1KSJA

Complex of arl2 and pde delta, crystal form 2 (semet)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
165
structure length
164
Chain Sequence
RELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arf-like protein 2
publication title The complex of Arl2-GTP and PDE delta: from structure to function
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/hydrolase
total genus 52
structure length 164
sequence length 165
ec nomenclature
pdb deposition date 2002-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ksjA00
4LGMA 3KDSE 3MAAC 1I4LD 4DEYA 2ZS7A 3AF2A 1BMFD 4F4JA 4RJLA 1IAQA 4N3NA 2ERXA 3WNCA 1J90A 1G17A 3U3KA 3AV0B 5FPSA 4BZPA 3QXCA 1XU4A 3GLHE 3KKQA 2IWHA 4A92A 3PJRA 2CL6X 3AVUA 2JDID 2VO1A 1E99A 2WJIA 3GQBA 1ZU4A 5DN6A 1E2EA 1Q44A 2RGBA 3OESA 4KXFB 4KLNA 1HURA 3NVAA 2OE2A 3AVWA 3CRVA 2QN6A 1AGPA 4D6PA 3THYB 1WB9A 1DO0A 2D7DA 5AUNB 1XD2A 2IYTA 1RRPA 3EASA 1OXSC 4P4SB 2G83A 4LHYA 4B2LA 2EQBA 2HYIC 2XGJA 1E9AA 3MGCA 4XJXA 4ILEA 5D3QA 2P6RA 4TYYA 3QXHA 2NG1A 2QUZA 3IBGA 2QAGC 3KFVA 3QG1A 4KVAA 5G53C 5CB8A 1E1QA 4LJ5A 2IYLD 4CEHB 2GCPA 1S2MA 3E70C 1BKDR 2YWFA 2WKQA 3JVVA 3SYLA 2OV2A 3BB1A 4LJAA 4OK6A 3R8FA 3U2QA 1KYIA 2AD1A 3CRRA 1U8ZA 4RCZA 2BMDA 2ANCA 3CPJB 2NO0A 4JBWA 4M9XA 2PX0A 2LKCA 4K46A 4NCNA 4MKFA 2XOKA 4QJ4A 2ECKA 4HDQB 4A2QA 4M1KA 1S9DA 1PUJA 1ZU5A 2RGAA 4V02A 4LJ4A 2REOA 3E2IA 4NBSA 3SFZA 5L3QB 2HXYA 2G6BA 4K81B 3E1SA 4R98A 2HV8A 2OILA 4AC9A 3I4LA 5FOTA 1EXMA 3ZVRA 4FMCF 4PHGA 4WZAE 4DDUA 1OIWA 1G3MA 4Q9HA 5CIWA 2F9LA 4Z54A 2FSHA 2RGNC 1GRNA 1PUIA 3BWDD 4NCIA 4Q02A 1IHUA 2W00A 4W5WA 1G8HA 3CR7A 2P3SA 2R65A 1E1RA 2AHOA 3CRQA 1P9NA 4V0OA 4HDOB 4MGKR 4CT4B 3IKJA 4XTCS 3TAHA 4DC9A 5LPNA 2BCJQ 3CNOA 3LXXA 4XSHA 2ZR0A 4HLUA 3L0SA 2ZJ8A 4OQMA 1CULC 4IXNA 2RGXA 3ASYA 4JL5A 4CDGA 5E7JA 2EYQA 2VHQA 4E5UA 4ZCIA 2ZYWX 3AVVA 3NHAA 2QI9C 4EQ6B 4QJ5A 4ZDJA 1T8TA 1WQ1R 1HQYE 1PLLA 3LX8A 1IXSB 3BORA 4I99A 2NGRA 1E2QA 4WXPA 4HI0E 4GMXA 2RGEA 1NVVR 1QHHA 3RS2A 1QF9A 1F2UA 3CRW1 4KFSA 2KJQA 1M7HA 1G18A 3GLHA 3WMFA 4NU0A 1XMSA 2EYUA 1M7GA 2ZE7A 1E9CA 4D0GA 1QVAA 4NL4H 4RKEA 1R5BA 2NTYC 3T5GA 3K0FA 2CE7A 1NG1A 2I3BA 2H16A 1BYUA 3NEYA 1YZKA 1G16A 4LX0A 3EG5A 5EE1A 1PLJA 5CLLA 4KFTA 1I4TD 1R4AA 4JKYA 5LD2C 3BGWA 3QF7A 3GEHA 4DVGA 2GDJA 1VYVA 4B43A 1XD2B 4DLSA 3GJXC 1P62B 4QBFA 3EPKA 2AD5A 1D2NA 2ZVPX 1OW3B 3SEAA 3OZXA 2ZAMA 2ZJZA 4JYBA 3GLIE 2Z6VA 2YOHA 1XNJA 4BLQA 1GKUB 2ZRLA 4XD7A 2QNRA 3CRMA 3BIFA 3SU8A 1E2FA 4JVNA 2YOGA 4Q4JA 1GILA 4KODA 1VKJA 3UMRA 4TL7A 5E7IA 1W36C 2IYUA 2WWHA 2ZVQX 3CBQA 1Z0FA 4HATA 3KFXA 3SI7A 4MGIR 1ZD1A 1E4YA 4A15A 3A1SA 1AS2A 3B6EA 1N6RA 2ZRPA 1XTIA 1KY2A 4IOLA 4RZXA 4KVGA 3A4NA 4PPGA 3EA5A 1A82A 3BFXA 1ETUA 3HPQA 2WZQA 3K0CC 4QHSA 5DH9A 4JMPA 3ADBA 2GBLA 4JLMA 2GXUA 4LV5B 2VBCA 4RFSA 3CO5A 2FNAA 3QNUA 3UWKA 3GJ5A 5CJPA 5HZHA 3DHWC 4KLZA 1NBME 4KFUA 4WA7A 4LZZA 3X2SA 1WA5A 5LD2B 1JXOA 3KB2A 4FXPA 3PIRA 4B6FA 1X3SA 2FPMA 3LV8A 5DN6D 1KZ7B 1XF9A 4L5BA 4MKHA 1AIPA 5EZ6B 5JJIA 2ODWA 2GXQA 4QM7A 1UJ2A 5JBQA 3DVLA 4NCJA 2C95A 4EJSA 1MV5A 2C9YA 4UJ3A 4ZDWA 2YC4C 521PA 3VTKA 5AUOB 2EW1A 1Z6AA 1GKIA 2PLRA 2G0TA 2OSBA 3BOSA 3LVRE 4RY2A 4D4MA 1K5DA 5AJXA 1WXQA 1YRAA 1U81A 2YZ2A 3GCGA 2QQ0A 3V00A 3B85A 3CR8A 2HLDD 2F1RA 4HAUA 2QSYA 1ANKA 2ZIAA 1FMJA 1NVWQ 4LCBA 4B3CA 5L3SA 5AK0A 2JEOA 2Y8EA 3NC0C 2VP6A 1XTRA 3UIEA 4NYMR 4Q66C 4TLBA 3H1TA 3CWZA 3A58B 2QA5A 2XOKD 1TNDA 1F2UB 4HB2A 3P1JA 4HYYA 4Q9JA 1NN5A 1DO2A 4RD1A 3X1ZA 3AGPA 2LWIA 4RD4A 3GLHB 4WZ6A 1OHHA 1OV4A 2BKUA 3X1YA 2W0MA 1FL9A 1MO5A 2X19A 3THXA 5JWHA 3GLFE 1P61B 5B57C 5KUTA 1YR7A 1MRNA 4DCTA 4YMSA 1RIFA 1N5KA 3VKHA 1N6IA 3QY0A 1OLOA 2C9OA 3EIEA 3K0FB 2JJ2A 4MRSA 1QZXA 1ZM4A 2NOAA 4KI0A 2ZI9A 3A8TA 1KK0A 4XVRA 2H57A 1QVRA 2A5DA 4TYQA 3RS7A 1Z3IX 3WNBA 3QG5A 4TLEA 2F1HA 1GKYA 3BC1A 4G3XA 3GLIA 4KSCA 2ZM5A 1F5NA 2WJGA 2HJVA 4ERNA 3O8CA 2WIAA 1RRFA 2REBA 4FMDB 4V03A 3F0TA 2PZGA 5GVSA 2WBLC 1S9HA 2QP9X 2ZJBA 1KJZA 4PXAA 1KI4A 4DCUA 1SGWA 5BN5A 4C0BA 3SJZA 1DBSA 5FOUA 1P9WA 4RD3A 1FUUA 4B3FX 1W36D 2CNWD 1ZMXA 1KSGA 3BFVA 5FTLA 1DTSA 1T5LA 2XAUA 4GSYA 4NONA 2ORVA 3WBJA 4F38A 2D2EA 4DXAA 4P31A 1VIYA 5EP3A 1OB5A 4OI1A 3IPYA 5B30A 4OHZA 1JQLB 2CHVA 3EX7C 1NVVQ 3VKGA 2EFGA 1MR3F 1K5GA 1DOAA 1UBEA 3SJBA 1NBMA 1QHSA 3B1WA 3R9IA 4B74A 4M9SA 3FHTA 2Z43A 3KKNA 4DCNA 2Q6TA 2V9PA 3QUSA 3K0SA 3TMKA 2BBSA 4DWJA 2PT5A 4LSGA 1NY5A 4US1R 4RFSB 3AH8A 1YZLA 1GG2A 4Z51A 5JMTA 2RH5A 2R9VA 4RCYA 5BQ5A 1S8FA 2XNDA 1MABA 2QPOA 4LHZA 1F6BA 5DSZA 4DIDA 3IO5A 2OBMA 3EC2A 4KYUA 1JAHA 3TW8B 3U61B 4NTZA 2IS4A 3WMEA 1ZM7A 2XXAA 4P0TA 1OFIA 1G41A 3B13B 3AKDA 3EWSA 5JCPA 5HTKA 4XSGA 4KAXA 4EJSB 1KGDA 3FMOB 3RANA 2FSGA 2G77B 4QGGA 1IN5A 1HT1E 4B3BA 3CONA 4IFBA 4LJ8A 1TX4B 3O8RA 2WJVA 1MRSA 2EFEB 1QRAA 2YC2C 4BFZA 2PT7A 3C15C 4FCVA 4XD7D 1WCV1 1RC8A 3L0PA 4J0QA 5DI9A 2ZRCA 2JLXA 3AF4A 2V4ZA 1CRQA 5L3SB 1PLKA 1ZAKA 2Q3HA 2RAPA 4I4LA 4A2WA 2A5JA 3LX5A 4JBYA 421PA 2ZI4A 1C9KA 3C14C 4EPWA 2FEOA 2R6DA 1NN0A 4HZUA 1D9ZA 2HCBA 3THXB 1BH2A 4PPFA 4YMUA 1GUAA 1TTTA 1U90A 3AKCA 3AF0A 5GJVC 2GCNA 4PAMA 