 3OJWA 4Y6SA 4OSOA 3PFWO 2HH9A 4OO3A 1PL7A 2EWMA 3KT6A 3AR3A 3KUXA 3L4BA 4P54A 4RFVA 3ZBTA 3AR5A 3LFTA 4DSOA 2YMPA 5MN6A 2DR2A 1UDWA 2HF9A 4B2YA 1Y8QA 1VCIA 4M76B 4D0RA 2B3DA 5CM8B 1C81A 3OD1A 5CB8A 3V4FA 2QW0X 3EF3A 1D03A 1USKA 1M1YA 1Y1SA 1KYQA 4OFZA 1P6QA 1SXJD 1QG0A 1YHYA 4P5PA 1W47A 1II8A 2OXTA 1A5ZA 3A0RB 3ZQUA 4FW8A 3CZMA 1GSOA 4LG1A 2PUHA 4LSMA 3A6PC 4KW7A 2FMXA 4M53A 1LTHR 1WZEA 1LQ2A 3IUQA 3OBBA 3HEMA 5LXTA 4UNNA 1BAPA 4B35A 3O3CA 3T5CA 3ZJ4A 3S40A 1EYZA 5LP6F 3RLFA 3UGTA 4BUCA 3VPBA 1DEHA 1H6BA 2H8KA 3A10A 1OIXA 3PXBA 5B57C 4Q1FA 4UTZA 2V7WA 2G8NA 3BFVA 4DW8A 1FSZA 2V4MA 3D6UA 3DZJA 3ORYA 5AOVA 2J67A 3X1WA 1WU7A 5ECGC 4R01A 4BKOA 3GCXA 3OTQA 4PYKA 4OG2A 3EQ7A 1OBCA 4MS4B 3RJMA 5F2OA 1ZGCA 1YS7A 3DWFA 2F1HA 3UA4A 4EELA 5FAKA 1OBHA 4CEIB 1QIDA 2ZRKA 4FHGA 4BL5A 4MKGA 3HL4A 3SS9X 3PXAA 3F9RA 3S8YA 2DQZA 1R66A 3VVCA 1VKRA 4FBLA 1TC1A 2WB2A 3CLKA 1M2WA 3KDSE 2CV2A 5G4KA 1DOAA 4QJ3A 3V7UA 4NZ9A 4Q7MB 3FTDA 4A5SA 3EDQA 3BF8A 1FFWA 1FVFA 3HB4X 3REOA 3EGDA 2YH2A 4L72A 2KW5A 4MZDA 2AMLA 4Q16A 4HMOA 1D2AA 2FLKA 2IS1A 1ECPA 2B1JA 5TQVA 2HA6A 4P2GA 4ITRC 4R1NA 5DYNA 4AX4A 2RGEA 2PBRA 3OEWA 4A8JB 3TNFA 4F9FA 4QYSA 1YAJA 2X9NA 1Z4JA 3MFQA 5I6DA 5A4KA 2BJWA 1DPGA 1K5HA 2I2AA 3PLRA 4LYFA 3AOEC 1Y3DE 2BFEA 2Z1NA 1E0SA 1XQ1A 2GBLA 3O4GA 3PX2A 4H7KA 3DSRA 2UZ1A 4M7WA 3KEOA 4O3MA 1U2GC 2VZ0A 1R6VA 3ROQA 1AUOA 2RGXA 4URWR 4F96A 4HEA1 2E21A 2FNAA 1OH8A 1B2LA 5TT1A 4RTKA 2GBPA 3GDWA 5LYJB 4KUHA 2PAFA 2CC2A 3NRJA 4C0HA 1T8PA 2C95A 1QE5A 1XR3A 4S24A 2WPNA 1N9KA 2RBKA 2GAIA 2HJGA 4BWFB 3R9WA 5KYWA 3B8HA 4BZZA 4EGFA 1NJ5A 3LRXA 1M66A 2FEKA 3T06B 5JNWA 1VMAA 1VLVA 1KI6B 1UDCA 1UKYA 3EZ7A 4JCCA 4MV5A 4N0EA 3IBCA 2YDXA 1P44A 1SCUB 3F3YA 3MF4A 4NYJQ 3SNHA 2HYIC 1FFYA 1FJHA 4IVNA 1EUCB 1M5UA 4BNKA 2OE2A 1M75A 2HRCA 5E9JA 4C2TA 4RXTA 3CUVA 4MWSA 4ER3A 3LBYA 1T1RA 3RG8A 1WJGA 1YB4A 4PRLA 5BYAA 2C9YA 3V8VA 4RAQA 1HT0A 2J45A 3LQQA 2PTHA 3U40A 1CC1S 2NXCA 3R41A 4YWHA 4BP1A 4F6CA 2OMKA 3BF7A 3AP2A 1KJ9A 3E8SA 4MKFA 5A7HA 4EUSA 3B3GA 2GTIA 3NU1A 1CW2B 5BVHB 5I7OA 2CJXA 5JD6A 4RK0A 3UKJA 1R0SA 4AJNA 1HY3A 3DTVD 5C0OE 3TZBA 1RJDA 6CHYA 1YGPA 1SKUA 2QPOA 4LBWA 4KPFC 5B7QA 2VI5A 1IHYA 4JGIA 4JSRA 3T0FA 1XNJA 2Y93A 2CCGA 4YV7A 3X1ZA 3PLAE 4IDQA 3LHKA 4YAKA 2MDTA 1N9ZA 1GGNA 4DJAA 3VZSA 1GKYA 3OU2A 1YU9A 3H13A 1WF6A 4M9QA 4QUEA 1U8FO 5T5QA 4D9BA 5LZ5A 2JIBA 4YT5A 5AM0A 3SHOA 1D7OA 4R41A 4I66A 1RXIA 4G0XA 3X3HA 1CDEA 1JA0A 2V5UA 3UC5A 2W4QA 1Z4PX 3KLNA 1U02A 3BX1A 4EVIA 4HRXA 4OSEA 5FA6A 1H1TA 2HJRA 3DMHA 2E4AA 1RZRD 4NZOA 3BAFA 1SR8A 1PT6A 4B87A 2LKCA 2R4QA 2DWQA 4MUJA 4P7BA 3UMGA 