1KSJA

Complex of arl2 and pde delta, crystal form 2 (semet)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
165
structure length
164
Chain Sequence
b'RELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arf-like protein 2
molecule tags Signaling protein/hydrolase
source organism Mus musculus
publication title The complex of Arl2-GTP and PDE delta: from structure to function
pubmed doi rcsb
total genus 52
structure length 164
sequence length 165
ec nomenclature
pdb deposition date 2002-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ksjA00
3C4JA 4JLPA 2ODNA 1DVRA 4JVLA 4Z54A 3BE4A 1FNMA 4V02A 2XB4A 3A37A 1TAGA 2RB4A 4TYQA 2EVWX 4TYPA 1JEEA 1M34E 4LBZA 3C7KA 3KXKA 3IDQA 1G6OA 1M7GA 1NBMD 3VTKA 1ZNXA 4LDJA 3K70D 3HPRA 1ZNWA 2CCJA 4IW3B 3T1TA 4JS0A 3ICEA 1G5RA 1UBEA 4TLAA 2FFAA 2ZITA 2QORA 5JECA 4F4JA 2NO9A 2ODWA 3ETLA 4KVGA 2ZU0C 4DUGD 3RRNA 3ZS9A 3SFVA 4RD6A 3VU9A 5HZHA 5L3QB 1Z08A 2NTYC 3U44A 4KFRA 4BEJA 4W5WA 1MO5A 2W6IA 4YMTA 2EQBA 1YKSA 4CEHB 3LRPA 1VYTA 2GXUA 2GAAA 1W2GA 2RGAA 2EU8A 4GT1A 1EGAA 4YXWD 3FGNA 3Q5EA 2IYZA 2CE2X 3X2SA 2FGJA 3SU8A 1QHYA 2VYFA 1VIAA 1ZU5A 1T9HA 2ZU6A 4MRNA 1RPZA 1G19A 5CLLA 2LKDA 4DLVA 3U4QB 1R0WA 1G8HA 3RS2A 2ZRAA 3R20A 4JVMA 3KL4A 1CEEA 4KXFB 3B1ZA 4DLSA 4QBIA 4XD7D 4YQFA 2CNWA 4IEIA 2GJSA 2A2ZA 2IS4A 2J0SA 1IXSB 2JLXA 1N0UA 3W3ZB 2VP9A 1Y63A 5TV2A 1AGRA 2FSGA 4B3CA 2CL6X 4B74A 2ZAOA 2DWQA 4OQMA 1JR6A 5ANRB 5IK2A 2J7KA 4CEIA 3VKGA 2KJQA 1JR3E 4ASUD 2F55A 4Q19A 1U94A 4URUR 1XD2B 5JJLA 1XTJA 1UEJA 1N3BA 1OIWA 3CNLA 1U90A 4DEXA 4NYMQ 5TB5A 4JLMA 5C46F 1FP6A 4Q7KA 4BECA 2P65A 3RSLA 2ZRDA 4F4CA 4JKIA 5HCNA 2C03A 4IXNA 3X1YA 4TQUS 1D2MA 4BFWA 1GVNB 3KQLA 3KZ1E 4QM7A 2N1BA 1KO1A 4PQYA 4PPNA 1UJ2A 3IHLA 3X1DA 5CB8A 1XB2A 4LV8B 2RH5A 4AG5A 1RIFA 4TLDA 2XNDA 4AWXA 2NG1A 5LD2B 2FEOA 1N5JA 2QQEA 4B75A 3VR1A 3TSZA 3VU9B 3L43A 3N2EA 3K0SA 1HT1E 2CLDX 1XPUA 3CF6R 3GLHA 3SYLA 1YU9A 2XNSA 2XOKD 3PG5A 3KTAA 3VNVA 2FJUA 5F2EA 1E79A 1N2CE 3AM1A 1FX0A 4MH0R 4B2PA 1MKYA 1R2QA 4BGDA 1G6HA 2REBA 2QI9C 4P4SB 1UBCA 4PHGA 1TX4B 2V54A 1MRSA 4QGAA 2WJGA 3FDIA 2RGBA 1G8FA 2QN6A 4RY2A 3EA5A 3ADCA 2QMOA 3W6NA 4TMXA 3ZLJA 2BBOA 3UK6A 4P4UA 1T3SA 2YHSA 2CCKA 4GOJA 3QG1A 3OEHA 2WKQA 4KCGA 1YZUA 1OH6A 1I2DA 5LBIA 1YVDA 2IYVA 2NO1A 4PX9A 1NLYA 4MRVA 1IN7A 1H8EA 4KSBA 2EFHB 1P6XA 3GD7A 2QPTA 4A4DA 1CLUA 1ZU4A 1GRRA 3H2YA 4XH9B 1ESNA 1P9WA 3I4LA 3UMSA 4PSAA 3TH5A 2GXQA 3CNNA 4FMBB 4LV5B 1D5CA 1TEVA 3VX4A 3TVTA 3MJHA 4NBSA 4BRWA 4C0KA 3TSOA 5CM8B 1E2LA 3NWJA 3DDCA 4NYIR 2HCBA 3SNHA 3UANA 5HCIA 1ZUNB 4B35A 2GZHA 1E79D 4LPSA 2HXSA 5CDFA 2W6JA 1EWRA 3NBFA 4MKHA 1G3UA 1E0AA 1WF3A 5D3MA 4B2LA 4GOXA 2LCFA 2JLVA 1GZSA 1SKYB 1ZINA 4UXHA 4DWJA 4DIEA 4BFUA 3TQCA 2PH1A 1DAMA 5SZJA 3OEEA 4KYIB 4V0KA 2VEDA 2GAOA 4TL8A 1JEDA 2FZ4A 1GITA 5FBVB 4IOLA 2JLYA 1R0ZA 2W6ID 4TL7A 3P4XA 4V0LA 3RRYA 3T5GA 4B6FA 4DDUA 1WA5A 2VP2A 4NCNA 3W8NA 3KKMA 3D3QA 4HLUA 4D82A 1DAKA 4MUAA 3CPJB 4PFSA 2X77A 3ND8A 3LFUA 3QKSB 3GJXC 3RS3A 1E99A 1E9SA 2BBWA 4ARZA 4P33A 3DMDA 4DIDA 1KGDA 4HI0E 2PX0A 2H1LA 4A2PA 2IYXA 4MGZR 4MYUA 2WKPA 4UJ5A 4IDHA 1TU3A 3RDPA 4TN1A 1XBTA 4JL6A 2Z83A 2ZRIA 3CX7A 1YHNA 5B2ZA 2DHRA 1GRQA 4M2LA 2RKOA 2PEYA 3GP8A 1AKYA 1GG2A 1KKLA 1WDTA 2AFHE 1VG9B 2OFOA 2ZE7A 2ERXA 2FGKA 2ZSAA 3ZD7A 1ELOA 4LC0A 4US1R 1KDPA 3LLUA 5TDHA 2Q21A 2ZSFA 3RHFA 4M1WA 1EESA 4EFNA 2WWXA 4CEHA 2F43A 3QOFA 1E96A 3JVVA 3FHTA 1NJGA 4R71A 4YMSA 4KAXA 2BBSA 1E2MA 2FFQA 4Q4HB 2KWIA 1XEFA 4AD8A 4K46A 4PSVA 3HU3A 4BASA 1TF5A 4NZYA 1D9ZA 1O3YA 4CRWB 4M0LA 5G3ZA 1VTKA 4YMUA 221PA 5FTLA 3CWZA 1F5NA 2A5FA 3DO6A 2G77B 4PQRA 5F9HA 2IXEA 3B9QA 1ZM3A 3QEJA 3PCRB 4R2IA 1OW3B 4HYYA 1GAJA 3BH6A 2BVNA 4H9GA 5KOYA 1G4UR 2WOOA 3W9YA 4DBLC 4QNMA 3U7HB 1B23P 1JPNA 2OSBA 5SZIA 3IBGA 1N0WA 2RGCA 3NH6A 5HE9A 2QBYB 2W2XA 5TVKA 2VP0A 1RYHA 5EE1A 2ZQ5A 3Q5DA 5DH9A 4QG7A 1CR2A 1E32A 4XWKA 3N70A 2FE4A 3ND9A 5FOUA 4TL6A 5TXGA 5GVRA 2ZE6A 3EZ2A 4QGGA 1KK0A 3LXXA 2QGNA 5H1YA 3KKPA 1XJ0A 2WBLC 4XTRA 5FFMA 2VTKA 2WMNB 1KKMA 1XNJA 2ZRGA 4ZKDA 4PC3A 5IRCD 5FBLB 2XXAA 2FNAA 1U9IA 3U3MA 2NQ2C 1W7AA 4OJKA 3T06B 3ADBA 1V5WA 3HPQA 1ZYUA 1E2FA 1F2UB 1P9NA 2CDNA 2ASEA 3H86A 1ZW6A 1CF4A 1A4RA 3CRW1 3RRZA 2GEVA 3FE2A 4DKXA 4TWZA 1S9DA 3NVAA 3LNCA 2OG2A 3IO3A 4UNNA 3IIMA 4HUQA 4WZBE 4PZLA 5C2JB 1LV7A 3OFND 3K1JA 3T1OA 3L0IB 2EYQA 4NTZA 2EWWA 4EIWA 2D2EA 1E69A 1UM8A 5AJZA 5JCPA 2V3CC 1Z83A 3LQRA 3LDAA 2JLUA 4JLKA 5AR1A 4XVQA 4TTRA 4TTPA 1BKDR 1PZNA 1XJQA 2E1RA 3QG5A 2AL7A 4Q4JA 5HTKA 1P9RA 3WYFA 2GZAA 2OZEA 1TUEA 2IK8A 2JAQA 1HQYE 2VHCA 2GF0A 1ZIOA 3KB2A 4DLWA 1J99A 5JI3E 1W0JD 1NMYA 1Z22A 4LSGA 1YZTA 4CEIB 1XJCA 3TAUA 2YV5A 4CEJB 1AQYA 2VHTA 3M4YA 1W0KA 1NNEA 4D6PA 3TUZC 4L9WA 3CW2A 3CONA 4EUNA 1IXZA 2B92A 4DSNA 1L4UA 2WWFA 1Q22A 3FTQA 4JJZA 3SDZA 4DSTA 1ZP6A 1E2KA 4HLQB 3MG9A 3A1VA 1ZNYA 2OLJA 3FMFA 3UG7A 4D4LA 1OB5A 1Z28A 4WXRA 3B1XA 5KNDA 3WMFA 1MO6A 3C5HA 5H8WA 3CZQA 3LH5A 2FSFA 1JJ7A 4TMTA 2FF7A 4WOPA 1CULC 1UKEA 2VL7A 4MRPA 4ESHA 2Q3MA 1Q57A 4Q02A 1X8LA 4IVQA 4C0LA 3AH8A 3I5XA 4NCIA 4XWAA 4Z8YA 5EP3A 1GRNA 