1G7CA 1T3HA 721PA 4JZKA 2ZRDA 4Q47A 4DLXA 2V7QD 3CX6A 2ZPTX 1XWIA 3LD9A 4FWIB 3QI2A 2GF0A 2QRZA 1FNNA 4EFNA 3GLIB 1GNRA 1E2JA 4MRPA 1RJ9A 1LS6A 3PUYA 4C0HA 2FH5B 5JEEA 2ZRMA 2XEXA 4UNQA 5DNYB 1OXXK 4UNSA 3X1XA 1JBKA 4OHVA 3QXXA 2F3TA 1GFIA 2G0NA 3AVQA 4A0GA 3CNNA 4HB3A 4YXWA 2PZFA 5EXPA 5TV2A 1X8LA 1DAEA 2FZ4A 4B34A 1OIXA 2DYKA 4KBFA 1ZINA 1QG2A 3D3QA 4MYCA 2A5YB 1E2PA 1WRBA 4TYNA 3NDBB 1AGRA 2NQ2C 4NYMQ 3CF6R 4A6PA 621PA 2CVFA 1CR2A 3QBTA 3SC3A 1Z29A 2FFBA 3OF5A 2OZEA 2A5GA 4Q4AA 5KYKA 4TN1A 3SBEA 4HAWA 4TMVA 4OL0A 5HCIA 1OHHD 4ZV4A 5DO9A 2PLFA 2E1RA 3Q72A 3UG6A 4AYTA 4AURA 1BMFA 1KI8A 4P3YA 5K8LA 4IDOA 2OM2A 1D8TA 3GD7A 3ASZA 5CIQA 3GJ6A 4OHYA 1NF3A 2A30A 1HYQA 2A9KA 2ORIA 4DUGD 1MABB 3C5CA 3V4FA 4NYJR 4TQUS 4M1MA 3MCAA 1R7RA 4G5QA 1W4CA 2N42A 4EAQA 3WRYC 4D0NA 4XH9B 3AVTA 4DSOA 2IYRA 4C2UA 2XXAB 5DI3A 5FTNA 3RSLA 1CR1A 5SZKB 2PJRA 1ELOA 2K5UA 1Z0DA 5J4VA 4I1OA 4PSKA 3DOEA 4LDJA 4IVQA 3THOA 4CZ2A 4BFYA 1TUIA 3I62A 2ZUCA 1UAAA 3BB4A 5JHHB 1Z63A 3KJHA 4WOPA 4D26A 1OIVA 2NZ8A 3NBZC 2QBYA 2BC9A 3AVXA 1YJ5A 3IIMA 1ZIOA 2AKAB 3MJHA 2BEJA 2I1VB 3U44B 4URWR 2AXPA 1AM4D 4TTQA 2PZEA 4LRWA 2ZJYA 2Q21A 3GJ0A 1D2MA 4N0DA 4KHZA 4LYJA 4Q7LA 4EPVA 4YMTA 2ZI6A 2CHQA 3RVBA 1R2QA 3BK7A 4ZKEA 1WMSA 1P6XA 2REXB 4OK3A 3L8ZA 1S0UA 2ZRGA 1NBMD 3Q8XB 2WAXA 2P2LA 1CS4C 4HZUB 2ONJA 4NHOA 3NDPA 5UKDA 1NIJA 3OIYA 1VIAA 4YDHB 3REGA 4O0MA 3B2EA 4MYHA 4R7ZA 3I1FA 3T12A 2JLYA 3N2EA 2FGJA 1E9EA 1KKLA 1T8UA 3VMFA 2XNDD 5KNCA 4A36A 1XZPA 2O52A 2QQEA 1FTSA 1YVDA 2F1IA 4DRZA 3EXAA 4WAUA 1X8KA 4AKGA 1F2TA 2W2VA 1MO6A 1RJ9B 4LJYA 3CZQA 3Q7PA 2BBWA 4OQFA 5E95A 4D82A 2GTPA 3VR6A 5KSPA 1YKSA 1OFHA 1OXVA 4ASUA 3U3JA 1K6MA 2J0SA 4NKRA 1OFUX 4UNPA 1NKSA 1AQYA 1W0KA 2XTMA 3VU9A 3I8XA 4DDTA 2WSSA 2QG6A 3C5HA 4M1OA 2IW3A 1TMKA 4OKSA 3QVVA 4QL3A 3BJIC 3G5UA 5AJYA 3PUVA 3B60A 4BQSA 5FOWA 1U2RA 3ZD6A 2QE7D 1KK3A 2IS6A 4DZZA 1J7KA 2KBEA 3PEWA 2FF7A 2HUPA 2O0KA 5EE9A 2AL7A 4URXR 1RZ3A 2Q9BA 2FPLA 1W7AA 2IXGA 2WICA 3NG1A 4IVRA 3BRWD 5CDFE 2J9RA 1ZM2A 4URYR 4Q4AB 4IVPA 2QP4A 2XZOA 4WVFA 1XD9A 2VP2A 3U4QA 4IEIA 4QOSA 4TQAA 1PVOA 4XWAA 3H0KA 1OT3A 2YVUA 2FOLA 2D62A 5L3QA 5EE0A 3CKLA 3BD9A 3DDCA 5FBLB 2PMDA 3ND9A 5JRJA 1LFDB 3ZDQA 1YQTA 3ZLJA 2H92A 4L8GA 2CLSA 5FFMA 2YINC 2C98A 2OAP1 4MGYR 3KKMA 2BIFA 2QENA 1A1VA 4KSBA 1VCNA 2R44A 2IA5A 2QGZA 3TH5A 4LOAA 1X6VA 1QHNA 2CHGA 2GCOA 4GZLA 3RABA 3RS3A 2MSCB 3QJYA 5TARA 2BJWA 1LY1A 1G8GA 3MLEA 2ZANA 5LDDC 4LV6A 1T4GA 1NMXA 2QAGA 1FFHA 5JZVA 5CK5A 3DM9B 4Q1BA 5CJ2A 4RKFA 2QBYB 1U0HC 2OG2A 3KXIA 2Z0MA 2FA9A 2ZJ2A 4OI2A 4YXWD 2QAJA 5TMPA 3FVQA 2IEYA 1UFQA 4US0R 1U94A 2EU8A 3U5ZB 4QBHA 1UDWA 1EFHA 2W2TA 1N5LA 1SKQA 3C41J 5G40A 4CF7A 4IRUB 1CR4A 1U0LA 5FPKA 5ELXA 2B8TA 5LBIA 4BZXA 3EPJA 1W46A 1X86B 1AQUA 1WE2A 1E2GA 2IC5A 2QTFA 1M6NA 2Q0HA 3K53A 4Q9KA 2EFDB 2J41A 2BMFA 3SS8A 3LWNA 3T1OA 5B58C 4DIEA 3WP1B 5C18A 1IQPA 4G0NA 4BRUA 2C78A 2ZUDA 3GMTA 3QENA 1ZVQA 3GEIA 3D8BA 2A7QA 3EC1A 1XBTA 1NY6A 4BFXA 3TSZA 4LK2A 2WSMA 1M8PA 5KPDA 2RGNA 5G3YA 1CTQA 4IDQA 2ZRKA 3WHLA 5KU1A 4BLRA 1JECA 3S1AA 1XPUA 1E2MA 1E2DA 1W2GA 1E9RA 1M34E 1F2TB 3A36A 2OFOA 2FWRA 2FV8A 3NIBA 4JS0A 2DB3A 3ZVNA 4DLWA 1TU4A 2XJ4A 3RHFA 1G7SA 3JZAA 1KO5A 3KQLA 3W6PA 5EXTA 2CL7X 3L82B 3ICQB 1JI0A 3KL4A 3VU9B 4BFSA 3LW8A 2A3RA 3UXMA 2XB4A 1UPTA 2ODNA 3SE0A 3KUDA 1KI7A 1KNXA 1UDXA 2ZS8A 4LJ6A 4BWYA 2AK2A 2HLDA 2FPKA 4JKIA 2Z4RA 3VR2A 2XNSA 3AUXA 3V9PA 4EPXA 2JLWA 2JLRA 2FN4A 4FMCB 2ZYUX 5H70A 1WBBA 3RS0A 3SYKA 4ZCMA 4MA4A 1DVRA 4NYIQ 3U4QB 4LPKA 2FGKA 3MWKA 2C2HA 1H8EA 5IK2A 3OIUA 4G1UC 2YWGA 1CJUC 4QGHA 4ABYA 5IT5A 2GVDC 1X1RA 2X8AA 4MRNA 4RZ3A 3RC8A 4IXMA 4QGFA 1H8HA 3HU2A 1Q3TA 3C8UA 1MT0A 2DBYA 4I1SA 2ERYA 2QT0A 1P75A 2I4IA 3ZIAA 1WBDA 1YR8A 1UKZA 2LCFA 1N6OA 1ZIPA 2QRNA 3TBKA 2IEZA 2PL3A 5AR1A 2OBLA 2GCOB 4V0KA 2J7KA 3AEZA 3IIJA 2ZE6A 3NXSA 5GADl 4I81A 2IHBA 5GJCA 1ODFA 3Q85A 1M74A 3QQ5A 2KWIA 4IOJA 2BEKA 2VA8A 4GPTA 4ASUD 1JPNA 4MUBA 2QAGB 5HKKA 1FMLA 1W2HA 1W0KD 2IUSA 4PC6A 5D3MA 3QEOA 1ESMA 2FE4A 2AN9A 1NKTA 4DLUA 5FPHA 2WSSD 5KSYA 3K0EA 4O25A 2E87A 4IFEA 4DCSA 4GDFA 4PFSA 2CNWA 4LI0A 5AUQA 2IBMA 4DEXA 3CH4B 1TF2A 1SVLA 4L15A 4PPNA 5G3ZA 2J46A 3L0OA 1MO3A 3GEEA 3NBXX 1CBUA 4BFVA 2X2FA 2C03A 5J47A 3P20A 3VAAA 1Z5ZA 2D74A 2YJTD 3QPWA 2GA8A 1JR3E 1G64A 2J87A 1TADA 2JAQA 1XMVA 4FINA 3OHMA 4W5JA 4M1WA 3K0CA 4DLYA 1XJCA 3T61A 3U7FB 4BEBA 4AIIA 2A78A 1O87A 2OLKA 4PAQA 4PO1A 3VHXA 4Q03A 1QHIA 3RC3A 1VCMA 4RD6A 1UBCA 4NDZA 3EZFA 4TSFA 1TQDA 2FFHA 4C2TA 3TUIC 2CLDX 5G41A 3ZYCA 3S1AB 1EWRA 1IBRA 1K8RA 3SR0A 2H5EA 4LBWA 1G8PA 1RYHA 1YR6A 1ZNZA 2IF0A 1CR0A 1JNYA 1SHZA 4WZBE 5JI2E 3DZDA 2W6JA 3QE0A 4FCWA 3SDZA 5A5GA 4AK9A 1IXZA 1IJEA 1IY2A 3C7KA 3FFAA 1MO4A 2ZSFA 3PEUA 4LBVA 4C0QC 1DAGA 5EP2A 3CH5A 2HT6A 1XCMA 1E2NA 2RGDA 3AF3A 1FW6A 4OK5A 3KX2A 4ACAA 5JS8A 3O47A 2JLUA 2O8CA 1KIMA 3UATA 2KB0A 3LY5A 2QROA 5K8TA 1G4UR 5FH9A 4G5OA 2F1JA 5ANRB 3SZRA 1E9BA 1GL6A 2PBRA 2P67A 2ZSEA 2IWRA 3PEYA 1J8MF 1HT2E 3H84A 1KJYA 5FTKA 2OCYC 2GXAA 1JAIA 4HUQA 3QPUA 4JL6A 4D4JA 3WHKA 4DB4A 4OBEA 1HY3A 3HYTA 3B9PA 