1G3MA

Crystal structure of human estrogen sulfotransferase in complex with in-active cofactor pap and 3,5,3',5'-tetrachloro-biphenyl-4,4'-diol
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
290
structure length
290
Chain Sequence
SELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTROGEN SULFOTRANSFERASE
publication title Crystallographic analysis of a hydroxylated polychlorinated biphenyl (OH-PCB) bound to the catalytic estrogen binding site of human estrogen sulfotransferase.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 111
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 2000-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g3mA00
1Q0UA 2ZYWX 3MSXA 4PXAA 1KI2A 4WIAA 3RS3A 2GJ8A 2XTZA 5FOWA 2GVZC 4ARZA 3MWLA 2F43B 3FKSA 2BBWA 3PVSA 3T12A 5ELXA 3E5HA 2VP9A 1II0A 1X8KA 2VHUA 2W0MA 3EWAA 1NIJA 3MJHA 3RS2A 5DISB 1IXRC 1AA9A 1E98A 2EYUA 2WV9A 3R8FA 4D2IA 2R6GA 2VSXA 2VSOA 1ZM9A 4UNSA 3VR2A 3TK1A 2AHOA 1NLFA 4FCWA 1ZRHA 1JNYA 5EXSA 2EFEB 2ERYA 1CIPA 1IY0A 3CRQA 4DT1A 2Q3MA 2R62A 3AKCA 2C98A 4B75A 4BEJA 1US8A 2IWRA 4ABYA 1G3QA 3H84A 4LHYA 1NF3A 4FN5A 5JBQA 3KB2A 3LRPA 4PZYA 4V0MA 3VKGA 3Q72A 4XVQA 3CF6R 4JBYA 4TL7A 2NO7A 2W2TA 4JKIA 1DVRA 3DEFA 4HB0A 1IBRA 2EFDB 3NDPA 5L3SB 3KXIA 3CWZA 3KQKA 2O52A 2QAGB 3MRSA 1KMQA 4JYCA 4LWZA 3REFA 2KE5A 5SZKB 2I4IA 3LQQA 3PIRA 2C77A 2KB0A 3L8YA 1T5IA 3Q8XB 2Z4RA 1U2RA 3CO5A 3IHLA 4LJ4A 4PC7A 3GJ4A 2P0EA 4B35A 2ZPTX 1Q21A 1UM8A 3PEWA 2A78A 3GLIA 4D81A 1TAGA 4AYTA 2WSMA 3U3KA 1D8TA 1IY1A 1XMJA 4RD0A 3QXSA 1WRBA 2J0VA 1XEFA 2I1VB 3W6NA 3ZVLA 1Z6XA 1JR3D 2WPDD 4QJ4A 4Q47A 3KUCA 1KHTA 1D2MA 2HF8A 3L0PA 1OYYA 1W2GA 3K1JA 5KSOA 1RRGA 2GXSA 1II8B 4ZPXA 2D4HA 2QA5A 1QHHB 2P6UA 1XD2B 2ZRLA 3QKUA 2FNAA 5IDVA 3SU8A 2GAOA 4DEXA 5CB6A 3FDIA 5KNBA 1FTNA 4URYR 5H8WA 1T91A 1F2TA 1S3GA 3QQ5A 1G7CA 1N6OA 3PUYA 4NYIR 4WZBE 2A5GA 4C30A 3B5JA 3RSLA 4V0KA 1HURA 3D6TB 3MMPA 4WBSA 1Q44A 4UNQA 4PQRA 1ZD9A 3AQ4A 1E32A 2PMKA 5HCIA 1RIFA 1E2KA 1J7KA 3U44B 3PUVA 3AVYA 2AL7A 5EZ5A 4JJZA 1WA5A 1UJ2A 3FGNA 4GNKA 3AP2A 1MKYA 1OKKD 2IYYA 3N2IA 2ATVA 3UIEA 1CR0A 1G8PA 5LDDC 1GITA 4B33A 4MYTA 5J4KA 3ZS8A 2CJWA 4GOXA 3T15A 4IDNA 1DPFA 2B7CA 3GFPA 2DCUA 4A1FA 3AF2A 4XTCS 1U9IC 1G3MA 2ZI9A 1OHHD 1GKYA 1YRBA 3NG1A 4YXWD 1I4LD 3CPEA 5DH9A 1Q3HA 2FGJA 4M4SA 1C1YA 2W00A 1KO8A 1PZNA 5AJXA 4AURA 1XPOA 3RRZA 4WAUA 1RKBA 4Z51A 3D8BA 4X8HA 3CX8A 2KJQA 3OF5A 4U02A 5FBWB 4WOPA 3TR5A 1B0UA 2PT5A 2IEYA 1Z47A 1DE0A 1XTJA 3BGWA 3NTUA 1OIVA 2V4ZA 2OM2A 3EA0A 4ZKDA 2AN9A 4MRSA 1S9DA 4LJ9A 4Z8XA 1G4AE 3UWKA 3PUXA 3Q7PA 4Q19A 1MO6A 1FX0A 1ETUA 3HYRA 5FPKA 1KI9A 1OIWA 4DKXA 3LBIA 4I1UA 4M9XA 2ZS9A 5CITA 1GL6A 3WY9A 1E2FA 4IXMA 1TUIA 3DMNA 2O0KA 4OI4A 2BEKA 4BFXA 1GWNA 3FMIA 5KYKA 1G21E 4TTPA 1IN5A 1S3SA 5FOXA 4PC3A 3A1VA 2GCNA 4ESVA 1YR8A 1Z29A 3EXAA 2H5EA 3T5GA 4JLOA 1UF9A 4IFEA 4HEJA 4A0FA 3KX2A 2RGEA 2ZJ5A 4PTLA 3LXRA 4PAOA 1V5WA 4KSCA 2ZJBA 2ERXA 3CIOA 1VIYA 2IBMA 4N0EA 5A0FA 3U2QA 4DDVA 1Z0IA 1TNDA 2A5FA 4IOLA 1L7VC 2G3YA 1FMJA 1XEXB 2IL1A 4FMBB 3ZZ0A 1CEEA 5FTLA 1GUAA 3GMTA 2CHQA 1R0WA 4MITA 3GLGA 2GBLC 3AVQA 2CL7X 3BC1A 3NXSA 1C4OA 1JB1A 1Z6YA 3OESA 1GNQA 1OFUX 5FUWA 4EPRA 1YZLA 3I73A 4DEYA 4CZ2A 3K8YA 1OB5A 4IEIA 3DDCA 1NSTA 4EFNA 3P4XA 1W48A 3TQCA 5J4VA 3CB4A 4TL9A 4P32A 2AKYA 4Y0AA 2A2ZA 4PR0A 1JXOA 4RD4A 3R7WA 2GCPA 2YWGA 2V3CC 3H86A 3QNUA 1UEJA 1J2JA 3DHWC 2IEZA 2OAP1 4LPSA 4D25A 2LKDA 2XTNA 4LHWA 4M53A 4UXJA 1SULA 2ZJ8A 4HLQB 3FB4A 3QXJA 3AVUA 1XZPA 2WSSD 3Q5EA 2OFWA 2QP4A 4QG7A 3NWJA 1P62B 1J8MF 1WQ1R 1H8EA 2ECKA 4WXRA 3THXB 1NIPA 2YOGA 4Q4JA 2WJVA 3G5UA 3K0AB 4I1OA 2VPPA 4AC9A 3OEED 1XMVA 1QDEA 4Q03A 2OFOA 2VHCA 3UANA 1JEDA 4DSNA 2Q9CA 3U6BA 2B8TA 4M2LA 2ZJ2A 1TQ4A 1P4SA 1ELOA 1DAHA 2Y8EA 4PSKA 1R0YA 3UKDA 2P67A 2ZRJA 1E2NA 4CDGA 4RFSB 4AI6A 1RFLA 1SVMA 5CIWA 3SBEA 1BH2A 4LV5B 1CULC 1UEIA 3PUZA 2BBOA 1N0VC 1DARA 2JIZA 3BIFA 5FBRB 1CR4A 3FMFA 3QF4B 2JLYA 4LBYA 3EG5A 1AKEA 1SXJD 4AY2A 1CBUA 1SVWA 3K09A 4D82A 2LKCA 5FR1A 4NONA 3ICQB 4MRPA 3GJXC 5IHPA 4R9UC 2GCOA 4DCTA 3MWJA 4QM6A 2UVQA 1F6BA 3X1YA 4NYMR 2VH5R 1NN0A 2DWQA 5GJBA 4GMDA 1QHIA 2ZU6A 3B2EA 1XTQA 1DAEA 3RANA 1U8ZA 3SHWA 2IYUA 3AF1A 3MFYA 2R65A 1NBME 3O8CA 2H18A 5JECA 3KFXA 3GP8A 1M2OB 2EYQA 3W5JA 5KPJA 2WICA 1IM2A 3BH7A 1TL7C 3F5FA 5P21A 5G3ZA 2BMDA 4A0GA 3DVLA 2YHSA 4JJKA 4KBFA 1ZNZA 1ESMA 2XB4A 1DO2A 2CBZA 2R6CA 1JBKA 2QP3A 4B6EA 3VAAA 1Q57A 4PPNA 2XAUA 3IBYA 4HB2A 1FZQA 3U7FB 4V0NA 1W1WA 5JLJA 5AK0A 4UXIA 4I81A 4DCSA 1R5BA 1GRQA 5JSZB 3AF0A 1OFTA 2RGCA 2BJWA 3ONWA 4YONB 3LFUA 2DWPA 2W0SA 4M1TA 1ZCAA 1VDZA 2GKSA 3I1FA 5AJWA 1S2MA 4ZDKA 1AS3A 1R0XA 3U7GA 1JR3A 2WPDA 1NVVQ 1W7AA 3GLHA 4BLRA 5HR5A 2WTUA 1X1SA 3FOZA 1WF3A 1TQDA 2G88A 3ZIAD 4M1KA 5DI3B 3QPWA 1XPUA 4V0LA 2NGRA 1E2QA 1N5LA 4QL3A 1NLZA 3R9XA 2JA1A 4KODA 5JWOA 1C9KA 1NN3A 1VHTA 2HJVA 2JLWA 3A6PC 2WWGA 4I99A 2ZR0A 4QGGA 5FUXA 4DLTA 4PPFA 3K53A 5HE9A 2GJSA 1FW6A 3I62A 2ZI3A 1ZW6A 1DAGA 4BFVA 5CK4A 3QG1A 1ZC4A 1E0AA 2QROA 3ETLA 2YZ2A 2PX3A 1YVDA 4NYJR 2JCSA 3THYA 3TSZA 4C7OA 2G83A 4JLMA 1E2JA 1ZM3A 4M9SA 2EU8A 5KSYA 