4I4IA

Crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
319
structure length
319
Chain Sequence
b'MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDIIHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDAATSHERTYVIEVMGRHAGDIALWSGLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGFETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEALANKHTIDQRMYALSKELSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphofructokinase
publication title Redefining the Role of the Quaternary Shift in Bacillus stearothermophilus Phosphofructokinase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase
total genus 117
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.11: 6-phosphofructokinase.
pdb deposition date 2012-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i4iA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i4iA02
4MCJA 4P5EA 4A3SA 4P5DA 4OHBA 2A0KA 3QUAA 4FYHA 3EHDA 1MTOA 3BQ9A 3MAJA 4JENA 4U1RA 1S2DA 4KXNA 1WEKA 1ZXXA 1KZHA 4KXLA 2KHZA 4OHRA 2Q4DA 1S2LA 2F2TA 3O8LA 2F64A 2IZ5A 2F67A 3O8OA 3OPYA 4WL0A 2NX2A 5ITSA 1YDHA 2F48A 4I36A 4RH3A 2F62A 3GH1A 6PFKA 3UQZA 2HIGA 3K2QA 5AJTA 4HX9A 3HNOA 2PMBA 2Q4OA 4PFKA 4FYIA 4MEJA 1RCUA 2A33A 4JELA 4LJRA 3IMKA 3U39A 4KXMA 4NPAA 3O8NA 3SBXA 2IZ7A 4FYKA 1T35A 1S2IA 4I4IA 1WEHA 4LJKA 1S2GA 3F5MA 2PFKA 2KLHA 5AJUA 3PFKA 2IZ6A 3O8OB 1F8YA 1PFKA 3OPYB 1S3FA 1F8XA 4JEMA 4I7EA 4LJLA
chains in the Genus database with same CATH superfamily
5A5EA 2IYPA 2W8BB 3ZDEA 4ALIA 2PD3A 3O9MA 4LZWA 4HAYA 5M2QA 4O4IB 3ZXSA 2QRVA 4L4XA 4Y2YA 1E98A 2CWDA 4F4CA 3I4CA 3CNHA 4HRYA 4KPYA 1GSHA 2BFCB 5FA5A 4PW0A 1KNXA 1Z17A 2XKAA 3BFXA 4HG2A 2H2HA 4WFIA 5C8VA 3CVYA 1T3LA 2VT7A 4D9IA 4N41A 2WVGA 4I8DA 4IG4A 4B7UA 3AR6A 3CPHA 1PWHA 4HH1A 4I81A 4LMBA 5J9FA 5C53B 2CL0X 4KQKA 1MEOA 3ZWDA 1YS9A 2R8OA 2LCFA 4JB8A 1XC7A 2BSXA 4HPJB 2OGUA 2XIQA 4BFTA 3AYZB 4QXOA 3V8EA 2E87A 3I5MA 1RS0A 1TUEA 2BBOA 1ZK3A 2PGDA 4P4SA 3KFVA 3IO3A 4CR6A 1JTEA 2E4UA 2FEPA 2OYSA 3HH8A 2IV7A 4GLBA 4CJXA 3QTTA 4ITVA 1JAHA 4QOSA 1AHIA 1E1KA 5HCNA 2Y05A 3RF6A 4CEJB 2SKDA 2IZ5A 1CP3A 3PWZA 1WMAA 1XZHA 1YCDA 2GD0A 4JA2A 4JL5A 1DQYA 3UO8B 2AUNA 4V0NA 4P58A 3H6KA 4DDWA 3QFSA 3U16A 1U3DA 1QK5A 1WY5A 4RABA 2H4WA 4D3DA 2EL9A 2GZSA 1OFVA 4EZIA 4E5VA 2WT4A 2XTZA 1HETA 2WWRA 3IH5A 4Q7LA 1A9SA 3MHTA 4M49A 3GD5A 3URMA 3ZGOA 2F62A 1YZQA 1FBTA 4W7IA 4DANA 1YTLA 3GR6A 3TTVA 4X92A 1GGVA 2VPZA 3KV3O 1TCCA 5CEFA 3TX6A 1Y3DE 1C29B 3OWHA 2FMIA 1GTSA 1GEGA 3DT9A 4NH0A 5F7JA 4QX6A 1KMHA 1XE3A 3TUJC 2OV6A 1JJIA 1WWKA 3FTPA 1P8AA 3RVLA 1BFUA 4ZI7B 2DXIA 1W59A 4ARZB 2P6NA 2GHQA 4MR8B 1E5QA 2XYRA 3L6UA 3HI6A 3CNNA 4RMJA 1K6XA 3UFXB 4MW9A 3RW9A 2XUHA 2AVNA 1TNDA 4ZJPA 2YW9A 1VLHA 3GDHA 3KBOA 3CA8A 1RMQA 1RADA 2A9JA 4C6HA 4DCTA 4CQMA 1LW7A 2FEXA 3NWEA 7REQA 1ND6A 4LOLA 2IYWA 4LXIA 5I8WA 1VYUA 1IHXA 2KW5A 4KCGA 5GTDA 1RPNA 4PVCA 2Z08A 3BICA 3U6BA 2AT1A 3SC6A 2IBSA 4CLDA 1AO3A 2XYPA 1OBCA 1AKTA 2YXEA 3QLUA 5T5QA 4NCKA 4ACAA 5M04A 4XFDA 2VSXA 3HBNA 3EFBA 2IXBA 2ZDHA 4KI7A 3WGKA 3BWXA 1HYHA 4G85A 3OJWA 1V9CA 2O2EA 4FS8A 3KSAC 2VSFA 1E60A 4YALA 3QVOA 4F11A 2OHGA 4DHWA 1LPPA 4NSNA 1ORDA 1SA0A 3UCEA 1L1QA 3NW9A 4G1VA 1A7AA 3BZBA 4IBOA 4RESA 3ZBTA 3ZCRA 4Z1MD 4YJ3F 5ECWA 4FI3C 2E21A 4KOAA 1DQPA 1KMNA 2XT0A 2G8NA 1TRHA 4NMMA 1OXMA 4QT0A 5FJJA 1NW5A 3RANA 2ZUTA 4ZP1A 4CZ2A 2BEUB 3EUFA 1R4NB 4BX8A 4J94A 1F20A 3GJ5A 1TF7A 3LVFO 3ZOKA 3PGA1 3QHAA 5HFJA 2TMYA 1LDYA 3FCYA 3KQVA 3AOEA 1CT9A 4J3JA 5DNWA 3RU7A 4CR8A 4E09A 4G9EA 4RPJA 5BSEA 4OHXA 2VOEA 5EFZA 5BUSA 3OHPA 4EWLA 1N2CE 1TD9A 3CZQA 3EOZA 2XVYA 4Q1AA 5IYZF 2JZOA 4J16C 2ISCA 5KVAA 2PE5A 3U61B 3VJKA 2HB6A 2I8LA 5K8CA 4L16A 4H1VA 3OBIA 2VJBA 4GBJA 3H2GA 2WTEA 4XQGA 1TK2A 2JK1A 1RZ3A 3KELA 1ZUWA 2A0UA 2R84A 4QNNA 1QFXA 2BFMA 2ZQZA 3WRXA 4AG3A 1EE2A 3PXCX 3QQ5A 3D54D 4K40A 4HO1X 1ELOA 2B61A 5T4EA 3WK9A 5HJ5A 2R4TA 4PANA 2VP5A 5TGZA 1QP8A 1BFKA 1W76A 3M2TA 4KJZA 1NNSA 3SQMA 3CF4G 3EBPA 1W6UA 3KHKA 4PC6A 3TLYA 2BGMA 1X1RA 4CG1A 2I2WA 5MHTA 3TQQA 4F4UA 1ACJA 3EGOA 2ZR8A 3V55A 1ABBA 5JAUA 3CUKA 2C82A 1OC4A 4HNQA 5H5JA 3EZYA 2FFQA 3KZ1E 4KYVA 2Z5LA 3CNBA 2ODAA 4KI0A 3WAKA 3FOFC 2O54A 3GQBA 2FJUA 3ITNA 4LYGA 1U7OA 4MJXA 4MWBA 3O1IC 4G5OA 1T6XA 1KMIY 4MS4B 4S35A 2J85A 3UHPA 3V34A 4CCWA 3CVVA 4EYOA 4NAVA 4E07A 5J43A 3BE8A 4ZGWA 1KGDA 3Q40A 1PJSA 2YWFA 3E9EA 4GL4A 2X5NA 1Q19A 2EKPA 3RO7A 2C59A 1Y4SA 1NVVR 1HLDA 1RAGA 4EG1A 4GZLA 2X4GA 3IIJA 4GYWA 4XYMA 3T5DA 2YY6A 4MRNA 4ALJA 4FWTA 1P1FA 3PUVA 4FIDA 1MDFA 2MT9A 4NZNA 1BD4A 1EVYA 1Q7CA 1USGA 2XMZA 8LDHA 2BEWB 1QRDA 2W6PA 1C0IA 4Y7DA 5CH5A 3M1YA 1BEZA 1XVLA 2HNAA 4IZ6A 3WZ2A 2J45A 2Z98A 2O59A 4BLOA 4QVIA 4JIGA 3HDVA 4Q16A 4BLSA 1DG3A 4Q9KA 2C0PA 4OEHA 3TLGA 1LK7A 3JV7A 3ZIAA 4E32A 5L53A 3EXAA 4RZ2A 3CEHA 2IHUA 3Q9UA 4KMRA 1JI3A 3DBVO 4FYKA 3ZHOA 4DC1A 3T15A 5B7PA 4D9CA 5JANA 4YMTA 3TVYA 4BO6A 2ALJA 3MTGA 2PXAA 4DSOA 1QB8A 4QASA 4PVDA 5EAIA 1G20A 1C1XA 1N5MA 2HSJA 1W5SA 3LDGA 1A50B 5AM1A 2Z4RA 1D4OA 1V39A 3AR2A 2R7LA 4RK1A 3R5HA 2ATVA 3PLNA 2QA5A 5F1PA 2XGGA 4I1SA 5K8LA 4QGGA 1E63A 4N3NA 2NU9B 4E1BA 4JT2A 5ER9A 