4I4IA

Crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
319
structure length
319
Chain Sequence
MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDIIHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDAATSHERTYVIEVMGRHAGDIALWSGLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGFETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEALANKHTIDQRMYALSKELSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 6-phosphofructokinase
publication title Redefining the Role of the Quaternary Shift in Bacillus stearothermophilus Phosphofructokinase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 117
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.11: 6-phosphofructokinase.
pdb deposition date 2012-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i4iA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i4iA02
4JENA 4LJLA 4LJKA 2A0KA 3BQ9A 1S2DA 3QUAA 3OPYA 4LJRA 2NX2A 4FYHA 6PFKA 2F62A 2IZ6A 2F2TA 2PMBA 2A33A 2PFKA 1WEKA 3U39A 4P5EA 1PFKA 1RCUA 4KXLA 3PFKA 5ITSA 3GH1A 2IZ5A 1F8YA 2F64A 4JEMA 3K2QA 1F8XA 4WL0A 1KZHA 3OPYB 4PFKA 1S2LA 4HX9A 3O8OA 4KXMA 2F67A 4MCJA 2HIGA 2IZ7A 2KLHA 1YDHA 4P5DA 4I7EA 4RH3A 3O8LA 4FYIA 4OHBA 1S2GA 4I36A 3SBXA 4MEJA 3UQZA 3IMKA 4NPAA 4JELA 4U1RA 1T35A 5AJTA 3F5MA 1ZXXA 2Q4DA 3HNOA 2KHZA 3O8OB 3MAJA 4KXNA 3O8NA 4I4IA 1S2IA 1WEHA 1S3FA 4A3SA 2Q4OA 4FYKA 4OHRA 5AJUA 1MTOA 3EHDA 2F48A
chains in the Genus database with same CATH superfamily
4TMKA 3AY7A 1Y5LA 3RKRA 5LSAA 3EGEA 3PUYA 2QW0X 3DMFA 5K8LA 2V9ZA 2XNKA 1JSXA 3M5PA 2WHXA 4X6YA 4BMPB 1T3TA 4K6KA 3BXOA 2BMEA 3VI4B 2GAFA 2Z6QA 4HWKA 4BTVA 1Y98A 1VMAA 1M2OB 1NPTO 1X1SA 4PU0A 5I9TA 2XUJA 4OI1A 5AP9A 1K5PA 1VJRA 2V59A 3C7KA 5BN1A 3EWSA 3IDFA 5JMOA 1I6KA 5AHOA 3GLIE 1M72A 3LUCA 1T0JB 2QD1A 1C7QA 1H2AS 4P3XA 4L2IA 3K70D 4GS5A 2A5YB 2BM1A 2JHPA 5JTTA 1VLVA 3HYRA 4WOBA 4V0LA 2OZPA 2DVMA 4LV5B 3IIJA 3OZBA 4JBIA 1QSGA 4O2RA 3LVFO 4KG7A 5BMVB 1YB7A 2WJ6A 5AVTA 2PBLA 1Y6FA 2Y99A 1RWQA 3U7GA 2Q5IA 1UUFA 2O7NA 2OLEA 5B4VA 4BGDA 3FW1A 4KE9A 1WBBA 4X64B 1AY0A 2A1TS 3GFTA 3P4YA 3QV2A 1WTAA 4B4UA 2KBEA 4P84A 3T95A 1Z35A 4JJEA 5BUZA 7MHTA 1QYRA 3B70A 3EHEA 4IRXA 4AKHA 3PWTA 1W0KD 3BN3A 4KE8A 5F4BA 2JGMA 3O9ZA 1O96B 3CC8A 1A8UA 1UK9A 2WG2A 4II2A 5C4IA 3HDVA 3LD9A 3CT6A 4FUTA 4C7XA 4CMIB 4EGFA 1DOZA 2JZCA 1FSGA 1Q2XA 1QMPA 1TVCA 3BB1A 3HA2A 3KSRA 1DXYA 4FHGA 4ZREA 2E48A 1XU4A 3RTGA 3M1LA 3PR2B 1JHAA 3CUEF 4FGUA 3E05A 1O9GA 5L3SA 3OWXA 4K7JA 3PLNA 4MVYA 2I6XA 4OHFA 3U1BA 1RMTA 1AUQA 1FQOA 1ZOPA 1LDNA 1U0TA 2BRUA 2YMPA 4FFSA 1V8FA 4HJRA 5LQMA 4MITA 4V0KA 2E2WA 5A3JA 2I2XB 3S81A 3EXHB 2K5UA 1BS9A 5I7AA 4HR7A 1FLDA 1RZ3A 3D3QA 2HA2A 2I2BA 4OQFA 3RRJA 3SC3A 3UW3A 4DWWA 2KMLA 2GB4A 5CH3A 4ZC8A 4MULA 4CKWB 4DANA 2R2AA 3WQBA 1IULA 1U1GA 4H3HB 5J5CA 3TZLA 2NXCA 1SR8A 2WT8A 1JDSA 2IV3A 3COYA 3LJKA 3VH4A 1CUVA 2E21A 1ZVKA 4QODA 5G41A 5BVHB 4DOMA 1SU6A 2CV2A 4KWHA 3CF2A 3JSXA 2F4VB 2NXWA 1VSVA 1P3JA 1W1IA 1QQ6A 3HSSA 4PGGA 2Q9AA 2W90A 4HVCA 2QE7D 4B3BA 4XWWA 1ST3A 1FRZA 2JIOA 1IEWA 1QTNA 3OFNA 4XASA 3TDKA 3VH3A 4ZQHA 1CR4A 1FNCA 3OE1A 4KQ6A 2I3AA 2B61A 3OT1A 1EXMA 5KVAA 4JJZA 4AMYA 4D9CA 1EZ1A 3I23A 1V8DA 1QE0A 4JHXA 3HYLA 1DXQA 3IOCA 2EFDB 1SPXA 4DSZA 2GF0A 2BFWA 2BPOA 4TTTS 5CURA 1XMOB 1S01A 2R60A 2WTXA 2C20A 4LZWA 2V0GA 3AI1A 2HXYA 2W2VA 2WKWA 4R7GA 5EIBC 1RPJA 1VL8A 1SIUA 3TCKA 3VZCA 2HBYA 3T7TA 3QF4A 5J4KA 3TSCA 1S2DA 1CR2A 2OD9A 1K66A 3AFGA 3QJYA 3M1AA 3RSHA 4A5SA 2GBPA 5KS2A 4LW8A 1NW9B 1L1EA 2AX3A 3PKZA 3GFOA 3QKWA 4KXYA 1XCJA 2Y93A 3U80A 3ECSA 2CJFA 5IT4A 3P94A 3S8EA 5EOVA 4WY5A 5U4QA 1K6JA 1XEWY 1OIXA 1PIWA 1HE8B 1UJBA 2CXPA 3LPDA 4H0NA 1Y5MA 5AKGA 4OJQA 1N1DA 4P7GA 4D8WA 1YB1A 3WMFA 2HK9A 2PX2A 2D0IA 4RV4A 5JADA 1T2VA 2H5JA 1Y48E 4RULA 3F8SA 2JCYA 4CUZA 5CBPA 3DKPA 5LBTA 1XRNA 1UC5B 4UZFA 1SVWA 3RHZA 1EEXB 2OYRA 3ZDBA 1C2TA 1IYZA 4QRHA 5IEJA 3NOXA 5ELLA 3MNFA 4YFVA 1ZZGA 5EIBD 5FPQA 3ONVA 3FYHA 1YJBA 1VIVA 4G5QA 1T5OA 5BN4A 4ZVLA 4LUCA 3W8EA 5K0SA 3JVUA 4QARA 3L49A 4BMYA 2ZS8A 3R1IA 1I2MA 4E94A 4RTRA 1R2QA 3WY9A 4YCJA 2QJRA 4OF4A 3WLIA 2WD7A 3JWGA 5F5NA 1XTRA 4I8DA 3FH0A 4PZYA 3SKVA 1UOEA 1T6ZA 1G20B 1YVEI 2EHJA 2RARA 2VP2A 2XDQA 3PJEA 3NIDB 3CN9A 4HGRA 2E85A 3B9BA 5C7LO 2XCIA 1KZYC 3V4PB 5C32A 2HRRA 1HRKA 4MR7A 3ZJYA 4YT8A 4BFZA 1QF6A 3KKMA 1UBSB 1CR6A 2EDCA 4FNGA 1XYYA 4KXMA 2ZAIA 4L6CA 1YXMA 4V0MA 3DOFA 1RJWA 5IUJC 4BNFA 2RG1A 4BWVA 1KEKA 2EG5A 1YR2A 1C50A 2YJ6A 3D8UA 1HV8A 4JP8A 5JFTA 4A0FA 2BTQA 3ASUA 3WGMA 1ZBQA 2D8AA 4AP9A 3MUEA 1WDKA 4M1MA 1ZR2A 1KJWA 3ELDA 3B6MA 3FI9A 1PGJA 3MB5A 5CT8A 4Z0TA 1X86B 3CRQA 3LC7O 2GQ0A 3PGMA 4GPD1 5IMBA 4EBBA 4A15A 1YMUA 3OE5A 2ZAGA 3MWGA 1G8PA 3P27A 1C8LA 4TKLA 1ILWA 2PYZA 2WPDD 4LISA 4O4LF 4WKNA 1JRLA 3UJDA 1CF4A 1G8SA 1D07A 3N3BC 5IJWA 3W04A 1T6XA 2NVBA 1JZQA 2WPDA 2B1RA 5KB3A 1UWLA 6REQA 7MDHA 2V8BA 3RKSA 4AULA 3L7DA 1F6DA 1OF1A 2J6HA 4BQSA 1EVQA 3QPBA 1DMRA 1T1IA 4RLSA 4KJXA 1DU4A 3DBHA 3TLYA 2E6KA 5DW0A 1U8YA 4ZCPA 1YDGA 1T36A 4IDDA 1IBRA 4JMPA 4AN1A 4KR9A 4HAOA 4ZPJA 4BLPA 1A76A 2FFJA 2GTIA 3URKA 1RRMA 3FG9A 3QU4A 4AAYA 4NVRA 3KWLA 5JT1A 