1XX6A 3EPHA 2YKGA 1LNZA 1OKKA 3AF4A 2NZ8A 2ODEA 1XFAA 3U3MA 3K0EA 1A2BA 3IEUA 4EPWA 3VX4A 1AN0A 2YNMA 3GJ7A 1R8SA 1LFDB 4A8JA 5CJPA 4D0LB 5DSZA 2B92A 2WJJA 3CW2A 4PZLA 2V6JA 4G01B 3A1WA 1GOTA 2WMOB 4D4JA 2JLSA 1JJVA 4OQFA 5TB5A 1YHNA 2CHGA 6Q21A 3KJEA 2D7CA 3HWSA 1D5CA 4LI0A 3I5XA 2QSZA 3M1IA 4Q1BA 3H0KA 1OB2A 3DL0A 4O2RA 4UNRA 2RGBA 3SOPA 4BE7B 4KBGA 5GVRA 4P4TA 2IXGA 2VBCA 2X77A 1KO4A 2A30A 2F9MA 2V1UA 1IJFA 3A1SA 5CYOA 3PG5A 2WKQA 3UPUA 1B23P 1J70A 1PLKA 4YDSA 5K8LA 2PLRA 1T8TA 2EWVA 2XTMA 2ZRPA 4JVSB 3I8XA 4LSGA 1DOAA 2JLZA 2QP9X 3SS8A 5J4YA 3W5IA 3B7GA 2QNRA 3LLUA 3F0TA 4QHTA 1N6LA 2IYRA 2QTFA 1S0UA 2P6NA 3OE7D 5D3QA 4A9AA 4B3GA 3TBKA 1M1YE 3KKOA 3OIVA 1YZTA 2FSGA 1G7RA 2C9YA 5FOTA 4PQFA 5F9HA 3OZXA 2ZR9A 1NG1A 1PJRA 5EQTA 1XEWY 1RVDA 3AP1A 5KPDA 1RYFA 1TF7A 5JI2E 4QGFA 3O8RA 3A37A 4F4IA 5LB2A 3K0FA 1WDTA 3AVOA 2X2FA 3AKEA 2C2HA 2XITA 5CK5A 5IT5A 5C4GB 4BFTA 3K70D 2PX0A 1AIPA 3VU9B 1Q22A 4NYIQ 2E9SA 2BHRA 5FPSA 1KI6B 5JWHA 4DSOA 4ZDJA 2O8EB 4QBFA 4BZPA 1AGPA 5BXQC 4OI0A 1F2UA 2R6DA 1G41A 1JEEA 1G8HA 3A8TA 4OK6A 221PA 4US0R 3OIYA 4OHYA 2CCJA 1GILA 1G16A 4U7DA 1DAFA 4US1R 1GRNA 1W2HA 2WWYA 1E69A 2OFXA 2J0QA 5F9FA 4P4SB 1SVIA 1ZUNB 4IFBA 4K46A 2YOHA 1D9ZA 3Q7QA 2WVJA 4PHHA 2VIIA 3WNBA 4JKYA 4NCHA 4M21A 1X86B 2WWIA 4URWR 2OAQ1 2X1VA 2GTPA 3CR8A 1KOFA 4TLAA 5TXGA 1JPJA 1HTWA 2J59A 4A2PA 2WSSA 2IHBA 4LYJA 4B76A 3AB3A 3THOA 2HXYA 3RNLA 4OI2A 2OUKA 2P6RA 2NMVA 4EKDA 4BPBA 1P9NA 3DOFA 4M1WA 1XTIA 4RD3A 1N5IA 3WBJA 4UNPA 3EZ7A 4Q4HA 1RYHA 3IIJA 4ESHA 4TL8A 3OEEA 3V9PA 2A9KA 4P4UA 1EFTA 1K5DA 4P31A 1DBSA 4LJ7A 3SJAA 3U4QA 4UKDA 4IOJA 1Z83A 3EPKA 4RVCA 1T0JB 4QHSA 4OHVA 2HCJB 5HKKD 2G1JA 1T5LA 3TW4A 2GEDA 1S9HA 1E0SA 2CLCX 3C14C 4ZIRA 1CRQA 1E2DA 2JAQA 4B2PA 1UBFA 1O87A 1FL9A 2OSBA 4QGHA 3BS4A 3L0SA 2FOLA 4MKFA 3LVRE 3WYFA 1W4BA 3P1JA 3LAWA 1Y63A 3ICEA 4JL6A 4UXHA 1SXJA 4R7ZA 2OBLA 1DG1G 4JL8A 3NBYC 1E2HA 3VKWA 3ZLJA 3P4YA 3NBFA 1NLYA 4Q4AB 3VMFA 4DLWA 3WYAA 3I3SR 4O0MA 1XWIA 2VHQA 1OW3B 1XXHA 4B43A 4NCKA 4Q48A 1OE0A 4H1UA 2DFLA 2J7PD 1Z0FA 2NQ2C 2WAXA 3MWKA 2H1LA 2VHJA 3DKVA 2FFHA 1OYWA 2H8KA 4C0BA 1JECA 3RS7A 1KMHA 1W36C 3CX6A 4NZYA 3ZH9B 1T3HA 4BRWA 3K70C 3SDZA 2GILA 2F55A 3K9LA 4QBIA 3K0CA 4EFMA 4EJSA 5TVKA 4JBXA 4JL5A 1WP9A 4QGAA 3ZYCA 2H17A 3QEOA 3K0SA 1D2EA 4GZMA 1K8RA 3T1QA 4NL4H 4BLPA 1W4RA 1A82A 4JLKA 3C7KA 2YWHA 1UAAA 2GF9A 1KIMA 4MYCA 2OCAA 4OKSA 821PA 4H9GA 4JLVA 3WNDA 1YQTA 4Q1FA 2VP2A 2FU5C 2AXNA 3P27A 3KJIA 4Y0VA 1BS1A 3WNCA 2CVHA 2VHTA 4CIDA 1YRAA 2PJZA 4Q01A 1Z63A 2X2EA 2YJTD 3BB1A 1N0UA 2YWEA 2YOFA 1G6OA 2FPMA 3MD0A 5EE9A 3GCGA 5CM9C 1KNQA 2JIZD 3CRMA 3IO5A 4CEIA 1MOZA 2XZPA 2CNWA 3DM9B 5TARA 4S35A 4W9MC 1EFUA 3AGQA 2Z43A 3A4LA 5FFMA 4KLNA 5L3SA 1GG2A 1GM5A 1XRJA 4WA7A 4D0GA 2QAGA 2F6RA 3CRRA 3N5CA 3ND8A 1X1RA 2EVWX 3NHBA 3U5ZB 4TLEA 2O8CB 3ND9A 4OL0A 4EUNA 3ZIAA 3X1WA 2QRNA 4EQ6B 4IOKA 2GXUA 5TV2A 2HYIC 1GSIA 2V7QD 3TQFA 5A4JA 4LHZA 3WMEA 1EX7A 3T35A 3L0IB 4KVAA 4QNRA 3RS5A 4LX0A 4KI0A 3UWOA 2QSYA 2J5XA 1OH8A 3GFTA 4B3XA 3KB1A 3NDBB 5K8UA 1RJ9B 3AVXA 2C95A 2VL7A 4MYHA 2BM1A 4GP6A 4GBMA 3VR4A 3AM1A 1Z0KA 4HLDA 3B82A 5FUYA 4BASA 2IYSA 1RRCA 1II8A 2QAJA 1U0JA 4NYMQ 4Q18A 2I3BA 4KYIB 2R6FA 3VNVA 1KI7A 5G40A 5JJIA 4KSBA 4DZZA 1U99A 2A7QA 3GLIE 4DLYA 3AVVA 2BDTA 2D74A 2CDNA 2VTKA 4N0DA 4EPYA 3TVTA 2IS1A 3ADKA 4UNNA 5M04A 2XB2A 4TYWA 3QI2A 1GZSA 4NKRA 3GPLA 3EWSA 3TMKA 1Z6AA 3CH4B 2W6JD 3ADCA 4A82A 1JXMA 2ZRHA 1QG2A 1ZAKA 4PX9A 2W6ID 3U44A 3NEJA 1CJTC 4XWOA 2AR7A 1WE2A 4MGYR 1XJQA 4PQYA 2NO6A 2UKDA 4RZUA 1U8AA 1UDXA 2FZLA 1US8B 4PO8A 1YZQA 2RH5A 3L82B 2R44A 4LBVA 4WZAE 1RE0A 1E2MA 4TMXA 3EZ2A 3MGCA 4TMWA 1T8UA 1VIAA 3B1YA 4ZCLA 1LB1B 2NO1A 3H2YA 2QT0A 2ZTSA 3ZGXA 1KDTA 4P3YA 4C0QC 2BVNA 1HUQA 2FEMA 2Q0HA 3OE7A 4HAWA 2V6IA 4NCIA 4JLNA 1AM4D 3W3ZB 1XF9A 2QL6A 4ZCIA 2QY9A 4X8LA 5HCNA 3EARA 5E7JA 2O8FB 1GIAA 2C96A 2FPKA 4AKGA 3K09C 3Q5DA 4FWTA 4ZO4A 1SVLA 4XVRA 1J90A 4F4JA 1R0ZA 2R8RA 4C9BA 3GLIB 1E0KA 3SYNA 4B3FX 4DLVA 3WMFA 1ZC3A 3LQRA 3QPUA 4B48A 3W8NA 1Z2CA 3CPHA 5FOUA 2IK8A 2C03A 1IY2A 3T61A 4URUR 1FP7A 1CF4A 3DMDA 2Q6TA 5E4FA 1IXSB 2OCPA 2BMFA 2GWHA 1SVKA 2IT1A 2ONJA 1Z2AA 2D2EA 4IOMA 4NYJQ 2A5DA 5K8IA 4MH0R 4JLAA 4PC1A 4DLXA 1AKYA 3BORA 3OEHD 1NJGA 3KQLA 3J81k 1OLOA 3CZQA 1KYIA 1IAQA 1D9XA 4Q1EA 4DCVA 1I2MA 5FL7A 2IWHA 1E1QD 5DO9A 4PPQA 3T5DA 4HI0E 1UBEA 1TPZA 4JVNA 1NMZA 4JSYA 1VCMA 2IA5A 1GTVA 1TADA 2HCBA 1UBGA 2ZSFA 3HJNA 3UATA 3U7HB 1U81A 521PA 4BFUA 3IGFA 2ZE6A 3LWNA 2XNDD 3EIEA 4LK2A 1XEXA 1G3RA 1ZBDA 3CNOA 4FW9A 4NDZA 4G5OA 4TTQA 3RSOA 4C3ZA 4F38A 4GSYA 3ADBA 1A1VA 3LX5A 5LD2C 1KZGB 4I1SA 1JJ7A 1HY3A 4PPGA 1OIXA 2D2FA 4RD1A 1OH7A 3QKRA 2TMKA 3RRMA 2F1HA 2HT1A 4OHXA 1NY6A 2MMGA 3LH5A 2G77B 1E9AA 4PAQA 1XBTA 3IIKA 3IQWA 1FQKA 1U8YA 3RS4A 3EPJA 1F60A 4B3DA 4CW7A 1BMFA 3HYTA 1XJ0A 4GOKA 2WWHA 5HKKA 1NL3A 2DPXA 3W90A 5CB8A 4GRAA 4RCYA 121PA 2XXAB 1ZNXA 4A92A 3QKTA 3JZMA 3FE2A 1UKVY 4O2LA 4A6PA 4LC0A 4P33A 3CPJB 4TMVA 1Z07A 4KCGA 5FBLB 1IONA 5SZHB 2ANCA 4CRWB 5IK2D 2IXFA 3KQNA 5CYPA 1IN6A 3GLGE 2BEJA 1LF5A 4XWKA 3QPVA 2OV2A 1W4CA 