3I83A 2L17A 1KEPA 4KR9A 4PSKA 3STVA 2QVBA 3G2LA 3A1DA 5JADA 2PKXA 1N8TA 2HADA 3ELWA 3OQ6A 4O2LA 4OQZA 3ZJYA 5LNK1 3Q1LA 2R87A 9MHTA 1U8YA 2BUCA 1R16A 3B2EA 4Y2JA 2IF0A 2AXEA 1AUQA 4CMIA 1LA2A 4KNWA 3V2IA 2FHSA 3FPSA 1JDBC 3RHZA 4Z4HA 4XGNA 1WCV1 3BE6A 1OZ0A 3DO6A 1X1SA 3OF2A 2ZRHA 3LT0A 2XKJE 4KBYA 4YBZA 3D0KA 5CX1A 5DOVA 4C6SA 4TL9A 4X6UA 1QGOA 5AK3A 3RIHA 4D74A 1G17A 4I1RA 1V8ZA 2QE6A 3NAGA 4HWOA 1X8JA 3TZLA 3UJDA 2PS3A 1SVNA 4CL2A 1PJZA 2BGGA 2IEGA 1ZGZA 1PK7A 1VIMA 3A1NA 3DL7A 3AL0C 1KO5A 3RBXA 1KEZA 1RDFA 2X3YA 4DUGD 2AW3A 2J33A 4WLNA 1ZA2A 1DG9A 2BI8A 2RH9B 4LJ8A 4Q15A 1UT8A 3COWA 3BTSA 3H83A 3PGMA 3QYPA 3RUEA 2WP8J 4MVJA 2XF2A 4IMRA 4P80A 1YR9A 2K87A 1HA3A 5FTWA 2NO7A 2FSHA 3K9HA 3P4XA 4LVNA 3UAOA 2G9ZA 2VZ0A 2A4KA 2NUTB 3ADBA 5DBIA 1EZZA 5JFOA 2BH9A 3TFOA 2DSNA 3TD9A 4GEKA 3H1GA 4ZKDA 4MVJH 1M6VA 3X1MA 4CL8A 2VH1A 1ONPA 3R74A 3F8TA 4RMHA 4Q9AA 3RG8A 4H7DA 3B48A 5F9HA 4BGIA 4Q1EA 2VOJA 3D2CA 2ADMA 1E5DA 1GKKA 4Q6BA 4P6VF 1SU4A 2AA3A 2JFFA 4DQVA 1IXSB 1GRCA 2K5UA 4PBSA 6PFKA 5IKPA 3MHPA 3NX4A 3CZMA 2PMFA 1ZICA 1TT7A 4NDNE 4RLSA 2CJWB 4RWZA 3UC9A 2FUEA 2XWQA 3WB9A 2C0QA 2Y4NA 4UCWA 3KZXA 4IHKA 4OD0A 5DSZA 2X1LA 3JCZA 3F3KA 3FCUB 1FJ2A 2BGIA 3JQRA 5JPCA 3ZWKA 4FK8A 3LZDA 2Q3JA 1MDBA 1T9KA 4FN5A 1NYTA 3RF7A 1XK7A 4AJOA 5CAEB 2EAUA 4J9VA 3LQ2A 1H4QA 1T9DA 1QANA 2M98A 2WE7A 5HCUA 3WQRA 4QPCA 2BEVB 3WL3A 3K5WA 1BQ3A 5E38A 1Q0UA 1QE0A 4K0KB 1U3CA 1V3QE 4FQ8A 2DHRA 2FGJA 3H2SA 2W11A 1JB9A 3L43A 2I7DA 1G6KA 4G97A 4CMEC 1JFLA 3KR2A 1J21A 3BFVA 2Q6TA 3BJZA 3SLKA 4N0QA 3U3JA 1I10A 4YT8A 1KWKA 5JXGA 3KDPA 5JHHB 5I3CA 7MDHA 3SIWA 1SBIA 2IUSA 1S1CA 1ZAKA 3HE3A 3OZUA 2I6XA 2EBHX 1R6DA 3HR4A 4X7MA 4GMFA 1Z6YA 3DKKA 1GGFA 4MAMA 1RC1A 2VT6A 3BXXA 4Q1BA 4U6NA 1P5FA 4RMIA 4BVGA 4AQYB 2JLAA 1YRLA 5K99A 1F2UB 2V0NA 4JU9A 1JG7A 3UKOA 1BXZA 2IK8A 1U7HA 1PQWA 1OXSC 1DWUA 4DRXA 3AZOA 3BIJA 4CF5A 2OOSA 3IP7A 3O83A 3UPDA 1X0VA 2BF7A 3KKZA 2RD2A 3HZRA 3U81A 3LCUA 4ZT4A 4UHKA 5LIRA 1H4SA 3AINA 1X8LA 3RTCA 4AZ0B 4LJLA 4BIIA 4BQNA 4HUQA 4IINA 4RL4A 5I8PA 3BFKA 3A6HA 5I7FA 2ZBUA 4TT3D 2YN4A 2QV0A 3DW3X 3X43A 1A88A 1GVNB 2AYYA 4G4SO 5THXA 5IZ4A 2ORED 3OP1A 1W0CA 4LXUA 3PE6A 1EZ1A 1Q92A 1GA4A 1KDRA 2G5TA 2OLKA 3TN7A 1LPSA 3NHSA 3A31A 2PZGA 3D1LA 3R7WA 3JXEA 3K1ZA 4ESHA 4ER7A 3I9JA 2P2LA 1C9YA 2RC5A 4IDNA 2JFBA 5D86A 3AOGA 1E20A 3EAFA 1BA3A 1AGXA 5FPYA 2B3DA 3W1WA 3II6X 3PDUA 4R1OA 1XA3A 2YV2A 1N3IA 2O3TA 4GECA 2QU8A 1E1QA 3H11A 1PR2A 1FEZA 2HC9A 2MHCA 4JVLA 4TS3A 1J22A 2I3DA 3AVXA 1VMDA 1C9NA 1PSZA 1BO6A 1MOZA 1N25A 1XMJA 1XX6A 2J32A 2YHSA 4GU5A 1EJ0A 4IJWA 4RHCA 2ZXUA 1RYZA 4BOYA 3D3QA 3ZDRA 4K9QA 3VQTA 1EXMA 1XRQA 3KJGA 3WHLA 5EKUA 5FAKA 1D8TA 1QAOA 3A05A 5IBCA 1A4IA 2HUNA 3IQHX 1DAFA 2CYCA 3DPUA 1KQOA 5IHXA 3OPYA 1NI5A 1RYMA 4CUZA 4JITA 1H0KA 2IX9A 1GTZA 1JR3D 3DE4X 5DISB 3SQNA 1A9ZA 3WLRA 3RS7A 4BMVA 2O3UA 3JWGA 1RAHA 4PQYA 2FLWA 5ITSA 2HRZA 3HL4A 5IAJA 4EJSA 3DPIA 2JLSA 4Z7JA 1L1RA 2VQSA 2D5CA 3H86A 4Q18A 5JMTA 3HXTA 1NVAA 3PYXA 4GKAA 3NIWA 1ZW1A 4HJRA 4YP0A 3UWMA 2G4LA 2JI4A 3GFBA 1L5VA 2MSNA 2B7BA 3CVOA 1JBKA 2XEXA 5LDGA 4BASA 4IXDA 4R2IA 4ZWNA 4CI9A 4D26A 1XKQA 4ZTZB 3BGOS 4KAFA 5IVDA 3GUYA 4N5DA 1D1SA 2WTAA 2VYCA 3AX6A 2YV1A 5KSYA 4BB9A 2MINA 4UPDA 1U94A 2I0FA 1RQGA 1CLEA 2VRWA 4BFXA 5AVVA 2XRZA 3AEQB 2I62A 1LBIA 1NQTA 3CG0A 1V7CA 3L1UA 3LPLA 3O9VA 1GUFA 4YMUA 1FPMA 4TWAA 3HKCB 4JR2A 4AMBA 2EV9A 3L8EA 3LPDA 9LDTA 4YY3B 4GMXA 3KQUA 2F9LA 3CC8A 1O94C 3O8NA 1PQPA 4BNFA 4QFBA 2VDOB 3EGDB 1U1IA 5HJ2A 2WUGA 3UV6A 4EYGA 4K6GA 1IONA 3OAAD 2GARA 3G2MA 3B1YA 3U80A 3AXTA 4GZMA 1RI3A 2QTCA 3HO6A 3VPAA 3C3AA 3V1MA 3ZCVA 4Q9NA 2YXPX 3K70D 1XMIA 4HLUC 5A3RA 4RCVA 1NGSA 1RJ9A 4IV5A 3A2NA 4G5HA 5KQMA 1FVFA 2VHQA 4QLAA 2C31A 4HJXA 5B64A 1F5NA 2WHPA 3HVIA 4PCAA 4TSFD 5AUQA 4MSUA 5K3FA 4ZYWA 4CKWA 5JZVA 1DHTA 1C1DB 3N2YA 4H2DA 1E3IA 1ZC4A 4QDOA 1PO7A 3NKVA 4R41A 3V4PB 1O7JA 1G2QA 3QVMA 4MRMB 3HY3A 3H97A 2FSFA 3JVDA 4JBYA 4OQYA 4C4PA 4P3PA 5JIBA 5JH7A 2OUKA 3HR8A 5HILA 1IB6A 1WOMA 4QICA 4ZCTA 3NT2A 3JD0A 2G40A 2VHWA 2YC2C 1A97A 1V37A 1ZL2A 4UE6A 1XVTA 4FNOA 1JA9A 1W0KA 1GADO 1WMSA 1Z2NX 3X1XA 2C5GA 1KSFX 1UINA 4JLUA 1YV9A 4J3FA 5ALGA 5E3JA 1S2OA 2GWHA 3K09C 1XHFA 2Z04A 2XCQA 3T12A 2XDQA 1V5EA 5ADWA 4PZDA 2HU7A 2WUFA 4FMDF 1TXGA 1LSOA 1I6WA 2XWPA 1Z47A 2HIMA 2ZBFA 2VHXA 3KSUA 4HWKA 1R4AA 2BD0A 2CD7A 3IIIA 4LJ6A 4FHCA 2P1DA 1GKIA 3T3MB 4LZPA 2QZ9A 3DEHA 1VCNA 1ZCJA 2NIPA 2OTCA 3WV4A 1LKZA 2FN7A 1K4YA 4A9AA 4RTRA 1BQ4A 2Q1YA 4QQNA 1T3TA 2FWAA 2H5IA 4C4SA 5LOVB 1IBLB 1WMBA 2H0QA 4QQRA 3MJRA 4L5BA 2WJHA 3OE7A 3UV3A 2EARA 2QTHA 1WXIA 1UJBA 2GZMA 2VVTA 3NT4A 4HWSA 3L0IB 1Z6QA 3AI3A 3HJCA 1E7MA 3D0RA 4XVHA 4WZBB 8ATCA 3WK5A 2ZJ0A 4ZVNA 5AHOA 2JRCA 2D2FA 4C6TB 2PZJA 4H6WA 4DPKA 2GRJA 1A0OA 1VB5A 3DC7A 1KA9H 3MJTA 1U0SY 3JPYA 4GPD1 3CZCA 3EIEA 4PPNA 4EY7A 3H0KA 1I94B 1EESA 1T2AA 3NBYC 2WHYA 5FOUA 1N6HA 4D1YA 2BONA 1JJFA 5IXJA 5TJ9A 3F78A 1WD7A 2ACWA 4OHKA 1H42A 3CR8A 2KMLA 3BC1A 1N1DA 3EY4A 2IY7A 1E66A 5ALRA 3GK3A 4PFSA 2O5RA 1TAUA 1IN6A 2RKBA 3W5HA 3GNSA 3ZG6A 4RE6A 4Z4CA 2FPOA 1N78A 1GNVA 5KTTA 1FZQA 3BHJA 4I14A 