3LRXA 2OLKA 1C3OB 3EMKA 1XO1A 1F9AA 1PP4A 3U44A 1HT1E 4F56A 4UJ5A 2MU1A 2WNIA 4RAQA 5AK4A 1QU3A 4B44A 1UBKS 1VIYA 121PA 5FADA 3UAWA 1W5BA 2VXYA 3MT8A 2XX3A 1VMIA 1KO1A 2A0KA 5H3LA 4LPSA 3RNLA 1N2CA 3WHPA 2GZDA 1V5WA 2PJZA 3BWVA 4RLHA 5DNVA 1UXKA 3DYBA 3SEZA 3T1NA 2VS1A 2GPYA 1JMKC 1RXUA 2DHEA 2H8KA 4Z3OA 3EF0A 1B0PA 1JZTA 1SCUA 2JFVA 3QI2A 4JU9A 4U7PB 4X1KB 2J48A 2QZ9A 1UT5A 2GKSA 4YCCA 1VHQA 3PXEA 1NBMA 2DHQA 4LRQA 4P4SB 3QHPA 3M7IA 2DWOA 5BN3B 2HB6A 4KQKA 5LXTA 2J09A 4CVNA 2Y77A 1OASA 1E1QA 5JO0A 2XUIA 1QHSA 3ZNQA 3VR6D 1SOAA 4NNPA 3RSOA 3ZHBA 4LXQA 1LLCA 3JQAB 3QE0A 4AJ9A 3L02A 3CG0A 5C5IA 3BK7A 1NWCA 5B37A 3BJZA 4QOSA 2G5CA 1BHQ1 3Q9SA 4MUJA 5AVUA 3H11A 4HSGA 4IICA 2UDPA 1PFKA 3KOMA 1L7BA 3QRWA 2UYCA 2PUGA 3PFKA 3SR3A 3UJ6A 2Q8PA 2WHPA 4KXUA 1AGPA 3ZUPA 4HG2A 3OQVA 3OQ1A 5BNWA 2HL6A 4PGFA 5JXJA 3ET5A 2G9NA 3VHXB 3EPKA 1Y9EA 1ZK4A 2VYND 1JR3E 1GGMA 4OQZA 2WJJA 4H17A 2XGMA 3CF6R 3JARA 3R75A 4GRAA 3UUGA 3GDFA 1DV2A 5IVHA 1HY3A 1E3JA 2ODQA 2FWJA 1QH8B 2ZI3A 1Z45A 1P1IA 3D59A 1UDCA 2DR2A 3I2IA 4M9ZA 1N5DA 2WU0A 3PQ5A 3RK4A 1M34A 4GQIA 6LDHA 3O95A 4O1MA 5JH7B 2B8JA 1SD2A 1RWXA 1ES9A 1LRLA 4G5FA 5EUBA 1HZZA 4P36A 3PYLA 4A03A 4ZU3A 1NJSA 1R27A 4QEZA 1T8SA 2DP4E 1DAIA 4FMPA 1J0EA 1G9TA 1D9ZA 1T8YA 2WTEA 4EJ6A 1PW5A 1JQKA 1BH2A 2OESA 1HYGA 3DOHA 3H5AA 3TD9A 1QK4A 3VI3B 1LSJA 2C5BA 4AX8A 2ZBPA 3ADDA 4M89A 2FPWA 1ZUNB 4HDKA 5AJYA 1Z0IA 1RKVA 2YVKA 2FP4A 1C4KA 3NG1A 2RHJA 2P0AA 3VVLA 2GM5A 2C3MA 4E13A 2P9FA 3PJDA 4YRDA 1G8FA 4Q19A 4IF6A 2CLEB 3HVJA 2D62A 3SYNA 3PE3A 3U9LA 1NW3A 2FPXA 2PMKA 3K1YA 3ZK8A 4YMVA 4W63A 1KDPA 1S89A 2G63A 3DEFA 1YVRA 1JJ7A 1GL9B 3D3NA 1FMFA 2G09A 4PSDA 4BXOB 3GC6A 2C84A 4RDIA 4JT8A 4XI9A 2M2IA 4F71A 3UCFA 1F20A 5ES3A 3QH4A 5FQNA 2OORA 4HS9A 4WDRA 1TM4E 3SX0A 1B6GA 1D2EA 2WRZA 3D6TB 3EIEA 4ZAWA 4CLEA 5CVUA 4FX5A 5KX5B 2F00A 1PJRA 3Q40A 3T4XA 3TXXA 1DO2A 1JI0A 4UE3S 1S0UA 1L5GB 2Z3ZA 4M9SA 4AFNA 1ZCBA 5MGBA 3NUGA 1MJGM 1VYVA 2JANA 3P32A 5IHPA 3WIUA 1NI4A 1ZI8A 5DNYB 1WG8A 1DFIA 2QHXA 3FFTA 4TKUB 1TZMA 4Y6OA 5D7NA 5FNVB 3OPYI 4Y30A 1KTVA 2P2DA 3ZE0B 1UM9B 2PSDA 4IRUB 5I7WA 1FXUA 3K0CA 5ESWA 1GUDA 1G5QA 3FBTA 4D0RA 1UJ5A 4FQ7A 1KE1A 1CUUA 1DX9A 2YFYA 4PBSA 4E03A 3KAPA 3ZOZA 5CX1B 4AP5A 5GTDA 3DZIA 5CNJA 4G07A 3OHPA 3TECE 2GJKA 3KG2A 1PJAA 3A9RA 4MW4A 5DBEX 1C1XA 3WL7A 4F0JA 5I7VA 3REQB 1XHLA 4L4UA 3IRVA 2FFRA 3WK4A 4JB0A 2OV8A 4KBGA 4R1SA 4RTJA 3FTFA 2X3FA 4MQBA 4CHGA 2J3DA 2IF2A 3EIWA 3D54D 1D6MA 3G0GA 2P5SA 1Q0TA 1QRTA 3HS3A 3OQNA 4MQFA 3OE4A 1I36A 2JIPA 1NPYA 3ONWA 4YRGA 4OM8A 5ALPA 3VR0A 3OZ7A 1CHDA 1TEXA 1V6AA 2REQA 4HDOB 1OH7A 1HOXA 2BGLA 1FRFS 3SJAA 1TYDE 1F0KA 4OHVA 4ZO7A 2N1BA 4JSYA 3DZDA 1QRUA 2NSYA 3C3YA 5JQGB 3MMNA 3P9NA 3O94A 1UAAA 1NXQA 2H65A 1SC6A 5DLYA 4BFCA 1X87A 1FTQA 5DJ5A 4JUCA 5AOBA 1D0VA 2V3WA 2YWRA 5G1NA 3RPEA 2ABWA 3C3WA 4G9EA 1TX4B 1MB0A 1HTTA 4OHUA 3LV8A 4F8EA 1QF9A 3CKKA 4OLAA 1KP2A 1OLSA 1P0CA 2JLBA 1DPFA 4O4HF 1EJBA 5JMTA 3U09A 3GB9A 5TS3A 1B42A 1H42A 5JXGA 5GP1A 3CH4B 3L6CA 4Q7JB 1W4LA 2VJBA 2C31A 5BQXA 1U3FA 2OEPA 3LP5A 2Q28A 2JHGA 3HYSA 4N01A 3WWYA 2R6GA 4ZVQA 2HO4A 4OLBA 1ILEA 2A9OA 4FGSA 3JWEA 2YYAA 4B3TB 1K4YA 4DM7A 3OCYA 5K03A 4Y1FA 2IPLA 3L7YA 3ZQJA 1W2HA 2JGDA 4JBLA 2G71A 3H9CA 4XX1A 4PZDA 1UFQA 3JQRA 1M8KA 2AG5A 2UXDB 1G4HA 1Z12A 3OJEA 4D42A 1QIJA 3OJXA 1TZKA 3VPSA 5HKKD 3AVVA 1B0AA 1J90A 2BGIA 3RS5A 1Q6YA 3C6QA 4M98A 3DDCA 3JQ8B 5HKKA 1YBHA 2CF6A 1L7PA 2AEMA 2JJ2D 4YRQA 1YBFA 1TA4A 2IYYA 4N1AA 4WDQA 5BXYA 1M5RA 1CYEA 1G0OA 3ND7A 4BX0A 4KYUA 4E7OA 2GARA 2YIMA 4CLOB 1T9GS 2QN3A 1IZYA 2JJ2A 4FSHA 4AS3A 2J4CA 3KO8A 1OV6A 1JEYA 4PZLA 3JCZA 1ICEA 4JLOA 5LA6F 4R2IA 4BP8A 1VE9A 1XWIA 3E23A 1RZRD 4KQ1A 4GKAA 4D57A 2BGGA 3TG8A 1EP9A 1TFUA 1XL1A 4Z4GA 4NZPA 2QRGA 3VNBA 3FXAA 2JLXA 1J8DA 1XQ9A 4KAXA 3C7CB 1EHYA 1RZRA 1TJ3A 2C3UA 3FUUA 4XWAA 1WOYA 1GPJA 4RVOA 4L0CA 4TMFA 2AMVA 2CHUA 1YC2A 3LS2A 2AJBA 3IR7A 4B5LA 1AF7A 4ISCA 3UK6A 2W2KA 2W6QA 3WHKA 1Z06A 2BIFA 2VKQA 3HKDB 2AT1A 1W85B 2OBYA 2IUFA 3K0HA 4H6XA 1RWVA 1EM6A 2B4KA 2JJYA 1PBNA 4XPZA 4AUNA 3N8KA 3A1UA 1HT2E 4P3NA 1D2MA 1HE1C 2QBYB 3AR3A 1EI9A 3LE8A 1C30A 2GEJA 3R3XA 3QW2A 4JAVC 2AF4C 2UYGA 4F1WA 5A4AA 2IY8A 1SUSA 3VO9A 4BNZA 1ISSA 5IBCA 4EB8A 4N9QA 1W4AA 3LPMA 3A1WA 3MRSA 3OHMA 3HXQA 1INLA 2PUEA 4M8SA 3BXHA 3QX7A 1UWKA 1N0UA 1XEAA 2VPWA 3TX6A 4EI8A 1YQQA 5JSZA 4Q4AB 1G41A 3C8MA 3H1BA 3MTJA 1O94D 4ZXFA 3IP1A 1KDYA 3ZJ5A 3TFOA 2I9PA 1GV1A 1WW2A 5DHTA 2A0UA 5CD1A 5K99A 1UBOS 1O94A 3OX4A 2A4KA 2WFZA 4QPNA 2ZRGA 2R8YA 3LWDA 3N7TA 3ZKAA 2IV2X 1YU9A 1QJCA 1Z0JA 1RPTA 2PIDA 4RHYA 1PDOA 5K8UA 1X1RA 2J4FA 4HTAA 5AFSA 3CSSA 5EWLA 4GNKA 4AS1A 1PJ2A 3C6KA 4AZVA 3MHTA 2JFWA 4ILKA 1KI7A 1NZFA 4QVGA 4AJNA 1CHNA 4YQYA 4G23A 1VKOA 4RM2A 1P1JA 5JVDF 3SR0A 4QOIA 1FVXA 2NV6A 4X91A 4RJKA 4KHPB 2TMYA 1C7EA 3GGDA 3FKSD 1UBUS 2PV0A 3OAAD 2ST1A 4I5EA 1A82A 1XRLA 1KRHA 1OGYA 1G6OA 1G8GA 5JO9A 4C0JA 2R8ZA 1T8PA 3T1HB 3E81A 2QA5A 1Z5UA 4N48A 2X6TA 4HB0A 1V3UA 4Q47A 5DGIA 2B4YA 2OAGA 3CZMA 3GI1A 3L7NA 3OAAA 4UAJA 1NW4A 2BFNA 2WW8A 4P93A 4UHKA 3RLFA 4DLLA 4IPTA 1B8NA 1BSVA 4GUAA 1M3SA 3EC7A 