2QTHA 1FOEB 1NLYA 3REFA 5CB6A 2VHTA 5KDOA 4M21A 4HLCA 1YZNA 4EKDA 3MFYA 2QL6A 2V7QA 4Q5IA 4PC2A 5FI0B 1AK2A 1L2TA 2IXEA 3VHLB 1UADA 4POAA 4JIMA 4C0SA 3B7GA 5FOVA 4BLSA 4JLKA 1SXJC 4M1YA 3VQTA 3HPRA 2ZE5A 3KQUA 2ZTSA 3WNDA 2WWGA 3FFBA 3MSXA 3AKEA 4A0HA 1DS6A 1TQ2A 3AVPA 1Q20A 2B6HA 4EUNA 3QOFA 5IF9A 5D3MB 3WY9A 4JSTA 1UEJA 3AF1A 4KJZA 1W36B 5FPYA 4B71A 4W5HA 1IM2A 4XIGS 4LC0A 1BS1A 1E94E 2HCJB 3NTUA 4M9ZA 1N0UA 1SZPA 3Q3JB 2GJ8A 4JJKA 1OSNA 1D2EA 2IX3A 4LPSA 1XCPA 1R10A 2VEDA 5F9HA 3UANA 5IHPA 2GF9A 1RE0A 1XXHE 3PUWA 1EX7A 1LF5A 2QMOA 2VH5R 3IILA 2D2FA 4PPQA 3LH5A 5SZJA 1H8ED 5IK2D 4A9AA 1AS0A 1W5SA 1WF3A 1OE0A 3O8DA 3N70A 1G7TA 3HP1A 2WKRA 3KJGA 4XOIA 3EZ7A 2GETA 2G1KA 3CF0A 3HYRA 1H8HD 3LRPA 2UZ3A 5EXXA 2V1UA 3R7WA 1Q0UA 4MQBA 3BH0A 3A6PC 1KDRA 3I32A 4DUGA 1P9RA 4GNKA 3ZIAD 4Q21A 4P33A 4KYIB 2B21A 4TT3A 5AJVB 1Q3HA 3GJ4A 4TYWA 1T6NA 1C1YA 1GZSA 4Q1FA 4G5SA 1LV7A 1ZJ6A 1TU3A 2AK3A 2EWWA 3MUFA 1BOFA 2ZJAA 4TMXA 3AGQA 3C4JA 3VFDA 4E09A 2JIZD 3RS5A 2NO1A 4Q7KA 1G6HA 1N0VC 2UZIR 5HKKD 4CVNA 1OH8A 2QT1A 1IN7A 3NBFA 4BUJA 1P5ZB 1IONA 2DWOA 4HAZA 3ZH9B 5FBVB 5F2EA 3MWLA 4TMKA 2O8CB 1L8QA 2G9NA 4X8HA 4U00A 4BFUA 2D3WA 1COWA 4YLGA 3TJZA 2X2EA 4L4UA 3HR8A 2W0SA 3A1WA 4GFDA 1G4AE 2J0VA 2GAOA 3V4RA 4TTRA 5FR1A 2IYWA 1QHGA 4Q1CA 4GI7A 3X1DA 1LW7A 1XEWX 1NLZA 3OE7A 2GJSA 2BV3A 4S35A 4A2PA 2R8RA 2AWOA 2ZETA 1AZSC 4NCKA 4HUQB 1J99A 5CK4A 4F7WA 1CF4A 1XCGB 1PV4A 2DWPA 3VR4A 1KMHA 1XTJA 1Z2AA 4C4PA 4TZ0A 4NH0A 2ATXA 4LYFA 3NHBA 4CGZA 2XSZA 3QXJA 1Q12A 2VP5A 4TSFD 4MDEA 3QKRA 3LFUA 4LJ7A 3W6NA 3RRMA 5L3VA 4JSYA 2ZQ5A 1OYYA 3SQWA 1Z22A 5EUMA 1XPOA 1SXJD 2NO6A 4IEEA 4C30A 4BE7B 1R8QA 3MJRA 1R5OA 1JXMA 2GAAA 2VF8A 2ZJOA 3CWQA 1E2HA 1Z0JA 1SKYE 3SQXA 2BBTA 2W6JD 4AY2A 5EXSA 4B44A 2ZYVX 2GEVA 2IYQA 2OLJA 1VECA 1GIAA 3P27A 4ZCLA 2ZE8A 1G20E 5TY0A 2VL7A 1YZTA 4CW7A 3D6TB 4V0NA 3Q5EA 3DPUA 2VPPA 2BBOA 1VYUA 5F98A 4JT4A 3VR1A 1XXHA 2XTZA 3I73A 4BLTA 2CJWA 3U44A 3EIQA 4B6EA 3ADKA 3FWYA 3U6KA 4OJKA 2QE7A 3EZ9A 4ITRC 4JVMA 4PSVA 3ND8A 4FN5A 2H1LA 2CCKA 3AQ4A 3SYNA 4GP7A 3GLFA 2JCSA 1LTQA 4OQXA 3IEVA 4DDWA 1FUKA 4M8NE 4HEJA 2V1XA 5JCZA 3BH6A 3G82C 1D5CA 1N6PA 3BE4A 3QXSA 4HAYA 2EFCB 5F9FA 1RRGA 3SHWA 3AM1A 3AB3A 5K8UA 1KI6A 5H8WA 1Z83A 3W3ZB 3R7WB 5BYKA 1Z08A 5DE3A 4M0LA 2R6AA 1Z2CA 2ZRBA 1TEVA 2V55B 2WJHA 1TEXA 3TR5A 5KO2A 8OHMA 3SNHA 1LF0A 3HJNA 2P6UA 4E22A 1Q1ZA 4C0JA 5JS7A 4PO8A 3UG7A 4ESHA 3QKUA 2JASA 1AKYA 4NPHA 4BRWA 2FEMA 1N3BA 5DHFA 4TMZA 2C8VA 5TB5A 1XFAA 4L9WA 5TXGA 1N25A 4P4UA 3M4YA 2AKYA 3OEHA 2QSZA 1JR3D 4WXRA 4U7DA 3FPAA 1S96A 1N2CE 2VYFA 2ZSDA 2AFIE 3A37A 3Q5DA 4TMWA 3VR5A 2FSFA 3DMNA 4QRHA 1Z0AA 5BN3A 4PZYA 5KPJA 1SVSA 2AXNA 2QGNA 3K09C 2DCUA 2DWQA 2ZJ5A 1GL9B 3EIHA 2WMOB 3QVUA 5J4HA 2AWNA 3FTQA 1JQJC 2UVQA 3K70C 1SHKA 1GITA 2WPDA 3NEJA 3TLXA 1TUEA 2FX3A 5KSZA 1DAFA 1NJFA 3CIOA 1KMHB 3K8YA 3UPUA 1OH5A 2F6RA 4LBZA 5M04A 2SHKA 3LQRA 4G5RA 3MWJA 5DISB 1A4RA 4B33A 3QKRB 1E9SA 3DKVA 2CE2X 2B8WA 3RLFA 2YYZA 4TT3D 4HDCA 3QKSA 4TL6A 3KXKA 2ZUBA 1J70A 2F9MA 3PV0A 1QG4A 4X8MA 3W8NA 1VCIA 5HR5A 4YONB 2QY9A 1ZUHA 2CDNA 3NC1C 4II7A 3MWYW 5E4FA 1JJVA 3AP2A 2XTNA 1RFLA 5FR2A 3TSOA 3U7HB 1IN4A 1KKMA 3EW9A 2DFKB 3B9QA 4EPRA 3TKLA 2GESA 1XXHB 1G291 2CJWB 1KI1A 3IIKA 4KBGA 2IL1A 1COWD 2F43A 2O0HA 2F7SA 3I3SR 4ZKDA 1OYWA 2F3RA 3IBYA 3WRXC 5SZIA 2W83A 3GLFB 3RNLA 3I61A 1VG1A 4FMBB 3K70B 4QM6A 2CCGA 1RVDA 1ZYUA 4MRVA 1XB2A 4D81A 3OE7D 2OUKA 2BMEA 4Y0AA 3KTAA 3LVQE 3DEFA 2ONKA 1ZD9A 5FPTA 1VHTA 1VG8A 1BYIA 2OXRA 3F3YA 2RGCA 3DL0A 121PA 1KI6B 2JLVA 2GEDA 3PR1A 1FX0A 5CYPA 2XSZD 4F92B 1W1WA 1Z6XA 4FW9A 4LJ9A 4KITB 4ZI2A 4ARZA 2J1LA 3RS4A 1R5NA 2WHXA 1CEEA 1ZP6A 3GFPA 4LC1A 4KCGA 5AUPB 4H9GA 5JI3E 1DADA 5DYGA 3ZS9A 1Q22A 2IK8A 1KSFX 1CLUA 2A5FA 3KUCA 5GJWC 1J8YF 4Q1AA 4RD0A 3W34A 4BECA 4PSAA 2ZI3A 1KOFA 4B3DA 3HR7A 1UF9A 1KJWA 4IOMA 1XMJA 1G7RA 4JVSB 1E32A 2DPXA 4P32A 1W5TA 2PX3A 3NH9A 4RVCA 2BVNA 3RSOA 3FE2A 2IUTA 2AR7A 1E0SA 1E2IA 3DKPA 3ADDA 1ZC4A 4JLPA 2UKDA 4PTLA 1UKYA 2WKPA 1Z06A 2F55A 1G19A 1E9DA 2ZRFA 3I8SA 4TL8A 5DIFA 4ZDIA 1LVGA 1Z8FA 2TMKA 3JZMA 2FDCA 1KMQA 3K70D 4V0ME 5EQTA 2MMGA 2B92A 2R2AA 1MH1A 3T35A 5FOXA 2WIBA 4Q01A 4HB0A 2R62A 3CLVA 1W4BA 4CEJA 2WVJA 3I92A 2GHIA 3T5DA 1KK2A 3UMSA 4JLJA 1SKYB 2FFQA 3PG5A 4C9BA 3ZZ0A 3LXRA 1FP7A 5KNBA 2ASEA 2ZRNA 3ZZUA 1KSHA 4TLCA 4AD8A 4A82A 1II0A 4D4KA 2H8KA 3MG9A 5J4LA 4QHTA 1P73A 1L7VC 3B5JA 3FYHA 3GFTA 4Q4HA 3QKSB 2GZAA 2C77A 2D4HA 1Y3AA 3KXLA 4HSEA 5FL3A 2FJUA 2QMEA 3HWSA 2WWYA 5LB2A 4DBLC 1T3SA 1P4SA 3FMFA 1SVWA 5KHOC 4DLTA 1P2SA 2BM0A 1YR9A 2PJZA 2J5XA 4HAXA 2QMHA 2PCJA 1LS1A 4JLAA 2GWHA 1BIFA 2J0QA 2KE5A 1N6NA 4JYCA 3OEHD 3QPVA 4M22A 4YQFA 1OH6A 1XRJA 3AVOA 1AJEA 2F43B 3I72A 2Q9AA 4R2IA 4IDPA 2WAYA 5B64A 5FUXA 2VTKA 2QTVB 3RWMB 1NI3A 2JATA 3G0HA 1EFCA 3U3MA 4JLVA 5KTYA 1KO1A 1N0WA 1GTVA 2X1VA 4QNMA 1E4VA 4LBYA 6Q21A 2JJ1A 2XZPA 3EA0A 3KTAB 2OCAA 4B3GA 1KO7A 2WPDD 5FI1B 4L9SA 1GL7A 3PITA 1XX6A 1ZUIA 2GKSA 1Z6GA 1ZD8A 2OEPA 2NO9A 3FKSA 4NP6A 1OJLA 1QDEA 3RDPA 3GJ7A 3GJ8A 4D2IA 4O2RA 1CJKC 1E9FA 1FX0B 2PMKA 3A1VA 