1KSJA

Complex of arl2 and pde delta, crystal form 2 (semet)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
165
structure length
164
Chain Sequence
RELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/hydrolase
molecule keywords arf-like protein 2
publication title The complex of Arl2-GTP and PDE delta: from structure to function
pubmed doi rcsb
source organism Mus musculus
total genus 52
structure length 164
sequence length 165
ec nomenclature
pdb deposition date 2002-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ksjA00
1XNJA 4DDVA 4UNQA 2CE2X 5DI3A 2HF8A 3W5IA 2ZVQX 1DVRA 2RCNA 4KFSA 2JLSA 1AS3A 1XD9A 3PR1A 3T35A 1NY6A 4EKDA 2IBMA 1I4TD 1A5TA 2MMGA 3QBTA 5EE0A 4LYAA 1DOAA 5DI3B 1VTKA 3B1VA 1TADA 4L8GA 1SXJC 5FPHA 1FTNA 2GEUA 3OEED 2DHRA 1AGPA 3HU1A 2ZE7A 5J4LA 1OHHA 4JLVA 3RYTC 1HE1C 1O3YA 2JDID 4YDSA 3U3OA 3WRXC 4Q9HA 4OI1A 4EPVA 1P61B 1P75A 4FWIB 4V0NA 4GZLA 4DJTA 5AK0A 2XTNA 4WZAE 3CR8A 3ZZTA 4C2TA 1YR7A 5CITA 5E4FA 2WKPA 1ZBDA 5KDOA 2D74A 3ZDQA 1LY1A 2H57A 1HY3A 2OSBA 2WJIA 3UG7A 1KO7A 4XH9B 5JEDA 1A2KC 3L0PA 1XMJA 1EFTA 1XDBA 4HB3A 4DSTA 1KI6A 1N6OA 2QI9C 2VQSA 3VKGA 2Z4SA 2IYLD 1OFIA 2GVDC 3EIQA 4OHYA 1GRRA 3CPJB 4IW3B 5DISB 4HZIA 3UMRA 4LBZA 1DG1G 3N2IA 3QG1A 2JJ2A 1TPZA 2QPAA 3VKHA 4GP7A 1Z0IA 3L8ZA 2ZR7A 1LF5A 4HI0E 3R9IA 2CL0X 5B64A 1MKYA 2ZEJA 2ZRFA 3UKDA 1OT3A 2OO7A 1U90A 1DTSA 3QI2A 1Q20A 1XFAA 5FUYA 2A7QA 2IYXA 2P6NA 3EAQA 4OKSA 2B92A 4KYUA 2F9MA 2DFTA 3QXCA 4M22A 1JXOA 2FZLA 3K0SA 1EX6A 2C95A 3KJIA 4JVNA 4QJ4A 3SDZA 2GJAA 1AZTA 3NIBA 2IXEA 1OFTA 3VTKA 3B60A 3A58B 3TSOA 3GLIE 5GJBA 4LGMA 2F3RA 5JS7A 2BKUA 2UZ3A 4IFEA 4UJ5A 5LD2B 2P67A 1ONBA 1UDXA 2Q0HA 3BD9A 4NBSA 1ANKA 1QG2A 5DH9A 2ZJAA 2BMJA 3FGNA 2GRJA 2QGZA 3KZ1E 2H16A 5DO9A 2VP6A 2WSMA 1CR0A 2CK3D 2ZETA 3IHLA 3TNFA 2X77A 1TU3A 3SJZA 1R2QA 1NJFA 5TXGA 2NIPA 1GM5A 1CS4C 1Z0KA 4S2EA 3AVXA 1G7CA 4TZ6A 2ATVA 4G5GA 4MQBA 3VR6A 1VIAA 3K0EA 3TSWA 5KO2A 4OYHA 2FDCA 1T6NA 5KSZA 1SKQA 2DYKA 4Q1FA 4TTRA 2QMHA 1KK2A 3M1IA 2QL6A 1JEDA 3KDSE 4JYBA 2ZI7A 4E07A 1F2UB 2NPIA 3TBKA 3HU2A 3P1JA 3QKSA 2PX3A 3W3AA 2VH5R 3UG6A 3B9PA 4P3YA 1GOTA 3VFDA 5EZ6B 5JS8A 3T5GA 5KHOC 2A5DA 1FPMA 1G17A 1DO2A 4PR0A 2EVWX 2IC5A 1BOFA 4Q4AA 5JSZA 3UANA 3RVBA 2R44A 4ASUA 2ZS8A 3U7EB 4Q4AB 3JVVA 3IPXA 1CP2A 1MO3A 3QUSA 1EFHA 1I4LD 2E9SA 3B1ZA 1J8MF 2H1LA 5JSZB 5EXXA 1QRAA 4HAWA 1X6VA 2FPLA 3LRPA 2ZI5A 4AWXA 5LPNA 1AQYA 2AX4A 5J5CA 3RS5A 3PENA 4C0QC 4NYJQ 2CVFA 2HLDA 3KJGA 3TKLA 4AKGA 4ZV4A 2D2FA 5CM9C 1XTQA 4JLAA 4MYHA 1RRCA 2V54A 5H8WA 2FA9A 1T3LA 2Z5FA 1UKYA 3MWKA 4NZYA 3GJ3A 1M7BA 4RKFA 5SZJA 3KQUA 4GOXA 3IO5A 4BEJA 4MYTA 1Y63A 2XNSA 4R9UC 2VBCA 1DADA 5FOWA 2Y8EA 2VP0A 5AR1A 1QHGA 1QHHA 1RIFA 3IQWA 1CR1A 2WAYA 2AL7A 3WYFA 4BUJA 4NYJR 3FVQA 3C41J 3MSXA 4TLDA 4ZIRA 1T5LA 4A2PA 2BMFA 2R65A 3CRQA 4B44A 3Q5EA 1A7JA 3T61A 1KSGA 2CBZA 4TZ0A 4JLJA 1QHHB 2QT1A 1W0KA 3LWNA 4YXWD 3K8YA 4IKEA 4PZLA 2QSZA 3C15C 1Q22A 3KXKA 1AJEA 1Z83A 1TQ6A 2OXRA 4LJAA 4QHSA 4JIMA 3HDTA 3DPUA 3SI7A 2G3YA 1XPOA 1CIPA 1SHKA 4HLQB 4G5RA 3ZIAD 1VDZA 4DEYA 2IYTA 3I4LA 2I1VB 3A8TA 3I72A 2CCGA 3AH8A 1FNNA 3ZS9A 2GBLC 1G291 4JJZA 2QSYA 3SHWA 4LBWA 5HCNA 1XXHE 1NLFA 1HH4A 2JJ8A 2QAJA 5B57C 3C16C 5G41A 4TQAA 4LHZA 4LC1A 1KDRA 3V4RA 1GNRA 4PQFA 1ZIPA 4NTZA 1ZNXA 1ZJ6A 3OF5A 1MABA 3EIHA 4TMKA 3PUWA 2HYIC 2W0MA 3SOPA 1BMFA 2WAXA 1SKYB 2O8BA 2QN6A 3BGWA 4LI0A 3C5HA 2ZJZA 3FMIA 5DYGA 2WJYA 4QM7A 1MABB 4NPHA 1W49A 4Z8XA 1KDPA 2H92A 2QPOA 2WOJA 3QOFA 5CJ2A 1UBFA 5FOVA 4KVGA 3ZZUA 3W6PA 3THOA 2JJ1D 2J59A 2ERXA 4CVNA 1HT1E 1CJTC 2ZRBA 3LVRE 1U0LA 5SZIA 4Z1MD 2ZRAA 3CRRA 4P4SA 5JHHB 1KZGB 4PAOA 4HAYA 3QXSA 2YC4C 1NJGA 2YV5A 2RGNA 5FBLB 3SQXA 2DB3A 3GLGA 1PZNA 3CNOA 1N5KA 4P4SB 1VMAA 2OLJA 1GG2A 3KX2A 2FGKA 1VCNA 4RJLA 1ZM9A 4LV5B 1AIPA 4DEXA 5FTLA 1E2PA 3U2QA 3GEHA 4D26A 2ZE5A 3GLGB 1SVOA 2YWGA 2GJKA 3G82C 3IPYA 1WQ1R 3AQ4A 2IUTA 3ASYA 4Q48A 2ZSDA 3THWA 4R2IA 1S3SA 2ZUBA 2VSXA 3T15A 4PHFA 5TVKA 4M53A 3Q7QA 2W6JD 2PJZA 2AFIE 1WB9A 2JEOA 4CGZA 1JI0A 3THWB 1J70A 3CF0A 1ZIOA 1RYFA 1XTKA 2I3BA 5CYOA 5AJXA 1F5NA 1P2VA 4IDNA 3D3QA 4OK5A 4ZI3A 1E1RD 2IEZA 5EXPA 2JIZD 2ZRGA 2BBWA 1UKEA 2IYYA 2WICA 4NYMQ 3RS0A 1P2TA 3AKYA 3NHBA 2IHYA 2QA5A 2IS2A 2FE4A 3H2YA 2FX3A 3SJAA 1E2GA 3MJRA 1E0SA 1UFQA 1L7VC 2B21A 3WY9A 3MD0A 3AVPA 1Z0FA 5HZKA 4GFDA 2D2EA 2J0VA 3UK6A 3RDPA 3AP2A 3T1QA 5L3VA 2ZXUA 5JECA 4QJ3A 2D4HA 3QEOA 2BHRA 4IOKA 4JL8A 4PSKA 3QENA 1XEXA 4E22A 1R0YA 3ONWA 3W34A 3W5JA 3WHLA 4B74A 2HJVA 1DAEA 4Q7LA 4B47A 3EZ2A 2WJJA 4Q7MB 4DLYA 2HYDA 2F43A 1KSJA 4KU4A 3P32A 5E7MA 1T3HA 4C0JA 1EWRA 1XEXB 1DE0A 5KYKA 3PEUA 1LTQA 2BKEA 3D31A 3PEVA 1XMVA 3F0TA 4UJ3A 2MSEB 1WRBA 1YZNA 2HXSA 521PA 1QDEA 3DZDA 1DAGA 1M7GA 1XZPA 2ZREA 2C77A 2WWFA 1U9IA 3BFVA 4GOJA 2N46A 5HE8A 4IEEA 3L0OA 4QKQA 3L2OB 4C0BA 3I3SR 4JLMA 3QXJA 1CBUA 3KQHA 1NIJA 2GESA 4NH0A 4KAXA 2AWNA 2QM8A 2REBA 5BXQC 2IS6A 4DKXA 4D0LB 5FOUA 4BRWA 4DCNA 5J47A 2A78A 3O8RA 3JVUA 1RE0A 4BZQA 1VHLA 5E7IA 4WA7A 3BB4A 3C8UA 3WMEA 3K0AA 4JLDA 3UPUA 3TE6A 3HR7A 2OE2A 2O0HA 1XD8A 4BECA 1KZ7B 1A82A 1UEJA 