1G3MA

Crystal structure of human estrogen sulfotransferase in complex with in-active cofactor pap and 3,5,3',5'-tetrachloro-biphenyl-4,4'-diol
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
290
structure length
290
Chain Sequence
SELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of a hydroxylated polychlorinated biphenyl (OH-PCB) bound to the catalytic estrogen binding site of human estrogen sulfotransferase.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords ESTROGEN SULFOTRANSFERASE
total genus 111
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 2000-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g3mA00
2QE7D 5M04A 2JLYA 2C03A 3CPEA 3KXIA 4P4UA 3QXHA 1QHYA 1KO8A 2IC5A 2J0SA 2QZ4A 3HPRA 1CRQA 2YV5A 2AWOA 4JBYA 2PZFA 4PSKA 1UAAA 3MMPA 5DNYB 4RY2A 4RD3A 3TSZA 3MWKA 4LGMA 3KJEA 3RHFA 1KI7A 4EPTA 3RSOA 5KNCA 2FPMA 1P6XA 1H65A 1KGDA 4Q9JA 2FU5C 1IAQA 2JJ1D 3MUFA 3NVAA 5G41A 1TQ6A 2CJWB 4EQ6B 3THXB 3K70D 5CJ2A 2J7PA 4XTCS 3U44B 2F3RA 3HPQA 5FPKA 2XZOA 1OB5A 4QHYA 3Q3JB 5EP3A 4V02A 4M9SA 2REOA 2V1XA 4D0LB 1EWQA 3FKSA 3LNCA 1LW7A 3MCAA 4NCKA 1T0JB 3WYGA 3LBNA 4A4DA 1DARA 5FTKA 3K9HA 4IDOA 4RCYA 3MJRA 5DH9A 4BLSA 1EK0A 1DAHA 4PO8A 5FL7A 3B9QA 1KNXA 3EA5A 4OK3A 1T5LA 4OK6A 4YMWA 5HCIA 4TYWA 4DLXA 2GZDA 2W2TA 4JJKA 4UNQA 3REGA 1KKMA 2DYKA 3WBKA 1E32A 1FTSA 3ETLA 2CK3A 5LD2B 1UDWA 2WTUA 1G3RA 2V6JA 2ZJ8A 3LQRA 4MGYR 2ZYTX 2W00A 2FJUA 4Q48A 3CWZA 4BECA 3M1IA 1E9SA 1P3JA 4CDGA 4KFTA 1AQYA 3PQCA 2R62A 2J3EA 4AD8A 2AFHE 1JPNA 4EDHA 3VU9B 2J0QA 3BD9A 2F43A 2WPDD 3DPUA 4CGZA 2GZAA 2RGNA 4NP6A 4AKEA 2C96A 1R5BA 2V7QA 1G20E 4JLBA 3UG7A 4IVRA 3RWOA 2W6JA 3KKQA 3U61B 1FUKA 4LK2A 1EXMA 3K0SA 4D4LA 2F1JA 1F2UB 2DWOA 2ZRFA 2J45A 1OHHA 6Q21A 2WWWA 4RKFA 1XFAA 3G0HA 2QGNA 1ZD1A 4OQFA 3T1VA 3NBFA 1J8YF 1SVMA 3HYTA 1YZKA 1SKYB 4HLCA 1JQLB 5DYGA 2CE2X 5EP2A 3C8UA 2BIFA 2JAQA 4GMXA 1HA3A 2XSZD 1YR8A 4B3XA 5KSYA 1NY5A 4RFVA 2O0KA 2P67A 2ZR7A 1VKJA 1GTVA 4DSOA 3T35A 2NGRA 1UKEA 1IJFA 1XRJA 5IT5A 1OB2A 2O8CA 2ZRPA 1DOAA 2WWXA 4IDNA 4MYHA 3R7WA 4BEJA 5TMPA 3L8ZA 1XBTA 3DEFA 1XXHE 4KJZA 3THOA 1H8ED 4F38A 2H92A 1RRPA 1Z07A 4DLZA 3U3RA 4EUNA 5GJBA 3QVVA 5AR1A 1VYTA 4XH9B 4CT4B 4D0GA 1KO7A 1E2DA 1NG1A 4TL9A 1GRNA 2PLFA 1SZPA 1KDTA 2GXUA 2XOKD 2GWHA 1Z0DA 4OI4A 1CR4A 1HE1C 3U4QA 3GLFE 3AKEA 5A0FA 2DR3A 3KTAB 5B58C 2DFLA 4ZKEA 1P75A 2HLDA 3D8BA 3VR2A 4XWAA 3ZDQA 1JI0A 1U0HC 1ONBA 1I4LD 2BJWA 2MMCA 1QHHB 2NQ2C 1XCPA 3I4LA 1FW6A 3F3YA 4DC9A 3FOZA 4LWZA 3FGNA 3X1XA 2JLVA 1QG2A 3FKQA 4Q7MB 1G4AE 1GKIA 1NIJA 1W0KA 4H1UA 3X1ZA 3S1AB 1WDTA 1UM8A 2IXEA 5KSPA 3IBYA 2IW3A 2FF7A 2YYZA 4EPRA 3U7GA 3QXJA 4QC2A 5FBWB 4Q4AA 3WRXC 4TN1A 1G7CA 1R0YA 1NI3A 4TLDA 3R8CA 5J4YA 2NG1A 2WJYA 4ZIRB 4YMSA 2CL6X 3IO5A 3O47A 1NSTA 4Z1MA 4B3BA 4LUCA 2X19A 1JXOA 1I4DD 3G5UA 3T1TA 3RC8A 4I1OA 1AK2A 1DTSA 3B8HA 4ZO4A 3VR1A 4BFTA 1UDXA 1M8PA 1ZUIA 1GL6A 1DAGA 3EXAA 4D4MA 1CR1A 1WMSA 2CCJA 2QP3A 1OXUA 2NOAA 4B3CA 3U6KA 4KVGA 4WIAA 4W7SA 2PBRA 4OJKA 2OXRA 1G4UR 5P21A 1A5TA 4FMCF 2G88A 1X8JA 2G1JA 2QPOA 1W0JA 4MDEA 4B6EA 2J41A 3W6PA 1WBBA 4ZDIA 1YZNA 621PA 2VYFA 4QKQA 3KZ1E 2B6HA 5JS7A 5B57C 4YMUA 2MSEB 2LKDA 2WZQA 4Q4JB 4NMMA 4Q4HB 1N6LA 4A2WA 1NMXA 3GQBA 2J0UA 4I1SA 2IWRA 3RS0A 3OIWA 2PT5A 4CF7A 2UZIR 2BMFA 4IW3B 1A82A 4NCHA 2HV8A 4BGDA 1KJWA 4C0KA 1ZM4A 2DHRA 2ZSEA 4BZPA 1JXMA 1RRGA 1ZAKA 3NH6A 3N70A 3AM1A 4RZXA 4M9XA 4B75A 2I1QA 4B3FX 3TK1A 4PC3A 2CLDX 2JCSA 4KO8A 5JEDA 4A0RA 5GVRA 5J5CA 2G1KA 3FYHA 2O8FB 1OHHD 1YR7A 4JLVA 1OIWA 1ZINA 5CYPA 3CX6A 3QPUA 3QNUA 3ZZTA 3RVBA 3C16C 3V00A 1CEEA 4PO9A 1YR6A 4MRRA 2JGNA 3T61A 1Q21A 1Z2CA 5KOYA 1HH4A 2EU8A 3HR8A 4OHYA 2IUUA 1AIPA 1GILA 1JEEA 1UBCA 1XEXB 4GZMA 4B2PA 3SYLA 1W4RA 2CVFA 1ZUNB 2DWPA 1HUQA 5AJYA 5GADl 1LNZA 1YZTA 2HYDA 4M2LA 4TLEA 4N0DA 1EESA 2D06A 1AKEA 4UNSA 4HDCA 1AA9A 3W8RA 2QTVB 4MH0R 3BOSA 2OZEA 4NU0A 3GJ5A 3I1FA 2HJGA 4QGHA 5BYKA 3OEHD 4Q18A 3P4YA 4B76A 2OCAA 4F92B 2BBSA 4D2IA 4JL8A 3IILA 4C2UA 2J87A 3DMNA 4LYFA 2O5VA 2ZS9A 2JIZA 2WWYA 5DIFA 4G5GA 2IS4A 3JZMA 1VYUA 2ERYA 3DOFA 1P9RA 4MYTA 821PA 1ESNA 3GPLA 1I2MA 2ATVA 4V0MA 1U94A 1NF3A 2WBLC 4PZYA 2P3SA 3RABA 2GRJA 3UK6A 1EGAA 1S4QA 4PAQA 2NO9A 3I8XA 3B1XA 1NIPA 2CVHA 1MO6A 2NO0A 4LSGA 1H8HA 3EIEA 1QBKC 4YXWD 2VQSA 