1KSJA

Complex of arl2 and pde delta, crystal form 2 (semet)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
165
structure length
164
Chain Sequence
RELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The complex of Arl2-GTP and PDE delta: from structure to function
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/hydrolase
molecule keywords arf-like protein 2
total genus 52
structure length 164
sequence length 165
ec nomenclature
pdb deposition date 2002-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ksjA00
2G3YA 2ZRJA 2CHGA 3JZAA 5BXQC 4HUQB 3ZS9A 3PEUA 3H84A 3B6EA 4L9WA 3U3MA 3QBTA 4B71A 4ILEA 3ZGXA 2SHKA 1P2VA 2QAGA 2R62A 3ZIAA 5FPSA 4TMTA 1Q12A 1N0VC 1GL6A 3DPUA 4LHXA 4UNNA 2CVFA 1P2TA 1GWNA 1NG9A 1Z0AA 4CEIA 1G7RA 4TYNA 1Q20A 1ZCAA 1KZ7B 1I2DA 4IXMA 1CLUA 1VIAA 5EP4A 5JRZA 1COWD 3TUZC 5JJKA 2F1RA 1NY5A 4GP7A 1N5IA 3PUYA 3GEEA 3TQFA 1LS1A 2EQBA 1E9AA 4C4PA 1ELOA 5D3MA 2QTFA 4QFMA 3TRFA 1HE1C 4JKIA 4URUR 1SKYE 4G1UC 2QRZA 1G5PA 1G5RA 2F1HA 2P6NA 2ZXUA 2IUSA 4U5XA 4IVPA 1AKYA 3GJXC 1E2PA 5AUOB 2QNRA 3ZD7A 4M22A 4Q4JA 2WKRA 4JYCA 4GI7A 2A5JA 3VHLB 3TVDA 1YZUA 4MGIR 2V1XA 2IUTA 4XWKA 4CT4B 1UM8A 1E9FA 4PC3A 1XMSA 1SVMA 2DBYA 2PCJA 5KHOC 2Z0MA 4HLUC 2N46A 4Q4AA 5FPKA 1X1RA 3U2QA 4JMPA 1PLJA 2JLXA 2YKGA 3DEFA 5D3MB 4L4UA 4BFUA 4BRWA 4L16A 2Q3HA 3LA6A 2R2AA 4NHOA 1WE2A 1LB1B 4XD7D 2X19A 1RPZA 3IPXA 2ZUCA 1UFQA 5CDFE 1G3QA 2BJVA 1UKZA 4W5WA 4QGHA 1CP2A 3A1UA 2KB0A 2R9VA 1W0KA 3DHWC 5CK4A 1QVAA 5TY0A 2CNWA 1QF9A 4N0EA 1KDOA 3PITA 4PZZA 4KCGA 2J7KA 2WHXA 2XOKD 2ZRHA 3WHLA 2B7BA 2QAGC 1IN6A 2ZROA 1NMZA 1OKKD 4MA4A 5AK0A 2V1UA 5E3HA 1GIAA 1KHTA 4IRUB 4JL6A 4ACBA 4W7SA 3EZ9A 1G20E 1E2MA 2FEMA 2VP4A 3L0IB 2FDCA 2IXEA 2ZVQX 1KAOA 1AS2A 2PX3A 4R7ZA 1M7GA 1MRNA 4LHWA 4QJ4A 4B3FX 2ZYVX 2YC2C 4A0GA 3SFVA 4IHQA 1W4BA 2WWXA 2ZRBA 4POAA 4Q1CA 4EPTA 4ZDIA 4KHZA 2FZ4A 4HDOB 2ONJA 3CB4A 1NG1A 1G7SA 1L8QA 3GLIB 3Q72A 3RWMB 4RSGA 1Z6GA 5DYGA 2NO1A 3LQQA 5J4YA 1XTQA 3KQHA 2GBLA 2GJ9A 2A5DA 2W6ID 4M1OA 1T3HA 2PZGA 4BFXA 3VR1A 1QHXA 1X3SA 4OHXA 1L4UA 3QI2A 3R9WA 4RY2A 1PJRA 1ZJ6A 4UXJA 4AK9A 1XD9A 1E69A 2J5XA 1B23P 5KDDA 2RB4A 3RSOA 1MKYA 2DWOA 2VHCA 3OFNA 421PA 3X1XA 2QE7D 2F7SA 2F55A 2HF8A 3K70D 2GCOB 5AUPB 3EZ7A 3R20A 5HE8A 5KNDA 5CB6A 2ZPTX 3W6PA 1X86B 1NBMD 3QXSA 2IYXA 2QL6A 1ANKA 3NKVA 1XEXB 4QHSA 3QPVA 4P33A 3GLHA 3W90A 1FP7A 3VKGA 3V4RA 3BRWD 4BGDA 2GZAA 2PLFA 1KKLA 3F8TA 3ZZ0A 1OXUA 3SQXA 2OFWA 4RZ3A 2VLIA 4L9SA 3CRVA 1A7JA 4A9AA 1JR6A 5LPNA 2ZSDA 4TMVA 2ZJZA 3IO5A 4PHGA 4QNMA 3ONWA 5FL7D 3GJ5A 2GCOA 2EFDB 3X2SA 3A8TA 4MYHA 1KO7A 1TQDA 2VF7A 4UNSA 3WMEA 2NMVA 3EZFA 4AURA 2ZS7A 4Q9LA 1IXSB 2W83A 4LBZA 4QJ3A 4OK5A 4LC1A 2GNOA 1DTSA 2C04A 2XSZA 3A4MA 1SXJB 3C5HA 3D31A 3LXRA 3PUZA 4IDNA 4K81B 4ASUD 3NEYA 1DAFA 3KTAB 4M9SA 4GDFA 1KSFX 1H8EA 3E1SA 3GJ7A 1KI4A 2BOVA 3F5FA 4PC6A 3BB1A 4EFLA 3ZJYA 2F9MA 4C2UA 3EWSA 2HJGA 2PJRA 4A2WA 3KJGA 3GLFB 2IXGA 3FMFA 1PZNA 3FFAA 3M1IA 5JSZB 5KSZA 2N1BA 2WWGA 5GJCA 4BFSA 1AZSC 2WJGA 4B33A 2ZSBA 4US1R 1FUUA 3D8BA 4B3XA 5FTMA 1NMXA 2VA8A 3VHXA 4LBYA 2FU5C 2JA1A 5TXGA 4A0HA 1FX0B 3B2EA 1Q57A 3KKQA 1W7AA 5DHFA 1CTQA 2GJ8A 1R10A 4JLAA 1W48A 3OF5A 1F6BA 1BYUA 4WXPA 2NGRA 5IDVA 1VYVA 2Z83A 1KO1A 1OB5A 4MRPA 4NYIR 4DUGA 4F92B 1SQ5A 2OCBA 5GVSA 4A8JC 3FPAA 1W2GA 3TNFA 1NL3A 2ANBA 4N3NA 2JLSA 1FNMA 2R6FA 2DR3A 2ZE8A 3QKSA 3W34A 3LX8A 3OE7A 2O8CB 1P9RA 3WHKA 1CEEA 2OAP1 2YWFA 3AVXA 1W36D 3M4YA 3GJ8A 2IYQA 3SNHA 1XEWY 2CDNA 3H0KA 1COWA 2EWWA 4US2R 1EGAA 4M1SA 1MO6A 4EPWA 3FDIA 2IYLD 2OLKA 2E87A 3J81k 1J8YF 1XPOA 1JB1A 3ADDA 3A6PC 1S1CA 4P31A 2DPXA 2QM7A 4TYPA 1QHGA 1KO4A 2RGCA 4WOPA 1HURA 1GKIA 1KK3A 1G3MA 2JEOA 2ZRMA 1IJFA 1HUQA 2V7QA 5FOWA 3BFXA 5FUXA 2A5YB 1TNDA 5AJXA 1TQ4A 1XWIA 1VTKA 2CVHA 2G0NA 3BS4A 1YE8A 1NNEA 1E2EA 2HF9A 4BUJA 3SS8A 521PA 4KU4A 4O2RA 2WWYA 2ODEA 1NLZA 2MSDB 3ZYCA 3GFPA 1NN5A 4LJAA 1DELA 1Q1QA 3LDAA 4DEXA 1WMSA 1ZMXA 5JCPA 5KPDA 2IUUA 2D06A 2P6UA 4Q7KA 4TLBA 1GRRA 2O8DB 3THYA 4ITRC 2OEPA 2CLDX 4QNRA 5HE9A 4MGYR 4BEJA 2O0KA 3I8XA 4Z8YA 1VG1A 1ZVQA 1YQTA 3B9PA 4MKHA 2ONKA 3BH7A 1DEKA 3VR4A 1M8PA 1O3YA 3FKSD 5FTLA 2B21A 2R6AA 2XJ4A 1KSJA 2YYZA 5DN6D 3U44A 1IN8A 2GWHA 4UNRA 1OT3A 1XB2A 5KTYA 3E70C 2QENA 3QJYA 5CLQA 5DO9A 1GOTA 4KBGA 4F93B 2O8BA 3AF0A 3AKYA 3CONA 2AKYA 1W4CA 1XEXA 3T61A 1J70A 4OQNA 3RSLA 1IY1A 4MH0R 2QROA 3QG1A 1WXQA 4M9ZA 5JEDA 3IBGA 2GZDA 4IKEA 4LHYA 1IAQA 3K8YA 4Y0VA 1IXRC 1ZNWA 3AM1A 2P5SA 2ZRDA 4Q4HB 5FPHA 3KZ1E 2I1VB 1M2OB 1JECA 3RRZA 4ZCMA 3SQWA 1DAHA 4PO8A 4KITB 1E9BA 2FZLA 1VECA 2KE5A 3DMDA 3EAQA 1S4QA 3HR8A 5E95A 5SZJA 1DS6A 1KDRA 3A1TA 3IBYA 4DLUA 3CLVA 3TBKA 3AVWA 4Q48A 2CHQA 3QG5A 4P4SB 2D7CA 2J0UB 4MQBA 1OF1A 4P4TA 3TMKA 1ZU5A 3X1ZA 3QBVA 5BN3A 3SJCA 2GXUA 2YINC 2EVWX 1Q21A 2ZUBA 3MWKA 4MRVA 4WZBE 4I1OA 1JXOA 2RGBA 4PR0A 2ZQ5A 5L3SB 2J9RA 3PEYA 1U8AA 2QMOA 2GXSA 3PIRA 4LV8B 1OHHA 1RRFA 1KNXA 3A1WA 2XNDD 4K8OA 4RFSA 1VYTA 3CX7A 4QKQA 5CITA 1ZNXA 2ANCA 3CRMA 2RMKA 1JEDA 3RDPA 3L0PA 4FMCB 4OHZA 1Q1EA 1XJQA 1XFAA 3HPQA 1RRCA 1H8ED 2OCPA 1LTQA 4PSAA 3LBHA 5B2ZA 