4TMZA 5DHAA 5L3QA 4F93B 4HLUA 3SC3A 4QM7A 5L8VA 3KL4A 1RRFA 2FFAA 3FFBA 3R20A 3ASYA 1YE8A 2VP0A 3IILA 3X1ZA 1CU1A 1G6HA 5CM8B 1IOZA 2ZE5A 4LOAA 3A36A 1FNNA 3EIQA 3LD9A 4NCNA 1H65A 3K9HA 3TUIC 2A3RA 3ECCA 2WKRA 2J3EA 4IDHA 3AV0B 4YMVA 2J7PA 1LS6A 2RHDA 1EFCA 3EW9A 3KJGA 4DIEA 1OJLA 1EWRA 3PEUA 4DLUA 4RFSA 4U5XA 4DUGD 5KHOC 1E9RA 2A5YB 5EXXA 1VCIA 2AD5A 4A8JC 2JLVA 1KK3A 4UJ5A 2O8DA 2D62A 2EWWA 1ESNA 3LXXA 3BH6A 2VO1A 3QY0A 3TVDA 1KY3A 3QVVA 1QHSA 1ANKA 3D3QA 1E9CA 1Z5ZA 2IUSA 3QF4A 5FPHA 2MSCB 3TAUA 4URVR 4G3XA 4DSUA 2YVUA 1HQCA 4TYNA 2ODBA 5BYKA 2OXCA 2ZXUA 4M0LA 1G7TA 5B58C 1FPMA 5BYJA 3SJCA 4GFDA 4FINA 2G1KA 2XNSA 1XCGB 4HB4A 2FZ4A 5FTJA 3H4MA 1X8JA 1KO1A 1Z08A 3VR5A 2FF7A 3KZ1E 3ADDA 3TR0A 1XTSA 2J9RA 2LCFA 2WOJA 3LW8A 3A4MA 4AYXA 4CF7A 5CDFE 4NBSA 1XMSA 2QTVB 3GLGB 1QBKC 3HR8A 1HE1C 2HEIA 3W6OA 4QC2A 4TYPA 3R8CA 5B2ZA 4EPTA 3Q3JB 5EXTA 5JCPA 2Q9AA 2RAPA 2FWRA 2ODNA 4JMPA 4QNMA 1G17A 2GZAA 5KNDA 4XWAA 4JT2A 2OBNA 4FI3C 5J4LA 2ZJAA 1GVNB 1Z0AA 3SNHA 1TTTA 4MKGA 5G3YA 4JS0A 1OXXK 2AX4A 3RWMB 2WWFA 2V7QA 4G5QA 2QBYA 3GLFA 4MKIA 3CNNA 3LY5A 1EESA 1VYVA 3PR1A 3IUYA 3G82C 4LJ5A 1T0HB 2BBTA 1J99A 4EAQA 5JSZA 1VTKA 2YC2C 3CM0A 4ZCMA 4O25A 2HV8A 2MSDB 5BN3A 3VR6A 1EFHA 5EE5B 4CEHA 4BFWA 4Q7KA 2CL0X 2NPIA 1G8FA 3HU2A 3B6EA 2NTYC 4LJYA 1KI4A 2ZAOA 3PUWA 1WXQA 2FJUA 1EX6A 1KNXA 1KGDA 2BM0A 3RS0A 4DLSA 1BKDR 2BCGY 1ZJ6A 2ZIAA 1HYQA 2IYQA 1QHNA 1Y3AA 1A2KC 1O3YA 3P32A 4TQAA 4YC7A 3LV8A 2ZRFA 5DI3A 3REGA 5C18A 2VYFA 2YV5A 1NI3A 4JT4A 3KJHA 2QMEA 4WXPA 1NBMA 3GJ5A 4KITB 3WRYC 4F92B 2C8VA 3NC1C 2VRWA 3MAAC 4KAXA 2CK3D 1JAIA 5CIQA 4A0HA 3O47A 4RZ2A 3V4RA 4HSEA 1L4UA 5BN4A 1VECA 1RC8A 3BAFA 3C15C 4HUQB 3MWYW 2CNWD 2J1LA 4PSVA 2LWIA 4IRUB 4C0KA 2J87A 2PJRA 2RGAA 2W6JA 2PCLA 2JJ1D 1GL9B 5E95A 3W34A 2ATXA 4LYAA 4POAA 1TQ2A 2W6IA 1KI1A 1VCOA 5HZHA 3PFIA 3IQXA 1U90A 2RGGA 1K6MA 1JPNA 3QG5A 3ZVMA 1P6XA 3AKYA 1Q1BA 2F3TA 4F4CA 4RCZA 2B21A 4OHWA 3SFZA 4E5UA 3T1OA 3QJYA 3M0EA 1DAMA 1FUKA 1G18A 3LBHA 1YZNA 2QMHA 3ZZUA 1EWQA 2ZREA 4DSTA 4JVLA 1OXTA 2P5SA 1VMAA 4DJTA 3MUFA 2CLDX 4JLPA 4UJ3A 3PEYA 3PV0A 1PUIA 2QMUA 3KKQA 2UZ3A 3QE0A 1FFHA 5DIFA 1NRJB 4BZXA 4Q1AA 2RGXA 2XOKD 2VP6A 4FCVA 3QKSA 2ORIA 3QUSA 3IBGA 2ZU0C 2C9CA 1SXJC 3THWA 1MO5A 3CUEF 2WJYA 4A4DA 3G0HA 4LCBA 4Q5IA 4II7A 1MR3F 1P9RA 1NMXA 5C4MA 4MDEA 4OJKA 4QJ5A 2A5JA 3F8TA 3KTAA 3FTQA 2QPOA 4NH0A 1N25A 2N46A 5FUVA 3V00A 1HE8B 3S1AA 3TJZA 4B73A 4TLCA 1P2UA 5J47A 4KU4A 4HAVA 4LV8B 2ZUCA 3BH0A 3UK6A 4QBGB 4LZZA 5K8TA 3CF0A 3SI7A 1S4QA 2F7SA 2ZM5A 3R9WA 3TE6A 1ZM4A 1IQPA 3A1TA 2IUUA 3OIWA 1GKIA 3HR7A 1P61B 3CH5A 3K0CC 1Z0DA 1X6VA 3SN6A 3T34A 3GD7A 4EJSC 3OEHA 2NO0A 1XCMA 4NTZA 2GA8A 4M1OA 3GEIA 5JWRA 1M34E 2AWNA 4D4KA 1KKMA 5JCZA 3FVQA 1RZ3A 5DNYB 1E1QA 5UKDA 3U60B 1G19A 4KXFB 3JZAA 4JZKA 2J41A 4AKEA 3SQXA 1N0WA 2IYWA 1L4YA 3DZDA 3P26A 3VU9A 5G53C 4GDFA 4JBWA 2C5LA 2ZJZA 1I4TD 1KI6A 2XNDA 2RHMA 4Z1MD 1G7SA 2P3SA 1BIFA 4B32A 3THYB 2I1QA 1Z0JA 4IW3B 4RD2A 3B9PA 3RVBA 4AKIA 1LW7A 2ZRNA 3NIBA 1G8GA 1P72A 2YINC 2VLIA 2ZI7A 3FHOA 4V03A 4DHEA 2WKPA 2CLSA 1Q12A 2H16A 1ZM2A 3QXHA 5KSPA 1AQUA 1MABA 2O5VA 4F91B 1JALA 4Q21A 1NVXQ 4A8JB 3EX7C 3RC8A 2QAGC 1YR6A 2ZITA 3LDAA 1ZIOA 4IHQA 4P4SA 1FTSA 2PCJA 3WP1B 4C0SA 3LNCA 3AGPA 1G5RA 1QHGA 1TEXA 4GOJA 1ZD8A 2OLKA 3CF2A 1E1RD 5BN5A 1E9SA 4LDJA 4XSGA 1S8FA 5EE0A 5FI1B 3AP3A 3HU1A 3TIFA 2ZROA 2F1IA 5SZIA 4N1AA 3SHFA 5GVSA 2BBSA 4HLCA 2IW3A 2ZVQX 5IK2A 1KY2A 1KZ7B 4CT5A 2BKEA 4C0AC 1OH5A 4XIGS 3B1ZA 3IDQA 1EFRD 4J0QA 2JLXA 4B6FA 1AJEA 5FL7D 5KO2A 5AUPB 4FCTA 5FPYA 1Q20A 2OZEA 4LJ8A 2E87A 3EA5A 3GFOA 4KLZA 2ZUDA 2IXEA 4DDWA 1LS1A 2VF7A 4MGIR 2ZRAA 2QN6A 4IVRA 3U3OA 1MRSA 3GEHA 1G8YA 4Q9JA 4HAZA 1N6NA 2YWFA 3SJZA 1QVAA 5D3MB 3BFVA 5FR2A 3TSOA 4DUGA 1VG8A 4TYYA 2ORVA 4TSFA 2HF9A 2PEYA 4V0OA 3QSYA 1JQLB 3I8SA 1EGAA 1KK1A 1H8HD 4NE2A 3RWOA 1COWD 2G0NA 5BWMA 5EUQB 1JR6A 4G0NA 3W8RA 3EIHA 3BE4A 2AFHE 3B85A 3BJIC 2GJ9A 1W47A 3PQCA 1SHKA 1DAKA 2PL3A 4C0LA 3B13B 4TN1A 5E3HA 4RD6A 4PHGA 3DOEA 4QRHA 3X2SA 3ZVNA 1BMFD 1E3MA 1SVOA 2WOOA 2O0HA 4G5RA 1ONBA 4YDHB 2ZYVX 3ZD6A 4R98A 3UMRA 2J0SA 1SZPA 3SEAA 1SKQA 3LO5A 4C0HA 4IXNA 4IKEA 5H68A 4GI7A 2J0UB 3WYGA 3H1TA 1IN4A 4B74A 4HZIA 2FMXA 1VCNA 2QQ0A 4MRVA 1SKYB 1MV5A 5EJEA 5ANRB 4BWYA 2KSQA 4HAYA 2VEDA 4HDQB 5JFGA 1RPZA 3EC1A 1NP6A 1MH1A 2REOA 1S96A 4QHYA 4BQSA 2QM8A 4PO1A 5C2JB 4AWXA 1W5SA 1Z8FA 4OQLA 4RZXA 3JVUA 2FGKA 4ILEA 4PO9A 4RZ3A 3KQUA 1YR7A 3FHTA 4LHXA 5AUNB 3IIMA 3U61B 4CEJB 3AVTA 3A4NA 1E9FA 2GJKA 2FFQA 2Z0MA 2F1JA 1E0JA 3PITA 5FTNA 2C9OA 3K9NA 4B44A 2MSEB 4PHFA 5J40A 1KO5A 1ODFA 2WIBA 1G3UA 4QBHA 4KFTA 2F43A 5FPTA 1E2PA 2W2XA 3VFDA 1NKSA 1CLUA 4B34A 1NN1A 4TMTA 3E70C 4WZ6A 4CT4B 2IS2A 2ZRCA 5EUMA 2QGZA 3L0OA 3RC3A 3SFVA 1YKSA 1E99A 2FV8A 4JLJA 1LTQA 4Q9LA 5GADl 2IYZA 2O8CA 5HE8A 2IYLD 5C46F 4ZIRB 2FEOA 1W46A 2FG5A 1XD8A 1ZIPA 4D4MA 3CZPA 4TMKA 5KDDA 2EW1A 4N3NA 2NIPA 1FQJA 2ZYTX 4LYFA 3TLXA 1IXZA 4ZV4A 1NMYA 3NH9A 3QVUA 3SQWA 4E22A 1YJ5A 4LBWA 4AIIA 4ZKEA 4LUCA 1N2CE 2CK3A 5FTKA 1IJEA 3E2IA 4D26A 2D7DA 4IEEA 3CX7A 3QF7A 2B6HA 2J46A 2O8BB 