4OK5A 4D81A 5LBIA 3GEHA 2FZ4A 4DDVA 1J2JA 5EE5B 4JVMA 2DB3A 4Q02A 3W3AA 1E9AA 3GEIA 4AYTA 1BKDR 4DDUA 1P60A 2XZPA 1KJYA 3CM0A 4G01B 2QMEA 3ZYCA 1I2DA 4AI6A 3FFBA 4Q9IA 1P72A 2NO7A 2GJAA 2RGAA 2C9YA 3RDPA 4QL3A 2VP4A 3BBPA 3RAPR 3EIHA 4BQSA 4W5JA 5EQTA 5JHHB 3SI7A 2BMEA 2ODWA 4I4LA 5SZIA 4Q4AB 1A2BA 3B6EA 3AVXA 2PL3A 3L0SA 2QNRA 1XNJA 4KAXA 1BMFA 3HDTA 5AUPB 3CF2A 4RZ3A 4DLVA 2ATXA 2GEUA 1G8GA 1SXJD 2WSSD 4ZPXA 1E2QA 1ZD8A 1DBSA 4A8JC 4C0LA 3U2QA 3L0IB 3IIJA 1KI4A 2JJ2D 4IJMA 4KBFA 5G3ZA 4DSUA 2YWEA 3BH0A 1W7AA 4QOSA 3IDQA 3L2OB 1J90A 4B47A 5KDDA 2B92A 1QHGA 4ON9A 4TSFD 4B3GA 3VKHA 1AJEA 4WXRA 2F9MA 2L0XA 1D5CA 1U99A 3K09A 3GJ6A 5F9HA 4Q47A 3ICEA 2Y8EA 4TTRA 1US8A 2NPIA 2RCNA 3P4XA 4M1SA 1COWD 3CUEF 3FTQA 2XTNA 3MD0A 5AJVB 3QSYA 1U9IC 1OKKA 4LJ8A 5JHGB 2LKCA 4LBZA 3EA0A 4WZAE 4PHFA 1E94E 2ZE5A 3MJHA 3OZXA 3ZVRA 3FMOB 4CW7A 2GCOB 1NN3A 1R0XA 2C2HA 2VHQA 2RGNC 1YVDA 5J40A 3TUJC 4TQUS 2C5LA 1V5WA 2HDNB 3B78A 2OXCA 4JLOA 4CEHA 4LCBA 1LS1A 1E98A 2GF0A 4F4IA 1KYIA 5DN6A 4JL6A 4ZIRA 1I4TD 3RSLA 4KFUA 1AQUA 4JKYA 4QJ4A 3SHWA 1NNEA 4B6FA 2WPDA 4LYAA 4U5XA 4V0OA 2NZJA 2IL1A 3HU1A 4I81A 3TIFA 1LB1B 1XCMA 4LHZA 2RAPA 3K9NA 4NYMR 1G5TA 5FOUA 2J46A 3THYA 2Z43A 3BXZA 2OBLA 2HT6A 4TMXA 3LBIA 3K70C 2ASEA 2QENA 3GEEA 1XTIA 1LTQA 4QM6A 2QA5A 1G291 2DFKB 3DKVA 3ZZUA 4EPXA 3DM5A 1YE8A 3NTUA 4EPWA 2ZI6A 3OFND 4C0HA 4MKGA 2G3YA 1BS1A 4DT1A 2Z83A 2FH5B 2QRZA 4OQXA 5L8VA 4DB2A 3HP1A 2A5JA 5KUTA 2Q3HA 2ZJBA 1NN5A 1W5TA 4B33A 5HE8A 2ZE8A 1DPFA 2XX3A 1WBDA 3ZQJA 4F93B 4Q1BA 2QG6A 1G16A 2BMJA 4Q9KA 2JLSA 2YC2C 3H84A 3W5IA 5FTJA 1XXHB 4CT5A 1R4AA 2ZRMA 4TYYA 4G1UC 4HB2A 1WCV1 4DLSA 3K0AA 2VP0A 3AF3A 2ZRNA 4PSVA 1DE0A 4C7OA 4DCTA 1FNMA 3PG5A 4DVGA 1D8TA 4OI0A 1XDBA 2CLSA 1G3MA 1ZW6A 2YOFA 4BASA 2O8EB 3AH8A 1W46A 1JJ7A 4Q1FA 3A4LA 4LY6A 3T12A 3VKWA 3GJ0A 4C0SA 4NONA 2QGZA 2P2LA 2ZSAA 5JRZA 3C41J 5C46F 1CR2A 2HCJB 2CJWA 4CEHB 2YJTD 1E9FA 1O3YA 5AUQA 2C9CA 4WBSA 1G5RA 1JR3D 2VHCA 3BRWD 2O8EA 2VEDA 3VU9A 3PEVA 3GJ7A 4Q9LA 4Z51A 2KI5A 1QZXA 3LV8A 4EFMA 2WOOA 1UKZA 3VQTA 4URYR 1RVDA 3MWLA 2H16A 1KSJA 1Q44A 5B2ZA 5KNBA 3PITA 3U7HB 2IUTA 4C2TA 1X8KA 3U6BA 3EWAA 1KSFX 1W2HA 1Q1EA 2PMDA 4BLOA 3AVWA 4O2RA 1CLUA 5CIWA 5LDDC 1COWA 1TEXA 3KB2A 4ABYA 1RYHA 4FIDA 1IM2A 3O8DA 4DEYA 1UEIA 4UNPA 3CWQA 1YU9A 1FP6A 2R44A 2QSYA 1A2KC 3BJIC 3X1DA 1KZ7B 4UKDA 4AKGA 1C9KA 2X8AA 2XSZA 2BC9A 3A4MA 1FPMA 1CTQA 4OBEA 5KU1A 2A7QA 4FCTA 2B21A 5BYJA 1OPXA 5AJZA 2AHOA 3B5JA 1IN8A 2ZUBA 1RRFA 1O87A 3UIEA 4BLRA 5C4MA 1T5IA 4C7OB 2F55A 2QP4A 3A6PC 2QY9A 3F5FA 3NBZC 4QHSA 3PUZA 2BMDA 3B7GA 2XJ4A 1G9XA 3AVVA 2WICA 1K6MA 4PHHA 5TXGA 3HU3A 2ZJOA 5CK4A 2WJIA 1OSNA 5A5GA 3RC3A 3WP0A 1BIFA 3PFIA 2FOLA 5CYOA 3U4QB 1ZVQA 1H8EA 2ZTSA 1MT0A 4RZ2A 2GNOA 3TJZA 3UKDA 4LHWA 1FQJA 1QHIA 4B73A 3O8BA 4HZUA 1R0ZA 1S9HA 3BC1A 4ZDKA 2P6NA 2XTMA 2WKPA 4B2IA 2GILA 2QRNA 1IN7A 4ZI2A 1WF3A 5HE9A 4EPVA 5BWMA 4MGZR 4JZKA 2D3WA 1GSIA 1OIVA 2PLRA 3FVQA 4PR0A 2IK8A 3NBYC 4KBGA 5EE3A 3ZLJA 2ZR0A 1N6KA 4KFRA 4PANA 2BEKA 1VIYA 2RHMA 2WMOB 4HLUC 1KY2A 5GJWC 3WHLA 1LF5A 2ORIA 4A0HA 2CL7X 1TADA 2XNDD 1HTWA 3AP3A 3BGWA 4AWXA 2GBLC 1NKTA 4A92A 3VR6A 1DAFA 1G7RA 3QVUA 4L8GA 1AM4D 4BZQA 5ELXA 2QAGB 2IBMA 4MYCA 2WKRA 4O0MA 4M8NE 1DEKA 2HXYA 3QPWA 3SYNA 5C1BA 4MITA 1N25A 2YNMA 3EAQA 2LCFA 4ZDWA 1E0KA 4YLGA 3K0CC 3TE6A 1P5ZB 1S0UA 2GVZC 3GFOA 4O2LA 1JEDA 5EUQB 1JALA 3BE4A 2QP9X 4C30A 2GJ9A 4C3ZA 4OI2A 3K0EA 5HCNA 4BFWA 1TEVA 1KOFA 4CEJA 4EPYA 3FMFA 3NDPA 3SFZA 1DAIA 3L8YA 2HYIC 2ZQ5A 4E22A 2NPFA 4ERNA 1SKQA 5CB6A 4PX9A 1OH6A 4FXPA 3UG6A 1HEIA 4F4CA 2CXXA 2H17A 3UMFA 5J4KA 3LH5A 5GJVC 1XF9A 1TMKA 3CONA 4XJXA 5KSZA 3WP1B 4JT4A 5EJEA 2IX3A 1CRPA 5CM8B 1Y3AA 4GT1A 1SULA 2Z6VA 3QKRB 4NCNA 3NC1C 4PO1A 5JSZA 1E9DA 3CR7A 4XOIA 3GLHB 1DS6A 2BM1A 2X2EA 4MKFA 4UNNA 2AFIE 3VAAA 1KHTA 2IYYA 4D4JA 4DDTA 3N5CA 2B8WA 3Q72A 4BE7B 5IK2D 3ASYA 4HI0E 1TPZA 4R2HA 1YR9A 2NO1A 2ZE6A 3WBJA 4IOJA 4FCWA 4QG7A 2HUPA 2ZITA 4UXJA 4TYPA 1TX4B 2XTZA 4M53A 4PC6A 4K81B 3VR4A 4S35A 1NMYA 5FR1A 4KCGA 1C4OA 2OBMA 3TGPA 2AXNA 2BKUA 3MG9A 2BOVA 3UMSA 3IUYA 1TQDA 3L0PA 1ZYUA 1TUEA 2O8CB 3PUYA 4MDFA 2PZEA 3C14C 4LJ4A 3T5DA 2IS6A 2GK7A 1KSHA 4B3DA 4BFYA 1UJ2A 2IYLD 1T3LA 3CRW1 2ZRJA 3HR7A 4Q7JB 3GLIE 4NCIA 2EWVA 3ASZA 4EFNA 3SNHA 4GOXA 