4O0MA 5JCPA 2ZJYA 1KJZA 4LYHA 3FB4A 3K0AB 3SN6A 2JA1A 3QG5A 4XWOA 4C0SA 4DVGA 4M9ZA 4LV6A 4BFUA 2H8KA 3CKLA 3OHMA 4DXAA 1NVXQ 5KNBA 1RZ3A 1JR6A 1U2RA 3EWAA 1S8FA 2H7VA 2ZSEA 2QORA 2PEZA 3AUXA 1ZM7A 1OXTA 2YHSA 3W8RA 2WVJA 4QBHA 4RVCA 5JMTA 4MKIA 3QSYA 4JS0A 4F4JA 1ZP6A 4ZKEA 2X2FA 5FUVA 1NL3A 1UBGA 2J41A 1QZXA 2OCAA 1G6OA 4HSEA 1H65A 4YONB 2BOVA 1OHHD 2Q9AA 5JFGA 1WA5A 1W44A 2F1HA 3IEUA 4BLTA 3ADKA 3GD7A 3NH6A 1W47A 2QUZA 3PCRB 1R0ZA 1RFLA 3ECCA 2ZJ2A 5DLQC 4M1KA 1FFHA 1ZD9A 3KKMA 3BOSA 1BKDR 1OKKD 4CEJA 3DM9B 2OUKA 1DARA 3ZLJA 4IJMA 1MO4A 1Z07A 1TUIA 1OW3B 4FMBB 4JZKA 3ZQJA 2ZRIA 1G3MA 3GFOA 3EA5A 1KO4A 2CJWA 4CEJB 4CEHA 1ZM4A 1G19A 1MV5A 1G8PA 4JL6A 1KI9A 2NZ8A 2V55B 5CLQA 4JVSB 3WBJA 4NYIR 4PQYA 4MKGA 3SR0A 2RGAA 1SGWA 2JJ2D 1KIMA 2CJWB 4CEHB 3WYGA 1FZQA 4FW9A 3HPQA 1E2KA 1P6XA 1ZAKA 1E99A 1Q44A 3DVLA 4GDFA 5JJKA 4POAA 1UBCA 2SHKA 2DWOA 2PT7A 2WJGA 2CVHA 4LX0A 3F3YA 5A4JA 1FP7A 2ZS9A 1P7CA 4X8HA 4IRUB 1ZINA 1XBTA 1YR6A 4MYCA 1SXJA 2ZE6A 3RS2A 1XF9A 2OESA 2BEJA 2V9PA 4EPRA 4FMDB 1E98A 2FSGA 2XSZA 2UZIR 1E2HA 3QVUA 3TK1A 2KI5A 4V03A 1OH5A 2GXUA 1KNXA 4OJQA 2VHQA 2C98A 1W48A 1E1QA 4DLSA 4GPTA 4Q4LA 5J40A 3CR7A 1TEVA 4MUBA 4B3CA 1OJLA 2MSDB 3WNBA 1J90A 2GZDA 4TLAA 1Q57A 2RGEA 1GIAA 4HATA 4MITA 1MOZA 2AN9A 1E2JA 2AXPA 2Q21A 4FD2A 1JQJC 4K46A 5HTKA 1KAOA 3RS3A 4ZO4A 4DDWA 4QHTA 2OBMA 1XCPA 2XZPA 4IFBA 4U02A 5JWRA 4EPYA 4C4PA 5JWOA 3CWZA 2V7QA 1JPNA 4M21A 5FOTA 3EPLA 4S35A 1KI1A 3QF7A 2ZRJA 4M1OA 5L3RA 1KYIA 1JECA 4FMDF 1LW7A 2IYWA 4D0GA 3OIYA 2VHUA 4MGKR 5AUPB 3AVYA 4IOJA 1OV4A 4OHXA 3A1VA 1HT2E 3TR0A 4MGZR 2V4ZA 1IXSB 2ODBA 1FP6A 4KV9A 1WCV1 2BVNA 2J9RA 2BC9A 2GJ9A 2K5UA 1G8FA 2GXSA 1J99A 4PPFA 2LKCA 2PL3A 2PCLA 5EE3A 4C0KA 5EXTA 4DSNA 3KB2A 5JJIA 3GLFA 1D2NA 4NKRA 1XXHA 1F3OA 2Z4RA 4M8NE 4NE2A 2W2VA 3H84A 4ASUD 3I62A 1R5OA 4LJ9A 3AKDA 1SKYE 4TL6A 4HEJA 4W5WA 2VF8A 4QHYA 3TVDA 1U0JA 3TSZA 2GXQA 4CT5A 2AR7A 1VYUA 2ZQ5A 5C18A 2F3TA 2NO7A 3MAAC 1XXHB 3GJ0A 2D7DA 1P9RA 1W36C 3ICEA 2HJGA 4WVFA 1T4GA 3U60B 2OM2A 1EGAA 1ODFA 2JCSA 5CK5A 3TRFA 1VYVA 4Q1CA 5G40A 3WYAA 2HLDD 3FMPB 3I5YA 1M2OB 1CRPA 3AP1A 4Q4HA 5C46F 2JLZA 2ZUDA 4PO8A 3I92A 4W9MC 2XNDA 2QQEA 4PANA 3MUFA 1VPLA 4LJYA 1P2SA 3TMKA 5FPYA 1MT0A 5IF9A 4AI6A 1XPUA 1S2MA 2A5FA 2ZJ8A 2EFHB 2AFHE 1NN0A 4Q4HB 3U3RA 1CTQA 2ZRMA 1TQ2A 2ZYVX 2R8RA 5CDFE 4D4KA 4HDQB 2GCNA 3TUZC 1W5TA 1Z28A 3GLGE 4LK2A 1EX7A 1S0UA 2F1IA 5HKKD 5FBRB 4IVRA 5FOSA 4GSYA 3QY0A 2FPMA 4LJ8A 4URVR 2JLXA 4DB4A 1ZM2A 4RZUA 4F92B 1W0KD 1SHZA 2OFWA 2OCBA 3DEFA 1NKSA 3SBEA 2IK8A 4PXAA 1Q1EA 1HURA 2OG2A 5FTNA 4C2UA 4A36A 4LJ6A 1S9DA 2IYQA 3I8XA 4QNRA 2R6DA 5DN6A 4PSAA 2JGNA 2PJRA 2W0SA 4EPTA 3LW7A 5CYPA 1JR3A 1NY5A 2JLQA 2ODEA 4JSYA 3TUIC 2DBYA 1GKYA 4ZDJA 1VHTA 3R8FA 1NBMA 4M9XA 2OEPA 1HQCA 2J0SA 4IEIA 1YE8A 5C2JB 4F91B 2I1QA 4GL2A 3IQXA 4BRUA 3KTAA 1ZYUA 1ESNA 2H18A 1T9HA 3P4XA 1KO8A 5SZHB 1N6PA 1YRAA 4US2R 4D4JA 4TYWA 2R2AA 1CJUC 4E03A 5H68A 3OESA 3KTAB 3WP0A 3PFIA 1FTSA 2CEAA 3UMFA 4G5QA 5DSZA 5H1YA 1NRJB 2ZSBA 3MG9A 2NGRA 1K5DA 4WBSA 2QAGC 1TNDA 4MGIR 4XWAA 2ERYA 2LKDA 1BMFD 2ZYTX 2UKDA 5EP2A 3BIFA 1QF9A 6Q21A 3C5CA 1N6HA 1TF2A 5F98A 5FFMA 4HAUA 3PG5A 4HUTA 4CZ2A 5UKDA 1E9FA 3U4QA 4QJ5A 2BBOA 3DZ8A 1IY0A 2NO9A 4URYR 5CLLA 2GAOA 2PLFA 3Q85A 4IXMA 4ARZA 4B32A 1HA3A 2VIIA 4LBVA 3U4QB 2GDJA 5KTYA 2CL7X 2QT0A 4B43A 1PV4A 3CRVA 1T0JB 4B2LA 3TR5A 4Y0AA 3RRZA 1YJ5A 4M1MA 4ARZB 1NG9A 2WPDD 4DLUA 5AUQA 1IN5A 2EFCB 3TGPA 5M04A 4DDUA 1OF1A 4A0GA 4FI3C 1US8A 5L3QA 5BN5A 4BGDA 4C3ZA 1WP9A 2Q3FA 3K9HA 2GKSA 3QQ5A 3KUCA 1W2GA 3GJ7A 2XXAA 1KI6B 2GBLA 3ND9A 4KVAA 1XJQA 4CT4B 1US8B 2F1RA 1AZSC 1JBKA 5FPKA 4ACBA 2PZFA 1W7AA 4DCSA 1AKYA 2O8CA 1M6NA 3RRMA 3CRW1 3CPEA 5K8LA 2OBLA 2VTKA 1WDTA 2GZAA 3ADBA 1FX0A 4Q00A 1VG9B 2ZS7A 3E2IA 3GFPA 5KSPA 1QHSA 3RAPR 1YZTA 3TW4A 4KFUA 5K8IA 1JAHA 3B9QA 3LLUA 2QNRA 1P73A 5LB2A 1FX0B 4TYQA 1ZU5A 4ZPXA 3EARA 4RSGA 4TTQA 1KTVA 2G1JA 4Q7KA 3BJIC 2VP4A 1BYUA 3WHKA 1Z29A 3VQTA 2FF7A 5DIFA 4WW0A 1PJRA 3LX5A 4AURA 4OQLA 4A92A 1RW4A 5TY0A 2GILA 2OXCA 3LAWA 4DCTA 4BLOA 1XP8A 3U3KA 2QP9X 3B78A 4M0LA 2WKRA 1OIXA 3X1DA 4LYFA 1GL7A 2WWIA 3AGPA 2KJQA 3HJNA 4KFRA 1LNZA 2E1RA 2QROA 1O87A 5F9FA 1EG7A 4IVPA 2WWHA 4ERNA 4KFTA 1XRJA 4LDJA 3GEIA 1S1MA 1RPZA 1LS1A 2QG6A 2CHGA 3BFKA 4Q1EA 1EWQA 5LDDC 4DT1A 1W4RA 3K0CC 4A6PA 2ZSFA 4AYTA 4F4IA 1KDOA 2XGJA 1CU1A 3L0SA 2XOKD 5FBQB 1N6NA 4DT1B 2ZYWX 3QKSB 1R8QA 1W4CA 1TU4A 5KNCA 1ZC3A 1GKUB 3KQKA 4NCKA 4TQUS 2NO1A 3UATA 3B82A 4MUAA 2DWQA 1VYTA 5C4GB 3VR1A 1PLLA 3B85A 4NHOA 3K70D 3AVOA 5CM8B 2REOA 1ZU4A 2E87A 1TAGA 3KL4A 4J0QA 3FFAA 5GVSA 4A8JC 1QHXA 1SXJE 1RRFA 1SVIA 3MWJA 4CDGA 1ETUA 2ZI6A 2B8TA 2FV8A 2VLIA 1GWNA 4LBYA 2AKYA 3TVTA 4C0AC 4TMZA 4HB2A 4HZUA 3DL0A 3PXGA 2JASA 1WBDA 1JALA 3U7FB 4XOIA 1NN3A 1WXQA 2OILA 3AVTA 2X19A 3ADCA 1WE2A 4HZUB 2REXB 1W46A 5KSYA 2PT5A 2FWRA 1G41A 4A82A 721PA 4D82A 1ZD1A 3ZVLA 4HAXA 1Q3TA 5EXSA 3U44A 5DNYB 4DBLC 3CONA 4ZKDA 3ZZ0A 1OE0A 4EFNA 5AUOB 3GLHA 2CHQA 1IJEA 2BBSA 1OXUA 2W00A 4IVQA 4GMDA 3AM1A 3U44B 4K81B 1UM8A 5FR1A 2OZEA 1E9SA 1CEEA 1KO1A 