2Q0HA 4WAUA 3U60B 1XPOA 2WMOB 4BLPA 5EJEA 1NY5A 3GFPA 1U8ZA 1WXQA 1R8SA 3H84A 2RGNC 2BMEA 3IKJA 4PQFA 1X8KA 3UMFA 2C98A 4JLVA 4ASUA 5IT5A 2HLDD 1FMLA 2QA5A 2ZI9A 4X8OA 3R7WB 3NHAA 2PZFA 5L3VA 3F5FA 4M1OA 3QXXA 1K8RA 1IN6A 1KY3A 1KI7A 2CHQA 4AG6A 1GSIA 1YRAA 1I4DD 3K9NA 2GJKA 4OK6A 3KFVA 2MMCA 4YONB 5FR1A 1IN8A 2OXRA 4TYWA 1Z5ZA 3UXMA 1ZAKA 4GMXA 4TT3D 1Z0FA 1XEWX 2FEMA 3FWYA 3Q7QA 3QEOA 3CH5A 4P0TA 2VQSA 3A1TA 2BWJA 2BKUA 1PLJA 4G01B 1U98A 2C95A 4OK5A 4RCYA 1OPXA 4XTCS 2QP3A 3X1XA 3JVUA 1HT2E 4LJ8A 1JALA 2O8CA 5EZ5A 2OILA 5AUPB 4MRSA 4DLXA 1QHXA 2F43B 2ZROA 3A1WA 4DCTA 3S1AB 4PHHA 3V9PA 4BFZA 2X2EA 1JQLB 3CX8A 2QEQA 4EFMA 4GP6A 2IUUA 1WCV1 4TMVA 4BPBA 4PTLA 4IDPA 1YE8A 3M6AA 4LUCA 2PMKA 5H68A 4NYIQ 5FOVA 2Z6VA 4BFTA 2PZGA 5CJPA 1N5IA 3X1ZA 1CKEA 4ZDIA 3K0EA 3CRMA 1FZQA 1OHHA 1T91A 2GJ8A 2OLKA 2RCNA 2D74A 1G21E 2VPPA 1LFDB 2ATVA 3NIBA 4I1OA 5EP4A 5K8UA 2D06A 4KYUA 3BBPA 2ZSDA 2QP9X 1LS1A 4ZI2A 4FMDB 2R6GA 3KB1A 1N6NA 2G6BA 4FCTA 4M1SA 2ZS9A 3R8FA 3R9WA 1Z07A 3U7GA 1QVAA 4GRAA 4PAMA 2F3TA 1KIMA 2BKEA 2HV8A 3BD9A 2VHQA 4D0GA 4PAQA 4DDWA 2PCLA 1TU4A 2IF2A 2FPMA 3EIHA 4JBXA 4Q48A 2BEJA 3PENA 1N6KA 5FUWA 4BFVA 1R5BA 4FMCF 2ZEJA 2YVUA 4URXR 5J4YA 2ZUDA 3GJ7A 3HU1A 4RD1A 3Q8XB 4HAYA 1FOEB 2WICA 4JL8A 1HH4A 1F2TB 4FN5A 1NVVR 2J45A 2H16A 4PPGA 3GLGE 3I92A 3SQXA 5AJYA 3UG6A 1KZ7B 3AVOA 1W36B 5EXTA 4QJ5A 3HWSA 5HR5A 3ONWA 1Y3AA 3FOZA 1R7RA 1S1CA 1LB1B 3IQWA 4C2TA 4G5GA 5DI3A 4LHVA 4JLJA 1MABB 1NN5A 5KPJA 4DT1B 4A0FA 2ZRBA 4XJXA 3E70C 2GCPA 2GK7A 1UDXA 1Z29A 1G291 4G0NA 4LBVA 2B7BA 1OF1A 2EFDB 4LHXA 1Q12A 3WYAA 4FWTA 3VR2A 1T5IA 3FKQA 5CJ2A 3G0HA 4QKQA 1VYVA 4TMKA 2FWRA 2JCSA 2NO7A 1KSGA 3B82A 5JWHA 1JB1A 3CPHA 3E1SA 1KSHA 4L16A 2P6UA 1VECA 3SQWA 3CM0A 4ZV4A 2HLDA 1G3QA 1KSJA 3KJGA 1H8HA 5B64A 3C41J 1E9EA 1K5DA 1Q44A 1GTVA 1Z0IA 3NG1A 3MRSA 3THWB 3F0TA 3PVSA 2BEKA 4NU0A 4PPQA 2FFHA 4U5XA 3R9XA 4BLTA 1IJEA 5AWFC 1XDBA 3K53A 3P32A 1ZCAA 2FPKA 2ODEA 3OESA 3QENA 4M21A 2AKYA 1II8A 2F1IA 3SI7A 1CXZA 3CRRA 4HB0A 2HJGA 1T3LA 3OZXA 1G7TA 5E7MA 5L3RA 2Y8EA 2PBRA 2O0HA 1F60A 2GZDA 5E7IA 1E4YA 1N0VC 2GESA 2RGXA 3HU2A 2DR3A 2P5SA 3TGPA 3SS8A 1NJFA 1KDRA 1UBFA 2QSYA 3AUXA 1X6VA 1IN4A 4WVFA 3MLEA 2JLZA 1A2BA 3QVVA 4LJ6A 1WB9A 3BAFA 4OK3A 3K0FB 4MUBA 2HF8A 1BIFA 2J5XA 1Q21A 3A4LA 4KODA 1DG1G 4NKRA 4IEEA 1TPZA 1WBDA 2IWHA 1KZGB 4DLUA 1XD8A 3LW7A 4DB2A 3IILA 2HJVA 1J70A 3RS4A 5J47A 3NXSA 2QMHA 4E07A 3BJIC 2ZUBA 2GCNA 1EFUA 2GBLC 2OBMA 2R8RA 1FUUA 2WOJA 3ZZUA 5BN3A 3DKVA 3GLIB 1KAOA 2OFWA 5DO9A 5FOTA 4I99A 4Q9HA 1CJKC 4Y0VA 1JECA 2ZJ2A 5CIQA 5BYKA 5JMTA 1TTTA 4CEJA 5JHHB 1SHKA 2IEZA 2I3BA 3PUWA 5FL3A 3NKVA 1KMHB 1SVIA 4DCNA 2O8BB 1EFCA 3VAAA 3GLHB 2OBLA 4WW0A 4DZZA 1I4TD 2W58A 4IRUB 5IDVA 2FFBA 3ASYA 2XITA 2YWHA 2LWIA 4Q1BA 4ABYA 4DCUA 3KKNA 4OQFA 3QE0A 821PA 4NE2A 1KO7A 2Q6TA 4POAA 1QG4A 4XOIA 3RS0A 5L8VA 1A7JA 2RGGA 2CNWD 4HSEA 4XVRA 4HUQB 4D4MA 1CJTC 4U02A 3AKCA 3ZS8A 4W5HA 4ZCMA 3G5UA 3RLFA 2XZPA 3AVWA 2IYYA 2ZI6A 2G88A 1QHHA 2O8DB 4QGFA 1AK2A 2BOVA 4GZLA 2GA8A 3QKRB 1P7CA 4LGMA 3GLFB 4OI4A 3VFDA 3SR0A 1NMZA 2F1HA 4HZUB 1JXMA 3O8CA 4GPTA 5JSZA 5FOXA 5BWMA 4M4SA 4M1MA 3Q9LA 4RCZA 3TIFA 2OAQ1 1NSFA 2VA8A 2ZJBA 3BC1A 4K81B 1TEXA 3MGCA 3EPJA 4NYJR 3WMEA 1H8ED 2KE5A 3BB4A 1V43A 3NDBB 2ZR0A 4S2EA 5IF9A 2ORWA 3FMPB 1OKKA 1ODFA 3M1IA 3K0FA 1DE0A 4B6EA 2NMVA 4PO8A 1J8YF 4X8LA 4I1UA 4LX0A 3TBKA 4CDGA 2UZ3A 4LYJA 1BYIA 2ZRPA 2IYQA 3B1VA 4G5OA 3RS5A 2IL1A 3V4RA 3IPYA 2ZRHA 4GDFA 1TF2A 1XD9A 5KSYA 2ZIAA 2W0SA 5FBRB 2OCPA 2FA9A 3C14C 2WVJA 4TL9A 5KNBA 1YZKA 4CZ2A 1D2NA 5K8IA 1OT3A 2WZQA 2H18A 1OXXK 2DYKA 4LYFA 2P3SA 1II8B 1Z6XA 4LHWA 3GPLA 2HYIC 4G5QA 2IT1A 1RKBA 1MR3F 1OXVA 1XCPA 1YR8A 1H65A 2DY1A 4JBWA 4V0OA 4P31A 1OHHD 1MRNA 3AF0A 3QPUA 3RNLA 1E2HA 3G82C 1IJFA 4AYTA 2O8BA 1NRJB 2WHXA 1W1WA 3A1SA 3BS4A 5FL7A 3CX6A 1GDDA 1W36D 5BN4A 4GZMA 5P21A 3HYRA 4I81A 1DG3A 4OQXA 2QP4A 4Q7MB 3WHKA 5EUMA 4G3XA 1G3IA 1HUQA 2A9KA 1O87A 2C78A 3EWSA 4B73A 5SZKB 2ZRKA 1WP9A 2EFGA 2OUKA 2WKRA 4E03A 1G8YA 1E2DA 4LWZA 2GJAA 3PV0A 2FSHA 2QAGC 4D26A 3EWAA 3I1FA 1UAAA 1GWNA 2Q9BA 1G3MA 4JKYA 1FMJA 3LBNA 2HT1A 4AYWA 2QAGA 3VKWA 1W4BA 2IUSA 2F1JA 4ARZB 2WSMA 3S1AA 1KI4A 2OESA 1UPTA 3OE7D 3IUYA 1KK2A 3SEAA 2QG6A 2C04A 5LB4A 4OHXA 5DSZA 3A1UA 2BM1A 1COWD 3GJ0A 2E87A 3EC2A 3GQBA 4I4LA 1PUIA 4N1AA 2VO1A 1VCOA 2HCJB 3GJ8A 4IFEA 4XVUA 4QNRA 1KK3A 2IS1A 2HDNB 1E9AA 3QPWA 3EIQA 4JJKA 4FCWA 1CJVC 1G7SA 3THXA 3ICQB 4DHEA 4TMWA 1ZM2A 4ZPXA 1SVKA 2L0XA 2P6NA 4AC9A 3DMNA 2OCBA 1AS2A 4OHYA 2WJIA 3U2QA 5KHOC 3T5DA 1JPJA 1NVUQ 1KY2A 4JVSB 4DSUA 5DI9A 1YQTA 2ZRCA 2QU8A 3EX7C 1P3JA 2NPIA 1DOAA 2GTPA 1IOZA 3ADKA 4B3XA 1ESMA 1NMXA 3H0KA 3QVUA 5HPYB 4ZO4A 121PA 2AHOA 2XTMA 4MYHA 3WNDA 1OFTA 4KFUA 4EPXA 3SHWA 3J81k 1GNQA 3LVQE 5J4VA 4LJ9A 4LI0A 1PJRA 4AKEA 3MD0A 3FVQA 1JXOA 1KMQA 4MKFA 2QGZA 3RSOA 3NBXX 5C1BA 1A1VA 2W00A 1NVWQ 2J87A 3KJIA 1VYUA 3F3YA 5AK0A 3P1JA 1Q1ZA 1Z0DA 2VSFA 2VSXA 1KI8A 5K8TA 1GNRA 1KO5A 1W49A 5EE0A 3VHXA 1SXJE 4CT5A 2XOKA 4AKGA 2CVFA 4WZ6A 2JA1A 2C2HA 2IW3A 1DARA 4IOJA 1YR7A 1EWQA 3THOA 2Z4RA 4MITA 