4IKOA 2VJAA 2JFHA 4NC9A 2Z3WA 3HLYA 1B73A 4Q3KA 4TYQA 1KSGA 4OSEA 3KQQA 2VF4X 2I7CA 3L01A 5E8JA 5H1YA 2VAVA 5T67A 4QDTA 1ZITA 3HP7A 5FBRB 4UTVA 3VZBA 5DNYB 5E7MA 4XWGA 2IXTA 1W6RA 4ERNA 1IVNA 4EZBA 4IJUA 1WB6A 3OQOA 4Q6WA 1U8EA 3I30X 3IBGA 3H2KA 4MPJA 2FQWA 3K15A 2QTRA 1HTWA 4PSVA 3PCXA 5T41A 5BQFA 3WYBA 1OIXA 1E6UA 1CQJA 2WRZA 1FFGA 1T9HA 3LH5A 4NMLA 3ZV5A 3ZZUA 2J9XB 1YB2A 4ZHQA 4RY2A 1J9EA 1HE8B 3E22B 5K4GA 3AIOA 3STUA 4ND4A 1JT2A 3AV3A 5JAHA 5H80A 3VR6A 4CGYA 4I1YA 3QVWA 2FUCA 2B4QA 4A8JB 1PNQA 1PHPA 3DE3X 4PSUA 4U6SA 3CBQA 3FF4A 5ALKA 4V03A 1OU0A 1UC8A 5I9TA 1C4XA 1B93A 2HU8A 2JI9A 2L0XA 2WC1A 4IYJA 3UC5A 3OEED 4PQFA 2PSEA 2HLNA 4C29A 4U2DA 1R9MA 4INPA 2QVLA 3A3YA 4ZGGA 2WV9A 3RHTA 2BR3A 3TQSA 2B6NA 1LDEA 2IUYA 3R76A 1K8YB 2ZM5A 3QKIA 3CH4B 3E05A 4AKGA 3RVQA 1SPXA 5LP1A 4FBGA 3EFOB 4NJEB 4WY2A 3PZBA 5DGXA 1FLAA 1QYWA 2VK4A 2QNBA 4RH0A 2CW5A 3ANXA 1DP4A 2QXTA 2ZE5A 4O4LA 4UHCA 1KTIA 3C6XA 2WWFA 2E5FA 1MQSA 3BMQA 4CKCB 3HG7A 2ZI7A 4O2AF 1ZXXA 4TQUS 3W8FA 1UMCA 2N47A 4QDZA 5CDFA 5KC8A 1CDOA 5EMKA 2B99A 1EFHA 4AKSA 4EOGA 1JEDA 3IKLA 4JLWA 1S5PA 4GUDA 5J5VA 5HA5A 1PL8A 1U11A 1YTUA 2Q28A 4TXLA 1YI0A 3NHJA 2QR3A 3GARA 5BWBA 3C3YA 3QUBA 3IR5A 1NNEA 4UEOA 4NMXB 5AVZA 4LGYA 2ZRFA 3DCJA 3HCEA 4BS9A 5EUCA 4YLEA 3EVEA 1ESMA 1FVHA 3MB5A 1RVDA 1D4AA 1U6KA 2QAGA 3FH0A 1J06A 4UTOA 1LBEA 3E0XA 5ALWA 4ZYUA 1HLGA 2RH4A 4OQPA 1PT5A 1M7HA 2HSDA 1WA5A 2QTMA 3V1LA 3ICQB 3VTFA 1YDHA 1Z7BA 3ADDA 4PRKA 3NTQA 3SF8B 3FOZA 4YDRA 4J07A 3RK4A 2Z2IA 3VKUA 1NDQA 3OIVA 3MN1A 2O7RA 3W6OA 4RKRA 1PZHA 2ZULA 3DAFA 4N82A 3UT5B 2O20A 1VE6A 2HFJA 2AL7A 2YWEA 1PJ4A 4BJ1A 1T6NA 2JLXA 1CVRA 2DQYA 4HVCA 3GVHA 1GZHB 1HT0A 4J1SA 3W9YA 3L6CA 4B6GA 2BMEA 4I55A 2HQBA 3W6NA 2NTJA 2I3GA 3ANTA 4V3CA 2X14A 1YBAA 3BF8A 4G5YA 4PYKA 3ZK9A 2C7RA 3FHLA 1O8CA 3RVOA 4C03A 1QYXA 4M60A 4QOGA 3DMNA 4LCEA 3LL7A 1N6OA 1XRNA 3OUZA 3GJRA 4KVFA 2PGIA 1SHJA 2X0EA 4DKJA 3R3ZA 3QXHA 4QXAA 5K2OA 5EZ6B 1WNFA 5D3KA 1YS1X 1L3BA 1GQQA 3ESYA 4WLEA 1RLMA 3S2FA 3SSNA 1FXWF 3HU5A 4MR7A 1A5TA 1KH2A 4PXYA 1Z4QA 2GAJA 2ID9A 2GRUA 2JCYA 5KYWA 1YHNA 3MT7A 5BYJA 1MBZA 2BZ1A 1DLIA 2AXPA 2REXB 2IWRA 4EA9A 1W4LA 2EZ4A 2QSUA 3G2HA 4OF4A 1N4AA 3RH0A 2E2WA 3PFFA 1RRGA 1IN7A 1HOXA 3A04A 4IZOA 4M21A 5K3AA 5LKAA 2NTVA 2XCRB 1KO8A 1RP1A 2TMKA 3CURA 4PEVA 2ZSEA 5FO0A 4P7KA 2A1TS 2JGDB 2PKCA 2PLNA 1GITA 3T6KA 5EL0A 4BVHA 1Q3KA 4M1QA 5LXTB 3I1YA 2OVBA 1KYYA 2ZRDA 5TSDA 1EP3B 1LY1A 3T9DA 5IT0A 4FFLA 1XB2A 3D7LA 5HJEA 2ZWAA 4BFSA 3EZLA 2VEDA 4URXR 2GN4A 1EFAA 2NO6A 3ZC3A 4OB7A 1BMQA 3AJRA 2B4AA 1XMSA 2JZNA 1YOVB 5K3CA 5BRNA 4AY5A 3EH1A 3WDKA 1L9XA 3AP3A 3GGJA 4OHPA 3TW4A 1ZD5A 1XYGA 4UVGA 4J3NA 4QUDA 5JS6A 3BOSA 2X5JO 5F7ZA 4DXDA 1FNCA 3W2EA 3RFTA 3QMWA 4JLJA 4C0LA 4KR2A 3DOUA 4BBPA 1Z2PX 1ZD3A 2RJNA 3TB4A 4O1MA 1QQBA 1AQJA 4Z3KA 3P8ZA 4EHJA 3TGPA 4CEIA 3HGTA 4TMYA 1MO2A 3TLAA 1XPRA 1JKJA 2D7DA 2QG6A 4MROA 1OA0A 5C35A 1UKYA 2PUFA 2IU4A 2G06A 2VHUA 1PGOA 1O96B 2GZ1A 1Z7GA 3MOIA 1POXA 2ORVA 5AI6A 5F51A 1OZAA 1UADA 4UM9D 2JIPA 5C2JB 4TMZA 4YXWD 2R751 3EY9A 3MGGA 1N2XA 1TEVA 3A6LA 5EVJA 4EAAA 2P78A 4YQYA 1NXQA 1WXWA 2W2LA 2D13A 3IA7A 4LE1A 4AQDA 2J3JA 2JEYA 4WASA 4Q9HA 1GKUB 5SZIA 4DJTA 1UXIA 4K9NA 2KYRA 3ZTTA 3OLQA 2W2QA 4JX8A 2Z1DA 1E59A 4GI5A 4YROA 4QKQA 5IVHA 1YUNA 2OP0A 3EAGA 4L7VA 4S2UA 5KX5F 2RGRA 3E8SA 3EVCA 1SC6A 4KEAA 3UEOA 4GQAA 4HS4A 4GZ3A 2Q5CA 3SX0A 1RWOA 4DV4B 3JRWA 2O19A 1O4WA 2CT8A 2OWDA 1E2PA 3W5JA 5DBFA 4YJ2A 3PFIA 4HDRB 2DERA 4LX0A 2W83A 3M5CA 3SZ3A 5AVXA 1DLJA 2OT3B 4Q48A 1GT6A 4B43A 1BJTA 1ZVKA 1M1YA 3U3RA 1KBZA 2FR8C 2I6TA 3PD0A 4WNCA 1JJAA 4MV1A 3VTAA 3JAWB 2PFSA 2PMBA 3I2GA 1JU9A 4PGGA 5CVTA 5B2ZA 2ZAOA 3KZCA 1DWPA 2JHCA 1X7GA 3GY0A 4TV8B 1RR6A 2B0CA 4N7RA 3ANYB 4OJYA 1Z29A 2CSXA 3LA8A 3GN2A 3BKWA 4M6WA 3VTZA 2ZTSA 1RSZA 4TSKA 5KTOA 4MRRA 1JH9A 3IAS1 1J0AA 1DJQA 1R5BA 1JNXX 1JIKA 2HKIA 1OFTA 4CMHA 4DLYA 4N49A 5KYKA 2Q27A 2ZBRA 4EGAA 2NACA 2WD9A 1Z13A 3ICVA 4I3HA 2FPIA 1LCIA 5DIZA 3UMVA 1YDMA 4LRSB 3C70A 3K0FA 1C7QA 5EMHA 5CB4A 5CB8A 2AC2A 3QWAA 3ENQA 3PE4A 5JNUA 1F17A 4R98A 1NVXQ 4YI3A 3CCFA 3DBHA 4FGSA 1J07A 2JGAA 5K0GA 3HCPA 1J9ZA 3RAGA 4MIYA 5TMBA 4RU1A 4UTRA 3FVTA 2FX3A 3MILA 1PFKA 3BB1A 1RYBA 4KFRA 5FLXA 4ESEA 4LNUA 4Y0VA 4XR4A 4BLPA 1E9RA 1OBOA 4UC0A 4PPGA 2ZBPA 4OMUA 1JYEA 2HMVA 1LZLA 4KAXA 1NJ6A 3HVKA 2XAUA 2FZWA 5CFOA 3DOOA 2JLQA 4HNTA 3NC4A 1SKBA 2I7TA 4YFYA 1J70A 2PG3A 4XGIA 3T3GA 1PT6A 1NBEA 5EP1A 3KJEA 1E1NA 4JV5B 3FWNA 3W7VA 2OBLA 2ECPA 1JHVA 1KC1A 3MAJA 5DW0A 3K8OE 4U1RA 3P45A 2IHKA 3AIKA 3EJWA 1WXQA 3MT9A 2G82A 4IDPA 4JC8A 4U5XA 1IWBB 2P1ZA 4LDQA 4XWYA 4XTRA 1Z4OA 4ZCSA 4AJEA 1PNOA 2C4KA 2Q5IA 3A32A 3GB9A 4FSXA 2DG2A 3V00A 4UNIA 3D59A 3HVRA 1G18A 4ZOQI 6GPBA 4QJ4A 3COJA 3HPRA 1VLLA 4JZYA 3REGA 3VNRA 4ENTA 4W6ZA 5HE8A 4DXAA 3F7NA 4K1XA 5FBLB 4XDZA 4Q7QA 5CYFA 4HATA 5K9ZA 2HWUA 2QTZA 4AN4A 2KQUA 4F06A 1FMLA 3NKFA 4UOQA 2QW0X 2ODWA 3ECSA 4ZQHA 3UG6A 3UVEA 1NM5A 3TRJA 5DHUA 5AXBA 1DMRA 4BIMA 3E7XA 3LUHA 1SCNE 3LM8A 3O7MA 4TZTA 1IXYA 2RHOA 2CJYA 3NETA 4K6KA 4NCBA 4YRIA 2PGAA 2WU4A 3ZH2A 1A9XA 1M2NA 2Y0PA 4DR5B 1Q91A 1WO8A 4KB5A 