3NHAA 4WERA 1A3CA 1G1AA 3HV0A 3HDTA 3G17A 2CJFA 3I6ZA 4Q1AA 4A26A 4BOYA 4NNPA 4M88A 1DJMA 4KVGA 1O6GA 1V3UA 4MWGA 4W1RA 3PPVA 4C29A 3OX4A 2Y9PB 4JASB 4G0WA 1WEHA 1CX9B 1OBOA 1PNQA 2QW1A 3LCCA 1UBFA 3QEKA 4PRZA 1U3VA 3FTNA 2B9VA 4KDRA 2VPTA 5A4MS 4HFNA 5CEJA 4UTNA 1A9ZA 4ZO9A 1T9KA 3JZAA 4QECA 1KGSA 4MV8A 1SHTX 1LWOA 4EKEA 2WE8A 4RSMA 4RMIA 4PX5A 4Q37A 1GQOA 3RC8A 1J24A 3IVXA 3JQAB 1JIVA 1HTBA 2BI4A 3AUJB 4HTFA 3CH6A 3L2OB 4CL0A 3LY7A 4LV6A 4EHNA 2VQSA 4F3YA 1DKMA 2DHQA 2YNMC 2C2HA 1UPCA 2DH6A 2FP4B 2JF0A 3FPJA 1EUDA 3FVVA 3L4JA 1AKWA 3K2EA 4ESOA 5CAEA 4XWWA 2XXAB 4LHSA 4FK8A 1IBRA 3EOZA 4TLAA 5TPZD 2XVYA 3V32A 5KYYB 4CV2A 3AL3A 4OU4A 1U8XX 3V1MA 1FFBA 1K68A 3O1IC 4BXOA 2BGTA 4N48A 3T7RA 2GZ2A 3ZVKA 1C4OA 4JC8A 1APBA 3GVPA 1S89A 3IVMA 5CDFE 1ZD5A 5GAJA 1TYDE 2DMRA 2IQIA 2W11A 1ZNQO 4S1VA 1UOOA 4NR0A 3VNSA 1SVMA 2IEZA 5LQDA 2CLIB 3N2IA 1SUSA 1BHO1 3KP1A 3LUDA 2P90A 3G23A 5BMVA 3QWBA 2H17A 2X5KO 4LCBA 2GF0A 1DRWA 3T3IA 4UEJA 4D25A 5A9SB 4LA4A 3TFOA 2G40A 1VGVA 3HTXA 5BSHA 3B51X 5K2OA 2XVMA 3JSAA 5E6RA 1FFDA 3QXCA 2EBFX 1JLLB 1QQ6A 4IH4A 4TTPA 4TS9A 1PD1A 1XLVA 3TLGB 3VR4H 4D44A 2GD0A 1H3EA 4CMAA 5J2UA 1SXJA 1YD7A 1ESMA 1G98A 1KU0A 1MRSA 2HQSA 2NZUG 4CM1A 2WYOA 4IINA 1HE1C 2X2OA 1SIWA 1SC3A 3RFVA 1NBOA 3WIEA 2QZ4A 5A1TA 1CS4C 3B1VA 3B3AA 4BZXA 1ZH0A 5F9MA 1O4VA 1Z28A 1H65A 5DHSA 3V8EA 4C0KA 4L50A 4NBNA 4L5JA 1V4VA 2ODWA 1EFLA 4ZTBA 3IP1A 3A2NA 5AVQA 4KRFA 3DOIA 3WOHA 3ZQ6A 3EIHA 3OFND 2WJAA 5JZBA 3ICCA 4MDYA 5BNZA 3RT9A 2IXFA 2NAPA 4RF2A 4GX5A 4QICA 2RC6A 3ZBPA 4L8VA 1J8FA 1U8CB 3DP9A 1TMGE 2R79A 4K8RB 3VI4B 1N5RA 2O2ZA 2GEUA 4BNIA 4C07A 4GOLD 1P17A 4OXRA 1Z8NA 3DDUA 2OBXA 4H0NA 1XTPA 1GRVA 3IP7A 4WFIA 5EGSA 2LDXA 3SFVA 4C05A 2DPGA 4FUQA 4MW5A 5HRAA 5LUAA 4EB6A 3AF2A 1NQWA 1PG5A 2DCMA 2DU8A 4WLVA 4DUZB 5LZ9A 3OE4A 4US1R 3VI3B 2X5JO 3OX2A 2F3PA 3KIPA 1UMBB 3TTYA 4K6FA 4ESHA 3AZPA 2JGMA 3ND8A 1L5OA 2FWBA 2E6UX 2QR2A 3BBLA 1UQUA 3H1PA 4KXVA 3AR7A 1Q95A 3TGWA 2BFBB 2QRMA 2KX7A 3BKXA 1G64A 1QRTA 2ZR0A 1TM3E 3MAAC 1T25A 4GVLA 3RABA 5A4DA 5I51A 3M1AA 2A1UA 4Y18A 1MZPA 4JOQA 5ENVA 5I8ZA 3IUEA 5KAMA 1NY6A 3DF7A 3ZS9A 2X3UA 1YKSA 2J59A 3AG5A 2QBYA 2MSKA 4ZIRB 2NUBA 1BS9A 4RTQA 1FC0A 1CE8A 1SBCA 1S3FA 2GESA 3KPVA 3FFXA 3RLIA 3TVTA 1DT3A 1GXSB 2H1SA 1VHTA 2WAOA 4OXNA 3IP6A 4F8YA 1SA0A 4G4JA 1OX5A 2XGMA 2F00A 2D0IA 4RVHA 1DQSA 1FRQA 2LW7A 3HJHA 3HSSA 4QOEA 2V3VA 2WNSA 2OP0A 3OIVA 1Q3HA 2HWKA 4YCJA 1Y3IA 4H3KB 2AE2A 4B7ZA 2C00A 2QMYA 5B6JA 2ECKA 1BVHA 3G2MA 3HBMA 3ZEAA 4PS0A 5A6SA 3SWWA 4B3FX 4RZXA 3ZWVA 4FS8A 5ICEA 1ZMOA 4GR4A 5D6NA 2RKWA 2XUKA 1EDBA 1CYEA 