2A7QA 4LGMA 1ZW6A 3REFA 3NVAA 1SVOA 4XH9B 3OIYA 3WNDA 4FCWA 1TEXA 3PG5A 5AJWA 1S2MA 3B5JA 3QE0A 5DE3A 1GRNA 2HLDD 2OUKA 5G41A 2FFQA 4BLQA 5JECA 1EG7A 2XITA 4NTZA 4RJLA 3RAPR 4B47A 2ECKA 1KK1A 4TT3D 2IXFA 3TSWA 2GAOA 2ERXA 3KDSE 2FPKA 2JLVA 1E0AA 3EWAA 3U4QA 4KJZA 2P2LA 1FPMA 1KO8A 5C18A 4NCHA 2EWVA 5DH9A 1A2BA 4HLCA 2KSQA 4CGZA 2Q9BA 4L5BA 5FH9A 3B1XA 2BM1A 5JS7A 2NG1A 1XCMA 1GL9B 3DOEA 5SZKB 2QAJA 2QT0A 4NYJQ 1ZINA 4B2PA 3U60B 4BLOA 1J99A 2C99A 1X1SA 4DSUA 5F2EA 3BGWA 3SEAA 2ODBA 1XF9A 4H9GA 2WM9B 2P3SA 2FFHA 1VHLA 1Z63A 2I1QA 4G5GA 4D4JA 3FMPB 1JQLB 2BKEA 2IEYA 1TQ6A 4M1YA 4BE7B 1AZTA 4WZ6A 1UBFA 2LWIA 3LW8A 3RWOA 1N0WA 2WJJA 1AN0A 1CR1A 1Q0UA 4BZQA 3DO6A 2ZJYA 4Q7MB 1W49A 1W0JA 3LY5A 4B3CA 2K5UA 1WBBA 2V6JA 2ZAOA 3CX8A 2QBYA 2REXB 4YDSA 2AR7A 3VR5A 4HZUA 1CJVC 4TQ9A 1VMAA 2ORIA 1OXTA 2IYTA 1AK2A 1G4UR 4H1VA 3T1TA 1SKYB 4D4KA 2L0XA 1IY2A 1OYWA 3BFKA 4B35A 4DCVA 2WOJA 4E03A 5C4MA 3FYHA 4ERNA 3GPLA 2JJ2A 2HXYA 1E2HA 2VHJA 4IFBA 4PPGA 5D3QA 5E7JA 5TDHA 5CK5A 3TSZA 2CL0X 3GLHB 2IWHA 3AKDA 1GG2A 5K8LA 4NP6A 4EFMA 2VP6A 1T91A 2GVDC 3ND8A 2IHYA 2AHOA 2BVNA 1EFTA 4GT1A 1ZU4A 2V7QD 1GL7A 3L8YA 2XOKA 4PQRA 4MKGA 4PC2A 3R9IA 2AXPA 2CNWD 4JBXA 1W0KD 4PAQA 3KL4A 1U81A 1E94E 2H1LA 4RD1A 1Z2AA 1K6MA 1VCOA 3AF4A 2MMGA 4LX0A 1XTJA 1GKYA 2XTZA 3TUJC 2CEAA 1AS3A 2EYUA 1XPUA 1IM2A 1SXJA 1EXMA 1VCIA 1YR7A 3EIEA 3CR8A 2D3WA 4BZPA 1B0UA 4ACAA 4EFNA 1HQCA 3SHFA 3SJAA 1Z0KA 4OBEA 2BJWA 2FV8A 2JLWA 2WIAA 3DKVA 4M21A 2O8FA 2ZJAA 3N5CA 5FL7A 4DWJA 1EX6A 1U8YA 5K8IA 4AKIA 4LZZA 2ZSAA 1KKMA 4M8NE 3LFUA 3IO3A 4W9MC 3O8CA 3L2OB 1FMJA 1JAIA 2WMNB 4GSYA 3RS3A 3T1QA 1OFHA 4MRNA 1KI3A 2RAPA 5BW8A 2HT1A 1IXZA 3B1ZA 4Q1AA 2YVUA 5DLQC 4C3ZA 1AA9A 4JLPA 1VHTA 3FB4A 4EQ6B 3O8RA 2JJ1D 2FF7A 3LBIA 1NLFA 3E2IA 3MCAA 1OH7A 2PMDA 4QL3A 2BMFA 4JJKA 4EJSA 4XSHA 3QF7A 1HH4A 2IYYA 1Q44A 4DB4A 1DAGA 3RRMA 1WF3A 3WRYC 1G7CA 3OAAD 4R2HA 5FOXA 1TUIA 1NN3A 3MSXA 1FL9A 2OFXA 3EA0A 1NVUQ 4RD4A 4BASA 5BN5A 5EP2A 1BH2A 3NTUA 2ODNA 3K0SA 1EFHA 3NIBA 2EFHB 2WPDA 5HTKA 3W3ZB 2HDNB 4MKFA 3U44B 1UDWA 1PUIA 1G7TA 5B64A 5HKKD 3AF1A 5C46F 1R8SA 1QG4A 1EK0A 2C96A 2RCNA 2VSFA 2XB4A 3ZQ6A 2VH5R 4PANA 4XSGA 3CZPA 3GEHA 5FOVA 2O0JA 4GZLA 4TN1A 4XIGS 4EJSB 2JCSA 4ZI3A 4LJ4A 3Q5EA 1E9DA 3UG6A 1OXXK 1OLOA 3P4YA 3PV0A 4HAYA 5DGXA 221PA 3U3JA 1OIVA 1BIFA 4NDZA 1FMLA 4KSCA 3TW4A 1DO2A 3QKTA 2IYRA 4KO8A 4O0MA 4DDTA 1KJWA 2VF8A 1KJYA 1KAGA 4U02A 3QKRB 3EASA 1I4DD 5CYPA 4CYMA 1M7BA 2OM2A 3MAAC 4QBHA 4M0LA 3BORA 3Q3JB 5EJEA 2I3BA 2O8EB 2H17A 2QQ0A 2ZREA 2BCGY 4WA7A 5TMPA 5EQTA 3WYAA 1KMQA 2A2ZA 2DCUA 1QHHB 4TL6A 4TTRA 4C0QC 1D5CA 3LWNA 4GZMA 1SXJE 4KFSA 4A4DA 4Q19A 4P4SA 1MT0A 2YJTD 4R71A 4LYAA 1E2QA 4FW9A 1E2KA 4XD7A 2VL7A 4IVQA 3T06B 2XB2A 2P5TB 2Z5FA 4C0AC 2G88A 5KOYA 2VHTA 1G8PA 4IW3B 2FPMA 1QHYA 4DLWA 3RS0A 1X6VA 2E9SA 2D2FA 3VQTA 2FEOA 3HU2A 3VX3A 1DO0A 1DBSA 1MRSA 2AX4A 3UWOA 4LYFA 1UKYA 3IDQA 2H7VA 4DSTA 5DN6A 1N6IA 1ZUIA 3FKSA 1EWQA 1G6OA 4BRUA 1E79A 3I32A 2AK2A 1W47A 2Z4SA 4LY6A 2JLRA 4GMDA 4XJXA 2EU8A 2WJYA 4YMWA 3R8FA 4Q03A 3ETLA 1SULA 1XJ0A 2ZETA 4JJZA 3EIQA 4JLNA 1BO6A 4TT3A 3SYLA 4YMTA 4Y0AA 4X8HA 1DAEA 2NIPA 2R65A 2XAUA 3A4LA 1RYHA 3GLGE 1MABA 5DI3B 2BC9A 3I3SR 4B74A 5HKKA 1BOFA 2ASEA 3AVYA 1PLLA 5GADl 4GOKA 1U94A 1KI9A 3KUCA 3QOFA 1DPFA 5J4KA 2BBSA 4BZXA 3L82B 2IS1A 4NYJR 2FSIA 2J0UA 3HPRA 3N2EA 5DYIA 3ADCA 4IDQA 3EZ2A 2UKDA 4TYYA 4RVCA 2G9NA 4QRHA 1RRGA 1JEEA 2VHUA 4QM7A 4PO9A 2J41A 1XP8A 1H8HA 3CX6A 3BOSA 4Q1EA 4A0FA 5AUNB 1OV4A 4Q9KA 1FOEB 1LV7A 1SVLA 3LNCA 5ANRB 3C8UA 2QGNA 4HLDA 1RC8A 2ZS9A 2O8CA 4F91B 3I5YA 1EWRA 1GFIA 2H57A 3G5UA 1OH6A 2ZJ2A 3Q5DA 2OSBA 1JR3E 4IEIA 2ZE5A 3B1WA 4RZUA 3RRYA 4ZIRA 3THOA 3R8CA 3EC1A 4QHTA 1OH5A 3BB4A 4NL4H 1XCGB 3QVUA 3RNLA 1G19A 1Z08A 2QU8A 1CJUC 4Q4LA 4DLVA 3K0CC 3Q7PA 1FTNA 2ORVA 3I62A 2YHSA 4NONA 3ZQJA 2ZRNA 3IGFA 4KVGA 1GZSA 1RKBA 4Q1DA 3NG1A 2C98A 4U00A 3IHLA 5IF9A 1XZQA 4LRWA 3PFIA 1HT1E 2QRNA 1VDZA 1ZM7A 3OEEA 3THXA 4C0HA 1PVOA 2CJWA 2P67A 1NVWQ 1W2HA 4KV9A 4NE2A 5EE1A 1TU4A 4MUBA 3KUDA 3KQUA 1RZ3A 2Q9CA 2KBEA 2AKAB 4PPNA 2OV2A 2ZS8A 1XD8A 1VG8A 4ZDWA 1OIXA 1SVIA 4HB2A 2GESA 4PHTA 4LBWA 4HB3A 2F43A 4M9XA 3OIUA 2OXCA 4MYTA 1CR4A 2BV3A 3VR2A 4OQFA 1EX7A 5JJIA 4XVRA 2XX3A 3KXKA 1KMHA 3MGCA 2RGGA 1HQYE 3KKMA 4F7WA 1N6LA 1IBRA 1L7VC 5LD2C 4JKYA 5JSZA 4KSBA 1G3IA 2NOAA 4YLGA 4ZCIA 4NCJA 1G8GA 3GEIA 4Q47A 2CLCX 2HT6A 1U98A 1QHIA 2PEZA 4ESHA 4F4JA 5CJ2A 1JBKA 3BERA 5JWRA 4WW0A 4DT1B 3TIFA 3WXMA 5BYJA 1J2JA 2JLQA 3CNOA 3LH5A 1CF4A 1GDDA 4CIDA 1NP6A 1XMIA 1ZM2A 3X1YA 5TB5A 3EC2A 2R8RA 1RFLA 2ZI4A 1KSHA 4JL5A 3PEVA 4JVNA 2ZITA 5FUWA 1TU3A 2VP5A 3SC3A 4CF7A 2IT1A 2QP9X 1IN4A 5BN4A 3CUEF 2WPDD 1NVVR 2JDIA 1D9ZA 5IK2A 1P60A 4JT4A 2BIFA 4AG6A 3D3QA 3AUXA 1JNYA 1ZD9A 1UEJA 4K46A 1V43A 3MLEA 1YZNA 1XXHA 1KGDA 4DJTA 4TMWA 4M1MA 5FBQB 3RYTC 3TR0A 4JLJA 5GVRA 5FFMA 3T15A 1J7KA 1HY3A 5KNCA 1N6PA 3PEWA 1CXZA 2ZR7A 1E9SA 4TMZA 4A36A 3GQBA 3OEED 3TW8B 2ZR0A 2ZEJA 4TQAA 3TKLA 2ZYTX 1U9IC 3I73A 4P3YA 3AF2A 3K1JA 4QGFA 2MMCA 2GF9A 4ABYA 5B58C 2YOHA 4HDQB 1R5NA 4KAXA 4M9QA 4TTPA 