5B7NA 1Y1SA 1H2WA 1CUHA 1EK5A 3T1NA 4A5SA 3QZUA 1YZHA 4MJ3A 4NS4A 5DB4A 5AW0A 4BFVA 3BVPA 4LY6A 1XKLA 4LSZA 1WIWA 1NE7A 3ZDBA 4D4KA 1V6CA 2Z6QA 3MAGA 4Z9FA 3FROA 4QZVA 2FOIA 3PD7A 1UKEA 1PNVA 3LRTA 2RAPA 2W2MA 3VC1A 4M7RA 2B5VA 3JY6A 4CE6A 4D9KA 3TGLA 2WYUA 1UDXA 1Z45A 4F91B 4X62B 3QMPA 4BNUA 4LGCA 5E6UA 2G5CA 2VF7A 4RK6A 3PIRA 5B7GA 5C52B 1M5TA 3K8QA 1Z8FA 1XJ0A 1BN7A 4N5NA 1MW9X 3IQEA 5G4KB 5B2EA 5KYYA 4ID3A 4HLNA 5KVCA 4LF9B 1MVLA 4Z2AA 2ID8A 4KMMA 4B6JA 4UFOA 1T3HA 5JY6A 3QXJA 1N7IA 4KAJA 1OVMA 3I01M 4PYLA 2Z3VA 3RS3A 3M6LA 4HLCA 4TXJA 3EEIA 3NV9A 4N6GA 5AKKA 5J2UF 2VQDA 2R5NA 3N8HA 4J7UA 3CVXA 4W9MC 3BJMA 4TLCA 2X0KA 2VTKA 2IDJA 3ER9A 3DLTA 3PXEA 4MVYA 4AL4A 1E77A 4JL8A 4PF1A 1U0RA 3DXZA 3PQDA 4K2AA 4R1MA 4Y6SA 4ZVTA 5LQKA 2X3UA 1MHTA 2VXYA 2CFSA 3WB2A 1JG3A 1USVA 3PEVA 2H2DA 1H2HA 3OFSA 5JSHA 3C3MA 5CNKA 1EDOA 1RXYA 1X7YA 2OZLB 3R40A 4PS0A 3CO5A 1XQVA 4HNGA 4RSMA 1LUAA 3ZHTA 2Q5LA 1MAUA 2Q41A 3WVNA 4BEJA 4D2IA 4OGFA 1Z5OA 4P98A 1PQYA 4MI9A 1WDMA 4EQ6B 2R48A 5DXAA 1EJ6A 3DMYA 2HMAA 4WFQA 5T6BA 4BVLA 1QAQA 3IQDB 3Q3VA 1N3LA 3EGXB 1RE0A 4FFMA 4GLOA 3VU3A 1GV0A 4LFCB 1NYLA 5TQ0A 1F7VA 2F1RA 1MB4A 3HWWA 1GTVA 4IZIA 3L0PA 1JPJA 1Z2EA 4UU1A 2ECFA 5AVRA 2JATA 2YJGA 4UQOA 2A9PA 4P36A 2WU8A 4HAWA 1BJKA 2C98A 5PNTA 1URPA 3JPWA 3P1JA 3Q3IA 3I58A 5FQNA 1OLXA 1CXZA 4AUEA 4KQCA 4Q9LA 3MM4A 4IFTA 2CHVA 3T3OA 1DJPA 2IYUA 4FQ7A 4Y8VA 3LQQA 2H59A 4XDHA 4YP1A 4X20A 2AMVA 3EEQA 4JQYA 4UEKA 1UCFA 1ZK4A 5E4FA 1XLTC 1EVIA 1G66A 3FR8A 5JEDA 1NVKA 1DBWA 1D2AA 2Y1LA 3AETB 3AG5A 3GGPA 3NAQA 3JRNA 3P71T 4TVKA 1UBMS 3A3NA 4E5NA 5JQGF 3C7KA 1W5TA 3E58A 1X94A 2J30A 2WYIA 2YS6A 3CISA 1BGWA 1UH5A 3CPSA 4XJSA 1J20A 1Q0LA 3RR2A 2Q2WA 1YZGA 4LVCA 5IDWA 4LMRA 1V7PC 2A5DA 1G9TA 5F77A 4K7JA 3NNNA 2P5SA 1MNQA 3DDZX 3JD2A 1SUAA 5EQJB 1YDFA 3COYA 5LZ4A 4XTCS 1CE8A 1HDOA 3I8SA 4JP5A 4OQFA 2VAWA 2VEOA 3U40A 1L5QA 2EKBA 3NNDA 4AURA 5F5NA 1OH8A 4JP3A 3CKYA 3VGPA 1FMFA 5A05A 1RBQA 4G9BA 2LXNA 2ZBEA 3GH1A 4EFNA 1E2NA 2Q1WA 3AEYA 2P6OA 2JIQA 3BS4A 1I13A 2A14A 2A4MA 1YKFA 2GCNA 1F60A 1AXEA 3AO0B 3T1YB 2JLWA 3KPYA 1GG8A 3KJZA 1AC5A 1FX1A 1C3JA 1PR4A 2BLNA 3L7OA 2AI3A 3PK0A 5BV7A 4YLGA 2QMQA 2H18A 4CLRB 5AJXA 2FDXA 4I50F 5L95A 3NASA 1YUBA 3EAQA 1K27A 2Q49A 3E3MA 4IDQA 4MWZA 3BMXA 4RDXA 3UJCA 1GG5A 1BMDA 1NTOA 1I2CA 1DBQA 2OV3A 3L0DA 2ZRCA 5EG5A 5IP5A 2R00A 1N1GA 4PS1A 2WAOA 4DR7B 1TX4B 4NV0A 3FNRA 2FG6C 3OZGA 2GLUA 2P6RA 1DKOA 2H3EA 2PMWB 2XA1A 4ND8B 5J58A 2XYHA 2CMDA 4G0WA 4FWIB 3PT9A 1SIUA 4IJMA 2IHJA 5CLLA 3MJHA 5LIPA 1VJCA 3F0TA 2WE8A 3JVEA 3P9IA 1TKBA 1DEAA 1GHTA 3K6RA 4UEWA 3VR5H 5H82A 1KPIA 1O6ZA 3UK0A 4DBLC 1UKBA 1JKFA 1MR3F 2H4HA 3QVUA 4HDCA 1WV0A 3FNIA 2AJ8A 4ZCPA 2PKQO 3Q7SA 4J91A 4F93B 3ECCA 1OXKB 3OOEA 3ORFA 1YCFA 3AR4A 3DULA 4I19A 5EMMA 3X3HA 3OTWA 4JJGA 3AK4A 1RLIA 3ONDA 4R7GA 2IWHA 3TKLA 5KPDA 2RGEA 3KYDA 5JZSA 3FKSD 3B2NA 1QCYA 3QVVA 1MV5A 1K8QA 1MVNA 2F43B 2KBFA 3OPXA 4RF2A 1BMTA 3VX4A 5CGQB 3QTLA 3G9XA 4EB8A 3DBLB 1IUNA 3HU2A 2EKDA 4QU5A 1E5XA 4G23A 1UBCA 3N2LA 5GWXA 2JJ2A 2O3JA 3DA8A 4AYXA 1DBIA 5KCZA 2QRJA 5KYUA 3KKPA 5C7YA 4JOCA 1ZJYA 1JN0A 5AKXA 1NULA 4TKUB 4QWMA 2GSDA 3OM1A 4G65A 1O95C 1X8XA 2JJ8A 3K1AA 3ZE0B 5BVHA 1YZ3A 1N5JA 1QRRA 1I1HA 1YQGA 3E9NA 1XQ9A 3HM9A 3HXMA 1RT9A 2CL7X 5M29A 3H6HA 3I8XA 2YS7A 4JSYA 2AYZA 4EYSA 3LI2A 3ZWAA 4V0KA 5LYJF 4HAUA 2FPPA 3KYCA 3P32A 4TM7A 5LQNA 3KYBA 5AKYA 2GEKA 4ON9A 1ZHFA 2D00A 2WHEA 4YN3A 2F8TA 3TIGA 3WMWA 2XE7A 3ZXYA 3TX2A 1KRHA 1BJRE 3M1LA 3AF0A 4NS1A 5EE0A 3RAPR 4BZZA 4ZYLA 5HUJA 4Y9DA 2PTGA 1R8XA 4KPGA 1N2CB 3BGIA 1IZ9A 3H04A 4QTTB 2E4YA 1BW9B 1GZUA 1RHQA 4U0KA 3VUEA 4TTRA 3SSAA 2QBYA 1XFAA 3Q8LA 1Q12A 2WF9A 2ATEA 3IESA 3RYFA 3E7DA 4JLOA 4JP8A 3G23A 5TMDA 3F73A 2FAXA 4RW0A 2XZTA 1E7RA 4M9SA 4YAGA 4M22A 4UPVA 4X9XA 4ECEA 3AUTA 4DIBA 3HJBA 4C07A 3CBGA 1L5LA 3T7KA 2C9ZA 1G5HA 2QT1A 2OVFA 4DW8A 3FYUC 2ZUEA 2J31A 3IXQA 1USWA 4MAAA 5T7BA 4QYWA 5CNMA 3D2LA 2Z6UA 2WSSA 3E35A 1U8TA 1VIAA 2EYQA 2FWMX 1QOPB 1PZMA 2OCAA 3ME5A 1UQTA 1JLMA 3IOBA 3WDLA 2IHBA 3KEQA 3WLIA 4II3A 3RM3A 3EBLA 2IIVA 2HXGA 1QORA 2OPHA 2PO5A 4EMBA 1W35A 3DEYX 4CMGA 5B3JC 4ZIRA 1KI6B 5I9LA 2BZ0A 4ZI7A 2X76A 3CUSA 2WG2A 3B20A 1RACA 4L5CA 5EXEA 1M8KA 1T6ZA 2DHEA 3BA1A 2HA6A 1GAQA 3KFXA 1FS5A 5KC9A 2RBEA 5ULLA 1JQDA 3ZDCA 2ETVA 3MPOA 1RHUA 3KXIA 4YCCA 2ODTX 2IOYA 3I23A 5THKA 4OM7A 4MPTA 5TE9A 3GT3A 3O3OB 3SOZA 3KHTA 5H02A 3T9FA 3PFBA 4DRZA 1B1AA 1ISFA 1R4MB 2WSLA 3AIIA 3QE2A 1D6SA 4HQ0A 4IHJF 5CYPA 2JPDA 5L6LB 1SELA 3AYXB 3U4IA 3DCNA 4N1AA 3DYVA 1QO0A 5AHXA 4C7OA 2QI9F 3BL6A 3JATB 5IANA 1UPAA 2R8EA 2B83A 4NAUA 2XYVA 4OUKX 4YQZA 4B82A 5B58C 2YZKA 5K0EA 2V98A 2LE0A 3H75A 4BQRA 3ICPA 1PJTA 5K3SA 4J0GA 3CSDA 1DRVA 1KHTA 2O48X 1EBBA 1JEQA 4F5ZA 3KQHA 5HP4A 3PU6A 4MO9A 2FN4A 3HNRA 1IN5A 4L4RA 2Q6LA 2QTWB 4R84A 4ZCIA 4YP5A 3GROA 5EJMA 5HOEA 2GM9A 3CNOA 4XUDA 1CUEA 2Y1FA 1JNYA 4FTWA 4EG7A 1UC5B 3L18A 3LP8A 3EN0A 2A1UB 2JIMA 5INTA 4LRXA 2Z2KA 1KK2A 1Z82A 2O1SA 2VUTA 3ABQB 2Y1DA 3OEHA 4FEYA 4MIOA 4W5JA 4A16A 1ZKMA 2OD7A 2IUFA 2EP5A 3COZA 5DFAA 4HTFA 2PDAA 2WWXA 1NHWA 2AHRA 1L7DA 3IKVA 2QMOA 