1JQLB 1W1WA 3C5VA 3P9CA 4QG7A 1ORHA 4WZAB 4G36A 1G4AE 4HFMA 2VP4A 4DSNA 2X42A 2O5CA 1XKQA 2XXJA 4EFDA 5TQ2B 4UOZA 1JQAA 3IXMA 4DCMA 4C7OB 1EK6A 2CYAA 1W1UA 2CLIB 3PDWA 3IIKA 4K5QA 3R76A 1GFWA 4MWSA 2O8EA 1N2OA 2HSDA 1N5IA 3THRA 5FV7A 1QC5A 4DABA 5ILGA 4NWIA 4AN0A 1OIWA 3PJRA 1EHIA 4MIYA 3WR5A 1AA9A 2DRIA 1H0HA 3B9RA 1J99A 2GK6A 4FEEA 5CNIA 3UOAB 4ALLA 4DRZA 2HDWA 5FWYB 3G7NA 1K2VN 3T0FA 1G1MA 3OF5A 3KEMA 4BO0A 2R5WA 2JB9A 4J3JA 1XF9A 3DPSA 3RT1A 5KKNB 4CGZA 3WBKA 1NUHA 4YMWA 1U28A 3Q2OA 2BEWB 4XR4A 2EJBA 1O97D 2JCGA 2MIIA 5I3CA 1TYEB 1ABEA 1NVXQ 4HVAA 1AKYA 4GEGA 4UTNA 1TTPB 2YOFA 3JWJA 3L6DA 1SAYA 1N92A 3OD1A 3TKLA 1WSWA 1EVIA 2P69A 1SQFA 2RAUA 2DOKA 2VSFA 2ACWA 1NW5A 2POCA 3KHSA 4G0OA 2NOAA 3UH0A 2E4YA 4DJAA 2BD0A 2ZBRA 3NWOA 4MR9A 2DFKB 2NSHA 4OU4A 4H31A 3ZCQA 1OVMA 4W5QA 2G9QA 2P11A 1IPHA 3IAS1 3MJSA 1JAIA 4E12A 1U9ZA 4Q7KA 3LHIA 4OAOA 2VRBA 1S7GA 2BM8A 5E1DA 4WA8A 4R0MA 1V16A 4F3RA 3GR6A 2PGIA 4PHGA 1NQVA 1KK2A 2AR7A 2EU8A 3E3AA 4QASA 4QFMA 5B1EA 2H63A 3MJEA 3C14C 4FGKA 3SXPA 4KPEC 2FLVA 3GDWA 3EISA 1EK2A 3O2NA 3N8NA 1T15A 4RVFA 3LX5A 1B8PA 3PA8A 2NG1A 5FEMA 5JW6A 3DMPA 2P75A 5HP4A 2Z56A 3HCCA 3IIIA 3I72A 5AOVA 3VR2A 1SQ0A 3K2BA 1RCUA 4FFMA 9ABPA 1M6WA 1GTRA 1JH8A 1MXHA 4WK2B 3SC4A 2WKQA 2HREA 2YS6A 1YMVA 2FFBA 3NV9A 1RM5A 4MB0A 4DQUA 1R50A 2VH5R 1M33A 3DXZA 5K2OA 2SHKA 4ER7A 1UEJA 2ZOSA 4GLJA 1Z4JA 2I2FA 2QGNA 4FHDA 1SURA 4JGIA 1IBLB 2E4VA 4KWCA 3QLVA 4MRMA 2DWUA 3ANMA 2YHIA 1RU3A 3NEAA 2W2TA 1BS1A 1L4BA 4JLBA 4LCEA 4KKVA 4URFA 5IBRA 4I3HA 5JJLA 5FX2A 3C3CA 2C4HA 3GMDA 1B14A 2BR3A 2YICA 1MBZA 4X7RA 1WM1A 1Z4KA 4EA8A 4HN4B 4IILA 2J87A 3A10A 1EGVB 4K2AA 1GPH1 4O5OA 2XRZA 2EJTA 2ZIEA 2VZLA 3A9SA 2JKZA 5CDHA 2Q62A 1P17A 2G8NA 1X2BA 4ASUD 2WC1A 4YJ3F 1KO5A 1PJBA 2WU3A 5EN4A 1NASA 8LDHA 3BIXA 5BPHA 1QIDA 1XCGB 1T2DA 2G04A 4G41A 4B8WA 4P5PA 1DQYA 4ASUA 3O5AA 3BL6A 1SUCA 1NGSA 3RI3A 5KOHB 4I4TF 4JKYA 1E64A 1SHTX 3GGSA 4XIFA 3EYAA 5DX1A 4TXLA 3ZCPA 3DZ8A 5DASA 1QDUA 3FLAA 4EY7A 3ITNA 2RHDA 1XLVA 3UXMA 1SBCA 4LXHA 4BVBA 1YZQA 3P0JA 4RWZA 5E8RA 5GMOA 1JYEA 1FTWA 2Y68A 3LYLA 3PQ2A 3V1KA 3BKWA 1NOIA 2OP1A 1SUAA 2ZI4A 4QXMA 4ZAGA 1N3BA 2AN1A 2KHZA 3ZE2B 4B17A 3RANA 1SBQA 2CYBA 2CFIA 1B6RA 1F51E 2PKRA 1XJQA 3DZBA 3QY9A 1KQ3A 1QGUB 3VU1A 2ZT8A 3LGSA 4LDPA 4FOOA 5HK9A 4DMFA 4KI0A 4F21A 1M0WA 1Z4NA 3LU1A 3DCYA 2DPXA 2PY6A 1P8AA 1PI3A 3B20A 5CT5A 1MOPA 2O2YA 3BQMB 2YIVX 3EAFA 4F9TA 1OILA 3ZWMA 3AVWA 1I51A 3S2SA 2HFKA 3OOSA 2WJPA 3L8MA 4CMAA 2ZM6B 4DV3B 4J1QA 3T9AA 1O2DA 2BV3A 3PE4A 3LQ4A 3R0IA 1DBWA 3UAGA 3U9TA 5IYZB 1CR1A 1PLLA 2JNWA 1GGEA 3N86A 1OBHA 5D6OA 3WV5A 3ELWA 3MQFA 4HEA6 1E18A 2ODEA 1KEEB 2E5WA 1AKNA 2R7KA 2H1IA 2JFZA 2B1JA 1R9NA 3IEXA 2Y1LA 1N2ZA 3CUYA 3TNYA 3F97A 1QH0A 2F3UA 4AG5A 4QULA 3C24A 4URWR 4INZA 2C4NA 2HWUA 1WCIA 2CC2A 1J97A 4OKIA 4G4GA 1M5TA 4ZCLA 1AKQA 1YZNA 4XSGA 4F4CA 2XNHA 2JLRA 4C78A 1GNLA 5AHRA 3BMCB 3PS9A 4QIHA 3CEHA 5CGZA 4KN6A 3K96A 1YCGA 1DOHA 2K2QB 1TT7A 3A9UA 4C7VA 4CXMA 4EYQA 1NJ5A 4O1HA 4D0NA 4EYKA 5FOVA 2I99A 5DNAA 1KSJA 1SXQA 3O91A 3L1KA 2PUWA 4RA9A 2FRXA 3TX2A 4JEMA 3DEIA 2QIOA 4JX9A 2CNBA 4OY3A 2EGHA 2CNDA 4KLRA 2ZB7A 4MRNA 5ALZA 5KYUB 1FYVA 2DETA 2YX1A 4KVFA 4Z49A 1TQHA 2OK8A 4IMJB 1K0UA 5JZVA 3HN2A 2B4TO 4NHEA 1T3LA 3ETEA 4BDTA 4LBWA 4MVJG 2QR3A 4UHJA 2HSEA 2IODA 3E8XA 4ZCIA 2YQZA 1SRRA 1QGDA 3BE4A 1YZGA 1Q7TA 3EMVA 5BMVF 3D4LA 2FG7C 4F1KA 4D0LB 3SZLA 4GPTA 3EAGA 1POWA 3S0JA 2ZUEA 2ZRKA 4GLFA 3ZU3A 1PX2A 2MSNA 1USVA 4US0R 2OXFA 4ZZ0A 1Y5IA 5DTJA 1VP9A 5IKMA 1OTXA 3C4VA 2L82A 1Z8NA 2GCNA 2IE0A 1Q7EA 3IC5A 3SE7A 1BYIA 1EQ2A 1KI4A 1SBTA 4YC7A 2AFIA 1VPDA 1OYYA 3EIXA 3LLMA 4P22A 1ORWA 2J7PA 3EZ2A 5LBUA 4N49A 3H8JA 4QICA 1P4AA 2CHEA 4U5XA 1I94B 1SCBA 1FTNA 2ORVA 2R3SA 1ACJA 1IOLA 2XQJA 4Q3CA 4RKWA 2HUNA 3KL4A 5K3CA 2W70A 4CG2A 4EHHA 4NBVA 1JPNA 4EENA 2FA9A 2OCLA 1OFTA 1JDBB 2VJLA 3QQ5A 4UATA 5KDDA 5C8YA 2ON6A 5BOSB 4KXNA 1IZ0A 3UH1A 2NUBA 3FIJA 3AB3A 3H0KA 5JWOA 3PFFA 4AT1A 3CVXA 8AT1A 2I34A 3ZU4A 3H5TA 4EUHA 4RTSA 1XB2A 3PC3A 4P3KA 4KBYA 1TCAA 3G13A 3VR5D 2WHQA 4C4TA 5CXQA 1CUGA 5EJ2A 4OHRA 2Z2IA 3UYKA 4DNFA 2WWHA 1SXGA 3ZDEA 5C53B 4X20A 3AIOA 1QGAA 2QORA 2I55A 2BH9A 4Q16A 3DM5A 2C9ZA 1EYZA 2PLRA 3WGQA 4DB2A 4B84A 2Z3VA 1N0IA 4N41A 2M1XA 1ZGJA 2GNPA 3LTEA 2AXQA 2HU2A 3BCUA 4GXTA 4JLMA 4AS2A 4YRNA 4G09A 3ELUA 2J5RA 4RCZA 4P0QB 1XDZA 1DL5A 4Y6LA 4C5CA 4DE5A 3F67A 3DMTA 3B12A 5LD2B 3KHUA 4H77A 5CTJA 4PNPA 5MN5A 4NV1A 1NHWA 5K3EA 1WR8A 4YRAA 1Y8QB 2HCRA 2QZJA 3N8HA 3QIAA 3D1JA 1Y81A 5E6UA 2L19A 3JQPA 3LC2O 3CH7A 5EWJA 4DMLA 2FQXA 2WI8A 3BMQB 4HPJB 4P6VF 2ZAMA 3ZLBA 2EQ5A 3KQHA 1PK9A 2BDEA 4IOJA 3RIMA 5KSPA 1PVVA 2E1RA 2GTHA 5B7PA 3O3OB 3C6YA 3O74A 3IHLA 3S2ZA 5ES4B 4IFBA 2PEZA 5D86A 3S1LA 2IBMA 4TN1A 2W8BA 4TWAA 3PNMA 3JAWB 4R8VA 4WECA 5B3LA 7REQB 1YRBA 2UVPB 5FR1A 1RNLA 3LXMA 3W9YA 4KXWA 4EFMA 4MGYR 4HFJA 4JMLA 3NXKA 4BP1A 4DF3A 2P0EA 1ITZA 3EWNA 3HCRA 4MW2A 3V8RA 2NUTB 2ZB2A 4CUKA 3RQIA 3TIXB 2IHVA 3C3PA 3C87A 4M99A 3SIXA 3UWSA 2XF2A 1PJ4A 4BNNA 5BVGA 2NSJA 2HA3A 3ZD8A 5JCJD 1V35A 1YL6A 3K0FA 3NVMB 5F1OA 4KZPA 1HXHA 3LH5A 3TVDA 2FOXA 3T3GA 