3JX9A 2FMUA 4EJ0A 1QFMA 5ALTA 3NR2A 3DMPA 2ZE7A 2B4KA 4X41A 5EWLB 1N7JA 1M2HA 4XASA 3TDNA 5KQGA 5K2MA 3NIWA 1TLTA 3DTVA 3QV1A 1BVRA 1NVVR 1JHVA 1D2MA 1XHFA 2GHIA 2WJYA 2LPMA 4MCHA 1P5HA 2WKPA 3QX7A 4N6NA 4AKTA 3U80A 1MORA 3GZ4A 1JYFA 3PVZA 1Y5LA 2ZRLA 4TKUB 5HIMA 4F85A 2FFHA 2W83A 2C4UA 2IIBA 2PYDA 4KR0A 2X23A 1MKYA 1Z8FA 5T57A 4DQ0A 4OOFA 4CIAA 4IZOA 2JFQA 2WG2A 2PL5A 4HYYA 3OCWA 3H9BA 4FMDF 5C5CA 2VXYA 5JRJA 2JI6A 1A8PA 1F8YA 3CVUA 1NW7A 3DNMA 3PLNA 3CLUD 4WCFA 5EVCA 5HF8A 2I34A 3Q9NA 4E4TA 1GQQA 3T95A 4LXQA 2GN2A 3ND7A 4LZPA 3BIJA 1OFTA 5FIUA 5AQEA 5M29A 2I2BA 5CXSA 1VPEA 4IOMA 1Y9DA 4I6EA 4YGYA 3NDRA 5ESXA 4GPZA 2WJWA 4MV7A 2VP3A 4HY3A 1OMOA 3D8BA 3G2OA 2ERYA 2HBRA 4BFVA 2NU6B 2YY7A 3I9OA 4MW6A 4QUIA 5H59A 5CFLA 3RR2A 4BO7A 1JZQA 2QW8A 2ZS7A 1PE0A 3KXKA 3WB1A 1R27A 2DTDA 4LY0A 4TYQA 3QI7A 3PGLA 4OB7A 2IS2A 1SBZA 3PENA 4IZHA 3RVLA 2AFVA 3LXRA 3ZK9A 1T2AA 5J2TB 1LSOA 4LJ5A 5CVVA 1Y6JA 7AT1A 3I9KA 5KWEA 3IQHX 4JT2A 4LISA 4LXYA 5HFNA 2ZYUX 3TLKA 3WKEA 5ABPA 5IWAB 1ZIDA 1ZITA 2HF7A 2XNCA 1ZOPA 3R2JA 5F3RA 3KT0A 3E58A 3OLXA 4YYZA 2O2GA 4MEBA 1J8VA 5A5EA 4MQEA 1V5IA 2UKDA 1MIOB 3A06A 4PZ0A 4ZKDA 3GC6A 1YVDA 1Z6XA 5ALJA 4MRSA 2ZRCA 3BK2A 2X19A 1PS0A 4X71A 5CPFA 1DJQA 2AMYA 3ZK8A 3WGVA 1Z8HA 4JI2B 1PVOA 3LBIA 1X8JA 4EHHA 1NNUA 2JCVA 1WB4A 2P2SA 2JGAA 4R71A 2JGNA 1DKUA 4M0UA 4UUBA 3F7OA 3W3ZB 5HDQA 2D06A 4B85A 1E1QD 4HWRA 4MV6A 1A0OA 2GCNA 3K1AB 3NYWA 4RANA 2W2OA 5ALLA 2ZUTA 3IBYA 1NX9A 2X6QA 3K1JA 3CONA 2FXVA 3SYTA 4DMHA 1ZHFA 4S3MA 1OXSC 2ENWA 4C0AC 1GGVA 1RLMA 2QRVA 3KLPX 1LF5A 1ETUA 3A37A 1KDTA 2C77A 1IZ0A 5CD9A 2FFQA 2PDAA 1ID1A 1FFXB 3UUFA 1JQDA 3WSWA 1GLVA 3UXEA 1Z39A 4NZMA 3UKDA 1L0BA 4R40A 3HY6A 3ORQA 5LL6P 5TARA 1EUZA 1YR6A 2VP9A 3BMNB 4N39A 2ZLBA 3MLAA 4HRVA 2DYKA 2OHJA 1M5TA 4EABA 4A1OA 4EECA 1YCFA 4PVCA 4R98A 1KEWA 2ZI7A 1DTEA 4G89A 3A6GA 5AESA 4AMZA 1RHRA 1Y7TA 3WMFA 1B7GO 2PS0A 1KGDA 4D99A 3IIJA 3IQFA 2SICE 4BNGA 5DGDA 3V8BA 4C4RA 4YAIA 1XWWA 4DLVA 4BBZA 1FFEA 2JKZA 5ALVA 2P75A 1QIMA 1V41E 2EZ4A 4HLUC 3EXG1 3FUUA 4M98A 2WF8A 4XKJA 1N0HA 3R6WA 2DBVO 5IC6A 5KTRA 1DEXA 2ECPA 3GGOA 4L1KA 1PW7A 3UWSA 1P7CA 1JVNA 1L4GA 1KO7A 2Z98A 4HEA6 4OH1A 4WGGA 1OSNA 4IQ4A 4P83A 5JSUA 2YXDA 4RPIA 4RJTA 1MHTA 1H1LB 2PPLA 1XK7A 1R74A 4JBIA 1GFWA 2QM3A 5THQA 3H04A 3B9QA 4XYEA 2YMLA 3GFBA 3VZRA 1E96A 3TN7A 3IKVA 4DMLA 4HH0A 3F6CA 1THTA 3ZXXA 3BZBA 3HV2A 4Q3OA 4DM4A 3GDFA 3WLTA 2PKQO 4JQSA 2ZUBA 3HN7A 4IIJA 1G5QA 1HG1A 1CY2A 2XWJI 5CLIA 5DOZA 1T1IA 5U4XA 1SG6A 4BE4A 1H2HA 3E81A 3WOVA 1ZISA 3ZDRA 1TMYA 4MO2A 1KMMA 4IZ6A 2BH2A 3SZ3A 1Z34A 4IIXA 3ER9A 2YHAA 2XIQA 