4FIZA 1ZJ5A 4U39A 1C3XA 2PX2A 2QU7A 2QXUA 1W94A 4O3MA 4B9EA 3ETDA 4QTXA 1FX0A 4IX9A 1JSRA 4JN6B 2J6IA 4MW0A 3VVMA 4CM6A 3JZFA 4XWTA 3HRKA 1N5LA 2X2EA 1H6CA 3IAUA 3IDOA 4RDIA 1I0ZA 1UC4B 3ABRB 4FYYA 1GZ4A 2E4AA 1Q95A 2AX4A 4TL6A 2HOQA 5CG2A 2AG5A 2EWVA 1BXGB 2GH1A 4LK3A 1ODFA 1EX6A 2O0LA 4NFHA 3AWIA 5A06A 1RC8A 1VL6A 3F96A 4QUGA 1RWQA 5D5PA 3S27A 4ZICA 1D1PA 4GBED 4I08A 1XMXA 3QKSA 1ZU4A 3LHSA 2ZI4A 4PX5A 4KQ6A 1H6AA 5ESRA 3QYJA 2XCTB 2JAUA 1S2MA 2D2IA 3HA3A 1ZIXA 3T7EA 3QSGA 3S7TA 1OW3B 2EOAA 3E8MA 3SXPA 4EHAA 4F0JA 4B3HA 3IAAA 1PTKA 2Q7XA 3KZVA 3L0OA 5DGIA 1KVUA 1B2LA 1JTFA 1WNTA 3K32A 3I2FA 3IQGX 2IU3A 5C4GB 2WMOB 1VYTA 4HEJA 2NU6A 1RIIA 4K88A 3GFQA 4CT0A 2WJ4A 1EINA 1GZ5A 1SU6A 3D9QX 3NBAA 3OU6A 4TVBA 2H4FA 2P4SA 2ZOSA 3N0VA 3T95A 3UYKA 5L40A 1NMZA 1NJ1A 2IHTA 2OZPA 2PPVA 2PZFA 4BE7B 5EJ8A 2YWJA 4D3SA 4E03A 1DC5A 3DNFA 1NXXA 2YMPA 4P34A 3A1CA 3ZD6A 1G5RA 1Y4AE 2X8BA 3M33A 4AF8A 3V8VA 4EARA 3CRQA 4Z86A 5EIEA 2OQIA 1VPEA 1AZTA 2JJ1A 3AUSA 3DOFA 5U4XA 3SFVA 1COWA 1F5SA 3OCUA 3SBXA 2OCPA 2VJNA 1JBQA 4UHEA 5DYTA 4B2LA 4QPJC 2OOKA 2W43A 1T9AA 1GXSA 4C7KA 8AT1A 1Z25A 1XHLA 4O25A 5LD2B 1U9YA 2YJ4A 1U7TA 3HKEA 2HT6A 1TM2A 3GUCA 3LUFA 2GASA 3QF4B 3UFBA 2VJMA 2W00A 3C8UA 4B80A 4C87A 3P2JA 3DJYA 2W48A 4ZQGA 4DV3B 1WUJS 5C5DA 2NOAA 1N5KA 3ZVKA 2RH5A 1NIPA 3N3AC 5FEMA 1DFIA 1IZZA 4OQEA 3DW1X 1MGPA 3N2GA 4WQMA 1D1TA 4Q1DA 3WDSA 4B84A 4EBBA 3GMIA 2H52A 4M38A 4TV9B 1VJ5A 5KYVA 4M8SA 2NZUG 4TVOA 3MT8A 2JJMA 3B8HA 1VJTA 1Y7PA 1CU1A 4L72A 5EWJA 3H2HA 4GX5A 2PGXA 1SXIA 2VYNA 2QVGA 5CA1B 1UBKS 4K9PA 3GRUA 3WGZA 1NI3A 2PWYA 5KEIA 3CLUC 3AW8A 2XA9A 2RB5A 4TKLA 4ZODA 3A1TA 2BL4A 4A1OA 3UHOA 1G8SA 1ULSA 4AJIA 4KV7A 1OYYA 4DE5A 1C0KA 2P40A 3CRVA 4E12A 3WWEA 2ZK7A 2ZYRA 1G20E 1WXEA 3IQIX 3PR1A 4NHOA 3OMXA 1G6OA 2X1VA 3PF8A 2Y1WA 2PS0A 3B6EA 3KZKA 3G2IA 1XEAA 2FEOA 2EFCB 4C4OA 1ADCA 3LWZA 4A27A 3N59A 5J5CA 2V4ZA 1ZNWA 3TZQA 3K31A 4B4OA 1ZGJA 2YHIB 4S1TA 1CUCA 2VNHA 4GWLA 1PJ2A 1YL7A 1COZA 3KUXA 4LECA 4PYRA 4X63A 2YVAA 4CXMA 1IUKA 1MB3A 2HNBA 2P9YA 1TTTA 1NN3A 4Z4FA 5CTJA 1FRFS 3P0JA 4EFMA 1EDZA 4RIGA 1IU9A 1GUAA 1A77A 2XOKA 4LKOA 4QYIA 4PCLA 5FWNA 3KZOA 2YWXA 1BRTA 2MOKA 3N05A 4LAFA 2WJJA 1LBQA 3RVMA 3ILSA 1YDEA 4PC1A 1KYZA 3OIDA 1YBFA 1YI8A 3CLRC 3JQ7B 3KTFA 3LY5A 3O4FA 3OESA 4PLZA 3ZDZB 1H9CA 5LBIA 3ZXUB 3U9TA 1EXDA 4RHTA 1EA5A 3Q7PA 3EIWA 2VQFB 4Q4AB 4L8WB 2VDNB 4BO7A 4DLXA 1VG0B 2FZ4A 5IASA 1AQNA 1M73E 4RPGA 1XFDA 3LUBA 1YIOA 4R8LA 2P1RA 2O23A 2NUTA 2D5IA 1T25A 1CTQA 2I4NA 4ZREA 3VVLA 4E5DA 5ADUS 5JAIA 1UFQA 3I4FA 1X70A 1U2GC 2R7MA 4IVRA 2IBMA 3LE8A 2IV3A 2R6AA 2HLHA 3ED1A 3JWIA 4EW6A 3WP0A 4MVJE 1BEEA 3ZVLA 1KVTA 3IPRA 5HBRA 1EXWA 4QGSA 3GRPA 4YJFB 2JKZA 1GU1A 4B3DA 3B38A 3FB4A 1VMKA 2ONKA 1TB4A 2FI1A 4LJ5A 5MGBA 3KWMA 2ZU0C 4PHCA 2IRWA 3AV0B 5HS4A 4X6YA 1FSGA 1GAEO 5CLQA 4EO9A 1TJ4A 4QU9A 3OSZA 3MCZA 1MQ9A 4G0QA 3CRZA 3V4FA 3VDRA 2UUBB 1SWWA 3FGZA 4INZA 4QIHA 1WCYA 2OQRA 5G1NA 3CUWA 2GJKA 2B92A 3N8DA 1KJIA 3NTRA 5EEHA 3WYGA 3N2IA 3FMOB 2QGZA 1SU7A 2BKLA 1O9GA 3Q5DA 4MI1A 3K35A 5EY5B 3GPDG 5CXXA 5IULC 2I54A 2CKDA 1I01A 3EZNA 4DTCA 3AVTA 1TQHA 2YWDA 5J2TF 4D6YA 2Q4BA 2X86A 4J2HA 2PUJA 2JI8A 5K51A 1XDUA 4N8DA 3IAHA 4NBUA 3CS3A 4EPTA 1IDN1 3FNBA 2R1TA 4G5XA 4O4JB 2QTFA 4OVKA 4MW7A 1TF2A 3PUXA 2PEYA 1Q5PA 4RVFA 1A76A 1NMYA 1UP4A 2ILVA 1YT5A 3DT8A 3RROA 4ENUA 5HGXA 5JY1A 3OA2A 2O5EA 2MCFA 1HNWB 2HXSA 5H70A 1UWLA 2IH5A 1A82A 4R68A 5E6SB 4B81A 3AM4A 3LBNA 3CIOA 1HX7A 2W2NA 3X1KA 2H0RA 3K7EA 3QNWA 3RQIA 2XNDA 5E6RA 1YS6A 1CRLA 1YACA 4R9RA 3EXIA 5A6SB 3ZHQA 3WYCA 1NRXA 4E46A 4QBKA 2BTQB 5FYDA 1ICEA 3PNOA 3SIXA 5LZ2A 1ZUD1 1R0SA 3O92A 3RTGA 2ZXEA 1BIFA 3P0IA 4O08A 3IXLA 4ZZ0A 2YYZA 4WXRA 2WJWA 1T13A 3K94A 4KO3S 1TIKA 3GCGA 1P2GA 1ZZGA 1EDBA 2VJYA 3SKVA 4U8HA 3ZQ6A 3GZJA 2W2KB 3TMYA 3WGHA 4BP9A 3WA7A 2J0SA 2IA5A 4X1KB 1MO3A 5JW6A 1N6PA 4RA6A 4PAOA 3RRNA 3G02A 2P3SA 4PLHA 2B3TA 5DBGA 4WE3A 1N6KA 5FTKA 4C1NA 4E2FA 2IITA 1W4RA 2AN4A 5G3YA 2B1GA 1S4MA 2O2CA 3NZEA 1TECE 3FMVA 2E55A 2C61A 1KI2A 4GP9A 4KFTA 1Q7EA 3DV0B 4IKPA 4RV4A 3OIYA 3EXFA 4IM7A 3FDZB 4NZPA 5AXDA 4EG3A 2GPNA 2IL1A 3FCCA 2IYXA 2J6CA 4HGRA 5ESDA 4H16A 5LA6A 6ADHA 2Y27A 1PJLA 3E5NA 1CF4A 1VBNA 2IC5A 3HI4A 4QHSA 3FYHA 5JFTA 1LDBA 3BG5A 4LYJA 4I2VA 5EUMA 1ZISA 3H2YA 2A35A 4FLEA 4Q9DA 5I48A 6LDHA 4ZCRA 3RVRA 1NHGA 2QK4A 2HU5A 5LU8A 2BH2A 2RJ3A 2CEKA 2NM0A 2GBIA 2YIDA 4IFBA 3WL5A 1SCIA 2ZPAA 3IAM6 3TCXB 2DBZA 1B8OA 1T8SA 2AG6A 2XQJA 2QZ4A 4X60A 1SXQA 3V4SA 5CVEA 4DC9A 4AQ7A 4O8CA 1ARZA 4D98A 2FRDC 5G3ZA 4FYPA 1D6MA 1RHMA 4DUZB 1ZXLA 3D0OA 2ANCA 1XA0A 3B82A 5JMWA 4KITB 3ZU4A 5DTJA 4KQJA 1SVUA 4QT4A 1W48A 1N6RA 1QQ6A 5AKZA 2ABWA 1QYCA 4UULA 4X1YA 3VPBA 4KR3A 1ZD8A 4OQMA 2JS7A 5FWDA 3I0NA 2VJCA 2XTAA 3M4XA 4RPCA 1BWSA 3PB3A 4JUFA 5DGTA 2NUPA 1C0PA 4QYXA 3ZWMA 5L4SA 2CLHB 2DQZA 4FE4A 4U02A 2W6JD 3IALA 1UP7A 5AVYA 3W5BA 1SVMA 4R3UC 3MMSA 2PYDA 4EHHA 1U99A 1I0LA 3AGQA 1NKSA 4HGNA 4NE7A 5ALFA 5EJ6A 3G85A 4IIVA 4KU4A 1M8PA 1XEXA 3AEQA 4D0NA 5B6JA 4M9RA 1C2YA 2DBRA 2P2YA 5IVIA 2FJ0A 3EMKA 2NP7A 2WLSA 5FIUA 3NFYA 2O0MA 2XD9A 2XMCA 2W6IA 2X0NA 5H3HA 