1NLYA 3O8BA 4BPBA 5EP3A 2A2ZA 3B1XA 3GLHB 4QBIA 4C0HA 1Z2CA 2R6CA 4ZIRB 1LF0A 4LHYA 1X1SA 5TB5A 2ASEA 4JLOA 4A0HA 2P0EA 1XJ0A 3SNHA 1RC8A 3AVWA 1XEWX 1ZNZA 2V1UA 4U5XA 1YZGA 3RWMB 3DO6A 1NSTA 4RZ2A 5BYJA 2ZRCA 3WMFA 1N6LA 1E0JA 4LHXA 3RSLA 3VU9A 1G18A 3DMNA 3NBYC 2Q9CA 1K8RA 3LBIA 3VX4A 1MR3F 1DAHA 4B73A 3GLFE 4A15A 1UBEA 2VYFA 3OZXA 4AD8A 3UWOA 4BFSA 3LLMA 1V5WA 1H8EA 4RZXA 3EZFA 1AN0A 4TMXA 5BW8A 4RFVA 1NVUQ 2G88A 2BIFA 3R8CA 2VHJA 3AVQA 4TL9A 4C9BA 3K53A 3TW8B 1IXRC 2FZ4A 3GJ5A 2XSZD 5KDLA 3FWYA 3W6NA 4U00A 3EIEA 4WOPA 1G20E 3CX7A 4N3NA 4UXHA 5BN4A 1E1QD 2AXNA 3TUJC 2W2TA 1VCOA 4KITB 2QM7A 1DS6A 1KKLA 2O8EA 3S1AA 4V0MA 2O8BB 2FNAA 3ZQ6A 1KY3A 5FPSA 4MH0R 1W4AA 1R5NA 4G0NA 2O8DA 5CJPA 2YWHA 3AF2A 1FOEB 2OAQ1 1P9NA 2Z0MA 3L82B 3VR4A 4AKHA 1G3QA 2NMVA 4BASA 2O8EB 1Z0JA 4JBYA 1E2DA 3V00A 4C0LA 5CDFA 1X8KA 1E2IA 1NN1A 2W2XA 121PA 4B3XA 4UNNA 4B6FA 1XTRA 4V0OA 3LQRA 4C7OA 1GDDA 2O8DB 1N6KA 2HXYA 2QTFA 3ZYCA 4JBXA 4HLUC 4Q7JB 2V7QD 1KOFA 4MRNA 2EFDB 2VPPA 4IDPA 1AA9A 4W5JA 3T34A 2O5VA 2GK6A 3AF3A 4I1UA 2IL1A 3QBVA 1SVWA 4C7OB 4OK3A 1J7KA 3ICQB 2QEQA 1QHIA 3BORA 2IXFA 3OE7A 4B33A 4P33A 1ZUIA 3R9WA 1OH8A 5IDVA 3EPJA 5JI2E 1JR3E 2YOHA 1AS2A 3I61A 1IN4A 1QBKC 3QJYA 1NBME 3K1JA 3RS7A 4M1YA 3U7GA 4C30A 1HYQA 2WMOB 1X1RA 2KBEA 4UNPA 1UEIA 2X1VA 2VEDA 2LWIA 3FMOB 3KUDA 4DRZA 4QNMA 2O52A 3SJCA 3AB3A 3IBYA 4Y0VA 3F8TA 2F9LA 2YOGA 2W58A 4IDHA 1DBSA 3QKTA 2F55A 2RMKA 4JKYA 3PUVA 2OHFA 1TQDA 1X8LA 3EWSA 3GEEA 1E9RA 4IDOA 2IYZA 3EASA 2FEOA 1T8TA 4D81A 1U99A 4E5UA 3LXRA 5BQ5A 2ZR0A 4UQOA 1S9HA 3ETLA 1Z6GA 3CBQA 2ZVPX 1IY1A 3X1ZA 1G16A 2CLSA 4B35A 4E09A 4ZDIA 3BK7A 3AF0A 3LH5A 1T3SA 4RFSA 5JBQA 4NYMR 4F7WA 2GAAA 1RJ9A 2XNDD 3NEYA 1QHYA 5DGXA 3KJEA 4N1AA 1FW6A 2G77B 2HCJB 4RY2A 3NDPA 4DLRA 4XWKA 2PZEA 3IIJA 2GCOA 3CRMA 2OCYC 4RD4A 4RFSB 1J2JA 2V1XA 4Q1DA 3OIVA 5JHGB 3Q72A 1IM2A 1NKTA 2VL7A 2AD1A 1Z47A 2CMKA 1EK0A 4MDEA 4GNKA 4DSOA 2R6FA 3BB3A 3X1YA 1G7SA 3FOZA 1OB5A 2F43B 2GCOB 1Z06A 5GADl 1GP2A 3IHWA 4ITRC 3U3MA 4I1OA 4TSFD 1Q1QA 4DDTA 3IO3A 1FQKA 4L9SA 4BE7B 4B3GA 3VR5A 4FMCB 3CH4B 2KBFA 3Q8XB 3DM5A 4N0DA 2IXGA 3VHXA 4EPWA 1XTSA 1ZCAA 1OPXA 4N0EA 2FFBA 1JR3D 4M1TA 3W3ZB 1NBMD 2D62A 3DKVA 5JLJA 2VHTA 3LXXA 2DY1A 3QPUA 2QMEA 1NVVQ 1R8SA 2WWYA 2DFLA 1PLJA 2J5XA 1NSFA 4B2PA 5IRCD 3KQLA 5G53C 1ZCBA 3HPRA 4I1VA 3OFNA 2CXXA 3EA0A 1XPRA 1U0HC 2J7KA 1W36B 2IF0A 1Z6YA 1YRBA 3FTQA 1YHNA 4BZXA 2CDNA 3AF1A 3X2SA 4M9SA 1W0JA 1YZKA 3KKOA 1GNPA 4FN5A 4RKEA 4GP6A 1VKJA 4LPKA 1HV8A 3D6TB 3QVVA 4FMCF 4MRSA 1E94E 2RHMA 4JVMA 2PZGA 4TTPA 3TJZA 4EJSA 1NVVR 2Z83A 5BWMA 1NF3A 3LX8A 2W6IA 5IHPA 4V0LA 4Q5IA 1C9KA 3PITA 4ZCIA 1TF5A 3FYHA 1KHTA 3FE2A 1CJMA 3NC1C 4OQNA 4EJSB 4KSCA 1OIWA 3VNVA 3QE0A 2PLRA 1G64A 3ND8A 4FXPA 3C4JA 1ZUNB 3OEHA 1H8HA 3CWQA 1SQ5A 2WSSA 3PUXA 1TUEA 3MFYA 2WWXA 1L2TA 1NI3A 2FGJA 4Q4JA 4URUR 3WBKA 1HQYE 3FKSA 2WV9A 3QNUA 4NMMA 2ATXA 2VHCA 1C1YA 3BH7A 1OLOA 4Q66C 4HAVA 1Z8FA 3GJXC 4R98A 3ZJYA 1G1MA 4Q4JB 2XZLA 4DUGA 3SE0A 2WJVA 4UKDA 1KSFX 3CPHA 3PV0A 3GMTA 2GHIA 1KJYA 1R10A 1U8YA 2OBNA 2P5SA 2QE7A 4YQFA 4G01B 5CK4A 1LS6A 2ZR9A 3CLVA 2CCJA 2ZI9A 4GMXA 4KCGA 4JL5A 4QRHA 1F2TA 2V8OA 1KY2A 4G5OA 3LBHA 4DHEA 5IT5A 3X1WA 3P26A 4L9WA 2A9KA 3EPHA 2NO6A 5SZKB 1DG3A 3GJ8A 4PQRA 3UIEA 3CM0A 1GL9B 2FFQA 2QAGA 1F2TB 1N25A 3QIAA 5A0FA 1NMZA 2YJTD 4EFLA 3B13B 4QOSA 3QXXA 5F2EA 1BIFA 1DO0A 3T12A 3REFA 1VCIA 5FBVB 2QAGB 1G7RA 3ZGXA 5J4YA 1SXJB 2VSOA 4IHQA 3M6AA 5DHFA 4CIDA 3E70C 3EZ6A 3KXIA 4YMSA 2F6RA 2C2HA 2CNWA 2ZSAA 3CNLA 4FCWA 2QENA 4OHWA 5B58C 1G5PA 3P4YA 4QBGB 2GVZC 2FSFA 4TYPA 4GRAA 4KHZA 2WIBA 2J7PA 2ZM5A 2V6IA 2OAP1 1IN7A 4G1UC 4HDCA 2H5EA 3EPKA 4DWJA 1P72A 2D3WA 1T91A 3HU3A 1E3MA 3CIOA 3LA6A 3GLHE 5EE5B 2BCJQ 4B3DA 4MA4A 5C4MA 4AK9A 4I1SA 3PEYA 3ZVRA 3IIKA 4P4UA 4DCVA 2WKQA 4DIEA 3E1SA 1G8HA 4QFMA 1D9ZA 1U8ZA 3NG1A 2FOLA 5TDHA 3TQFA 1RVDA 2QMOA 4I99A 3THXA 4TYNA 3P20A 4IDQA 3U6KA 3R7WA 1T5IA 3K9NA 3MJHA 3RSOA 1TTTA 1OFHA 2QRZA 3T1OA 4ZCMA 1CLUA 3C7KA 4MRRA 4OQFA 3KKNA 3TAUA 1SVKA 2RGBA 3K9GA 1IONA 4LY6A 3R7WB 1YR8A 5F9HA 1E2MA 3FHOA 4XSGA 2X2EA 2ZTSA 1RRGA 3KFXA 4TN1A 4XD7A 3RC8A 3NVAA 4D80A 1HUQA 2I4IA 2IYVA 4FWTA 4LCBA 1GSIA 2QTHA 1MH1A 3W9YA 621PA 2NZJA 4Q47A 5TARA 2ZRHA 2P5TB 2C96A 4BFYA 4UXIA 5FTKA 1OIVA 1CXZA 1RYHA 2G6BA 2IA5A 3K09C 5D3MA 1C4OA 2O0JA 3GLFB 1UF9A 2MSCB 2YWEA 2R6AA 5G3YA 1UAAA 2AWOA 4JT4A 2O0KA 4QGFA 1S3GA 4DLZA 5D3MB 1A4RA 4B71A 1KMHA 3KJHA 1G5RA 2WWGA 4V0ME 3NWJA 2Q3HA 1IXZA 4B6EA 2V6JA 2OLKA 1E96A 1U81A 4QGAA 3NDBB 2OFOA 5EP1A 5KPJA 2QP3A 1KMHB 5FL3A 1PVOA 2C8VA 4XVQA 5GJWC 1P62B 2HT1A 3K0CA 4H1VA 4HB0A 2GTPA 1E79A 1UKVY 1EFUA 4GT1A 3B6EA 421PA 1NG1A 4PC7A 2BEKA 4OQXA 5L3SA 1KI2A 1Q1BA 2B6HA 3QPVA 4BFXA 2AK3A 4LRWA 1OFUX 2GEDA 1OYWA 4QGGA 3T1VA 5LB4A 1R7RA 1JAIA 3KKPA 4YC7A 2BMEA 4QXAA 2WOOA 2IWRA 3ZS8A 4W5HA 4ZDKA 4KYIB 3ZVMA 2OV2A 1XWIA 1D2EA 3BAFA 1XEWY 3VHLB 2BM0A 3BS4A 3CF6R 3U61B 2DCUA 4PC6A 5HE9A 1LVGA 1ZW6A 1Z0AA 2JLRA 3BRWD 2PX0A 3BB1A 3CO5A 3UXMA 3SZRA 1GUAA 3SYNA 2F1JA 4TMTA 4OJKA 4A8JA 2XB2A 1R6BX 4ABYA 3SFZA 5JI3E 2IX3A 