2BELA 1O2DA 3ZD9A 1LK5A 3RTBA 3ORSA 1ZNZA 4BTLA 2PV0A 1Z4KA 4BGUA 1NTOA 3AILA 1MG0A 2SKDA 4ILEA 3UHJA 1OD6A 4E09A 2I4IA 3AUXA 1K4KA 1M34E 1QCCA 1K97A 3IMGA 4I9HA 4UVEA 2VNHA 3X1DA 1VE5A 5CVEA 1NOIA 4E1VA 1U7XA 3NXKA 1X7YA 3VV3A 1VJ1A 2H5IA 4XSGA 3HVRA 1MO4A 1KEEB 1EVZA 1C8KA 3GJYA 3HABA 4DAOA 3PHLA 3AETA 2PEZA 3IB3A 1KJJA 3RS8A 2OXEA 3F9IA 1AV7A 3FWHA 4FCCA 4JOCA 4RZ3A 1HSOA 1RT9A 2FWMX 1N2SA 1WXDA 4B6RA 4G8JA 2G83A 3A3OA 4J4TA 2VK8A 3M6XA 2HJSA 3NP7A 2EGGA 1T9CA 3QMMA 4RLFA 4ZC1A 2PJRA 1H4TA 4LFBB 2Y1GA 4WFJA 2HCTA 4I1UA 3BCSA 5IYZF 3HCRA 3PE4A 4ZV4A 1C2TA 1GHTA 4CF7A 2CLSA 5IM4A 3N5CA 4ED9A 3Q40A 4LWQA 3TXXA 1J8MF 1ISRA 1QZUA 3AHJA 5ICCA 2A59A 4OGGA 5K4AA 3V1YA 3CLSC 3ESAA 2GJAA 3KAKA 2KBEA 1H3NA 2PTGA 2PZAA 3O73A 2QRGA 5AO9A 1C3LA 1CJUC 5G1NA 4I1RA 4LEIA 3R3WA 1JKXA 1V5FA 4Y2VA 3R9KA 5FV4A 3R7WA 4PRKA 1AJEA 4UMEA 2O0KA 2O0JA 4U02A 2C4MA 2ZJ3A 5CU7A 1MU0A 3C6MA 2DPXA 1FSSA 4G56A 5H4HA 3TNYA 1YUNA 1KYWA 2ORVA 3QA9A 3CZCA 3GLIE 2FFAA 2ZOSA 3UUEA 1IYZA 2C0CA 3L7BA 2F43A 1YOVA 1AKMA 3CYFA 4P33A 1G38A 1YL5A 4IO0A 5FI1B 4D80A 2MSWA 1G8JA 1M8FA 5JO9A 4TV9A 2ZYSA 1NT4A 3HKDA 2ATCA 4EY6A 4RHFA 5IJZA 3V5NA 2NU9A 4HX5A 3W5UA 3ZJYA 1OV6A 5CCBA 1XJCA 5CR9A 3ORHA 4O5OA 1VA5A 5CLHA 4YROA 1RRCA 4HB0A 1ZVVA 4XCQA 5DMXA 3JTEA 1ACLA 1B41A 1ORWA 4WLUA 1WB6A 1NW9B 1STOA 3HXOA 1WZUA 1CR0A 2IDKA 1PL8A 1N25A 4J49A 3WNBA 3KTAA 5HWSA 2AQ8A 4E4YA 1I2AA 4URXR 3KQYA 4RKEA 5FTJA 3ZCPA 5LDGA 5KTNA 3OLYA 4C7JA 3EFHA 1LLQA 2WKRA 3BFPA 3NHWA 2I80A 1QGZA 4KWIA 4NU6A 1URPA 1WV0A 5UKDA 4E5SA 3BXXA 3UPUA 3LGSA 1D4OA 3WLLA 1QYVA 3C3PA 3U7JA 3EUFA 1KQFA 2G1JA 2NUTB 3OCCA 5KNCD 1BEZA 3PK0A 1ESNA 2VWGA 3JYHA 1UBRS 1FFHA 4Q4DA 5TRTA 5EXXA 1B6GA 5J4YA 1NKSA 2GT1A 5ELMA 4IRMA 4QUHA 4MPTA 4JJFA 4KMOA 4ZJZA 2I6SA 5B2EA 2W6ZA 2ZQZA 4WDQA 5LB2A 2XUDA 5JH7B 1G60A 4RKYA 3WHLA 1QDLB 4DA9A 4DF3A 5IMSA 3QVSA 4E15A 1UADA 2BFNA 2FK7A 4Y7CA 1BD4A 4ON9A 1TA0A 1EX9A 2VQDA 5I4IA 4WOCA 5FPYA 2IZOA 1YB2A 3F7NA 2YHIA 5T4BA 4BKRA 3WYFA 5L4NA 1OZHA 1M1NB 2SCUA 3P1JA 1K06A 4WK6A 4AUMA 4EX6A 4MYSA 3KUUA 5BURA 1LSSA 5KQPA 1E2EA 4RIHA 4WJZA 5A5VA 1RAAA 1T0HB 1T36A 2XE4A 1UXJA 1X7HA 3LLVA 2OCBA 1OGYA 1AXEA 2YV1A 1FMCA 1SBIA 2B36A 3RQIA 2I6TA 3K1YA 1ZRHA 3M33A 4K05A 1GT6A 1N1MA 1QHSA 4IIBA 4A8PA 5J4HA 3QVJA 4QFMA 3GRAA 2P2LA 4NV3A 4UPDA 2YN0A 4WNAB 3H2IA 1PSWA 2CXNA 4JQYA 4RGBA 4DCTA 5I8PA 1J5PA 1ABBA 4DV4B 1SC4A 2HPVA 3LOQA 3TL6A 3F2IA 4HI0E 1UP6A 1BXGB 3W8DA 3WLQA 2P41A 2FG6C 1Y1KE 4C0BA 4BQOA 4FR0A 1CEEA 1Q84A 1E5TA 3EAFA 4OQXA 4NJMB 2ADOA 2PFSA 5KX5F 4Z4GA 1NFQA 3EH2A 4KI0A 4EO9A 2LDBA 3T1VA 4DVGA 4RVUA 2C31A 