4Z8XA 1HT2E 4DDWA 1G291 3CPJB 5HZKA 5EE9A 1OJLA 4GRAA 1L4YA 1P61B 4GOJA 3AGQA 1J8MF 4D25A 4TTQA 1E2NA 4P0TA 2G0TA 1WB9A 5AJVB 1II0A 1TUEA 3IUYA 2ZE6A 3NWJA 1T0HB 4A2QA 3ND9A 4DLSA 3UMSA 2Z6VA 4QM6A 3NC1C 4PO1A 4HYYA 4BECA 4URXR 4BLPA 4PC1A 1WQ1R 3QXCA 1KK2A 2H5EA 1Z83A 4QXAA 3WYFA 2IS2A 3TAHA 2FA9A 3BJIC 3T34A 3CW2A 4LHVA 2WKQA 2B8TA 3WYGA 1OHHD 5L3RA 2FGJA 4C0JA 2QI9C 4OYHA 4LJ6A 1Z0IA 1HTWA 4Q1FA 2CHVA 2ZYUX 3IEUA 1A1VA 1YU9A 4LHZA 1TADA 2BMDA 1FQJA 3CPEA 3SBEA 1W44A 2DWQA 2A9KA 5DSZA 1SHKA 2QM8A 2QT1A 4I1UA 3LLUA 3THWB 2LKCA 4JLOA 5UKDA 1PV4A 1MO4A 2PEYA 3CRQA 4OQMA 2FOLA 2YOFA 4URWR 5A5GA 4PQYA 3WBJA 1E0SA 5JI3E 2EFCB 1QDEA 2O0HA 4URVR 4FCTA 1XNJA 5JBQA 2W0MA 2PLRA 2WJVA 5CYOA 5CM8B 1E9EA 4EQ6A 4IDPA 5IRCD 1P2SA 4LYJA 4RD3A 2CE7A 4FCVA 4UJ3A 3VU9B 1I4LD 2PBRA 5F9HA 4OHWA 4TLAA 3P20A 2JJ8A 4B34A 3CM0A 1G8HA 4DVGA 2D74A 1EESA 3L8ZA 1Q3TA 1T9HA 5EP1A 3I1FA 4TYQA 3VR6A 3X1WA 2J7PA 4ON9A 3GJ4A 3QXJA 1G17A 2DYKA 3ZVMA 1VG9B 3VKHA 3KQKA 5G3YA 1XCPA 5DNYB 4ZPXA 4PAOA 2P6RA 1DAMA 1UJ2A 4C0SA 2ZVPX 2RGEA 1ZNYA 4UNQA 4OQXA 5FUVA 3QUSA 3UMRA 4R98A 2W0SA 2ATXA 2GDJA 1GAJA 2Y8EA 4ZDKA 4A15A 4D26A 1W5SA 2JAQA 3K9GA 4QBIA 1DOAA 4R2IA 4YMVA 2OCYC 1U9IA 2O52A 4Q4JB 1N5JA 1SXJC 1NJGA 4A8JA 1VPLA 3AUYA 4PHFA 5EXXA 4OI0A 2EFGA 1P7CA 1T5IA 3K70B 1RYFA 4JT2A 2WIBA 2HYIC 2IW3A 2QN6A 1M34E 2WICA 4XVUA 3H4MA 4PX9A 1YZGA 4RZ2A 3TLXA 2YOGA 3MWLA 4JLDA 2WSMA 4LI0A 3RVBA 2J46A 3SN6A 4ARZA 3B82A 4Q00A 1NBME 2WAYA 4J0QA 2J3EA 1CR0A 3W5IA 1N6HA 4CEHA 4TYWA 1TEVA 1CRQA 5FBRB 4MRSA 4U7DA 4GL2A 1ZC3A 4PTLA 4Q7JB 1T4GA 4BWYA 1P72A 1UBGA 4QG7A 1TF2A 2CE2X 3O8BA 1M7HA 4TZ6A 1OH8A 2FX3A 2IHBA 3U4QB 3C14C 3AVVA 4ZKDA 4PHHA 4X8OA 4HAVA 5A0FA 4LYHA 1OXSC 1W4AA 1PUJA 2W2VA 2IL1A 5KSPA 4DSOA 4EPVA 3FOZA 3O8DA 4JSTA 1XX6A 2LKDA 2OESA 4B75A 6Q21A 3EXAA 2BHRA 1JI0A 1E1QA 1XDBA 5FI0B 1DG1G 3EZ6A 2RKOA 2VHQA 1ZCBA 4M2LA 2WAXA 1DAIA 3K0FB 4MGZR 4DXAA 1Q1BA 3VFDA 1ZAKA 4ZO4A 1BKDR 3DKPA 5LDDC 1LS6A 3HR7A 4EDHA 1JR3A 2VRWA 4B44A 4DHEA 4A2PA 4EPRA 1WP9A 2PX0A 5HZHA 1F2TB 1E2FA 1ZM3A 2AWOA 3SI7A 4BQSA 3IQXA 3UMFA 4MUAA 2NPIA 2OLJA 2IBMA 3GLHE 4URYR 4OK3A 2ZANA 1OFTA 1SVKA 1MOZA 4G0NA 4RD0A 2FFBA 5LB2A 1SVSA 4JLKA 2WJIA 5JHGB 3R9XA 3NDBB 2J87A 1CJMA 3KKNA 3VNVA 1CS4C 3RC3A 5DI9A 2BWJA 2VP2A 2CK3A 4AI6A 4OK6A 1MO5A 4MITA 3OIVA 1N5LA 3THWA 4DLRA 1OFUX 1RJ9B 3K9HA 1F2TA 4PPQA 2QPTA 3E5HA 3V4FA 3ZVLA 2G6BA 1OFIA 2GBLC 3VX4A 1G21E 1S8FA 2BMJA 4GBMA 1P9WA 1UBEA 1NIPA 4JBYA 4I1VA 4X8MA 1ODFA 2WJHA 4Q01A 1KDPA 2FWRA 3AQ4A 3UATA 1NY6A 4YQFA 1WBDA 3ADKA 3P1JA 4C30A 2C77A 4B32A 1CJKC 3HYRA 2DHRA 4AG5A 2XSZD 4LJ5A 5FTKA 3HU3A 2QMHA 1Z0FA 2MSCB 4Q9JA 4HUQA 3U7GA 3CNLA 3FHCB 2ZSEA 2QY9A 4A1FA 1XZPA 4FINA 4FI3C 4NZYA 3I4LA 2O8EA 2QAGB 1JPNA 1WDTA 1GTVA 3LQRA 4OJQA 1X8KA 2IF0A 3BH6A 2ORWA 1UAAA 2CLSA 1YZTA 4NMMA 1OE0A 1R7RA 2OILA 3Q9LA 1T0JB 1E0KA 3M6AA 4L15A 3GLFA 2OG2A 2OZEA 4RFVA 5TV2A 4KFRA 4NU0A 3TAUA 4ZDJA 4JSYA 2CL6X 4GMXA 1GNRA 4YMSA 4DRZA 1BS1A 2BBOA 1XMVA 4TQUS 3FFBA 3BD9A 2D4HA 3IPYA 3RRNA 1GVNB 1XEFA 2IYVA 4LWZA 3VNUA 3HU1A 3OAAA 4LOAA 3G0HA 2KJQA 1WRBA 1ZBDA 2C5LA 5TARA 4DCUA 3TE6A 4PAMA 5JWHA 4A92A 3KFVA 2CBZA 2I4IA 1G3UA 5EXSA 3IIMA 4KODA 2JDID 4NKRA 2GJKA 2ZTSA 2J0QA 1YR9A 3DM9B 4IOKA 5F98A 3ZDQA 1OIWA 4B2LA 1Q22A 2H92A 3QKSB 4HB0A 5HCIA 3K70C 3BAFA 3QXXA 4BFTA 2GKSA 5L3SA 4Q66C 1X8JA 2YZ2A 3SJZA 4L8GA 1GILA 2FNAA 1QBKC 1GSIA 5AR1A 1P5ZB 3C15C 3VAAA 2BMEA 4Q02A 2XGJA 4MGKR 1D2MA 2CXXA 5KDOA 2W58A 3TJZA 5CJPA 4C0LA 3NC0C 5GJVC 1JALA 3QENA 4UXIA 4N0DA 2OO7A 3WMGA 4ZI2A 3ZS8A 2YWEA 3GLFE 5IT5A 2O5VA 3QF4B 3AVOA 4LPKA 1Z6XA 4GFDA 2NQ2C 5K8UA 1ETUA 3G82C 2C2HA 4JLMA 1NKTA 4YDHB 1KK0A 4ZV4A 1ZIPA 2IA5A 3UANA 3MG9A 4TSFD 1OB2A 1IQPA 3BFVA 121PA 1OPXA 4DIDA 4BLRA 3FHTA 4QHYA 2C95A 2FFAA 3KKPA 3H1TA 1S9DA 1TX4B 2EYQA 1IHUA 2ZRCA 4TL8A 1E1RA 4KXFB 3V9PA 1W46A 2W00A 4HI0E 4QGAA 1W5TA 2AD1A 1N2CE 2VP9A 2X2EA 4LV5B 4NYIQ 2ZU6A 4UXHA 3W8RA 4B3BA 2O8DA 2QUZA 2CK3D 3F3YA 4E09A 2RGNC 1CRPA 3CKLA 4ASUA 3FTQA 5KSYA 2YNMA 5FI1B 3CPHA 2V3CC 1G41A 4D4LA 3BXZA 1GRQA 4Q21A 4Q7LA 4XTCS 1AQYA 1E2GA 1NSFA 1G9XA 4GOXA 3FMOB 5E4FA 1CBUA 3M0EA 1GM5A 3KXIA 1N6RA 4BEBA 2P65A 3C7KA 1P2UA 621PA 4LV6A 1CR2A 1CU1A 3HJNA 4WBSA 3W9YA 3SE0A 3EW9A 2Q3MA 1M74A 3EPLA 4LSGA 2O8BB 1F2UB 3GLGB 5FUYA 3DL0A 5P21A 1KYIA 4QBFA 3SJBA 3U3RA 3QY0A 4B3DA 1NF3A 1KY3A 4A8JB 3CR7A 4M1TA 3JVUA 3WNCA 1KY2A 1TF7A 1RW4A 2NZJA 2QBYB 2FSGA 2BEJA 2KWIA 2DFLA 2ZRGA 3HP1A 5G3ZA 4C0BA 2D7DA 4DCNA 2ERYA 5JFGA 2R44A 2DFTA 2GZHA 5BYKA 4AC9A 1KMHB 2CCGA 3DZ8A 1OXVA 2OBNA 1UADA 4TLDA 4EKDA 3DOFA 5KSOA 3VKWA 2ZI7A 1QVRA 1YZLA 2AFIE 3RS4A 4FWTA 1G8FA 1W4RA 1P6XA 2EFEB 2QEQA 3OFND 3HDTA 3HYTA 4XTRA 1NVVQ 1GUAA 5DI3A 3BBPA 2WSSA 2HJVA 2ZM5A 4AY2A 1RIFA 2ZI5A 4D80A 1NN1A 3KB1A 4WIAA 1U2RA 3NBFA 3BC1A 1SKQA 1UDXA 2C8VA 2VPPA 4Q4AB 5AUQA 2UZ3A 3IKJA 1XEWX 2ZIAA 1Q3HA 2EW1A 3NH9A 3PUXA 3GFTA 4PFSA 4I4LA 1UKEA 1ESNA 4RCYA 2QQEA 3OZXA 2VSOA 3KB2A 3PUVA 4AKEA 2X8AA 1AGPA 1Z3IX 3KQLA 1G4AE 1UKVY 3MRSA 3A36A 1R0WA 3U5ZB 1O87A 3U3OA 1YZQA 3BH0A 1GITA 2RGAA 3S1AB 