4QFMA 4D4LA 1M2OB 2HXSA 4ARZB 4RZ2A 3TUZC 4NYJQ 3U60B 3TAUA 1U0JA 4AKIA 1FP6A 3BS4A 2W2XA 2IYVA 4LUCA 2VSFA 1SVKA 5EP1A 1ZCBA 4BGDA 3IEUA 1DAMA 2X77A 4C3ZA 1UKVY 4A1FA 3T1VA 4LV8B 5F3WB 3IPXA 4I1VA 1EK0A 3ZS8A 4ZIRA 1YZUA 5IDVA 1TQ4A 1E3MA 1W0JD 3FOZA 2Q9CA 2P5TB 3U3OA 1CJTC 2IYZA 2ZU0C 4PANA 4NCHA 1T91A 2WMNB 5EZ5A 2NPFA 2AX4A 1SXJE 1NP6A 2J3EA 4V0MA 4N0EA 1ZM9A 4Q4LA 5CDFA 3LBHA 1QHXA 3PENA 4JBXA 3NBYC 3K9HA 1Q21A 1G5PA 2HT1A 3P26A 2VQSA 4NMMA 4B73A 1Y63A 1G21E 2O8EA 5CM9C 2GK7A 3M1IA 1CU1A 3X1WA 1UM8A 3W6OA 2C04A 1JEEA 1SVMA 2ATVA 2DR3A 5P21A 2VF7A 3QIAA 1VG9B 4WIAA 2JLZA 3LDAA 4GZMA 1WP9A 3W5JA 3K9NA 5BXQC 4TQ9A 3W8RA 3FHCB 4B48A 1SVIA 2GVZC 5C4MA 3B1XA 1R0XA 2XZLA 3KQNA 4CEJB 3D7MA 1NVXQ 1RYFA 3M6AA 1C4OA 1I4DD 1KY3A 1AA9A 1Q1BA 4B47A 3SJAA 3LLMA 3DM5A 2B7BA 3U7EB 1NJGA 1CJMA 3LA6A 4H1UA 1U9IA 1VPLA 1II8A 2PH1A 3GP8A 4Q4HB 2OO7A 4OI4A 2G1JA 3KJIA 2VIIA 2GJKA 2J45A 2ZRIA 3DOFA 2NO7A 2WV9A 4D0LB 4ZDKA 1CIPA 4JT2A 1KDOA 1IY1A 2IUUA 1DEKA 2JIZA 1E96A 1XJQA 1UEIA 2B7CA 3F5FA 4C7OA 4JL8A 4URUR 1GSIA 4ZPXA 1ZCAA 4CEIA 2E9SA 1UBFA 1E79A 1YRBA 1ZNWA 1UKEA 2MMCA 4MYUA 4UXJA 3H86A 3SJCA 4EPTA 2IF2A 4PAOA 2ZI5A 2P5SA 1XEWY 2WJJA 5FTJA 5FOSA 3C16C 5JJLA 3IO3A 3B78A 3CX7A 3L0IB 5J5CA 4TYPA 4BLPA 5K8IA 2DFNA 4G01B 4TWZA 2L0XA 5A4JA 1GWNA 2C96A 3W90A 5JFGA 2H7VA 1EWQA 1LB1B 3KKPA 4TTPA 2ANBA 5EP4A 1E0JA 1A2BA 1DAKA 1P2TA 2FU5C 3AKYA 4F93B 2MSDB 4M4SA 2QORA 3WYAA 2RKOA 5HE8A 2BKEA 4A0FA 1SVOA 1XP8A 4CT5A 2Z5FA 2O5VA 3EARA 4URZR 1RW4A 3P4YA 3EWAA 1KTVA 3IHLA 3HU3A 5HE9A 2CK3A 1XD8A 2P0EA 2YKGA 1U9IC 3LLUA 4DJTA 1SXJA 4XWOA 4LYAA 4A0RA 1E0AA 3OFNA 5TDHA 1V43A 2GEUA 1KO8A 4ZIRB 3GLGE 2CLCX 1SULA 3TQFA 3BXZA 4DT1A 5HPYB 1DE0A 3THWA 1UBGA 1NG9A 3TVDA 3SN6A 4PZZA 1U8YA 1YE8A 4CRWB 1YHNA 3H2YA 3UKDA 1HTWA 2GZDA 3FDIA 1JJ7A 5DHAA 1TPZA 4BASA 2O8EB 3U3RA 3B1ZA 2H18A 3ZQ6A 4EFMA 1E2KA 5JWRA 5KOYA 3QSYA 3FGNA 3KQKA 2O8FA 3EZ2A 1EFUA 2NIPA 2ODEA 4DKXA 2JJ1D 3K1JA 3UMFA 2GILA 1MOZA 4JLNA 4AKHA 5DYIA 4M2LA 3MMPA 1OF1A 4TZ6A 4V0LA 2OCPA 3R9WA 1E69A 3FKSD 2ZITA 3CPHA 4HLUC 3ZD7A 1W44A 4UNRA 5KDLA 1FTNA 2IT1A 1YZGA 4M1TA 1ZC3A 1PZNA 2P65A 5JHGB 2BOVA 2ZREA 1B0UA 1II8B 5B2ZA 1GAJA 1P72A 1KDTA 1L4UA 3BBPA 4LHVA 2IYXA 4PHHA 2OCBA 1T0HB 2GZHA 3TR0A 2VHCA 1P2UA 1OB2A 5FBRB 5C1BA 4WBSA 1G3UA 1Z6TA 2W6IA 4Q00A 4LHWA 4QJ3A 3BH7A 4B32A 1Q1QA 3GJ3A 2ZSBA 4PC1A 2G88A 2YHSA 3D31A 4C7OB 1NMZA 4MKIA 1T5IA 5EJEA 2XB2A 1ZBDA 1E2LA 1XTQA 1G6OA 3A4LA 4CEIB 2XJ9A 2CEAA 1AS3A 1P2VA 1JR3A 3IGFA 1XDBA 2JJ8A 3T1QA 1NSFA 1KI3A 5L8VA 1R6BX 3PVSA 4PZLA 3SOPA 2OAQ1 4FD2A 4LWZA 1EFTA 5A0FA 1XJ0A 4GRAA 1NL3A 4ON9A 4LYHA 1II9A 5AJZA 4DHEA 4QKQA 1XEXA 4C0KA 4Y0VA 4F91B 2PEZA 3TE6A 2AFHE 5FBWB 2CL0X 5JSZA 3IHWA 1E1QD 2R6CA 1S1CA 2RGGA 4MYTA 1NSTA 1E6CA 4QBGB 3RYTC 3SBDA 4A8JA 2QZ4A 5FUVA 5EE3A 5C2JB 1TF5A 1ZNXA 3GLGA 3TK1A 5FUYA 1OKKA 4EFLA 1A2KC 1EFRA 1GRQA 2QU8A 1EX6A 1B23P 5E3HA 3CX8A 3ZZTA 4B76A 4CYMA 3TQCA 1SXJB 4AG5A 4FWTA 1QHHB 1TF7A 1TL7C 1NIPA 4B2IA 1VTKA 1GM5A 4L16A 1VYTA 4DB2A 4EPYA 2IHYA 2I1QA 3NH6A 1KI9A 5JECA 1FNMA 4DT1B 2N1BA 4OQLA 3OIVA 3THWB 4IKEA 4EDHA 1NN3A 4S2EA 1YZQA 2J0UA 2V8OA 1M1YE 3AP1A 1E79D 1HE1C 3CW2A 2D06A 1IJFA 2GBLC 1G5RA 2JLSA 3IQXA 3PUXA 5BYJA 1N6KA 1NVUQ 4WW0A 4M9QA 4PQYA 5FL7A 3B1VA 2O8BA 1QBKC 2KSQA 2VSXA 1TAGA 4F4CA 3AP3A 1E1RD 1JALA 2A2ZA 2RHDA 4E03A 4AKEA 4AYWA 2O8FB 4PHTA 1V5WA 1KO4A 1KSJA 1Q1EA 3RAPR 4EJSC 1KK1A 1P7CA 2RCNA 4UXHA 3L43A 5FBQB 4MGZR 3VNUA 4U5XA 5C4GB 1WDTA 2VP0A 1S4QA 2C5LA 1DAHA 5JLJA 4JVLA 4YC7A 1S3GA 1Z07A 5GVRA 4QG7A 1G9XA 4Q4JB 2PEYA 3PXGA 1JB1A 3ICEA 2P6NA 3OAAA 4MRRA 3U6BA 4FMDF 1KZGB 1DPFA 4A8JC 3AUYA 4DLRA 3BAFA 3O8BA 4C0LA 2CK3D 3QEJA 2EVWX 3QF4A 3SHFA 1US8A 2IS2A 4HUTA 4ACBA 5CM8B 3OFND 1FPMA 2ORWA 3RRYA 4D80A 4JLDA 3HDTA 3T06B 3K0AA 2YNMA 2OHFA 1IY0A 4B3XA 1XEFA 3ONWA 1EG7A 4Q1DA 3VX3A 1H65A 5LB4A 3M0EA 3BFKA 4DSNA 3KZ1E 4IDHA 1GP2A 5DGXA 1XMIA 3TRFA 2QMUA 3RWOA 4YMVA 2VLIA 1G3QA 4FIDA 4AI6A 3TUJC 4GP6A 4AG6A 1P60A 5J4YA 5GJBA 4UJ5A 1HQCA 3BERA 2ZAOA 3VR3A 3K09A 3QKTA 1T9HA 2J7PA 2V3CC 3ZVMA 4US2R 4O3MA 4PHFA 1XEXB 2XITA 4X8OA 3R8CA 4QHYA 1A5TA 1F48A 4PO9A 2R6GA 1S1MA 4MDFA 1L4YA 4Q7JB 1FQKA 1SQ5A 3FMPB 4XVUA 1O3YA 221PA 5JSZB 2OBNA 3TVTA 3P32A 4UXIA 3OEEA 5JRZA 4PC3A 4AYXA 4Q7MB 4GOJA 4TMTA 1VMAA 3K9GA 4IW3B 4A8JB 5C46F 1NNEA 3FHOA 2YOFA 5L3RA 1KAOA 1DARA 2YWEA 1AKEA 2Z83A 3FB4A 2ZI7A 4KV9A 4DSUA 4EIWA 3GLGB 4MUAA 5HZKA 2ZR9A 3T1TA 5JJKA 1JPJA 1PJRA 2FMXA 3ZGXA 3GPLA 1KAGA 4Z8XA 2FZLA 1M7BA 1W4AA 2HEIA 1GNPA 5JEDA 2W6ID 5J4KA 3KJEA 4C0AC 2YWHA 2RB4A 3A1TA 2QEQA 4RD2A 3GFOA 4HAVA 4OQNA 3W3AA 3H4MA 5E7MA 1HUQA 2OXCA 3ZVLA 3PQCA 4QC2A 5SZHB 4RSGA 1Z6YA 4Q1EA 3B82A 2OESA 3CNLA 4UNNA 2WWXA 5IRCD 4G5GA 3NKVA 1F60A 3CB4A 3LBIA 1GVNB 2J0UB 1ZRHA 3IUYA 2IS1A 4HLQB 1Z28A 2BDTA 4FCTA 2ZRJA 4PR0A 2MSEB 3T15A 1AZTA 2FFAA 3ECCA 3EPHA 1N5IA 1D9XA 4Q18A 3IDQA 4MITA 4OYHA 4XVQA 4E07A 2O8BB 2RHMA 1W4RA 3N2IA 2YV5A 3RRZA 2G3YA 2GXSA 4B2PA 5H1YA 1W48A 1GNQA 2GNOA 2WOJA 1VDZA 4W7SA 4R9UC 1U8AA 4Z1MA 3CUEF 4GL2A 1IN6A 4LY6A 2ZROA 4O2LA 2BHRA 3R20A 