4S0XA 4EDHA 3GGCA 4J6FA 4E4TA 3WFIA 1KMHB 1J0AA 4C43A 3PDIB 2QQGA 3UG7A 1U0FA 2NPIA 3QKSA 2V45A 2ZVPX 3HDYA 1XD2B 4G6ZA 3G7SA 3VKVA 4CDRA 1JG4A 3DL2A 1A9QA 1N9GB 4TOIA 4K3VA 1OPXA 5ALTA 1W6UA 3ABZA 4NDZA 1N2BA 4GPAA 2HKIA 4ALIA 4BP9A 4DDKA 1PR2A 4NBUA 5KQRA 3INNA 2GYYA 1AZTA 2VI5A 4B71A 2PT7A 3P4XA 1PYDA 2M6SA 3GLHB 5H0IA 1AQIA 2CVZA 2YY6A 5A7HA 4IJ5A 4PW0A 2XWSA 1W9MA 3KDPA 2ZYSA 4BWYA 4R3NA 1VP3A 2O3SA 2WUFA 3DBIA 3O8QA 3OOHA 1G8HA 3R20A 4JWKA 3RODA 1YZUA 1AUPA 1SUBA 1WUTA 1DAPA 5E7JA 3UK1A 3QXCA 3K6SA 2VXBA 4D3FA 4GAEA 1Z37A 3CISA 4LZPA 1E5VA 1KC3A 2ZJFA 2XE8A 4CLRA 1G8KA 3KPWA 4RTLA 3WLPA 2MYPA 1U7PA 4B6RA 5AVRA 4X41A 3AGQA 1XOIA 3NRBA 5AHXA 1MH1A 2VSNA 4J76A 1XPOA 1PJLA 4XX0A 3OEEA 2HZ7A 2GK3A 1PQUA 2Q4OA 2VRNA 5FUYA 3F9IA 4HDNB 4C30A 2PFGA 5HUQA 5GJWC 1A9XB 2ZE7A 3QWHA 1JG3A 3DWEX 2PMFA 4CEIA 1HR0B 3AKZA 3K1AA 4KDEA 3OE7D 1GZ4A 2AFVA 4ZK6A 1PFGA 4OQDA 3U3ZA 3SJCA 3QVGB 4EW6A 3PTLA 4ETMA 5EJGA 3MWJA 4UKDA 1EFPA 3TUIC 4C6RA 1QR2A 2NO7A 4NCNA 3G3EA 4RD6A 1SCAA 2GJ4A 2HH9A 4IDPA 3TN7A 3UGKA 3EXEA 2EXXA 3VZPA 3V6MA 1HL3A 4PTZA 3UICA 5GGYA 5GWXA 1U02A 4BEVA 3BHJA 1YFKA 2OXIA 1Y9JA 2RE8A 3O83A 3D9QX 3LUKA 4W9NC 4ZHQF 5KQMA 4JL8A 4ETWA 3PEFA 1JFSA 1BCRB 3LHSA 2IK8A 3WB1A 2WJIA 4BQQA 2YOHA 4F6LA 3ZZ1A 1H5NA 1M1YA 5GJBA 2C9BA 1J8MF 1O4WA 2IYWA 2QMQA 3JQCA 4JJ7A 4U6NA 4RZSA 4BNJA 2OYSA 3GDOA 2JH8A 2QSYA 4OATA 2AWNA 1A9PA 2GS9A 1QP7A 1H2YA 2BZSA 5EKUA 4F2GA 3KJFA 3P0RA 5ALQA 3DFMA 1LPMA 5JY1A 3ZEIA 1U2QA 1H5QA 5LLSA 3CW8X 2IUYA 1H1TA 3FIUA 4GSKA 4KQ2A 3O8RA 1ZPDA 5AQ1A 1HDCA 1OJLA 1MCZA 1Z7GA 2ZYGA 2LP4Y 4OMUA 4OHZA 3G2PA 2B5OA 2H52A 3NTLA 3TQQA 4NFSA 4QTTB 4BC1A 3M4NA 3QZUA 1B3BA 5CFMA 4G1FA 1CJBA 1SQ5A 2Z2KA 4FGJA 3V46A 3AFNA 3HFGA 1WMDA 2FW6A 4UPEA 3V7WA 3WB2A 2WWIA 3UKOA 1GAQA 2XKKA 5BSTA 3H5RA 5DHRA 3BSYA 3GRVA 2VCHA 3MEQA 3AOEA 3IOMA 4AKIA 3HEBA 2OA0A 1X9GA 1C1HA 5EP2A 4BQPA 5ALSA 1EGHA 1N0HA 3DZCA 3N6RA 3UO8B 3H84A 2FX2A 3E18A 1WSDA 2J9ZB 3W1VA 3KDSE 2H9AA 5I3ZA 3LUPA 5MGNA 3NTXA 3TW8B 1JHYA 2MOKA 4BFTA 2FSIA 4INOA 4NMXB 3D0OA 5D85A 3WZ2A 3ZXSA 4EQZA 2OY0A 3LZCA 1VG0B 4WLUA 4JJAA 1S9HA 4ZEMA 1ZJJA 1AZWA 2XBLA 3UJHA 3WLKX 1E9DA 2R44A 5F76A 2CXUA 2RGXA 4NE7A 4I36A 4EHLA 4JX8A 4KFCA 3VBEA 5BSVA 1L6IA 2QZZA 4IJMA 3IMKA 3IAUA 2ONKA 3LPNA 1GRNA 2X8BA 3JAMA 2WNHA 4IINA 3UOGA 4CM5A 2O8FB 3L4EA 2F3PA 2KI5A 5JH7F 2Q0SA 3FR7A 1VG9B 1H22A 2G5GX 3D64A 2Q4DA 1RWMA 3HRIA 5KTSA 3M6VA 3HVRA 1FFHA 3QBTA 1EX1A 4UQPA 3SOPA 4E15A 1KZ4A 5FA5A 3LXRA 4P08A 2AZDA 3SJUA 2Z1MA 1KSHA 4JJ6A 4WOPA 3EEIA 2E5LB 4O3MA 4ZKDA 3MXOA 4W7HA 4YLYA 2HWKA 3R3JA 3KKOA 1MX9A 4QDTA 4TQGA 5DRTA 1ID8A 2YNMC 1ZVMA 3I6IA 4A8JC 5FTNA 1GU7A 2FW8A 3ESYA 3IAM1 1W5SA 2FSVC 3OH8A 4HLUC 4K46A 4WZBE 1U2TA 2JDID 4QUGA 2A0YA 4E30A 2H48A 1GDHA 4FLEA 1E4YA 1EQUA 4F7WA 1CQJA 2PUJA 4XQGA 3FETA 2JDIA 1E6CA 1J2YA 1IIBA 1QAMA 2Q5QA 1UXHA 3DC7A 4CHTA 4NENA 4R01A 2DTDA 5B4UA 3ASZA 4Z4EA 1DMSA 5C1DA 1UFRA 2Q07A 5KNBD 3HL0A 1BVYF 1FTSA 5FBWB 1P9OA 2RG7A 4XB2A 5KNBA 4KNWA 3TAHA 4LECA 4Y6SA 1Q0RA 2OG2A 5I9IA 1E2EA 5KTNA 5AKKA 4MVJM 5KX5F 5ED4A 2QIPA 5LZ9A 4BTEA 4COOA 5G4KB 1U9YA 3PUZA 1CFZA 3WNZA 3ROZA 2GOYA 2NADA 4B47A 1V1MA 2FUG1 1X74A 2HBQA 2YNMD 4MLPA 2YBDA 1UKBA 3DVRX 3K5WA 3IT2A 5HW0A 5FNVF 3GYGA 2L69A 2C1ZA 3E3OA 4NJEB 5L3RA 5BP7A 2OGSA 5M2QA 2JD0A 4UHHA 4A6EA 4U7JA 4G8JA 4YO7A 1I4WA 3D43A 4E5DA 1HRDA 1NMSA 2ZIWB 1J8FA 5FCDA 2X9NA 4DMUB 4EY6A 5M29A 3B3AA 5IAEA 2H1OA 5E6SB 4C7BA 1YC5A 3ADKA 2CNNA 3KE8A 3LSYA 3P5SA 2Z6AA 4W7IA 2H29A 3GVPA 1JIIA 2CMDA 3SIRA 3A1CA 5FBVB 3QVSA 2BHSA 1EXNA 4XWGA 1YK1A 1V2HE 1FBNA 3H16A 3OF2A 1HETA 3E7FA 4CTMA 3KCQA 2GBGA 5G53C 2H59A 1IHXA 4M1QA 5AJXA 3EOZA 3ZZ0A 4PGMA 3H6GA 4K9SA 2ZI5A 2IXEA 2FPLA 4G4JA 2FFHA 2V7UA 5LOVB 1M5UA 2A5LA 1UBRS 5IBQA 5K6RA 1YRLA 3AEKB 2D1YA 5GONA 1FS4A 5FOUA 4WX2B 4WXHA 2RHMA 3AU8A 2EQAA 4NYJQ 1V7PC 2PLFA 2EIXA 3JRNA 2WD9A 4DL9A 4UBKA 2DJ5A 4CKBA 3U4CA 3BJMA 3RC2A 3ZDFA 4JUIA 4DLTA 3W5CA 5JQGF 4BGUA 3GVXA 3I0NA 3IKVA 1NI5A 3ML1A 1ZD3A 4DV4B 1U9CA 3SDBA 1EFDN 4YHHB 2DWCA 4B3GA 3RQSA 2BZ0A 3E22B 4ZOLA 1M1NA 1NV9A 3L9WA 4C2AA 5ITVA 2YYYA 4PVCA 2PHZA 1P7YA 3U3KA 1PR9A 2CB0A 5BWBA 3RU2A 4I1UA 5K4AA 2O0LA 3WMWA 2XQIA 2VJMA 3AR8A 1XWWA 1BIFA 3GPCA 3H8VA 1QHGA 3V1NA 5ADVA 2G9VA 2IOFK 1LLQA 1VBMA 2ZLBA 3BJIC 4MW7A 2J0UB 3V4VB 1TLTA 1HO3A 2PXAA 5KTRA 3ESCA 3IAXA 1GNPA 2A3RA 3OSUA 4NBNA 1ZGBA 4X6UA 3CWZA 1PZNA 2DKNA 2PV7A 1NJ8A 3PNOA 3HCOA 3B9PA 4EG7A 1K8QA 1ZDMA 1SNYA 1HQKA 5KTTA 1Q1NA 2A86A 2FEWB 3NANA 1MOSA 4M0LA 1VE1A 1YOVA 2H31A 2XNJA 3CKLA 3E5HA 3N2NA 1EUCB 4K9RA 1BRTA 4B6EA 2FZVA 4PG7A 3L0ZA 1KZ9A 3EGDB 4REMA 4PNEA 4KMOA 4PZ9A 5HWSA 1OGIA 4WUVA 3PD7A 4D3ZA 2OC9A 3NFYA 1XALA 4N6OA 2EJCA 2YWEA 2GESA 4Z2AA 3H2KA 3T9EA 1U8XX 3SZGA 3O1LA 4EG8A 3BHMA 1JTEA 3GPIA 1DE0A 1PQPA 4FDAA 5SYAA 2HR1A 1E7QA 3ROFA 3MPUA 4X8HA 1BWPA 1Z0KA 3DQPA 1ISHA 2NXNA 4M54A 4EJSC 4ZI7B 1ZK0A 3T5GA 1ZUWA 1FQJA 3FPLA 1TW2A 1E0SA 1Y0BA 3F46A 1M2VB 5ALJA 5K45A 4XD2A 1SVLA 1KO4A 2VUHB 2PANA 1OROA 1H2XA 1DKMA 2GUGA 2FRDA 3E15A 1BDIA 3L4JA 1UWVA 3E9YA 1YR8A 3LX8A 3OEWA 1X80B 2FSGA 1DZIA 1G17A 1YFZA 3DT6A 