4DB4A 1E0AA 3ADBA 2Z0MA 3BB1A 4MYUA 3QXCA 1E2PA 1SXJA 1EX7A 2AK2A 4QBIA 1XB2A 2F6RA 5IRCD 2F3TA 4TLCA 2R9VA 2X2FA 3NEJA 3UPUA 2OAQ1 2XB4A 1L8QA 4IEIA 3MWJA 3UATA 3SC3A 2O8DB 3I92A 3OE7D 1MO3A 3EASA 1E9EA 4TTQA 2ZI5A 1HURA 3VKGA 4Z8YA 4Q00A 3CH4B 1GAJA 5AUOB 1KK3A 1T3HA 3IQWA 4KXFB 4BPBA 1KI6A 2GCPA 4WA7A 1NMZA 3T34A 4DLYA 1M1YE 4FW9A 3QEJA 4M9ZA 1D9XA 4GZLA 2IYQA 1X8LA 2WSMA 3RLFA 1VCOA 1G6HA 1X6VA 2J0VA 4ACAA 1RE0A 3IEUA 5FBRB 1ZRHA 1BO6A 2FPKA 1E1RD 3CW2A 4GMDA 4MA4A 3HYRA 4KFSA 4CEIA 2VF8A 2VP2A 3MLEA 1XD2A 5FPHA 5EZ6B 2JLRA 3AKYA 3JVVA 2ZANA 1XD8A 1DAMA 5JJKA 5KDOA 1BMFD 4W9MC 3CRMA 2FDCA 3FFAA 2CK3D 1LFDB 2VL7A 5E3HA 3LRPA 4IFBA 1KI2A 3OAAA 2W6ID 3X1YA 4WVFA 2CMKA 4D80A 2QAGA 2A5GA 2ODEA 3EPLA 3BH7A 4JLJA 2XITA 4R7ZA 4YXWA 4G3XA 2V1UA 4FMDF 4G0NA 2FFAA 3VHLB 4BLQA 2W0SA 3A1UA 4F91B 2ZUDA 1X1SA 4KSCA 4HAYA 1B0UA 1GVNB 1MABA 4A1FA 4ZCMA 4UJ5A 3K53A 4IDQA 2WSSA 2ODNA 1ZNXA 1RRCA 1E79D 4NCJA 3ZGXA 1RYFA 1NVVQ 8OHMA 2OM2A 1AS3A 1ZD9A 2RGEA 4K46A 3KFVA 4G5OA 4M1TA 1E2HA 1XD9A 4X8HA 1PLKA 1Z6GA 2ZI9A 1IJEA 4QHTA 1GNRA 5IF9A 4GDFA 3VNVA 4OHWA 1IOZA 1NY6A 2Z4SA 2P65A 2GA8A 3IGFA 3AVYA 1R8SA 3WYFA 3F8TA 5L3SB 1VTKA 2D2EA 2G0NA 4XSHA 1FMJA 1YRBA 1GKYA 3CO5A 2IXGA 3LDAA 1PLJA 3W3ZB 1XMIA 1X1RA 4RD2A 1W4CA 2B8TA 2CHQA 2EFHB 3M4YA 2BM0A 3LVRE 1JR3A 2HCBA 2VHUA 1QHNA 1YRAA 1OE0A 1WP9A 3TVTA 4MUBA 4DCSA 3TAHA 1T3SA 3I3SR 4OJQA 5FL3A 5HZKA 2UZ3A 3A1VA 5L3QB 5J4VA 1Z28A 3B13B 3PV0A 3KFXA 3CX8A 4XTRA 1EX6A 1XPOA 1P61B 4C0AC 3L82B 1G3QA 1SVIA 4TZ6A 1NN1A 1YZLA 1W0KD 2GVDC 1OJLA 2CDNA 4DLTA 1DG3A 1Z22A 1MRSA 1SXJB 4M0LA 2GTPA 4Q1DA 3U7EB 1EFCA 3IKJA 1M2OB 4KVAA 4FMDB 3TBKA 3KKPA 1PV4A 1ZM7A 3BORA 5UKDA 3I8SA 1L4YA 4C4PA 4LBVA 5CLQA 1EFRA 1NVVR 4HB4A 4V0LA 2EW1A 2FGKA 1YQTA 1GDDA 4Q4JA 5E7JA 2XGJA 2C77A 5EE9A 3UWOA 1PUJA 1EWRA 1EFUA 3QENA 5D3QA 3ZS8A 2ZR9A 4A82A 4DKXA 1TF7A 1HY3A 2J5XA 4TL8A 2HT1A 3RS7A 1CP2A 1U81A 5HTKA 2BCJQ 2PJZA 3ONWA 2CLCX 2P6UA 2V55B 2ZRGA 3R9IA 3ICQB 2A78A 4PPFA 1MR3F 3WMGA 3LO5A 3PUWA 2IEYA 4BUJA 3K9GA 4IHQA 4UNRA 1N6OA 3C5CA 4BFVA 1KO5A 3L0OA 4ZCLA 2CL0X 5GJCA 4A2QA 2IXFA 3AP2A 5JJLA 3PCRB 3BWDD 3QKUA 3WNBA 1R8QA 2A3RA 4GSYA 3VMFA 2IYSA 2W6IA 5JCZA 3CB4A 1ZP6A 1U8AA 2XOKA 2XZLA 2IYUA 4F4JA 1KTVA 2QMUA 2JDID 3M6AA 3C7KA 3IPXA 3VTKA 4A0GA 4Q01A 1W1WA 1YHNA 3GLFA 1JR6A 2O8DA 2ZRBA 4EAQA 3CIOA 2RH5A 1MRNA 5CDFA 5FI0B 4RCZA 4LV8B 4NYIQ 4PSAA 3CPHA 2C99A 2BDTA 4XSGA 3LFUA 2F1IA 2N46A 4Q9HA 4PC1A 3T06B 3NDBB 1CU1A 1FL9A 4HUQA 2ZS7A 4LHVA 1E2GA 4OQMA 3D3QA 2AN9A 3H0KA 3A4NA 4EQ6A 2ORVA 4HDQB 2FSGA 4Q1CA 4DLRA 3NKVA 2EWWA 1DELA 4Z54A 2ZIAA 4DIDA 2J0UB 2F1RA 2ZSFA 3BB3A 3NC0C 4PXAA 3QF4A 4L15A 3EX7C 3NHAA 2ZM5A 5CLLA 2VP5A 1L4UA 3EZFA 5FPTA 2C78A 2YZ2A 3FB4A 3QOFA 4LJAA 4YMTA 2QROA 3WXMA 4A36A 4PC7A 4JLPA 4V0NA 1FZQA 5BQ5A 1EG7A 3K8YA 1N0UA 4HSEA 4RD4A 3AF4A 3CX7A 3B9PA 2QQEA 2HJVA 1G8HA 1ZUHA 1KI9A 4GL2A 1P62B 3EW9A 4FWIB 2AX4A 4PC2A 1F2TB 5DYIA 3CPJB 1VCMA 1Z6YA 4ZDJA 4GRAA 3SQXA 3RS2A 2D2FA 3D31A 1ZBDA 3A36A 2YOGA 2ONKA 4WZBE 1Z0JA 3SE0A 4KSBA 2ZS8A 4Q21A 5JWRA 2YHSA 3KJHA 4R98A 3ZD7A 1G41A 1KAGA 4E5UA 2ZAMA 2GXAA 1VMAA 2AXPA 2N42A 4M1KA 5C2JB 5H70A 1G21E 1F5NA 3QPVA 3B82A 2OLKA 3FMPB 2BBWA 3IHLA 1VIAA 1B23P 3NHBA 3DOEA 3DMDA 3GJ3A 5DO9A 2R8RA 1K5GA 1OXSC 2QU8A 3L43A 4E03A 5TARA 3RANA 4IEEA 2OT3B 4UQOA 1II8A 2FWRA 3WYAA 2WJHA 1TF2A 4W5WA 1QG4A 3AF1A 3AF0A 4NYIR 1SXJE 2RHDA 4NDZA 1NP6A 1T8TA 3W9YA 4NBSA 2V8OA 1ZM9A 5E95A 4BLPA 1JAIA 5AUNB 3GLIA 5AJWA 2IA5A 3GLGE 1Z6XA 3TW4A 4Q4HA 4V03A 1KMHA 1SVSA 4S2EA 1KK0A 2D7CA 3B1YA 5KNDA 2MSDB 2YWGA 4YONB 1W44A 3TAUA 3ZIAA 5KHOC 2Q9CA 4R9UC 1BH2A 2IYRA 1ANKA 4H9GA 3O8RA 4A6PA 3EZ6A 1RJ9B 2ZYWX 3MWYW 1NVXQ 4HLUA 2IHBA 4TYQA 4D4KA 2CNWA 2JLXA 1NN0A 2PH1A 521PA 4LDJA 1CKEA 4IXMA 1N5JA 2HF9A 3REFA 4JYBA 1W48A 4FWTA 4AKHA 1QHXA 1OF1A 1VHTA 3ZS9A 5FBVB 2NMVA 1XEWX 4D26A 4Q03A 2Z4RA 5SZKB 1YKSA 1X86B 4P4SA 5FUVA 2PEZA 1NG9A 1FX0A 1G1MA 1P9WA 1PLLA 2WWFA 3CNOA 2VSFA 1T4GA 3KQLA 4PAMA 1XZPA 2G9NA 4O3MA 4I1VA 2KBFA 1G8YA 4A6XA 2C8VA 2JJ2A 1R10A 2BCGY 3EZ9A 4URZR 4D82A 1GG2A 3EZ2A 1UKVY 2DFTA 3OHMA 1UBFA 1KSGA 4B71A 4Q66C 1P4SA 4DSTA 1E99A 5JCPA 3AVOA 5LD2C 2IS1A 1J70A 5E7IA 5BW8A 2J9RA 4FCVA 4CEIB 1F3OA 4BZXA 1GNPA 2VRWA 2ZRDA 5L3QA 3NWJA 5FBLB 1A1VA 