2ZRAA 1CXZA 3K9LA 2ZR7A 4RFVA 4UKDA 4MH0R 2OT3B 4OHWA 4PX9A 1OXTA 2EWVA 2KBFA 4A4DA 4K8OA 3I5XA 4GT1A 1Q57A 4Q19A 1OKKD 1XTKA 1EFRD 4P4TA 3VNVA 4N1AA 3WBKA 3QF4B 4IDNA 1US8B 5KNDA 5KDDA 2H17A 4R71A 3Q7QA 5CITA 4OJQA 1F3OA 1ZNYA 3K0AB 4IOKA 3ETLA 5EE5B 3RRNA 3TIFA 2IXFA 4ZI3A 5KSOA 3PEVA 5BWMA 821PA 3IQWA 1R8SA 1W0JA 1OFTA 5CYOA 2GJAA 3B1YA 1ESNA 3LNCA 2BWJA 1NN1A 2QM7A 2ZEJA 5JWOA 2JJ2D 1GDDA 2WOOA 1DAIA 3CPEA 1TQ6A 3EPLA 1HV8A 2O0JA 5AJWA 3PFIA 4I1UA 1IN8A 3W5IA 3UK6A 4RZUA 2JDIA 5FL7D 3TGPA 1RRCA 2VHJA 1CP2A 2JA1A 4QXAA 1I2DA 2WWIA 1T0JB 2PCLA 2XX3A 3CM0A 4FI3C 5HCNA 3UWOA 3JVUA 1XPRA 2DFTA 2W58A 5DLQC 4BEJA 3ZJYA 5CLQA 3U7GA 3KQHA 1G1MA 1KDPA 3F8TA 3FMIA 4QNRA 4TLAA 5BN4A 2O8DA 1FQJA 3WYGA 1I2MA 3TNFA 4DDVA 5FTMA 4GBMA 3A4MA 1ONBA 2Q3FA 5AWFC 4DSTA 2ZRHA 3TSWA 4QBIA 3QBVA 2BCGY 2VSOA 3WMGA 4TLDA 4OI0A 2DY1A 3OAAD 1IXRC 1YU9A 4JJZA 2RMKA 4DCVA 3KKOA 1LNZA 1QHYA 3EZ6A 4BFTA 4LHXA 3L2OB 1N6LA 2IYYA 4IHQA 1X8JA 2V54A 1G8FA 3BB3A 1ZW6A 4R2HA 3VKWA 4KFRA 1T3LA 1CRPA 4NYIR 1P3JA 2DHRA 4U02A 3EAQA 3TW4A 2LKDA 1IOZA 2HF9A 2NMVA 4ZO4A 2FSIA 4JLOA 2WTUA 1R0YA 1N5JA 2QP3A 3FKQA 4W9MC 4DLZA 1EGAA 1Z0KA 2HDNB 3Q9LA 1RKBA 1OXUA 3P4XA 1R0ZA 1NMYA 2GJ9A 3R9XA 4KU4A 2FG5A 3B8HA 4JLBA 3PCRB 2JLQA 1KNQA 3MD0A 1GRRA 3WYFA 2IYSA 2VP9A 1JEDA 2CBZA 1U98A 2J7PD 3ADCA 2QPTA 1KI2A 1XZQA 3THYA 2HYDA 2ZS9A 2BMJA 3E5HA 2V6IA 4PQFA 4AWXA 3AVYA 1DG1G 4GOXA 4P4SA 1HA3A 4CIDA 1ZM3A 5FUWA 2WWWA 2N46A 4PC7A 1G3IA 4KO8A 4BPBA 2CXXA 1GOTA 3SFVA 4B75A 3OEED 1AN0A 3KB1A 1JR6A 4CEHA 3W9YA 2C99A 2Z4SA 5J40A 1KHTA 4X8LA 1MKYA 4B35A 3LAWA 1J2JA 3LO5A 1OH7A 2VHUA 1A7JA 1XTSA 4HB4A 3CF2A 3WXMA 1HE8B 2QM8A 3N5CA 1N6HA 1NRJB 2GRJA 3A1UA 1DG3A 4OHXA 4UQOA 1RPZA 1W49A 3LBNA 1ZUNB 4M1SA 1E0KA 4A6XA 3DZ8A 2C9CA 2BM1A 3OIWA 2HJGA 2VP4A 3T34A 4XWKA 1FZQA 1G5TA 2DFLA 4H1VA 4ESVA 3NWJA 5TVKA 3LQQA 1CKEA 1NLFA 2HF8A 2OFWA 3DMDA 3L8YA 3CZPA 2JGNA 4DLVA 1OPXA 1E98A 4YMWA 4BZQA 4QGAA 2CCJA 2NZJA 2ZYTX 1R0WA 2ODBA 4HLDA 3LW7A 5DI3B 5BW8A 4M53A 4Q9LA 2ZXUA 2WM9B 1HEIA 2OFXA 4URVR 4HZIA 4BLOA 1EESA 4Z1MD 3ZQJA 2WJYA 4XTRA 1S3SA 2CMKA 4PQRA 2O8DB 1CJVC 1G8YA 1VCOA 2NPIA 3WP0A 3J81k 4Q48A 1X1SA 2J59A 2KI5A 2CVHA 3VX4A 1VG0B 4Q9IA 2R6FA 1VHLA 3DO6A 3MRSA 3PUZA 2D7CA 4NZYA 5EUQB 4BFWA 4NE2A 4D25A 4Z8YA 4EQ6A 4F4IA 2QPAA 1U99A 3HU1A 2BJVA 2ZSAA 2VRWA 4YDSA 1Z0IA 3I5YA 4GMDA 1W47A 4MKGA 1D6JA 2WWFA 1BO6A 4GOKA 2GK6A 2EFHB 5H68A 1G3RA 1DELA 2Q3MA 2V6JA 2ZU6A 4IJMA 4TL9A 1HH4A 1Z47A
chains in the Genus database with same CATH superfamily
2OO5A 2VK2A 2FX5A 1W35A 3SC2A 3TOVA 4M99A 3KT8A 1I4LD 3T95A 4DEYA 2ZS7A 4IG9A 4XQGA 1AG9A 1YDGA 2O1EA 3OCUA 2C5SA 4JP8A 3I83A 3U3KA 1BGXT 3AV0B 4ZAFA 1JBEA 4WERA 1EDBA 2O7RA 3E9NA 3JWHA 3RAEC 2CL6X 2GMWA 2ZBGA 1HDRA 1Q44A 2RGBA 3T1YB 3D7NA 1JLKA 2OE2A 1OX6A 4F5DA 4D6PA 4FNMA 4Z99A 4MB6A 2NNWB 1PQPA 1VLQA 3ZCRA 3GNQA 1RAGA 4IIGA 2AOUB 2G83A 4I50F 2EQBA 3IX7A 1G2IA 3MGCA 1CFJA 5DTJA 3Q1LA 2D00A 1JLRA 1WDLA 2CDAA 2QUZA 3IBGA 4KVAA 2FUEA 1S2NA 1QV6A 4YJGB 5G53C 5T3YA 3NV7A 5CB8A 5F12A 4RF2A 1EUZA 4LJ5A 4Q34A 5IXSA 3WGTA 3MS7A 3OWXA 1BA2A 1X13A 5EUCA 2I6XA 1XQ9A 3E70C 3JVVA 2GARA 2OV2A 5J1SB 4OK6A 3QVGB 3EMKA 3U2QA 1KYIA 2AD1A 2HSJA 2H4WA 3ESQA 4UAUA 4O2BF 1RXWA 3WQRA 3TZKA 1MB4A 2AI2A 3CPJB 1NYTA 3CNBA 4NF2A 4LI3X 3RFUA 4HPXB 3RSQA 5A4KA 1PRYA 4XM2A 5FBZA 4X44A 2H0QA 4JYZA 2LKCA 4K46A 5LXTA 2DLDA 3AHHA 4N9WA 3WRWA 4UHBA 3TINA 4EB6B 5EJ6A 4QJ4A 4BO9A 2VJDA 4L3VA 4HDQB 1GZ3A 3TNLA 4M1KA 4CXMA 3VV2A 2HDOA 4V02A 3VO9A 2MYUA 3D7SA 4NBSA 3M3DA 2HXYA 2AG5A 3FNBA 1T4BA 1OAAA 3VR6H 3X1KA 2OILA 4B3TB 3BCUA 3PGMA 1V1RA 2F17A 2G4CA 2V03A 2XVMA 3I4LA 3OKCA 4NZMA 3RC1A 3UGKA 5C8ZA 1MJ5A 4FMCF 5J2TF 3BWVA 3TVYA 2O06A 4NBNA 1C9JA 1TFRA 2JH9A 2Q99A 1C9EA 1SA0B 5CIWA 1FRZA 2F9LA 1E3LA 4R8KA 4TZKA 5C1PA 3BTVA 1RE1A 3VISA 1IHUA 1X87A 2J8ZA 4NMXB 1RKVA 3CR7A 5LQJA 2AHOA 1TW2A 3CRQA 4CCSA 4V0OA 1PR2A 2C29D 4HQ6A 2FW6A 2RHOA 1NFRA 3KU1A 1LBQA 2IGBA 2ECQA 3R2JA 4HLUA 1YDWA 4KWCA 1KTIA 4QASA 2ZG6A 4IXNA 3ZY3A 4JL5A 4CDGA 1PE0A 5E7JA 3AILA 5AICA 1B6TA 4A0QA 1N5MA 4X1KB 4RHTA 1C41A 4PNPA 1PBTA 1GTL1 3I0ZA 3N6VA 3RBZA 1XALA 1I3MA 1XO1A 3WB2A 2QI9C 3EOZA 2I99A 3N5KA 1WQ1R 5I7EA 4IP0A 5TQ0A 4FW8A 1EFKA 2OCGA 2XYQA 3LX8A 3BORA 4NJMB 5EWMB 1PX2A 5T6MA 2C5FA 1XAIA 2EXXA 2NGRA 5DYYA 3REQA 3W2EA 4EM6A 3UK1A 3ZJVA 4CCYA 3V32A 1P4GA 1NVFA 1Q3KA 2YXLA 3ZTYA 1QF9A 1TO2E 4CODB 4KFSA 1XNQB 3KK0A 2B99A 4IHKA 2V3WA 4H4EA 4U2KA 4X7PA 4HVCA 4NU0A 3TG2A 4GR4A 1M7GA 2JGLA 4WKNA 1PKEA 1XG5A 3B3AA 1QR2A 4D0GA 4NL4H 3EPRA 5DNAA 4HTAA 2ID8A 5EC8A 5JV5A 1IQUA 2NTYC 3T5GA 5BN1A 2A9OA 1SCAA 3L6UA 3OZRA 1WPQA 4NBVA 3S5UA 3OOHA 2CE7A 1UBNA 2B34A 1P2DA 1NG1A 3PLNA 4IIEA 3T4EA 5BWOA 1BYUA 3K73O 4LYYA 4DREA 1YT5A 2ECOA 4NARA 3AMVA 3GQBB 4ADSG 2WF9A 1Y7TA 2F3PA 3A10A 1PLJA 3PDIB 4FBGA 4ZOBA 4LAFA 3RU3A 1P31A 4N18A 1YTUA 4RHCA 4L6IA 1WUJS 3ILXA 3GEHA 2JNWA 4YJFA 4PTZA 4DVGA 5JAUA 4COOA 1L7PA 2Q6VA 1MH9A 2IZ6A 2QVZX 3Q98A 1XD2B 3ZWQA 1C7IA 4B43A 1D2CA 3IPRA 4NCXA 4C3VA 4ER3A 4JFRA 5DHSA 2AD5A 4HP8A 1D2NA 3DWFA 2G8LA 3UEOA 