4DTIA 2E49A 4RQTA 3ORRA 2PMCA 2QXYA 1ST3A 1M74A 2D1SA 2C1EA 1N9GA 2CFIA 3EGDA 4MEAA 4BQPA 4JLPA 3C6MA 4ZZIA 4WGFA 2CC2A 4CODB 5K03A 1GCGA 4FDLA 1E89A 4PCVA 4AWXA 4BNVA 1SXJC 3ZCXA 4QU0A 1X9IA 3B6JA 1E3JA 3TZEA 1YQDA 4P82A 3T9EA 3AXSA 4PSDA 5BWMA 1QJCA 3F8SA 3GLFB 2GN1A 4MZXA 4BN4A 4QTZA 4BCDA 2FFHA 2IX3A 1MEEA 1BHO1 2P69A 3FFBA 4WKOA 5FWXA 2QM7A 5B58T 3TOCA 2W6CX 1HQKA 4R01A 3P2IA 3W6UA 3TSZA 3GDFA 2PR7A 3E3OA 4IEEA 4ZIRB 3G5MA 4JEUA 3HYRA 1FFSA 1L4MA 4TWJA 2JCXA 2ZB8A 5EYPB 1I32A 1B26A 2QYTA 1Y9DA 3C14C 3K4PA 2XTJA 2B4YA 4U7WA 4WOKA 3ONVA 1G3MA 3QE0A 4G41A 2DFLA 5TC4A 2CCJA 4TOIA 5EHGA 4TL8A 2YINC 1VLJA 5LQUA 4AI6A 1UAYA 2AJTA 2QMYA 3N8KA 3TIFA 5KNDH 1F51E 2PSSA 1JHMA 3QKRB 1HE2A 3RFXA 4B3RB 4BO4A 3FHOA 1NW8A 3W3AA 1KZ7B 4QEZA 1YR8A 2VK2A 3V42A 1FS6A 5LZ8A 2WQZA 3OT1B 3OTIA 4MDYA 3UGTA 4MICA 1RXCA 3KQPA 3RBVA 4GWGA 5FTMA 3PUZA 5A3QA 5JYEA 1R15A 5DGHA 4PYQA 5CYGA 3AVPA 3A14A 4D4LA 1I14A 1NVWQ 4AJPA 3PJFA 2D7JA 1RXIA 1T2UA 1FRZA 4S0XA 3TM4A 1L7PA 4NULA 3FPFA 3GN1A 3EYWA 4ODIA 2ZRKA 4HGQA 4B09A 4DIDA 2HQ1A 3LXMA 1Z16A 3QBDA 2CFCA 1NR1A 3QA3E 4HWTA 3RSQA 1IY1A 1UDCA 1B74A 3CONA 4RHXA 4ZV7A 3VBCA 5GJCA 2VDWB 4EBFA 2I8CA 2ZJFA 2JJYA 3QLJA 1PE0A 2BGKA 5FB3A 3ZE6A 4C6TA 2CBXA 4F5YA 2WQ7A 1QRUA 4ZOEA 1GFSA 5AJTA 3EFHA 4DMCA 4O4HF 3E9ZA 3LUAA 1Y3FE 3C48A 5K0LA 4JUIA 4W1PA 5DP1A 1HZZC 3NBUA 5CDSA 2NYUA 2A2ZA 2I80A 3GEPA 3J81k 1JR6A 4EITA 1QV7A 1IJBA 3A2KA 4EMUA 4RA9A 4MV0A 2HJHA 4CBVA 1FOEB 3MC1A 2QMZA 2I2FA 4W7HA 4AC9A 1L4GA 4OV6B 3DBRB 1AGRA 3STTA 4AF6A 3BAFA 3MF4A 2O14A 3G5TA 4ONEA 7YASA 2RI1A 2ZI6A 4V0MA 5REQB 5JDCA 3FTQA 1ISHA 2P2CA 2RBKA 2J0QA 1DIOB 1SMKA 3BKXA 2O06A 1H0SA 3HUTA 4I5IA 4YJHA 1XZBA 3NS7A 3K71B 3AR8A 1EIWA 2HHCA 1ISPA 4DQ0A 1AK9A 2ADFA 2EFEB 2BMFA 2XMBA 4K9KA 2OZVA 5H4HA 1B4DA 5FDFA 5DHTA 3KBBA 5H83A 1PWYE 3OJEA 1RP7A 2QTAA 5DW3A 3N28A 4GH5A 1E69A 1I6KA 1WPQA 2VCHA 2WFMA 4M87A 5AJUA 5EC8A 2XH8A 4PLCA 4RD2A 1DKQA 1B8NA 2I87A 3K8YA 4OK6A 3UAXA 5IJ0A 3AUKA 3KWFA 1RRVA 2NU8B 1F8XA 3STXA 1Y80A 1Y1LA 1E1QD 1D8AA 2VUHB 1KS9A 4MWOA 5CXSA 3KX2A 4NQZA 4C04A 3KPWA 5CM9C 2Q3EA 5C9ZA 1K7XB 1US8B 5ILGA 5K0FA 5LLDA 1VG1A 3PTAA 2WTUA 5CHEA 2OE2A 3KNZA 4F9EA 1V1MB 1BNCA 4NENA 2JI7A 4IP0A 2ZIXB 4YMVA 2MSWA 1CFZA 3C3JA 4UATA 3WHPA 4DA7A 4ASUD 1VKNA 4LV5B 1W36B 4J29A 4CDNA 4ZFNA 2Y0CA 1Y37A 1NYRA 1UWKA 1WTCA 4FILA 4XR9A 4H3HB 1DX6A 1G0NA 1SG0A 4GO1A 5EZQA 4H7JA 4BTLA 5KU7A 1S2DA 2GVNA 5F9MA 4ZDIA 3RAEC 2G77B 2WVHA 3SYTA 1YJXA 1RC0A 4JI1B 4LZOA 4LXTA 3QOFA 4AKTA 1CY2A 1XZFA 2V1XA 3VZCA 1TYAE 3I9V6 2HYDA 1EFPB 4K6FA 4U2GA 5FNZA 3WLLA 5FP0A 2VQ3A 3T54A 3RDPA 3R7AA 3A1EA 1QHXA 3EG9A 1IMJA 1IULA 2IP2A 3FCAA 3IC5A 1Q1AA 3M4YA 2VQ6A 5AW2A 5K8TA 4Z5XA 3EFOA 4IIUA 5FFMA 1A8SA 1J5EB 4PRZA 5LQDA 2C4HA 1R1DA 4XOUA 4MK4A 1OY1A 3INYA 2I1VB 2GHRA 6Q21A 3GEEA 4DJEC 2A0XA 3TM5A 4OATA 4ZC1A 1DXYA 2YXLA 4D0GA 3K5PA 4K8OA 5EXSA 1L5WA 5EZYF 1BQEA 1F4PA 3DHYA 3NBQA 3HUEA 3OTGA 5DCLA 3EA4A 4DUPA 4I55F 1UKCA 1OGIA 4KHZA 1PBTA 2W6ZA 1H3FA 4WHMA 3VPDA 1ZIOA 5C3MA 1YB4A 5JMOA 1ADYA 3G79A 4IDAA 3ID6C 2OZKA 3S2YA 2XW6A 1GTMA 2X9QA 2C8LA 3ZWXA 4DV1B 1DRUA 2JAOA 4Y9RA 2QLLA 2XLCA 2C7VA 4B87A 3KRTA 2EU8A 2J67A 4IDGA 3ZU6A 2RGWA 2PAFA 2VSNA 1Z7EA 4M1WA 5CDFE 1ID8A 5JCJA 1G8MA 3BFJA 2JBAA 5FHRA 3AHIA 1CKEA 3K73O 3L06A 1MVOA 3LPAA 4HX9A 4AX4A 5BR1A 2YYAA 2G3YA 3VPFA 4H6PA 3SCZA 1ODLA 4INJA 1KI4A 3GHHA 1GLNA 4TMKA 1F6WA 1ZOIA 2V97A 4XIGS 4C08A 1U0GA 5BUZA 2ZRQA 2EW8A 2XNHA 2HF7A 3TOXA 2ZRGA 4R5HA 4FW9A 5FUBA 3RLIA 3UT5A 1X14A 5I7AA 3SNHA 1FDIA 4QQ8A 5EJ9A 1YF3A 3VOSA 4MQMA 2R1VB 3E3NA 5JDIA 2QS9A 3QJYA 3KQWA 1XLUA 2FEKA 4P93A 2PWAA 4A7PA 2XBMA 2E4ZA 3V2GA 1W0KD 5AHWA 2O52A 2IF2A 3D3NA 2EFYA 4OXQA 5DI9A 1HTTA 5K3OA 4MV3A 4JK3A 4O5AA 4YBRA 2L42A 2QIPA 4ZOLF 2AW5A 1J49A 3EB9A 2B37A 2QUZA 2OB2A 3TZKA 3U7GA 1FLVA 1LX6A 2X6TA 3HYTA 1TYEB 3JD4A 3QRWA 1YKSA 1NTRA 2OKGA 4PBRA 1QTIA 1J8YF 2ZSBA 3M7IA 1S3FA 1J8VA 1E2HA 1DL5A 3OJLA 3ULKA 3T5AA 4ZN6A 2ZPTX 2C58A 4IJ5A 4D92A 3CX3A 1XNGA 2VWGA 3LPNA 2FB9A 3ND5A 1SCUB 3NAMA 2G83A 5ARDA 3SSMA 3VH1A 1KSJA 1HURA 1ZUNB 2Q45A 4F1JA 3MAAC 3S2EA 5CLHA 1P4JA 3AJ9A 2Q6OA 3VYSB 1SG9A 2E3JA 2W37A 1TO2E 4NNPA 1USUA 4FHDA 1BCSB 3EZFA 1X39A 3VR0A 2WT8A 3C5EA 3W5DA 1CZRA 1FP7A 3VDNB 5A0VA 1JQ3A 2V5UA 2P62A 5JYBA 4ZO4A 1MG5A 2B78A 4QPPA 1K6JA 1T5HX 4L4UA 3DO8A 3A2LA 5J59A 3N6XA 1DIRA 4PNHA 4G1EB 2R6R1 4LI0A 4D3XA 2Q5EA 3KZNA 3FYUA 4N65A 4Q3EA 2EBWA 3OZFA 4PCUA 4OL0A 1GPMA 5A7HA 3VSEA 4DCMA 5MN6A 1E3EA 2ERXA 3RC3A 3B3JA 4OH1A 4DCCA 2VP2A 4LOAA 3WL7A 1NLUA 3RRBA 3WL6A 4RPIA 1IJEA 3JQ6A 4ADSG 4L78A 3L0SA 3O75A 3OUTA 3T06B 2Q99A 3D6FA 3EPKA 1WOYA 4OHYA 3ROZA 1FB5A 1M54A 2IDMA 3CKMA 3QV2A 4HNUA 4GR4A 2DUJA 3CNLA 1QDLB 2F55A 1WBDA 1LWNA 2AEFA 2ZWIA 3EVAA 3O8OA 4FI3F 1AF4A 1JILA 2NSHA 3QGMA 2I33A 3FYTA 4LZLA 4QFCA 3V1KA 3MEQA 3M6WA 4EUSA 2DWPA 1U81A 3DKPA 5B37A 1YR6A 4UE2A 1TM4E 3OKCA 4CQLB 3M89A 4DA4A 1Z07A 3TCKA 3A4LA 2CV0A 3R75A 1PGPA 1W4CA 2QP3A 1NUTA 3KO8A 1IATA 4MRVA 1YQXA 3UWKA 4WK2B 1P91A 2FW1A 2PRYA 3ET5A 4NNJA 1FTGA 3CH5A 5ED4A 4J0HA 4RACA 2JA1A 3B1ZA 3D4IA 2CFTA 5DYNA 4ZVLA 1SC1A 5JU6A 