1AN0A 1Z3IX 2QM8A 3LLMA 4LBYA 4QXAA 4XIGS 1BOFA 2MMGA 4ASUA 1OH5A 2CEAA 3SFVA 2VH5R 5KDLA 3P32A 5DI3A 2JIZD 5BXQC 4P3YA 1FFHA 1XMSA 2HF8A 1SVLA 2UVQA 2XJ9A 3TSOA 4CEJB 3EPHA 3RRNA 2QBYB 1PVOA 2RGBA 1TAGA 3BK7A 1G18A 1LVGA 1R2QA 5CM9C 2ZREA 2FMXA 3LD9A 2A9KA 1DAEA 4OHXA 3TUZC 5LB2A 3PVSA 1II9A 1XTQA 3LBHA 3U3KA 4J0QA 3U60B 3DZ8A 3KL4A 4M1YA 4PQRA 3OESA 3RRYA 1L7VC 3LW8A 2GEVA 5K8IA 1Z08A 2XAUA 5FTNA 1G3UA 1NL3A 3VX4A 5JRJA 2OESA 1MV5A 4HEJA 1CBUA 5JI3E 1NSFA 1VDZA 3VR3A 1NLFA 2FSFA 1YZQA 1SQ5A 3BERA 2V9PA 3Q7QA 1N0VC 3I5YA 4GP7A 1SHZA 2PMKA 5IK2A 1Z63A 1P73A 2ZE7A 1G8PA 3KX2A 4WAUA 1GRQA 2ZRKA 4F7WA 5FOWA 3W6NA 1TQ4A 4AIIA 2G6BA 3TQCA 3PJRA 1GKUB 4AK9A 1E2MA 3ECCA 4HAXA 1VG1A 3N2IA 2GCOA 2BV3A 3Q5EA 4TMVA 1RJ9A 1H8HD 2ZU6A 2F43B 721PA 5JI2E 3A1WA 3LY5A 3MFYA 5DSZA 1RPZA 4AYWA 3QI2A 5JMTA 1QHSA 3SS8A 3VFDA 5DISB 3CZQA 1CS4C 1ZU4A 1R0WA 4LYJA 1BYUA 5H68A 1D6JA 2E87A 2AD5A 1Z0FA 1ZM3A 1ESMA 3KQHA 3B1WA 2FV8A 2DBYA 4QGFA 2WIBA 2FPLA 1IY0A 3NXSA 4Q7KA 3K0FB 4NZYA 3EC2A 3SBEA 4P4TA 2AKYA 2P5TB 4TL6A 3NH9A 1P2VA 3IPYA 1D9ZA 2VTKA 5HKKA 2VP6A 4DCNA 3C5HA 1QRAA 1U98A 2KB0A 1M34E 3K09C 5G3YA 1CULC 2XXAA 4D25A 2VIIA 2NZ8A 1FQKA 3HWSA 5LPNA 4X8LA 3FMIA 4HAZA 1W2GA 4LRWA 3GJ8A 3MRSA 5DGXA 3EC1A 4RZUA 2EVWX 2VF7A 5CK5A 2QPAA 1NBMD 2GAAA 2Q0HA 2PX3A 3QEOA 3CKLA 3LLUA 1E69A 4PPNA 1GITA 2WAXA 2ANCA 4Q5IA 3ADDA 4A8JA 4BRWA 1G64A 1GFIA 4OL0A 4M4SA 3KUDA 4NKRA 4U02A 4II7A 4JKIA 4JLDA 3A58B 1Q1BA 2O52A 3C4JA 4US2R 1IXZA 4PPGA 2FFHA 1GWNA 2PZGA 1IQPA 1GP2A 4L9SA 1ZM2A 4LJYA 5B30A 3AQ4A 4A15A 3THWA 3GJ4A 3I32A 5FOXA 4QNRA 2OUKA 3CBQA 4V0ME 1N0WA 1US8B 4ILEA 2DCUA 3BIFA 1ZC3A 4PHGA 4QNMA 1S96A 3OAAD 5L3VA 4EJSB 3PUVA 4DZZA 3RNLA 1U8YA 3MGCA 3THYB 2VHJA 4KODA 4ITRC 1AGRA 5DE3A 3D7MA 2AK3A 3AP1A 2J1LA 2QT0A 4QBFA 2GZHA 1OLOA 4EIWA 4FMBB 1JB1A 4R2IA 3TR5A 1CJMA 3FPAA 4ARZB 3LWNA 4GPTA 4MKHA 4DBLC 5KPJA 4OHVA 1FX0B 4GOJA 2B7BA 5FOSA 1KAOA 2A5YB 1OXVA 2H5EA 4U7DA 4RJLA 3IHWA 3DHWC 2REBA 2PEYA 4RD0A 4TLAA 2QN6A 5L3RA 4CZ2A 3CNNA 3CF0A 4MUAA 3A1TA 5KPDA 5CDFE 2GAOA 2J59A 2EFEB 4IRUB 4K8OA 3RYTC 1HE8B 3KUCA 1PZNA 2GXQA 2FZLA 1S9DA 4LBWA 3K0AB 2QT1A 2REXB 2G77B 1XWIA 3OEEA 4QJ3A 2Z5FA 5JWOA 4Q7LA 2ZYVX 4JL5A 4NYJQ 3OFNA 3QKTA 4HB3A 5BN5A 1Q22A 2JDIA 4L5BA 3KKOA 4IXNA 1X3SA 2WAYA 1U0JA 3TRFA 1DAKA 2GHIA 4B35A 1R5OA 4Q1AA 5FPYA 2OG2A 2ZVQX 2QAGC 2WWGA 1KIMA 1OYYA 1N6RA 2GESA 2ZPTX 2A30A 3HJNA 3H86A 4JLMA 1TU4A 2WIAA 2ZSDA 4Y0AA 1GUAA 1QVAA 2QI9C 3KQUA 2ZXUA 2IS2A 3RWMB 2OCYC 3RS3A 4HAUA 2YKGA 4HZIA 2H18A 1N5KA 1R5NA 1TUIA 5EP4A 3ZH9B 5DN6D 2AL7A 4C9BA 4TTPA 1FMLA 1KY3A 3T15A 4V0KA 3GLHE 3QG5A 1SGWA 3OIYA 3PIRA 1SVOA 4Z1MD 1MABB 3FHCB 1EFRD 1U8ZA 2R6DA 3QBTA 5JZVA 1XPUA 3M0EA 3WNCA 2QUZA 1XU4A 3QUSA 4MGKR 4LYHA 3KJGA 1TQ2A 3OIUA 4RD6A 4TLBA 3E5HA 5EP1A 2O0HA 2ZEJA 1KDPA 5FI1B 3OEED 5FL7D 1Q12A 4TMWA 4E09A 1VCNA 3WRYC 5LB4A 1N6HA 2GKSA 3K0FA 4HZUB 4JIMA 4BFUA 2CHVA 3B1VA 1EFHA 5A4JA 3SJBA 3GFTA 221PA 2FNAA 3I73A 4HUTA 4CRWB 5C4GB 4QJ5A 3R7WB 5TB5A 1N5IA 1W36B 2OFXA 3B60A 5EUMA 3VNUA 1JBKA 1KJZA 2WMNB 3KJIA 1G6OA 4IKEA 5H1YA 1Z83A 2R6AA 3DO6A 2GJSA 5BN3A 4LPKA 5BN4A 1F60A 2RGDA 4QBGB 3KQNA 1IY2A 2DY1A 1M7GA 1P9NA 1PUIA 1OFTA 3V4RA 3LAWA 1RIFA 4GP6A 2CCGA 4JT2A 3FHTA 1TU3A 1E2NA 1Q1ZA 4EKDA 4FD2A 3QG1A 2BHRA 2RMKA 3FE2A 5F2EA 2CNWD 5JECA 5K8LA 3TNFA 1MH1A 4NTZA 4WOPA 3AGPA 4Q4LA 3U5ZB 4TWZA 1Q57A 2RKOA 3IBGA 4US0R 5HPYB 3PEUA 1LS6A 1UFQA 1KI8A 1VG9B 1YJ5A 2DFNA 1W4AA 4PZLA 2OFOA 4OQNA 3Q5DA 4IOLA 1FOEB 3BAFA 3S1AA 4LJ9A 1G5PA 2BWJA 1PJRA 3SR0A 1F2TA 2WWHA 2H8KA 1ZCBA 3QBVA 1KZGB 3ND9A 3SQWA 2GEDA 1E3MA 2YWFA 2RGXA 1WE2A 1E0SA 3K9LA 4M9QA 1A7JA 4RSGA 4MGIR 4JVNA 4RVCA 4XD7D 2OCBA 2QMOA 4WW0A 2FE4A 2ZRCA 3VX3A 2QEQA 3DKPA 3NG1A 4DWJA 5B64A 1T9HA 1E2EA 3LW7A 2GJ8A 3P20A 1M7BA 5HR5A 1XZQA 1AZSC 4B44A 4YDHB 5KTYA 4M1WA 2R6CA 2FFBA 3AV0B 3DL0A 1XEWY 1F6BA 2ZU0C 4P0TA 4ASUD 3MAAC 1WB9A 2GK6A 4HAVA 3JVUA 3KKMA 1LY1A 1FNNA 2JLZA 2NIPA 2XEXA 4BRUA 2A5FA 5D3MA 1N6PA 3QQ5A 3PXGA 3LA6A 2IEZA 4KU4A 4ARZA 1SKYE 1Q1QA 2A2ZA 2YWHA 3IIMA 2PJRA 5G40A 3GP8A 4X8MA 2JLQA 3LQQA 2IYWA 4N0EA 1ODFA 2ANBA 1W4BA 2GBLA 2KSQA 2R65A 3WMEA 1AZTA 4C0JA 3R9XA 3RRZA 2OILA 1XP8A 2XNSA 3QXXA 1MO4A 1RKBA 3X2SA 5CB8A 1E1QA 3GCGA 5JEEA 3AUXA 2C95A 3W34A 2G83A 3NBXX 