4D6PA 1XEFA 2DWPA 5JRZA 2ODNA 5DI9A 4CF7A 1E2NA 2FG5A 2QP4A 3RNLA 4B2IA 4FCTA 1N0VC 3EXAA 3VKWA 1H8ED 4A8JB 1GTVA 1BO6A 1I2MA 3NH9A 1A1VA 3LVQE 4X8OA 4TQ9A 4YMWA 2CLCX 2P6RA 4JT2A 5JCZA 3A36A 4M4SA 1W4BA 4B75A 4ESVA 3LBNA 1N0WA 4EIWA 1OB2A 2QQ0A 3EC2A 4F4CA 2FJUA 1TQ4A 5GVRA 2P3SA 2TMKA 4PAMA 4D4MA 2XJ9A 3NC0C 1VG8A 3BBPA 3QKRA 1EFCA 4M1SA 1KI8A 1A2BA 1OXSC 2ZRPA 4B34A 1D6JA 3PUZA 1S96A 2FFAA 2HEIA 1W1WA 1T0HB 2ZROA 2G0TA 4URWR 1YR9A 3HP1A 2XZOA 1AS0A 3EZ9A 2A30A 3I73A 3EX7C 3QKRB 2A5JA 3RHFA 5C1BA 1IY2A 2VP9A 3QEJA 3OIUA 3AEZA 4YMTA 1G9XA 3T06B 5FBWB 3MWLA 2EQBA 2GF9A 1XCMA 2VP2A 5IK2A 3TH5A 2FN4A 4US1R 1KK1A 2P2LA 3I1FA 2ZAMA 3OAAA 4KI0A 4MRPA 2OCPA 4PHGA 4WIAA 2VSFA 3GJ4A 3OE7D 1JQLB 1K5GA 1E0AA 2QZ4A 3EG5A 4CW7A 1AM4D 4K8OA 5L3QB 3THYA 1BS1A 1WBBA 5AJWA 1E9EA 5JRJA 1OKKA 1D2MA 4MKFA 2QPTA 3UWKA 2XXAB 1CRQA 4KLNA 3SQWA 2EW1A 2G1KA 3HYRA 1OXVA 3THYB 1W2HA 3IKJA 4LV8B 4DB2A 3WXMA 5J4KA 4NCJA 2O8CB 2EU8A 4QG7A 2RGDA 1VG1A 4P32A 1G8YA 3LQQA 3A1SA 4LWZA 5AUNB 1G6HA 1FMJA 4LHVA 2J45A 1EESA 2DR3A 3NXSA 4G5SA 2G83A 3N2EA 821PA 4OI0A 4PPGA 3HWSA 3VR2A 1DPFA 2A5YB 1B23P 3H86A 2HUPA 1LV7A 2WJHA 4TT3A 3U3JA 3CF2A 3IUYA 1CJVC 5EE9A 2KSQA 1KMQA 3BXZA 3RWOA 1CULC 5DHAA 4NU0A 1RRPA 1SZPA 2IUUA 3RS4A 4CYMA 2GETA 4WZBE 4XVUA 5CIWA 4LZZA 2BWJA 2L0XA 1MRSA 3SYLA 1GRNA 3EZ7A 4EDHA 3GP8A 4HLUA 3DOEA 1UJ2A 5KPDA 4Q9JA 1XMSA 3A1TA 2PH1A 4JBWA 4AYWA 1P60A 4BWYA 2RHDA 2IHBA 4ZDWA 1OH7A 1GILA 3P27A 1B0UA 1PUJA 1TX4B 3SU8A 2QTVB 4EQ6A 4D0NA 1JB1A 2R62A 4MRVA 8OHMA 4L4UA 2VO1A 2N1BA 3Q5DA 2YC2C 1GAJA 1VG0B 3RRYA 1XCGB 5FI0B 5HR5A 3CX6A 3AKCA 3PUYA 4DZZA 2EYUA 5FTJA 1Z63A 2GZHA 4EQ6B 3TIFA 1EFRA 4ON9A 1F2UA 1N6IA 2FSIA 3CZQA 3VR3A 2FH5B 1XB2A 1BYIA 2NG1A 3D8BA 3R20A 2WBLC 1BH2A 3DDCA 4HB4A 2BBTA 2C99A 4HLCA 3WNDA 5EUQB 2AHOA 1Q1ZA 1K6MA 4Q1BA 1P3JA 3RLFA 1E9DA 2HDNB 5L8VA 2GF0A 3N70A 3SJBA 1W36D 4AY2A 2B7BA 2Q9BA 2RKOA 2IUSA 4A1FA 5HCIA 4OHZA 5KU1A 4ILEA 1ZUHA 2A3RA 4KJZA 3OFND 5CB6A 4XTRA 2F7SA 4TL7A 3H4MA 3EC1A 4JYCA 1W0JD 3KKQA 4LHWA 1ZMXA 2VRWA 4NCHA 5JJLA 2XEXA 5FUWA 5JWHA 4PZYA 3DMDA 5ELXA 4B76A 4DLTA 1I4DD 1ZVQA 4WXPA 3WMGA 3O8CA 1E2QA 2W6ID 3QPWA 1JXMA 4PPNA 1GITA 5KUTA 2IW3A 1VIYA 1PLKA 1Z22A 3O47A 1KI7A 3SC3A 5EQTA 2GA8A 4AKIA 2KWIA 1XU4A 2OT3B 3F5FA 3QXHA 5EJEA 4D25A 3OEHD 1H8HD 4BLSA 2WSSD 3UMSA 3R9XA 1IAQA 1XD2A 4LPSA 2ZAOA 2WTUA 2CLDX 1P5ZB 4DLWA 4LUCA 4KODA 4XTCS 3NBFA 2J46A 1E2LA 2CL6X 1E0KA 2ZRDA 3FKSD 4Q21A 4QC2A 1FQJA 4ZCLA 1XD2B 4R7ZA 4RD1A 1KDTA 1CR4A 1N0UA 1FL9A 3AVUA 2Q3MA 5B2ZA 2EFEB 3L0IB 4DUGD 4PO9A 1QVAA 2YINC 5AJYA 1VECA 5KNDA 3CB4A 5JEEA 1D8TA 2FFHA 4HAZA 3AP3A 3NBXX 1ZC4A 4HLDA 1COWA 2QE7D 5HKKA 3VMFA 2BM1A 4B3BA 4DSUA 4QL3A 2WWWA 3M0EA 2ANCA 4H1UA 4AIIA 4JLNA 4P0TA 2CHVA 2HV8A 3VU9B 1OXXK 4HYYA 4OL0A 2R9VA 4FCVA 3A1UA 3PIRA 2ZPTX 5CB8A 3QF4A 3TQCA 4DLVA 1SXJD 3GCGA 3MRSA 2RH5A 1SVLA 2C03A 2IT1A 1Z08A 2IYUA 3GJ6A 4NONA 1ZNWA 3SEAA 1KI4A 3QF4B 4OHVA 4KXFB 3CZPA 4Q01A 3SS8A 3WP1B 4BLQA 4WAUA 5FL7A 4V02A 2GK7A 3BERA 2CNWD 2ZI3A 1S1CA 5E3HA 4OI2A 2RB4A 2ZANA 2QY9A 1NIPA 2J7PD 5KOYA 4RCYA 2ORVA 1NMXA 4ZI2A 3PQCA 2DFNA 1ZRHA 4Q03A 2C9YA 1Z6AA 2LCFA 1Y3AA 3S1AB 2VP5A 2EFGA 1YZUA 4M1WA 2BMDA 1DAFA 4Q19A 2D06A 3BWDD 3OEEA 1U8AA 4W7SA 2ZUCA 2QBYA 2GWHA 4FINA 5LD2C 2JDIA 5AJVB 1XMIA 1E6CA 4YDHB 5FUXA 1G8GA 2OFXA 4LSGA 5ANRB 5TV2A 1N5JA 5HPYB 3U5ZB 3AVVA 2A5GA 3BC1A 1N6RA 1II0A 2QBYB 1IN8A 1LB1B 2ONKA 3A37A 4YMVA 3B7GA 1IJFA 2UVQA 1XTIA 2YZ2A 1SVSA 2J3EA 1YVDA 1X8JA 4L15A 2G9NA 3FPAA 4AC9A 3SFVA 2WPDA 5FI1B 1YKSA 4XVRA 3A4NA 2PEYA 3MCAA 2XTMA 2GEVA 2PMDA 4BFWA 4BFVA 2EYQA 1YQTA 4LOAA 1KJWA 3FKQA 4XD7D 2JAQA 4D4LA 4M2LA 1EXMA 4PHTA 1TEXA 5F3WB 3IGFA 1J8YF 2J0QA 2J0UA 4TWZA 3Q9LA 2GNOA 4XSHA 3VNUA 2ZITA 1JEEA 3RRNA 1Q12A 3I8SA 1RKBA 4II7A 2ZIAA 2XJ4A 1DELA 4O25A 2J0UB 4P31A 4A4DA 4EFMA 4G3XA 3KQNA 1CJKC 2GJ8A 2IWHA 1AQUA 4IXNA 1KK0A 4U7DA 3NHAA 1DAIA 1KKMA 5TMPA 4RD0A 3BE4A 3FMFA 3CW2A 4RCZA 1S4QA 3A6PC 4X8LA 2C78A 3MLEA 4URZR 3SBDA 4PSVA 5K8TA 1U94A 1E69A 5J4HA 1MRNA 1CKEA 3LO5A 3REGA 4PO1A 1TF7A 5E95A 5HZHA 1AGRA 1IQPA 1RJ9B 1GL6A 1GVNB 1QVRA 1KI3A 2FMXA 1IHUA 3LY5A 1E79D 4PTLA 3KFVA 2FU5C 2MMCA 2O8FA 1GZSA 1Q21A 3L43A 1E2FA 2BJVA 2X8AA 1G4UR 1GNQA 2CK3A 5LBIA 4BZPA 3IDQA 2ANBA 2V3CC 4RD3A 1NN5A 1NVWQ 1NP6A 2O8FB 4DIDA 1DEKA 1P9WA 5BYKA 1X3SA 2ZRKA 5DN6D 4LC0A 4IOLA 3ZH9B 2NOAA 4PFSA 2RGXA 5FR2A 3K70B 2C9CA 2ZYUX 1E4VA 2NPFA 4O2LA 3EW9A 3MGCA 4AYXA 3FHTA 1L8QA 1NMYA 1G21E 3LNCA 4O3MA 4I81A 4MYUA 4Q9IA 3IEVA 1V43A 3Q3JB 3K09A 2JLVA 5G3ZA 2XOKA 3LFUA 4JVLA 2R6GA 3BH6A 2BJWA 4A2WA 2YWFA 1JPJA 1KAGA 4JLBA 2CCKA 4DCUA 2DPXA 2XB4A 2ZU6A 4TLBA 2QRNA 1R5BA 1F48A 4L16A 1E32A 2VA8A 4JMPA 2PCJA 3E5HA 3U6BA 4GOKA 3LDAA 5JZVA 2XITA 1YZLA 1X86B 3BH0A 4P4TA 1Z3IX 2ZE8A 4A9AA 1ELOA 1SVMA 2ZJBA 2H17A 1FUKA 1N5LA 2B7CA 4OK6A 5P21A 1L4UA 1CF4A 4FIDA 1TMKA 4NDZA 1JNYA 1L4YA 5CIQA 4XJXA 4EUNA 2JLUA 4Q18A 2HT6A 2XTZA 3M4YA 3HR8A 1TL7C 4BLPA 2D7CA 2WM9B 4GBMA 4F38A 4BFZA 2FSHA 2NQ2C 4NCNA 3GLIA 1F60A 4TLEA 2YNMA 1NNEA 3AV0B 4MKHA 5E7JA 3G0HA 1XJCA 4HDOB 5B30A 3DOFA 