2VP4A 1NKTA 2N42A 3BK7A 1Z3IX 4MQBA 4XD7D 3EZFA 1QZXA 2WHXA 1XPRA 1RJ9A 2DFTA 5JI3E 1Z06A 2C04A 2R2AA 3WXMA 2JJ1A 2C78A 2WIAA 3FPAA 4TL6A 1CR2A 4HZUB 4M9QA 2G9NA 2ASEA 2RGNA 1GDDA 3ZJYA 3FMPB 3CRVA 4AG5A 2DR3A 3QBTA 1CR1A 3FYHA 4A2WA 4BEBA 1XMIA 1Z6GA 5AJVB 3UG7A 3ZQ6A 4DBLC 5JHHB 2D3WA 2JJ2D 1XTKA 1Q3TA 1YZGA 1U0HC 1KSFX 4PC2A 5CLLA 1FMLA 4EJSB 2F3RA 5EP4A 3I61A 1OT3A 1ZYUA 2DY1A 1XTRA 1KO7A 4FXPA 4V0ME 2IHYA 1GFIA 1VHLA 3AF3A 5GJVC 3TGPA 4US2R 1P5ZB 1UADA 2RCNA 4XOIA 4QKQA 1TUEA 3CKLA 1NNEA 4S2EA 1LV7A 2CCKA 2XOKA 4KV9A 1DS6A 4D6PA 3QIAA 3ZZTA 4G5SA 4A0RA 5KDOA 1UPTA 4HLUC 2BCJQ 4BUJA 4HUTA 2XJ4A 5EE1A 4OQNA 4HAUA 3KDSE 3D7MA 2HLDA 4K81B 4QFMA 1QHHA 1XD2A 2CL6X 4MRRA 1NBMD 2GEUA 2ZSAA 4MKHA 3TNFA 1XD9A 1E9EA 1CKEA 2VP5A 2DB3A 3U7EB 4ARZB 4C2TA 1G5TA 4KVGA 4CEIB 5E7IA 3X1XA 1G4UR 3PENA 2ZJYA 3E1SA 1VPLA 4OQMA 5LBIA 3BFXA 2OO7A 4E09A 3SZRA 3GEEA 4NCJA 1FOEB 1G3IA 2JDID 3TUJC 2O8FA 1N6RA 2YC4C 5TY0A 1NY5A 4ACBA 1W0JD 4I4LA 3GQBA 4BRUA 4YQFA 5BW8A 4RKEA 4BFZA 2OEPA 2B7BA 3NHAA 1QHXA 5KOYA 4DT1B 1IN8A 3IPXA 4W7SA 5G41A 4Q4LA 2W83A 1D2NA 2XSZD 2Z5FA 3SR0A 1TQ6A 2BOVA 3WP0A 3GJ0A 2NPFA 5F98A 1E2GA 1FP6A 4Z1MA 5DE3A 1YU9A 4Q66C 3FMOB 2IYXA 4E03A 1KAGA 1TF5A 621PA 5AUQA 5KSZA 1SVSA 1II9A 3NKVA 1Q1QA 2YYZA 3LVQE 2GZHA 2Z6VA 1ZCBA 3OIUA 3M4YA 5BQ5A 3BWDD 1ZVQA 1SGWA 1R5NA 4FMDB 3AUYA 2QQEA 1X3SA 2QT1A 4KYUA 2PZGA 1KSGA 4DDUA 5DYIA 2GJAA 2R9VA 2F9LA 5HTKA 4MYUA 5F3WB 2K5UA 2ZRDA 3C41J 5J5CA 3ZQJA 1EK0A 1W5TA 3W6PA 5F2EA 1E2LA 2QE7A 3HU3A 4O3MA 1E1RA 3VQTA 1GKUB 2GVDC 1T3SA 3U3RA 5LB4A 1JI0A 1BOFA 1P2SA 3P20A 5CJ2A 3UMSA 4BLQA 1F5NA 4RSGA 4DCUA 4JYBA 3EPLA 5CLQA 2PLFA 4KFRA 4WW0A 2H7VA 5FL3A 4IDQA 3U3JA 1EFRA 4B3BA 2OCBA 2DFNA 1IN7A 4NP6A 1VG0B 4RFVA 3IEVA 4PAMA 5AR1A 2D06A 3SJBA 5JHGB 1TU3A 3OHMA 1A4RA 3IKJA 4FMCB 2ZANA 4X8OA 4P0TA 1F2TB 4RY2A 4A6XA 3AVPA 2REXB 3OAAD 4L4UA 2XXAA 3CR7A 4F7WA 3ZS9A 2JASA 5IF9A 1XP8A 3CBQA 1L2TA 1U98A 2ZUBA 4YMUA 3NEYA 1XZQA 5H1YA 4OBEA 3SE0A 1H8HA 5KNCA 1COWA 2AKAB 2IUTA 5DN6A 2ZSDA 3KKNA 1UKYA 2BMEA 1OH6A 2GEVA 1KJYA 2DBYA 2Q3FA 1QHYA 1WB9A 2ZI4A 3BOSA 2CJWB 4IVPA 1TX4B 2CMKA 2ONKA 3RLFA 4BLTA 4L5BA 1KSHA 2ANBA 721PA 1G64A 1W36B 1P7CA 1P9WA 1KJZA 3VR3A 4DVGA 3K70B 8OHMA 3CONA 2HDNB 4IJMA 4LGMA 5FOVA 4R71A 4JLDA 5EP2A 1RRPA 5FBQB 4LRWA 3DPUA 4EPVA 3T06B 3OFND 4M22A 5JJKA 1AZSC 3W9YA 3AKDA 3V4FA 2QG6A 3KFVA 5GJWC 2QRZA 4JVMA 4A15A 3THXA 2N1BA 3K0AA 3B78A 1NVUQ 5JEDA 1GRRA 3RAPR 4XSHA 4IVQA 4Z8YA 2EQBA 2IC5A 5H70A 3UXMA 1FX0B 1KSJA 4C0JA 2Q21A 3PEVA 4PC6A 1K5GA 3SYLA 1ZU5A 2QM7A 4KFSA 4BLSA 2GESA 1GNRA 1TF2A 2C99A 4AG6A 4TSFD 1KK2A 1KK0A 1N6PA 4ASUD 2X19A 1I2DA 1YZKA 2QI9C 3DM5A 2GK6A 3QKRB 3PXGA 2CVFA 3HPRA 3T1TA 1CJKC 2QENA 4HDOB 1GP2A 1MO4A 3R9IA 1Z6TA 2GETA 4B3CA 2XGJA 2IS6A 4R2HA 3O8BA 1CJVC 1HV8A 1F48A 3BB4A 4JSTA 2ZETA 3C5CA 4HDCA 1E4YA 1P2VA 2P5TB 2GNOA 4K8OA 5AJZA 4BFYA 1XU4A 4JLBA 2UZIR 5LPNA 1XB2A 5DGXA 1VG1A 2HXSA 1MT0A 2V55B 2XX3A 3I72A 2ODWA 2WJHA 4L9SA 1VKJA 2DYKA 3C8UA 4M9ZA 1OPXA 3AVWA 2WM9B 2PZEA 3IHWA 2PT7A 2V1XA 1LY1A 5B64A 4CYMA 2CHVA 2QU8A 1W0KA 3BERA 2E1RA 5L3QB 3BXZA 1NSFA 1KJWA 1E79D 1XJCA 4XD7A 1CRPA 4AYWA 1PV4A 4GP7A 1HA3A 4DLZA 2HUPA 1AQYA 1DAIA 2W2VA 2ZAMA 1NVWQ 3C16C 2IF2A 3R7WB 5IRCD 1EXMA 2BV3A 4EIWA 5CDFA 4MGKR 1DADA 4EDHA 4DIDA 4KFUA 2IS4A 3QXCA 3VTKA 2QTHA 4LV6A 2EFCB 5FBVB 2O8DB 5DI9A 2JJ2A 3GLFE 3EC2A 2BWJA 1DG3A 4M1YA 2KBEA 1UKEA 1ZU4A 3LA6A 1J8YF 1LF0A 2REBA 4Q4JB 4GZLA 4HUQA 2WAYA 1CP2A 1HT2E 1NN5A 4M1SA 2BC9A 1ZD1A 2JLUA 4B47A 3CRW1 2GZDA 2PH1A 4TT3D 3TH5A 4A36A 4HB3A 1U9IA 2WMNB 1VYUA 2FSHA 4HYYA 4MDFA 2ZRKA 5KU1A 2Z83A 3F3YA 2J45A 1AS2A 4B2IA 1QVRA 2ZRBA 4NPHA 1T4GA 1KI8A 5FOSA 2WWXA 5B57C 5DYGA 2GHIA 1R4AA 1P60A 4DB4A 4LPKA 3TKLA 3NH6A 1N5JA 4TLBA 3TUZC 4R2IA 4EFLA 1HT1E 2PBRA 2EFGA 3NC0C 1S1CA 1OXSC 2BMJA 2GAAA 2AD1A 4KJZA 2WJIA 2ZI6A 1ZUHA 3I5YA 2QORA 4CVNA 1YR9A 2GCOB 3LW7A 2ZS7A 3VNUA 3L2OB 4YLGA 1M6NA 1A5TA 1P2TA 3B1VA 4YMWA 4BECA 1JR3E 2FSIA 3MCAA 1UFQA 2JDIA 3GLHE 4MUBA 4Q7JB 2XZOA 2MMCA 1GL7A 3A1UA 3QBVA 4X8MA 1N5KA 1D6JA 1W0JA 2AK3A 2WBLC 3B9QA 1T6NA 3FHCB 2VQSA 1E96A 2QBYB 1KDOA 4DC9A 3GLFB 4KO8A 3C5HA 5B30A 1G1MA 3FFAA 2FA9A 4V02A 2OESA 5EP1A 3VR1A 1CS4C 3FWYA 1KI3A 1T9HA 1XEWX 2XSZA 1PLLA 2WJGA 3QXXA 5TDHA 1IHUA 2PMDA 4CEHB 3FKSD 2QEQA 2OG2A 1SQ5A 3KKMA 4M1MA 4TQUS 1L8QA 4B71A 2BKUA 2DHRA 3SBDA 1NG9A 2GRJA 1MRNA 1FNMA 1FUUA 2AFIE 1DELA 3LBNA 1G291 4MA4A 1R6BX 2V9PA 3GJ3A 1MO3A 1U0LA 1ZNWA 4A2QA 1W4AA 1BYUA 2G6BA 1R2QA 2HLDD 3Q9LA 1KDRA 2IF0A 1X8LA 2ZSEA 2G0TA 3IPYA 4JIMA 1DO0A 4TQ9A 1LVGA 2NZJA 4L8GA 3C4JA 4URXR 2GBLA 3UG6A 4FD2A 4HAXA 5LD2B 3KXLA 1R8QA 4TZ6A 4XTRA 1P73A 1R10A 3PCRB 3MJRA 1YZUA 3RHFA 1HEIA 4QOSA 2P2LA 5E7MA 2CCGA 1CJMA 3GLHB 1UDWA 1BO6A 1XCPA 4OYHA 4EPXA 4MGZR 2X8AA 1KTVA 2IYVA 2KI5A 4Q9HA 3WHKA 2OLJA 1G20E 1G5PA 3X1DA 4FMDF 2ZQ5A 4U00A 2Q3HA 5KUTA 4H1VA 2IYTA 1R7RA 1V43A 2P65A 2SHKA 3B60A 5GJCA 2GXAA 1OHHA 4GT1A 2DWOA 2V54A 5JMTA 4FWIB 2Z4SA 2ZRMA 1KAOA 3K9GA 4Q1CA 2ZR7A 5AWFC 4YXWA 4AKHA 4URZR 2GXQA 3EZ9A 3OAAA 3ZDQA 3N2EA 5JS7A 5L3VA 2OHFA 2AWOA 2VF8A 