4BB6A 2GM9A 2RCYA 3OFVA 3OZXA 3BJMA 1FDWA 2VJAA 2ZJZA 4FFVA 4JYBA 4A8TA 4XCQA 4BLQA 3QUBA 4OHFA 4B46A 2ZRLA 2VATA 4W99A 3HJHA 1LBTA 3AESA 4FD3A 4IX1A 4HUJA 3K5IA 4XDHA 5EQDA 4JVNA 1Y4ZA 1NKVA 2ISCA 3ER6A 3NXKA 4KODA 4LE2A 1VKJA 4KI7A 1W5EA 2ADMA 2R4TA 3OEWA 4W9NA 5DOZA 3EEOA 2H4XA 1ZICA 1C81A 4DR6B 4OHKA 2GD6A 4BMCA 4DIUA 1H1TA 1WCWA 2OV8A 3CBQA 3SI7A 4ABTA 2G08A 1JDUA 3QV2A 1C30B 4LQ4A 5F1YA 4A15A 4DPMA 3FF4A 4FC7A 1AS2A 2X0EA 5K3EA 1N6RA 2ZRPA 1R6VA 3MELA 1OC2A 3GH3A 1ODSA 3O8NA 4ZZ0A 3LY8A 5HWSA 3DTVA 5CLHA 5LMCA 3KVNA 3BDAA 4UUAA 3O3NB 4PPGA 3BMQB 6REQB 4YCJA 2PFGA 3O2SB 5I3CA 3VKFA 3M6WA 4JLUA 2AJCA 2I33A 2PLWA 4RKYA 1LTKA 3T3NA 2BFFB 1ADYA 5ECDA 2GBLA 1NAIA 2XRFA 4NHEA 4LV5B 5AVJA 2PJDA 3VAYA 3VO8A 3NM4A 3WRVA 1NZDA 3UWKA 5JYBA 3GVPA 3GJ5A 4ZOAA 4R51A 4BXOA 1H6DA 4C1BA 4LZZA 1D5WA 2PMFA 2VDKB 4IDEA 4D0RA 3K6SB 4ARIA 3IQGX 5EAIA 1FS6A 5EUBA 3L4KA 3E22B 4RA6B 1KZ7B 2IEIA 1YGYA 3ULKA 3NBKA 3ROPA 1GCGA 3DBOB 5ECWA 1NM5C 2B2CA 1RWMA 3TRJA 1UJ2A 5JBQA 1CVIA 2C95A 4KQ9A 1C9NA 3H97A 4D9MA 4LF7B 1ZVKA 3T99A 3VOBA 5AJTA 4QQRA 1GT6A 3AG5A 3IEKA 2HL6A 3B1JA 1H4QA 2G9VA 3GMIA 1MV5A 1ZOLA 2C9YA 3Q0EA 2CXOA 3M5PA 3QLUC 3UPTA 3VTKA 3DMPA 1PW5A 3IR7A 2EW1A 1BHQ1 4H0FA 4HS9A 5KEIA 4J8PA 1JSCA 5HBRA 2BELA 2C8KA 3F47A 4G84A 2HLDD 4P4LA 2GB4A 2IOYA 2F1RA 1AZWA 2O1WA 3DULA 2DVMA 4OOEA 1RJFA 1FMJA 1UMBB 1WXIA 1Y37A 2Z08A 4LCBA 4BNYA 3F90A 1LSOA 2PKCA 4R54A 1H6AA 2D5LA 2WUVA 2HR1A 4TLBA 1EFPA 3H1TA 3CWZA 1F2UB 1LX6A 1N7GA 4G5FA 2O2YA 3TXYA 3RLIA 1GQRA 3AGPA 4I55F 5CH5A 1I01A 2BKUA 2VBIA 2D1RA 2VJOA 4K3UA 4TWBA 5CTAA 1MO5A 2PGXA 2X19A 1YJQA 3UAGA 1RBYA 4ZHSA 3THXA 1ZCZA 4BE4A 1YR7A 2IZOA 3AETB 3AL3A 1Z2OX 5CVCA 1Z33A 2ZAYA 2YMQA 2YR0A 4XVCA 3EIEA 1ZM4A 3HDGA 3QX3A 4A3SA 3HJAA 3IMKA 4XVRA 1P4JA 3QRWA 2H57A 1B2RA 2A5DA 1RDFA 1MX5A 4ND5A 5BW4A 1R0CA 2OZLB 1KERA 2F1HA 3KOXA 3P2KA 1F2DA 3BC1A 4KSCA 3DP9A 1P81A 2R7LA 4FN4A 2HJVA 4G07A 2WIAA 3KLOA 4JQSA 1RRFA 4C0WA 2I66A 1E3SA 4FMDB 2UUOA 4MI3A 5T4FA 4GM4A 2JL1A 2PL9A 3IAXA 4HFMA 4OL9A 1U0BB 3RVKA 4XGIA 5TX7A 4ZAYA 2WG2A 4I1RA 1WJGA 4P5EA 2NTJA 1KJZA 4HXEB 1JR4A 5BMVB 1BEUB 1MORA 3HCRA 2JHFA 4KDCA 2FTKE 3D2LA 1QCCA 1X94A 2G4VA 2H85A 3I1JA 1U3WA 1P9WA 1YACA 2H51A 2H52A 3SSAA 2ACEA 1JDZA 4B17A 2CNWD 4GSKA 2FJPA 4OAPA 3LJKA 4IGFA 1ZR2A 2JFVA 4NONA 4QXMA 3WBJA 3CUTA 4F38A 3CVUA 4DG5A 4J03A 4PFJA 4DADA 2W48A 2UZ1B 5EP3A 4WT7A 3R40A 1N4AA 2UDPA 2XHEA 5B30A 1JQLB 2C82A 1NONA 4BN5A 4BLVA 1M6VA 2LZ0A 3ZV6A 1NP3A 1SQGA 1MR3F 2EFGA 1K5GA 2VZEA 3GYBA 3X44A 3SJBA 4CR7A 1QHSA 4M9SA 4MVCA 2Z43A 4Q3KA 4HF7A 4IIVA 3VSDA 3DQPA 3MWFA 5ERXA 3K0SA 3UN1A 5AOCA 2I2DA 3TMKA 2BBSA 2P9EA 4LSGA 4KQCA 3H9QA 4DR2B 4YFVA 4RFSB 3MINA 4OMFG 4ZEXA 4EVSA 1GG2A 2DT5A 1F7VA 2QTZA 2R9VA 2RH5A 1HE2A 3K9FC 4YACA 1S8FA 1MABA 2QPOA 3FVWA 3FRJA 3MMNA 3UWPA 4AJ4A 5HZMA 4CUKA 2Y99A 2OBMA 1EUDB 4JT8A 5AKZA 4DXDA 5KYUA 5IJ9A 3WXBA 3C8ZA 3GPIA 3TW8B 4AS2A 4YRFA 1V1JA 3T0FA 2XXAA 3RUCA 2IHNA 1P9LA 1G41A 2Q7XA 3AKDA 1CYEA 1YE5A 2MINA 3AFNA 5B58T 4EJSB 5T4EA 3DNFA 3H8SA 1LPNA 3MC1A 2GASA 1IN5A 4ZCPA 2BI4A 1QQ5A 3CONA 4QWWA 1MRSA 2EFEB 1F51E 1U7UA 2YC2C 3A6ZA 4BFZA 3HG7A 1HFKA 2PT7A 1UDRA 3C15C 5H7XA 3FYSA 3A3PA 1KFKB 1PD0A 1U7WA 3IALA 2Q2VA 1B26A 3L0PA 4UDXX 5LUBA 4BQFA 1UFKA 2A0XA 1U8FO 2EGUA 3D4BA 4JUCA 3P4UA 4KNVA 5FCDA 1CRQA 2EIHA 1PLKA 1ZAKA 1T2UA 3HNPA 1Y1KE 3CEAA 3PWSA 4H16A 2JFUA 5IXYA 3MCWA 4E2WA 4EG0A 2ECFA 1B76A 3MLBA 3BRWA 1JT2A 4M0UA 2IVFA 1ZDMA 4UZSA 4FUTA 3NHFA 4G5XA 3C14C 3DTVD 4HWOA 2R6DA 4ESOA 4PIVA 3RE1A 3U09A 4HZUA 4N03A 1HPLA 2ATEA 3BE8A 3KSAC 2F3UA 1T5DX 3DZKA 5GJVC 3WLFA 4EMBA 4ENPA 2GCNA 4PM4A 1T3HA 2PZAA 5DGDA 3Q8MA 5B6PA 3PUKA 1UBMS 4OFBA 3RWBA 2V7QD 1S2OA 4XFDA 5IAEA 5K0EA 4P92A 2ZPTX 3L0YA 4U7GA 4UM5A 4A91A 2C59A 4FWIB 1FFAA 5CT9A 2QRZA 4PBTA 4OB8A 1FNNA 2GBPA 1GCAA 1XKTA 3HKDB 4DA8A 4EFNA 5DCWA 2YVAA 1QGAA 3GVHA 3L06A 5LJLA 3V80A 1D2RA 1N0HA 4PIPA 3ZV4A 4NFLA 1U9CA 1C3LA 1DJOA 1XVAA 2XEXA 4KP7A 1EWVA 5DNYB 1OXXK 3X1XA 4JENA 1UXHA 4OHVA 5BN5B 4RTNA 4PINA 4XIJA 4B7UA 2AT1A 1TEHA 1GFIA 4WQMA 4CR8A 4A0GA 2ZBPA 4LQCA 1J42A 2PZFA 3AINA 3PGLA 1DAEA 3I05A 1YRWA 1NF8A 1XRRA 5JCXA 3HACA 4KBFA 4MA5A 1EG2A 1E59A 1QG2A 2Y1DA 3F97A 3D3QA 1TK3A 2A5YB 5ILGA 2NZUG 4R5HA 3R7BA 1AGRA 1DTWA 4HH1A 1SUCA 4A6PA 3QTBA 621PA 4WJLA 4C76A 3SC3A 1KJJA 1Y7IA 3DKRA 5FDFA 3TO5A 1YONA 1KPHA 2B4YA 2JFWA 3R24A 4Q4AA 1L7RA 4CMEC 1X19A 5KYKA 4IIYA 2Z09A 4OL0A 3TZQA 2WIKA 5EZYB 2HADA 5C34B 3EDCA 1T9KA 3J7AC 2ZUVA 3EQZA 5D5PA 3IDSA 2B36A 2E1RA 1XLTC 2HK7A 2LGJA 4JVOA 4Z9YA 4ER5A 3JZIA 4QEZA 1BH6A 1BMFA 2PY6A 2YN2A 3MTQA 5KYWA 2VHZA 3O31A 5CIQA 4BEWA 3ASZA 3GJ6A 1NF3A 2XYPA 3WK7A 3DLCA 4DUGD 1VMEA 3C5CA 3TFOA 5I6DA 1E4EA 1UBTS 5EHNA 1Z0ZA 1PGQA 4FFDA 4M8SA 1R7RA 1X39A 1W4CA 4EAQA 2OQVA 4YT5A 2HMVA 3GIDA 4J0HA 4EW3A 2APJA 4G1FA 4MYDA 1C9MA 3WB1A 5DASA 2AH5A 5D3ZA 4DSOA 1QU2A 2CVQA 1CR1A 2GH1A 3S2EA 2H0AA 2PJRA 1T9CA 2XB9A 2BE7A 4PRLA 4X20A 1N7HA 5FXMA 4K9QA 4I1OA 4PSKA 3A3OA 4QECA 1XZBA 3ONFA 4LDJA 4I14A 1MN6A 3CN7A 3JQDA 1TUIA 1P33A 1VLLA 1XTVA 1FPQA 3VAZA 5CFOA 3GEPA 