221PA 4CRWB 3CH5A 1G7TA 1JJVA 5BN3A 1UADA 1Z2AA 3B1YA 1W5SA 5GJCA 3B8HA 5IK2D 4MDFA 1QG4A 2IS4A 3GLIB 4A0FA 4B48A 3GQBA 1Z0DA 2DFKB 4URXR 2EWWA 3PJRA 1Q3HA 3OAAD 1OSNA 3IILA 2ZRNA 1U98A 1ZM3A 3H0KA 2P65A 3RABA 4NYIQ 2HF9A 1VCMA 4Z8YA 3O8DA 2J1LA 4Q9LA 5H70A 1DAKA 1XZQA 3PVSA 3Q7PA 4OQMA 4AKEA 2ODWA 4PC1A 4US0R 3ZVNA 1JJ7A 3RANA 4YXWA 4LYJA 2WZQA 1R0XA 2RGNC 4KSBA 2WMNB 2NTYC 4IOMA 3TLXA 5EP4A 1M74A 1E4YA 4A6XA 4X8MA 2ORIA 2HCBA 1HTWA 4NL4H 3KXLA 2BDTA 1M7HA 3CX8A 3FDIA 3ZIAA 1AK2A 3H1TA 2EWVA 4UNSA 4EPXA 2JATA 4QM6A 2KB0A 1M8PA 4LJ4A 3AUYA 4BLRA 4DLXA 1MO5A 2IYSA 4TT3D 1E9BA 4TL8A 2JLWA 1R4AA 2ZJOA 3K9LA 1UDWA 1AKEA 4F93B 3AF4A 3A4MA 1M34E 2PBRA 2G0NA 4XIGS 4UXJA 4A2QA 4Z54A 4B3FX 3J81k 3DKPA 1N3BA 3CNNA 3T1TA 2W83A 2BV3A 4MGYR 1KO5A 2Q6TA 2JLYA 1I2DA 4RZ3A 4BQSA 4BFTA 2B8WA 4TYYA 2CE7A 3GPLA 1XTJA 4H9GA 4R71A 3B2EA 3BFXA 1Z6XA 3WRYC 2JJ1A 4PC3A 3ADDA 1DAMA 1E9CA 4KBFA 4Z1MA 1WMSA 1FUUA 1Q0UA 3QKUA 3RC3A 4PHHA 1ZNYA 2BCGY 2J87A 1HEIA 1SULA 5FOXA 1T8UA 2GXAA 3A1WA 2P6UA 2PMKA 1QHNA 5AJZA 1N2CE 3IIMA 3THXB 2RGGA 1EFRD 1WF3A 4Q1AA 3IBGA 4Q9KA 2GCPA 5EE1A 4TMVA 1G4AE 1XX6A 5D3QA 2IF2A 1LFDB 2XAUA 2ONJA 4KLZA 5A5GA 1G5TA 1IBRA 3DHWC 3NBZC 4D2IA 2IS1A 3ZD7A 4AG6A 5FPTA 1KK3A 2RGCA 2QGNA 3MWYW 3SHFA 4BEBA 4PPQA 3ZD6A 2YKGA 4PAQA 3CUEF 4KBGA 4HUQA 5GJVC 2WIAA 3PEWA 3K0FA 3T5DA 4ACAA 2YYZA 3X1XA 1U9IC 2GJSA 2ZJ5A 4GI7A 2QU8A 4NCIA 2FEMA 4UNRA 4HUQB 1M1YE 4EAQA 2W6JA 1G3IA 1KSHA 3TAHA 3K0FB 3AGQA 3W6OA 1IOZA 3FFBA 3FHCB 5DE3A 4ESHA 1UPTA 4KO8A 3KB1A 1MO6A 4LJ7A 2ORWA 1E1RA 2JIZA 5DYIA 3SYKA 3L8YA 1G3RA 5EUMA 4CEIA 4RD2A 1KGDA 1PUIA 3K70C 3MMPA 5KSOA 1Z5ZA 2ZU0C 4R2HA 1GFIA 2KE5A 4I4LA 3I5XA 1N5IA 1OH6A 4WXRA 2Z43A 4JSTA 1E2EA 5AWFC 2FPKA 2AKAB 4CEIB 3NTUA 4Q02A 4YMUA 5K8UA 3W8NA 2IEYA 3V4FA 2XX3A 4OI4A 3V9PA 2C04A 4YLGA 2IYRA 3I32A 1YZQA 4DC9A 3GFTA 1D9XA 4PZZA 1P4SA 2QMUA 3B1WA 4LJ5A 4QBFA 5FTMA 1IN6A 1ESMA 1KNQA 4QGHA 1GKIA 3LW8A 3N5CA 4V0KA 3HYTA 1R0WA 2YOFA 1G3UA 4JLPA 4L5BA 4O2RA 3LV8A 4EJSC 5L3SB 2YVUA 3B5JA 4OBEA 3W90A 3AKEA 4PX9A 3ASZA 4JJKA 4TMWA 1OYYA 2ZRLA 1II8A 2NO0A 2RAPA 2Z6VA 2ECKA 3NEJA 1COWD 3VAAA 5EZ5A 1ZD8A 4JLKA 1YU9A 4NP6A 2C5LA 4M9QA 3OIWA 1FNMA 4TLCA 1II8B 4TSFA 4JKIA 3U7HB 3A4LA 1CR2A 1FMLA 1F6BA 2WHXA 1NLZA 2VF7A 3VX3A 1II9A 3JZMA 1GRQA 2ZI4A 3NKVA 3D7MA 1P2UA 2N42A 4A0RA 5J4VA 3LD9A 2C9OA 4RD6A 2AD5A 1UKZA 1Z6TA 3C14C 4GZMA 4PC2A 5FH9A 4AG5A 1HE8B 3G5UA 3WNCA 4WZ6A 1E9AA 4Z51A 5KDDA 5FL7D 1D5CA 2AK2A 3JZAA
chains in the Genus database with same CATH superfamily
3ZWVA 4CKBB 1KE1A 4CIAA 2GRAA 4Q3DA 3PX3A 1E3IA 3CXUA 3W5IA 4PRKA 5CBKA 1X9GA 4CMHA 4KFSA 4XCVA 2CKMA 2GPTA 3OUZA 3MCWA 3RR2A 1HC7A 1NY6A 2EC5A 2HBZA 3FF1A 3NP7A 1Q77A 2HK9A 3L04A 4YEDA 2IBMA 1I4TD 5E9WA 1D2HA 2E37A 3Q2IA 3QBTA 2UXDB 2YJGA 2G04A 2ZVDA 4LYAA 1A71A 1DOAA 1N1DA 1JG3A 3ZGOA 4DV3B 2XIQA 4CV0A 5EVJA 1XT6A 3DP9A 4FOPA 5JV5A 4HNTA 1H0RA 1P1RA 3JWPA 5KYVA 1A1SA 1OHHA 4M6WA 4JLVA 3G9TA 4FIZA 4B3HA 1NLUA 4FGWA 3V2GA 4ZU6X 5CA0A 5L6MB 1DSSG 5JFOA 1TW3A 4UAGA 1VYHA 1GPKA 3A25A 3ZZTA 1UP6A 1TU0A 4M6WB 4BX9A 2B3DA 2J3MA 1ZBDA 4OL9A 1TKCA 3AETA 1BD3A 1HY3A 2AUTA 2OSBA 4ZTUB 1LSSA 3DL4A 2XR1A 3OA2A 4DR4B 4UU1A 1A2KC 4HZGA 1ODTC 1TA0A 3WFIA 1LJ8A 4HB3A 4PONA 5J2TA 1ZOLA 3AETB 2QI9C 2UYGA 2VQSA 5DW0A 2IOHA 2VAMA 2Z4SA 5H82A 3JQDA 1UH5A 1O0CA 1BGWA 3TLJA 3OM9A 2KX7A 4IH1A 1SC3A 1JFSA 1SQSA 4IQ8A 1F2VA 3UAVA 1FYDA 3OLXA 3MK31 3P97A 2YYYA 5EIHA 1GGMA 2WYOA 5J2TB 4YRDA 4WH0A 1DG1G 3G5AA 4F04A 1T4CA 4MR9A 1UJ5A 3NIFB 3L8ZA 1SOUA 3QFFA 4Y6OA 1PR1A 1LF5A 1ZHOA 2VJLA 4IIVA 2D7DA 2CL5A 2HIMA 2H59A 1MKYA 1T4CB 4MR9B 1P1KA 4COOA 4ANFA 1JSLA 4OLAA 4XWWA 1YAJA 5FUYA 5CLJA 2IYXA 2DT5A 3E18A 1U3DA 3LQFA 1QFMA 5B37A 5BR4A 2JCVA 5KWEA 2SKDA 2HIHA 5L53A 1NT4A 2AMJA 2JGRA 1ISGA 1OLXA 4LNHA 1DKOA 3MAGA 1EX6A 4JVNA 3SDZA 3VTKA 1E7YA 3AR4A 3VNBA 4OMCA 1CDEA 3H6GA 1WDKA 5AKIA 3OZCA 3RVKA 5FP0A 2F3RA 3AILA 5JS7A 1U9YA 1BG6A 2OQ2A 4IFEA 3V4LA 1OLXB 5LD2B 1VB5A 1NXVA 4N18A 1P17A 2Q0HA 5DH9A 4L57A 2ZJAA 2ISSD 3HCWA 2F67A 4GDMA 4V1CI 1K8XB 5AHKA 2WSLA 5MFPA 5DO9A 5AOVA 1YONA 1MN6A 1LPNA 1V2HE 2I2WA 3SX2A 1XQXA 3TNFA 2Y0CA 3P19A 1N3LA 2X77A 1POWA 2ZSHA 2I4NA 5KKAA 1JWLA 4MZXA 2VT2A 1GM5A 2C4NA 2WC1A 1Z0KA 4S2EA 5BO5A 3LBYA 1RBYA 1D2AA 2YICA 1UM9A 4KAAA 4MQ5A 3VR6A 2IITA 3KDAA 5KO2A 4ZT6A 1KPIA 1XDWA 1VKRA 3H05A 4YJGA 4OYHA 1JJAA 4NG5A 4QQ8A 1CUFA 3O03A 3QX9A 1DZIA 5CG1A 3WQQA 1MQ9A 4RV4A 3ANTA 1JEDA 4JYBA 1UM9B 4E07A 1EDEA 1F2UB 3WDKA 4YJGB 1PR6A 3TBKA 2YV4A 1GN9A 1E60A 2X0JA 3P1JA 4X64B 1SG6A 3FSJX 4RUKA 4BMOB 1DJMA 1CFZA 2E82A 3W3AA 1BS2A 1FBTA 2PV7A 3LQ4A 5LZ8A 3REOA 1P77A 1PJSA 3ROEA 4P54A 3UT6A 1JU4A 2P9JA 3KUXA 4P3YA 4YIKA 4ZU3A 5B7NA 1EK6A 3Q11A 1H5UA 3VFDA 5FHRA 3UOWA 2IHZA 1WTAA 4TYMA 2A5DA 1G5QA 4H7PA 5CIYA 3BIOA 4PR0A 2EVWX 1V8OA 2COKA 2IC5A 3SM9A 2ZWOA 1ISRA 3PIIA 1JHYA 1V45E 4OFXA 2R8ZA 3RVBA 4K9SA 2R44A 1T5DX 4GNRA 3UEOA 1HE3A 2RGWA 2X5JO 4BLVA 2CSUA 1FFWA 3N8DA 5A0TA 3QUSA 2ACWA 1EFHA 3N8NA 4E5SA 4OX9B 2ZBRA 3LMKA 4HAWA 5EWMA 2WIDA 1JG4A 2CGEA 4YLEA 3KVYA 1W5AA 3GUCA 5CCEA 