3KQSA 1MNAA 5KWIA 3TG2A 3SBEA 2V6GA 3SP1A 2XPCA 2A9OA 4GMKA 2NZYA 3P9RA 2DPMA 3BMNA 2J7PD 5CURA 3ZWWA 4MB6A 2ZZMA 1T34A 2AX3A 1TO6A 5BP7A 1MW8X 1DTSA 1MT0A 1NFFA 1X1BA 1DUIA 3MD9A 3KJIA 3RFUA 4PLTA 1D4ZA 5AYVA 4ZXPA 3UH1A 3QEBZ 1G9SA 1OAKA 1D2HA 3WGQA 4C3VA 4ZDKA 4MLZA 1XZQA 3DKRA 3EDQA 3IILA 4C2UA 1EFVB 3RVNA 4AP5A 2FZLA 3MTDA 4ZT2A 4IIJA 1F3OA 4PO3X 4WCVA 3RYIB 4ENPA 4WN3A 4PYJA 2C9DA 3UA4A 3UJ8A 1IY9A 3OOJA 1P3JA 3EW7A 1F8GA 5E1DA 4MUBA 2DPGA 2WJPA 4O2BA 2EJCA 1M2WA 1UBOS 2ZANA 4LNAA 4WY8A 5TT0A 1G7RA 3WYNA 3GMTA 1C7RA 5FEUA 2HRBA 1OBHA 2FPLA 1E6CA 1DOAA 5GJWC 4YWJA 3T3PB 4BC0A 2WB4A 2C3PA 3R7LA 3QELB 5HW0A 4OA5A 3TSWA 1DV2A 2ZAIA 4RD6A 3RC7A 3UN1A 3IJ5A 4FS3A 3N58A 3RHSA 2A9VA 3NHRA 4WVFA 4FR0A 1L4HA 2AF3C 4KVAA 5C8YF 1U04A 2YXBA 3OTHA 1CUWA 2DFPA 2C5FA 2DBVO 3FWPA 2BFEA 5DM1A 1FTSA 4XYLA 2WSBA 4NJMA 5BQ5A 4PG6A 1TVKA 1CWUA 3D4NA 5HBGA 1UDAA 2V9CA 3B89A 1MV8A 2HX1A 1GL6A 3U9SA 1ICIA 3RU9A 2OXCA 1KEEA 5COQA 1E2QA 1OFUA 2C96A 4KPUB 4EYQA 4UOEA 3EHDA 2G25A 4ZRMA 2C2MA 2VYQA 5TQ2A 3RSFA 3UXYA 1EA7A 3HB7A 4BJHB 3W5AA 2ZUFA 2B0JA 3SR0A 3MUEA 4I1IA 4ZAWA 1FJGB 1VCOA 3EPLA 4MKFA 4EA8A 4H18A 4R05A 3WOHA 1BYIA 1QTNA 1KQGA 1T4BA 4IXNA 2LBPA 4HN9A 2X7XA 1OWLA 2FETA 1CX9B 3MQ2A 3O7WA 1IXZA 2BHSA 1V3VA 4YECA 4KE9A 1ADBA 1ZP6A 4G26A 4GPZA 3ZK7A 1DIGA 2XMPA 2CVPA 1GDDA 2EWWA 4P54A 4Y18A 3TLZA 2Z09A 3PSHA 4UEJA 2LCQA 3UKJA 1G4HA 4EHLA 1PJ3A 2KI5A 4CRWB 3F8WA 3SX2A 621PA 3F9CA 4KXXA 5ICCA 1Z5WA 3DM9B 4OYHA 2QG9A 3LDUA 4Z0PA 1J8DA 2BV3A 2JFNA 2VLIA 5J2UB 1W93A 3I32A 5FPSA 1DDOA 1O87A 2CUKA 1AZLA 1OHHD 4HZIA 1P1CA 4QOHA 3WI7A 4FOTA 2BMJA 3ZH9B 2Q5FA 5K0SA 1RFGE 3L4BA 1CS0A 2HA3A 2R1UA 5MGNA 3SM9A 2GWRA 2YY7A 1G7TA 3AKCA 3GFPA 4HQFA 5G2OA 4MULA 4FUTA 2A0WA 4C3UA 5AOAA 2HUPA 3VR1A 1XG5A 2R4QA 4CTMA 1ZN7A 4KKVA 1M8JA 3FVVA 1E9CA 2IYOA 4MQ4A 5DSTA 1YS4A 3FPBA 1H8HD 4LGVA 2YNMC 3QV1A 3UGQA 1DBVO 5BN4A 1QZZA 3A0RB 3KPUA 1PWXA 4EVIA 2GKSA 4UNSA 2ES4A 3BFPA 4HBZA 3S2ZA 1GZ6A 3PIDA 4KMOA 1KNQA 1FYVA 4Y2UA 4HWRA 3FSGA 3ICCA 2XEDA 2AMFA 1NIJA 4WKBA 5KVSA 1FTWA 1DFHA 3P9PA 4LYEA 4CEHA 1U1DA 1NONA 1YK0A 4A8TA 5FBWB 4E1VA 2Z6AA 3QPDA 4NI5A 2GN8A 1F2TA 1JJBA 3TOSA 2JIOA 3V8NA 4R0MA 2GAFA 1RXUA 3GT7A 2IP4A 2ZP1A 3V7UA 2A9QA 1H9AA 1NXVA 3RVDA 4PFJA 3Q7TA 1DX4A 3DGFC 2DP4E 1E79A 1L8XA 2KB0A 3D6VA 1G6Q1 1YR1A 5D87A 4I3FA 1IN4A 3K9CA 2YWBA 3TOVA 1BS2A 3I72A 5LDDC 3HV2A 1UKZA 1ODCA 1ADJA 1VKJA 1P0IA 1EVJA 1OWPA 1OYWA 1DOHA 1B3BA 3H1PA 3AM1A 3VU0A 3NHWA 1M67A 1HMPA 2IXDA 5KCMA 2DFKB 2VUSA 4Q3AA 1B00A 1NZFA 4UBNA 5EPEA 4LFAB 4ZARA 1VKRA 2C8KA 1UQRA 2A0FA 5DMXA 1QGDA 3VKGA 2LWIA 1O8BA 3JVIA 2AHOA 4G1CA 1NWCA 5E95A 1GRVA 3W7AA 2ID4A 1L4FA 4HNAA 1NV9A 2VP9A 3DWEX 3S1AA 5B3AA 4YHBA 4BKUA 1QHHA 1LEHA 3LDFA 2P65A 2VDQB 4IRXA 2FOXA 1MAVA 1MT3A 1YQWA 1W96A 2V74B 3FFXA 4P0PB 5KHOC 1HUQA 1IZ8A 3W4IA 4LVUA 2ZJYA 4QDUA 2BHNA 2IQ5A 2CV2A 1T26A 4KXYA 1RBYA 3IQXA 3Q12A 5A7FA 4MAFA 1DGQA 2RIRA 4RNDB 3KLNA 3P26A 3PG5A 1CP2A 1F9AA 3COSA 3SBDA 4BX3A 3FIUA 4JI2B 3SEZA 4PV7A 5F5LA 4W4TA 1EJ2A 2E7ZA 4WGGA 3U0BA 1VL8A 3I45A 1WUIS 3SWWA 4PIVA 2NXNA 1J00A 1T4CA 4J7CA 1V2HE 2HTEA 3WLHA 5A5DA 5AI0A 3HUFA 3AEXA 3TSOA 4UXJA 1CF9A 1ZCZA 2Q50A 5G0SA 4BNMA 1V1RB 1WPXA 3I9OA 5C81A 5KNBA 4HADA 1DKUA 1GUYA 1Z4KA 1YVUA 2GD1O 3IEUA 4JYCA 3UQZA 3PR3A 5FPTA 5CFPA 3X2EA 1V43A 1T3GA 1U6IA 2DYKA 1Y5NA 4B17A 4MTLA 5HPYB 3TL3A 3PT5A 4UW9A 4MUJA 1KIAA 4XFJA 5M3BA 5KNBH 1JDJA 3GPCA 4RTKA 2R9VA 2FZGA 5ALYA 3MJDA 1EQAA 1ZRMA 1QHSA 1TLFA 2HHLA 2X9NA 4BUZA 1XAHA 5CW1A 4YRFA 4FFDA 4UPEA 2IGTA 5KOJA 3T1OA 1XWWA 1M6HA 2WZDA 3PNPA 2RGNC 3WSWA 4EB6A 1FJXA 3KOXA 1H2ZA 1M34A 2XECA 2GCPA 1TGVA 3OT5A 1NPTO 1NSYA 1D2GA 3F46A 2WKPA 1PJ8A 4AFNA 3SLGA 5CA0A 2CLOB 3N2EA 3GA5A 5KJCA 1DI0A 2V54A 3WGJA 2CUTA 3HGMA 2A3NA 5H0IA 5B36A 5I5EA 4C4TA 2NXWA 1M9NA 3GJQA 4KLAA 4OUDA 3UMCA 2RGGA 5LMCA 3MQ4A 4JB3A 4P4SB 2QAIA 5L45A 1TA4A 2I78A 5CLIA 5J4LA 2HR1A 4PAGA 1E0AA 1U7XA 4W7SA 1IBMB 3KOMA 3RWMB 1XZIA 5ICFA 3T7RA 4WT7A 4XCVA 4CIBA 1TUBA 4U2BA 5J3JA 5JVDA 3WAJA 2HA0A 3AERA 5FAXA 3S5JA 5GVSA 1Z06A 3F3YA 2UVPA 2FWBA 2R68A 3HXLA 4BN0A 4F8YA 1DZIA 2G5PA 3EGIA 4KQMA 4ND8A 1OTHA 2CLIB 5ESWA 1VKHA 3PDWA 4QDJA 3TLMA 5IM4F 2DB3A 5LYJB 1JH8A 2A0YA 2QNIA 2CXQA 1P19A 4Y2VA 4XUEA 4Q39A 2H6EA 3ELDA 5AFSA 1E5LA 2DX7A 3LWNA 4JI6B 1D4FA 4URHA 2VC2B 4RHUA 5GVRA 4Z4QA 2WP0A 2AOVA 3RRMA 4UQLA 1ZSNA 1P5JA 1P81A 3DZ8A 1VP3A 2OHXA 3L46A 2XSZD 4PLGA 5CD1A 3IB3A 1UBRS 3EXG2 1WQ4A 5CNIA 5DEOA 1KMHB 1QE5A 2DFDA 3SQXA 1GQYA 4BVBA 1RTKA 2XUGA 3BMOA 4UDYX 3LUPA 2AFIA 2ZQ5A 4AMYA 3PHIA 4FFVA 1JWAB 2X15A 4MVCA 3VDXA 1FUKA 3RJTA 4ED9A 4RJKA 1WEKA 2QY6A 3CWQA 1PX0A 4GEGA 3P9ZA 4N39A 3DTTA 3R3XA 4HZGA 5BOSA 1KDTA 4FT2A 4HN4B 5AM3A 4G4IA 1NN1A 1T15A 2R65A 1L5RA 4PRYA 4CQMB 4JT9A 4QG3A 7REQB 3IODA 4U2FA 3OLYA 4WXYB 3MYYA 5CDUA 1KBQA 3IUQA 3QU7A 1WU7A 2ZRMA 3FLBA 3K2BA 4GUAA 4ITUA 2IHYA 3ZV6A 3K2IA 3PPXA 2C8VA 2ZSDA 2YFYA 1CQIB 3AGPA 3GCZA 2BHTA 2RMKA 4P7GA 5BURA 1W5AA 1CJMA 4HB3A 1EBFA 4FE3A 2D0DA 2C2ZA 3EWNA 3EZ2A 3GXBA 2OFWA 4B32A 4ZJYA 5FPKA 2GXQA 3OF3A 4DARA 5GZ1A 3RT7A 2DZDA 1J1ZA 2ZLBA 4YRLA 5ED0A 