1PV4A 4LCBA 2ORVA 5AJXA 3EIEA 2G9NA 2R2AA 3KX2A 1CRQA 1E9BA 3P4YA 3QXJA 1KTVA 1R0YA 5FI1B 4QBHA 3SJBA 2EFEB 3MWJA 1OB2A 2QL6A 4C0BA 1DAFA 2GXSA 3KXLA 2VH5R 3BRWD 4Q4AB 5F9FA 4DCSA 3MWYW 2C9YA 1Q1QA 2YOHA 3GCGA 2AXNA 2X8AA 4KJZA 4Q7JB 1E9FA 4YDHB 2R62A 2UKDA 1CJMA 4LBYA 1SXJD 2CK3D 4UNQA 1KI6A 1OFUX 1VHTA 2KBEA 3B85A 1KSFX 4OHVA 1AA9A 4DRZA 1XTSA 5HKKD 2AKAB 4A8JC 1F6BA 2F9LA 2QROA 3QF4A 2ORIA 1BH2A 3AEZA 5AJWA 1NL3A 1RW4A 4Y0AA 2ZRFA 1WBBA 2HXYA 2GEDA 3MWKA 1NKTA 2DFKB 3HP1A 1P2TA 1E0JA 3TSWA 3D31A 4GNKA 4P4SA 2D7DA 4V0ME 2BC9A 2IBMA 3QJYA 2ZANA 4HLCA 1L4YA 2ZE5A 4WXPA 5B58C 2NGRA 1E2EA 2G1KA 1E1RA 1SVLA 1EFTA 1E98A 1MV5A 3M0EA 4B32A 1XXHE 2UVQA 3K70B 1J8MF 4KLZA 3QSYA 3PUYA 3QBTA 4HAUA 4GL2A 1XEXB 2GCOA 1GKYA 3DVLA 1P4SA 4JVNA 5FTKA 2AK3A 3HR7A 3K9HA 4RZUA 4BFYA 1YZLA 2CJWB 4BLQA 2ZI3A 3R7WA 3PEYA 1DELA 2A3RA 4N0EA 1JAIA 3ZZ0A 1XTRA 4NMMA 4DLTA 1FTSA 3EZ9A 2NZ8A 4BE7B 1XU4A 1Q20A 3CRQA 4DLYA 3WXMA 1DAEA 3OE7A 4HDCA 1VKJA 3T61A 3ZQJA 1P61B 2XZLA 2NIPA 1U0LA 2IS6A 1B0UA 4B48A 3TAHA 5CM9C 4OQNA 1NN3A 4PO9A 4PXAA 1XXHB 2BCGY 2NZJA 5FR2A 3SC3A 4Q4AA 2VHJA 4MA4A 4RD2A 1FX0B 1KAGA 3EASA 2ZVQX 4GFDA 4HAXA 4QL3A 2VP5A 3LWNA 3D6TB 2AD5A 2QRNA 1YZGA 1W46A 3U6BA 1HEIA 4WBSA 2WM9B 3WY9A 3QXCA 1DAIA 1VIYA 4XSHA 1X1SA 3U44B 3T12A 4AKIA 3QBVA 1UBGA 3PUXA 1I4LD 4ZDKA 2FH5B 3K0AA 3SN6A 1JBKA 4IDNA 4A8JA 2WTUA 3BWDD 2OO7A 3JZAA 1J7KA 1ZUIA 1G20E 3A4NA 2BIFA 3K8YA 3TLXA 5LB2A 4RD0A 3OHMA 3SJAA 3RWMB 2AFIE 3TJZA 5J4KA 2K5UA 1G17A 1IBRA 3QQ5A 1NSTA 3LBHA 1PLKA 5EZ6B 4B3GA 5AJVB 1L8QA 3QKTA 1OYYA 4LV6A 4KSCA 4A15A 5ELXA 1M6NA 4LJYA 2ZI5A 4Q00A 4JLBA 3W34A 2V1XA 1G8GA 1OXTA 4LJ4A 3F8TA 3BH7A 1G1MA 4Q1AA 1ZMXA 4JYBA 1Z0JA 3SBEA 4CW7A 4KU4A 4D0NA 3PIRA 3OFNA 3B6EA 3B78A 5K8LA 1US8A 3KUDA 2GJ9A 3Q7PA 4DC9A 2ZRJA 1CRPA 4L8GA 5SZHB 2GNOA 5A4JA 3AUYA 3GFTA 4ON9A 1WRBA 4URZR 2G1JA 3VR5A 3I5YA 1N5KA 1S96A 2GRJA 3I8XA 2GILA 4EJSA 1SKQA 4L5BA 3BH0A 4RFVA 1S4QA 2JLRA 4TYYA 3AVPA 1EFRA 3A58B 3OAAD 1TQ4A 1QHSA 1OFHA 3OEHD 1YZNA 3KKQA 2N46A 5KDOA 2RGEA 1P2SA 2BCJQ 3OEED 1N6PA 2MMGA 2ZPTX 3AVQA 3QF7A 2ZAMA 4C0SA 2IS2A 2OBNA 1R5OA 1F2TA 3ZYCA 1Z2CA 1CBUA 3T35A 3SFZA 5KSOA 2EW1A 2W6JD 2ZI4A 4AY2A 3QNUA 3BERA 5CK4A 3TUJC 2J0UA 3A8TA 3FKSD 2ZJOA 3OIUA 4IJMA 2V9PA 4LJ7A 4QFMA 3R9IA 2OAP1 1XWIA 3ZGXA 5CITA 5JCZA 4C7OB 3SYKA 5G3YA 1UF9A 3AF2A 4R98A 3RC3A 3WRYC 2V6IA 1MH1A 3L8YA 1OXUA 1FUKA 2NO6A 4OI1A 1P2VA 4G5RA 4BZXA 4DDTA 1RRPA 2OXCA 2ZJAA 2BHRA 4RFSB 1WMSA 2QY9A 4J0QA 1NN1A 1P72A 2OEPA 4FWIB 2O8DA 5KTYA 3NC1C 3MFYA 1ETUA 2G0NA 4HAVA 3ASZA 1ZUHA 2JATA 4M9XA 4TSFD 3ZVLA 1R6BX 3CZPA 2J3EA 1RRGA 1Z0KA 4EPTA 2OCYC 1E9CA 1M7HA 3BORA 2YWFA 4W9MC 4EJSC 1AIPA 4HUTA 2AWNA 2QZ4A 1EX7A 2YOGA 2AX4A 2BM0A 1W48A 2IC5A 2WJJA 2ZJ8A 2ZYVX 4LYAA 3QY0A 1XZPA 1RJ9B 2JIZD 1KO4A 3E5HA 3W90A 4M53A 1FPMA 4DJTA 2YINC 3FPAA 1U81A 5G40A 2JDID 1UKYA 5DYIA 3VR6A 2PL3A 1JR3A 3CNOA 3K0CA 1GM5A 4Q01A 3ECCA 2MSCB 4Q47A 5KO2A 3H4MA 2WAXA 4EQ6B 3SZRA 1GILA 1SVMA 4Z1MD 3U7FB 4DVGA 3CLVA 1T5LA 4RZXA 1KI3A 2O0JA 6Q21A 1C9KA 1VMAA 2JLWA 2CE7A 5G41A 3ZDQA 4B33A 2DWOA 2ZTSA 4FW9A 5CYPA 3QI2A 2BJWA 4F93B 5LD2C 1IN5A 4AIIA 1E3MA 4EJSB 4M9ZA 1BYUA 3TUIC 3AVXA 3FFBA 1KO8A 2GVZC 1Z6AA 4KFTA 1VG1A 2C77A 3KDSE 3WP1B 2ZRLA 1WE2A 3QPVA 1YRBA 2ZE8A 4C0AC 4MRRA 521PA 4A92A 4BLOA 4LHYA 2REXB 3QKRA 1EXMA 4Q03A 4GP7A 4OJQA 1SZPA 2ONKA 5FOWA 1E2GA 3I62A 4DUGA 1Q0UA 3NTUA 5JJIA 2ANCA 1QHHB 4G5SA 1CIPA 4NCKA 4DDVA 3SBDA 1LVGA 4B71A 4O0MA 2BMDA 4YC7A 5FTJA 3X1WA 3AF4A 2ONJA 5L3QA 2O8EA 1T0JB 1OKKD 2ZI7A 2QM7A 2IYSA 4QC2A 1FP7A 1Z2AA 2H92A 3A6PC 2R9VA 2XJ9A 4KBFA 1NBME 4FI3C 2OHFA 4H1VA 5EE9A 2PX3A 2VLIA 5IK2D 4D81A 2ZRMA 4IVPA 2GCOB 3LV8A 3C8UA 1NG9A 5EXXA 4V03A 4K8OA 4B3FX 1YR9A 1KMHA 3B7GA 2D3WA 2PLFA 1FW6A 2R44A 4D2IA 3N2IA 2FU5C 3EW9A 5F98A 3VR4A 3SYNA 4JIMA 1NG1A 4M1KA 3B8HA 4TLCA 3DOEA 1G16A 5JS7A 3AKDA 4UXJA 3WNBA 1G9XA 1IY1A 2OM2A 3ZVNA 4P3YA 3U4QA 3V00A 1R5NA 3L8ZA 4DLRA 2WSSD 3AP2A 4QXAA 3ZIAA 2YNMA 4UNPA 2KSQA 5KUTA 4XWOA 4M9QA 2XEXA 3CF0A 2GVDC 2QMUA 4JYCA 4RD4A 2J0VA 4HZUA 3SJZA 1OH8A 5HZKA 3K9GA 2J7PA 4CIDA 2WWYA 1XMIA 4D4KA 721PA 3AVYA 3D8BA 1N6OA 5JWOA 3U6KA 1C1YA 2B7CA 4HDQB 1ZNZA 2ODBA 1JAHA 3EA0A 2QE7D 2A5DA 4MDEA 1GNPA 3UKDA 2Q3HA 2G0TA 3GFOA 3L82B 2ZSEA 3LW8A 3U3KA 1AZSC 1E2QA 2OCAA 5FH9A 4C0QC 1S9HA 4ACAA 4URVR 4EDHA 1U8AA 2MSDB 3ZVMA 4HEJA 2Q9CA 5CB6A 1JNYA 5LDDC 4NL4H 4WIAA 2QPOA 2EWVA 2I4IA 4G1UC 2WJVA 3NHBA 2C9CA 4C2UA 5L3SA 2HT6A 3AP1A 1G3RA 3KJEA 2XX3A 3KQNA 1VG8A 3DZ8A 1ZCBA 4P32A 3AV0B 4A9AA 1H8HD 1G7RA 4AKHA 4ZCIA 1TQ2A 2CLCX 3GEEA 4A8JB 3FHCB 4OKSA 1D2EA 2H57A 2GKSA 2I1QA 3K9LA 4QHTA 2ERYA 1XD2A 1M7BA 1A82A 1U9IC 5H70A 4BZQA 2VHUA 5KDLA 1XCGB 2PJRA 1BOFA 2XXAB 1HA3A 1EG7A 4MGYR 3CIOA 3K09A 4PAOA 5EUQB 1N5LA 2GWHA 2GXAA 1NKSA 3L0OA 5FOSA 2IWRA 3REGA 3GLIA 4C9BA 3RC8A 2ZXUA 3MJRA 2IF0A 2NPFA 1Q1EA 2G83A 2V55B 2DCUA 1OE0A 3WP0A 1VCIA 1IONA 5IHPA 4TTQA 4ZIRB 3LA6A 1LF5A 3EZFA 5E7JA 3PXGA 1R8QA 3QXSA 4F7WA 3THYA 1ZM7A 2FMXA 4HLDA 2P0EA 3CRVA 3AVTA 2RHDA 1KI9A 2CHGA 5D3QA 1T8UA 2WIAA 3L0PA 2ZREA 3U7EB 3MCAA 