2PEZA 4LC1A 4OQXA 1ZM7A 4IDPA 4D0NA 2BJVA 1QG4A 4ERNA 1WBBA 1A7JA 4RJLA 4OK5A 5EZ6B 5L3RA 5KDLA 2VSFA 2ZRGA 2O8EA 2KWIA 3QKSB 4E07A 1M7BA 4C7OB 2QPTA 3RYTC 3EASA 3U6KA 4GPTA 3THWB 2RMKA 4WVFA 1OV4A 4B2LA 2ZE7A 1T3LA 1N6IA 4YMTA 3DO6A 2JJ8A 4KHZA 4Q02A 5KTYA 3KTAB 1AZTA 2NG1A 4MUAA 3FKQA 1U94A 1QRAA 3CWQA 3S1AB 1HH4A 2OBMA 4FMCF 1WCV1 1E94E 1TMKA 2RGNC 3KQHA 3VHLB 3VKHA 3AUXA 4D4LA 4XJXA 1NJFA 4Q00A 2FE4A 3L43A 5HZKA 5D3MA 2QE7D 2W58A 4L16A 3DZ8A 2GK7A 1UBCA 1W49A 2WZQA 1OSNA 5FTMA 2BIFA 3EZ6A 1ZUIA 2QGNA 1P75A 2O0JA 4C2UA 5FH9A 2ZE8A 3OFNA 2ZJOA 1PLJA 4TYQA 2GF0A 4AK9A 5FI0B 421PA 1M7GA 3BRWD 2ZS8A 5A5GA 3HDTA 1SHZA 4IDOA 1EG7A 1UKZA 2F1RA 1SKYE 2FH5B 3I32A 4ITRC 4ZI3A 2IX3A 1F3OA 3MLEA 3TRFA 4Z54A 4YMSA 4PHTA 2ZSBA 4TLDA 2HJGA 4L15A 5JEEA 2OXRA 1N6HA 4QJ3A 1W36D 3VX3A 3D31A 4TTRA 3T1VA 5HPYB 3WRXC 2HT6A 5EXPA 4NHOA 4GL2A 1VG9B 2CE7A 5AJYA 1R5OA 2J0UA 2FPLA 2J7KA 4TZ0A 1VYTA 4DDTA 2PZFA 3QEJA 4ASUA 1S1MA 4NU0A 3WMGA 3HP1A 3I4LA 4DXAA 5DN6D 3KKPA 2ORWA 2FSFA 3L8ZA 4Q1DA 3VHXA 2JLRA 1MABB 3GJ6A 2AXPA 1BYIA 2HYDA 2OILA 1AK2A 4NMMA 4CGZA 4OJQA 5J4HA 3ZD7A 1XDBA 3LX8A 4Q4AA 3KXKA 3K0FB 2NO9A 4I1VA 1W44A 2JGNA 1E9DA 2QZ4A 1DTSA 4ON9A 1ZMXA 1OXVA 2VA8A 1ZINA 1WBDA 4CEJA 4QXAA 4ZDWA 1JQJC 1I4DD 4PSAA 1KKLA 2R6AA 2WWWA 4XVUA 3QOFA 3RDPA 2H92A 2OCYC 1E2EA 2QUZA 2OE2A 1F2UB 2NOAA 1RW4A 4DB2A 4DCNA 4OHZA 1E4VA 3CNLA 4G5GA 2RB4A 4LJ6A 4PFSA 1KDPA 2RGDA 3MG9A 1Z28A 1E79A 4RKFA 4LYHA 3AEZA 1AGRA 2KBFA 3W3AA 1SXJE 4LY6A 4PANA 3QENA 3B1WA 1PVOA 1E6CA 5C1BA 1PUJA 4BLOA 2CEAA 5JRJA 5JJLA 4OK3A 2RKOA 1Q1EA 1DEKA 3JVVA 4ZI2A 2JEOA 2L0XA 2V8OA 5JS8A 1XXHE 3B8HA 1E2IA 3N70A 3BFKA 3NVAA 4GMXA 4FIDA 3RRYA 3NBXX 4XH9B 5SZJA 5JZVA 1CXZA 4BFSA 4PZZA 4Q7MB 4LJAA 1AS0A 3IO3A 4TWZA 3RABA 2ZVPX 3HPQA 4HATA 4Q7LA 2O8BA 3I92A 3KUDA 1CJUC 4L9WA 1N6KA 3GJ8A 4AD8A 4D80A 4Q4HB 4DLRA 1OXUA 1N3BA 4W5WA 4MRNA 1Z22A 3NBZC 3PJRA 3B1XA 3U4QB 1M7HA 1OF1A 2QPAA 5EP3A 4DRZA 2XZLA 1TEVA 4ACAA 3M6AA 4BZQA 4TT3A 3RRNA 1ZNYA 2EFHB 4C4PA 2B8WA 4W5JA 4HZUA 4M8NE 1JAHA 2GDJA 2ZRIA 1Q1ZA 5TMPA 1GAJA 3UMFA 4UQOA 5DLQC 3BBPA 4Q9KA 4EQ6A 3TW8B 3AH8A 5AUOB 1XNJA 1OFIA 2FDCA 1WMSA 3LLMA 4ZDIA 4LHVA 3O8DA 1P3JA 1H8ED 2ZYUX 1W0KD 3SYKA 2XEXA 2FX3A 1TU4A 3WBKA 2DFKB 1SXJB 4Q9IA 2JLQA 5EE3A 1E9BA 1QF9A 2Q9BA 3BD9A 1OFHA 1NVVR 2FN4A 3ASZA 3TSWA 1GNPA 4W5HA 5DHFA 3TAHA 2ZEJA 3Q85A 5JRZA 1HQYE 3EAQA 2ZI5A 4G1UC 1CTQA 1ZP6A 1M74A 2FFBA 1XXHB 3BB3A 3WHLA 3ZVRA 1G9XA 2XJ9A 4BGDA 2H57A 4DWJA 2CXXA 2OT3B 2AK2A 2CE2X 2QMOA 3CLVA 3DKPA 3A58B 1M8PA 4OI1A 4LBZA 1KMHB 2JATA
chains in the Genus database with same CATH superfamily
1Q0UA 4J7UA 5YASA 1KFEB 1KI2A 2H2IA 4KO4S 3NHZA 2XTZA 1YAJA 2FPIA 2IU3A 5FOWA 1JA0A 2F43B 5EIAA 3PVSA 4YB8A 5KX5F 3KSMA 3WGKA 5ELXA 1R6UA 3BEOA 2H4JA 3COJA 1JQ5A 1X8KA 1PS0A 1YVRA 3CISA 2PKEA 1Z2NX 2W0MA 3VOBA 4X00A 1GLNA 5J2UA 3ZGYA 1MA0A 1E98A 1MQAA 5DISB 3L8HA 5IAAA 4HADA 4EF5A 2VSXA 1JLSA 1ZM9A 2VSOA 3VR2A 4JBHA 1IZZA 5TS3A 1E3DA 3GW8A 1NLFA 1RTKA 3Q0TA 5EXSA 2IQ5A 1ISRA 3CRQA 2V6GA 3Q8LA 2Q3MA 2R62A 3AKCA 2C98A 4GLBA 1YA4A 5CLHA 1GUBA 4YYEA 4RAOA 4V3BA 5I7RA 1GGEA 2DLDA 3B6IA 1RXVA 2QQGA 2L18A 2J6BA 3LRPA 3C5WP 2W37A 2B4QA 4A27A 4DPLA 2HCFA 4XVQA 1SRQA 2QAIA 4G86A 5F12A 1SZDA 3Q1KA 1T36A 5C0OE 3VOTA 4JKIA 1PBNA 4AZVA 4BO2A 1DVRA 1L4EA 3DEFA 1K3FA 2ZCJA 4U7WA 5L3SB 3A3YA 1FDRA 4UBMA 3KXIA 1SU7A 1YI0A 1E3JA 1KS9A 1ES9A 2QAGB 4JYCA 3DMPA 4HMPA 2KE5A 2XMQA 2Q5OA 2ZTLA 1L1FA 3OT4A 2O2IA 4C87A 4ED9A 3OSUA 1M6YA 3L6EA 5BW5A 3RK1A 2WY2D 2WWRA 3B89A 3CO5A 3PXXA 3FCEA 3WJ1A 5AKLA 4LF9B 4KSYA 1V3VA 1ISHA 1Q21A 1QGDA 1UM8A 3FOBA 3N2GB 3NI2A 3NV9A 3OFJA 4BMXA 4D81A 4EL5A 4EW6A 4AYTA 3PGLA 2E6KA 2R2GA 4DANA 1MAUA 3BSYA 4PZUA 4B79A 5AM4A 1PJSA 3I9FA 3UW1A 5EFZA 2C2XA 5EMNA 2O8VA 4QICA 3BMOA 1JBQA 1L6IA 3K9WA 3RBXA 1XEFA 4MQEA 3C70A 2VK8A 3N7TA 2OC9A 1QH1B 3ZVLA 4JGGA 2V4MA 3C7DB 2WPDD 2I66A 3O9VA 1KMCA 2HRCA 3TBHA 1IY9A 1KWGA 4N12A 1ULUA 3U19A 5ALQA 3BL8A 1UAYA 1PR6A 3RYFA 4F3YA 1KWKA 1C41A 4LNUA 4W5QA 5KSOA 3KYIB 3T5PA 2V5VA 1YGYA 5TRTA 3ZHSA 2QVZX 1M8JA 1XD2B 4ZVRA 3ACCA 3GOQA 4YRCA 3VOSA 3DT8A 2PUEA 3ILYA 1Q7BA 1HQDA 4RIIA 5TPWA 4DEXA 1CIVA 3ZWYA 3I34X 2IDJA 1QYDA 1UCFA 4WLVA 2XGOA 1KERA 2H52A 3VH1A 2CJPA 4C05A 3WDSA 2FCRA 1N6OA 3PUYA 4NBVA 3GJYA 4NYIR 2GASA 2BKVA 5IKMA 4C30A 3B5JA 3UB3A 4V0KA 1KVRA 1A2OA 3MMPA 2ACVA 5JYCA 1KVQA 2WWTA 4FZJA 1CNMA 4RF2A 4UNQA 2R8PA 3EZXA 1I36A 5JO0A 3AQ4A 1R4ZA 1ND5A 1P81A 5HCIA 3WOVA 3AERB 1RIFA 4AJNA 1UJBA 3VYUB 1N9GB 2AL7A 3I9NA 1OROA 2WTAA 1WA5A 1P9LA 3FOCA 4JJZA 3LUJA 1UXHA 3QU4A 1RZVA 2IYYA 2ATVA 1FFWA 1CR0A 3HBFA 4FE4A 4Y6QA 5ALMA 5EGNA 5EKXA 3D6NB 3UAXA 4WBNF 1C0KA 2CJWA 4GOXA 4IDNA 1EDDA 1QH0A 1Y3BE 2JAHA 1JYFA 4A1FA 4YY3B 3EG9B 2C7RA 1U9IC 2VHYA 1GGVA 3ENVA 1G3MA 2ZI9A 2ZIXA 3GPIA 5B3LA 4HDRA 5B53A 1Y5LA 1UWCA 4G07A 1ND6A 4IS3A 2C82A 1M2WA 1JLLA 3SS9X 3BGOS 3V8NA 1NF9A 1UBMS 1UFOA 3L04A 4X8HA 4ZVOA 2GJ4A 1S6YA 2KJQA 4Q15A 2CZGA 4AJPA 1ISSA 4OIFA 3PFFA 3R7NA 1ZSNA 2NNWB 3BWMA 1C1XB 4PS1A 2OHXA 1EXWA 4PX5A 3NTUA 4W1RA 3F5QA 5BURA 5KIAA 5CVUA 1ECPA 4EA9A 1JIIA 