2JLZA 3OEHD 1AIPA 3K9NA 4ZIRB 1R8QA 4AWXA 1CKEA 4FWIB 4D4MA 5EE0A 3T1OA 2ZSFA 3JVVA 1U8ZA 3HWSA 3LXXA 1YRBA 1Z5ZA 2ZI3A 3ICEA 821PA 4MKIA 2GJAA 2R6CA 3KXLA 3NBZC 1R0ZA 2QTVB 2C9OA 2GA8A 5GJBA 3DMNA 3CRW1 1E4VA 1W36C 3U3KA 1Z0JA 2JIZD 3K9LA 3ZZUA 3EPHA 5C4GB 1KO5A 2B8WA 1SHZA 4UQOA 4YXWA 2X77A 4JLVA 3ZVRA 2FGKA 4BPBA 2CJWB 3CH5A 2JLUA 3MWYW 4M53A 4TLEA 2Q6TA 4JVSB 3LAWA 3MJRA 4TMXA 5J4LA 4MDEA 2NO0A 4AD8A 3K0AA 3LX5A 5KYKA 3GJ0A 3FWYA 4WXRA 1HE8B 1VCNA 1JJ7A 1NI3A 1XTIA 3P27A 4II7A 4LCBA 2A5FA 4BFVA 3OESA 1MH1A 2OHFA 1UEIA 4IXNA 4G5QA 4JBWA 4PSVA 4XWAA 4C7OA 3SYNA 1P62B 3PXGA 3AF3A 2RGDA 5LBIA 4BLTA 4DUGD 2OAQ1 4IFEA 3CBQA 3X1DA 1D9XA 3KJHA 4NH0A 2Q21A 4YMUA 2BDTA 1US8B 1QG2A 3NBXX 1F5NA 4B2IA 4CDGA 3LO5A 1F60A 1EFCA 1H8HD 2FMXA 2GEDA 2AFHE 2ZI9A 2D62A 3C41J 4G5SA 5DHAA 1V5WA 5M04A 3GD7A 4KI0A 2W2XA 5JLJA 3P26A 4PPFA 3RC8A 1CJTC 1P4SA 1UBCA 1OW3B 1T8TA 3KX2A 1BMFA 5FBVB 3BK7A 5G53C 2XNDA 3QKRA 3CZQA 1XD2A 1Z06A 3ZIAD 3B85A 4B43A 4C0KA 2WWFA 4HEJA 3CH4B 1YR6A 2ZUDA 2QSZA 4EJSC 1SGWA 2GEUA 4FD2A 4LJYA 1E9RA 2JASA 1XJCA 4G01B 4M1WA 1T3LA 4LJ7A 1MO3A 2HYDA 2FPLA 5J4HA 1JAHA 2PT5A 2JJ2D 2F1JA 4CEJB 3L0SA 5AJZA 1Y63A 1N3BA 1TPZA 1YHNA 3ADBA 1ZUNB 1P73A 3A1VA 1ONBA 3B60A 1QHNA 3PR1A 3W3AA 1IOZA 2QA5A 4V0MA 3IILA 5E7IA 3CF2A 1G5TA 2QSYA 4HLUA 4JYBA 4R9UC 5KU1A 1XTKA 3PCRB 3MWJA 4DDUA 4IVRA 4AIIA 1FX0A 3LW7A 3ICQB 1AQUA 3ZZTA 2XTMA 1LVGA 1W0JD 3QNUA 5FR1A 5G40A 1E2DA 2GXQA 1SZPA 4YXWD 2HCBA 3DZDA 4V0LA 3AGPA 3T5GA 1TTTA 1U0HC 2JIZA 1T6NA 2OE2A 2O8FB 4GP6A 2GILA 2W6JD 4JIMA 1G1MA 2G83A 2QPAA 2BM0A 4C2TA 4HLQB 4CW7A 3R7WA 4ARZB 3GMTA 2GTPA 4FIDA 2J45A 4IEEA 2DB3A 3FE2A 3U7EB 4M1KA 2ZRPA 4MRRA 2WKPA 1XXHE 2KBFA 2W6IA 5FOUA 3W6NA 2Q9AA 2J0SA 3QXHA 4HATA 5DIFA 3S1AA 2HV8A 4PSKA 1NKSA 4LJ8A 5FPYA 3OEHA 1VYUA 2XTNA 4W5JA 4NYMQ 4CT5A 4RFSB 5KNBA 3NDPA 5L3QA 3NBYC 3VR3A 4A6XA 3F0TA 4V0KA 1QRAA 3TQCA 4DSNA 4IOMA 1TAGA 1D6JA 4PQFA 3AVTA 3Q8XB 1DG3A 4WZAE 2JGNA 2V55B 1NSTA 3N70A 1LY1A 4RKEA 3V00A 2BBTA 2B6HA 3P32A 1LF5A 4ZKEA 4DLZA 1EFRA 4FMCF 2PCLA 4TMKA 5CM9C 4HDCA 3SU8A 3I72A 3B7GA 4DB2A 1IY0A 4FMDF 4RCZA 4Z1MA 1D2EA 3TGPA 1AS0A 1NN0A 4DZZA 3SFZA 3IIJA 3LVRE 4HZIA 5L3QB 1XRJA 3AP2A 3BIFA 2XJ9A 4RD2A 5ELXA 4C9BA 4V03A 3CO5A 5JCZA 3LD9A 3B1VA 4NPHA 2UVQA 5CIQA 4TL9A 1AGRA 4FMDB 1II9A 3IEVA 2PT7A 4YONB 5FL3A 3Q7QA 2GCPA 3MJHA 3SBDA 1ZIOA 3I5XA 2WMOB 1A2KC 721PA 2JJ1A 1U0LA 3AH8A 4RZXA 3K09C 4KBFA 4BLSA 1UF9A 4JVLA 2A5GA 1DE0A 3ASZA 1KOFA 4LC0A 2ZRKA 3GLIA 3O47A 4DC9A 4JVMA 3W5JA 4V0ME 3QSYA 3AP3A 3BWDD 2V6IA 1S0UA 4AYXA 2OBLA 2VSXA 3OE7D 2ODWA 1NVXQ 2WTUA 2ZR9A 3ASYA 1XTSA 1E6CA 3EARA 1KI6B 4NYMR 1TQ2A 3GJ3A 4O3MA 1KZGB 5DISB 4P4UA 3D6TB 1JXMA 4OI1A 4RKFA 1II8B 2NPFA 3KFXA 3RS7A 1N6OA 4CZ2A 1Z47A 4Z54A 2VTKA 4HSEA 1XD2B 1A82A 4AYWA 1JR3D 1P3JA 3CRRA 3WP1B 1KI1A 1SXJD 1Z6TA 1XU4A 3OHMA 1ZRHA 4H1UA 3U6BA 3WMFA 1VKJA 3GLGA 2ZU0C 2J59A 1KI6A 5AJYA 2ZI6A 5EUQB 4CEHB 1F3OA 3I8SA 1LNZA 2XXAA 2R6GA 2ZJ5A 1SVWA 1L2TA 4A82A 1II8A 3T5DA 2WWIA 4DT1A 3BE4A 1W1WA 3MUFA 1N6NA 3CIOA 4QGGA 2V8OA 5IK2D 3I61A 2GXAA 4US0R 1JPJA 2B92A 2NO9A 1ZM9A 1KSGA 4NCNA 1C1YA 3AVQA 1YKSA 3H86A 4Z1MD 2CCKA 5IHPA 5LD2B 2B7CA 5JZVA 2QPOA 2FE4A 2FN4A 2MSEB 2Q0HA 3PUWA 1DAKA 5LB4A 3SYKA 4HAUA 1ZC4A 2A30A 4IDOA 1NIJA 2GAAA 4EAQA 5EUMA 1J90A 1HEIA 1I4TD 1JQJC 3LVQE 1Z29A 4JL8A 3FGNA 1OSNA 3I92A 2VP0A 2W2TA 1RRPA 4OHVA 3ZD6A 2XNSA 1CULC 1Z07A 2UZIR 3GFOA 2GCNA 3RABA 3U7FB 1WA5A 3Q85A 2RH5A 5SZHB 2IX3A 3WBKA 4DLTA 2REOA 4V02A 2GHIA 1G64A 1OKKA 1A5TA 2DFKB 1E96A 5E7MA 4LDJA 1R5OA 3PQCA 3UPUA 3K0AB 1NBMA 3A37A 3D7MA 3WNBA 3U6KA 4O25A 2X2FA 2C03A 5J47A 3QPUA 1YJ5A 5FOTA 4ESVA 5F3WB 3CNNA 5FBLB 2WOOA 2DFNA 1E2IA 1U99A 2OBMA 3QQ5A 2ZYWX 2Q3FA 3JZMA 4WAUA 4B6EA 4B48A 4D82A 2VQSA 2OFOA 1FNNA 2PH1A 2QMEA 4E22A 2IF2A 2IYUA 3C5CA 4XOIA 1E3MA 3NH6A 1R0XA 2J7PD 2IYSA 4IOLA 5SZIA 1LF0A 1RE0A 2YV5A 3CWZA 4DKXA 2IK8A 4IJMA 5B30A 3K09A 2AD5A 2NO6A 3GLIE 1C9KA 1H65A 5CIWA 1FTSA 5HCNA 5JI2E 1DADA 4A0RA 1MV5A 2N42A 3AEZA 3CF0A 1DVRA 1K8RA 2HLDA 3B9QA 2WV9A 2HEIA 3EG5A 2IWRA 1PLKA 2GETA 2ZJOA 2WWHA 3IIKA 4F38A 1IN5A 3QKUA 1Z6AA 5JJLA 3GJ6A 4OQLA 4OKSA 1YZKA 3KQNA 3GCGA 3AKEA 2D2EA 4HZUB 4B3GA 5FBWB 3SDZA 1GNPA 2PJZA 4G3XA 1E4YA 4OI2A 4BFYA 1E1RD 3TUIC 2WSSD 1TL7C 2H18A 3AP1A 3DDCA 5H1YA 2JLYA 2CCJA 4Q18A 3PJRA 1F2UA 1VCMA 1YRAA 1ZNZA 1FP6A 4PZYA 1Z22A 3THYB 2PL3A 2IC5A 3PVSA 1QHSA 1E2JA 3RHFA 1N6KA 2OXRA 3A1SA 4EUNA 3ZLJA 3UWKA 3U61B 2WWWA 5F9FA 2F9LA 3KTAA 5JHHB 1ZD8A 4ZCLA 3SHWA 2VYFA 1EFUA 1G6HA 3AKCA 4FN5A 4O2LA 4PZLA 4M4SA 3EX7C 2A3RA 3QEOA 2A78A 3UIEA 3N2IA 4AYTA 2RGXA 1KNQA 2NO7A 3AVPA 3ZH9B 3R7WB 3RS5A 4TLCA 5AWFC 1BYIA 5EZ6B 1Y3AA 5L3VA 1D2NA 4KFUA 2C9YA 3B1YA 1KI7A 3KJEA 2GJSA 2XZLA 1E79D 1HV8A 2ATVA 3FVQA 3MMPA 2YWGA 2FSHA 4DCSA 2VIIA 4BFZA 2AL7A 4OI4A 2QE7A 1T3SA 2XEXA 3EIHA 2G77B 2IEZA 3PENA 3C16C 1R4AA 3DM5A 1S1MA 2G1JA 2ZAMA 4HAWA 5KPJA 2WBLC 3B8HA 2QORA 5JS8A 3LLMA 2HUPA 2ZJBA 4TZ0A 5J5CA 3VMFA 4CRWB 1TMKA 3QF4A 4D81A 4DBLC 4I99A 2HCJB 3L43A 1FFHA 2TMKA 1N25A 1XMJA 2E1RA 2VBCA 4KLZA 4EPYA 1XPRA 