4PR0A 1SULA 1IQPA 2XB2A 5FTMA 4YXWA 3VQTA 1MOZA 3B60A 1FNNA 1COWA 4OHZA 1RFLA 1P5ZB 4TYNA 1OXSC 2V6JA 2H5EA 4N0DA 1T0HB 1ZIPA 3PEUA 1BO6A 1HE8B 4Q7LA 4Q9KA 1X86B 1NLZA 3MMPA 4LK2A 4WA7A 5BW8A 4HB3A 5J4LA 1K5GA 5EQTA 1TMKA 1N6RA 3LAWA 5DIFA 4OBEA 1EX6A 4F92B 2F9MA 3L0SA 4LHZA 2IHYA 4IKEA 4TZ6A 5BXQC 2Q9AA 4Q4HA 2QM8A 3I73A 2R6DA 1RRCA 1II9A 4CVNA 5DYGA 3TNFA 1XP8A 5KSZA 5EE5B 2BJVA 1P73A 3CPEA 4M8NE 3WBKA 1E1RD 4CYMA 3OIWA 4V0MA 2D2FA 3HYTA 2JEOA 2W0MA 2AN9A 1AGPA 2IXFA 3B13B 3U3JA 2J0UB 5GJVC 2JASA 2BBTA 5FBWB 5M04A 1NLFA 1DTSA 4KV9A 3KQUA 2QSZA 1GL6A 4U00A 1QZXA 5L3SB 4JSYA 4FIDA 5KU1A 3BK7A 5FPHA 5FUVA 1AS0A 2IYTA 3GEHA 2ZM5A 1XZQA 2QTFA 2YC2C 5JFGA 1ONBA 2O0KA 4YMWA 1R10A 3U3RA 1E4VA 2P67A 4QHYA 2ZUCA 1ZM9A 4UNRA 2YC4C 1G18A 3FHOA 3T1QA 1VHLA 2PMDA 2QAGB 2VP6A 1KJZA 3PITA 4AK9A 2EFCB 3TR5A 3EPHA 3BIFA 5DGXA 1P62B 4MKGA 1VCMA 4F91B 1XPRA 3IHWA 4QBGB 4HATA 5AUOB 3I61A 4PC7A 1DS6A 5E3HA 1KHTA 1XRJA 1NI3A 3C16C 4DCVA 2E9SA 3EG5A 4A1FA 4MDFA 5EE3A 2I1VB 5FPKA 1Z0AA 2YJTD 4BQSA 1AZTA 1AN0A 621PA 3IIJA 4RD3A 3L2OB 4TLBA 2AK2A 2ZYWX 2Q3FA 3GLFA 4PANA 2W2TA 2PEZA 3B1YA 1U0HC 3LD9A 4KFSA 4NH0A 4E22A 1W4CA 1G7CA 1E2IA 1I2MA 2AR7A 1AKEA 1AM4D 1SVOA 1XTQA 5CYOA 3VHLB 2JJ2D 2J9RA 3NEJA 3GJ4A 1N25A 1ZD8A 4PC2A 4LYHA 1DBSA 2JJ2A 2XTZA 3PFIA 3DEFA 3T15A 3BFKA 1HYQA 4C0HA 3OIVA 4LRWA 2ZS8A 4F38A 1CR1A 1E6CA 1GFIA 1Z8FA 2QTVB 4IDOA 1C4OA 4BLSA 3K0AB 3N5CA 3LBIA 1SXJA 2QTHA 2EYUA 2O8EB 4E09A 1GKIA 2BMJA 2YWGA 4NCHA 5C4MA 4HB4A 2ZSBA 1CTQA 2J41A 3QF4B 3THYB 4A0GA 3FFAA 5KNCA 2PLRA 2Z5FA 2DBYA 3SE0A 2ZRNA 4CF7A 5BQ5A 3IIKA 1LTQA 3P20A 4ZIRA 1F2UA 1DADA 4PSKA 1W47A 4Q18A 3WHLA 2FPLA 2XAUA 4X8HA 5JRZA 1K6MA 1SXJC 3EZ6A 3UWOA 2WWIA 3EC1A 3GLGA 1E0SA 2DFLA 3VX3A 2IYWA 1UADA 4I1VA 4EFLA 5E4FA 1RRFA 2CHVA 2ZETA 5KPDA 2AD1A 1G41A 2G3YA 2YWEA 1BS1A 1J90A 3TE6A 4YMVA 4QRHA 2VSOA 3GJ5A 2PT7A 4TMZA 4OI0A 3AF3A 3VKHA 4B43A 2CJWA 4QBFA 4IHQA 3RWOA 4JT4A 4KO8A 4NDZA 3KUCA 5DHAA 1SHZA 1UKZA 1KI1A 3BB3A 4Z51A 4R9UC 5G53C 3EPLA 4NONA 1L2TA 3W5IA 1G5TA 3O8DA 3RANA 2JLSA 1IY0A 2ZVPX 2V4ZA 2WV9A 4PHTA 2CK3A 2YOFA 2OV2A 5KSPA 4Q4JB 1Z3IX 2GK6A 5HE8A 1KI2A 2QMEA 1E1QA 4D0LB 4GBMA 4MYTA 4BFSA 2O5VA 3EXAA 2WWWA 2QQ0A 2BDTA 5JRJA 3K0CC 4ITRC 4RVCA 4YDSA 3DOFA 3WYGA 1KJYA 3B9PA 4I1SA 1MT0A 1M8PA 4JLNA 4B2IA 1CR0A 5DE3A 3TQFA 1E9DA 1DEKA 3Q85A 2J46A 1FFHA 2ECKA 2R6CA 3ZVRA 4AYXA 2YKGA 3UPUA 2IHBA 4BFXA 2IX3A 2GDJA 3IGFA 3THWA 1W5TA 1CJUC 1CP2A 4O25A 1AJEA 4LZZA 5A5GA 1W5SA 2QE7A 4R7ZA 1XX6A 5FUYA 4B47A 3AVUA 1XFAA 5FTNA 2WPDD 2YZ2A 3W6PA 5JBQA 2VF7A 2RAPA 2CL7X 1W4AA 2WIBA 1SVWA 1YZQA 4B3DA 3MSXA 2V8OA 1ANKA 1QG2A 2CBZA 4BZPA 2JJ8A 1TQDA 4O2RA 3ZIAD 3DZDA 2WJHA 5C18A 4D80A 4O3MA 4BUJA 1RC8A 2GETA 1Z6GA 3P26A 1OIXA 2WWHA 5JI2E 1E2PA 5UKDA 3UWKA 4PO1A 1P2UA 2R6FA 1W44A 1R4AA 1LW7A 2DB3A 1PUJA 1QHNA 1IM2A 2XSZD 1ZD9A 2FZLA 5DNYB 4LY6A 5KDDA 1NVVQ 3CWQA 2FV8A 5FL7D 1VCNA 3RS7A 2DFNA 4BLRA 1OH5A 1QF9A 2BV3A 2JGNA 4KI0A 4DLZA 2HF9A 1OH7A 3TRFA 1VPLA 4D4JA 2Z0MA 1Z6YA 1UEIA 4A36A 4A0RA 1NY6A 4DSOA 2WWGA 2J59A 2XTNA 3CUEF 4UXIA 3O8RA 4OHWA 4IVRA 1ZC4A 1KDTA 3AGPA 5JZVA 2QAJA 2CMKA 3O47A 2VBCA 2CVHA 3LLMA 3RVBA 4US2R 3A4MA 3O8BA 4QJ3A 3NEYA 1Z06A 5E95A 4FMCB 4FD2A 1MO4A 4NHOA 1T4GA 2PT5A 4XSGA 4TQ9A 1SQ5A 2JDIA 4IOKA 1OV4A 2O8FA 2C99A 3BB1A 1LF0A 3FYHA 1EK0A 1BMFA 1D8TA 1KOFA 4RFSA 2ZJ5A 3CF2A 2A5YB 4IXMA 4MGIR 1N6IA 3BXZA 4LOAA 1NIPA 2J7PD 3RABA 3GLIE 2Z4SA 3HR8A 4OQLA 1TL7C 2QUZA 3PUVA 1L7VC 1HURA 2FN4A 3K09C 4JMPA 1NIJA 2DWPA 1Q1BA 1XMVA 3LXRA 5FPSA 1DO2A 1FTNA 2RHMA 1RVDA 2ZYUX 5A0FA 5AUNB 2XJ4A 4Q21A 2A5JA 3VR3A 1W36C 1NVXQ 3TKLA 2UZIR 2GBLA 5LPNA 1YR6A 2YYZA 1AS3A 4C30A 2QT1A 1RJ9A 1QHGA 5JJKA 4Q1EA 1TUIA 3GEIA 3CB4A 2O8FB 2QENA 1UFQA 1CS4C 3HJNA 4Q1FA 1HY3A 2IA5A 3NDPA 2CL0X 4B44A 4ZDJA 5JEDA 1NN0A 3MAAC 4OYHA 1T3HA 1KNQA 1US8B 3EARA 3THXB 4DEYA 2IUTA 3CR8A 3BFXA 4HB2A 3V4FA 5DN6D 4JSTA 5CIWA 3LVRE 5JLJA 5JS8A 3QKUA 3AVVA 2PZEA 2WJYA 4PZZA 1IY2A 3B5JA 1XEWY 1PLLA 4Z8XA 4Q4LA 3TMKA 1A2KC 3RYTC 3CBQA 4EKDA 1P75A 5FPYA 4PHFA 5DHFA 4JLDA 4HZIA 2VF8A 4C7OA 1EFHA 3AGQA 4GSYA 1FQKA 4C4PA 1TF7A 2D4HA 4KBGA 1DO0A 3GLFE 4IOMA 3QXHA 1II0A 4HLUC 1ZM4A 2VP4A 3ZZTA 1QDEA 3AP3A 1F48A 3IQXA 4AI6A 4ILEA 4JLAA 2CXXA 3FB4A 2IYRA 1OIVA 2BMFA 4HAWA 2F1RA 3VNUA 4QGHA 4PC1A 4RKEA 2V1UA 2XZOA 1YJ5A 2NO0A 4IDQA 4AURA 3ZD6A 2ZJYA 4JBYA 3FMOB 2AXPA 4ERNA 1QVRA 3LY5A 4A6XA 4L15A 1U0JA 3W5JA 4EPVA 1XCMA 4XIGS 2QT0A 1FQJA 4PC6A 3SHFA 1DPFA 3B1WA 1XTKA 3WNCA 3ADDA 1SGWA 2TMKA 4Z1MA 4D25A 2A5GA 1G8PA 3MUFA 2O52A 1OFIA 5BYJA 2ZJZA 4W7SA 4FCVA 3OAAA 3T34A 4FXPA 5C4GB 1JR3D 5DISB 2XSZA 1KYIA 1GIAA 4A6PA 1E0KA 2B8WA 1BMFD 1XXHA 2JIZA 1XMJA 2ZR9A 3ZQ6A 4LJAA 4ZCLA 1P60A 3KFXA 2LKCA 2RGNA 3QUSA 1SKYE 5GJWC 2DPXA 2OT3B 3TW8B 3QIAA 5GADl 4BRUA 4B3BA 1UDWA 2C9OA 2FG5A 3KXIA 4UNSA 4M22A 4ZDWA 4Q66C 4XD7A 2B21A 2HEIA 4H1UA 1ZBDA 3CR7A 3GMTA 2C8VA 1CU1A 2VRWA 5GJBA 3LO5A 4WZAE 2FX3A 1OYWA 4TSFA 3W6OA 4NCJA 1NBMA 1EFRD 4ZI3A 1S0UA 1JI0A 3AKYA 2A7QA 2WAYA 2D7CA 1XTIA 5TMPA 1ZJ6A 3TW4A 3GJ6A 5DN6A 1Z47A 4FMDF 2HYDA 3CH4B 