2Q9BA 3Q85A 1E1RA 4PFSA 1RZ3A 4EFLA 4TL7A 3ZZ0A 1MOZA 2Q21A 1J7KA 3CNLA 3W6OA 3CR8A 4B34A 1P2UA 1GRRA 3AVQA 4ZV4A 2AD1A 1T6NA 3RS5A 2ZI4A 3QY0A 3W5JA 2V6IA 2ONJA 1HQCA 1Z2AA 4P31A 2IYZA 4LV6A 1E2KA 1OFIA 2K5UA 2G0TA 3PEWA 1W36D 1XCGB 4PPQA 1IXRC 1OW3B 3O8CA 5KYKA 2ZI3A 4LJ7A 3TVDA 1E2LA 5L3SA 3R8FA 2P6RA 2B7CA 2AR7A 2JJ8A 3FDIA 4C0BA 3ZIAD 1NVWQ 3TW8B 4IVQA 4KI0A 3SHFA 3TUIC 3SOPA 1G8FA 3CLVA 4BLTA 4KV9A 1LV7A 2QAJA 5TDHA 3PUXA 3DM9B 2H57A 5SZHB 1P2TA 4XVUA 4AY2A 3PEYA 4HLDA 1J99A 2R2AA 2NTYC 1XMJA 2YINC 1QF9A 2SHKA 4URWR 1Z0IA 2R6GA 1A4RA 1QDEA 1V43A 1ZJ6A 2FN4A 3I72A 1NBMA 4PQYA 2V54A 4A0FA 2XXAB 1Z29A 4PAOA 2O8FA 1Q3HA 3KXLA 5DHFA 3SN6A 4RD1A 3E70C 2JASA 1M7HA 2I3BA 1HT2E 1N6IA 4BWYA 3B2EA 3C15C 2OAP1 5EXSA 2X77A 4TT3A 2KJQA 4ESVA 3WNDA 1IXSB 2OV2A 4NYMQ 2QE7A 2PCLA 5GVSA 4R71A 3CRVA 2EFDB 2JA1A 2VBCA 2ZUCA 4TSFA 2O8BB 3PENA 1NLYA 3Q8XB 2V3CC 3SYKA 4BFXA 1Y63A 1QVRA 4L9WA 3RRMA 2W83A 2GXSA 1OFHA 2OBNA 3OE7A 5JJIA 1OFUX 4ZI3A 2VP9A 3AKDA 2BBTA 2GETA 3HU2A 1AS2A 1UBGA 2FX3A 2WJJA 2WWIA 3KKNA 421PA 1OYWA 2O0JA 1GZSA 3BFKA 3AUYA 3LXXA 4PQFA 1II0A 3H2YA 5FUWA 1NLZA 2C98A 1UEJA 2Q9AA 2QSZA 1XPRA 3R20A 1VHLA 4LV5B 4FI3C 5KSOA 5FFMA 3ZVLA 1ZNWA 3AB3A 1TL7C 1XX6A 1Z6TA 3ZQ6A 3U44A 3QXSA 4X8OA 2ZROA 1S3GA 4YDSA 1E6CA 1KMHB 2E1RA 1TF5A 2J7PD 3KQKA 2ZVPX 3H4MA 2D62A 1E2JA 2OO7A 2OCPA 3ZVNA 1J8MF 1IN5A 4KYIB 4LI0A 5FUXA 1F48A 4DUGA 3ADCA 2RB4A 1QHHA 1Z0KA 4RKEA 1OKKD 1NRJB 1GL9B 4DCUA 2KBEA 4WZ6A 2VSOA 3KDSE 5FH9A 2D4HA 1Q0UA 4US1R 3ZJYA 1T91A 4Z8XA 3SJCA 2JEOA 3VHXA 3BB4A 1W36C 4P33A 3ZD6A 1UF9A 3QJYA 5TVKA 1U90A 1E79A 2KE5A 2UKDA 2GF9A 5EXPA 2O8BA 4PZZA 3UANA 2YC4C 4JLNA 1G3IA 2ZJ2A 2PX0A 4W5HA 1IN4A 1SVKA 3QKSA 5HKKD 2ZSBA 4ACBA 3A37A 3UXMA 1FUUA 4B43A 1YZUA 2IUSA 1XD2B 2W6JD 2N1BA 2FGJA 3F0TA 1HYQA 1Z5ZA 3SJZA 3TSWA 2IYTA 1XTJA 2EQBA 1DG1G 3IO3A 5J4LA 1JECA 1NKSA 1E96A 2RGCA 1AS0A 1KK2A 4LZZA 1M74A 4JVSB 2VHTA 2D74A 1WQ1R 4JVLA 4DCVA 1VG8A 1XJ0A 4IFEA 2F1HA 4JSYA 3FWYA 3X1WA 2FEMA 3QKRA 1D2MA 5SZJA 2VA8A 4HATA 4DRZA 3GLHA 1XJCA 4EJSA 1G7SA 2WHXA 5H8WA 1IN6A 2W2VA 5DI3B 1Q20A 4D6PA 4LC0A 5JWHA 3JZAA 2DWQA 3AEZA 2JLUA 1JAHA 3ZVMA 1ETUA 2QM7A 5DI9A 3MSXA 4I99A 5AJXA 3RS4A 1P7CA 2F7SA 2VSXA 1U9IA 4TYNA 3TMKA 3V4FA 2WKQA 3ND8A 3GLGB 1HQYE 2F9LA 4JS0A 4JJZA 4PTLA 1ELOA 3CF6R 4LX0A 4HLQB 1BYIA 2CCKA 1E9RA 3AKCA 3SDZA 3E1SA 3G82C 1S8FA 1NBME 2AWNA 4QM7A 1D2NA 2RGGA 3B1ZA 4IDPA 4TQ9A 4N1AA 2CE7A 1NJFA 2IYVA 2HLDD 3GLFB 1UKYA 3TLXA 2WM9B 4HAWA 1ZCAA 1K5DA 3I61A 4JLKA 2C04A 2BVNA 4AG6A 2R6FA 4QRHA 4UXHA 3SU8A 4M1OA 2YOHA 1G17A 2Q6TA 3U3JA 4OHZA 4KLZA 4AYXA 5FTMA 2H1LA 2A5DA 3BFXA 4E07A 4FN5A 1XTSA 2IT1A 4LPSA 3T5GA 1MKYA 2OEPA 3NEYA 1S1MA 2EYQA 2E9SA 4DLUA 4GFDA 4IOKA 2ODBA 4BFZA 2JLWA 4OI1A 1G7TA 2V7QD 4QFMA 4A9AA 3GD7A 1KI1A 4O25A 1OH8A 4YQFA 1Z8FA 3CRRA 3W90A 3H1TA 1FP7A 4DHEA 2HEIA 3CH5A 1T0HB 3AVTA 4C0QC 3OF5A 1RW4A 4POAA 1CJUC 4XVRA 3IQXA 3QE0A 2EFCB 4OQLA 1Z0AA 2OLJA 1S1CA 1NJGA 4P32A 4QBHA 3BH6A 3TQFA 1KI3A 4CIDA 4RFSA 1OXXK 1XEXA 1W0JD 1KO1A 4KHZA 4YMVA 1JJVA 3BS4A 4LOAA 2W58A 3CZPA 3K70B 3EPJA 4IVPA 3GJXC 1KNQA 3EARA 1HV8A 3SZRA 1KO4A 1KI6B 3DVLA 1XMVA 3EIQA 1ZNZA 2IYXA 4JMPA 5KO2A 1EFTA 4GNKA 5CJPA 4XWOA 5IHPA 4AURA 1XEFA 1ZIOA 4KITB 2ZETA 5K8TA 3TH5A 1RFLA 1N6NA 1UADA 2VLIA 4CVNA 2WV9A 4FINA 3B85A 4MQBA 5FPSA 2V4ZA 1TTTA 4MRSA 2VPPA 1K8RA 4H1VA 1U0LA 1RC8A 4MRPA 2PT7A 3I5XA 1IHUA 3GLIB 1CF4A 4NHOA 1E4YA 2QBYA 3AGQA 4AC9A 2IWHA 3I62A 4N3NA 1G19A 2ZRLA 4URXR 5J47A 1Q3TA 4EJSC 5EE1A 1II8B 1IONA 4B48A 4XVQA 3LXRA 4JLAA 1W47A 2Q3FA 4NPHA 3EPKA 2XB2A 2ECKA 3GLGA 2XNDA 3T1QA 4ESHA 1XJQA 3KXKA 2VO1A 4IOMA 5K8UA 4D0NA 4TMTA 4FMCB 3N2EA 1OH7A 2FFQA 3QF4B 4JSTA 1E4VA 3SBDA 5TV2A 4JBWA 3K1JA 3P1JA 3OIVA 2OSBA 4B32A 4MKIA 4HYYA 3UWKA 1NVUQ 2BBOA 1P2SA 2CBZA 5FTLA 1DO2A 3QF7A 1VECA 1YZGA 4WXPA 3U3MA 1ZMXA 5FUYA 1CJVC 3K0CA 1T8UA 2ZRAA 4G5QA 4OYHA 1R6BX 2QTHA 1R7RA 5FOVA 2I1VB 5C18A 4LJ6A 3EWSA 1L2TA 3SJAA 2IF0A 1KKLA 3AVPA 1JNYA 1VG0B 1Z47A 2IHYA 3UMRA 2H7VA 5CITA 2FG5A 2MSCB 4NE2A 3TKLA 5J4HA 2PCJA 1JQJC 3Q9LA 1E9CA 1XTKA 2ZRIA 3OEHA 4QGAA 4M1MA 2ZJ5A 4LHYA 3Q7PA 1WXQA 1ZNYA 1OV4A 4MRVA 5JS8A 3QKSB 2ZAOA 4DEXA 3AF2A 2QTFA 1XTRA 5DHAA 2WOJA 3SEAA 1MO5A 1KK1A 1M6NA 4GOKA 4LJ5A 3FHOA 4IDHA 4Q19A 1ZIPA 2ZYUX 