4YT5A 4WTOA 1NLZA 4GI5A 2AMYA 1RRFA 3O9VA 2VTDA 2XMZA 3P7MA 4AJPA 2B69A 3HBNA 3IP6A 3KZMA 3NDRA 4ZOAA 4JI7B 4D97A 1PS0A 3PQCA 2EW2A 4D99A 3IESA 4FT4A 4RIEA 3UMCA 4ARUA 2NTJA 3I01A 4OHOA 4B3DA 5DLEA 5ALIA 1OFIA 5I7FA 1NUAA 5ITSA 3OU6A 2BN4A 1XLTC 1FJXA 2FLWA 3GH1A 2X15A 4H18A 4XIYA 8ATCA 2CVQA 1XP8A 4HDSA 3C3MA 2XYGA 1EINA 3H2IA 3GJYA 3HU1A 4QC2A 4WZ6A 1OR8A 3JYOA 1D04A 1F1BA 1UJMA 3VU8A 2ZBGA 4CFSA 4PSVA 4KU4A 2PA0A 1UP4A 2QMHA 3Q11A 3U7JA 4NCJA 2C4VA 4TM8A 3ANLA 1XNHA 1WSAA 3TLAA 3LBNA 3UXYA 3W3AD 5EMNA 1YB5A 1GL7A 4LJ8A 5FFNA 3R7SA 1U3DA 1N5OX 4L2IB 4E5UA 1NFQA 2Q2QA 1K88A 3T5BA 2O50A 4TMVA 3W3AA 1RHUA 2VP9A 4JIGA 4IOLA 5HRAA 2IZ0A 2VSQA 2EKPA 2NZJA 3FSRA 4ROSA 1WDTA 2FNAA 2BKVA 1D6SA 1DRWA 3HBJA 3MWEA 3QFCA 4P81A 4UNSA 2PWPA 4QDKA 1NULA 4RV9A 1DI0A 1L5RA 2QLNA 2JGEA 1CZUA 1NZDA 3PT9A 2GJ9A 3JZFA 5B2ZA 3USZA 3MFQA 5JRDS 1VBKA 5D3QA 2CFRA 3EGWA 3L2OB 4KQHA 5L45A 4PLVA 1GARA 3RFFA 4PZAA 3EUWA 3GIDA 5B12A 3ST7A 4RMJA 2G06A 3EBPA 2VDQB 1P1CA 3HV0A 4DA0A 4TZ0A 1PGNA 3C41J 4UTZA 1T4CA 5K05A 2F55A 2B36A 4C1NA 1SHZA 3NBQA 2B37A 4TMWA 1LCIA 1JHOA 3M2TA 1JFRA 1OW3B 5DX0A 4OYYA 4XGRA 4YLGA 4MWTA 4A26A 2IEDA 4F93B 1QIGA 3IXQA 4HH1A 2IEGA 4IMIB 3UB4A 3VTZA 2ECQA 3THOA 3ZXXA 1IHOA 4BX2A 3A58B 5AVJA 5B2EA 3S2IA 4OYLA 3UT0A 1U7WA 4MA0A 1X3LA 1CNFA 1G55A 1O9BA 1PLJA 1IIRA 5AICA 4BKQA 3K0AA 4AY5A 2WJ3A 4Y0VA 3WQQA 4EX7A 5HGXA 1JDNA 1IC6A 4J7XA 3RFUA 3UFBA 5L3SB 3SP1A 4KB5A 1ZIXA 4H7HA 3LQ1A 3EHDA 3AF3A 3O38A 5HKBA 5K9ZA 2FQYA 1F5NA 1KHHA 4OUKX 3GJ0A 3TBHA 2WMNB 3A3KA 1PV2A 3HCFA 4TWZA 3CNLA 3A11A 1VJ5A 3CMMA 2OFPA 4MCIA 2D2VA 3HC7A 5J2TF 4YQFA 1GUAA 1GKKA 1Q74A 5EI5A 1K68A 3A4VA 5KDOA 2PLAA 3O6VA 4RPIA 4WZAE 3UJPA 3JQ7A 1JGTA 1NF9A 1GUZA 3PXUA 5F7OA 2YJTD 5TGTA 2CHFA 2YVUA 2FX5A 4WZZA 5SZIA 2HK8A 4BFLA 2GFIA 3T99A 5LP1A 4E2WA 2WINI 5EXSA 3GBVA 4G97A 2H4HA 4C0AC 3OQPA 1JX6A 1K86A 4RKEA 3DKRA 4ZALA 3MQ4A 3B6ZA 5A5VA 2O8BA 2EFGA 2I91A 4OQEA 1OMOA 3EDQA 3GV0A 5AHKA 1IY2A 1PGQA 3ORRA 2WWVD 4G5YA 4LXYA 3SYLA 3OT1B 2JIRA 1L8LA 1G3RA 1XTKA 3GT4A 4JLVA 1DEOA 4CN9A 4GZ5A 4JOCA 3HUDA 4BY9E 4GE3A 6ABPA 1FQWA 1WEKA 2HSJA 2ZSEA 3B3FA 4P7JA 3RKUA 3GAFA 4RX1A 4ARIA 1J33A 4PSUA 4UBJA 4AJIA 4EMTA 3SVTA 4MV4A 2FF7A 1B2LA 3E8SA 1UJNA 4B6FA 5IDWA 2ZJOA 1SIOA 4WFKA 1KAMA 4E33A 4OXNA 2AC4A 1X8JA 2VEDA 4R2KA 3QF4B 5LBIA 1J21A 3AZQA 4YAGA 3TZHA 4Q9AA 5CT4A 4C14A 1PT7A 4YV1A 3TTXA 1JA9A 1LBIA 2YN2A 4NLLA 3I2FA 4NAVA 5AVSA 3R0JA 3KYCA 1HFKA 4BP3A 5IF3A 5AW1A 4D96A 2PCLA 1H65A 2DQSA 1Z5VA 5AKXA 4BIMA 1GUFA 3J81A 1E2PA 3TBFA 1P2GA 1H8ED 5ALVA 3UCXA 1IPFA 1QPGA 4FEYA 2P5YA 5JS2A 1Z75A 3L6UA 5CBPB 3QFHA 1YJCA 1MB2A 4OXKA 4S05A 3KUXA 2D5IA 4XH9B 2Y1XA 1O8BA 2XADA 3P1JA 4MRRA 5HVNA 2NTNA 4KDRA 1NX6A 4Q39A 4C05A 5BN4B 1YZTA 4GMFA 5IJ0A 2GM9A 5ICCA 2CHGA 2GHIA 3K0BA 4S1TA 1E1YA 1RSZA 2XTMA 2VPIA 2F1RA 2WYOA 3CNNA 3N2IA 1F38A 2JIDA 2WD7B 3CTMA 4V1CB 4FNMA 1CLEA 1Z18A 2XDQB 2W11A 3F5MA 2CMGA 1ODKA 1R10A 2LGJA 1I3CA 1E2FA 3G0BA 3KWFA 4DLUA 1LSUA 4MR7B 4NMLA 3W2IA 1VSBA 3OTIA 4E51A 5A5FA 2P2ZA 4TWJA 4FT2A 1W52X 2NT3A 4S35A 3L8ZA 2UUAB 1DB3A 4RDHA 5BUSA 3EMBA 1SVSA 2A78A 1C5KA 1UCFA 4Q4JA 2I67A 2AQKA 1M8PA 1TOAA 3NM6B 1QX4A 4RLQA 3CNHA 3L0OA 4IGEA 4AKTA 5KNDH 1MPXA 3L01A 1MV5A 1WB9A 2ZW9A 4QUEA 5FLKA 5AKJA 1K1EA 1P0QA 5A03A 3SI7A 2EATA 2BTQB 3QOXA 4XQEA 2XE6A 1AZSC 3SDZA 1RM3A 4UMVA 4D8XA 3KQVA 5IKXA 1MC1A 3RVQA 5L4LA 1NXXA 2ECKA 1TU0A 2VSYA 3CLRC 3WO0A 2YQ5A 3V33A 2W6OA 1NATA 2VF2A 1IHDA 2PMWB 3QOWA 4NU0A 1HM5A 3U49A 3EODA 4UNNA 1AB6A 2H17A 1P2TA 3DO5A 3EGOA 3LY5A 1FTYA 1T10A 4FJ2A 5A0FA 3RO7A 3SC6A 3BGIA 3B36A 1YUMA 1EJ6A 4LK3A 3MRXA 3M70A 3V8BA 2ZTMA 3VOBA 2Q3BA 3IQFA 1B15A 4JSTA 2A84A 2H3HA 3REFA 6REQB 2V5AA 4BNLA 1WRBA 1ZAKA 3ZPXA 5BW6B 1EUYA 1FMLA 3PQEA 4J0IA 3WLQA 1UKZA 3F5FA 4GOND 2JFNA 3DBHB 3RASA 5GQSA 3PPWA 3FYCA 1J0XO 1VRCA 1T36B 1CRWG 4P3YA 2GX6A 2YZMA 4FIZA 1R15A 2BCJQ 1YIDA 1HH4A 1G16A 3EYWA 4QOEA 1YFLA 3H19A 4MVCA 2WIFA 3EXG1 1DARA 3GZTB 5C51B 1OVGA 5LLTA 3PV0A 4J4HA 3SQOA 1Y89A 2VHXA 2G72A 1KDRA 3IT1A 3NEYA 1I2ZA 2Q9CA 2JI4A 2I5PO 3CLRD 3L1JA 3UOWA 2FWRA 3CKYA 2RHCA 2DR0A 1T9CA 3F9CA 5EGNA 3R44A 1JR3D 3BH7A 4MPPA 4OGGA 2Z8XA 2RIPA 2GCEA 1G4UR 5JZMA 1MQ9A 5LQCA 4F12A 5DSTA 4P80A 4R9VA 4EIWA 3AGPA 1IY1A 3COWA 4QU8A 5CHEA 1N2CB 3WNQA 3BX1A 4BS9A 2ENUA 4CMJA 4G86A 4KH1A 3NTVA 4KWTA 1TIKA 2KM1A 3GEBA 5HQJA 1WDMA 1SWVA 2WFLA 1SCUB 1Z8FA 5T4EA 1IY9A 1JE0A 3FUWA 1P3Y1 4FI3C 3KJXA 2ISSD 3MC1A 4H7EA 4HN9A 5J5AA 1KYXA 4OG2A 4KQIA 5B3KA 4J0JA 3DT9A 1L5KA 3BBPA 4Q9LA 5DLQC 5A62A 3F9RA 1JBEA 1GQFA 1IVYA 1CVRA 5CM2Z 5LXTB 2VATA 4GEKA 3F2IA 4PN3A 2J3MA 1IL0A 4YAEA 1YZFA 4YCSA 3C16C 3JQFA 3QVWA 2R7AA 4H1VA 4I55A 4MCJA 3AVPA 2X7XA 1MG0A 1IUNA 3N0VA 4JHLA 5DCYA 1DTSA 1H9AA 1JQJC 2G9ZA 4GT1A 4PZZA 4FZVA 4EBFA 4OLJA 1ZG3A 5DK6A 4OEHA 3CNQS 2CKMA 5AW7A 5G2OA 3H11B 2WNSA 4L9SA 3E1GA 5JI2E 3AYXB 4BV3A 3ZGZA 3ROMA 2WHPB 1N2SA 5KKCA 2IX9A 1P5RA 4DR4B 1GSIA 4LFAB 4LIPD 1XRSB 3DE0X 3JVDA 4IKPA 3PNLA 1NF8A 4R1MA 5CJJA 1E69A 3WISA 1YSCA 2BMVA 3TRKA 1ULTA 2HRBA 4M1YA 4QEKA 3DBRA 3LNCA 3JARB 4C4ZA 5JEEA 4V3CA 3FLBA 2ZIVB 3L1UA 5SZHB 