1SVSA 2C5LA 5EP1A 5FI0B 5BN5A 5DLQC 1PVOA 1XEXA 2HUPA 3GLHE 4X8MA 2GF9A 3WRXC 1HQCA 2IEYA 5B30A 1KDOA 4TLEA 5AUQA 4DXAA 2JJ1D 3DHWC 1NP6A 3NBZC 4HDOB 3U5ZB 4JL5A 1QBKC 2N42A 2X2FA 3FKSA 2P5TB 1LS6A 2XNDD 2AWOA 421PA 1VDZA 3UMRA 3CO5A 3LX5A 2ANBA 2R65A 3FMIA 3QKSA 3KKOA 2QNRA 1E94E 4URYR 8OHMA 4US0R 1JJVA 4JLOA 1E1QD 3DL0A 1TNDA 3IPXA 4QJ4A 5KYKA 3NBYC 5J5CA 4E5UA 1IAQA 3W8RA 3BFVA 4PPFA 4Q1DA 4S35A 4JT2A 4NYJQ 2H8KA 1KI6B 4A82A 4OI2A 1GL9B 3ZH9B 2W2VA 1KK1A 4MGKR 3PQCA 4Q9JA 3CKLA 3DPUA 4UJ3A 1D6JA 2A30A 3EPKA 1G64A 5GVSA 3DM5A 4RZ3A 3WBJA 4KITB 1DAHA 3KTAB 5JHGB 4QM6A 2F6RA 4PZYA 2ZS7A 2B6HA 3IBYA 2CEAA 3K70C 2MSEB 3DKPA 4QOSA 4EPYA 1M74A 1G4AE 1QHIA 4MYCA 1M2OB 2Z43A 5CDFE 4RKFA 1GP2A 1LY1A 1TADA 2C96A 4RSGA 1M1YE 1ZRHA 3I32A 2FSIA 1CR4A 2W83A 4FINA 4GMDA 4Q1CA 2RGDA 1XF9A 3EAQA 3I3SR 3IEVA 3LX8A 3I72A 2WPDA 4TZ0A 2A78A 2PCJA 3REFA 2X1VA 2PJZA 4QHSA 1S8FA 4R2HA 5EP2A 1U2RA 1N6LA 4JZKA 4RZ2A 5FBQB 4DB4A 2SHKA 1KJWA 1S3GA 1X3SA 1OLOA 1T6NA 3AKEA 3Q3JB 3TVDA 3I8SA 3PUZA 5J40A 3DM9B 1S3SA 1U99A 1A5TA 4RJLA 3A36A 4W5JA 2J1LA 2OFXA 5JWRA 3ZJYA 3RAPR 1GUAA 1HTWA 4MKIA 2FDCA 5EXSA 4Q5IA 3BOSA 2QPAA 3LQQA 3B2EA 2DFTA 1E2JA 3PEVA 5JEEA 1ZD1A 2H17A 4EAQA 2REOA 4ESVA 3W3AA 1T8TA 1VG0B 3T1VA 2R6AA 4HAZA 4B34A 2IYUA 5GJCA 4L4UA 1R0XA 1N6HA 4C0JA 4LBWA 5F3WB 1ZVQA 3NH9A 4UQOA 4CT4B 3H1TA 4Q9LA 4M1TA 2P6RA 5FUXA 1XMSA 3VMFA 4DT1A 5FPTA 1GOTA 1MABA 4C3ZA 3KQHA 4CGZA 2P2LA 3AQ4A 1LNZA 1W2HA 4L9SA 2CCGA 3C15C 3NC0C 3UIEA 1SXJB 4LPKA 3TR0A 3E2IA 1RYFA 3BGWA 2QRZA 4EPWA 2V7QD 2IYLD 4NYMR 1W0JA 1DAGA 3OF5A 4TT3A 4A2WA 3AB3A 1D9XA 4II7A 1IHUA 4V0NA 4Q9IA 4A0HA 5HKKA 5CLQA 2KBFA 3WMGA 1OSNA 4LC1A 4OL0A 3OIYA 3GJ3A 2IXGA 1JQJC 1TQ6A 2J0QA 4NPHA 4P4TA 1AQUA 4U7DA 4BWYA 1U8YA 3U61B 2F7SA 2ATXA 2ZR7A 1X8JA 3PR1A 2FOLA 2CLSA 4YLGA 4M1YA 1W4RA 5JSZB 1QRAA 4BEBA 3PEWA 1S2MA 3C5CA 3Q72A 3SJCA 4IFBA 3U3OA 2D62A 2RMKA 1Q3HA 1RE0A 3UATA 5B57C 1KNXA 4ACBA 5J4HA 1E9RA 4KVAA 4NP6A 1IXRC 1J2JA 1Z63A 4GI7A 3AF1A 4KLNA 1WQ1R 4O2LA 2GHIA 5D3MB 3IEUA 3GLGB 2OE2A 3KJHA 2H7VA 4TQAA 1HV8A 1G5PA 1MO3A 5CK5A 4GOKA 3PJRA 1HE1C 5DI3B 1Q3TA 2KI5A 1OJLA 2VIIA 4ZKEA 1E2NA 1RZ3A 2B8TA 4EQ6A 1F3OA 5EXPA 5TY0A 3KQKA 3IO5A 2JLQA 3D7MA 3RRMA 1FL9A 4F4IA 1ZC3A 1GKUB 4A2QA 3R8CA 2WSSA 4MQBA 4KHZA 2GEUA 2F3RA 3EZ7A 4N3NA 3HDTA 1Z6TA 2KB0A 5TARA 4EPRA 4LJ5A 2XGJA 3SOPA 1W0KD 4URWR 1NF3A 2X19A 3TK1A 4B76A 1S1MA 1GL7A 3JZMA 2NOAA 3MWLA 1UKVY 2O8CB 3P27A 4UKDA 4M9SA 2JJ1A 2QBYA 2ZYTX 2V7QA 1X1RA
chains in the Genus database with same CATH superfamily
1ZGHA 4HGNA 4JLPA 3ZGYA 3JWPA 5J9FA 3BE4A 5CFQA 1KEEA 1WCIA 3UMVA 3F1KA 1DRVA 3VUFA 4O4LA 4GZ6A 4KW7A 1TAGA 2EVWX 5C81A 1RJFA 1E62A 1NC1A 1FVFA 4MIEA 5D87A 3TSYA 3ZNPA 3C7KA 3IDQA 4MTLA 1M7GA 2XA2A 4K9OA 3L7BA 2QNIA 2PMFA 4BKMA 4ILKA 4TWAA 2QKYA 3VSCA 3M5PA 2QL5A 3EHEA 1ZH4A 2F59A 4RF3A 4LHEA 3BHMA 3ICEA 1G5RA 4TLAA 2G40A 5K1ZA 4CDNA 4PAGA 2HIMA 2FFAA 4PZCA 2QORA 1DJPA 3HXQA 4KVGA 3WGIA 4JH0A 4DUGD 4S12A 2JFNA 2FJPA 2OD2A 4RD6A 5F76A 4C4YA 5HZHA 5L3QB 4G0PA 1XK6A 1Z08A 1GLNA 2JBWA 1C3OB 1GPYA 2QY6A 4CTOA 3IJRA 5ED0A 1GAQA 2ZPAA 3NLLA 2EQBA 1YKSA 2O06A 1UZNA 5E8JA 3LRPA 4HXGA 2RGAA 1S4MA 2XVMA 4IIHA 4UVDA 4CGYA 5A4AA 2EU8A 5ADHA 4YXWD 3FGNA 1A8SA 2XGSA 2XZDA 2D1SA 3N8KA 3Q3CA 4HPWA 1NM5A 5KCZA 4EB6A 1QHYA 2VYFA 2OAEA 1TVKB 2X3YA 4OBBA 3DUWA 3E9DA 1G19A 4KQ6A 4C6HA 4WY5A 4M46A 5SICE 3PF9A 3W2GA 3L0CA 5HXAA 5FHQA 1O5IA 3MC1A 1ZA1A 4WNAA 4G5FA 4IEFB 3R20A 1KFBB 2QV7A 1IULA 4AWXA 2C5SA 3B1ZA 4DLSA 4QBIA 2TECE 4ALMA 1Z34A 1T2DA 3BE6A 2LCQA 4YQFA 1ZK0A 2O9JA 4IPTA 2R1TB 1PCXA 2GJSA 2IEIA 3COSA 4Q6WA 4EA9A 2A2ZA 1U4OA 3AEQB 3AHIA 4YFVA 4QTXA 4IMIB 2H1SA 5B6JA 1K7CA 4RPHA 5EG5A 3CCFA 4B3CA 2CL6X 3GBVA 2X40A 2W71A 2J48A 2DWQA 3RTBA 1JR6A 5ANRB 5HWSA 5BWNA 4LF5B 4CEIA 1PI3A 5T3YA 3VKGA 1WVIA 2KJQA 3GDWA 3TOXA 1AQIA 2OO5A 3BZBA 3BD7A 5LQCA 2QLNA 3F9IA 2WMYA 3GJQA 2WD7B 5JJLA 4KPUA 2X0FA 2FMIA 1BFDA 1UEJA 5F77A 1OIWA 4QYXA 3MTGA 5C1PA 1U90A 4DMGA 3B48A 2AW5A 3LT5A 4BECA 1MHTA 4FSHA 4HEQA 4FE4A 1W2WB 3PE4A 1NE7A 2H3EA 4JKIA 4MR7A 4REMA 1E8DA 2H4JA 2Q7DA 4COOA 2VNHA 1VXOA 5A06A 1KQ3A 2N1BA 3NBAA 3MUNA 1UJ2A 3IHLA 1U1IA 4WTOA 4Y3UA 2V65A 3IALA 1CUWA 2BZ0A 1RIFA 3OE1A 3PCXA 1Z8DA 4HEHA 4IIGA 2IPLA 4OXIA 1Z62A 1N5JA 2FEOA 3NHWA 3T38A 3FSGA 2F4NA 3TTWA 2YYSA 3PA6A 2G6TA 2ZJ7A 3TSZA 5T57A 1OTYA 3LI2A 3K0SA 1GPDG 1HT1E 4BQFA 4FS3A 5CXXA 5CNMA 5CD1A 1XPUA 1S89A 4INAA 2QSUA 2P2GA 1UBHS 2PX2A 3EODA 3D9QX 4RIFA 5IAGA 4CNQA 3RD5A 1ABFA 2FJUA 1ZNQO 3HVKA 1JIUA 4MH0R 3SXUB 1DQPA 2GD0A 3GOQA 3KDPA 2GBCA 3QVJA 2B2CA 4P4SB 1P44A 3KRTA 3E3OA 4PHGA 5HRCA 1N5DA 2RHRA 5E9AA 1NVEA 3LKZA 4IJ6A 1W29A 3PIDA 1VJ1A 2FSUA 1RLIA 2NXNA 3E7PA 2RAUA 1PF7E 3H1PA 3PQFA 4TMXA 3ZLJA 2OV3A 1IUKA 2BBOA 2QJRA 3UK6A 1PFVA 1N5MA 4QPCA 1MB0A 3GA7A 1NR5A 4KRXA 1R4NA 1XN1A 1KYWA 1YZUA 3AEYA 1OH6A 4FNOA 3J81A 1CD5A 2IYVA 3DGFC 1JJFA 1NLYA 2QG4A 1OROA 2YZMA 3GD7A 2JKZA 1CLUA 4A4DA 1WV1A 1JLMA 3CT6A 2I6GA 2PUEA 1UT6A 4OQEA 3WSTA 1AXGA 3H2YA 1HSOA 4BNNA 5BR1A 1W1UA 1P9WA 3I4LA 4MAAA 4FMBB 4FFNA 1JLSA 3VX4A 4YRZA 