5EE0A 4HDOB 4TT3D 3LX8A 4KYUA 4GI7A 4HUQB 4Y0VA 4OKSA 2OFWA 2NO6A 3P27A 1AKYA 1IY1A 1S3SA 2QL6A 2X1VA 2JATA 5G53C 2ZJAA 1Z6AA 3D6TB 4L4UA 3P26A 4LC1A 3VR5A 4BEBA 5HZHA 3U7FB 5AWFC 2EYUA 1CJTC 4XD7A 3KTAA 2Q3MA 1SHKA 2JJ1A 5F98A 1CJKC 2P5SA 2ZI7A 3EG5A 4B2LA 5JBQA 1N5LA 1E0JA 4DIEA 1SVWA 2OE2A 4XWKA 2YVUA 1UBEA 4A2PA 2IF2A 2GJKA 2TMKA 2DPXA 5EXTA 5JFGA 3T1OA 1TNDA 2WJVA 2ZJZA 1DO0A 2J7KA 4URUR 3QIAA 3WY9A 1UPTA 2FSHA 4U00A 4ZCIA 2ERXA 4PHTA 2QPTA 2KWIA 3KB1A 1E9BA 3EZ7A 4KLNA 1HT1E 2LWIA 5E7MA 3W8NA 1DADA 4B74A 2BKEA 4UXIA 2BEJA 3J81k 2QQ0A 4RFSB 4Q1EA 3THXA 4I1UA 4DUGD 5DLQC 4AKIA 1GIAA 5IDVA 1OIXA 4YC7A 4G5SA 5EXXA 1W49A 1GNQA 1JR3E 2ZRHA 1E1QD 121PA 1JPJA 1F2UA 1KMQA 5CIQA 1VPLA 3E2IA 4UJ3A 2GDJA 3DZDA 2CHGA 2WVJA 2BJVA 1E2IA 1XXHA 1CIPA 4HB0A 4QGGA 4LHXA 2QMHA 2EFGA 3CRQA 4NYJR 4TQAA 4TZ0A 2FEOA 2AKAB 5FOTA 5FR2A 2I4IA 4DSNA 1N3BA 1GM5A 5TY0A 2GCNA 4MRNA 4TMKA 3THWB 3TR0A 2P0EA 1AGPA 1CR0A 1GOTA 1IBRA 1LF0A 1WRBA 1OXTA 1D2EA 1W5SA 1DVRA 1VCIA 2QORA 1ZU5A 4AG5A 5JLJA 5E4FA 3IEVA 4G5RA 5ANRB 4DJTA 1N2CE 4DT1B 4NH0A 1VYVA 3ADKA 4L16A 2D7DA 5F3WB 3GFPA 5AK0A 2C9OA 3BFVA 4JBXA 4A8JB 4M22A 3LVQE 4NL4H 5JSZB 5EZ5A 1WA5A 1SXJC 2ORWA 1GL7A 2W0MA 3WHKA 1FTNA 1U2RA 3PR1A 4DXAA 3IIKA 2ZJYA 4DDWA 5FBQB 4URVR 1KDOA 4ZKDA 3GMTA 4GBMA 1S2MA 3LX5A 3A8TA 3V9PA 1E2FA 4JYCA 5F9FA 4CYMA 2WJGA 1ZC4A 3FKSD 4M21A 4TMZA 3A1SA 3NIBA 3U3OA 2W2XA 3DDCA 1OT3A 3WMFA 2FA9A 4DLWA 1Z06A 2HXSA 5D3MB 4BFSA 3AVUA 1CXZA 2OHFA 3R9WA 4P4SB 1C1YA 1KDRA 2FSIA
chains in the Genus database with same CATH superfamily
3GROA 3CVUA 1USUA 4EB8A 3FRJA 2E0IA 3G2NA 2ZJ1A 2C7VA 3K35A 4JUDX 4P4UA 1T9DA 2Q3CA 2WHYA 3GDWA 5HOQA 1S3IA 1SXIA 3RFCA 3K5IA 2O6LA 3HPRA 3RTBA 1GA6A 2NADA 1UXOA 2PZFA 4GI3A 4KH1A 3V7WA 3ZWAA 2TMYA 3BJRA 3JD0A 4MLCA 4PSKA 5LQAA 5LDHA 4YRAA 1HDGO 3N1UA 3EFEA 4RY2A 4FQ5A 1ZZGA 3JYLA 4MPRA 4UEOA 5EXDA 3ROKA 1BVRA 2PAAA 3TSZA 4Q3OA 4BNMA 3RHFA 1C50A 1KI7A 4EPTA 3RSOA 1C4XA 1L4KA 1H65A 1KGDA 4PN3A 1C8LA 1MB9A 2RI6A 1L5LA 3MUFA 5EL0A 4GEGA 3SXJA 5KX5A 2CZQA 5G41A 1E3IA 2V4MA 2MT9A 2OQ2A 5DKFA 2NP6A 3V6LA 3HSSA 2XTJA 3THXB 3TNYA 1E89A 1DMRA 3NYRA 1BA3A 3GX1A 4YRSA 3U44B 1JVBA 1CY1A 1ONOA 4TTIA 2XZOA 4RELA 1NGSA 3Q3JB 5EP3A 2P6OA 1D2AA 2JFYA 5SY9A 4E6PA 4M9SA 3S2FA 4UE3S 2V1XA 1NJ8A 3TZKA 2VTBB 2NAFA 2Q07A 4RYLA 4NCKA 1YJQA 4A4DA 2IHJA 1NW6A 1DARA 1LPMA 2AUTA 2P90A 4MXDA 2WW8A 4V0QA 5FTKA 1PEAA 3NV7A 3KZMA 4GXRA 4D8TA 5H4GA 1RKUA 3HDYA 3IERA 4WFIA 3FYUC 5DH9A 4QXPA 4YT8A 1SA0A 2C84A 4BLSA 1WR8A 4IO0A 5KJFA 1O9HA 1WZEA 4N6NA 1MFZA 4QD3A 1UDCA 2R60A 1DKNA 3ZNOA 2AMVA 5FL7A 2QKYA 2QVXX 2CNDA 1KNXA 3E27A 3H0CA 3SQNA 1T5LA 4WN3A 3J7AC 5H1YA 1B6RA 5KMGB 4DLXA 1NBIA 2GCIA 3R0QA 3D8HA 4CLEA 2GM9A 1DKOA 1M76A 4I0WB 3WBKA 3D59A 2AUMA 2ZBPA 2WTUA 2P9HA 2EGGA 4CMBA 1JDVA 1ZY2A 2ZYTX 3B7WA 4MP6A 2PA0A 3CZ9A 3D8NA 5EYPA 1ADCA 1JIVA 3JAWB 4BMYA 6REQB 2BFDB 3EVEA 2XI4A 1VP9A 1E9SA 3GHYA 3M1IA 4AJKA 1F0KA 3MTGA 4CDGA 4DMCA 2EP7A 3O94A 2RAFA 4EF6A 2R62A 4UTVA 1GUFA 2J3EA 1TVCA 4GGOA 4MR7B 3V8VA 2O3JA 3ZIDA 1JPNA 2M98A 3VU9B 4B4UA 1VLMA 1Y8QB 2WPDD 4OXIA 2FEPA 4GX2A 5FO0A 3DPUA 2RJOA 2RGNA 4AKEA 2GZ3A 1EK6A 2C96A 2GNAA 4S1WA 2W6JA 2PRSA 2ZTVA 3EGWA 3KKQA 4RTNA 3U61B 1L4GA 3EUEA 3IULA 2COUA 3GCZA 4IFIA 2V7GA 2I65A 4R40A 1DRVA 4YCDA 2J45A 3GGJA 1GQQA 1L7PA 1T5OA 1XFAA 5JATA 2XB6A 1N2CA 4KX5A 4A0QA 3G0HA 2C1EA 3NBFA 4HS9A 4AZ0B 4CG0A 1THTA 1SKYB 5DYGA 1Y6FA 2JNWA 2CE2X 3G7NA 3HXKA 2WTEA 3K6JA 4GVPA 3ZR4B 2VZ0A 4B3XA 2DH6A 5KSYA 2Z9DA 3KR0A 4RFVA 2O0KA 5GTDA 1SUEA 5IVIA 4IFTA 1UXHA 5FJJA 5LDGA 2Y67A 5T41A 1E66A 1I7LA 2OVBA 3T35A 1E3JA 1QGDA 4DSOA 3I1YA 2O8CA 2ZRPA 3GO4A 4MYHA 2G07A 4XRGA 3E23A 3L8ZA 4PYRA 5DHTA 3THOA 1Y6GA 1CZKA 4YK7A 4F38A 5AFSA 4KIJA 5A5DA 1ZG3A 3WSTA 4XH9B 2H3EA 4CT4B 1KO7A 3FZNA 3M9WA 4P5PA 3C74A 1EGHA 2XOKD 3ZV5A 4OI4A 2H59A 1R12A 3HR4A 1KEEB 1XZHA 4MI6A 1RI4A 4UFNA 5CNIA 5MGBA 2DR3A 4RLFA 2BL4A 2NUBA 4IXWA 5B58C 3MD9A 4FFLA 4ZKEA 1P75A 3VR2A 3D8BA 2HD4A 4P3NA 5F76A 2R8BA 2NZWA 2BJWA 1LQ2A 2G06A 2AOWA 2YFHA 4H77A 2ILTA 5JDIC 1RM5A 2EKQA 4UHKA 2AJ8A 2A59A 1EFVB 4DC9A 3RUPA 2PD3A 3TTUA 5HHTA 2JLVA 3LUPA 1QG2A 3FKQA 3GRCA 2NQTA 3BKWA 4QXOA 4S12A 4H1UA 3S1AB 2WFAA 1NMQA 4IDFA 1Q2UA 3RBAA 1ENYA 4NENB 3ZBPA 2X14A 5HJ2A 1D0IA 