2J1LA 5KUTA 3UXMA 2IYZA 2PZFA 2RHDA 2JATA 5B57C 3VTKA 1N0UA 3MFYA 4AKGA 4D0LB 2QGZA 1HYQA 2ZRLA 4LPSA 1EFRD 1KJZA 5CB8A 1E9CA 5KO2A 1MR3F 2F3TA 4IDHA 4KYIB 1UPTA 2FG5A 3LV8A 1Z2CA 2G1KA 4LBVA 4JZKA 3GP8A 2CMKA 2OCAA 5J40A 2XZOA 4OHYA 2GK7A 4OL0A 4CVNA 4JLBA 1IONA 3NXSA 5FTJA 4NCIA 1A4RA 3OIWA 4D0GA 1ESMA 3L0OA 3TVTA 1U0JA 1AM4D 4D6PA 1I2MA 3K0FA 1NRJB 2GRJA 4JS0A 5H8WA 3A58B 4MYCA 4D2IA 4DCTA 4QC2A 5JRJA 5JWOA 3RLFA 3FMIA 3EPJA 4QOSA 2BBWA 1AJEA 1C4OA 4I1SA 1ZD1A 2F3RA 3QIAA 3RS2A 4DLXA 3TK1A 2GF0A 4HAXA 4OJKA 2V54A 2Z43A 2ZRAA 2NTYC 3WP0A 2IYWA 1E2LA 3MD0A 1FQKA 4HUTA 3REGA 3FKQA 3QVVA 3ZVNA 2PMKA 3TSOA 3AVUA 3NEJA 3SZRA 5EZ5A 2KI5A 1CIPA 4P32A 2LCFA 1E32A 3RANA 1FUKA 3EPKA 2DY1A 1FZQA 3B13B 3THXB 4LJ9A 3VU9A 2ZRIA 4GPTA 3W6OA 2V9PA 1WCV1 4NCKA 4EPXA 4BFWA 5A4JA 1F48A 1OYYA 4X8LA 5FTNA 3B78A 1D8TA 4W5HA 2QP4A 3CWQA 1QHHA 2XXAB 1NMYA 4XWOA 4Z51A 4MYUA 1K5GA 2QG6A 2IS4A 4E5UA 5CLLA 1KI2A 3IQWA 1AKEA 4HB4A 2QTHA 4B76A 2ZRFA 4V0NA 2QMUA 5H68A 5C2JB 1Q1ZA 2BEKA 2VO1A 1GP2A 1G3RA 1ZM4A 5EXPA 3T35A 2CL7X 1Z6YA 3SOPA 2H16A 2PZEA 4FMBB 2XZPA 1GNQA 4PC7A 1KI8A 1K5DA 2FH5B 2R6DA 1KDTA 3NHAA 4DEYA 1W36B 1NLYA 4RD6A 1ZUHA 4NBSA 2P0EA 3FHOA 1VIYA 5J4VA 4WVFA 1Z8FA 2AXNA 1KTVA 2REBA 2ZE7A 5EE5B 4G5OA 4CEJA 5EP3A 2WVJA 1BMFD 3BB3A 1R6BX 2X1VA 2YWHA 3TH5A 4B73A 4AKHA 5H70A 2VEDA 4IOJA 1T8UA 3TR5A 1T5LA 2QZ4A 2RHMA 4TSFA 2AWNA 1FW6A 1IJEA 3P4XA 4UKDA 4DLYA 4E07A 3AB3A 3NHBA 4G5RA 2FSFA 3UK6A 1MABB 3QPWA 1R2QA 4PXAA 4MDFA 4URZR 4F4IA 2NZ8A 4Q9IA 4FXPA 2C78A 1GKUB 1XXHB 4LK2A 5KDLA 4F4CA 1YVDA 2FJUA 5L8VA 1S96A 4B6FA 1G18A 5GJWC 5BWMA 3C4JA 4KYUA 1P75A 4KLNA 4LUCA 5C1BA 4XVQA 4HAZA 1JJVA 4DIEA 5FPTA 2DWPA 5FR2A 3T12A 5HR5A 4KVAA 1LW7A 4Q1BA 5BQ5A 1XBTA 2YC4C 3QEJA 5CDFA 3UG7A 1M6NA 1M1YE 3KKOA 1HA3A 2GK6A 3LRPA 3W8NA 3ECCA 3K53A 1R5BA 1XTRA 1E99A 5JEEA 1G8YA 1LFDB 1E1QD 4C7OB 4Q5IA 1IN7A 3H2YA 3IHWA 2F6RA 2V4ZA 2W6JA 5TVKA 1R0YA 2Z4RA 4S2EA 5JMTA 2IS6A 2GVZC 5FOSA 4S35A 4TWZA 1US8A 1NJFA 3T1VA 4EIWA 1U90A 4GNKA 4D0NA 1N5KA 1TF5A 3A4NA 1ZP6A 3KJIA 3LBNA 1P9NA 4A6PA 3U7HB 4Q9HA 2ZJ8A 2QP3A 4DDVA 1YR8A 5EXTA 2C9CA 4QBGB 4QJ5A 1E98A 4KFTA 3UKDA 3DVLA 1VG0B 2BKUA 3K0CA 1E0JA 4UJ5A 2RGNA 5HPYB 1RVDA 1RJ9A 4N1AA 3WY9A 5EE3A 2AK3A 1S9HA 4I81A 1ZYUA 2WZQA 1KIMA 2J0VA 3WRXC 2AN9A 4CEIB 1DARA 3EA5A 8OHMA 2GEVA 3AV0B 2OT3B 3SR0A 4V0OA 2F43B 5K8TA 4YC7A 2BCJQ 1G16A 1Z0DA 3K0EA 2HXSA 4UNPA 1S3GA 1S3SA 2F1IA 1X8LA 4TL7A 1Z28A 2H8KA 3CF6R 4Q4HA 1QZXA
chains in the Genus database with same CATH superfamily
2P77A 1B76A 1FNSA 2ZRJA 3JZAA 4QVGA 4YRPA 3RTGA 3SF0A 2OP0A 3H5IA 4PPYA 3HMQA 2O2CA 3NTXA 3RU2A 4CETA 4B71A 2VZ8A 3QBTA 1ISJA 1M3SA 3VHRA 2NP6A 1RAFA 2H07A 1YFZA 1EBFA 1T15A 1GL6A 3DPUA 4LHXA 1P2TA 3PC6A 4FCCA 4GI5A 4X7PA 4YUZA 5ILOA 1Q20A 1O96A 1SBCA 3D2BA 4WI1A 1FX1A 2CWDA 1FVXA 3KT6A 1TKRA 2CUKA 2N9UA 4W5TA 2JCVA 2F1RA 4HGZA 3K8QA 5T4HA 1R50A 3F78A 1ELOA 4NRDA 3GEPA 2XQKA 3TAXA 2WP8J 2DFVA 3PDIB 4JKIA 1HSZA 1GQFA 3GP5A 2JEYA 4MVYA 4RESA 1ABBA 4Y9RA 2DVMA 1KGSA 2P6NA 3DTVA 3HLYA 5FLYA 3VH2A 2OV6A 5F2OA 4BX0A 2C4MA 1KS2A 1OAAA 4I6EA 1WTCA 4RF4A 2VA9A 4WK0B 1E6EA 2Y0BA 3DTVD 2O14A 5A3VA 3U39A 5KWSA 5JAHA 3VHLB 3AOGA 1ZJ5A 2RC5A 3VYSB 4UCFA 3TOXA 1E9FA 3E58A 1CNMA 1ZONA 4UHFA 1JV2B 5K3FB 5KHOC 5A2QA 2Z0MA 2N46A 3WMRA 3KYJB 4E33A 1IPHA 3O2SB 5D7NA 4PRZA 1B6RA 4IG9A 2Q3HA 3CVUA 3UAYA 1TKBA 3CLKA 4G1BA 1XLTA 5AVWA 2FSVA 1G2OA 1LB1B 5U1PA 2JANA 4B84A 1RPZA 4Y2PA 4GI2A 4OD0A 1K0UA 1UFQA 2J5KA 1G3QA 4FSDA 1UKZA 2GNAA 2Y1XA 4QGHA 4D99A 5C5CA 2KB0A 3A10A 5GIPE 1QVAA 1AF7A 5EJ5A 3W5CA 3V1MA 1KDOA 4EG6A 3BL8A 2AI2A 1RAAA 1DO8A 1ZGJA 2WHXA 4Y6GB 4Z9YA 2ZB3A 3CGGA 4TRJA 2ZROA 1WZEA 1IN6A 2QAGC 4G9BA 4C06A 4ENRA 1FJXA 1GKLA 3H7AA 3KO8A 1BXGA 1NM5A 3QLUC 4Y6OA 2IOYA 2VHYA 4IRUB 4JL6A 4ACBA 5AOBA 4W7SA 2ZVJA 4S1OA 3BQMB 1G20E 3SMQA 2FDCA 3L0IB 3BVPA 4H7KA 1JYEA 3P94A 4INPA 5KTRA 2IXEA 3HVJA 3FNFA 3VDMA 4YV2A 4A10A 4R7ZA 4QJ4A 2CV1A 1XU7A 1L7OA 2J5RA 2YC2C 4QWWA 2QRMA 2EEPA 1GGKA 2PMBA 2X8LA 3AMVA 3CVOA 1W4BA 2F8MA 2G17A 3D6VA 3LHDA 4IHQA 4JU9A 4OBBA 4Y7DA 2Z6AA 4BIIA 2WWXA 2FI1A 3BE8A 4TQGA 2QJWA 3WRXA 3I1JA 2FCRA 4MAFA 2FZ4A 3ET4A 1BE6A 1YA8A 2B25A 3U7IA 4OTZA 4OGWA 4LWPA 1FFYA 3GLIB 1ZK2A 3RWMB 1YIAA 4RSGA 2NO1A 3PX7A 3OZIA 3FJ1A 2A5DA 2W6ID 4D9NA 3U37A 3RFUA 1BE0A 3TSCA 5GTDA 1QHXA 5I9TA 3E84A 3QI2A 3WL5A 1HZZC 1PJRA 3EZXA 1O97C 2PX5A 1YL6A 3HV2A 3QYPA 1EDOA 1XD9A 2X8JA 2H5LA 3GVXA 3R0XA 5DBIA 1ISSA 1E69A 3O92A 4HQNA 2ZFUA 2CXTA 3GFQA 3RSOA 4HGQA 5EIAA 2WFLB 1KYWA 2XIQA 3MNFA 2PYIA 1SMKA 2VHCA 1U1EA 1VLZA 5GV7A 3V55A 421PA 1VHDA 4LC9A 3VYRB 5IKEA 3K70D 2GCOB 1CUEA 1ID1A 3EZ7A 5EZYF 3UC5A 1BCSA 4RVHA 4F7DA 3DGFC 5FX2A 1QLJA 1NBMD 2NYUA 3CEJA 3QXSA 2IYXA 5JH7A 3OTOB 2WB4A 1COZA 1XEXB 3QPVA 3VR6H 3V9AA 3IA7A 3COJA 5HJ5A 1LLUA 3AKZA 5HS6A 3IOEA 1UBUS 5ALFA 4OFXA 4PLZA 4ALKA 4BGDA 2NWQA 4K9QA 1OXUA 3GRPA 3R23A 1N2BA 1XK6A 2FPWA 2I78A 2VLIA 4F3YA 1X80A 3L7LA 3G7UA 2NYVA 4ZK2A 1N1EA 1JR6A 3P9QA 5F12A 5GWXA 1KF0A 3MXTA 1VPDA 2XCTB 5LPNA 1EUCB 1UT6A 2HA7A 4D98A 2ZJZA 4DPKA 4R6WA 1R0KA 