1NF3A 5AJTA 5L51A 4OREX 5T41A 1E4VA 5GOTA 2F1OA 2CJXA 3F47A 1M34B 3N0RA 1RKQA 5SYMA 1UPFA 4ZODA 4G85A 4QAQA 2MMGA 4MROA 1W59A 3M0EA 4R5MA 3X1JA 3ZVLA 5JDCA 1Y42X 1DC5A 1RM0A 3D3JA 4XM2A 3WJ2A 1NJ1A 2PG3A 2FN4A 3TRFA 5IU6A 5HKOA 1CDOA 3PZRA 1E6KA 1R12A 2ZJ5A 3HJNA 4KGXA 1SC4A 4WLVA 3DTTA 2D1FA 1GPKA 4L8LA 3EPLA 4REOA 1JU4A 3ID6C 4HDKB 1WUHS 2VQDA 3FA2A 2QX4A 2FP4B 2H4WA 1AKEA 3QKUA 3DL7A 4IQ0A 4RXUA 4JI3B 3SQNA 2AC2A 4KOAA 2PX0A 1N7HA 1ZEMA 3PPYA 2WAMA 3AUKA 2QL7A 2IA5A 2RMKA 3GRRA 1VLJA 3WK5A 1J5PA 4GFDA 4NBLA 1ZZEA 3GFPA 3PVZA 1JLRA 4HPWA 3ZHZA 4B9EA 4RIIA 2FPGA 4RADA 3LRPA 1K8YB 4L5BA 1UBEA 2VQSA 2HIMA 4J1NA 5K1ZA 4A8HA 4DB4A 2R1TA 3E84A 2DEUA 4P82A 1JI3A 3ENNA 1ZOIA 4ETNA 2HCJB 2CXTA 3BTVA 3ZDYB 1SUWA 4GNRA 2GBIA 3BE8A 3AY0A 3D2LA 4M9UA 1UIMA 1TB4A 4F3YA 4QWWA 1SHKA 3L0DA 1OYVA 3P71T 1AKTA 2NZYA 4XDZA 1VIMA 2XKJE 3MJRA 4LTMA 1T0IA 1QCZA 1UIRA 2EEPA 3RIHA 1E94E 2CNWD 2L18A 1XJ0A 3GLUA 1F2VA 3RVSA 4Y2PA 4DEXA 3ODPA 2X9VA 4G2TA 4Q6BA 3TFQA 4URUR 1NI4B 1TIBA 3G7UA 4TTIA 2DFTA 2RKOA 4EY5A 5BMOA 3DE4X 1Q0UA 5TF0A 1S2OA 5AT1A 3VPXA 1GP2A 2I76A 1ADYA 1ZH4A 4M21A 2RBGA 1FNNA 3CZ4A 3BSSA 1BTOA 3A2MA 1ZN9A 2DQYA 5I9BA 3JD1A 1QGYA 2Y0CA 4C3OB 3KFLA 1E1NA 1PE0A 1AC5A 1D1TA 1Q6ZA 3UHAA 4E6PA 3RIEA 2DB3A 1FP1D 1C1XB 3K9BA 1YJQA 1ZISA 2LCFA 2NYUA 3WYFA 2IX3A 2YDXA 2E49A 3I83A 3WYBA 5E1OA 4B3XA 4U02A 4Y2HA 1QWSA 3UHPA 1ZSVA 1CLUA 4CF4A 2VDJA 4KLNA 1JSRA 1DIHA 3U7IA 4ND6A 3I05A 4MQFB 1ZINA 3OPVA 1H66A 3R7LA 4WBSA 3HVUA 2REQB 3GA0A 1ENZA 2B30A 4ZYZA 1YOBA 4PQRA 4R98A 2AQIA 1Z6PA 4DEVA 4YHBA 1CJCA 4RPKA 3TSAA 2P41A 3EFBA 1ZMRA 4LRXA 1XNJA 1WHSA 1H1DA 2J9RA 1ADJA 2FDRA 2V97A 1OB5A 3HJCA 4Y1RA 4JVNA 3D5QA 4I3GA 5CLQA 2WT9A 2BFPA 2DUWA 2Z6VA 2JLSA 4FKBA 3GU3A 3WLFA 3G59A 1CVLA 4TKMA 3O84A 1WIWA 1V8OA 3E7DA 2YQ4A 2GJ8A 4EVRA 2H1HA 1OLSB 1Z74A 1JMYA 1ODCA 3GRPA 4HGYA 5DWVA 4FFDA 1ZJZA 4OH7A 3PGJA 1ONNA 4TROA 5GOZA 4DUGD 1EP2B 4F5EA 5KWEA 1VBFA 4CMHA 5INTA 3OI7A 2P4UA 6GPBA 4O2LA 3IA2A 4CV2A 2IVZA 4IBOA 3CPJB 1UJ2A 3N58A 3OG9A 4B6OA 10MHA 1AZLA 3JQDA 1AVTA 3FPBA 5DHFA 5IWCA 4HX5A 1S7CA 3UV7A 1BX1A 1WXGA 3TTSA 1W6RA 2JFYA 3L7CA 1BHO1 1RVV1 2CUTA 2OBNA 1EVEA 1BOOA 1Z15A 3RS0A 2RKBA 5FA6A 2JGDB 3PQDA 1VECA 4UM9B 3E9NA 1YRHA 2VTBA 3N76A 1E4EA 3KZCA 4KIJA 3GLHE 3RRFA 5CLFA 5JJBA 1B00A 3NP9A 3HR7A 2ZSAA 1RHQA 2JJQA 1M1XB 3F6SA 3Q8KA 3K5HA 4MVJP 4QLBA 1RAHA 2FB9A 3COPA 4C7KA 3HWWA 2OVBA 2ZSHA 4TQUS 4L8VA 3T5PA 2IS6A 1XRRA 3DHWC 2F59A 3DB2A 3PL1A 1YVUA 3DAYA 1GKLA 4WNYA 1XP5A 5DTIA 5FO0A 2XWJI 1X3SA 1U6JA 3DXXA 3D6JA 3FGOA 1SIBE 3G9UA 4OV6B 3CHYA 4OTZA 2O2GA 5DV9A 3S8YA 4C88A 2GZ1A 2X5KO 1J2UA 4M87A 1JEYB 3I5MA 2NGRA 3FPHA 5C3MA 4QGHA 4K0KB 2ZJ3A 2JFXA 2ESRA 3HZOA 3LLSA 4RL6A 2EKQA 3SKYA 4IHJB 4HK4A 2GEUA 4RVDA 2IL1A 4LHEA 3ERCA 3IUQA 3Q6MA 4OXIA 2VP3A 3DOUA 2ZG6A 3BRSA 1FUYB 3GVCA 3DWGA 3NV7A 4IQ4A 4JR0A 5A3RA 2QTAA 3DO8A 4KQCA 2W2KB 1I13A 4ZMRA 2FMIA 1TKAA 5LQAA 2V5UA 1RM4A 3L41A 1ZM2A 1JG1A 1HUQA 5BT9A 4PYKA 4L15A 3VISA 4X66B 2PZAA 4P86A 5IW8A 2OV4A 2P40A 5TV2A 5DW3A 5EKXA 3KR1A 3O8OA 3JQBA 3TS1A 1VHTA 2IOYA 1C30B 2IIQA 1PG5A 2CLHB 2GPTA 4MSUA 3LQQA 4R0VA 3VYVA 1NYLA 1W581 4HGPA 2YDYA 3L06A 5KNCA 3TMYA 4OSEA 4RDCA 4PC1A 3CUWA 3T34A 4WT7A 1PS8A 5JSZB 5CDFA 4RS3A 3RJMA 4LYAA 3WLRA 1PHRA 3ASVA 4BV2A 4DSOA 2RGGA 1A9SA 3IT0A 4ND2A 1X42A 2J5XA 4I2VA 1CUZA 3EXG2 5IX8A 2P79A 4KITB 5HJ7A 3I4LA 3L8FA 4PHCA 4AECA 1Z07A 4LI3X 4GR5A 5IFLA 2WVJA 5HJEA 1QBKC 1E3TA 1XDBA 2VJNA 3FZNA 2UZ1A 1QLHA 1U1DA 4JYPA 4QBIA 1FA9A 2WPNA 2Y0EA 2WJZB 3GVIA 3SYKA 5KDLA 1T2FA 1CS0A 3LBAA 3AR6A 3QEKA 5EWLB 3ZKWA 1ENOA 1XAJA 2JKVA 1U11A 1GAEO 4BQNA 3WDSA 3GRAA 2PYDA 3OKFA 1JSLA 1GFZA 4L4YA 1EE2A 4Z7QB 2PO7A 4MUNA 5EIHA 3D02A 4Y9TA 3E9DA 3AR4A 4V2IA 3U1TA 1SQSA 3ZWXA 4P7FA 3E6AA 2PX4A 3OCVA 4DIOA 4MUMA 2QUZA 4OX9Y 1W46A 4ARBA 3HABA 4D9NA 5TSDA 1RYZA 4GYYA 3BG5A 3BS4A 2W2OA 4JQCA 1E7YA 1RHMA 3A6DA 3T35A 4PANA 3ISJA 3A36A 4Z9XA 4BO8A 2ORYA 1B0ZA 2ODWA 3LP6A 3TLBA 4C3ZA 1LJLA 3JR7A 1FFEA 4X9XA 1N5RA 3HB4X 2VDNB 2OHXA 4CQNA 8MHTA 2AX4A 3FYDA 2XMSA 4B3HA 4NEGA 5LU9A 1IOZA 3NC0C 3NHZA 1J7JA 3IUNA 1Q83A 3VPAA 4F4HA 1Q1QA 2OL4A 1T6BY 1QC5B 6PFKA 4U5QA 3E70C 3D4NA 5DO9A 5I47A 2PUVA 1D8AA 5KNLA 4I1PA 4DPMA 2E18A 4TLEA 3H8SA 3OQMA 3EEYA 5F5XA 2H18A 3PRHA 3NI2A 2GETA 2QYHA 4FCTA 3IGFA 4QUKA 4AO6A 3V4FA 1NMYA 2ZQYA 4IXMA 1GGJA 1BGWA 1Z62A 1EPUA 3QPAA 2X8LA 1O03A 2ONJA 3W79A 4IZHA 4EI9A 4YRZA 5C5CA 1Y1QA 3Q1LA 1ADGA 3ZNOA 2JAWA 4JNKA 4BZWA 3D7NA 5F77A 3KXLA 5M3BA 4OIFA 1K3FA 1MP0A 1DWQA 3M6AA 3SJZA 2Q2WA 4YUWA 4YUZA 3EEFA 2FUCA 2YYZA 3FCOA 3LT5A 1WZNA 2EWVA 4G26A 5TPZA 2XCRB 4TRMA 1JVBA 2I2DA 2QAGA 3H7IA 4OB8A 4IIUA 1MGPA 2QRHA 3STHA 1G38A 1YKFA 1ST2A 2UKDA 3I3OA 1XC7A 2P3OA 5AI5A 4MR9B 2EJVA 4G84A 4I1YA 3JRXA 2QAJA 1IXKA 4PQEA 4P4TA 5D3KA 2OCKA 3PEYA 2RGDA 1Q16A 2A5FA 2FPKA 3AIIA 1ZH6A 5U1PA 2Z9DA 5JARA 1QV9A 5IM4A 2L2QA 2G1AA 4BLRA 1V16B 1NY5A 3SF8A 1NXTA 4R6XA 3S2EA 4RWEA 3ACDA 3LZDA 2WTNA 1I7SB 1L7QA 4CL2A 4YAUA 1RLJA 5JPDA 3P4UA 5H5JA 5CVEA 1I8TA 2FGKA 3L4SO 1K9SA 4UVEA 3N75A 1FDUA 1HOTA 4F84A 4EATA 1P5ZB 4UPDA 4D8VA 3ZIDA 3T9DA 