1NQAO 1Y9ZA 4K9SA 1B26A 2XUHA 3IX7A 4Q4AA 5FAXA 4ZOQI 2AE2A 2AOTB 1Z82A 2P7IA 1SVUA 4N9WA 1I9CA 2Q5FA 1X14A 2DXIA 3WLSA 3QOXA 6GPBA 1UC9A 1P7YA 4Z1MA 4RDIA 4EELA 2VTBA 4UCFA 5HF5A 4UEQA 5FP0A 4U39A 1AK2A 3VR1A 1UDXA 3L8FA 4I8XA 1DAGA 1J24A 4MYRA 3VRHA 4DA7A 2QP3A 2FB9A 2YS7A 4KVGA 3NIGB 4AQDA 3MVEA 4TS1A 4J0EA 5P21A 4FMCF 1NVDA 2CJFA 2G88A 1IWBB 1RPTA 4L72A 1L5KA 2C42A 1ND6A 3AFNA 2XRZA 4RGBA 4R2XA 3M5WA 1VJDA 1YZNA 3PC7A 1YS9A 5AICA 4GE3A 1MW8X 3G2KA 4POOA 621PA 2VYFA 1WMEA 4QKQA 4AO7A 3MJTA 5KQLA 1QHFA 2NNWB 3EVCA 5B57C 3K73O 3JQAD 2J4DA 4Q4JB 4OQYA 4NMMA 3PR3A 2IELA 4A2WA 1E5TA 1IXYA 4IUCS 3H9UA 4CIWA 2J0UA 3H4VA 2CHEA 4QUAA 3OIWA 4TS4A 2JGJA 3UGKA 3I23A 2E48A 4KOEC 1LI7A 4CIBA 4W5OA 3RU3A 1RM3A 2HI0A 2HV8A 5E1MA 5E3IA 4C0KA 4BGDA 1GPUA 1U80A 3MWDB 4AY5A 2DHRA 1OFUA 2PKWA 4BZPA 1CNMA 1NU6A 4U7JA 1RRGA 1ZGGA 2EJTA 5C8VA 1J0CA 5K0BA 4B3FX 3TK1A 1JWBB 1U6IA 2BR5A 4MV0A 5C32A 2CLDX 5DX8A 2IY9A 1H2HA 3FPEA 4Q82A 4HKTA 5JEDA 3GIWA 1NTOA 5GVRA 2O7SA 4WNYA 2G1KA 1DCKA 4FB5A 2O8FB 3WLNA 1LPBB 1OHHD 4TTVA 1MTOA 4EA9A 4CCAA 3M3PA 2GBFA 1Z5PA 3DCNA 2J3DA 5LU9A 2HK6A 1XZNA 5I5GA 2PS0A 3ZIUA 3ZZTA 1L4HA 5GZ3A 1WIWA 6ADHA 3CRZA 4DPMA 1KJJA 2HGSA 3JQAA 4EOGA 1RWQA 3T9BA 1HDEA 1QM5A 2I87A 2JGNA 1Q21A 1M1XB 4LXHA 2PZJA 2BUBA 3TW8A 1EBUA 4YMIA 1AF4A 5CVVA 1RHRA 2YY6A 4R8KA 3KWLA 1CNFA 5F33A 4NBWA 5EHQA 1GDTA 3NYWA 4OHYA 3D8TA 1IBMB 1AIPA 1UBCA 1B2LA 3LECA 4GZMA 5I7RA 4F5EA 1SBYA 1QYIA 3GW8A 4B2PA 2MSKA 3C3BA 2DWPA 1ZUNB 2PWYA 3LQ1A 4IIJA 1N1EA 5H5JA 4MAAA 4RPCA 3OCVA 5DBFA 5C1DA 3WGMA 2R3SA 5EPOA 1C7FA 2BM9A 1ULAA 3KOXA 1KRHA 1XJWA 5GONA 2HF2A 3W8RA 1PNVA 4WN9A 1PSDA 1K7XB 1XAIA 3W2TA 1UKAA 1Z5VA 2OZEA 4FPXA 3COPA 4NU0A 4GE0A 2JG3A 1NVAA 3I1FA 2HJGA 2Y77A 3I34X 4YI3A 5KJEA 4X0EA 4LFBB 5TS2A 1HOTA 2BEVA 3BX1A 3F3SA 3A2KA 1YRLA 2BBSA 4D2IA 3LYUA 4JL8A 4JXKA 4UEWA 4CDNA 4C2UA 1Y6RA 1JG7A 4LYFA 4NPCA 1FDSA 2O5VA 2I34A 4FQ8A 4BBJA 1FP2A 2JIZA 2LR0A 4X24A 1FFBA 2QD1A 3AFIA 1IQRA 3ILSA 2W9XA 1A4XA 5HDBB 1TK3A 1U8CB 5E0OA 1R9NA 3U40A 2ABWA 3MELA 2X1LA 1WU7A 2HU7A 2I2BA 3UC9A 3EOAI 4EX6A 5HDQA 5DIZA 4V0MA 3IOBA 4MR8A 2WBLC 5HBRA 1IK6A 2AJLI 2CD9A 1ENZA 1EVYA 3GAZA 3UFXA 3HADA 4TRNA 3ACDA 1TJ3A 1IOVA 4JR1A 1IVSA 1NOIA 2D5BA 4N54A 2NO9A 1Y8QA 3W4JA 3I8XA 4HR7A 4OSPA 3H6HA 2ZWMA 4RIFA 3SAJA 4DCCA 1ZJZA 4DA8A 4W7IA 5CAEB 4D5GA 2NO0A 4OLHA 4O4LB 2IV7A 4LSGA 1HZJA 1GZHB 4G26A 3EIEA 4AN1A 4D57A 2VHWA 2GH1A 2IP4A 2I66A 2NSLA 2QNBA 3FTNA 3GJYA 3GEHA 3NR2A 1A95A 4LWPA 4JVMA 4MB2A 4KWEA 2MYTA 3E9MA 3AB8A 4DQXA 2VZLA 4V1CB 1RI2A 4W82A 4W1RA 4AYTA 4BLVA 2ORYA 3FPCA 3H2KA 4J9UE 4C6SA 4RU1A 5E4JA 1JMVA 1QO0A 3NHMA 5BV2P 5AOCA 4AI6A 1UOQA 1P72A 3AONB 1MCZA 4HMQA 2O3SA 4TKVB 5TE9A 2F4NA 4V39A 4F8YA 3RDPA 2AZDA 2I99A 5EWJA 3EIHA 3CZCA 1MC4A 4URFA 4LW8A 3L49A 4W5JA 1M8GA 4UVHA 1I2BA 4KPUA 4NWIA 3SI7A 4E5DA 1CUUA 1BD4A 4LE1A 4M6WB 1KQ3A 1WZCA 4MQEA 4B3SB 1A2BA 1HK7A 4AMZA 2UZ1A 2JVKA 1P2GA 4TKUA 4UM7A 4B85A 5A1TA 1SOWA 1MOPA 5AUPB 1CR6A 4RMIA 4DLVA 4PCLA 2GEUA 1G8GA 3WDLA 5EWJB 2JEYA 5HQ3B 2ADFA 4EA6A 1GTRA 1E2QA 1M8FA 3CJTA 1WQ4A 4FMPA 1WVIA 3GWZA 1Y7HA 3R2JA 1B8OA 1VL5A 4QOSA 2NUAA 3HY3A 4ON9A 4TSFD 1T4MA 3H5AA 2HHJA 4IDEA 5JAIA 5H3LA 2P2CA 3FPFA 1V96A 1ZQ9A 5B4TA 1SCQA 2L0XA 3TEMA 1N77A 3K1TA 3ICEA 4IHKA 4Q47A 2Y8EA 3RFVA 1ONPA 2ENUA 1US8A 1BXRA 2JAWA 3AZQA 3EHDA 4M1SA 5BVHA 3T4UA 2XTNA 5LKAA 5AJVB 1Q15A 3QSYA 4E5MA 3CUYA 1U9IC 2YYAA 3NOVA 4JEIA 4MQ5A 2DFPA 5TGTA 3UHPA 5JHGB 8GPBA 1RXYA 1Z38A 1LJ8A 2LKCA 3B3FA 3ET5A 3HVIA 3I53A 3JWPA 2ZE5A 4PHFA 1N34B 1J8FA 2XE8A 2ZCUA 3CF4G 3T7TA 3VOSA 3WLAA 1C29B 1V16B 1Z68A 2XNHA 4CNQA 5IFLA 4FI3F 3GAMA 1ZVKA 3O92A 2IYFA 1NN3A 1R0XA 3GP3A 4QJBA 4IH9A 4WTOA 5J40A 4YRCA 1KJ9A 1FJXA 2PBFA 4ZAVA 5DJ5A 1M6HA 2C4WA 3U9LA 1E98A 2GF0A 3FAKA 4F4IA 4YO8A 1SG0A 1Q5PA 4ZIRA 5EIWA 1Z8DA 2HX1A 2C9ZA 5WRFA 5I01A 1A9XA 5AVWA 4C21A 4UHFA 4CM9D 2Z95A 3MWGA 1UBTS 4LS3A 3WLHA 1YBMA 1GGKA 4HY3A 2GA9A 3HU1A 3NASA 4I81A 2QJFA 4XQGA 3RIYA 4DQLA 4Z6KA 4QXRA 1QAOA 4Y7CA 2WV7A 4PYQA 5FOUA 3ZLBA 3WICA 3IQIX 2Z43A 5LLTA 4YRLA 2PAFA 2WJZB 3LBIA 3PFBA 2O19A 2RIRA 2ARKA 2VUTA 3ENVA 3VSCA 3TW0A 2W6ZA 2QA5A 1G291 1IUPA 3H16A 3DM5A 4PZUA 5I3ZA 3ENQA 1DIRA 2A92A 3THSA 4EKGA 3GBVA 4YAWA 4YJGA 3OFND 2B1RA 2C58A 2G3YA 2JRLA 3DAYA 