2ZI5A 1QH1A 1XC7A 1BA3A 3O7MA 3RS5A 2QGFA 4C0QC 4NYJQ 1T1SA 2ZPAA 1G4HA 4ZV4A 1RRCA 3NTLA 2Q8QA 4R9NA 5EWMB 3IKTA 1G2OA 1KEPA 3NQ41 1RZUA 3NOQA 3WLMA 1G9SA 4L5YA 1UKYA 1IWBB 3MWKA 2AZXA 1EX1A 2XUGA 4RKFA 5SZJA 3CE9A 2JGIA 5AESA 2WUGA 4GOXA 1FTYA 3T7SA 3TTUA 4WADA 1T29A 4G36A 1ORDA 4N54A 4D8TA 2K2QB 1KMCA 2EQAA 2GM5A 4TS1A 5K3EA 3T52A 5C52B 2HFKA 1DRVA 4UVDA 4NYJR 1IPFA 3DHYA 3HCEA 4MKRA 4TLDA 1AO3A 3X1KA 4A2PA 1FX1A 5H4HA 5JQGA 3CRQA 3MCUA 4HGPA 4BO7A 1B4DA 1KSGA 3T61A 4UFPA 1PQYA 3OLWA 3RJMA 2HLNA 2QT1A 1W0KA 2O20A 3LWNA 4YXWD 2DY0A 4IKEA 5AI6A 3AEQA 4PZLA 1KS2A 4TS3A 5JQGB 1O94A 4OQYA 3HJAA 1USGA 2P79A 2RB5A 1NNEA 2ONCA 3CRZA 3SI7A 2R4QA 1BHQ1 1L0BA 1SHKA 3ADPA 3AEQB 3D0OA 4G5RA 1GPWB 1JN0A 4HLQB 5HKAA 3BA6A 3I4LA 3ZDBA 3P0FA 1ZN7A 4J16A 2CCGA 2O06A 5HA5A 3TXYA 4O2BF 5ICEA 2YUTA 1ZGCA 3L7AA 5F78A 3F5DA 2IU0A 2OORA 4NMWA 3LC1O 3L02A 5FUMA 4JBNA 5IBRA 1B7GO 2GN0A 2M98A 2DX7A 1DKLA 1NLFA 1HH4A 2JJ8A 2IVFA 2WM2A 3A1FA 5B57C 3KQWA 2AOWA 4LHZA 3JD0A 3K2EA 3V4RA 1GNRA 1AZLA 1ZIPA 4NTZA 1ZNXA 4OAPA 5BUQA 3OF5A 4R1MA 4Z99A 4AS3A 2J3HA 3HU5A 3SEZA 1T9ZA 1BMFA 2WAXA 2Z3WA 3BXXA 1PJ2A 2QN6A 4LS3A 4CMIA 2CVZA 1JYEA 3ZJUA 5HKLA 3DZHA 2WJYA 4LWPA 2X40A 1RQLA 1W49A 2Q46A 1EXDA 1AGYA 1TYAE 1HL7A 3HXKA 2H4XA 5FOVA 1FJGB 2EIXA 4NDAA 4CMIB 2JJ1D 5BSTA 4CVNA 3SBOA 2HA2A 2R66A 3I9LA 4MR8A 1U0LA 4BVEA 4Z1MD 2WLSA 1NATA 2MHCA 2XBMA 3HO1A 3RFTA 2HIGA 3R5SA 1Q50A 1JWAB 5JHHB 1KZGB 3OTHA 2R0QC 2PH5A 4PAOA 5DNDA 4HAYA 3L5KA 1NJGA 4PEVA 3VZSA 4MR8B 3O8DA 5FBLB 1PTJC 2H4YA 2PTHA 3GLGA 1MRZA 2UVPA 3ASUA 1RLMA 3FWHA 2CBXA 1VMAA 4R8LA 2OLJA 1GG2A 1IPEA 3UC5A 4GZ5A 4O4HA 1X7WA 4RJLA 4ISBA 3HLTA 1UC8A 4QDXA 3U2QA 5KYXB 3GLGB 3KS9A 4Z7JA 2PUBA 1EKXA 2UVPB 5EHIA 1SVOA 4XFKA 1T1RA 2WUDA 4QFDA 5FFNA 4G97A 3IPYA 3G9UA 1X7WB 4KIGA 1IK6A 4O4HB 3AQ4A 3H1FA 3UFXA 4G25A 3K1ZA 4OIMA 1CY4A 4K6FA 1NBEA 3THWA 5MHTA 1K1EA 4K9RA 2P78A 2OZKA 3T15A 1O9GA 4HWPA 2C92A 5TVKA 4AXBA 3UFXB 2MU1A 3ZXUB 4RVFA 4P6VF 4CGZA 1J0AA 3AI2A 2PHZA 4WK0B 3THWB 3CF0A 3TRIA 2WTXA 1RYFA 3M4ZA 4QGSA 5CYOA 5LMNB 1SG9A 4Z4QA 1P2VA 2Z2XA 3D3QA 1QYDA 2B30A 2I7VA 3I5UA 1KJJA 1UKEA 3L4SO 3AUTA 5CT5A 3AKYA 3VJRA 3W5HA 2IHYA 2IS2A 2FE4A 1QF7A 1P1BA 3QVOA 4IHJA 4KPGA 4RMIA 3LL4A 1F51E 3SJAA 3MJRA 1E0SA 1UFQA 1L7VC 4EGFA 3W05A 3MD0A 3WY9A 4DQLA 4AS1A 2PLNA 2YZKA 2ACEA 5HZKA 4GFDA 1DWQA 1RXWA 1ODJA 4IHJB 2DSNA 2AIRA 2BEVA 4RPIA 1YB6A 5D5PA 1WMFA 3T1QA 2B5OA 1GVHA 1KJNA 2NZVG 2B4YA 2M2IA 4AZVA 3QENA 4L3OA 3W2FA 5IYZA 3FNRA 1KJ9A 1VKOA 1TCBA 4RLFA 2QM3A 1HO3A 3VDXA 1Z74A 3W34A 1SXGA 4KQ9A 3W5JA 2BEVB 1DAEA 3O3MB 4IJUA 5JSYA 4OHRA 1J56A 2ETXA 3HUTA 2WJJA 2JAPA 4YRQA 2HYDA 4JEUA 1EWRA 1L3IA 1EFDN 1OY1A 5IYZB 3PEUA 3F2IA 3KR0A 1OZGA 4Q4DA 4G0UA 3WRVA 3H8SA 1XMVA 3F0TA 3ODPA 2HXSA 2HK7A 4W5NA 2GD6A 1QDEA 1RVV1 4PIPA 2YIVX 4QTTB 3G2IA 4QAQA 3GZJA 5GM1A 4YR9A 2ZREA 3QU7A 2P2SA 4NMLA 1XZCA 3PDHA 5K51A 3WIEA 4A0QA 3PNYA 3V32A 3PVCA 5DNUA 4FGJA 3RRBA 5JW6A 3RVOA 1XUOA 4DNFA 1PUXA 1SCJA 3SR4A 1YS9A 2PU5A 4JLWA 1JV2B 2FHPA 4IGIA 2AWNA 3FIUA 1ND6A 3S70A 1MG0A 1VE1A 2H07A 3D2BA 1EVYA 2QPLA 4ZWNA 1WDMA 1R9GA 4RF2A 1FDWA 4UZEA 1IUPA 3QVMA 4WA7A 1AKWA 3C8UA 3WNVA 7AT1A 3K0AA 1PE0A 3UPUA 2AEFA 3DFUA 4TTTS 5AW8A 1YDMA 5B53A 4ZYWA 2EBWA 1XD8A 2O0HA 2QTAA 4BECA 2YHUA 2C2ZA 2X0EA 4RU1A 1I2ZA 2C61A 3N86A 4H08A 2ZJYA 1TAHA 5J23A 4MLZA 3K0AB 4H3VA 3V8QA 2JA1A 4WCFA 4LV6A 2H8KA 1DQPA 2AEEA 3M5CA 2R8XA 3OHMA 3TCKA 1JR6A 2ZULA 1U2RA 3B3FA 3D4IA 1K66A 2QORA 1IL0A 2PEZA 3BKWA 1IZZA 4TUYF 1C9MA 2A9VA 1NAIA 3NHFA 1OXTA 4KX5A 3AC0A 4N0PA 3W8RA 2HO5A 3CLUD 4UQPA 4EI7A 1C4XA 3V8VA 2O2IA 4JS0A 4WCFB 2OAGA 4ZHQB 5KEIA 4PYQA 4BPRA 2R1TB 2WB2A 2FKNA 1ZP6A 2X2FA 5HUHA 1NL3A 1Z9BA 2OCAA 1QZXA 2I2FA 4XWGA 4YCNA 1Z4JA 2BOVA 1OMOA 2A4KA 3L18A 5F4ZA 3T5AA 4BE4A 3VPGA 1W44A 5LN1A 1H2ZA 3URKA 5TLSA 3NH6A 2IU6A 3QW4B 5BSKA 1WV0A 3RKSA 4KQ2A 2IP2A 4DLLA 3L7NA 3IP6A 4EKIA 1GGEA 1JQEA 4MV6A 2X8WA 4EJ2A 4YMIA 4M1KA 1FFHA 5FUQA 4RDXA 2QN1A 5TF4A 1NR7A 3BOSA 1KQNA 2XLCA 2VF5X 2OUKA 1Z5NA 4F6RA 1GQOA 2UUBB 3ZLJA 2ZZMA 1Z07A 2XY4A 3CEAA 4ZAGA 5F35A 1MO2A 1OW3B 3RSGA 4KRXA 3ZQJA 1TC2A 2ZRIA 1G3MA 3GFOA 1YCHA 3RYIA 1KO4A 1OREA 2C42A 4CEHA 4M7RA 3PF8A 3BWEA 1ZM4A 4R1UA 3JQ8A 1MV5A 4Y67A 4FCCA 4F6RB 1G5IA 4JL6A 2NZ8A 1FU4A 1Q3KA 1VJ5A 4JVSB 1FPQA 4H15A 5JASA 3LSTA 3RYIB 2OQVA 1U2PA 3VU3A 4ZQCB 2CNOA 4I9UA 4CEHB 2G08A 2V6GA 2NYAA 3JQ8B 4FW9A 3HPQA 4DR5B 1ICEA 2JIDA 4LMPA 1E99A 1EX9A 3DE7X 1FFCA 3RE1A 4GDFA 4MTLA 3QFTA 4DC0A 2O8NA 2DWOA 4UAUA 2WJGA 4YAEA 4LF8B 2DBQA 1HG0A 2P9EA 1P7CA 4X8HA 2OR3A 1ZINA 4D3DA 5C7YA 3OQNA 3RC2A 2ZAGA 1MEEA 2OV8A 5AM3A 4GMGA 2I8CA 4HWOA 1P19A 1SXJA 1TAQA 2FWNA 4DREA 2WZBA 3A6KA 2BEJA 2XE7A 3ZV4A 4UHJA 1C7ZA 3RS9A 4FMDB 4CM8A 2HMSA 1IUOA 1E2HA 3GGDA 3ZCQA 2VPIA 2XNJA 4C4AA 3ZW7A 1V8DA 1H6DA 3N8KA 4OJQA 3LSYA 1XHFA 4GPTA 1ZA2A 3ILYA 4KO3S 4FZVA 2PYZA 4CM8B 2DWUA 2WTAA 2YJZA 3BXOA 1TEVA 5BWOA 3GX1A 3KQYA 1WUTA 4N01A 3SSNA 3GMSA 4B3CA 3QUCA 1OJLA 2MSDB 1J90A 3A9RA 4R1QA 3RU3A 2HZ7A 4UASA 2IZOA 3HCBA 4QXRA 3ZHZA 2AUNA 3PKZA 4YPVA 2Q21A 5CHYA 3GA0A 