4AWXA 3LRTA 4B9EA 1ZGAA 4HVAA 1PZEA 3UJ7A 3KKPA 1ZGZA 5DX1A 1I6LA 4B6QA 5BQOA 1GFIA 2PBLA 4Y67A 2ZJ6A 2BWJA 1JH8A 1CCWA 2E55A 1WULS 3N0XA 4V2UA 3WIBA 1C4WA 2CE2X 3VA7A 3U3JA 5DHAA 3U4HA 4B83A 3ZWCA 3T8YA 1YCDA 2VDMB 4JL8A 2BFFA 4LRYA 4AP6A 4LF4B 1M83A 2XX3A 3GELA 4GPBA 5FQNA 4LXHA 2R8BA 1Z83A 1BXKA 2VIIA 3IEKA 4JA2A 3WLHA 4D82A 1Q22A 1JR2A 1A4UA 2DWOA 2Z3WA 4G0VA 4LDPA 4BU0A 2XT9A 3TCKA 5KYXA 2BMDA 4HVTA 3QU5A 4DABA 1U2RA 4WW0A 1E2QA 2XGJA 3COSA 4K9RA 1VJTA 1GPNA 2GPSA 2XITA 2P9CA 4N5DA 1CUDA 1F8UA 3QZUA 3A04A 1MAAA 3L8FA 3MD0A 4IHAA 2ACVA 1SUPA 3B48A 4GP6A 5DN6A 3G2HA 3LH5A 1TAQA 4JL6A 4UVIA 3HWWA 3W04A 5K20A 4PONA 3KR0A 5JBNA 2PD6A 5C35A 4E5DA 2B8JA 3L8ZA 1HRDA 2JKYA 2E5LB 1EFPA 5K3DA 5BV1A 1O96B 3RSCA 2WSBA 3BB1A 3OOEA 3S4YA 3C45A 3DR3A 4ZTUB 2V0NA 1XT6A 3I64A 4LQLA 2OP1A 4QIHA 1ZIOA 2A9OA 4J2HA 4ZYYA 2JIDA 4CKCA 1RPZA 1A1SA 3VKWA 2JLUA 4IDFA 4LNHA 1II0A 5JSFA 5CLGA 3D6FA 2QX6A 2Z3ZA 4KVAA 4N6OA 4GF5A 1PZFA 3H11A 4UBMA 3WA6A 1GP2A 3IEXA 2FPRA 5EQFA 1N5DA 1JMKC 3WHPA 1JDPA 2I6FA 3T7JA 4CQLA 4D9GA 3CEAA 4EG5A 5BXYA 3FETA 4MRAA 4C01A 1AZWA 3LUKA 3O8OA 5JECA 1LPMA 2NLOA 4M0CA 4RFSA 2QEQA 3BVPA 3PL1A 2REXB 5DIFA 4RL4A 4CM8B 4PG6A 1BE8A 3IP9A 4M99A 3V97A 4Y2UA 3K16A 3LTNC 4QRDA 7REQA 1KI7A 1T0PA 3A1FA 1XRRA 4BFXA 2JGKA 3QNMA 3DOFA 4E2YA 2YVUA 1AF7A 3JXEA 4O4HA 1OFUA 5GONB 3FRIA 2B35A 1ZM9A 1NMZA 1ZIXA 3D7RA 3LW7A 1H4QA 3BFXA 4XJXA 2ARKA 1YRBA 1RS0A 1SOMA 1XCMA 1GTZA 1ZA2A 2PNFA 4KP7A 1SELA 4EMUA 3NWEA 1CRPA 2C8LA 4G41A 3EUWA 3HU3A 4OBBA 4AX8A 1XCLA 3GO4A 4WCDA 3DBLA 3WYCA 4WVFA 4DIOA 3D8SA 1NXOA 4LHWA 4JZKA 3IKLA 1F2DA 1ODSA 1K8RA 2FW7A 3PEVA 5DX0A 1H22A 3QEBZ 2QTVA 3CRVA 2PJZA 3A9CA 1WG8A 3ZWKA 1ANKA 2VXBA 3L6CA 4ZAZA 1H6CA 3HJCA 2P11A 1LD3A 3I4LA 4H6XA 2XCLA 2LIVA 3UUWA 2ZBEA 4LQ4A 4R1SA 1I1QB 2DFDA 1HE8B 1ZP6A 2FGKA 3DHWC 1YULA 2WF5A 3FJYA 4JP1A 3VO1A 1Z4NA 5E1MA 3PRYA 4BGVA 2B5OA 5DYGA 1BFKA 2PO5A 3TUZC 4TZTA 4X65B 3QF4B 3WC4A 4YRGA 2JVKA 5ELXA 2AH5A 1PKEA 1M33A 2HA3A 1QBKC 2Z2KA 3HZZA 4X85A 3AYZB 3OTHA 5ERYA 3IE2A 4WHMA 1VMIA 3RJTA 3V33A 2O5EA 3V2IA 1DC6A 4OXYA 3R09A 1RYNA 1QGUB 3NUGA 3P9NA 3B1ZA 4Q7KA 3K92A 1EB8A 5CA1B 5JZMA 1V8DA 2RGRA 4R2MA 2QSJA 3MQ2A 5ADUS 4PW0A 1DIGA 1M2EA 1OXUA 1CUIA 3W2FA 4EUFA 3UW1A 1OWPA 1EVLA 2RONA 3LKZA 1PR5A 3PKZA 1B93A 3IBGA 1F3LA 3AB3A 4EDFA 2VK1A 4BP9A 2FPSA 4I5IA 3OZBA 4F86A 4MS1B 1C2YA 5ALZA 5LP6A 2O5RA 2QMQA 3LWDA 3ISVA 3NDBB 3MLBA 2QL5A 1K8YB 3MCVA 4FINA 3SZOA 1JX6A 3GIDA 4BN5A 4KQWA 1MB9A 5JO0A 4DVJA 1ODTC 4MHTA 3I5YA 4M49A 3VU9B 1T8TA 1BA2A 1YZFA 2GFIA 2WKSA 3NTLA 1E1LA 3ORFA 1LSJA 4QNRA 5DE3A 4XQCA 1C9YA 