2VHWA 1UAAA 3FXAA 2DUWA 2W42A 3OQJA 4G89A 3UJ9A 1ZRMA 4WOPA 2WU3A 1OIVA 1E61A 3AVXA 2VXOA 3HUFA 2PKQO 3K6RA 4YJHB 4IILA 5F21A 3WLSA 4RKWA 3Q87B 1NW6A 1OZ0A 2HMTA 2XCIA 3OQ6A 3BCRA 3PDWA 4Q9AA 4CM9D 3WLLA 4JI7B 5A6SA 1QANA 4QD3A 4LYJA 3GVIA 1XZLA 3WJ1A 4WLVA 2ZI6A 4BIIA 4RBNA 2UXCB 3GRUA 2QYOA 3BK7A 3ZU6A 1LK5A 5CEEA 3P2IA 2C7GA 1HEYA 2ZPAA 4R1PA 1P6XA 2HQ1A 3U4GA 4OK3A 4AUNA 5ER6A 1S0UA 3Q8XB 4BLUA 5AXDA 5JYCA 2WAXA 3KL2A 5ECYA 1I51A 1KAEA 1LK0A 4NHOA 5UKDA 3MTAA 2WTXA 2IU0A 3ZTWA 1AKWA 2DHQA 1R18A 1IEWA 2JLYA 3OZEA 4QDXA 3T12A 1SUWA 3ILYA 3N2EA 3Q3GE 4YN3A 1E9EA 2AOTA 4L0CA 1Q0PA 2G7ZA 2P4SA 2O5EA 4A36A 2VTEA 3L1IA 1FQWA 1N8KA 4EYGA 1DLJA 3JQ8A 3HVKA 3FD8A 3P7MA 4RH0A 4DRZA 4E6PA 2HRDA 2NUBA 3EXAA 4WAUA 2YQZA 5I3ZA 4NCBA 3ONEA 4AKGA 4P7KA 4ZCQA 1A7KA 4JODA 4U6QA 1RJ9B 1DG9A 1TKRA 2FPWA 2J4CA 4LJYA 3CZQA 2XE7A 4ZT4A 2XI4A 3AJAA 3GO4A 2AZTA 5ETJA 1KETA 1M2GA 5REQB 1U2TA 4CLDA 4F5EA 1B6RA 3L1KA 1OXVA 1NI5A 3ICCA 4RTPA 2J0SA 1HLPA 1SVNA 5FP0A 5LNK1 4D6XA 1NW3A 3LQFA 1AQYA 1LPMA 1U2ZA 3FPGA 1W6UA 4MB0A 3ZJ4A 1FUEA 3I8XA 3PKJA 1Y3HA 3K72B 3IKVA 5CHYA 4BX3A 3A9VA 2Q3BA 5KWEA 3QVVA 1WBJB 4S1TA 2CLIB 2HPHA 3PUVA 3O4VA 5CR9A 2BW0A 4BQSA 1DKPA 3EFEA 4OLHA 4DSAA 4IZOA 1GR1A 4U2BA 2CV2A 1J7KA 4TVKA 2KBEA 3PEWA 2HUPA 1XWFA 3VMMA 4URXR 3F6BX 1RIIA 2IXGA 2WICA 3NG1A 2XDAA 3BRWD 4N49A 4F3RA 5CDFE 1A4XA 5K7SA 1AMOA 4WOCA 2XZOA 4R3NA 5JISA 5AKIA 1QH9A 5EWLA 2GEJA 3GLKA 2PBLA 5E6RB 3GBVA 5LOVA 1PVOA 4UMDA 1NVDA 2C3UA 1KEEA 1JJBA 2RHJA 1QSGA 4KGZA 1MJHA 5BW5A 1CUUA 4P84A 1KVRA 4Q24A 1RHKA 5KSWB 1E7WA 1FRVA 1UWVA 2BF4A 1LWOA 3KKLA 3UCXA 2UXDB 5FWXB 4RIFA 4RIEA 2Q5JA 2YINC 4ARBA 3F73A 2OAP1 4MGYR 2OV1A 1TLTA 1YZVA 3OUTA 4F6LA 1ZITA 2QENA 5CX1B 1UK8A 1X1EA 2Y3IA 2ZWVA 4KSBA 2R44A 2QUAA 4BS9A 2H2IA 3ZCQA 4RVHA 2J3IA 4XPIA 2CHGA 1OZAA 3R3YA 1Z13A 3QYFA 2OORA 3O95A 2JG3A 5DXFA 2O8VA 3PA8A 3QJYA 2KPOA 4O4LA 4O4HA 4EGFA 4ENRA 1LRJA 4U1RA 4RVFA 2JK1A 4P36A 2QV7A 1RXSA 2Z2XA 3OJEA 1LDMA 5F5XA 2QAGA 4YS6A 4PAWA 5CK5A 3RUPA 4U63A 2IP1A 3DM9B 3USES 2EKQA 5CJ2A 4E4RA 2VCHA 4RKFA 2VPIA 1Y4AE 3WJAA 1LV8A 3KXIA 3WLTA 5L45A 1ECPA 2J9ZB 2Q6KA 4TM7A 2QAJA 3DF9A 4K05A 3O92A 3FVQA 1C8VB 2IEYA 1UFQA 2B4TO 2FW7A 4US0R 1U94A 5HEKA 3UXYA 1K75A 1UDWA 3GYGA 2PUDA 1N5LA 3FTFA 1TO6A 3M9LA 1VSQA 3ER8A 3KZOA 5GONB 4IRUB 3UUWA 1CR4A 1OY1A 1U0LA 5TNXA 4BZXA 1BS9A 3LS2A 2PKYX 2QTFA 3GOHA 2X9VA 3JD1A 4ALMA 2EFDB 4ODIA 5AMXA 1K97A 2BMFA 3MHTA 4DIEA 4YCDA 2PQ6A 1ZCFA 2HA3A 3GAZA 2JGIA 1RFGE 2ZUDA 4KC0A 2N9UA 3LUCA 2NUPA 4MVJG 4RF5A 4X71A 2XKAA 2NYUA 3VNQA 5IX8A 3G0IA 1N2BA 5EJ8A 1OXBB 2IPAB 4BFXA 3TSZA 4JEHA 1EDZA 4HGZA 1U28C 1P0PA 1P1BA 1CTQA 2IXBA 1NBIA 5FTWA 4YCLA 5AKGA 1TA9A 5K09A 5KU1A 1JECA 1NDHA 1XPUA 2XD4A 3OQHA 3ZWOA 1E2DA 1JU4A 1DXHA 1JU3A 3DCNA 1M34E 1F2TB 1W581 2PSHA 3PZRA 1FP2A 3VJLA 5CDSA 3R7DA 1EJ2A 2VSYA 1Y1RA 3HVIA 2CMFA 4ARVA 3ZVNA 1N7JA 1DDOA 2HWKA 1C3JA 2JARA 4DLWA 4DA7A 2Y0DA 4H6XA 4LX8A 4E1BA 5H81A 3KQLA 2XQIA 2CL7X 3BEOA 3VU9B 2O2EA 1KYQA 5JAHA 4N3AA 2PXCA 4AJNA 3PX7A 4HDKA 3ABZA 5CXUA 2C3YA 1KNXA 1UDXA 4LVCA 5TGZA 3UJ3X 2ZS8A 2NU8B 1IG0A 5DBFA 4BWYA 1FEZA 2ZWOA 4AQ7A 4D56A 3GCXA 1ILWA 1YL6A 3ASVA 3AUXA 3V9PA 3IL2A 5EYPA 2FN4A 1KH2A 2QNBA 4AF7A 5E8JA 1BDMA 3H17A 4URFA 3RIMA 1MZPA 1NW4A 2XUHA 1PL8A 3GEBA 3G9ZA 3K1AA 1JKJB 3HLYA 1WXDA 1PVDA 4FX5A 2AVNA 2NN3C 1ZWLA 2ODPA 4INZA 1DVRA 1CS0B 2E4XA 3U4QB 2C3MA 1Y48E 2E4AA 4QLOA 3MWKA 4UVEA 3WGQA 5B2FA 4BKUA 2ZTLA 3OIUA 4QGHA 4IIJF 2WWTA 4KWIA 2H59A 2BKXA 4NXMB 3V1UA 4F97A 1I8TA 4RS4A 2G36A 4IXMA 4RZ3A 3HU2A 4LDQA 1Q3TA 3T8YA 4RTKA 4I4CA 3Q5GA 3BHMA 2QT0A 1P75A 5K5EA 1YAHA 2HLPA 3ZWNA 4EW2A 1WBDA 1YR8A 1N6OA 5ALYA 3BREA 5AK3A 5I9TA 2P3QA 1QIDA 5EKUA 1HL3A 5FO1A 1U2PA 4HDRA 5I7HA 2J7KA 3AEZA 3NXSA 2ZE6A 5GADl 2V7WA 4L8VA 1XTBA 5LZ5A 4DYDA 3DE2X 5ABPA 3Q85A 1M74A 2KWIA 3K0BA 2IJGX 2VA8A 1C29B 4AY6A 4ZO9A 2QRKA 2IIQA 3R7LA 4GYJA 1M1NB 5D3MA 3TLBA 3QEOA 3TR6A 4D3ZA 1ESMA 2ZPUA 1Z17A 1JAXA 4ZRMA 1Z62A 1JDBC 1ZA1A 1L4BA 3F7NA 1O6GA 5EIFA 4DCSA 4GDFA 1HWYA 2JS7A 4LI0A 3ZXIA 5D84A 1MDBA 1AO3A 1QKKA 1SU4A 2FSPA 3CH6A 3KVOA 3QBDA 4XLZA 5AKKA 4IM7A 4CUJA 4EMSA 1FVXA 4LYGA 4TS9A 3KJFA 5LQSA 5KNBH 5GZ1A 3HC7A 1TECE 3E18A 5HX7A 1PYOA 2XMDA 3VAAA 1Z5ZA 4H1HA 1JR3E 1GG5A 4KN5A 5BORA 3LUJA 4QPPA 3OHMA 4W5JA 3F49S 4MKZA 4ATNA 1A1SA 3LQYA 4AIIA 1I5EA 2G9UA 5CNIA 3A04A 1X80B 1M34A 4N6OA 4PO1A 2H08A 3VHXA 1C3OA 1QHIA 2YS7A 3GPBA 1UBCA 2Z9DA 4NU8X 4RD6A 5AKLA 1HFWA 3H2JA 3EXIA 4MOWA 4BNKA 4KXXA 3S99A 3ZU5A 5CDGA 3DGFC 4JXXA 1BKYA 3ZCVA 4F4DA 5G41A 1NV9A 1EWRA 3S1AB 3VYRB 1Q0TA 1C1DB 1YDEA 2H5EA 1XUOA 4F72A 2CSUA 3LCRA 1QE3A 1U2SA 4NBUA 1QO7A 1SHZA 1J22A 2WLSA 5FI5A 3DZDA 4LY3A 2W6JA 3LUDA 4P82A 4QYTA 3PEUA 2ZIZA 4QYIA 5TJHA 3G8AA 3O38A 1DAGA 2GZMA 1T0PA 4K6OA 3CH5A 4UASA 3C7TA 5EP2A 3FOEC 2HWYA 3IVGA 3AF3A 1RVV1 5CT4A 4HFNA 1H2AS 1LBHA 5HM8A 2C58A 1RZRA 4OK5A 3E03A 4RXTA 5IUNC 1IWOA 2O8CA 2TMYA 3O47A 4RGYA 2JLUA 4L3WA 4ZOQI 1N9GB 3RQIA 4F9GA 3UATA 3HH8A 5K4GA 1QVWA 5JCOC 3TOZA 1Y3IA 2LBPA 4ZAVA 1O4WA 2D7JA 5IDXA 2IUFA 1YZ3A 3OOEA 2PMCA 4H15A 