4OYRA 2IGBA 1JQJC 1ZCFA 2HSZA 5HTKA 4PZ0A 4Z7NB 2CV0A 1JLHA 3DEJA 1O0SA 1NZJA 3VNQA 3L8EA 4JI6B 4LJSA 1IJKA 4QHTA 4IFBA 2H2WA 2W4IA 3AI7A 1THMA 3CWZA 1GXSA 2AI2A 1L5VA 1JPNA 2C0PA 2D1RA 4M21A 4CG0A 3VSAA 4EEKA 2XCSB 3T8YA 2ZRJA 3MQ4A 5L3RA 1KYIA 3O94A 1EJ0A 3PQFA 3HB9A 3LUDA 5ICGA 1UANA 2VHUA 3CF4A 3F6PA 3DE0X 1QMPA 2FK8A 3QVWA 2FWIA 3D2CA 3A1VA 4LGVA 2UU9B 1GXSB 3TR0A 3K2QA 2GPBA 1FP6A 2VNJA 3OU7A 1WCV1 4KSYA 5JNWA 3D8HA 1QYRA 4LVCA 1UINA 3QMVA 1I7SB 5GY7A 2PL9A 3FCXA 4RY8A 2POCA 1E3SA 1ISHA 3PS9A 5J63A 4PPFA 1EVQA 4LZLA 4IJ5A 2X7HA 3L7BA 5JC1A 4DSNA 3BFJA 3B3AA 2J07A 2OECA 3PZBA 4UVHA 4NE2A 1CS0A 4ASUD 3PWTA 4Q16A 3JS5A 2JHAA 1W8DA 1B8UA 4LJ9A 3AWDA 1SKYE 1UP4A 3AUJB 4LDPA 4TL6A 1EDBA 4QUGA 3ROKA 1RXYA 2BZGA 3FAKA 4QQRA 1X92A 3TVDA 3TL2A 1HL3A 3ICPA 5T8KC 5JAUA 3GJ0A 3ICEA 3NT2A 4BEVA 1M2OA 3U60B 1A9ZA 2OM2A 2P9QA 3I6ZA 1EGAA 3R5FA 5AM1A 1AH2A 1XN4A 1EWVA 3HVRA 2C8JA 1DEOA 3LM8A 4BVKA 3ZBPA 1T2AA 1M2OB 3OQBA 4FDLA 2W70A 3HACA 1CRPA 2BF4A 4Q4HA 1RPTA 3HCPA 4PO8A 3KB8A 3I92A 1NPTO 3ETHA 4W9MC 2ACVA 4QFCA 3ZWDA 3QYJA 1VPLA 3JVDA 5FPYA 4PFKA 1S2MA 3KC2A 2A5FA 2EFHB 4KAFA 2QV7A 4Q4HB 1RWVA 2X6QA 4LDAA 2V74B 1U02A 4NBKA 3N7AA 4D4KA 2GA9A 4NQZA 1RRKA 1TM4E 1ZX1A 2G7ZA 1RI1A 2IELA 1Z28A 2WUEA 4FS8A 4RIGA 1DJQA 3R23A 3CC8A 5T4HA 1JE1A 2B36A 4IVRA 2GF2A 1MHPA 4RZUA 3IR7A 1T0UA 1Y1QA 2AS0A 2YWDA 1JZSA 3L4BA 2FLKA 1NKSA 3SBEA 5HJ5A 3CURA 2IY7A 4PXAA 3C3PA 4IDBA 1XQYA 3WB9A 3T4XA 1HURA 1EBFA 3AJ8A 4R2XA 4RTPA 4C2UA 5TQVA 2IYQA 2QSJA 3QK7A 4TVBA 3I9FA 4U8GA 5LJIA 3Q9SA 2JLQA 4DR3B 2YJ6A 2FFRA 3DXFA 1ZIXA 1B2LA 1YBMA 5LXTF 1TYCA 1W5FA 1H85A 1JQBA 1PQPA 3UV7A 2V9CA 2OEPA 2J0SA 2V96A 5C2JB 3RT7A 2M1ZA 4DSAA 3QEAZ 4BRUA 3OCCA 3U9SA 1ZYUA 1T9HA 3P4XA 4YCCA 4CQLA 1EB8A 2DBZA 3VU8A 1YRAA 4US2R 3WWZA 1T2EA 4CKYA 1R18A 1Y1TA 3EF1A 4E03A 5H68A 1N3YA 1YI0A 3OESA 1BJRE 4O8CA 2VHZA 2Z04A 4MR7A 5I7SA 4CQLB 4ZEMA 4XDYA 4JYAB 4EUFA 4L73A 4O1IA 1KOLA 1RHRA 4YFVA 4KRGA 4GQAA 4R69A 5TVGA 1I01A 3FSGA 3L49A 2FZ5A 1JU3A 2FUCA 2J3JA 3BIFA 4MR7B 1KQ3A 1QF9A 4P1ZA 6Q21A 1TF2A 5FFMA 4HAUA 3PG5A 4A91A 3RQIA 2NXCA 3VOBA 3R3WA 5UKDA 3NIWA 4G81A 1UPXA 2C82A 4YASA 3RASA 4BNVA 4D9BA 5AVZA 5DT2A 2QUKA 4HGQA 4X90A 4YRNA 3FB1A 1E1YA 3Q9UA 5EIOA 1ONPA 4LBVA 4IG9A 1TCCA 1D07A 4IF4A 4RM3A 4B43A 1WHTA 1PV4A 3CRVA 4B2LA 2FPGB 1YB4A 3EC7A 5ALDA 5JAOA 1GCIA 1YJ5A 1MC5A 2Y77A 3ZWAA 2WPDD 3FKJA 1HG1A 1IN5A 1K4KA 3TGPA 4NSNA 4R40A 4A0GA 5FBHA 1S8AA 5FO1A 4E5VA 4MW7A 2YHIA 2B5WA 4FI3C 3B52X 4QOIA 2XRMA 4AMZA 4C3ZA 1D1SA 3ITDA 3K9HA 2O0LA 3KLNA 4H17A 3PA8A 1JVNA 1VGVA 1FYVA 1W2GA 4YCJA 1NRXA 2XXAA 1SK9A 1YU6A 1USUA 3Q12A 5CX1B 4KVAA 2YHIB 2F1RA 1O5TA 2PZFA 2R5FA 1JFVA 1I2AA 1KP3A 3VNAA 4DCSA 2K7FA 2GZMA 3Q7EA 4G85A 1C0EA 2C9DA 2DQSA 2H0RA 5K8LA 1A27A 1BWRA 3VDQA 2FTKE 1E3JA 4MUMA 1G8AA 4PYRA 2DHEA 4GX5A 1A04A 5AW6A 2ZS7A 4C7BA 1ESDA 3BXEA 1XCOA 2QD3A 4BN0A 4KFUA 4CG3A 3B9QA 3IP5A 1JMKC 1L5GB 1P73A 5LB2A 4YYZA 1F3LA 4HEA1 4YXFA 3M6LA 4ZMBA 5TGZA 5LYJF 4HDKA 3BN3A 3EARA 4MAAA 3C5WP 4X3OA 4B1FA 1IFXA 4KNVA 3UTDA 1Y8RA 3T1NA 3CMMA 4ER0A 1C1XA 1F8FA 3LQ2A 2EBFX 4I9HA 4IG4A 1Z29A 3TSYA 1FXWF 2FF7A 5DIFA 3WHKA 3LX5A 2NP6A 4HDKB 1YI8A 3ZV5A 3L06A 2GAFA 2ST1A 1F8XA 5KHAA 2GILA 3F5QA 4X3CA 5TY0A 1R15A 3MEQA 3IQEA 1XP8A 3U3KA 4TOIA 5GZ3A 1C1XB 3L6EA 3B78A 4M0LA 4QYSA 2JAHA 3AHHA 3MJCA 2EX1A 2X1MA 4HN2A 3WB2A 2XIJA 4WDQA 1CZLA 3Q3VA 2ZJ6A 3PC6A 4WNCA 2ONZA 2XF8A 1V8ZA 2WWIA 2XD9A 3HWX1 3HJNA 2E1RA 4MUJA 2XA2A 1HF3A 3DBLA 2GFHA 3ILHA 3NO4A 4J2TA 4NPCA 2X0NA 4K6KA 4KX3A 2O0MA 3FG9A 2JCYA 3ZWWA 4D3FA 3LL7A 4F60A 1M2WA 4KFTA 1UODA 5FQOA 3BFKA 3G59A 4JMLA 5HIAA 1X7ZA 3NCTA 1LCIA 1TFUA 1W4RA 1JG7A 3DBLB 3K0CC 4IYRA 3GA7A 4Z0TA 4D56A 1KDOA 4EK9A 4TWIA 4LN1A 3VXKA 4EZEA 1UPBA 3GLUA 2H4ZA 2QUAA 5FADA 1GT91 2XOKD 4W1PA 1FLVA 3KJQA 2JH3A 5FBQB 1X7ZB 1JIVA 2ZYWX 3T9DA 1A98A 1UT6A 3A9CA 3FPHA 5JDIC 1YQXA 4GPZA 3QKSB 1FTQA 2IKQA 4HVAA 4R5MA 1ZC3A 4WX2B 1A8HA 3SXJA 5K3DA 1OZAA 1RXUA 1MB2A 4KDFA 2R3SA 1I3CA 3ORHA 2ZJ3A 3VR1A 1JR4A 3QTTA 4NHOA 1C9NA 1IRXA 4Q6BA 3JQFA 4H1WA 1RHJA 4OA8A 4EELA 4DMKA 5I4CA 4JELA 4TKZA 3ZBTA 4BWFB 3C1TA 1X74A 3KL4A 1PT7A 1V4VA 3FFAA 4J0QA 5GVSA 5I9IA 4M0CA 3CZAA 1SVIA 3MWJA 2AZMA 3WYNA 4CDGA 1ETUA 4ZV7A 1NQWA 2O4UX 3Q2OA 2I66A 2Q0SA 1QGYA 2AKYA 4ZZ0A 1DIHA 4I19A 1J9EA 1XLUA 4L22A 2QZ9A 4JI8B 1SBNE 2TYSB 2XZDA 1H2XA 4PWYA 2GPAA 5U1PA 2JASA 1JALA 4FT2A 4CDRA 1M6YA 3JAWA 3WLQA 3DVSX 1JQDA 1OC4A 5GZ6A 3BQNB 1MORA 4QRIA 3U4MA 1PU2A 4X20A 5FLYA 4KNYA 2G0AA 2PT5A 3U7JA 1KKUA 4NG4A 3JAWB 3GUUA 4KE6A 4A8PA 1EA5A 3ZVLA 4ZYUA 3D3WA 3RIMA 2J4FA 1BXGA 3CS3A 3NFRA 3EIFA 3NDRA 4LE1A 5H59A 5HZMA 5DNYB 1NQTA 4QXOA 2FFJA 5K01A 4IHKA 3SZ3A 5AUOB 5IVKA 2EATA 2ARKA 4V2IA 1IJEA 1WSDA 2BBSA 3D43A 2W00A 4K7JA 1NWHA 5FA6A 3NGLA 3ZBUA 1D4FA 4I46A 3KT6A 1BXGB 1U04A 1ZUD1 4LDQA 2PMEA 4E12A 1E9SA 5KOJA 3BMXA 4GRIA 3DCYA 5LA6A 1CEEA 2QKYA 3H7AA 4TWRA 4D9NA 4LX8A 5EJFA 4C0HA 4I4CA 1ZK0A 4DQVA 3VPAA 4EZBA 3NVKI 2R6CA 2V7BA 4R3NA 4CR6A 1XDUA 5F12A 4LHYA 3RYHA 4KMMA 4DIBA 5KOJB 1CB0A 1Y6FA 1QRRA 1XEWX 5DEIA 1DBRA 3I04M 