3UUEA 1JBEA 3FMPB 2OFXA 1PZEA 3QVGA 4FNAA 4NU5A 3N0WA 2R5WA 2C9CA 1EUCA 1SA0B 4V0LA 5D5HA 3SZRA 1REQB 4E21A 2ZIVB 5A5FA 5FOXA 4I6JA 1WMFA 4WLOA 3QITA 2O8EA 3PGXA 4YGXB 3K0CA 4F5EA 1ZK2A 2C07A 1GL9B 4ZO7A 1VJRA 2W2TA 1SEVA 1BW9A 5ALOA 3UPUA 2EJTA 4OGWA 5DHFA 3ZY3A 1RWBA 3ILVA 3DM5A 3R3SA 4CTOA 1XAGA 3L6BA 1JDNA 2WG0A 3L77A 3W5VA 3KUKA 1YFKA 1DXHA 2C0CA 5BRJA 1WB4A 5KTRA 1D2RA 3AR5A 1Z5GA 3STWA 1M3SA 4AS1A 1Y6RA 2D1QA 3EG5A 5SZKB 3SJCA 2IYRA 3DT6A 1MJGA 3OIUA 1Q2UA 1U28C 3NB0A 3NTVA 4RV9A 1QWOA 4FKMA 2NT3A 2DJ5A 4D6XA 1MN6A 5TGDA 3WBFA 4P9NA 3VH3A 1QVRA 2DJIA 4EUKA 1ZRNA 4BFUA 2V7PA 3O6VA 5ICGA 3KCQA 2NO5A 4RKYA 3F5DA 1RWNA 3PHBE 2B6HA 3P4YA 1WAMA 2XA2A 3A8TA 5D5QA 5JROA 2JAHA 1Y8AA 1AUOA 4RKEA 3CRRA 1ZJWA 3EIXA 2QTGA 1UWCA 2ZR7A 1FDRA 1WEHA 1CY1A 1LW6E 1JALA 2LKCA 4C4AA 2PRZA 4YJ3A 1BOFA 1Y9ZA 1N6LA 2OLJA 3V9PA 121PA 4URFA 3F7OA 2QE7D 1EVZA 1RM0A 2CXTA 3AG6A 3HM2A 4HYEA 1J0DA 4LRQA 2ORWA 3BXPA 1Q74A 4EELA 3PFNA 4ZT6A 1AHPA 2BOVA 2J1LA 3O84A 4KO1S 3A6GA 1QK4A 3CE6A 3FGNA 3OFJA 3KEGA 4QLOA 1D03A 3IR6A 1LS6A 4J1QA 4BMPB 2I3AA 4KODA 3JD1A 3LP6A 2AE2A 2OD2A 3JALB 3K53A 1NN0A 3OZDA 5A4JA 4LQLA 5FBVB 3LQ4A 3WQQA 5IYZA 2IOFA 2GJAA 2C3UA 2ZBDA 2IU0A 1JSCA 1P1IA 2B1RA 2OC9A 4IDOA 5K01A 5EJFA 2RHBA 5GPBA 5AI9A 1ZEJA 2JGFA 1RD4A 1N7GA 5AVTA 3WTCA 2O4UX 1IHOA 1XVUA 2BM8A 3PI6A 1Q14A 2QJFA 4EJ6A 2OORC 4XASA 1VC2A 4TS1A 4XD2A 1HSZA 1HZZA 1K06A 1RJWA 3ZWCA 5AW7A 5HZGA 2JHPA 3SN6A 1O97C 4B6RA 1IIRA 4EHBA 2P3QA 1A5ZA 2MR5A 3GEHA 3C1OA 4MCIA 3RREA 1Y6FA 5KOIA 4C0QC 4URUR 4YRPA 1P1BA 2H92A 2HV8A 1Y48E 1S2LA 2ZTVA 1TM5E 3TLGB 2C54A 2EW1A 4LC1A 4OBXA 3UHAA 5K3BA 1JDZA 1U7ZA 5DCUA 1XSEA 1JFFA 4JI0B 3NP9A 2OAGA 4NR0A 1J1IA 1CZKA 1I9GA 2D0IA 3UJ7A 2GXAA 4LDJA 1FYDA 1KAGA 5IDVA 1KOJA 4TN5A 1T43A 1T3ZA 2PYZA 2WY2D 3LY8A 4Z54A 1G20B 4CG3A 3M6XA 1OH7A 4FN4A 1JFSA 3W7BA 4NPHA 4OHUA 4TYNA 2NT4A 2XKBA 2QTBA 2HIAA 1BKSB 1JRLA 4OKIA 4CDMA 2PBRA 1PDOA 4FEGA 3VR5D 1AKEA 2XQVA 4L22A 3PPIA 4FQ5A 1JFTA 1NT2A 2QN6A 2FFJA 4ZMSA 1EEHA 1QGUA 3EGCA 1P7ZA 4IIGA 1AVTA 2JASA 2R6ZA 4QUJA 4Q3OA 1KK0A 2MSLA 3N76A 3OOYA 4BCBA 4K3VA 3B7GA 3QEAZ 2C7QA 1TYDE 1UODA 1YVRA 4CIWA 2WPDA 5H59A 2OYCA 2NPFA 4CMIB 4DR3B 2X4DA 4RK5A 1PRYA 3AJDA 1S4QA 4RF4A 5G0TA 3FPCA 2ZZNA 1FNSA 1JX6A 2YFHA 1Z73A 3OE5A 3N0TA 5FBZA 2WVJA 1NOIA 4LJRA 5CX1B 4ZDJA 3KPVA 4CM3A 3PKIA 2WOJA 3KCNA 1H22A 1ZPDA 2EYUA 3NOXA 2BKUA 1E3QA 2Q3MA 2H7VA 1W44A 2DR3A 2ZJ6A 3UOWA 4AS2A 1F6BA 3A1WA 2RI6A 4P3NA 4MQFA 5BV0A 1JI0A 2J0EA 4P86A 3O2QB 2Y2VA 4BHTA 3HJRA 4GXQA 1YA8A 3VR4A 4WCDA 1TLLA 1L8LA 5C18A 5C8DA 2AD1A 3TDMA 1WUTA 5FBKA 1A9PA 4F3NA 1E6LA 3NXKA 1E4YA 3H5TA 3UK7A 4Z2YA 3ZCQA 2PRIA 3R5XA 3DMTC 5A9TA 2JJ2D 1OYVA 1KF0A 4ZAZA 2IUEA 4YRQA 5EA2A 3VR3A 3JQGA 1U9IC 4P8RA 3VR4H 1V7QA 4DR4B 1XNHA 4JZKA 4Z0NA 1TW3A 1U8XX 3EUWA 4LDRA 4ZK2A 2ZRBA 1MLDA 2ADOA 2ZBQA 4AJ2A 3PX7A 4EUHA 4FJ0A 4P3OA 2XADA 3ZUGA 4HV4A 3C1AA 1VMAA 2DF8A 2HREA 2JVKA 3H8WA 1M6VB 3PF9A 3N8GA 4BNNA 1CF2O 5C5IA 3KDAA 3IV9A 3NYQA 4F3TA 1DO8A 1U2ZA 1F1JA 1E0SA 1CERA 2A94A 2QW8A 3BJRA 4RWEA 4YJGB 4DCPA 1W2HA 4DCUA 3B3FA 4TRNA 4QJIA 3P0FA 1LRLA 3D8HA 1AK1A 2C5AA 1WSAA 2QJRA 1JHYA 3VBEA 4BO3A 2F1KA 4WUTA 1T0IA 2RHHA 1SCJA 1AQUA 2J4FA 2NXCA 4NOLA 1GPAA 4B35A 4FFPA 1Y34E 2SHKA 3QUAA 4V0SA 2DWUA 3L4EA 4E13A 4D57A 1IEWA 3BGSA 2J59A 4PONA 5JNSA 2DRIA 1K66A 3GUUA 1EQUA 2EX4A 2CXHA 2QX4A 3IHWA 1M1ZA 1JA1A 3LQYA 2EGGA 3NORA 2ZAYA 5AI5A 3ZCTA 1MXHA 4IS2A 1CD5A 1LPMA 3Q7QA 1JQKA 4D5EA 1KKMA 2CHUA 2YHUA 3N74A 3LC7O 1O89A 3JQ9A 3O2NA 4NL4H 4PLYA 5HIIA 4U2CA 4N5LA 3VRHA 1WULS 3THSA 2NO0A 4JBWA 4MPPA 2BR5A 2EZTA 3Q11A 1O58A 1C7FA 5CFLA 1RNLA 5FD8A 1ODJA 4HDOB 4L73A 5TF4A 2NGRA 1HT1E 2EHJA 4M7WA 1E0KA 1DKRA 3WY9A 2F67A 1MAAA 1SVWA 4L1KA 5KHAA 1IXRC 1NW3A 3RYCA 2YZ2A 2AN1A 3ETGA 2R8YA 1ZGAA 1HQCA 3LL4A 3K0HA 3M4ZA 1RYFA 4PTLA 3IB6A 4JYBA 1IRXA 4IGFA 4TTJA 3WJAA 4PZ0A 4H35A 3ETNA 5HMMA 2WU3A 3D7NA 4DRXB 2A9FA 5I7RA 1FNBA 4OLJA 2A8YA 3LYUA 3QUQA 6REQA 2IJGX 4EKGA 1QHFA 3PA6A 4JSTA 1MA0A 2BISA 5IC4A 4D8XA 4Q37A 2GN9A 2O2ZA 3ZW7A 3NM5A 3QFCA 5K6RA 1MMFB 3VO2A 2D0OB 1SQ6A 3T4EA 4TLLB 3PQ7A 1RQ7A 4MB0A 1FU8A 5C0OE 3ZHXA 4JLAA 1KR2A 3C3BA 4HNRA 3ROTA 3EARA 5FV4A 3UTCA 4RBNA 1TFRA 2YZ7A 1P62B 1KJNA 4X0EA 5HQJA 3S2IA 4K2HA 5A4DA 2C4NA 4FDUA 3R7WB 3U44B 2OCGA 1KU0A 3C2QA 3NRBA 1BS1A 1QIEA 1KEWA 5G53C 3M6VA 3SYNA 3DAHA 2F8MA 4WKPA 2VZ9A 2JZCA 2TYSB 2GERA 4D44A 1C3OA 1OBVA 1TZ2A 4G1FA 5EMNA 3GX1A 2NV0A 1Z0SA 5EJGA 1E7QA 4QLBA 3H11B 4PC7A 5HQTA 2QYHA 1ECBA 4NXNB 3M5PA 1P7CA 2DH6A 1Z74A 4N4AA 1ZX1A 2J3HA 3DWFA 3R5KA 3HFRA 2NXJA 4HAZA 4LBVA 4AN0A 3KTDA 1N7JA 2UUAB 5I6DA 1OFGA 3DGEC 2J9FA 4WXPA 1GZSA 3MLBA 4YJFA 1CZOA 4OP2A 3OIFA 3V5NA 5BV1A 2D1RA 3UENA 4CT4B 3QEMA 3IIMA 1BC5A 3OEHD 4AB1A 1UJ5A 3MRTA 1LK5A 2FA9A 3FHJA 4FYMA 5IJZA 1SKYB 4S1WA 2IZ6A 3OPYB 2BBTA 1IEVA 4OK3A 3GYBA 4YCAA 5F2OA 3QTBA 1KC3A 3ZKWA 1FMJA 4MWDA 4GC5A 3RKRA 8GPBA 4V1CA 3BB3A 1J99A 2VAXA 2R2AA 4G0XA 4CNBA 5TQJA 4ETIA 4BMNA 4BX9A 3JYNA 5EVCA 1L4KA 2JDIA 2RG7A 3E03A 3FM9A 5F4BA 2NZWA 3WGNA 2VHZA 3PQ2A 1MOSA 2R44A 3KKQA 4H7PA 4YAKA 5HWSA 3ILYA 6ABPA 4K26A 3HCBA