2C5HA 3K71B 1YS7A 3GJ5A 4UMVA 3TCKA 2GCOA 2EFDB 1T9ZA 3D6UA 1RRKA 2AEJA 1BCSB 3A8TA 3FLBA 3OF3A 3I9V1 3D64A 4X54A 2OQRA 3FZGA 1DQNA 2ZS7A 4DADA 4LOKA 4ZMSA 2W83A 2N1MA 4OK5A 1KZ4A 3S8EA 1E77A 1TUGA 4CBVA 3SQOA 10MHA 2FAXA 2JIMA 1DTSA 3A4MA 4IDNA 1SXJB 1Y37A 3C5HA 3F97A 1G2IA 1O6BA 1VRCA 2PMFA 3EYAA 4E14A 2EBHX 5BUSA 1QO7A 3NEYA 1DAFA 3KTAB 5BRAA 2QZSA 3MM4A 4IQFA 4MVCA 4OFZA 3UGJA 1KI4A 5ELMA 2H54A 4ZVNA 1L1FA 3OEWA 1OYVA 3PQ4A 1BDMA 2HJGA 1NC1A 2QE6A 3IMKA 5TQ0A 3KJGA 3WQQA 4WZZA 4A2WA 2BFPA 4FD3A 5JSZB 3OZFA 2N1BA 5ESWA 5EIBC 2KLHA 4BFSA 2BD0A 2G4CA 2REQA 2ZSBA 4L2IB 4P38A 4B3XA 4E4YA 2F62A 4LXQA 5FTMA 1O08A 2JA1A 3CMMA 2JI8A 4RX1A 3B2EA 2R47A 2QTNA 4IZOA 5COAA 2GJ8A 1RQGA 2ZLBA 4JLAA 4JLSA 4OB8A 3GY0A 2GRAA 4MAAA 4AX4A 4OXNA 1H5NA 1LI4A 4WXPA 5IDVA 2Z83A 2W70A 3JPYA 3KPJA 1U1IA 3PRKE 4FC6A 4NYIR 4YP6A 5TQ0B 1RI2A 1SQ5A 3NASA 5JJLA 3FPAA 2YXEA 4KIFA 4X5OA 4Z4HA 1KPGA 1K7CA 5A4IS 4M0MA 3UVEA 2JHGA 2OV8A 1EK6A 1LVHA 2ANBA 2YW2A 5AHOA 4E2XA 4QRDA 3WLJA 3M5DA 3ZDXB 4E0BA 1A8IA 4NBRA 4U7GA 3BKWA 3QE2A 4IIHA 2DR3A 3F5DA 5CH3A 2X5KO 3B8EA 2O8CB 3CT4A 2WDZA 4ZOEA 1K3TA 1FS4A 3ZJ5A 1VRVA 2IYQA 1NNI1 3HBJA 1NVFA 2CDNA 2HV9A 2QR5A 1NXSA 2LRHA 2R1VA 3H0KA 3HABA 3MIZA 1EGAA 2QD1A 1LLFA 2NO5A 3KD3A 2XYRA 3KOYA 3WLNA 4EPWA 2B1JA 1IK6A 1C4KA 4YGYA 2VDJA 2X3YA 4P31A 3WGGA 1X70A 3QVTA 1IHDA 3UHJA 2QLTA 4GP9A 3ITEA 5B3AA 1FDRA 3TGLA 1T43A 2HSJA 3W2HA 5CG2A 3SF8A 1G3MA 3E05A 2JEOA 3L9WA 1H2EA 3ZY4A 3QEMB 1B8PA 4CCAA 3ABZA 1TJ5A 1Y1KE 3D6FA 2QHXA 4L51A 4OHRA 5FOWA 5FUXA 4KOEC 1OZ0A 4UM5A 4B82A 1TQ4A 1E66A 2YX1A 2EBUA 4S24A 3TJRA 1IULA 1V7CA 2Q2OA 3SS8A 4BUJA 4JR2A 5LDHA 2B1GA 4P81A 2V5VA 2WWYA 1Y8ZA 1GZ7A 4OG2A 5ALRA 1NLZA 4C89A 1QM5A 2LBPA 1XYYA 2H4XA 1BEEA 4KYVA 3THRA 2DQYA 1Q1QA 3LDAA 5JCPA 2HQRA 4GBED 1YFKA 3IXMA 5AKEA 2OYSA 4YXFA 5CFOA 4IIDA 1AKTA 2K6GA 1KXJA 1ZX1A 3S1LA 5CVDA 2IPNA 1FDUA 3EPPA 3DYVA 5KOHA 1PRYA 1ZD3A 1ZVQA 1JLKA 3CNHA 3DEKA 4MKHA 4WLOA 3S0JA 5JAIA 1N2CB 3I45A 1VKOA 2IV2X 3VR4A 4H16A 1O3YA 3O21A 4MPJA 1QIEA 1NDUA 1ECBA 1P6QA 2J5BA 2H9IA 1KSJA 2PXAA 3GPBA 4N54A 1E1NA 2GWHA 1IQ0A 5KBYA 4TRRA 2C1ZA 5TT0A 3F6YA 2MWMA 2XKJE 4PAGA 4AJHA 1CUVA 1SBHA 5H3HA 1E7QA 4F93B 3DE6X 4L8FA 5IAOA 3PXUA 3AF0A 3MJDA 3CONA 1U0EA 5CLHA 4Z0PA 4GVXA 4OGFA 2CKDA 4J16A 4A6EA 4AMZA 1U9YA 4DV1B 3A6LA 5DTQA 4AZWA 1JFFB 4OQNA 2OHGA 4RAOA 2WJ4A 1IY1A 4PRYA 4AJEA 1SEPA 3DEZA 1FMFA 4P8RA 4H77A 1WXQA 3BSWA 4EY8A 2O2JA 2WQ6A 1RC0A 1ECPA 1IAQA 3IKVA 4QXMA 2O8BA 4EGCB 1W34A 3PFNA 5FPHA 4RTSA 4MUYA 1YB4A 3RTDA 3CG4A 5G1NA 1ADFA 1OZGA 3DOJA 4COOA 5CU7A 2VYCA 4BN5A 5CFMA 5IH7A 1ECLA 1M1XB 3O9ZA 5TMDA 1E9BA 1ODJA 1X3LA 1GZHB 3II6X 2ET6A 3P19A 3HR8A 4X0EA 3TRHA 2WU0A 4CM8B 3UOWA 4QULA 2DH5A 3G88A 3PRHA 1KDRA 2GYWA 1QRSA 3EZGA 4DLUA 1OX6A 3IOCA 5K3AA 3RWBA 4QSMA 4Q48A 3AVWA 1TCVA 4MUMA 1JG1A 4C4SA 4MQBA 1OA0A 1RS0A 4GQAA 4WNYA 3TMKA 1XZKA 4CTJA 1K6JA 2BI8A 3I6MA 1XNGA 2V74B 5KX5A 4PEVA 4ZYLA 1QUEA 1ZH4A 1K4MA 4TPKA 5DGDA 4E70A 3ZKWA 1M5RA 5AW1A 2Q8QA 3KP1A 2HLPA 3E81A 2RGBA 4E5VA 4NCBA 4PR0A 1GAXA 2P2SA 2ZQ5A 2CXSA 3SLGA 1ABEA 1T8WA 1H93A 1T24A 2G06A 3NXKA 4C4TA 5L3SB 3SS7X 4ZI7A 3G2KA 1U8AA 4DPMA 2XE8A 4LV8B 3ROKA 3PF9A 3I6IA 2WJZB 4KQGA 3B3GA 3L4BA 4QKQA 3A1WA 2XNDD 4K8OA 1VYTA 3CX7A 3HXLA 4BX9A 1BDBA 1ECGA 3GELA 1JEDA 2ZTUA 4WQMA 5CLGA 5I8ZA 1XJQA 3H6KA 3NNNA 1H8ED 1J8FA 2FQWA 2OBYA 3F5SA 4PSAA 2A7QA 1ZW6A 3CG0A 1A9ZA 4NOKA 3ZWYA 2VC2B 1I4EB 2AYZA 3OIYA 1CY8A 3PX2A 4ISCA 1A50B 4INJA 3TZ6A 4MICA 3B5JA 3QE0A 4A03A 4BLQA 1GRNA 2GZSA 4CKBA 3DP9A 3IBFA 2Z3VA 2OBFA 1EG7A 4NTZA 4ZREA 4F2GA 4W4TA 1KK1A 4TT3D 4ZI7B 3TSWA 4GX1A 4J0CA 2A35A 3A6DA 5FQOA 3RIHA 2HB6A 1NJ2A 3EGDB 4OIMA 4IDDA 2L2QA 3AWIA 4BGUA 1GGEA 2Q46A 4LA4A 1JI3A 4NIMA 3IPCA 4D3FA 1NT4A 1QE3A 2Z2XA 3KKZA 3LU1A 3M8KA 1ZRNA 2Q9BA 4HR7A 5FH9A 3B1XA 1CUYA 1QYXA 2BZGA 2MINA 2IOHA 4ZRNA 3DOEA 2CYAA 4J49A 5H82A 3HR4A 3O74A 4FYIA 2GM3A 4B2PA 1N5RA 1QH8A 1Q74A 4Y2VA 2XVYA 3U60B 3OY2A 4BLOA 1J99A 4DSUA 3AR3A 2ODBA 4N4AA 1XF9A 3LS2A 1ZN8A 4Z4FA 3N2YA 2CMDA 1VHLA 3L4EA 4UVIA 3ORSA 1YOVA 4D4JA 4NXNB 1XRQA 3FMPB 2HJRA 1X8XA 4M8LA 4M1YA 2H1RA 1L4GA 3KT8A 4BE7B 3CJTA 3BICA 3NJRA 4U1RA 4AMVA 1TZJA 1UBFA 1H23A 2QJRA 1WVIA 5JVDA 1IK4A 1AXRA 1NVAA 3AEYA 1N0WA 4KC0A 4OUDA 3RWOA 4EY4A 1Z25A 4K3VA 4UEOA 2C1XA 3LY5A 1W0JA 3GJSA 2P68A 4B3CA 4ZO7A 3G8DA 2O3TA 2ZWOA 4K28A 4ZANA 2JGLA 1ORDA 3CX8A 3NRCA 1RJGA 4QYWA 3R7SA 4ARAA 5LP6C 2Q7DA 3VVMA 4AN0A 4HNVA 1VMAA 5AVXA 1I80A 1YOVB 3QU4A 4MMYB 2IYTA 3ESCA 5JYEA 2OO5C 1T29A 4KIUA 3WJ7A 3NALA 3P9YA 4UC0A 4WL0A 1GZUA 4XCQA 4W8GA 4E1AA 1USGA 4FDUA 1RJFA 4E03A 1KU0A 3L4BC 4ZQFA 1CYDA 3FYHA 3RUHA 1F1JA 1RWNA 1TZBA 2OV3A 5EIOA 1E2HA 4LXHA 5D3QA 3TSZA 2B98A 3D6HA 1H3FA 2CL0X 2FWBA 3AKDA 1JRLA 2JGEA 3L7OA 3G89A 3JAWA 3RIEA 2HJSA 1HMYA 1PQ4A 4DKJA 1T8PA 2XPCA 3HO8A 1HL3A 4EJ0A 4NP6A 1FNDA 3DMHA 4FGZA 3WIVA 5KWEA 4CL2A 3ND8A 4RSRA 2AHOA 1P8AA 3BWBA 1H1TA 1ESCA 5BQOA 4FHGA 5ERYA 1IEWA 4X65B 2VJAA 4GT1A 1DL5A 5LQRA 1RKXA 1ZA2A 2V7QD 2X6RA 3RD5A 5AM0A 4H2DA 5L6LB 3L8YA 4IJ6A 2IYAA 5ALTA 1Q15A 1F2VA 3K5IA 