1JHDA 5JDCA 3V1MA 3L7DA 5ABPA 3ZHZA 1NQXA 5B7QA 4MJ7A 1QGED 4ZVQA 3T7DA 4Q19A 4WZBB 2OKCA 3FYUC 3JQFA 5L4SA 3HYRA 1SCBA 4OQQA 3OZRA 1H22A 3RODA 2QN9A 3L7JA 2WT8A 3QX8A 4OUDB 4Y9RA 3NUGA 3LTEA 4L27A 1GL6A 3ITNA 3SC2A 3PDUA 3OKFA 2PX4A 4D3XA 1UOPA 4B6PA 2PX5A 4AX8A 5FEUA 4F46A 2I91A 4RDCA 5DIZA 4EHDA 3UT5A 4KR2A 1H9AA 4FYYA 1G21E 1QG6A 2GYWA 2R7LA 3IIEA 3L6UA 5I5GA 4B3SB 2HIHA 2GCNA 4MVWA 1Z29A 4DCMA 3E9RA 3EXAA 3Q8WA 3QVJA 2H5EA 3T5GA 1NVEA 3LY7A 5HF9A 4Q16A 1GRCA 4CLEA 1LBHA 1P19A 3FGZA 3HXOA 1QQ6A 3CVJA 1GTMA 3OTGA 4PAOA 4WN9B 2VT3A 2CUKA 3CIOA 3GRCA 1LJLA 1K63A 1VIYA 1TT5A 1VCHA 5DLEA 5DULA 1R0CA 1XK7A 2HMYB 1TUGA 1P5HA 2JF0A 4YMLA 1I7NA 4GGOA 4UVDA 1VMKA 1TNDA 2A5FA 1N2JA 1EUZA 1L7VC 2W48A 1CUAA 1FMJA 2G3YA 4G5YA 1EFVA 3GG2A 5C8DA 1CEEA 1EM8A 3IUEA 3IFSA 2LIPA 2Y1XA 3L8MA 4PLWA 4UULA 1M2JA 1OBFO 1CB0A 1BXGB 4FOOA 1MIOB 5JCOA 1QS0A 1Z6YA 4QUAA 3OESA 3I30X 4FYVA 5DM1A 4ENVA 5FQNA 1WUTA 3EPRA 3HO1A 1R8XA 1RBYA 1W581 1WNFA 3PD7A 4U7TB 5DGCA 5LDGA 5TJ9A 4CZ2A 2A0FA 2CSUA 3RAEC 3DDCA 2ECPA 4PV7A 1SD2A 4BB0A 1LZKA 1CJSA 2QLFA 3BILA 4FS8A 5FI5A 3CJRA 2YMLA 3P4XA 3TD2A 4F2WA 2VHWA 4WRRA 3CA8A 5LMZA 2AKYA 2ZIZA 2GCPA 2Z1DA 1L5MA 2YWGA 3R3ZA 2V3CC 4GOND 4R81A 2O3QA 5HJ7A 1I14A 1UEJA 2OAP1 2PUTA 3AXSA 3E9ZA 1WMDA 1QIJA 4LPSA 2XTNA 4EKEA 3WFIA 2QTBA 2VZLA 4C76A 4E4RA 2YZ7A 1KRHA 4HLQB 4CKBB 1GEEA 4QYXA 4ZZ2A 2O59A 5LP1A 2PA3A 1WQ1R 2FVYA 4GW3A 3AW9A 5DP1A 1K0UA 5J63A 1ZESA 2H59A 1NIPA 2YOGA 4FFWA 4N5LA 2WJVA 3LZ6A 4AC9A 4C43A 4S12A 2VPPA 5E8RA 4CM4A 4F1WA 3JQBC 4WLNA 1QDEA 3TXAA 2H1VA 2OHVA 4OVKA 1X7YA 4TVKA 3T3OA 3WDKA 1DKUA 2AN5A 3GH1A 1LI7A 4OSEA 5K8JB 1F38A 5CD1A 4MLPA 5DNVA 5DU2A 3C3DA 1DC5A 2CXQA 2XDQA 1RLUA 5BORA 2WF5A 1R0YA 2OHIA 4QJBA 4E2FA 4CV1A 2P67A 4HPXB 1GQYA 3IMKA 1EBUA 4K87A 2BHSA 3DYBA 1E2NA 1H85A 4N7MA 3ICPA 1RHUA 1XCLA 4G1BA 1V8PA 1E1CB 1AUPA 1RFLA 2QXYA 3KVOA 4IJ5A 3O4FA 3D3EA 3RB8A 1RAEA 2QS9A 4LV5B 3W8FA 1IWBB 3BUSA 4QT4A 3EXFA 2A1TR 3PUZA 1PT7A 3OPMA 4NFHA 3CLTD 4G23A 1VSUA 1RXYA 3FMFA 3QF4B 2G8NA 1DHRA 4LBYA 3WMXA 1SXJD 4GAEA 5KX5A 4AY2A 3VI3B 2D5BA 5I47A 1R12A 4QBKA 3D8SA 4HSGA 3ZV7A 4BQFA 4DIEA 1BCRA 3GJXC 4FDTA 4MRPA 5IHPA 4DCTA 4QM6A 1U2ZA 2WP8J 1MDFA 1ACJA 2JFHA 3P9SA 4W9NC 3WL5A 2VNJA 3G2KA 5D85A 3ZHYA 1NN0A 1Z8HA 1Z2PX 3EXHC 3MNFA 2P0YA 4QPCA 3II6X 3HXMA 4L0CA 3OPYB 3T3NA 1EVKA 3G79A 3PDIB 1LPAB 1V5IA 4E4TA 4UM9B 3G5LA 1IE3A 3RANA 3FTNA 2J3LA 4J9UE 3UJ7A 1MGPA 3AF1A 5JMOA 1T2AA 1UPFA 2R65A 2QRUA 1NBME 4Y1EA 1JE0A 3DZGA 2H18A 3K2EA 5JECA 5BV2P 1YRQA 4TYMA 4YHBA 3GP8A 1TK9A 3NP9A 5AVVA 5DCYA 2B78A 5J9FA 4OHBA 4B09A 3F5FA 1Q74A 3HB0A 5G3ZA 1NSYA 4YRAA 2BMDA 4A0GA 4HP8A 3CX3A 2OCGA 2YHSA 3BEDA 1P1RA 1AUVA 3LI2A 5G4KB 5JADA 3MJFA 3HY6A 2XB4A 4B82A 1OZFA 3M89A 2I3ZA 5EHIA 1LLDA 4B6EA 1CHDA 2VK2A 3OY7A 4O2BF 3L46A 1FZQA 1P3Y1 3A1FA 2X5OA 4D45A 4LKRA 3V32A 5DK4A 3OM1A 4KRGA 2X15A 2X58A 4G0YA 4BNXA 1QF6A 2H4WA 5FYQA 1SD1A 2HDHA 4UXIA 4EHLA 5HTOA 2C57A 2BZ1A 2Q0SA 3L7KA 3RD5A 3J7AC 4A8PA 3W7VA 1YS2X 1D07A 2BJWA 2RBKA 3RJMA 5JXJA 2W0SA 1AQ6A 1ZCAA 4M1TA 1VDZA 1BVHA 2BM8A 2GKSA 1H2RS 3AFNA 3I8OA 4LMBA 1MAVA 4E7PA 2DHEA 5EGSA 4Z4QA 4PR3A 3ZCTA 1Y3DE 4C88A 1AS3A 1R0XA 4FE3A 1NVVQ 2HF2A 1EWVA 4BLRA 3JATB 2G1UA 1U1FA 3CS3A 3W7AA 4H6XA 2Y1EA 3EXIB 5BSHA 1TQDA 5DBIA 2AR0A 4PG4A 4J0FA 3HJUA 1X1QA 2ACKA 2LGJA 3QPWA 3WBBA 1XPUA 1XU9A 1LSOA 2H4HA 2PKQP 3L9XA 4YRPA 2JA1A 4RY9A 3OOEA 5JWOA 5AJHA 5EMLA 4MS1A 1YFKA 2BGKA 2WWGA 3I0NA 3DC2A 4FFLA 3HFGA 1OYOA 1EEXB 2J48A 5KNBH 2VOEA 5HE9A 3PNLA 3THRA 1TPYA 1X7ZA 4EB6B 4Z53A 4FFBA 2QTZA 5K9ZA 1ZW6A 4UU0A 2G5TA 2YY6A 2R8ZA 3Q8KA 3FNQA 5IN5A 2MHCA 2QROA 1I3CA 1CZLA 2PX3A 2WB4A 3VR4D 2PAAA 1TA9A 3Q3IA 5EWLB 4QG3A 2G83A 1PFWA 4JLMA 3VJLA 4LF6B 4YI3A 5IZ4A 1ZM3A 2PMWB 3TSYA 1YQDA 2A9JA 2ZBUA 4XQGA 1C0EA 1OOEA 1LNZA 2EIHA 2PIDA 3H5NA 2VNAA 3K4PA 3OU2A 4GR5A 4GLOA 5K3FA 3SEFA 1A4UA 1K6EA 2XE4A 3IEUA 3LYHA 4ZALA 2MSNA 5F1YA 4MVJE 1PSZA 1HLGA 1V7PC 2CDAA 2RHRA 2YNMA 3OZDA 4MV6A 1R8SA 2AKEA 4LFBB 3DLHA 4IIJB 2HQ1A 3R3UA 4QUKA 3RYIB 4ZXFA 2ISSD 5CJPA 3H9JA 2W22A 3MWFA 3GVPA 3VPAA 4D0LB 4E70A 3CW2A 3FBWA 1XCBA 3NHLA 4IXDA 1EJ2A 2WMOB 4BVLA 4D4JA 1KL7A 3MJDA 5AIBA 2JLSA 4LA4A 3L4KA 1QRUA 1H1LA 4NPAA 3FVWA 1ZD2P 4WK0B 4C08A 3CNQS 1BSVA 4HFMA 4IVNA 4JCCA 3QEKA 1DRKA 4NZPA 4J3JA 2VZEA 4F72A 4YCMA 1QFMA 2C07A 3EVCA 4BQPA 3I5XA 3QVTA 2AEJA 3H0KA 4LJRA 4UM8B 4F7DA 3A2KA 4O2RA 4DAOA 5BNTA 4WKBA 4TXJA 2HIAA 1WPQA 5B2FA 3KJFA 5BWCA 4PVCA 1E4EA 3J7TA 2RHWA 4P4TA 4MR8B 3EIWA 1M34A 4BNVA 3R3YA 4CCWA 2A30A 2O57A 4F5EA 2JK1A 3PTZA 5CYOA 2ZCVA 2POCA 2WKQA 2ZATA 4KE9A 2C7GA 3UPUA 4MOWA 2C8KA 2PLRA 2EWVA 4TV9F 2ZRPA 5TVGA 3L7OA 4B4OA 1KEZA 1WUJS 2VPXA 3WJAA 1ITZA 1UQRA 3ECSA 5D00A 5J4YA 3R3SA 3MM4A 4O4LF 4DYVA 4W5TA 4F3KA 4KPUA 3TVYA 1SWVA 3V3KA 2P6NA 3OE7D 4IQFA 4A9AA 4L95C 3P52A 4HEA1 3KKOA 1PT5A 2FSGA 2C9YA 4BAUA 4EP1A 1YK1A 2VK1A 4Q4CA 2ZR9A 3IMFA 1SJ9A 1TLLA 1PJRA 1RVDA 1BKYA 2H1RA 3JSAA 3L6RA 1VIMA 3VVCA 4RFLA 1SD5A 3O1IC 4LDNA 3WXBA 3OFKA 2B37A 2YXDA 1IQUA 2B1GA 4YQEA 3TLAA 3A37A 4F4IA 1U0NA 4DR1B 1ZICA 2G6TA 3F6YA 3K0FA 