1HOXA 5BUSA 1RZ3A 1N8KA 3PHCA 5K6AA 4HFRA 4D8XA 4LY3A 1K6IA 1QRRA 4QYIA 1KAEA 2FSPA 1NE7A 3O38A 1FFGA 3L46A 3UAWA 1M0SA 1BVUA 1ICIA 4FBGA 2HSGA 5AVOA 1BDIA 3KWMA 3L0SA 3CW2A 2FW0A 1TVKB 2OZLB 1JE1A 3U7QA 1U11A 5CX1B 3EIQA 1DUVG 4YLYA 5F3WB 1L7EA 1Y9AA 1SVSA 3OJXA 1ESEA 2BKXA 4L9WA 1YQGA 2C2WA 4CCYA 4PZZA 4GIBA 3X0DA 5DT9A 3QU9A 1ZJWA 2G1PA 3L04A 3P5SA 1XRJA 2YVKA 4DEXA 4F4IA 4JI4B 5PNTA 1W46A 2WZQA 4F6LA 4JJAA 2GK6A 2VRBA 2BTEA 1J09A 1NN0A 4GQBA 1CRQA 2UVPB 3BJEA 1S96A 3VGPA 3ZHXA 3IUJA 5CITA 1V26A 3U1TA 2XKAA 3W6UA 4IWNA 1NLYA 4UUPA 4ISCA 1JI0A 1KOGA 2XADA 1QS0B 3DH0A 1E9RA 2JFNA 4XDZA 2XECA 4I4IA 4OFWA 5K0FA 2RFLA 1G5RA 2JZNA 4HAOA 3EWAA 3IUBA 4OJQA 4KE9A 4AFNA 4MW4A 3LZ6A 4YAFA 1QQ5A 2Z2ZA 1CQJB 3RRYA 3R3JA 1E5VA 1NQVA 2FLWA 1QZXA 4ZHQF 1O08A 4FMBB 1EJ6A 4JKYA 4X9XA 3JD4A 3VC3A 2NVWA 3PRJA 1UJ5A 1PJ4A 3H2JA 3ZZNA 5LU8A 5FHQA 2TMYA 3GQVA 2ZJOA 4Q4HA 5TX7A 4BCDA 3FUTA 4O2AB 5GADl 4UM5A 3IB6A 1BN6A 2VNJA 1ZRNA 4HX9A 4DCPA 2YXLA 1A2BA 1G6Q1 2ZWMA 1V3QE 3TOCA 3H2SA 2WABA 4NTZA 5TIIA 1EGVB 1ZRMA 2B1GA 3TQQA 3IYLW 1IUNA 3AKCA 3PC6A 3ESZA 4IM7A 1P4HA 4N9WA 4KR3A 2VBCA 3OA0A 4I4TB 2RK6A 2D8AA 4RPJA 4INPA 2HT1A 2G70A 3MS7A 1DTWB 1VBFA 3AY6A 3W9SA 2O0LA 4M3NA 4HUQA 5IJ9B 1M2NA 1JQEA 5E9QA 5EESA 1Y8ZA 1JXAA 3FHJA 3NPAA 4WKPA 3OX1A 2Q7XA 4HPXB 2H2DA 2DECA 2XKKA 3CT6A 2WWFA 2QE7D 4JT8A 3TEJA 4ER0A 1NPTO 5EXTA 3GOHA 3ZV6A 5JS8A 4UHEA 1QX3A 3VX3A 1P7YA 5IT9A 3NO4A 1JIIA 1GA4A 1XEAA 3D6AA 3GN1A 2VJYA 2ZSHA 3Q7TA 4EZBA 1WXIA 4KK4A 4C7KA 5C8ZA 4OHWA 5ILGA 4Q3BA 2GXUA 1Z7EA 4IJWA 3AI1A 3B70A 3MVEA 4HG2A 5DHTA 3WIUA 4B6EA 2FCRA 2WAMA 1G8MA 2X0DA 1UC8A 3HCPA 1H8HA 4OOEA 2YV5A 1SVUA 3KL4A 4B79A 1M1ZA 2Y66A 1PDWA 1ZWKA 3JAWA 2Q29A 2XXBA 2XMDA 4EJFA 4Y1RB 2ZYGA 5K4GA 1NYLA 2FU5C 4B48A 5EWMA 1YI0A 2V7VA 5G4LA 1SXGA 1SHLA 1KI2A 1U0HC 2WTAA 2YV2A 3TIIA 3PDJA 2AJTA 4B2IA 1GPKA 3ULKA 2WMDA 1V8PA 1KL7A 4FIDA 1JZSA 1BIFA 3A4VA 3O7MA 2XGSA 5BW8A 7MDHA 1KSJA 5KWSA 5HTOA 3EEOA 3DO5A 4QBIA 3V6MA 4C0XA 4JT4A 5J43A 4HBGA 4WOPA 5KNCH 4OREX 2Q3JA 3C3EA 4XLLA 4V0MA 4OLAA 4B3CA 3JS5A 1IK6A 2QLBA 1QH9A 4CF4A 2Q3CA 2A0YA 3K6KA 4IG4A 4XE5A 3C7DB 5L9AA 5C7OO 3AXSA 5DRYA 1DEAA 1T8UA 2WFZA 4P4LA 2CYCA 4CTKA 4IS3A 2W58A 3CIOA 5GQSA 1PR1A 1G7TA 1N4DA 2VL7A 3SG0A 4IIVA 4QAJA 1OIWA 2HSZA 4DR1B 4CM4A 1N92A 1XWFA 2VYND 4GBMA 4CDNA 3W8EA 4JBWA 3UCXA 5ETJA 1KZ4A 1Z4LA 3TPFA 4UHBA 3VGJA 5P21A 3TR0A 2PGXA 1XPRA 4R1UA 2IP2A 3WL7A 3FCXA 4XTRA 2GM9A 5CFMA 2YIMA 3E1KA 1FQKA 4H1HA 2WUGA 4EPYA 1H2RS 1G20B 3MERA 2O1EA 4E6EA 2C0PA 2ZJYA 5EIEA 3K70D 1E1YA 2IXGA 4PIPA 5JVDF 1O5IA 4KR2A 3OUTA 3ONVA 3GLGA 