3QVLA 4B80A 3T1NA 2AXPA 3WADA 2DE0X 2MSKA 4I55F 1PR4A 3KL4A 4F8YA 1U81A 1E94E 2H1LA 1Z2AA 2DQKA 3CF4A 4JX9A 2XTZA 1ISPA 2QM3A 3FFWA 1VL6A 3TUJC 2CEAA 2M32A 3HKBA 3WB9A 5AKGA 4DM7A 1VCIA 3HN2A 1EXMA 5C5DA 1YR7A 3EFBA 1B0UA 1REQB 3GFSA 3SJ7A 3VOAA 1GLVA 2DMRA 4ACAA 5T4BA 3C3CA 3IX7A 3Q8MA 1B93A 1HQCA 1GPAA 2WHEA 3QX7A 3SJAA 4OBEA 3PFCA 2FV8A 1RMTA 2BJWA 2WIAA 2FVXA 1YQUA 4DUPA 2MR6A 5DGIA 5FL7A 1WABA 1EX6A 2VUTA 3K3PA 3PLAE 4LZZA 1O6FA 2GPNA 1ZZEA 2OWEA 1EM6A 3ZJUA 1GU0A 4M8NE 2I2FA 4QJBA 3LFUA 4W9MC 2EJBA 3B9BA 2LGJA 2WMNB 4E08A 1CHNA 4GSYA 3CINA 3GEMA 4FGSA 4HZGA 1O8BA 4UCWA 2NM0A 2BKVA 4OO3A 3CE6A 4ZOAA 5L4NA 2Q3JA 1AK9A 5BW8A 3SLKA 1CD5A 4QODA 4MWOA 2NSDA 4C3ZA 5ED4A 1SUPA 4FFBB 1ENYA 1WSAA 8ADHA 3OZGA 1AD2A 1VHTA 2B4YA 2PGDA 3EA4A 3FB4A 2JJ1D 3N8IA 4O1MA 4PG8A 3WWEA 1B8UA 1GYQA 2QRKA 2ZKLA 2UUCB 2VWQA 4Q05A 2BFFB 3ROXA 1J8VA 1QXSA 3L6DA 4JJKA 2JIDA 5JNWA 2WYWA 2V5UA 2Z9DA 4M0EA 4BNMA 3QF7A 4M6WB 4TMFA 5BQ3A 3VPBA 2IODA 1NW7A 3T7KA 2Q5QA 4CMHA 1POWA 4J9VA 1YB7A 1OLXA 3OAAD 1QQ6A 3EA0A 4QO8A 1NVUQ 4ZGWA 3EK2A 2DGDA 3QV1A 1WCWA 4F2HA 4KK3A 1SY7A 2BISA 4JI1B 2YASA 4FFBA 4IJUA 1YJ8A 2HQ1A 1PZXA 4MKFA 4YHHB 1PYDA 4IRXA 3EH2A 2OMEA 3AF1A 4FJ2A 1UFRA 2H2IA 5IT4A 4MP3A 3DLPX 2RCNA 3K2EA 5C7IO 5AM1A 2X4IA 4Y1GA 4KXNA 3QFHA 3CZPA 3KBOA 4GZLA 2XNCA 1U02A 2VFAA 4IIVA 2D59A 3PNSA 3RS9A 5AW0A 3TG2A 1KQ3A 1OLOA 1EVYA 2KHZA 2PLWA 2YJGA 3CEAA 1OTHA 4NWIA 3LQ1A 5DGXA 3T7EA 5DXAA 1KMIY 4WJKB 3SHVA 3QKTA 4KO8A 4UBKA 5F51A 1KJYA 2YVLA 2Z58A 3FAKA 5IEBA 5J2UA 3QKRB 2YZ7A 1CYEA 1KARA 3JASA 5EA2A 4A8HA 2OM2A 1U1CA 3VI4B 3KQQA 3MAAC 5CEJA 4O2AB 1MX3A 3VDNB 4YJHA 4FBLA 1PFGA 4MQUA 4AQ7A 2GUWA 2O8EB 1OI3A 1KJNA 3A6EA 1XZGA 1EHCA 2VDUE 4GGPA 2ZREA 2BCGY 1ZGBA 5TMPA 2JIBA 1JHUA 3I12A 3USZA 3ODGA 2A2ZA 5AVOA 1KQFA 5K0NA 4GIBA 4KFSA 3DTTA 4Q19A 1N57A 4TV9F 2YJTD 5TT1A 3OOYA 1TC2A 3DZJA 4ZT5A 4QATA 4UCQA 3V2GA 1UBMS 3T06B 1DPGA 1JIUA 2Z5FA 2J31A 5C7LO 1G8PA 4KGXA 3R44A 1SQ0A 1QHYA 4DLWA 2ZIZA 3I6QA 4I9FA 3RS0A 3U81A 5BVGB 3L7BA 4NF2A 5K0JA 4RXMA 2XGMA 3ONNA 4UATA 4I6GA 4IZHA 3P97A 4LYFA 3IDQA 4DSTA 5KQSA 2C4WA 5F7OA 5L7YA 5AT1A 1ZUIA 3FKSA 3SM9A 4L8LA 3SSNA 1KAEA 4XXHA 3DT9A 2AK2A 3TWOA 2SICE 4J1TA 3D0QA 1TCBA 3LA8A 1EBBA 4U9HS 1L6IA 5JU6A 1ARZA 2DHCA 2ECQA 2XA9A 3K6JA 2Q3LA 4G2NA 4MROA 2Q28A 5TMBA 4CG1A 1AQNA 3DUFB 2PSDA 5T64A 2Q27A 4OHMA 4M8IA 3R8FA 4Q03A 1BMDA 2ZETA 2ZZKA 4JJZA 5H59A 1C30B 3V6MA 1FSSA 1ZEMA 4YMTA 1FPQA 4ZMRA 3H2BA 2XAUA 4B45A 3F3KA 4DV3B 2EP5A 1MGOA 1OXBB 1TAQA 1FVOA 5DNCA 3AVYA 1EQUA 1PLLA 1U94A 3L1IA 3QOFA 3L82B 4PXYA 3BAZA 1PNVA 2GTHA 1KH1A 2BMWA 3HPRA 1ICEA 5AI8A 2PGIA 2YZKA 4OLAA 4L5IA 1I13A 3K72B 2UKDA 3W5VA 1U7ZA 4H6PA 4WESA 1QQ5A 2G9NA 4EUSA 3HM2A 1ES9A 3QU2A 4QRHA 1JEEA 4Y6RA 1N0IA 4BNYA 3LUHA 4A8PA 2HRRA 3FPBA 4QM7A 4QOHA 1TT5B 3RYFA 1DKNA 1OROA 1GU1A 3GCDA 4FYMA 5LIPA 4Q1EA 3BULA 2X13A 3BD6A 1U3WA 3LK6A 3PDJA 5ANRB 1SVLA 1WHSB 3LNCA 5IBPA 4J6EA 3L05A 3ROTA 5L3ZA 3JW8A 1P5HA 1T0UA 1E59A 4HFJA 5DKFA 4FHZA 2ZJ2A 1B74A 4TN5A 4XI9A 3TQHA 2ZK7A 3IQZA 2BZ0A 4FFMA 2SKEA 2ZE5A 3AJ9A 2P0YA 3B1WA 3RRYA 4ZIRA 4C5AA 3R8CA 5JS8A 4KRYA 3TI7A 5A05A 3I6YA 3BB4A 2O3SA 4X1KB 4C29A 4EYOA 4YLYA 4BO7A 3RNLA 2C8LA 4EG0A 3ESZA 2CMHA 1Z2OX 3HB4X 3INRA 5M7EA 3FOBA 2NT4A 4HUJA 4OSPA 1FTNA 5CX1B 4CUJA 4UUBA 4YUWA 3L7NA 4NONA 1CZKA 2NN3C 4NQRA 4BHTA 3IGFA 4ND7A 2MYUA 5B55A 5J2TA 4CHGA 5T7BA 3EGEA 1GZSA 4CDNA 3RYCA 3NOVA 1DUSA 1RRMA 2DP4E 1MN6A 1M6VB 5ALSA 1T2AA 4LRWA 2ABWA 2Z1DA 1D0SA 2QRNA 5GM2A 4CCYB 4CMAA 4YAEA 1NR5A 1W35A 1Q0ZA 1EPUA 3FW1A 4CODB 5IM4A 2C20A 4MWEA 3BDIA 1XPJA 1Y9DA 1NVWQ 1OREA 4PZAA 5DN9A 4DA7A 2VS1A 5DYTA 3T1YB 5C80A 1ZA1A 4J0JA 1QFZA 5CG1A 1SOMA 3KUDA 4NG5A 3VO8A 4TXMA 5KKAA 3KQUA 3R3WA 1VL8A 1LW6E 5L4SA 4O3FA 3HCRA 1DWUA 2C5GA 3BE6A 4MI6A 1HDIA 3HTXA 1LGYA 1JG6A 2ZS8A 1XWWA 2P2NA 1HK7A 1QE0A 4ZDWA 3HDJA 4RDXA 5JFOA 4L0QA 4HNRA 4HB2A 4LBWA 1IZYA 3DW1X 3AJRA 2YIMA 4HB3A 3KYDA 5CDUA 1F8GA 3OU2A 1HG1A 4MP8A 1SUSA 5IJ9A 3EXG2 1H2HA 2BV3A 1XQYA 3D4IA 3F74A 1L7BA 2SECE 1Z56C 2R7LA 3GG9A 3GMSA 3KR9A 3AZPA 4CG3A 3KXKA 2F64A 5TNXA 3T4EA 3MGCA 2RGGA 1YR3A 1HQYE 4YEDA 2F67A 4QA9A 5A0VA 1IBRA 1L7VC 3UW3A 4JKYA 3QVXA 2NOAA 1YFJA 3EMKA 2EGGA 1XZAA 3BK1A 4MIOA 1WSWA 1S8AA 4GQIA 4DUYB 3DLCA 1XP5A 3F5MA 1U98A 3EGCA 2PEZA 2GSDA 2PYDA 2UZ1A 3PFKA 4PZCA 4Z4QA 2AHRA 2J8ZA 2C4VA 5JWRA 3KCNA 1KVTA 2AJCA 2MSWA 3LO8A 3LUGA 2WUDA 3RRXA 3WXMA 3DFIA 3LH5A 1LJLA 5DIZA 4ZHQA 5IPFA 4HRAA 1FBTA 1NP6A 4RIGA 1ZM2A 2R6ZA 2WTAA 4FX2A 3LYLA 1JW9B 1RFLA 4S1TA 1W5FA 2HUNA 3JQFA 3MA0A 4N5IX 5FUWA 4LQCA 4KRGA 2QP9X 3RW9A 3GA7A 4BFLA 3KZCA 5AM2A 1ZGGA 1NVVR 2JDIA 1D9ZA 4GLOA 4JLUA 2JFNA 2XDWA 2ZSJA 4AG6A 4I50A 4K9LA 1JHPA 4JHLA 2C9ZA 2F4VB 4J1TC 4PBSA 4K46A 4BS9A 1XZIA 3H3JA 4YTEA 5BV7A 2X22A 3D2CA 3S4YA 4DJTA 2JPDA 4N5LA 5TMEA 3I5AA 3T15A 1J7KA 1HY3A 1WXHA 2IELA 3ER6A 3TRKA 3PEWA 4FB5A 3FVVA 3AI3A 5KSWB 4TMZA 1E9SA 4DQUA 2X76A 1NBEA 1Z15A 2JFWA 3LQKA 3QPBA 3RVRA 1CEYA 1JMKC 3TKLA 2E6UX 3LT4A 3B7PA 3D5TA 1DG9A 2ZYTX 3EF3A 3KD2A 3RUPA 3VNBA 1U9IC 4D43A 3RYIB 1A88A 2BELA 2MMCA 2GF9A 