4L5YA 3A06A 1EK5A 2ZSHA 3AKEA 4J3NA 5HM8A 5AVWA 3GH3A 4OOFA 1RI5A 5C4GB 1PGJA 3VU9B 1AIPA 3WISA 2FQ1A 1I1HA 2BHRA 1WVMA 2JC3A 5BR4A 1G2IA 4QBFA 1XSEA 3HR4A 3PNVA 3HTXA 3IVCA 1VLQA 2FW9A 3RFTA 3USCS 2E1PA 4BHTA 3TD6A 4EGFA 4OATA 1BNCA 4OI0A 3PRKE 2CFOA 3NJ8A 4RF4A 5DLPA 1G8HA 1RHKA 5F33A 1LDNA 221PA 4US0R 2D6FA 3MW8A 2O9JA 1J06A 2XDAA 4Q6BA 1SUAA 4OHYA 2I99A 1NXXA 1PGNA 3DVAB 4RSMA 1GRNA 4YRZA 3H5IA 1EKXA 4TKZA 3TQTA 1M5TA 1H0RA 3AL3A 3VV3A 5BY2A 3PWZA 3IOBA 3N1UA 4RADA 1SVIA 3G13A 4IFBA 4K46A 4UVHA 4EUEA 3WNBA 3G59A 2WVJA 3BHJA 2VIIA 4IILA 2JBAB 2Y1LA 4CPDA 1FLAA 1Q0SA 1Y37A 2OAQ1 4XYGA 2EEZA 2OAGA 1YBHA 2X1VA 1CEXA 1KOFA 3AW8A 2XR1A 3LC7O 3MT9A 4G26A 4GYKA 1BVUA 2VHXA 2Y9PB 2Z2ZA 5JS6A 2EW2A 3NZEA 4RS3A 4FOSA 1HTWA 1NNSA 2WSSA 2IHBA 3U13A 4B76A 3AB3A 3THOA 2HXYA 4NDAA 3AUKA 1W0CA 2Z9CA 3KZVA 3IEVA 4BPBA 1P9NA 3A4TA 4CQMA 3VUFA 3V2IA 1MG5A 3WBJA 3EXHB 4ZQFA 1SG6A 4N49A 3RI3A 1ZG3A 5CX1B 1XVVA 3FUWA 3CNBA 4DDMA 5IJXA 3U4HA 2A9KA 1EFTA 1K5DA 3C6XA 3H8JA 2J5QA 4UKDA 3LGAA 4IOJA 5IU6A 5FAXA 2R25B 3ZKWB 3WK4A 1G2PA 1FFAA 4CM3A 3ISVA 3DAHA 5FOQA 1S9HA 1E0SA 3VU1A 3DWIA 4ZIRA 4AECA 1HFJA 2QVCA 2XUFA 3SG0A 1L1EA 4GQBA 3PFHA 1O87A 4TXHA 1RLMA 1U6KA 2V98A 4F3NA 4DCOA 1GAEO 3RG2A 3UJ3X 1H6DA 2D4AA 1GZDA 5A7HA 1Y1RA 2C84A 4MAAA 4AO7A 3WYFA 3MIIA 3BXEA 3ZY6A 3EIFA 1DOHA 3EGXB 4ISBA 1WPRA 4NOMA 3AR5A 2HB6A 3MERA 3CUTA 4UXHA 1U5BA 1AOXA 1HETA 3CW9A 3BD6A 3HBAA 4R7ZA 5JS2A 1W85A 1H0SA 2NYVA 3CH6A 4G5XA 1IZ0A 2P4QA 3GNQA 1CY6A 2FEPA 3OO0A 4HH4A 5BOSB 1OW3B 3WGVA 4NCKA 2GKOA 2XUKA 1OE0A 1N2GA 4ARIA 5C8ZA 1PS8A 4H7IA 2EIXA 4I4NA 4B5KA 1NBOA 3EWIA 3HG7A 4DM4A 1BRTA 3TGLA 3FH0A 4Z9YA 4C0BA 4EA6A 2J3HA 3K9BA 4M55A 4O5OA 3ZCPA 2L19A 4S2UA 4NZYA 1I5RA 4OREX 3RRXA 1L5WA 4BRWA 5TGZA 3UH0A 4RL6A 1DFHA 2ID8A 4RENA 3RHZA 1QOPB 3SDZA 4RTKA 3K9LA 2IHKA 3WQHA 4IFTA 2R96A 4BO7A 1WP9A 2HWWA 3ZYCA 4MV8A 4OAPA 1T3TA 3CHYA 1QDLB 1FNSA 1K8RA 2XUGA 1QZUA 3STXA 1U0GA 2DKFA 4QUGA 1P9OA 4G24A 3AR2A 5CDGA 4QYIA 2YWHA 2DMRA 1KIMA 3FSGA 2QIOA 4O2BA 2O2SA 2OCAA 4MYCA 821PA 5CA0F 4JLVA 1K8QA 3ZDYB 3ZNOA 1N92A 3KZNA 1KGSA 1AXGA 4ND8B 1X1TA 2VP2A 3PKZA 3TPCA 5REQB 2AR9A 5H02A 4FFVA 2BKLA 2PWPA 5IHXA 2PD3A 1CF9A 3NC4A 1XVTA 3JQFC 1P2BA 3QVKA 5AI6A 4JI4B 1B26A 2C5BA 2M1XA 1YVUA 3JQPA 1G6OA 2FPMA 5EE9A 3B12A 3IEPA 1F0PA 1KNQA 1JQKA 2FOXA 1MOZA 1GN8A 3N07A 2XZPA 1K8YB 1SOUA 5TARA 3VDXA 2FYTA 2P40A 3WYBA 2W8ZA 2BFDB 4H3HB 2ZQYA 2AG5A 1XRJA 4QXQA 2Q62A 3U16A 3CRRA 1ZI8A 2F6RA 4FHDA 3NHBA 5KNDD 3U5ZB 1FFYA 3IR7A 1GZVA 4TLEA 1CT9A 2O8CB 4HH1A 4HTFA 4PZ0A 5ALEA 3O0DA 3ZIAA 4L0DA 2Z6QA 4Q3CA 1UBKS 4IOKA 4I4TB 1WTAA 4K1LA 4MYSA 5AHRA 5TV2A 3TL3A 3AXTA 1KYYA 5KSWB 5A4JA 2PR2A 2MT9A 3OMLA 3WMEA 1EX7A 1B8OA 1E1NA 3I2HA 3L0BA 1P2DA 4AKTA 3HM9A 1JWLA 4MXDA 1VLLA 1ZH6A 4LX0A 5DDIP 2Q27A 5AM1A 4KI0A 2ZT6A 1LVUA 2ZJ7A 3SKYA 3GEDA 5DGHA 2AOVA 1OH8A 3GFTA 2HMWA 3UMJA 1ZRNA 3WGTA 2VTEA 3NDBB 1L7QA 1M6HA 2QZSA 5T41A 5K8UA 1QVZA 4MYHA 2WT4A 4GP6A 1P0QA 2XE8A 5JCOC 1AD2A 1QKIA 2DUJA 3OQ6A 5BQFA 4AB1A 1KEKA 1BXZA 1CR6A 1I6LA 2CLOB 1ZVMA 4R2LA 4RYDA 1HPLA 2ENUA 2WYVA 5JSFA 4Q18A 4EYOA 1S7GA 2I3BA 2ALJA 5JTTA 4TS3A 2R6FA 4YFYA 3UXEA 3IUMA 4FR0A 1JG6A 5BV7A 2JPDA 5JJIA 1EB8A 4MKZA 3R0XA 1NDUA 4QEDA 5JRDS 3NWEA 2FPIB 3T54A 2VPYA 1AHIA 3AVVA 3MTDA 2BDTA 2SCUA 4N0DA 2VTKA 3A70A 5AK6A 3VBEA 4BLWA 2IS1A 3ANXA 1J8QA 3RGGA 1PNQA 3QI2A 3PDWA 4NKRA 4DA0A 1Z36A 4FIZA 4BX3A 5ERXA 3RIMA 3FA2A 3ADCA 4I19A 3CSSA 1OWMA 4PX9A 2VTVA 2I4RA 2W6ID 3U44A 1SOVA 4YAOA 3ETHA 3CY6A 2R4QA 4ODIA 1Y48E 4CODB 1VHDA 1W52X 3TW0A 3SZOA 3WL7A 5JAUA 1P4GA 5A4FS 1WLYA 2GAJA 2DPLA 2NO6A 3O83A 4M8SA 5HNKA 3DW1X 4KIFA 5LQSA 1M6WA 1M2VB 4U2KA 4F5YA 2PNJA 2OV1A 4Y1GA 3O82A 1ONNA 1QQTA 1YZQA 3O95A 1ADGA 1R27A 2FWIA 1RE0A 4I0WB 1E2MA 4WZAE 4TV9A 1ORIA 4B7ZA 1KZ4A 5FCDA 4FEAA 4WCVA 3UV7A 4QYMA 4CTJA 4M9CA 1T9GS 3RADC 4M0EA 4O4LA 1JX6A 5SV2A 2QT0A 3WWEA 2H2HA 4D8YA 4C0QC 4JDPA 2BVNA 1DBWA 3VYSB 2G1AA 3EEOA 1B6TA 4GG1A 4NCIA 3G3EA 4FR5A 4ZVNA 4ZCIA 2WU4A 2QY9A 5HCNA 5KWIA 5KB3A 4LZJA 3RIGA 4RWEA 4KXVA 2FW1A 5E7JA 1TUBB 2O8FB 2C96A 4G0QA 3GQBB 3Q5DA 3WLJA 4FWTA 1D7AA 3FUCA 1OASA 4YR9A 1B7GO 3DL2A 3R5FA 1AUXA 5DHUA 2P11A 4C9BA 5SYNA 2HN9A 4ZYLA 1R37A 1X13A 1P17A 2F64A 1SA0B 1SUBA 1A9TA 4LTMA 1T24A 3LQRA 1TYZA 3W8NA 4I8XA 2A58A 3CPHA 1Q95A 3OICA 3HGMA 1TGVA 4PIVA 1EE9A 4BJHB 3KO8A 2C03A 2XUQA 4X97A 2XGGA 2QD1A 3NHPA 1B76A 2MU1A 3QEMA 1FP7A 3I45A 1XT6A 2GLXA 2Q6TA 3DMDA 4OX9B 1U1GA 2GWHA 2ONJA 1SVKA 1QTQA 4HF7A 4IWNA 3RYFB 3H2JA 4W82A 3VKFA 4CDRA 3K5IA 4GNRA 5IXYA 1Q0TA 3BTVA 4PC1A 4DLXA 1AKYA 4QU8A 1DEXA 5D5HA 4BCCA 3KQLA 3CZQA 1Z3CA 1KYIA 1L8XA 3E48A 1GXSA 3UXYA 1D9XA 1O9HA 2VDPB 5C8YF 2QYTA 3PU6A 3KEMA 3DOJA 2IE0A 2OC4A 3KOUA 1Z25A 3SM9A 4PPQA 4BNFA 1NBWB 1I3OA 4RDXA 4DA7A 2VWHA 4CFZA 1SIWA 3DB2A 1UKAA 4IIDA 3RTDA 3VNBA 1ZNQO 4C0XA 1IOWA 3M4NA 4D4HA 4LF8B 5C5CA 521PA 4QTXA 4BFUA 3DCJA 3LWNA 4PAWA 4HVAA 4GVXA 4IF6A 4LK2A 4Y6SA 3WKCA 2AT1A 3MBKA 2V65A 1LLQA 4NDZA 1RAGA 4GGPA 1YHZA 4TTQA 4F1JA 3E5NA 1I7PA 5I9IA 5ALRA 3O5AA 4MI6A 3LX5A 4XPIB 3X43A 1KZGB 1ESZA 3QUCA 