3AVWA 4BDTA 1E6KA 4MWCA 3G89A 3D0QA 4S24A 4LWOA 2OXFA 4P3KA 4RZ2A 5BYJA 3OPYI 1EFKA 3V4PB 3RYHB 3WKAA 2A0XA 2WI8A 3AFOA 4QYIA 3PPIA 1Q91A 1UMBB 1JA0A 3G85A 3BGDA 4E2YA 2Y1DA 3BL8A 4KO1S 4EHBA 2E48A 3UWOA 1GPAA 2QVXX 3DHVA 1U0TA 3EIXA 3LLMA 3FUWA 3OPYB 4QYIB 1RRMA 5EWLA 3OKAA 5BW8A 4TMXA 4DJAA 2JD2A 1NVUQ 3O83A 4TL9A 4C9BA 2FW6A 4GGMX 4JEIA 4FMPA 2XRFA 1C8KA 1JI3A 3VDRA 2WZDA 4HJXA 1TZ2A 5EWLB 3S2IA 2JPDA 1BXZA 5CCBA 3I6QA 1A4XA 5TEWA 4IJKA 4BQFA 5CX4A 1A69A 5IANA 1ZQ1A 2AVNA 3CX7A 2C0CA 1NVKA 4XOUA 4MHSA 3R5TA 4UXHA 4ZO6A 5EKDA 2B2XA 3CRNA 5LBUA 1VCOA 3MJ4A 5BN4A 3H5RA 3U3XA 3IC5A 5FA8A 1NXXA 4Y18A 1YTUA 3OPXA 1SB8A 4TXHA 4LW8A 3QITA 3UB3A 1NXSA 2FNAA 3ZQ6A 4EW6A 4D79A 4JI0B 1NQUA 1ACJA 2X8LA 3OFSA 5BN4B 1AQNA 1EGHA 4G0NA 2O8DA 1SFRA 1JHXA 4IXTA 2IODA 5AFSA 1P9NA 5JS6A 4AKHA 5KTPA 1RABA 3HS3A 1Z0JA 4IKOA 2Y6VA 4JBYA 1E2DA 5BOSB 4C0LA 1ZJZA 1X8KA 2QNBA 4U7TB 2NT4A 1SRQA 1JEJA 1UZLA 1FUEA 4UNNA 3PXCX 8ABPA 2H1FA 2O8DB 2GHTA 2HXYA 3RHZA 2BDUA 2QTFA 3ZYCA 3Q8KA 1OAAA 1QJ4A 4MQLA 3GLRA 3PUHA 4GBED 4Q7JB 2V7QD 4V0SA 3UOGA 4HOYA 2GK6A 4I1UA 4MI9A 5IVDA 2IL1A 4CE6A 5J2UF 1SVWA 4JA0A 4EF5A 5KOHA 1J7KA 4YBZA 3RHTA 4YAGA 4D9JA 1U65A 5AT1A 3OE7A 4H7HA 4CDMA 1QZUA 1U2GA 1ZUIA 3A05A 4GP9A 4XRRA 4JJ8A 1OH8A 2LBPA 5U4XA 4EL5A 5K0JA 3U09A 4QE3A 4EGCB 5JI2E 4CG2A 4UUPA 4MIYA 1O6FA 3VBCA 5F7JA 3COVA 5KOHB 2H06A 1GPNA 1Q6YA 5FXMA 1IN4A 1TVKA 3QJYA 3K1JA 3U7GA 1HYQA 1UBOS 2H2AA 2WMOB 2KBEA 3PCXA 1KBOA 4XJSA 1CRLA 3K5HA 1QOQB 4WZZA 2VEDA 2LWIA 1W6RA 4FE4A 2B0JA 4TN5A 2H85A 2VJCA 1CLEA 3JQGA 3ZW9A 3SJCA 1LNSA 1TVKB 3IBYA 3IMKA 4FFRA 4ML3A 2F55A 2HN9A 5BORA 2VUUA 4AUMA 4HDAA 3OH8A 4JKYA 2OHFA 3JQGB 1TQDA 3EWSA 4OTZA 6REQA 1I0ZA 5LP6F 1Z6PA 2IYZA 1B6RA 1KETA 2QMQA 3FSRA 4OG2A 1FVOA 2E4VA 2WUWE 2XA9A 3KVOA 4K2HA 4LRXA 1BJKA 3OI7A 3UCXA 2P30A 2VDJA 6REQB 1Q95A 5JZOA 9MHTA 3BK7A 2XDQA 3QRWA 4J49A 5A3RA 1XA3A 5DASA 3WK4A 3PCTA 4Y30A 5JBQA 4DR6B 1SUBA 4AO7A 2GAAA 2XNDD 4F7WA 2B9VA 5ER6A 2R97A 1W5EA 3KAJA 4RY2A 1DJNA 4BTEA 2XDQB 3OETA 4HADA 2R1VA 3L9XA 4ZI7F 1CC1S 3BGOS 2V1XA 4J0CA 3F6EX 3GVCA 4XDZA 3R3VA 4IZHA 4PXSA 3TNYA 2VL7A 3FYSA 2AD1A 1Z47A 4PNPA 2BH2A 1QE5A 4MDEA 2H00A 4DSOA 4I9GA 5T3YA 2DJIA 3LFHA 4NBNA 3IOBA 2R1VB 3LBAA 5GADl 2EEPA 5F7OA 3TD9A 1COZA 3IHWA 4I4NA 2O2DA 2Q3CA 3NNSA 3U3MA 4BO0A 3N8IA 4FZJA 4I1OA 3KALA 4HXFB 4ZARA 1QGDA 4CETA 5A3SA 3AWIA 1YD7A 4BE7B 2GH1A 3ED1A 4A27A 5IM4F 3EXIB 3VR5A 3CH4B 5TRTA 4BO3A 4Y2UA 1A7KA 4I1YA 3Q8XB 3KPVA 3DM5A 5D3ZA 3QU5A 3S2GA 3SLRA 5CEJA 4Y2SA 1ZL0A 4QU5A 2IXGA 3CQ9A 1THZA 1WP4A 2IX9A 1DV2A 4WCDA 5HK8A 1JR3D 1CQZA 1W9MA 2Y1XA 1Q7RA 2BN4A 4FFOA 4H60A 3NYWA 3OUUA 4HYEA 1B1AA 4MW4A 4QT0A 5JG7A 3VZDA 3AB8A 2VYND 5F2KA 3K3PA 5BV2P 1PHPA 2D62A 5K99A 3DKVA 3AONB 4G1FA 5F5NA 4CMEC 5JLJA 1B76A 4Q9NA 1R8SA 2YW9A 3SVZA 2DFLA 4FGLA 5A71A 3KKZA 1P7ZA 3AEUB 1NV8A 5GMOA 3EBOA 1HLDA 4DDKA 2PUEA 5EMLA 1NSFA 4XR9A 4E4TA 4EGQA 3OX3A 1TAUA 1U7PA 3HPRA 3K96A 4I1VA 9ABPA 5KJFA 4MS3A 1XPRA 2RI0A 3OT1A 4BZXA 3HYSA 4JBLA 1T0BA 2CDNA 1GCGA 2NUPA 1YZKA 3AHCA 4WNYA 2ZSUA 3EEYA 3KOUA 4L8VA 4ZTBA 1DX6A 5MN4A 4NEGA 1DC5A 1FYWA 5K8CA 13PKA 2PSEA 3PRHA 3GRKA 3D6TB 4JFAA 2YR0A 4LPKA 3D3KA 1E94E 4MS3B 2PZGA 1PZFA 1BVRA 2NSDA 3OWXA 1HX7A 3HZOA 1Y5RA 2ZBDA 2WIGA 4FOSA 1UXHA 2NUPB 4YIHA 4EKGA 1C9KA 1T25A 3PITA 5TPZA 2Q5FA 2AN1A 5AW5A 1ZGGA 3IAAA 2QG4A 4WZBA 2L19A 3KJXA 1W1UA 4QUHA 2ESRA 4K1LA 4OFWA 2OPBA 1NJ2A 3VNVA 3BWVA 4NBVA 4EW3A 2PLRA 1G64A 2I71A 2J3DA 4PYLA 5AKHA 2GM3A 5LZ4A 1ZUWA 1HI9A 1H8HA 2QR2A 3CWQA 3OEHA 2WF7A 2WSSA 1MJGM 3ET4A 2XWQA 3IUBA 4FX5A 4KTVE 4NF2A 4YWHA 5I5EA 2GFIA 5IHXA 5MDHA 1L2TA 3AHJA 3RSHA 2LUOA 1EWYA 1YJQA 1MOSA 4LQDA 5C53B 3OF2A 4KC0A 3L92A 1XVUA 1AURA 5BOVA 2FQ1A 4EWLA 1IBSA 1SVNA 3RD5A 1OWOA 4MYRA 1I94B 2FAXA 3ZDYB 1Z8FA 3WWDA 5EMJA 1K9VF 4F4UA 4QAJA 3KSBC 2RH4A 2P4SA 4LNAA 1HRKA 1MC1A 1TYBE 1UCFA 1GD1O 3NX4A 1QRUA 1OLSA 2GYVA 1JG2A 3F74A 4DM7A 4PBRA 1C30A 2Q1YA 2IIPA 3DBIA 3HB5X 4G01B 3T9EA 2WFLA 2OCKA 2RHGB 2ZR9A 2CCJA 3G1TA 4YCLA 1M1XB 2FSVA 3EUWA 4JL5A 2YXLA 1F2TA 5H3CA 4I3HA 1OLSB 5JDCA 1ECPA 4YGYA 4Z9YA 2A9KA 1C30B 3KHKA 2IPOA 2KS6A 1AK9A 5AVRA 2WFLB 2GT1A 3GJ8A 4PQRA 3WQRA 4ARIA 1H42A 1KDYA 3UYLA 3W3AH 4XLLA 1C3VA 1GEGA 1S7CA 2QAGA 3ZXIA 1H23A 1F2TB 4QOEA 3VTAA 4AU1A 1IG3A 1N25A 3NM5A 4GR5A 4PX3A 5EUCA 4B4KA 1NMZA 3EFOA 3R4CA 4EFLA 3FW1A 2OZLA 3B13B 1NUQA 3FNHA 3V7FA 4N3GA 4M55A 4QOSA 5F2EA 5C5DA 2DOKA 3B6JA 1BIFA 3BF8A 3MT7A 3REFA 3T12A 3UV6A 2QAGB 1PNTA 5KNCH 1GAWA 1CUIA 5J4YA 4IHQA 4FR5A 3EFOB 3QFSA 3EZ6A 3M34A 3KXIA 5B3LA 3BE8A 4YMSA 5IS2A 1YR2A 3ROTA 5JZBA 1HNXB 1ZH6A 4EUKA 3PUIA 4OHWA 1SBZA 1R0BA 4KLCA 4QBGB 4TYPA 1QYVA 4W8OA 3RLIA 1RTTA 2OHVA 3CEJA 2WIBA 3AZQA 2ZM5A 1U1GA 4D9EA 4C2BA 3NS7A 2V6IA 3L1KA 4OA5A 2OAP1 1RZRA 4EMTA 3MRXA 3AHIA 3S44A 2W2MA 2D3WA 4FYJA 1YRLA 2VDWA 5THXA 3K94A 3ROPA 3GA5A 1E3MA 2JJYA 3LA6A 5EE5B 4B3DA 2JB9A 1OC2A 3QYAA 4CT4B 1EE9A 3D6JA 4AK9A 1M8GA 4UBIA 2M32A 2VF2A 2FQYA 4TS4A 1K7XB 2GS9A 5ILOA 4DCVA 4P8RA 4ESEA 4DIEA 2VDWB 1J5XA 2ZKLA 1DUSA 1U8ZA 3SJ7A 2FOLA 5TDHA 1PYOA 2XE4A 3NPMA