3HHEA 2YOHA 4NATA 1HLPA 1J24A 4EYEA 3VBEA 5IJ0A 5AK3A 5EE9A 3FN4A 4GRAA 1WCYA 1C7IA 5BSMA 2HNBA 2SNIE 1Q2XA 2OG1A 3QBDA 4K6OA 3ORYA 1PSWA 3G59A 3SC6A 3WGOA 4PSDA 5C4IA 4D25A 1E2NA 3BG5A 3G1UA 3JQAA 2E85A 1LDMA 1N2XA 1H4TA 3MCVA 1TUEA 1RADA 1TCCA 3G0BA 4R5MA 1UAGA 2YVQA 4IDEA 1RBYA 2X9GA 1BZYA 3D81A 3N8KA 1E5DA 4URXR 4PC1A 3ETGA 4L8YA 3QXCA 4HDRA 4IKOA 4A3SA 1NUTA 4AZVA 1DV1A 1P19A 1Z83A 4PYRA 4QXAA 3WYFA 2IS2A 3BJIC 3T34A 3GUUA 4QECA 2B8TA 3DNMA 3IB6A 3LWBA 3ELDA 1OHHD 1OD6A 2PBLA 5L3RA 3IULA 4EDFA 4EVRA 2MJLA 2PL1A 3DB1A 2QI9C 3H4TA 2GSWA 2PZAA 1PVVA 2AZDA 4XCXA 1JEQB 3RU9A 4DMGA 2CHVA 2ZYUX 3V2HA 3DP7A 4LHZA 4F2DA 3WLKX 1Y7TA 5K4GA 1FQJA 3SBEA 1W44A 2DWQA 2R8OA 1FJ2A 1SHKA 1WUHS 2XNHA 4C1NA 2JBWA 3THWB 3N9IA 3QE9Y 5LQMA 1MO4A 3DE7X 2IPAB 4UTZA 5HOEA 4UMEA 1C1DA 1UC9A 1IL0A 2QT9A 2WJPA 1UR5A 2XUOA 3MOGA 2GHQA 3MT9A 3NC4A 4KRXA 3UJDA 2PWAA 3LPAA 2X6TA 1U3CA 1FFBA 3WBJA 3OT1B 5CP8A 3H99A 4AJ2A 1QDEA 2O0HA 1A2OA 1M1YB 4LS3A 5FEUA 1RAIA 5JBQA 1GNTA 3PHGA 4UBLA 1P2SA 4DA6A 4I1PA 4RD3A 1H2XA 1WV1A 2CE7A 3H9EO 3PZRA 2L69A 4YUAA 1D4AA 4OREX 2B99A 4GL4A 3ITNA 3P20A 2RHTA 3IQDB 2JGFA 2Y67A 4XWWA 2NSYA 1JG2A 4I1YA 3KZOA 1S3FA 4AUMA 1T9HA 4ZYUA 3I1FA 4TYQA 5C31A 5ULLA 3X1WA 4FHEA 4YAJA 3O1IC 1ABFA 1V8DA 2HF2A 2Q8PA 1AZWA 4HO1X 5HVNA 1YASA 2IPMA 1R66A 1WB4A 2IIBA 5EKUA 4D9JA 3KQKA 2HPVA 4ZGGA 3PS9A 1J1IA 3MTEA 1DAMA 1MUUA 1UJ2A 4F6RB 1E6KA 4UNQA 4DNXA 4OQXA 5IYZA 2QN8A 2O19A 3K6SA 2AN5A 3CUYA 1USIA 3M5PA 1GAJA 2BRUC 2Q0QA 9LDBA 1K68A 2RIRA 4AF7A 3ID6C 2WSYB 3E82A 1AKNA 3WLOA 2Q99A 2OCYC 3KQTA 1J09A 1HMPA 1P39A 3RVQA 4BJ6A 1N5JA 2IFTA 4J0GA 1VPLA 4PHFA 3RC2A 4XDHA 3COZA 5IAJA 1SC6A 3T9AA 4FIZA 2IW3A 2QXTA 2QN6A 3MBIA 1RXIA 1M34E 3NFYA 3W9BA 3ZWMA 3H4MA 4N18A 4IX9A 4V24A 3EQZA 1EP9A 4EO4A 2WSMA 1S7GA 3OFKA 2HBQA 2I3AA 1BVHA 4FM9A 1CJSA 2FW1A 2Q6VA 3OEYA 2J46A 2X7HA 4L2IA 3SN6A 3WGMA 3B82A 3C3KA 4M49A 2WAYA 2Y1CA 2HGZA 3DEIA 5IH3A 5JD6A 1XVAA 4EJ2A 4H7EA 5CA1A 4GL2A 3WX0A 5EIBD 1T4GA 1JH8A 1E5VA 4KXUA 5I3ZA 3T54A 4UEKA 2WW8A 2CE2X 1J33A 1OUMA 3L1JA 2GTIA 1T1RA 1IHYA 1OH8A 1RWVA 3ESDA 3GH3A 1P5FA 2EX4A 1AC5A 3C14C 4YCDA 1I32A 5JQGF 4U4AA 4MQ5A 4X8OA 4ZKDA 1CZLA 1UFKA 3F49S 2UYYA 1W4AA 2JAUA 3HZZA 1PUJA 5F4ZA 3FOZA 2JGIA 3JAMA 2DECA 4UPDA 5H0IA 4JSTA 5DMXA 2Q50A 1KYTA 2OESA 4XUDA 6Q21A 3AF5A 1VE1A 2BHRA 4MMZB 3WQRA 4PW0A 1N9GA 4GC9A 1JEJA 2ZT8A 4H0FA 3RS8A 3FIUA 5HKOA 1C3JA 5KWVA 1XDBA 1NW4A 3OPYI 3W7BA 1ZCBA 2NU7B 3O5AA 4M2LA 3UV3A 2YIDA 1P91A 1DAIA 3HUTA 3K0FB 4FJ0A 2XTAA 1Q1BA 2EJUA 4HYEA 2K4MA 3ED1A 4V1CB 5ALOA 5LDDC 1CERA 1LS6A 1E4EB 1UP6A 1WXEA 3AM5A 5LQUA 3E9RA 1JR3A 3DE5X 3PNKA 4A2PA 2WE7A 3QNWA 4CKCA 5HZHA 4X1IA 2AWOA 3G5AA 3H5VA 2ZCVA 1S8NA 3IQXA 4X1YB 3AI1A 2NVUB 3UMFA 2Q6OA 1IOLA 2PJUA 4MX8A 3PA8A 4URYR 3HI6A 3N58A 4OK3A 2ZANA 4KAAA 1OFTA 1MOZA 1GG9A 4TKMA 1J56A 3KR2A 3QWFA 1X1AA 4TWRA 2FFBA 1XDUA 4N82A 1V1RA 4KXLA 1YC2A 3OU6A 4BVLA 2EERA 5ESDA 4F85A 5A2GA 4B46A 2RCYA 3E2PA 4C05A 3KKNA 3I9FA 2IEDA 1JJBA 2WI8A 3V8QA 1C4XA 3IH5A 4XJTA 3VNVA 2WVGA 4F12A 3NV7A 4AI6A 1F9EA 2IYEA 4MW6A 4OK6A 4AMGA 3PYLA 1V0JA 3FTEA 1N5LA 1FP2A 3K9HA 5BWCA 3W79A 4H0CA 2QPTA 4OHOA 1NVKA 1I0LA 3VX4A 5JZBA 3L0YA 1G21E 2NX2A 3FTNA 3ZWCA 3TZHA 2VJDA 4JBYA 2GARA 4Q01A 4XASA 3AQ4A 2VBIA 3D4LA 3HP4A 5CURA 3TNJA 1NY6A 4FN4A 4J03A 5IFLA 2JVIA 1YZFA 1M6HA 2PRIA 1CJKC 3DH0A 1SRQA 1L4LA 3HU3A 3AESB 2QMHA 4PR3A 1CSEE 3B20A 4KVZA 4TWIA 2CSXA 1CY4A 3BRCA 1A7AA 1DKLA 3QVOA 2Y4OA 2NU8B 3U7QA 3EFHA 3G2OA 1OU4A 1PAUA 3DL2A 3I0ZA 5D6OA 5AOCA 4LDRA 3K8ZA 3QLJA 2RIPA 4RJTA 5CW2A 1V11A 5CCBA 4G1CA 4OJQA 5CDGA 3P2KA 5IVKA 4DJAA 2QW0X 1XL0A 1PJLA 2O9JA 1GTL1 2NT3A 3QWAA 3LIPA 5ALMA 2ORWA 3KUXA 1J0XO 3UMMA 1IBMB 2AC7A 4NZZA 5CMLA 5T67A 2Z5VA 1MQSA 1YZTA 1CWUA 2E4ZA 1PEAA 2I2XB 3DAGA 3OT5A 3U4IA 4Q3DA 4TTTS 3N1UA 1PKXA 1IFXA 4UU0A 3Q9LA 1KEPA 4REQA 1E0KA 3M6AA 1SURA 3UAOA 3HUFA 5BOSB 4RFVA 5HYVA 4TV8F 1YCGA 2D2IA 4MQLA 3OETA 4BVFA 5KNBH 2PSHA 2E21A 4G85A 4JSYA 5T8KA 5D1HA 1U7PA 2O48X 1XDWA 5LBUA 1GNRA 1STOA 2PM8A 5KNDD 3A6FA 3KBBA 3PQEA 1WIWA 1BVYF 3OMWA 2OECA 4LN1A 2CLFB 4PZPA 4EBFA 3AI7A 1U80A 2D4HA 2QVXX 4LXYA 4ZI7F 4NOMA 2OHOA 3ORHA 1PK7A 1L8LA 2W6ZA 4IF6A 1D1TA 1E3JA 1QX4A 1ZBDA 1BWSA 5GZ6A 1IE3A 3B3AA 4ZT2A 1G63A 4ALIA 3F6EX 1PFKA 4OQYA 3BMCA 4N39A 2P9GA 2OBBA 1ODSA 1U0GA 1VSQA 4IDCA 2YXPX 2GJKA 2VJQA 2B35A 2XW6A 4KR3A 3SR4A 4FQ7A 2AKEA 4ARVA 4X3OA 1Z18A 3ZDQA 5CH5A 4B2LA 5BSKA 5CAEA 1EX1A 2H92A 2M6KA 4YRAA 4E4TA 1I3NA 2HOQA 3W5DA 1RD4A 1YIDA 3OKFA 3QXXA 1B0AA 4JJ7A 5L3SA 2XF8A 4JYZA 4JQSA 5C35A 2YZ2A 1ORVA 4L8GA 2BI7A 2FNAA 4EFKA 1QBKC 2GWRA 2ZSKA 3PJDA 3GF4A 2HWYA 3VJLA 5FHRA 2H7YA 3FPJA 3OFJA 3KG2A 1ONPA 4FOOA 3PDHA 2BMEA 2I2AA 1ZXXA 3BREA 3VSCA 3PGVA 5KQLA 1A7KA 1ISFA 2HO5A 4OJYA 3DOOA 3H0EA 1PFVA 1JALA 1YWGO 2QW1A 3OX4A 4O33A 3MINA 4NHEA 4NV0A 3IELA 3GLFE 3ZS8A 1Y34E 3NAGA 4IUBS 2AOWA 3AIMA 3AVOA 3ANMA 1J22A 2C54A 2VDRB 3PNYA 4LPKA 4WRRA 2NADA 3RPEA 3PRJA 1B8OA 3DKIA 1MVLA 4C2BA 1NZFA 1ZIDA 1PZGA 2QIOA 1UOQA 3F47A 2IA5A 1WXGA 3MG9A 1O89A 3UANA 3W7AA 1OB2A 1OPXA 3GHHA 3HN7A