4JU9A 4PV7A 4RK5A 4ZZIA 4ZMRA 1KORA 4ITVA 1OGYA 2OHIA 3PQ6A 3BN3A 3KEGA 2XIQA 1GZ6A 2GHTA 3H84A 4R1MA 1CVLA 3ZZ1A 4AZTA 5JS2A 2QD3A 4AX4A 1ZXXA 4X6UA 5KNLA 2GXAA 5LYJA 2Z2YA 2E4WA 3QKIA 4D4JA 4Y7CA 4B09A 4EJFA 4U6SA 3SWWA 1V4NA 2P77A 3RJTA 1HY3A 4BV9A 4M0FA 4RVSA 4EW1A 2QIOA 2EKLA 2M1ZA 3N7AA 5GP1A 1MAAA 3HBNA 1KWKA 3SHOA 1LBSA 3WIUA 2WD7A 4UBKA 5JSYA 4EKDA 1EVKA 4ZQHA 3I6MA 3IE2A 3WGZA 1UP7A 3ZJ5A 2X9GA 3F7MA 2NT3A 1CUBA 2WUWE 5C7OO 2BRUC 2ZB8A 5ADHA 3BA1A 3W9SA 2EKZA 5HK8A 4ZQGA 4C6HA 1M66A 3UJCA 5MN6A 3IQEA 1T8RA 2WWGA 3ISVA 5C7YA 2VK4A 1YDFA 3UYLA 1DS6A 4WCVA 4XA8A 1P1RA 3HO6A 1MIOA 3AOEA 1BSVA 1BXRA 4E6EA 1Y5MA 1L8LA 1U3CA 2C3OA 3FVRA 4FMPA 4HFRA 2TSYB 1JFFB 3Q3VA 1FP4B 5IJAA 1RQRA 1TCUA 2PQ2A 1Y4DE 3KEFA 4AY3A 3LFTA 2YIMA 3R6TA 5EIEA 1JE0A 4NMLA 2F2TA 2HCJB 3H18A 5FX2A 3LKVA 1CUDA 1QMPA 4L8WB 1QWOA 1SZPA 2PZLA 3Q3JB 4QODA 2GJ8A 3EEQA 4JJKA 5H16A 1OSNA 2FR8A 1EYZA 1D2EA 4XWTA 4EGJA 3OU6A 1Q6ZA 2X42A 5H9WA 1BXKA 2GF9A 1RE0A 3V2GA 2PV0A 1ONNA 5DTMA 1XXHE 4YJ3B 4GS5A 1NC1A 2QMOA 2G09A 3I1IA 4FDLA 5IZCA 5SZJA 1RXIA 1KQGA 5FLKA 1AS0A 2PPVA 4N0QA 4A9AA 2QHXA 1WF3A 1OE0A 3O8DA 5IFKA 3JWPA 4DR7B 3C3WA 4XOIA 1Z26A 2PMWB 4F1WA 2G1KA 5LNK6 1I7QB 1TAHA 4O4JF 4E2XA 4NOLA 3N2KA 1ZJ5A 3GA5A 4GE0A 3I32A 3F5DA 1WF6A 1WSWA 1DX6A 2JFOA 2D2VA 1ZRSA 2AE2A 2XQJA 5T6BA 4Z1OA 5BYBA 4W7IA 1X7XB 5CLGA 4X7MA 5ED4A 3KIPA 5KKNB 4FE4A 2WJZB 3DEJA 1C1YA 4RTRA 3AHDA 1WU8A 1DLIA 3LGAA 4G5SA 4YAFA 3DDZX 1RHRA 1VHQA 2Y9MB 2HBRA 2JIZD 2OYSA 3FW1A 2NO1A 3T5MA 4XSVA 2HJSA 4UAVA 2H1VA 1G6HA 1GYPA 1MF7A 2QT1A 3CLSC 1FMFA 1FVOA 1IN7A 3NYWA 4BUJA 1WCYA 1P5ZB 3G7NA 5CA1B 1Q50A 3PTLA 2AG1A 3KKEA 4HO1X 4ZCTA 4FYVA 3HYLA 3AEQB 3DE6X 2D3WA 1COWA 3TJZA 1JA0A 3QLTA 4WBXC 4B5KA 2W0SA 2MU1A 1Z7BA 1ISJA 3AJDA 3K15A 4B3HA 2FZGA 3PI6A 5AOAA 1A72A 3NIWA 1JMYA 3G3EA 1V9LA 5DHTA 3PEEA 5LP6B 1QHGA 2HBZA 4Q1CA 4EAAA 2CYAA 4PHCA 1NLZA 1YMUA 3OE7A 3A3KA 2BV3A 3QHPA 4MMYB 4S35A 1P5FA 2VHVA 2ES4A 4HUQB 1J99A 4OHBA 1PW7A 3NYIA 3G89A 4F7WA 3OO0A 4ZVMA 1XCGB 2GCGA 1CF4A 3GZNA 4C4PA 3VR4A 1KMHA 1XTJA 4TZ0A 4NH0A 1SXHA 2PVSA 3P9PA 4LYFA 4KG7A 5SYAA 3E7WA 1Q12A 4MDEA 3P9SA 3SZUA 4LJ7A 1P1KA 2BGLA 1OXKB 2ZQ5A 3B3QA 4YK7A 3SQWA 3FY4A 5EUMA 1UXOA 3BJEA 4C4OA 2GZ2A 1XPOA 1PL7A 1DWUA 2NO5A 2NVUA 3ROKA 1IHXA 1R5OA 1XRSB 2VQEB 4HVAA 2O2ZA 5EIOA 2BBTA 2W6JD 3KPVA 5TR9A 2QIPA 3NTVA 1DQZA 2OENG 3RRBA 3ZE0B 2GN2A 3DZBA 2R0QC 1SRRA 4JXZA 4ZCLA 4II3A 3NDRA 1RZVA 2QVGA 4UU1A 2EFJA 1YZTA 3TCKA 2FQ1A 3DPUA 1RRMA 1I2CA 1DJQA 1J20A 3AERB 4Q9DA 4G63A 3HSSA 1NMQA 1BMTA 1I3KA 2W2MA 3FNFA 3MMZA 4JT4A 4LRSB 4M6WB 4OSPA 2JHPA 3W7AA 1XXHA 1ENPA 3I73A 3TNYA 2CJWA 4UTOA 1I14A 2PMBA 3ORQA 3DUWA 1KAMA 3IXMA 3FWYA 4K2AA 4UTRA 2V6MA 2WJ3A 4M55A 5E0OA 3RUEA 3EZ9A 1ORVA 1VBFA 4PSVA 2AS0A 4XLLA 2SECE 2YZ7A 1OI2A 3K5WA 1JX6A 4FN5A 2H1LA 3SYNA 3HSYA 4BTEA 4GP7A 5C1IA 4Q4CA 3GLFA 4CL2A 3IEVA 2R6R1 1KC3A 3NUGA 1YJXA 3K7EA 3D2CA 1BX1A 2V1XA 4W1SA 2XWBF 3EYAA 1JLMA 5JCZA 3HXTA 1D5CA 1B7GO 1U02A 2P90A 3KWJA 4GLLA 4HAYA 4CKYA 3M81A 4CV1A 3EZGA 3MAJA 5G4KB 2B0JA 3SE7A 3SHWA 2RI0A 1QWSA 5K8UA 3N75A 5BV1A 1PT9A 2HFKA 3OHPA 3GEDA 3FDXA 1Z83A 1M2VB 3R7WB 2I9PA 3TZCA 2HY7A 3NT5A 3HM9A 3ELYA 3IBCA 5DE3A 4M0LA 2ZDQA 2R6AA 3WNVA 1DIBA 4GXTA 3CVVA 2Y1OA 4LRXA 4RF4A 3ASUA 2PR2A 1TEXA 3O93A 4GLBA 4H7IA 5DLYA 5KO2A 4FLMA 1QOQB 8OHMA 3L6OO 2HA6A 3D59A 3TLCA 4CF4A 4FJ1A 4MUKA 3AUTA 5B3JC 4PO8A 4KR9A 2F00A 2ONYA 4NDAA 3NUZA 2JASA 2OECA 1DBVO 4K3VA 3UCEA 4OV6B 2GHQA 1GZ4A 5EZSA 1SKUA 4NSNA 1T5SA 3MBKA 1T6YA 1ISHA 3OPYB 2EX4A 4FYJA 5TXGA 4WBNB 4P4UA 2G5TA 3FRIA 1GGKA 5AVSA 3LC1O 2I6SA 3NHPA 4ZT2A 1QCYA 1JR3D 1IC6A 3CSSA 2I62A 4YY3B 2GD1O 1CF9A 1PFWA 2ZYIA 4FGWA 2FSFA 3TZLA 4EGCB 3PE6A 3FYUA 2ZIXA 4GDMA 4QRHA 1Z0AA 2QRUA 4KUGA 3ZWCA 1A8PA 1O6FA 4D42A 3JW8A 3C3EA 3BSWA 3BHIA 4F3KA 1UBKS 1CY7A 2PUWA 3HV0A 3N76A 1FDVA 1CPYA 1M8FA 3PPIA 5F78A 5B55A 1Y1QA 2UVQA 1GITA 2XW6A 1WXHA 5KYYB 1CX9B 2ZP1A 3L40A 2FX3A 3DMFA 1R12A 1P17A 1NOKA 2UVPB 1AVTA 1B93A 3CIOA 3Q3IA 3WKBA 2XKKA 3SQNA 4YASA 5M04A 1ULZA 2YYSA 2SHKA 3MF4A 4YNBA 4EG1A 1YHYA 1ZK2A 2NAPA 4G41A 1HO3A 1Y6RA 3UUFA 4DUZB 3QKRB 2BFDB 4ZOEA 2UU9B 4A10A 2FZVA 4B6EA 2AEMA 3IELA 1MD9A 3G13A 5LQMA 3QKSA 3I9OA 3H11A 5EN4A 5FV4A 3BFPA 3DQQA 5F51A 1DUVG 3A0UA 3EVFA 2NZXA 4D7AA 1VCIA 1J5PA 3RVSA 4C43A 5HR5A 4ZRDA 1XK6A 1OA1A 1SCUA 3ZHVA 1MQSA 2DLNA 4XDYA 2HHJA 2PRSA 1A4UA 1KVUA 1VKHA 3MWYW 4II7A 2EJUA 1JJVA 1QZUA 2YHBA 1YO6A 3O03A 3LDUA 1RFLA 2PU5A 2WDZA 2X8BA 3DC7A 4MHOA 4D9EA 3U7HB 1K66A 4F1KA 1XKLA 2B5VA 2XRMA 3AU8A 4I5IA 2QD5A 3AY6A 4KQGA 2YQ5A 4X1IB 4EPRA 5L4LA 2IITA 1JU9A 4R8MA 4RMIA 3V4LA 4S3MA 3A28A 4KBGA 3VSCA 2IL1A 4HDSB 3OIFA 1COWD 5DIZA 1DHRA 1FX1A 2F7SA 2X5XA 1OYWA 2BF7A 2CFRA 4GOOD 2RHTA 3T5TA 2WNSA 4KQ2A 3RNLA 4TV8A 2WC1A 3I61A 4K26A 4AVYA 2CCGA 1G5QA 3CNHA 1ZYUA 4MRVA 1XB2A 3DB2A 2WTNA 1JQ5A 3ZLVA 3OE7D 4Y0AA 4FEGA 4AMUA 4ENUA 5TSDA 1XAJA 3KETA 3Q7EA 3Q7IA 3TGWA 5HFNA 2PGLA 1KY5A 4XX1A 4IRMA 4AS3A 2CKDA 4ENQA 1VHTA 2D54A 2FUNB 1GUZA 2E4UA 4M9UA 2JVKA 1OFGA 2NU9A 3OCJA 2OPHA 1KI6B 1M67A 2GEDA 1M6YA