2CDCA 3BIXA 4I1SA 2Z6UA 5C3MA 1HY3A 3IUPA 1OH7A 2D2FA 5NULA 5DHRA 3TCXB 2TMKA 1H6CA 1HOXA 4QJIA 1NY6A 3F9CA 4UBLA 4BO5A 1DQYA 4KHPB 3M8KA 1E9AA 4ZEWA 2HHHB 3UB2A 2J09A 1IJKA 1P0IA 1PKXA 1TT7A 2O7QA 3K6RA 3PQ2A 1PWEA 1ENZA 1T2DA 2SKEA 4HDRB 4XQCA 3HYTA 2XNKA 4CW7A 1XJ0A 1N7GA 1SBCA 2WWHA 3OLQA 5DM4A 5HKKA 2A1UA 5CB8A 1EIZA 3COWA 4GRAA 2XXAB 3ILVA 3HMQA 1W4LA 2B61A 5C3UA 1JHVA 3FGPA 4KXXA 4NV1A 2UYCA 2EL9A 3AI3A 2QUKA 3AUUA 4ZQIA 1V47A 3EXEB 1J5PA 3F7MA 3EGDA 4P33A 5EI5A 2O0LA 4KCGA 5FBLB 1IONA 3TD9A 3VZRA 2EGHA 5BPHA 4OAQA 3KQNA 4JOSA 3NT5A 5DHAA 4TMZA 1SPXA 1HSZA 1OAKA 1RTTA 2Q5EA 2UVPA 3N28A 4WADA 4X24A 4A7PA 4HLUA 2HHCA 2J3DA 3IMEA 4RV5A 3DBVO 3SC3A 4L50A 4E1VA 3T5AA 1PNRA 3KL4A 1RRFA 2O20A 3RC9A 4CWAA 3PEFA 4B46A 1PW5A 1L5ZA 1CU1A 3HB7A 3PHBE 5CM8B 4ZOLF 3RTBA 1ZLYA 1QCYA 3U7JA 4AJEA 2ZE5A 4FGWA 1KJJA 1N1DA 1FNNA 3M6VA 3EIQA 3PB3A 4GX0A 3ITEA 2DXIA 4QSHA 5B5SA 3K9HA 4OH7A 3TUIC 4IDHA 2WKRA 1N2OA 4B3HA 4MVYA 2P7IA 1ZGHA 3EGEA 2YNMC 3H6GA 4IF4A 3SC2B 3O2NA 1XAIA 1YKGA 4DLUA 1BX3A 4U5XA 3K8OE 3AFMA 1B3RA 4DUGD 1E9RA 1VCIA 2YX1A 2IEGA 4RS4A 4EZIA 5KYXA 4RTSA 2JLVA 1KVSA 4HWRA 2EW8A 5IUNC 1CZRA 1EZZA 1KY3A 3QVVA 2W6PA 3TVDA 5IAOA 1ANKA 1S4MA 2PK3A 3D3QA 1E9CA 1D1QA 4D0RA 4WNAA 5IVHA 4YP5A 2QRQA 4P58A 3HCBA 1CK4A 2ZAYA 1HQCA 4TYNA 2ODBA 5BYKA 3A4VA 4M0LA 4JODA 2YASA 5B58C 3GYBA 4KLAA 5BW4A 4OQPA 1PNVA 2O05A 3HE3A 1GCOA 4FINA 1TT5B 2XNSA 2QNIA 3GAFA 2FPGA 2WRZA 1A5ZA 2XY4A 4HB4A 2BISA 3H4MA 2DUWA 5FTJA 3VR5A 1KO1A 2R79A 3D8UA 4OG2A 1KXZA 3KZ1E 3TZBA 2H0AA 4BMYA 2ROQA 2YXBA 2QUHA 3LUBA 3IEIA 1OI4A 4HVCA 4CF7A 2WOJA 1NASA 1PZGA 3FPLA 3DXXA 4PN3A 3ED5A 2QTVB 2W43A 4IHJB 4QUJA 1TKBA 1UBNA 1QBKC 3HR8A 4OXXA 5CW1A 1K9SA 1AKMA 4WXMA 3VPHA 2HEIA 1TCBA 3VPBA 5AHWA 4LWQA 2RH8A 5E3IA 1B74A 3WG9A 5HYVA 2GBGA 4HX9A 2X0NA 4B87A 3AR9A 3H7IA 3O4RA 3O38A 2Q9AA 4TWAA 3QYAA 2ODNA 4O63O 1NR7A 4RDHA 4QNMA 3OTIA 4UHHA 2FPSA 2V3VA 4WY2A 4D9KA 3FTCA 4YRLA 7REQB 3ZD8A 1G38A 3IODA 4RIGA 1DDOA 1NNUA 3IPAA 1M66A 4ZMRA 1NUPA 2ZJAA 3CUVA 3ZDZB 1C50A 3WLKX 3INYA 4XUCA 5IAGA 4BE4A 1TTTA 2Q1UA 3AFGA 3BXXA 4JS0A 1OXXK 2AX4A 3FUTA 4BTLA 3HRKA 4G5QA 5JC8A 3D2LA 3TSCA 3KETA 3QX3A 3GLFA 1DQRA 3IX7A 1FY2A 1R6AA 1I0IA 2XQKA 1Z8NA 3M6XA 3IUYA 1VJ1A 1CHNA 1LPSA 1XVUA 2BBTA 2ZIFA 4TVBA 1S8OA 4FE7A 4QPNA 4PLFA 3T7IA 4A16A 3K5HA 4ZCMA 5C7LO 4O25A 4CM4B 2HU5A 2J07A 5BN3A 1NYQA 5HMLA 1NDQA 2DECA 2XMGA 4ID9A 2IODA 1X7YB 2VAPA 4Z9BA 2NPIA 1G8FA 2E3JA 3BXFA 1JHOA 5F64A 3B6EA 3ICOA 2ZAOA 3VO9A 2PS1A 5DW3A 1EX6A 4CGYA 2BM0A 1X77A 2J9XB 5ALYA 4DLSA 2YUTA 3T7RA 1VL5A 2BCGY 2XDQB 4FC6A 1FFGA 2ZIAA 5AP9A 2IYQA 4DNXA 2PO5A 2FI1A 4EJ2A 4RIHA 2FSUA 4BVBA 5LUBA 2FPOA 2VYFA 2A1IA 4BNZA 4KDCA 1NI3A 4JT4A 4TMYA 3ROFA 3V2UA 3WLMA 2QMEA 4UTVA 5F2NA 1MJHA 3GJ5A 4RF5A 4D5GA 5AW0A 3NC1C 2XPCA 4ARSA 3W5UA 2CK3D 2QM0A 4RV4A 5CIQA 4A0HA 3NAMA 3KHUA 1L4UA 2OOKA 4RK6A 5BN4A 4ZRDA 3HFRA 1O96A 3QBEA 5LU8A 2A84A 1XTPA 1BCRB 4IRUB 4PX3A 2PJRA 2FEAA 2GO1A 1YONA 3I01A 2X2PA 4F3CA 2X2OA 5E95A 2ETVA 1CY7A 2ATXA 4LYAA 4Q4DA 2I67A 1TQ2A 5HZHA 1C3LA 1DC3A 2G63A 2WIJA 2GEJA 1U90A 1ZOPA 2PT6A 4M49A 3DE6X 4MW5A 4C06A 3QG5A 4WCFB 5AHKA 2QV7A 4EM6A 1A9SA 4A5OA 4DMUB 4EW3A 3F47A 1Q1BA 2F3TA 4F4CA 1QAOA 2WABA 3QUAA 4GMKA 4CKCB 2G9RA 4RCZA 1P2GA 3T1OA 3M0EA 3ZKAA 1TZJA 1UC5B 5KINB 1Q0HA 1QNFA 4DSTA 4J1TA 3AM4A 1WCYA 2DT5A 3B7WA 4A8HA 1JHMA 4JLPA 3PV0A 1PUIA 1D2CA 1T6YA 1MMFB 1NQAO 3TL6A 1R0BA 4RJJA 5DIFA 1C14A 2J3MA 2LV8A 5CG2A 3D64A 1XLTA 3PQFA 1U3DA 2HSJA 4YUAA 4B3RB 5CXQA 5A1TA 1YQ9A 2UYYA 3IXLA 3M5CA 4FCVA 4IY1A 5B4UA 2DPGA 3GCWA 3IBGA 1TTHA 2NSJA 2YVKA 3N2YA 3TR6A 3G23A 3THWA 1MO5A 1PDWA 4UU7A 5CVEA 1I94B 2PDAA 3G0HA 5JXIA 4Q5IA 5C4MA 1JRLA 3I9MA 2SECE 1GPDG 2A5JA 3H2IA 3KTAA 4QASA 2EL7A 2NUAB 2Q5LA 3MS4A 5FUVA 4B73A 3DOCA 3IPLA 4EJFA 2I5PO 2IIBA 3ZE9A 5J47A 4CQNA 3IAM1 4Y3UA 2W6NA 4JJ4A 1JKJB 1SR8A 5HKBA 3KRTA 4RKRA 4U2BA 4HQ0A 4WOCA 2F7SA 2ZM5A 3R9WA 3IHKA 3NWPA 4ZVLA 3VDMA 3OQHA 1T2CA 1IQPA 1Y80A 4HDMA 4E31A 4JITA 3HR7A 2O2HA 4M98A 5DFAA 2XHEA 1Y1LA 3DWFA 3WLSA 3NQ41 3RSGA 5C8YA 3DXZA 3P2MA 1IRXA 2OZLB 2GA8A 1IWOA 4R2KA 4CQLA 4ZYXA 2I1LA 5KHAA 4F6RB 4UZFA 1T6ZA 1I51A 1RLTA 1ZSVA 2R66A 2XHZA 3AILA 3FVQA 3AO0B 4H6WA 4REMA 3STYA 4LXQA 5UKDA 5HRAA 1G19A 1RPAA 5JYEA 1N3YA 2VDVE 3DHYA 3O8QA 1N0WA 4MARA 4QQFA 5I4KA 1N57A 2B4YA 1VP9A 2V7BA 5ARDA 2Q5IA 3OI7A 4UM5A 1KEEA 5KNLA 1TOAA 5G53C 5LR6A 2AW3A 5A0VA 1ZBQA 3GN2A 4JBWA 3TZKA 2HJ9A 2Y71A 5BRAA 1FXWF 4GP9A 2K6GA 2P3SA 3P2OA 4JUAA 4QFDA 4WQMA 5LMCA 1U0FA 2I1QA 2CUNA 1XALA 5F77A 2LR0A 1NJ6A 4OB7A 1TO6A 3ZXUB 1DBPA 4BQIA 1LW7A 3INGA 2YICA 3E9MA 2OXFA 3JQ7A 5FORA 4C4YA 4YDQA 5ALJA 2WKPA 1SUPA 2CLSA 3OIGA 4IXTA 4RACA 4EVQA 3KHKA 2R48A 3L18A 4FDMA 4GOMD 3F7OA 3OHSX 5K0JA 2LE0A 2O5VA 1JALA 3ZE0B 3ZW9A 3PC2A 4ESOA 5KTKA 2XKJE 2E4XA 3WGZA 4AJIA 4WK4B 3WP1B 2BTQA 1LKZA 2PCJA 1R4MA 4BNKA 4YMHA 4HQFA 1KEVA 3RF7A 4DR5B 3JALB 2FZKA 4GOJA 4Y8VA 3ZCQA 2AJTA 4L4YA 3CF2A 3NKLA 2P5YA 1WMBA 2NAPA 4LDRA 2G04A 5EZYF 1Z6ZA 3HU1A 2FMIA 3RUAA 2VDLB 2XRMA 3A0RB 3TIFA 2ZROA 2F1IA 4RXMA 1K6IA 2EDCA 4HLCA 4YBZA 1C3XA