2FHPA 1H66A 1TUBA 1DLJA 1PK8A 3MJHA 3HCWA 3ZE8A 3RJ5A 2HA0A 1I4WA 3TSOA 1W88B 3EQZA 1QYCA 5E8RA 4M0DA 1NT2A 5HRAA 1T6ZA 1UZUA 2WNIA 3E1GA 3N2ZB 5HCIA 4ARCA 2ESRA 1EQUA 3L06A 2W6JA 4X1KA 4L0MA 3ZV4A 1WF3A 2QN8A 3EVDA 3OP4A 4Y2RA 4AJOA 3VXKA 4B2LA 4GPBA 4GOXA 2FWJA 4AMYA 1X1QA 1ZINA 4OGWA 4UE2A 2HEGA 2I4OA 2X8WA 4CHGA 4BFUA 1KWKA 2PH1A 4J6EA 5SZJA 3T1YB 3OEEA 1AOXA 1JDJA 2GLXA 1XJ5A 1A3CA 4MR9B 1Z2DA 2V5UA 4OQDA 1JEDA 1N75A 1XRRA 2FZ4A 3X43A 1K8QA 3H4IA 3DYIA 4QFBA 2VVTA 3V8NA 5HA5A 2WEKA 3RRYA 3P4XA 4V0LA 4RJ2A 3S7ZA 2AEJA 5FWNA 2FMTA 1FSFA 3KC2A 1YBHA 4BX0A 1QVWA 3O94A 3M8KA 4H7JA 4AZ0B 4NCNA 4HD8A 2WZDA 2A35A 3GROA 2WAOA 5DLYA 3L7DA 1LTHR 2FWNA 3UGTA 1GZ4A 4D82A 4D9JA 3UCFA 4PFSA 2X77A 3HEBA 2X0NA 2P2SA 1C0KA 1E9SA 2E82A 4BEVA 3DMDA 1G20B 3D0KA 2H1LA 4UQPA 4F2DA 4FC6A 4C04A 1TOAA 3R3YA 1L7MA 1LGYA 3VA7A 4R40A 4TN1A 4EW2A 3PVCA 2Z83A 1NTRA 3DF7A 2GR9A 3RTCA 5A5EA 4D8WA 4DBLE 1F4PA 4P84A 1ZS9A 4XAQA 4Y2VA 1X7XA 3NAMA 1WDTA 2AFHE 5B57C 5CDUA 4CM7A 3KEFA 1RQLA 1H3NA 3R6WA 2ST1A 1CE8B 1Y33E 3BCSA 3C1TA 5TDHA 1EESA 3ANNA 1NNUA 2LW7A 1VP3A 4KAFA 4QXPA 2YW2A 3TPFA 3UFXA 2HA7A 2UYCA 2F43A 3KJQA 1FA9A 3QOFA 3QU7A 3FNQA 5HIKA 5BWOA 3ENKA 1K6IA 3NVDA 5CUQA 4R71A 5L4NA 1C4WA 2YJ6A 2EFYA 1GSAA 2KWIA 2FAXA 3MJCA 4KUHA 5LJLA 4D96A 4UUOA 1U9YA 4AD8A 5CM2Z 4A23A 8LDHA 4J1NA 2O57A 2QB5A 5EAIA 3STVA 5JQGF 1IY9A 1T8PA 3BJRA 3L0BA 5G3ZA 3IQZA 5LQDA 1R12A 4YMUA 3M83A 3SY8A 1SB9A 2IY8A 1UK9A 2GLTA 5FTLA 3NWEA 5LQMA 1F5NA 2A5FA 2ZWVA 2G77B 4PQRA 3UK7A 4FFWA 1U7PA 2EP5A 3SHOA 1BKSB 1H0RA 5HKBA 1IEVA 5HDQA 1H42A 4B84A 1WM1A 5LU9A 3IAS6 3WWEA 4M6WB 1ORVA 4IX9A 3L7OA 1GAJA 2YFYA 3BH6A 2BVNA 3LT0A 3UJBA 3OZAA 4K1XA 5KOYA 3GGSA 3RT1A 1QKIA 3W9YA 1B8VA 3IAM6 4I5FA 3HA5A 4LF4B 3IBGA 1N0WA 2LDBA 3NOVA 1J0AA 1JVBA 4J0FA 5IDQA 3JR3A 5EPOA 1A8QA 1RYHA 5DX1A 3FCEA 4DYDA 2I33A 5TPWB 4QG3A 3A9RA 1WCWA 4JZYA 4TXNA 1EFPB 5DH9A 1MIOA 1Y9DA 2PLAA 4FD3A 4N01A 5AQEA 5D01A 3ZLBA 2EJBA 2OCLA 2W9XA 4PZUA 4DMUB 4FPXA 1YZFA 1X15A 5ETJA 2R96A 3LXXA 5H1YA 1BDIA 4KR0A 4ND5A 5IXJA 4QDTA 2FQXA 3EWNA 2HD4A 1H2HA 2QL9A 1MGOA 2WBLC 3HWWA 2IZ6A 4JFRA 4ENQA 2CDCA 3EXEB 2GTHA 2VTKA 5C53B 3KJNA 3P19A 4NV3A 1XNJA 1SOMA 2R6R1 4ZKDA 4WI1A 3SR4A 2AUTA 3A6JA 5FYDA 4JXKA 1WNFA 2FNAA 4BP1A 1WUYA 4LIPD 4FDVA 2HV9A 2IHTA 3U3MA 2NZVG 1SCUA 4LQ4A 3ZBPA 1H4QA 2IDMA 1U3WA 3CKYA 3HPQA 4ZTBA 3BWMA 4R3NA 1R0CA 3FR7A 1YRYE 1ZJYA 1F2UB 2H07A 5HM8A 4DLLA 1CF4A 3CRW1 2AV6A 1YOVB 2UUPA 3FE2A 4O1MA 4X1KB 1T2EA 4ZAVA 2GFQA 3R44A 2AOTA 1S8AA 2DPHA 3SIWA 4RS3A 3LNCA 2OG2A 3IMKA 3IO3A 4GLJA 4V1CB 2JKVA 1K98A 1ZD2P 3IYLW 3CEPB 3QE4A 3LUKA 5BQ3A 4KN5A 2P8SA 1HR0B 3K1JA 3T1OA 2EYQA 3Q7IA 3VOAA 4CR6A 2VDVE 2PE5A 3MHTA 3AY0A 3O73A 2MT9A 5FTWA 5JCPA 5LMCA 1G6KA 1NPDA 4N5MA 5DNEA 4XVCA 1TJ3A 2X0DA 2AZTA 4JHLA 5AR1A 4PEVA 2AFIA 3OC0A 4LE0A 3U7JA 3QG5A 1PNQA 2AL7A 5HTKA 3U4MA 2H2GA 3WYFA 2HWKA 3MPOA 5IT5A 1WV0A 3PNOA 5BO5A 4EM6A 2BEWB 2ZWIA 3BJEA 1NWCA 2JAQA 2VHCA 5DTQA 1T4MA 4KOAA 5JNSA 2FPIB 1QRSA 5JI3E 2NUAA 1BKYA 4CIXA 2R8OA 1YL6A 4J7XA 3DEJA 4U8GA 1CRLA 3A6GA 4XW2A 3LX6A 1QVVA 1XJCA 1VDMA 2QTMA 5TPZD 2PRSA 4HGZA 4OP1A 3W1WA 3M4YA 1DWPA 1GNTA 2NN3C 2F3QA 4L9WA 5B37A 5B1HA 3TUZC 2B92A 3EDQA 2VCHA 4DQDA 4DSNA 1JR2A 1RHKA 2CD7A 3SDZA 3U17A 2W6ZA 1ZP6A 1E2KA 4Q3AA 1YS7A 2OORA 1P18A 4L4RA 3MG9A 4DV7B 1NV8A 3FMFA 3OLCX 3FYUA 2UUAB 4WDRA 3B1XA 5KNDA 4I9HA 3HJFA 3WMFA 1COZA 3PC7A 5FWDA 3RKRA 1YAHA 3CZQA 3GXBA 5FFNA 5GAJA 4CV1A 5TT0A 4D56A 5A1JA 1Y4ZA 4OXYA 4TMTA 2FF7A 3IOYA 1KDYA 3WRXA 1NRXA 4BJ5A 3DKKA 1QO7A 3SQLA 4MRPA 4EL0A 3R7BA 2X7JA 1LH0A 2I3GA 1E3QA 4UDNA 2BKAA 1KWGA 3A32A 3I5XA 4HWRA 3RFCA 3VPCA 1QSGA 1USUA 1ZW1A 4XWAA 2BUCA 5AI9A 3CKKA 4HRYA 4Z8YA 1LLFA 4WAUA 1GUZA 3SIRA 4C88A 2INGX 3FPSA 4BLPA 1CP3A 3DBLB 5EJEA 1A4XA 4G56A 4TV9B 3GFPA 1WXQA 3HJBA 1R8SA 3IKJA 4OGGA 5DM70 2PWAA 3IR5A 2NLOA 2WE7A 2Z98A 4ZC1A 2YJGA 4MOWA 1ECCA 1H5NA 4YJ3A 4BC1A 4EMBA 2FN7A 2IY7A 3CEMA 1JT2A 2CVZA 2Q5OA 3D3WB 3OLYA 2W42A 3X2EA 2B94A 3NHAA 5E6UA 1C9MA 4RA6B 1UMCB 3CN7A 5L3VA 3F5FA 3IE0A 5T8KC 2C4TA 3RVQA 2D5LA 3CZMA 1YFZA 3I64A 3ZOKA 3ZK7A 3KPYA 3OZDA 3N6RA 4TZKA 5CVEA 3I34X 2F3PA 1X7HA 1SHLA 5FR1A 4FZ5A 1NW9B 1ZICA 3VAZA 3DSRA 1ZAKA 2DH5A 3T3NA 4GBJA 2W6QA 2J6BA 3OUZA 1CFZA 3L0DA 4P7BA 3BSFA 2FG7C 4P0TA 2VQSA 2BKUA 4BBAA 1MH9A 1NUSA 2C95A 3P7MA 1JTFA 2PBFA 3DDWA 4GLBA 3ZV6A 1ZKMA 3IP3A 5TGZA 1GLVA 4B7ZA 3JVUA 1HT2E 1SBNE 5CGQB 1EUYA 5JBIA 3OTIA 1JALA 1O94D 3HKCB 4DNPA 2CSXA 2PZMA 4X7MA 4FBGA 4CV2A 3HB0A 2CLKB 4RJIA 1MBZA 4BQRA 4AY5A 1HEYA 4DCTA 3S1AB 2O2XA 1DL5A 2P77A 2QAIA 1BZYA 5I4CA 3KKKA 1WIWA 3JYLA 5I3CA 3F96A 2QEQA 4EFMA 4GP6A 5CLHA 3ZGLA 4TMVA 4BPBA 3O82A 1A5SB 2E4AA 1EXNA 1H5UA 2VYVA 4L07A 1PYGA 2ZDGA 4ND7A 4RTNA 5LKAA 2OB1A 4B8WA 1F8XA 3OZUA 4B3TB 5CJPA 1EJ0A 1PG2A 1N5IA 5AVZA 5TLSA 3O26A 1CKEA 1Z82A 4ZDIA 5BSUA 2R4TA 3W79A 4RX1A 3EXHB 5DPMA 6ABPA 3OM0A 1Y1SA 3E1KA 4DCMA 4DSZA 3FZQA 4OX9Y 5LQRA 2RIRA 5LA6B 4YJKA 1VLHA 1KFJB 5K8UA 1CB7A 2GRUA 2W2KB 4PYMA 2ZSDA 3I5MA 1LS1A 2JH9A 1WDKA 4R2JA 1EA5A 4ZAZA 3R40A 3OU6A 3Q7RA 4HR7A 5COAA 