1PHPA 2C2GA 1N2EA 1X1AA 3NVAA 1QCDA 1NN1A 1U8AA 3R77A 2WJAA 3MVEA 3UXEA 4LSWA 3HCEA 3AJDA 1ZSNA 3PCTA 1YIAA 1N57A 2AXNA 4HB3A 4ZVMA 2IXAA 4Q1CA 5KYYA 3R5SA 2B4QA 2ONYA 3I9V6 5DM2A 3UC5A 4EB6A 3AUAA 4DCSA 3VU9A 5FPKA 2IPAB 1OYOA 1XZEA 1NUSA 3EZ6A 3L4BC 1M73E 1XRPA 3QA3E 1ZGZA 5B1YA 5FAKA 1WW3A 3N3AC 3MJCA 5JANA 2PH3A 1R0SA 4M8KA 3GEDA 3NONA 1FX0A 1IK6A 1HSOA 2OV6A 3Q3GE 4JLJA 1KFBB 5LP6C 5L4SA 1BXRA 4MRMB 2YHIB 2QRPA 3C85A 2NAFA 4MVJE 5LOVF 2LW7A 2J4DA 3L43A 3Q5EA 2WUGA 5KJEA 5U9CA 2QLFA 5FTJA 1IJBA 2XWQA 1I5OA 1F3LA 1KJZA 2VWGA 3IBGA 2WQ7A 1L4HA 3SM9A 4L9WA 1RQ7A 4Z6KA 1F06A 1U0OC 3RS3A 1UAGA 5EP1A 1HI9A 3VNAA 4YA6A 1TTHA 4LRTB 4WK4B 3A2LA 2C9YA 1LPPA 3GUCA 1RWPA 4JT4A 4J90A 5LL6P 5TMPA 3GZNA 2QN6A 3JVVA 4BZPA 1Z0ZA 1M1UA 4LX8A 3NB0A 2PH5A 1T5LA 2GRJA 1CDDA 1QOQB 1XZHA 3JQQA 4RESA 5BV8A 1YDFA 1KARA 4DBLE 1Z88A 3ZU2A 1JLHA 1SUFA 2AYYA 3K9GA 4H7IA 2B8NA 3K71B 4GMXA 3EPPA 3IP5A 3QFSA 3KXDA 3PPIA 1GU0A 4XQ9A 2M6LA 5C5DA 1TFRA 3WL3A 4FD2A 1BMFD 4JBYA 4MV9A 3WYAA 3LHKA 3ZZMA 4BLTA 5EIAA 3H05A 3PLAE 1II8A 4JH0A 3KUCA 1N3IA 1P2UA 1BMFA 3QWIA 3W06A 1H4QA 2PXXA 4FFRA 2JAHA 3THWA 4X44A 1E59A 2A14A 2J9XB 2X2OA 1E6WA 3INTA 4LCBA 2F3RA 1A9RA 1MABA 1HPLA 2CXNA 4N3CA 4PC2A 5KWIA 4FBLA 5EKTA 3IBTA 2CXHA 2AMJA 3F3MA 1SCDA 3K0KA 4J2TA 4KV7A 4Q1VA 3MCUA 2B92A 4LWQA 4AQ7A 1QK5A 4JBWA 2VHQA 4L3VA 1KEPA 3ROPA 2ZPUA 4RPJA 3IBCA 3TR6A 2VZ0A 4ZV4A 3JQ9C 2HBZA 4YVFA 5DGCA 4D9EA 2E87A 4R41A 2ODPA 2PKWA 1A2KC 5HDBB 4PYNA 2XCTB 2ZBQA 4JLWA 5KC9A 2Q27A 5MN4A 1V8PA 2DQKA 4WCFA 4PAWA 2B6HA 3GYBA 1GSOA 6YASA 1GNRA 1Q84A 2VZ8A 3C2QA 4RACA 3ZV7A 2DULA 5DT9A 3I09A 4B75A 4D4KA 3NJ8A 1PYOA 5ETJA 2BEKA 5C1BA 4DQXA 1SO8A 4FZ3A 5ALHA 4BO1A 1RJGA 4C87A 2GLUA 1Q7RA 3JS5A 1G63A 4H7DA 4NCKA 4EG0A 4C04A 4GOKA 4L4ZA 1Q95A 3FTEA 5IPFA 1NIJA 2HMYB 3QNWA 3NMUF 2QD2A 4OJTA 2CNOA 4S2EA 3WJ1A 2IH4A 1U0JA 1XXHA 2F1KA 5LQSA 3D7SA 1TM1E 1QE5A 1BDJA 1UEXC 2BFCA 3E82A 2I33A 4OBXA 4GZ3A 1KY5A 2OSBA 2X0EA 4XVRA 1WCIB 2A5JA 3IOYA 4FOTA 4EHIA 3CYFA 1RTTA 4IUYA 3VR6H 3L79A 2GLXA 1L5HA 3ILHA 1YAHA 4BMSA 2YXLA 5EIEA 1N34B 4QM6A 1XPRA 2BSAA 1H2EA 2PCJA 4WNCA 1GTL1 1QHFA 2L17A 2BHLA 1RP1A 2Q0XA 1NJ6A 2V1XA 1XVLA 1S2GA 5AYVA 2FYTA 3IBFA 1LW7A 3TSYA 4RA9B 3W5IA 2GCPA 2FDCA 1G3IA 3ZZUA 1WXEA 3ZE1B 2XBUA 2EF1A 5THXA 3S29A 2JBHA 3LUDA 3NBMA 4HMOA 1I3LA 2XZOA 1ZVVA 3SSNA 2XRFA 3BHNA 1IZ7A 5JAUA 3A04A 3L6RA 4X6XA 1M1ZA 1U2ZA 5EKSA 2C1EA 1RJFA 3OUTA 3UJBA 1NRWA 4GP7A 4Z1OA 4E1VA 2XHEA 4JUBA 4XGKA 1Y3BE 1X7YA 2VPZA 4KV9A 4IR7A 4RD4A 3MQ2A 2WT4A 4IG9A 3RE1A 1GQQA 4QU0A 1SVMA 3L7JA 3NNNA 4M0MA 5J4VA 1CEQA 1ZC4A 1UKYA 4M7RA 3V1UA 1PAUA 1EM8A 1DIRA 1R5BA 1THGA 4CM7A 4Q4CA 1VMKA 1XMIA 2O19A 1L4MA 3F4LA 3ICCA 4QELA 2ZRNA 3F78A 1N5KA 1EA7A 1VTKA 4RFSA 1M8FA 3TLGA 1BFDA 4TRJA 4XAQA 1XKXA 3K35A 3W78A 1M6HA 2VF7A 5JDIC 1V5FA 3MJTA 3S3TA 3EDMA 2WTMA 4BFXA 4I81A 4RZUA 4EYSA 1Q0SA 4RM3A 2C0CA 4UW9A 3RRYA 2AFIB 2FFQA 2B7CA 2CMFA 4IJ6A 2KS6A 2VF5X 1QCCA 2G7ZA 3R6WA 1ENPA 3PENA 5KU1A 3RUPA 1NVFA 3BFXA 2NYAA 3I5UA 4DMHA 3VKWA 4MJLA 2YN0A 4BRSA 1DAGA 1NDQA 1WMBA 3WKCA 4AXXA 4CKEA 2YUIA 4K87A 2R00A 4OU5A 4NIMA 1T9KA 2AHOA 2IKSA 3O8BA 4HQNA 4M6WB 4LWPA 5DYGA 4WFIA 3ED5A 3ZJVA 4F60A 5KYTA 1YL7A 1P4GA 3KQNA 3JYPA 4N7RA 2F1JA 4MWGA 5KHAA 4BRUA 5BQPA 3RVOA 2A33A 4Q3DA 1E0JA 2FEPA 5G4LA 2FTKE 5JASA 2EJWA 4TM7A 2SICE 1B6SA 4GSLA 1E1CA 4A0GA 3AF6A 1WDWB 2VHTA 1GYPA 5LQDA 4X20B 1JQDA 3CLVA 3FUCA 3BAZA 1WMSA 1W73A 1DEHA 2ZITA 3KOOA 1NQOA 4BNDA 8GPBA 4ABYA 1JECA 4TGLA 5I4BA 1Z5ZA 4F96A 3MMXA 5JDIA 3C4QA 3BD6A 4J1TC 1R37A 5B1SA 2X14A 3K9WA 1XGKA 3ETGA 1X7ZA 1COWD 5DU2A 1PT8A 1DIAA 2W4QA 4L5AA 2GN4A 3RVKA 5HZKA 1NX9A 2HSWA 3SSAA 3Q8WA 2LZ0A 3RUIA 4ZK2A 1X94A 5I7OA 2V4MA 3RC1A 4LJYA 3UGJA 2P9YA 3JW8A 5C7IO 3RAGA 4N6GA 4H0CA 4NPCA 4WLFA 4B34A 1DJMA 2R97A 3RT7A 4EABA 3HP1A 1DGQA 4P2GA 5E6UB 2IDZA 1CB0A 2O6LA 5EWJB 2F67A 4WFJA 3OU2A 4CEHA 1WUYA 3C3AA 2AC7A 2Z5VA 4XUCA 4ZZ1A 2AYXA 5CP8A 3U4QA 3UJAA 1K7CA 1RJ9A 2G3YA 2WKSA 3OJWA 2QYSA 1Z47A 5EJ9A 3K7EA 4L5YA 3C45A 1Q7GA 3HP7A 3OIYA 4XEUA 3WGTA 2W8BB 4P5DA 5CFNA 4JI1B 5TMDA 2H1LA 1L5NA 3KOYA 3ORSA 4YP0A 3M6IA 1QTRA 3O21A 2RHOA 4TQ9A 1MTZA 4ROTA 4MV7A 1NYQA 2CLLB 4NZOA 3WGGA 2A1TR 4KCGA 1G3MA 1D2CA 2V55B 3CWCA 3QMVA 4HRXA 1OA0A 5DHSA 1L8AA 1RIFA 3TLKA 3LPLA 5BVGB 2EIHA 3MAAC 2ZB3A 5E2AA 3ZK9A 3K0FB 4F9FA 3AEZA 1W87A 1DKPA 4HT3B 1QG0A 1QKKA 2GBLC 2G28A 3MUOA 5JFGA 2QNIA 1YD7A 4GOLD 4H1WA 2WKPA 2V0CA 1FLAA 2YJZA 1J0BA 2PPVA 1ECFA 3GD5A 3K72B 1CDZA 4G25A 2OCDA 3K09A 1LFAA 2P4QA 3Q8XB 1FU4A 2VJDA 3QKSB 4IQ8A 4QRIA 5E9AA 3RAPR 4LE1A 3K9QO 4ZOCA 1BKSB 1BMTA 1PL6A 1BMQA 1MB3A 5D8DA 2O8DA 5ESDA 4ZOBA 4BDSA 2FWAA 3LQRA 3RFTA 4BWFB 2O54A 2GKOA 4PSKA 4ZJUA 2FX3A 2FEAA 5COBA 4CIXA 3H5NA 4PPNA 3AHDA 2OVFA 1AJEA 2ZI6A 5MF6A 1B1CA 5EP4A 4BVLA 1QOZA 4EHKA 4LJLA 1V9SA 3LT2A 2ZS7A 4GD3Q 1QDLB 3QPUA 3N0XA 2FXVA 2O3UA 2Y2VA 821PA 1AQ6A 1ZLYA 3LK7A 4H08A 2LWIA 3O8QB 4C5BA 3L1IA 5BW8A 5GZ1A 1T5DX 4PIPA 2ANBA 4Z7JA 1SRQA 3IP8A 3V2GA 4D7AA 1GNSA 2JEOA 3V6LA 3GRZA 2HAEA 3DAFA 4D0SA 1T2AA 3NBUA 2XMDA 4CLRB 3NHRA 2CLDX 1I32A 3CZAA 4CUJA 5KSOA 4EH1A 