4Y9UA 2WHPA 4I9GA 5FUYA 4A0SA 4BTVA 2BKEA 2QY6A 3MD9A 1WIWA 2VDQB 4YRSA 1K63A 2VXOA 2ZITA 2FF5A 3O4IA 3TBKA 1RQPA 4D9JA 3THXB 1QHEA 2VDWA 3RAEC 2QNRA 2OGSA 4K86A 1F1BA 4XIGS 3T9FA 2VTVA 4B44A 3ML1A 2CF6A 4QOSA 2C4HA 3K4HA 3GFPA 4Y0NA 2CVFA 3HDGA 4P22A 4G97A 1T4MA 3ZW9A 3T61A 1S8NA 3ZDZB 1XXLA 1BXRA 1GG9A 1RI5A 3ITEA 4I50F 4L4SA 2OEPA 2Z4TA 5DI3A 4I8DA 3TRHA 1VDMA 1O0BA 3K9HA 3BGDA 1YR1A 1B0AA 3VU3A 1MZVA 2WJPA 3AVVA 2QTLA 1HE5A 3C3XA 2YXNA 4KQKA 2NNWB 2JAWA 2W6JD 3ZDYB 1KAGA 1YGYA 3NXSA 5EKTA 4D02A 3NH9A 3LBAA 1NXTA 5A71A 2HEIA 3PXGA 3VUFA 4EUNA 2PYZA 3GPBA 3NIGB 3H83A 4ZGBA 4I3GA 1L5SA 1J70A 3ZDAA 4B73A 1F7UA 3C1AA 1R0BA 1LVHA 1UMDB 2LIPA 4W7HA 3RVNA 3D3NA 5I5EA 1QUEA 1YMVA 1ZM3A 4G85A 3QSYA 3X43A 2ZGVA 3HHEA 3W5AA 2O20A 2VFAA 1QOZA 5DWDA 4ZGWA 4AKGA 1T9AA 1E6UA 1PHPA 3HRHA 4PFJA 4A0RA 4RV4A 4C2UA 1TAUA 1T9BA 2ZZMA 1D2CA 5CDSA 4P4SA 2EVWX 3EPRA 3TGPA 1SQ6A 1BS2A 4L9RA 3STVA 2XR1A 1M5RA 1K7SN 3QXSA 2ZRNA 1NOKA 2CVZA 2V6IA 3K0CC 3QELB 1DNPA 4A0GA 3BS4A 3PFKA 3FYUC 5HF6A 4PAMA 4EQZA 3JWJA 1VL8A 1SXPA 1JXMA 3FYUB 4B3TB 1RQGA 2JLVA 4YECA 2BUCA 2OYSA 1C7QA 1UBJS 3CW8X 2GVZC 3AWDA 3DWEX 2H5EA 3GB9A 3HDQA 3O2NA 3WDKA 4OHCA 1QIHA 3CE6A 2QE6A 8OHMA 3JWGA 1JALA 3AL2A 3HUTA 4CODB 1J1IA 4QTUB 1EXNA 2VDNB 1JILA 3DG9A 4JEUA 5K1ZA 4BX8A 2GZRA 2L0XA 3PEUA 1JEQB 5L3QA 1KBQA 3C4JA 3R24A 3VR2D 1XZCA 2WFMA 4PLFA 5E7MA 3ESYA 3A26A 3F78A 1M2VB 3WB9A 3EXHC 5C8VA 1OC4A 2WT9A 4G5QA 2VJMA 3E3NA 1HE3A 4FGZA 2GLXA 1OZFA 4YAOA 5HGJA 3M3DA 3GZTB 1PWYE 1ZN9A 3RSFA 1DG3A 1NBMA 5HJ2A 1F8GA 1KEVA 3PQ6A 4GHWA 4JOBA 1KYIA 3K8ZA 4IOJA 4PICA 2P65A 4HN9A 4V2IA 1WCYA 4KN9S 2YINC 5LA6B 3DL0A 1KKLA 2F1JA 4E07A 4Z51A 2NTYC 2HRRA 3LUFA 1T10A 1Y3AA 1W5FA 3AFMA 3BHNA 4DTIA 4YJ3A 2VSYA 4XB1A 1USVA 3N8GA 3AU8A 2OCPA 3JASA 2WWGA 3I2IA 1TZKA 1KAMA 3WLPA 5IG2A 5KC8A 3UJ9A 1W88B 1AGRA 2C1ZA 1ML4A 3DTYA 4W5NA 3VYVA 1BCRA 1IPFA 1SVWA 2PJDA 4KYIB 1EFHA 4U8HA 2QE7A 1QRAA 2XKJE 2XDQA 1PSDA 3A7DA 4LJKA 1UK9A 2JAOA 5EJ6A 2I1LA 2Q8PA 2W48A 3LPMA 1AQYA 5MFPA 1I13A 2R00A 4NXMB 2IEBA 2MYUA 1HEIA 1ULZA 3HXTA 3KZCA 4TS4A 5C52B 4DXAA 1CNFA 4WD3A 2O50A 2MR6A 2D5BA 3CZ4A 4NJEA 3WICA 4BQPA 1E62A 1GQYA 1BX0A 1FQWA 2PFGA 4UTOA 2YW2A 2ZB8A 3I76A 4O4IA 1U6JA 3NDIA 2IYPA 3T1OA 1PEYA 1EGAA 2C5GA 2HREA 3E23A 3GEBA 5AVWA 2JGIA 1VKHA 4YMGA 5I9IA 4UQLA 4B32A 4RTJA 4D74A 3GLFE 1YA6A 1JQ5A 4JV5B 1Y4UA 4MR9A 3DT9A 3O26A 1DBVO 1L7RA 1DBWA 3OC6A 1N2HA 3C6YA 5BSVA 1P2DA 3ROFA 3Q85A 2AZMA 1AMOA 1DKRA 4DDUA 3RADC 2VP5A 3MQFA 4B82A 2QAIA 2WWXA 3U9LA 2XUFA 2II6A 4KGDA 5T41A 4B6JA 1RQ7A 1U6KA 4EL5A 1PJ2A 1E77A 3E3LA 4BAUA 1Q1QA 5HUQA 