4F4DA 2J08A 3EK2A 1VGQA 3PQ6A 5CU7A 1CYEA 1CQXA 4I1IA 1EINA 4RAQA 4D5EA 3R9WA 2EP7A 4NV0A 1V4BA 2JI8A 2HV8A 1Y9EA 2YY5A 2H51A 1T1SA 3DV9A 4OCZA 4D0GA 1JIVA 3G2PA 5CLGA 4DDWA 4B3JA 3F8WA 2IF2A 2QDKA 1Q95A 3EIHA 4Q48A 1HE3A 3GAFA 1ZESA 4DZTA 1NXQA 1UH5A 3PHIA 1E3SA 2KX7A 4BFVA 1AV6A 2EERA 1A95A 1URPA 4Y2GA 1CB0A 4E1AA 1RWVA 1EWYA 2ZUDA 1HDGO 4M7OA 2IVFA 1IZ9A 4GX5A 5DM4A 1E8NA 3EEBA 2PKEA 2C07A 1QO9A 4QTYA 1X94A 1OV6A 3QHQA 1TB4A 5FBZA 4FN5A 2I6XA 3GLGE 5JXHA 4FUTA 4OYYA 4R2MA 1NAIA 1CUXA 4I3GA 5KOJA 2OCKA 3Q15C 2ZKLA 1DX4A 3HWSA 2DPGA 2XKJE 1S1CA 1PG5A 3UWSA 3QU2A 4C2TA 2YNMD 1MABB 4JLJA 2EIXA 5KPJA 5HKAA 3TZBA 3EVZA 4XJXA 1ZGCA 1FU7A 2OCXA 2ZSJA 3G5AA 2GCPA 4MGHA 2UUCB 1T2NA 2X9GA 5AIAA 1UDXA 1DWOA 1G291 2ZWAA 4G0NA 4L4ZA 1P1FA 4LBVA 1JSCA 1UPBA 3ZNNA 1KY5A 4FWTA 4Q6BA 1JFSA 1W4ZA 1U2PA 3KZVA 5CJ2A 3H6HA 5JYDA 2K2WA 2W8BB 4BAZA 4BN5A 4IX1A 1VYVA 4DRXB 5KC8A 1VLJA 5LXTA 1TZJA 1FVHA 3RR2A 5CT8A 2OXIA 3B82A 3TTVA 4LXXA 5TRTA 5JWHA 1JB1A 1NR1A 4L16A 5KKCA 2IOFK 3LUJA 2FXIA 1EGHA 4JDUA 3KJGA 3KEQA 1H8HA 1QH0A 5B64A 1E9EA 4IS2A 4H1WA 1Z0IA 4XQGA 4P86A 4KYTA 5LMNB 3NG1A 4DA7A 3ES9A 5AVSA 2JS7A 4KDRA 4EHJA 3F0TA 3PVSA 5DHSA 4AL4A 5AW6A 1PJTA 1VBKA 2RGRA 2HDWA 2I4LA 2FFHA 2OOKA 1B73A 4U5XA 4QYIA 4UFOA 4BCCA 5EUCA 4QQ8A 1DBQA 3K53A 2C3MA 3RVKA 1K3UB 3PJEA 1T9GR 4KGDA 2AKYA 2I6TA 2JIQA 4M54A 3QJGA 1CXZA 1YO6A 4HB0A 5KJFA 3A2NA 3FROA 3T3PB 1NI5A 3TBFA 1PQPA 2CNOA 6NULA 3HFRA 4IJUA 3QFFA 5E7IA 3DZGA 2IYEA 2HI0A 1WVMA 2DR3A 3K6JA 1JEYA 5L6LB 4MB6A 1KE2A 5CURA 3CV3A 3ZCVA 1P8AA 3SBOA 1EJBA 4XIFA 1X6VA 1VMKA 3AUJB 3I9FA 1RC1A 1TA9A 2O3JA 4O0LA 4KWIA 2OQ2A 4LJ6A 5AVOA 5HS6A 3ZE1B 3I58A 3BAFA 4OSOA 4E2ZA 3REQA 1BIFA 2J5XA 1A9YA 4R5MA 4EHDA 2EX1A 4ZALA 4N18A 5GY7A 2VXCA 3GXOA 3EGWA 1EJ2A 1TPZA 1E6MA 2HF2A 3B9BA 3GEPA 1KZGB 2BFDA 3BSYA 5DLPA 1PSDA 2SKCA 3OZFA 4B4WA 3I9JA 3IILA 1BRMA 3E9YA 5J47A 3OF3A 4E07A 1F1BA 2D1RA 5EJ2A 4HDSB 3S68A 1FUUA 1OVMA 3FCYA 5BN3A 4YCBA 5EJ5A 1NQVA 3DKVA 2CJYA 2EKDA 2OFWA 2FW7A 3DMTA 4QQKA 1Z38A 4U2CA 1CJKC 1C50A 1KFKB 3OP1A 5LXTB 2FEPA 5JMTA 3WGUA 2XQGA 4XDGA 3V6MA 3H0EA 3TQIA 3P45A 3PUWA 4LTDA 3ZWMA 4ZMSA 4IZIA 4ZO7A 3FGOA 2WUFA 4DR3B 1Y9JA 3P9XA 2OBLA 4WW0A 3ZCUA 1WMDA 4BB6A 1S7GA 3D6JA 1X7WA 1U6IA 4R69A 4N8DA 2VZLA 3UNXA 4XUCA 3MCVA 2WHPB 2QN3A 4V0SA 1SUDA 3T5MA 2WQ6A 1EJ6A 1ZVJA 4MV7A 3NC4A 2YWHA 2C7GA 2FUG1 1QU2A 3HCCA 4ZANA 3T3DA 2C2YA 4OQFA 3FSRA 2DT8A 1O03A 1UDRA 4NE2A 3I6IA 1KO7A 2O50A 2R6ZA 2W2QA 3M70A 4C4SA 1L5HA 2E4XA 3PHJA 3RS0A 3U62A 4HSEA 2YV1A 1OFVA 1Q7BA 2J09A 4EG1A 3AF5A 1CJTC 3NVMB 4U02A 1SIBE 3NOQA 2OXTA 4W5HA 3ZG6A 1AZWA 1RYDA 3DTTA 3R4CA 5A3VA 3JQ7B 2XZPA 5AHXA 2Z8XA 3TLBA 2TSYB 1K8YB 1KZ6A 4X85A 1BS2A 1JU3A 1R4MA 5B3JC 1FXWF 3PCTA 2QM0A 3V1UA 5JAIA 3RFVA 1P7CA 1Z2NX 1GPJA 3LXMA 3RSQA 4D4IA 4JK3A 4J0EA 1RHQA 4QARA 3AERB 1WVGA 1F0KA 2OZKA 2RKBA 4CUZA 3UWPA 4F97A 4JVOA 2CMFA 4HZUB 1JXMA 1DKQA 4MJ7A 4RY9A 5J2TF 1PO7A 4GPTA 3V1TC 3OQIA 2CB0A 5JSZA 2YCBA 2UZ0A 4CTNA 4ZO9A 3TIFA 3PX7A 4AS1A 5JYBA 1NSFA 2VA8A 3A2LA 1BJKA 2YWJA 3B52X 1V6CA 3BC1A 3NORA 2PT6A 1J42A 1N2IA 3DDHA 1WLYA 3RYHB 4F4UA 2ACVA 2Q1WA 1JI3A 4WNAB 2ZB4A 1YR2A 3HLTA 5IF9A 1WOYA 2ORWA 2D5CA 3CUUA 3L4SO 3PNYA 3NATA 3Q9UA 3KEMA 4HZGA 2P9YA 3SFTA 1DE0A 4EK9A 4Q4CA 5BT9A 4P22A 4UU8A 2IPMA 2L18A 4I1UA 3W8DA 1EBUA 4G07A 4CDGA 2JCVA 2P9CA 3GDHA 1NXTA 2IYQA 3B1VA 2OA0A 3V4RA 2CFCA 3BUSA 4E5PA 1ZDMA 4H7EA 4HYQA 5KSYA 2Q3CA 5AW2A 5DBIA 3KSAC 2IFTA 5AM3A 3KQWA 2GI4A 3ER6A 3NNDA 2ZJ3A 1YZKA 3FJ1A 1RXVA 3I2JA 4RANA 3WDMA 5KWVA 5K8IA 2WZQA 3CUVA 2H18A 3H1BA 5JISA 2DYKA 2H06A 1N2JA 3EXFA 4CKEA 1WP4A 1M6WA 1RZRD 2CJXA 1I30A 4S0ZA 3GCZA 1OXVA 3LGAA 1XZLA 3OIDA 1L9KA 4V0OA 3WTBA 2P35A 1MRNA 3AF0A 3IXLA 3QPUA 4YAOA 3HCPA 4EB3A 4E32A 5FWYA 1D2HA 2CLFB 1W1WA 3DDNA 1UAGA 2FVXA 3CX6A 3OJ0A 3PZBA 3U13A 3W2EA 2PX5A 1FLNA 3GWGA 1AKVA 2O2HA 2X5XA 1JHQA 3ESZA 5FX2A 1F0PA 4KAJA 1HDCA 2QP4A 3M6IA 1T3GA 4L74A 4Q7MB 3GHYA 4D41A 6ADHA 3NV7A 1JR4A 1P8JA 5JQGB 4RKQA 2ZRKA 1OZGA 4PR3A 2R8BA 3VZDA 2EFGA 4HFRA 4A8PA 3SM3A 1JJIA 3HXMA 1A4IA 2YDYA 2Z2XA 3PV0A 1VSQA 2I6FA 3LNTA 4QYSA 1H6CA 1MX3A 2FMFA 1C30B 1W9HA 4D26A 2PFGA 2FSSA 5EERA 2FZCA 4KX5A 3RC1A 4HGYA 5JXWA 3NHJA 3TJRA 5GIOE 3LTNC 4YVFA 3C6QA 1HLPA 4W5NA 2IYFA 5LZ7A 2Q3LA 3BILA 5E6SA 1JFFB 3O4JA 4BO2A 1W4BA 1HNWB 1O97C 1EFPA 1KJQA 3ABRB 4TS9A 2B36A 2OESA 2RI6A 1UBNA 1H85A 1RBQA 4KDCA 3IUYA 4O1HA 2XT6A 4D3FA 3HB5X 4V1CI 2EXXA 5IAAA 2NU7A 4OHXA 3DE7X 1CUUA 1L5RA 5DSZA 1QHEA 2R6HA 3A1UA 1A97A 3K1AA 5C8XA 1FNDA 4DV3B 3EC2A 2Z09A 4I4LA 1UXHA 3PS9A 4JI0B 3MT8A 3UGJA 4NSNA 1K4MA 5DWDA 3FFTA 4NDNE 1CJSA 3LKVA 4N7JA 4NULA 5K3AA 1JE1A 3BTUA 1U3TA 3ICQB 1M6EX 1VE5A 2FFJA 3A70A 3KTDA 4J9VA 1SVKA 5HTOA 3JAKA 1VIMA 4CQJA 2QRGA 1M2HA 2P6NA 1F8GA 3AWIA 2W6OA 4KB5A 4AC9A 4RCVA 1DBRA 1ENYA 3WGZA 2I2WA 3U2QA 2FKNA 2XMCA 3E58A 2ZJFA 3DEHA 5LP6C 2I55A 2FSVA 1NVUQ 1KY2A 3IEIA 4YP0A 2QU8A 3G0IA 5F7JA 4C21A 3EX7C 4GOOD 1DQNA 5AH0A 3AHCA 1ZD3A 3DA8A 5FUMA 1ESMA 3H0KA 3KD3A 3P71T 4R1QA 121PA 1PNTA 2QTLA 3MS7A 4TKVA 1Q16A 4MYHA 1PHRA 3LECA 3WNDA 3D4BA 