2XW6A 3NIFB 5TY0A 2X76A 4PR0A 4BE9A 2V6BA 4D9FA 1EGMB 1F4PA 4XUGB 1P1BA 2VJKA 3QYAA 1F14A 1RRVA 3HI6A 1G9SA 4L4RA 1YB4A 1SVNA 4TVBA 3ORQA 4Q82A 2YWDA 1YCHA 4XX0B 2H7CA 2X6QA 2HHAA 4MO9A 4UU8A 1DCFA 3TLZA 4C0BA 2R6HA 4LGVA 1ATZA 3T12A 2CXXA 2YFHA 3M81A 1QYDA 3B1XA 3HCNA 3LPCA 3NHFA 3KEQA 4V0ME 1FJ2A 2BELA 2RB5A 3MCAA 2A4MA 4CEIB 3DNFA 3QXXA 3C3EA 5AVOA 4ZTBA 3K1AB 2OWEA 3AXSA 3BFJA 3HPQA 4IDAA 4NXMB 2JFQA 4JI8B 3IPRA 3PICA 1YKSA 1E9FA 4Q24A 1LPOA 3IJ5A 5SY6A 1EFPB 3AUSA 5F2KA 3SQLA 3OVMA 5I7SA 4H6VA 1KJYA 1X39A 3EXEB 3Q4GA 3SYTA 1C7JA 2XRYA 2IHJA 2XB6A 3KOZA 4IXTA 1U1CA 2C4TA 3LA8A 3GJ8A 5L7YA 4ZGGA 4GMDA 1EAMA 1DBIA 2PJUA 2Z04A 4PFKA 1VDMA 4UMDA 1IU9A 5FTWA 5DI3A 4E08A 1OFUA 1M1YB 3G0OA 3MZ0A 4RV5A 3BXFA 3O82A 4OD0A 3D4PA 1U7XA 4OUDA 5B57C 4Z1MD 3NGLA 2TSYB 3EIUA 4G5HA 4R84A 4C5AA 2GK7A 4J91A 1HQYE 1OLXA 2ILTA 2QT1A 1H4SA 3PJFA 2PKQO 3OJLA 4C22A 1DUIA 4UUOA 3L40A 2IYSA 1N33B 4X1OA 1XKLA 4FCVA 5KJ1A 4HAVA 1R64A 2J3IA 2F9MA 3F98A 1CEEA 1F6WA 1MDFA 4KSBA 2E55A 3THSA 4JJIA 1I7DA 1F0YA 1IWPB 2D5LA 1ODJA 3UMJA 4Q3KA 5FJIA 3CVJA 3VPDA 3F71A 5FFFA 3BILA 1EFLA 5CPFA 4R8KA 1P7PA 4MK4A 3VTAA 2W2NA 4OJKA 1N2CE 1P5HA 2B35A 4N7MA 2V6GA 3MD0A 3MS4A 3P9KA 4GM4A 5BUCA 3ZX5A 1USKA 3PQ3A 1X1BA 2Y0DA 1Q91A 2FY8A 3MAJA 4RENA 4NHOA 5I9MA 5BYKA 3H5WA 3KPVA 5CXXA 1C2YA 1NBME 1L7OA 4RIFA 4JUFA 1PL0A 1J9GA 2COKA 3VOAA 2YOGA 1BH6A 1I9CA 3ZUGA 2EEZA 2QLMA 3ZDZB 4DJJA 2G9RA 2PUAA 4JUDX 2QVZX 2AXEA 4WZBA 4EHDA 1R9JA 2Q0QA 2H06A 3MXTA 1V47A 1QH1A 2Z1NA 4NU6A 4RJIA 3OFVA 3WWPA 3FFAA 3MBIA 4M36A 3WLAA 4UVIA 1P18A 3NNSA 4CIWA 1CIJA 1TJPB 1QQBA 2CHVA 3HDQA 3OQIA 1LEHA 4LF8B 4XPIA 4DBZA 5B7NA 1JEEA 3MD9A 2KSQA 2R5FA 4R2WA 1C9DB 3B53X 5FQOA 5IC5A 4DDWA 2H2FA 5G0TA 2BI8A 2P1DA 2VJQA 1JIQA 1IM2A 5CX4A 1RQ2A 3IULA 4OKSA 2IW3A 3UB2A 5TIIA 2QZPA 1YK0A 4PONA 3TD2A 2ICAA 1C80A 3FMOB 1M34E 1UPTA 1YS4A 4AKGA 4Z3KA 1T25A 2HMTA 3A1SA 4PLYA 3D8NA 1XJCA 2D7JA 4J0QA 3ZV5A 4Y9UA 5FFMA 3QE3A 3NLLA 4MV6A 3CBQA 1XNGA 3OICA 4QX6A 4EYEA 5I9LA 4BMDA 2I03A 1XTIA 4PRYA 3LUBA 1CCWA 2HADA 3NH6A 4FQ8A 4UQLA 3K8QA 1BE8A 4KE7A 1CQJB 3UCEA 1CETA 2Z9CA 3NTQA 2OHVA 2E5FA 3K6JA 1QZZA 1XZPA 1G7CA 1ZBDA 2AZTA 1AUVA 2P2NA 2I4MA 1TMYA 4NENB 5IBPA 5BN5A 1QGED 1EFAA 4RQUA 1LTQA 5L53A 3EWAA 4JI5B 1LVHA 1VL6A 3OT4A 4NF2A 1Q50A 2QAIA 2WR8A 5L3ZA 1CV2A 1E2IA 3FRIA 1JHRA 1D6NA 4GGPA 4N3BA 2W6ID 2RH5A 3H9EO 4UZSA 5KAMA 1PSZA 2GM3A 3SD7A 4GLBA 4CM6A 5T8KA 3FDXA 4DDMA 3TPCA 1ZEJA 3CG4A 4P2BA 3X1XA 1O57A 5JNTA 3GJSA 1H2FA 5DBOA 4H1TA 1YIOA 2AH5A 6Q21A 5JNUA 2Y05A 1O6ZA 5BNZA 4XFKA 1U4NA 2EKZA 4YCLA 3DV2A 2DF8A 4LJ5A 2JZNA 5FOSA 1V1MB 2PX3A 3D7MA 5JHGB 1XLUA 4C4YA 4C07A 4P38A 1ZN8A 4K05A 4EEXA 1R8XA 4EO4A 2B6NA 3G2KA 4JKIA 2DLDA 5TS2A 3R74A 1SB8A 1ZD4A 1JHDA 2R79A 4AJOA 1TQDA 1VPEA 2C95A 3NS7A 4KYTA 1E2UA 3U1VA 4U7WA 4R81A 3NCTA 5HJ2A 1VJTA 5DMXA 3ZWQA 5CA1F 3I61A 4LFBB 2QYTA 4JJGA 1LH0A 3M82A 3SBDA 7ADHA 5LDDC 2VCEA 1Q1BA 1N6NA 4ZJYA 3HQ4O 2GPBA 5EQDA 4P7KA 1LQUA 1KJ8A 2D4AA 2OO5C 4XGQA 5ALOA 2JI7A 3EVTA 3PPVA 4D41A 2PZEA 1EX6A 2NUPA 5JD3A 1UODA 5G0UA 2ZYDA 1GPWB 2WIDA 5D01A 1BJTA 1D1QA 3T7CA 2LTAA 3P97A 2HF7A 2A94A 1JUDA 1XD9A 1R6VA 1AS0A 3T4EA 1YJAA 3QX9A 3R3SA 1WA5A 3TIGA 2JL1A 1CT9A 1ELOA 4RQTA 2B5VA 5GONB 4ZQBA 1E2NA 1BGVA 1SB9A 5E3IA 1UPBA 1P1HA 4WW0A 3OJCA 5DP1A 3MGKA 4J49A 1E2LA 3DM9B 2VPQA 3B6KA 4G0ZA 3G9XA 4FCWA 4Y18A 5YASA 4UUAA 4CKBB 1A9YA 2FSPA 3AP2A 2IPXA 3BRWD 4FEGA 3V7YA 1FVHA 4NI5A 2BHTA 3RR2A 1UMBA 3DP9A 1OYWA 3WRWA 2L0XA 1M1NB 3BRWA 4ZOLB 4ZAVA 3J7AC 5ALEA 4BVEA 4EPWA 3MGBA 1TM5E 2C88A 3FB4A 4E5VA 1UC4B 2OHJA 1WF3A 3CW2A 4GX1A 4RJTA 4D26A 1THTA 3X1YA 5CDUA 3OEHD 1GCAA 3KDAA 4UM5A 3RV3A 2VJMB 4IH9A 3D6FA 2ZWPA 5HOEA 1JDUA 4JR2A 4P4GA 5IDQA 4C2TA 3OEHA 2OGZA 3BEDA 1D4ZA 2P67A 4ENTA 2BONA 4A10A 3HR8A 2Q5JA 2XODA 2I80A 3N39C 1B43A 4QXPA 3CZQA 5C8XA 1U8CB 3M5DA 2V96A 3QBVA 2WYIA 1J23A 4ESOA 1OHHA 1VG8A 2BR5A 5DNCA 5CEEA 4BN4A 1JBQA 4YRBA 2JJ8A 3WBFA 1A97A 1YOVB 2QRUA 3VFDA 3P9IA 2AW3A 1F1JA 2C07A 4H59A 2WYVA 3AY3A 3Q2KA 4MLCA 5L6MB 2VDRB 2FF5A 2YWGA 4HYQA 5IAKA 1Z73A 4OM7A 1X38A 2B2XA 5AIBA 3D1LA 1H1LA 1MRSA 2GXSA 4GR4A 4MS1A 2FKAA 3GJ4A 3X3HA 1GLVA 1KP9A 1IZ9A 4B33A 5FWAA 3D7RA 3ZWAA 4UNRA 1TGYA 2Z5GA 1DCKA 4EHBA 5H83A 2G6BA 1OXMA 1YT5A 1LQTA 3F3YA 2NP6A 1UQUA 3AZPA 2CVPA 3AI2A 1ECGA 3BDIA 3ECCA 3WBJA 3ZGLA 4S04A 4W5OA 2WTUA 3LYUA 1YCFA 4UZEA 4FR5A 3UMSA 3B7WA 1I3OA 2CSUA 1DADA 4A1OA 1Y33E 1J20A 2Y4NA 3AEUA 4LSGA 3V8NA 4BNMA 4U3JA 1YBVA 5EP3A 4ALKA 1XYGA 3F74A 2PS9A 3OLVA 3P9SA 1VLLA 4YWJA 1YNSA 1JTFA 1WXFA 2HQBA 3HO6A 1UM8A 4NU8X 3DUWA 4IHJF 1LZLA 1J39A 3VYTB 2PK3A 2WVGA 5KSZA 4DSUA 4RHUA 5A3SA 4JROA 4V3BA 4I99A 1TAUA 1QE3A 1HT3A 2RHWA 3PUHA 1UR5A 3AVQA 4EFLA 4C29A 4EAQA 2UAGA 3DEYX 3WYDA 3QU7A 3T5DA 2JFBA 4DNPA 4YRMA 3D6UA 4ND4A 1GTVA 5E7QA 4EUEA 4HDSB 2YCBA 3MWYW 1IBMB 2LPMA 2VUSA 4ZYLA 5F9MA 3Q7IA 3H3XA 4NICA 3DMDA 3TXAA 1T35A 1IWOA 2GPNA 2JIBA 3NM5A 4IIBA 4OQMA 4FM9A 3DCIA 2H54A 5CU7A 3FCUB 3E0XA 2O9JA 3QXHA 4P54A 2BDTA 4BZXA 1JSZA 5D5QA 1M6VA 3U3MA 4EJ0A 3ZQUA 1FRNA 4W1PA 4GE0A 1UBTS 4L1KA 1GA4A 4R31A 1V9LA 1YS2X 2H07A 2V9CA