4UCXA 1KJIA 4U4AA 4HAZA 4NV1A 5IHPA 1BDMA 1PHRA 3HCNA 1QLJA 1A5BB 3P26A 1A4IA 1WHTB 3IA2A 1YVRA 4WSOA 3W77A 2QT0A 3W9UA 2Q49A 3H9GA 1YR3A 4A03A 2EW8A 3PFHA 3CPHA 5IDVA 4J0IA 3S55A 2NV2B 1L2TA 4GLOA 4QQKA 2BISA 4IXNA 5EE9A 3RT1A 3USCS 1PYOA 2FQQA 3JAKB 1D2NA 3WLNA 3UWMA 2G4VA 3H8WA 2HPAA 3AEXA 4KMSA 5BYBA 1XU4A 3AEKA 2FPXA 1T1EA 5KVAA 1VBNA 4BVBA 4M7OA 1T0JB 5AW4A 3EVBA 3K2BA 1BOOA 1C9JA 1UBHS 3ICVA 4R8VA 4ZANA 1XXHB 1MB4A 3PZBA 3THYA 4N18A 2OCAA 2X2PA 3L0ZA 5JJKA 4W63A 3GPLA 5KNBH 4IG9A 4EQ6B 4ZYWA 4QC2A 2GJ4A 5REQA 2AXPA 1DBRA 4PANA 5BNIA 3AVUA 3HU1A 2V7GA 3CO5A 5EWJB 3BGWA 2JC3A 4E6PA 3DAYA 3UVEA 2V03A 2ZSJA 4BNDA 4GOXA 1OVMA 2XTNA 4FDVA 5JTTA 3HY3A 3WLMA 2LVBA 1G9TA 1W2HA 1R4AA 2YRWA 5F33A 2VJBA 1KRHA 1NVWQ 3H86A 4JR0A 1JYEA 1CZNA 4IF6A 2V3CC 1B16A 4XTCS 3A25A 3BCUA 4NU5A 1T6NA 2QDXA 2CXTA 3ACBA 5C51B 1NW5A 1A82A 1Q1EA 2J33A 4JJKA 4N3BA 4PRYA 4X1IA 3U61B 1HEUA 1I2DA 1Z0JA 1VLMA 4XSHA 1WETA 1SKQA 2CLHB 4U5QA 4D8TA 1EFCA 1P5FA 3NVKI 1N33B 1YS9A 2VBGA 1VMEA 4GYYA 5LQMA 1SUDA 2FFJA 2Q0SA 3KKQA 3NETA 4OQPA 5TMPA 4OA8A 4URZR 2OGZA 5DYIA 1H05A 1N5IA 3GCWA 2O3SA 3KR9A 4GRAA 4LWZA 2Q5JA 5BN5A 1FSFA 3H2GA 1O9HA 10MHA 3VO9A 5LZ4A 1TM5E 5AVJA 1I3LA 2NO7A 1BKDR 3HR8A 2Q1SA 3GBPA 1MO6A 4QVKA 1JU3A 3LC2O 4M6WB 4X3CA 1EE2A 4HGYA 2DBRA 3TKLA 4F97A 2D7DA 3DCIA 2AZXA 4R3WA 3T1TA 1YMQA 4DDMA 3JQFC 3N3BC 2CUKA 5IKEA 1YZQA 2AHRA 1GCIA 2NSHA 3L3BA 4GLBA 3G0GA 3FDFA 4UZEA 4DIMA 3NKLA 1FSPA 1PK7A 3PQ3A 3PT5A 2H9YA 2PM8A 4UARA 5TXGA 4CKBB 4XWOA 4EJ2A 4ETNA 4YV0A 2Q50A 4HVLA 5BW5A 5DM70 3HJFA 1IUOA 1V9LA 3R3YA 4MHSA 1C4KA 3ZEIA 3D4LA 2R2AA 4DCGA 1VDZA 2X1VA 4EG3A 3DLIA 4BMZA 3ZVMA 2PYIA 5DNUA 4L76A 4G09A 4P0PB 3DVRX 1DEOA 3K96A 3QUBA 1GZ7A 3IUYA 3SZRA 1BCSA 1QG6A 3I72A 3N05A 4A5OA 4RJIA 4DNFA 3RASA 1Y37A 4J7AA 1SCAA 5J40A 3VZBA 3ZWYA 1ATIA 3I92A 5JU6A 1U3CA 1E3EA 5H3LA 1YS1X 1T3SA 1QLWA 1U7WA 2D0PB 3X1JA 2COEA 1CR1A 4X20A 2DWCA 3D8TA 2QRJA 4IBOA 1FVXA 4HJXA 3TIXB 1QH1A 3K94A 1E5QA 2FVXA 1AZLA 4F9EA 5FBLB 4Z49A 3PFGA 2HWWA 4MYRA 5HQJA 1HR0B 5F7XA 4YJHB 3OHPA 4Q3AA 4RYDA 2I55A 1ULAA 1PL0A 5AYVA 1K3UB 2PX8A 3VR2A 3WGJA 3W5BA 5IMBA 5FB3A 1OLUA 4DIEA 1T4CB 3OZVA 1BMDA 3JQCA 2CYAA 1MN6A 3JVEA 1CQZA 1DKOA 2NO9A 2QUAA 1GL3A 2O05A 4F84A 3O8BA 3SEZA 3UEOA 2BEVB 1ITZA 3ZG6A 1RADA 1IJFA 1ZH2A 1QCDA 2HR1A 2PQMA 2AD5A 3UYKA 4UFNA 4KO2S 4M1KA 3I2FA 1AN9A 2FPGA 4QHSA 1PGPA 3R8XA 5GMOA 3BMXA 1N6PA 3D6MA 2DQ4A 1E4EB 4Y1GA 2FEXA 3EOBI 1ADJA 2RGNA 3E5NA 4RJ2A 2O2HA 3FF4A 3KYBA 4OHPA 3BIFA 1MVNA 3OQ6A 5KDLA 2IEYA 5KUTA 1OLSA 3DJFA 5JNLA 3G0BA 2L19A 1CG6A 4ZZIA 5BSGA 4PFKA 1UXOA 3ITNA 4UAGA