3RAGA 2XYPA 5SY9A 2NNLD 1QV7A 1Y7TA 3KSDO 3LVQE 4BJ1A 4CIWA 3ND7A 3J81k 3I2YX 1XAIA 3SYTA 3MD0A 1NX9A 3TIGA 3U3ZA 3VO8A 1KMQA 4RAOA 4L3VA 3NBXX 3FOFC 4Q9NA 1A8HA 2W00A 4L0CA 3WJ2A 3KJIA 3F3YA 3JQBC 3NALA 3H4VA 5AK0A 4QGBA 1H4SA 3AMVA 3R6DA 2WSYB 3L0YA 1Y9AA 2YR0A 13PKA 1R00A 4LFAB 4PONA 4BC0A 3IQGX 3DKRA 5K8TA 5I9TA 1IHYA 2AG5A 3TEMA 2AN4A 3NJ4A 4XIYA 1WKBA 3VHXA 3W2FA 3T7DA 1CRZA 3E9CA 1XHLA 1Y42X 2ID7A 2AYZA 3SF8B 2IW3A 1WBJB 2JHPA 4AQDA 3THOA 2Z4RA 3UB3A 2ORVA 4N0QA 4PS0A 1Y8ZA 4DCCA 3KPVA 4XVHA 5HILA 1QFSA 5MF6A 1YA6A 3M6LA 2EHDA 2H3HA 2QL6A 4YB8A 3KXLA 1QPGA 3BRWD 2YWRA 3AO0B 1WEKA 4Q4AB 5NLLA 4M38A 5T3UA 5A9SA 4B31A 1NQAO 2G4CA 3GCGA 2AXNA 1WF6A 2V6GA 4OA5A 4AG3A 1GQYA 1E3WB 2UKDA 2VRNA 1CJMA 2W4MA 2ZZKA 3QNWA 1U8TA 3BICA 4UNQA 3U48A 1OFUX 1QIEA 1VHTA 3JRXA 3RW9A 1LPAB 1J7JA 1EDBA 3LHSA 3T9CA 2AXEA 4REQB 1WUKS 4DRZA 4A8JC 4WBXC 2FX5A 1KYYA 2QROA 3QF4A 4FFRA 3AEZA 4M9RA 2PSDA 4MW0A 3ROEA 4GXRA 1STOA 2ZRFA 2HXYA 4QPJC 3ZZNA 3BCRA 1WBBA 1LWNA 5JCJA 2VT6A 5FWXA 1YVEI 4BZZA 2IPNA 1AV7A 3FHLA 2XUAA 1P1BA 2BC9A 5C1OA 4QDZA 5EIEA 2ZANA 4HLCA 4KI7A 2ZE5A 4WXPA 5B58C 1E2EA 1SVLA 2NGRA 1E1RA 5B4UA 2X7XA 4LAFA 2JANA 1V96A 1YQ9A 1CHDA 1WETA 2PGIA 3L6DA 3QSYA 4HAUA 3BMQB 3WRWA 1MP0A 3ICPA 3UFBA 2F67A 4NPAA 4P6VF 3K9HA 2HN9A 4RK6A 4BVAA 3VNAA 6CHYA 1I5OA 1TM1E 1REQA 3V4LA 4B82A 3R7WA 2A1TR 4FFMA 1JB9A 4WA8A 2B4YA 2DQSA 3C98A 3EEQA 1XTRA 4NMMA 1UMDA 3OUUA 1QFYA 2IZOA 1W6RA 2NZ8A 2Q1UA 4I8IA 4BE7B 3IEXA 3WXMA 1DFHA 3IXMA 1F5SA 3C85A 4ZVPA 4L7QA 4MS4A 4RSMA 2VUUA 3F4KA 1V3UA 1R1DA 4KC0A 4XASA 2FF5A 2I7CA 4YQEA 4DN6A 4PRLA 3TG2A 5IVKA 4JI2B 4FOPA 3TKYA 3GEDA 4YGXB 3T99A 4ND1A 5K01A 3TAHA 5CM9C 4OQNA 3VVBA 5FR2A 2WU4A 2C2KA 5B2EA 1Y80A 2VHJA 3HCBA 3HC7A 4ZYXA 2B0JA 5IBCA 1U4SA 1LZKA 2IEDA 3ANXA 3B5IA 4NENA 1MQSA 4HAXA 2Y67A 1MOQA 4H35A 1W46A 2WWRA 3DXZA 1JH9A 4WBSA 1RCFA 3D7LA 1VIYA 1HDXA 4DMKA 4YT4A 4Y8VA 1P1KA 2A4KA 1JEOA 1Y4UA 1MJ5A 5TMDA 1I4LD 4TUYA 3WLIA 2FH5B 1U2TA 2XYVA 1G98A 3KVYA 5K09A 2BFBA 2WTUA 1NDHA 2OO7A 3BWDD 4X24A 5BR4A 1J8QA 1I6KA 2CFTA 4E1VA 3H4TA 3KJFA 4RD0A 4QE3A 3RWMB 4NU6A 5J4KA 1G17A 4BNVA 1CUDA 1JKIA 2PSHA 5KOJB 1QIGA 5A3SA 3EDCA 3S2YA 1THZA 2XBMA 3QKTA 1PN3A 3R8XA 4YJ3B 5IBPA 4LV6A 4CCAA 8MHTA 4LGCA 1DTEA 3CRNA 2HRBA 2BGRA 3W34A 1U7TA 2V1XA 3DBLA 5LA6F 4DM3A 1G8GA 1OXTA 1EZ4A 4LJ4A 1DQRA 1M76A 3BH7A 3CE6A 3CHYA 1OB5A 3O2SB 1AF7A 1N7JA 1R4ZA 5K8JB 4I4IA 3FTCA 1RKUA 4D0NA 1IG3A 3ZE0B 4CL8A 1P0MA 1US8A 3KUDA 1QORA 4L9RA 4ARVA 4MS1B 3TQTA 4N40A 2G17A 2ZRJA 1BHQ1 3ZW8A 1E7RA 3I4CA 5AYVA 3E22A 4RKRA 2Y27A 3HACA 3RV4A 3CTPA 3VH2A 2GNOA 5A4JA 3MFQA 2QXUA 3E3AA 1BDJA 1XRNA 2HLNA 1C3EA 2QXYA 2RGWA 3WLFA 3I5YA 4NCXA 1N5KA 1O95A 3WK9A 4YRAA 3RAEC 3GGDA 2GRJA 2LZ0A 4ZV9A 1SKUA 1KARA 3ZZ1A 4B87A 3EVTA 3GQBB 4DY6A 1RWNA 2G28A 3ABQB 1Q84A 3UJ8A 3ZDDA 4PG4A 1SKQA 4AJIA 3BH0A 3PHCA 1DTWA 1SU7A 3KKQA 2WE8A 3UYLA 2RGEA 4WE3A 2BCJQ 3M6VA 1HTTA 1HM5A 2IS2A 3M6FA 4MMYB 3JALB 2X9NA 2R7MA 4GICA 1HFWA 3PFNA 4UFNA 3ZYCA 2QLFA 1XZDA 3KOUA 3HUTA 3K9QO 4KO2S 4J0GA 4Z49A 4AY2A 4DLNA 2VH2A 5CK4A 3RADC 1MX9A 2J0UA 3FKSD 2ZJOA 4GKKB 1GU1A 2V9PA 3GZJA 4WLEA 5CITA 3ZGXA 2P75A 4HDKA 3MQFA 4RKYA 4ZGBA 4KFCA 3OQ1A 5G3YA 3HEMA 2QN9A 2IYAA 4R98A 2JK1A 3GT4A 5LP1A 2CHUA 1KRXA 4YJGA 3WRVA 1QU3A 2B37A 1NUUA 1SWWA 2OXCA 2ZJAA 4INJA 2XCSB 2BH9A 2FWBA 1DKMA 2AJBA 1NN1A 2FETA 1P72A 4HH0A 4J0QA 3VBEA 5T67A 3F6CA 2O8DA 3PC8C 4KQKA 1M2NA 1JKFA 3BQNB 4DMFA 1QP8A 2JATA 2BTQA 4MPTA 3JQ7A 4TSFD 4GR5A 4Z0NA 3EC7A 4MQFA 3STTA 4TV8B 3QPDA 3TCNA 2GM3A 3H8JA 5K3EA 3WYCA 2BUBA 1DJNA 4YLEA 1SU4A 4YQZA 2HFKA 2NT4A 3I01A 4NAVA 3BORA 1C1HA 2Q41A 1Q7CA 3BFPA 3EXFB 4EJSC 4HUTA 5HGJA 3FLAA 2B34A 2H5IA 3PUIA 2YOGA 4ZU6X 1HYHA 5DBEX 4DBVO 3WA7A 4AUKA 4UTVA 2IC5A 1UAYA 3PFGA 5CR9A 4ZMRA 2HA4A 2ZYVX 4WGGA 4BCDA 4D9EA 1XZPA 1RJ9B 2GMWA 5IC4A 5I3ZA 1GYPA 4CQMD 2C31A 1IWPB 4DJTA 1F14A 1DG9A 2HSGA 3FPAA 4C5CA 4Q93A 1U81A 4R16A 4KPFC 3T9DA 3B5EA 5JC8A 2VJLA 1UIMA 3TPZA 3NT5A 5DASA 1TZKA 3SZRA 3T4XA 1NI4A 3WISA 4DZRA 1NYRA 4QPDA 1BWPA 3DBOB 4J7AA 5FNZA 3MTBA 4DC1A 4F45A 2RJ3A 4HVLA 1KI3A 3HVUA 3UH1A 6Q21A 1D8AA 3ZLTA 2ZKIA 1LPSA 1Q50A 2PD4A 3HADA 3H9BA 4FW9A 2CGEA 4F93B 1KOGA 2XMPA 3H1FA 4HQ6A 1N5OX 1NMSA 2RH9B 4L4YA 1BYUA 3AVXA 3FFBA 1DEHA 4B83A 4OX9B 4NMLA 3P2OA 1EIWA 1HMPA 5KKAA 4DJJA 4GC9A 2C77A 4GNRA 2GPTA 1ISSA 5DNUA 1WE2A 1B00A 3SNKA 4JA0A 3NUQA 5A9TA 4C0AC 5DTRA 4BLOA 1WY5A 4W7IA 1EXMA 2X5KO 1UMDB 2EARA 5FOWA 4C7MA 5LDGA 1E2GA 1JDSA 1KZ4A 1P7VA 3CLHA 5LDHA 4DUGA 1GQ2A 1VLMA 2HWYA 5K0BA 1QHHB 5FLKA 4KEAA 3NP7A 2HMVA 1QTRA 2JAUA 4MCAA 4ND8B 3SBDA 1LVGA 1BFUA 1BCSB 1FLAA 3E9MA 4HDMB 3L7KA 2EGUA 4B0OA 1EVIA 4O0MA 3P9CA 3DOCA 4EWLA 3BL8A 3CLTD 4CLHA 4EHNA 3IQFA 4OO3A 3SLRA 1JHRA 2KQUA 4KXVA 4KQIA 4YBRA 2BELA 4KRFA 3DMYA 2VWPA 1TFUA 2WIFA 3A6PC 3OTGA 2XJ9A 3EYWA 1L1FA 1WDMA 1WMEA 3SZUA 3FPKA 3GVIA 4OXQA 4EUSA 1RZUA 1GGNA 1FDWA 2I7DA 4IVPA 4YR7A 1O9GA 2BGJA 5BQXA 1UPCA 4KQ9A 3C8UA 1TCBA 4OB8A 5EXXA 1YCHA 2R25B 4V03A 2C4UA 4G0YA 3D6HA 1KMHA 1NG9A 5C37A 3FX2A 1FW6A 1QV6A 1GPMA 2QJFA 2DPYA 1XR3A 2RBGA