3LPCA 4UTRA 1DC4A 2X8JB 2Z83A 4Q4DA 3S7ZA 4ZGWA 3AQIA 5TF0A 3TRIA 4IDBA 1R8XA 2YHUA 2XUIA 4YAFA 1JG3A 4AT1A 1JTVA 3E5RA 3H8SA 2Q3HA 2ZJBA 1I3LA 4KQMA 4CIXA 5IJZA 1W5TA 3UWPA 5MN6A 1KEKA 1ISMA 3HJBA 1JV2B 1LSSA 4YRRA 3H42B 1P0CA 5HE8A 5HUJA 1AKNA 4E5PA 5ARDA 1WBDA 2W6NA 3HO8A 3EVNA 5FPPA 3ZK7A 2QG6A 1ECFA 4FDAA 5EZSA 3H84A 2YC2C 4FFSA 2O54A 4PV7A 1XXHB 3F46A 5B6PA 4QDTA 3V7NA 4M8KA 3VC1A 4B81A 4HB2A 4BGUA 2R97A 3K0AA 2VP0A 3SP1A 1TTTA 2HNKA 3E8MA 1VHDA 4C7OA 1FNMA 2C5AA 3UQYS 1SUFA 1Z62A 2WD9A 4WCDA 1KQFA 4BASA 3AH8A 4Q1FA 4LY6A 5ALJA 5K7SA 2A1TS 3G85A 1XMPA 4M55A 4UVIA 4BFCA 4EO4A 2QGZA 4F2HA 5JRZA 1U2EA 1CZRA 4KMOA 4CEHB 2YJTD 4FJ0A 1H69A 1R0CA 2AG5A 2AYZA 2C9CA 4WBSA 1NFFA 5FOQA 2AIRA 1JR3D 4C2AA 4FZJA 2SECE 3JD2A 1CF2O 4U7TB 5H3HA 1ZI6A 2WI8A 3WLLA 4LY3A 4JP5A 2VEDA 1WMDA 4OG2A 3GJ7A 2EBFX 2R6ZA 3TOVA 1K4YA 4Q9LA 4Z51A 2KI5A 5EMNA 1QZXA 5IASA 3V1LA 3I5AA 2V3VA 3EVTA 3PHJA 1W8IA 2ZT5A 4URYR 1DGQA 3H8WA 1X7WA 2H16A 4F4HA 3LX6A 5A6SA 1P1IA 1KSJA 1Q44A 1X7XA 5EIBC 3U49A 5KNBA 2AN3A 3U4CA 3DQZA 5I3CA 3QMVA 4RPIA 1X8KA 3NGXA 4KLCA 2QX9A 3U6BA 3EWAA 3AVWA 3PHCA 1E60A 3G3EA 2IDKA 1DXQA 3WAJA 4AQ7A 1B8UA 5CIWA 1QKJA 1R18A 2B5WA 3CRNA 5A9TA 2EW8A 5LDDC 1YOBA 3DB2A 5HP4A 2M6KA 5C1OA 4FIDA 4HUJA 1WXHA 5CRIA 1LDGA 1N3IA 2O2XA 2D8MA 2XUOA 2WQ6A 3UUFA 4NE7A 1KZ7B 1E3LA 2QM0A 3EH1A 1H2ZA 4G25A 4KPUB 5HTOA 1NRXA 3B89A 3MS4A 2G71A 3NIWA 2GK4A 2DP4E 4OBEA 5BYBA 4FCTA 2B21A 3G0DA 3P5BA 3I37X 3D3EA 4MIOA 1IN8A 8LDHA 1N1GA 2ZUBA 5D85A 3SS9X 4BLRA 3HJGA 3RSFA 4BP1A 4V1CI 2PLWA 3QE3A 4ZI7A 2AI2A 1MB2A 4AULA 3A6PC 4Y9DA 1ZWLA 5LYYA 1IOWA 2C7GA 4LMAA 4WY5A 3NBZC 4QHSA 4LAFA 3RVNA 3UEOA 4PZDA 2BMDA 3B7GA 2XJ4A 4FE3A 4H7IA 1RLJA 1V3QE 1VPEA 3R5HA 4DPLA 1ZJYA 4OJMX 4YJKA 5G4LA 3T0IA 5KAMA 4RGYA 5TXGA 4Z3DA 5EHZA 5LYJF 2ZVJA 1JMYA 4IHJB 2QK4A 5FKJA 4CL0A 2ZK7A 1A04A 4BMVA 2R8XA 3RC2A 3KT6A 4AS2A 2IXAA 2JGAA 3KR2A 1ZVQA 4MWCA 5DDIP 4YYEA 3WJAA 1JKFA 4BXOA 1FX1A 2GNOA 1RXEA 3TJZA 3UKDA 4B73A 1PBTA 4HZUA 1G0OA 4H2DA 5IXJA 3BC1A 2ACKA 1KBQA 1H2WA 1RJEA 2PM8A 1HBJA 1PT9A 1Z88A 4QPJC 5CX1B 5EKDA 3RSZA 3HBAA 3KALA 2A67A 5TQJA 4YP1A 2ZSIA 5JXJA 4NG5A 4FHEA 3D6FA 4GZ6A 3S1SA 3PFHA 2XMCA 4PBTA 2P1RA 4AP9A 1RM4A 1GLVA 3V2HA 2ZR0A 4G0MA 3IQHX 4KFRA 5IJ0A 1VXOA 3G9QA 1O8CA 5KTNA 3GDFA 1V5GA 4EI9A 5B3JA 5GINE 4H35A 1W85A 1HTTA 4LJSA 2ZPAA 5EJ5A 5A1JA 1Y1PA 3I0ZA 3QMPA 3UAOA 2BISA 3I83A 3ANSA 4A0HA 1HTWA 1U02A 1V95A 3H9JA 4AWXA 2FWJA 2CV1A 1MLDA 1ZUWA 4Z4GA 3VNAA 5IVPA 1MRZA 4RDXA 1OROA 4C78A 4G5HA 3L07A 3VR6A 2H0RA 2I2DA 5FWYB 2C3OA 1G7RA 2Q4TA 4L8GA 4BZQA 3RGWS 3A05A 4K9RA 5ELXA 2BTOA 4J7UA 4BJ3A 5T8KC 4EB6A 1RWKA 2OYSA 3OZSA 5EMKA 2ETXA 3WQBA 4BRZA 4CTMA 1AMNA 1DEKA 5ALWA 5C1BA 2LIVA 2CSUA 1PG2A 2UVPA 3VNBA 3VZBA 3ZCTA 4EHDA 2W6OA 1E0KA 3GVCA 5M29A 4LDAA 4WKPA 4YJ2B 3TTWA 3LFTA 3TE6A 3R6TA 5EGSA 4O2LA 5H02A 2NU7B 2FUG6 3JARB 3U1TA 4ENPA 4QT4A 3Q2KA 1YRYE 1W88B 4KTVE 3ZI0A 1XTTA 1NU8A 4ZT5A 2GBCA 1DFHA 1T9CA 3MAJA 2X8JA 2II6A 4W99A 1M2VB 3K0EA 1SB8A 2NW6A 1TPYA 1KOFA 2LXNA 2A1UA 1XTVA 2VTVA 2Z09A 3HA5A 3HZRA 3SSAA 3TVYA 1SPXA 3FI0A 3NDPA 4OHOA 3SFZA 3ERCA 5LFAA 2BLLA 3L8YA 4F56A 4KXQA 2HYIC 2A14A 3U5TA 2F9FA 3ULKA 3O93A 4MW7A 5SV2A 1SKQA 2VJMB 1VRVA 5TC4A 5CB6A 2Y0EA 2OK8A 5I7FA 1OH6A 2I3DA 4OHRA 2CXXA 2FP4B 4E31A 4U3JA 1NHWA 2R1TB 1KMCA 3OZBA 1TMKA 5KSZA 1CRPA 4JT4A 4U6SA 1QK4A 1MQSA 5CM8B 3E7PA 3ANYB 4EJ2A 4GT1A 1T9GS 3QKRB 3HKDB 4ETIA 1NXQA 2GYUA 2WM8A 5MGNA 3CR7A 3GAFA 3WKEA 4JXZA 4KE7A 2D0IA 1DS6A 3JZDA 3OOWA 3PXUA 2C3PA 2X2EA 4MKFA 5LMZA 1GA4A 5BUQA 3VAAA 1AK9A 1QZZA 2IYYA 2WNSA 3HCNA 4XLLA 4P5DA 3E3LA 1TI7A 5A3VA 7YASA 4ZV7A 3RSCA 5IK2D 2B61A 2ZE6A 3EDMA 3AR4A 2YJGA 3MBIA 2GHQA 4IOJA 4FCWA 1FRFS 2QW8A 2HUPA 4GPAA 1FU7A 1U2DA 2EZ9A 3CQ9A 4NCXA 3N05A 4LGYA 2UU9B 3M6LA 2CLOB 1QGAA 4WY8A 3N8GA 2AFVA 1Z13A 4S35A 4HGQA 3VR4A 3N76A 4FCCA 5FR1A 3VVMA 3WG9A 2OBMA 2PUBA 5EMHA 5LQRA 4KQJA 1GPJA 2A7XA 1RAIA 1GTMA 1V4BA 3MG9A 1GR0A 2Z2IA 3H18A 3PCXA 3PI7A 1Y1KE 1TUEA 3SJ7A 2O8CB 1CZHA 2H07A 3NCTA 1VYHA 4YNBA 1B0ZA 4MDFA 2AG6A 3NMUF 4FSHA 1RCTE 4DGSA 2IYAA 4KV7A 3L6RA 4YQZA 4B3DA 4BQFA 4Z1OA 1UJ2A 5K5EA 4KNWA 4M88A 4TV8A 1R6AA 1L5SA 3CIFA 5D5PA 4ZA2A 2ZRJA 3HR7A 1XZKA 4X1KA 4HDNA 3F73A 2QHXA 2YXBA 3LKZA 3URKA 5FLXA 1N33B 1E0AA 4XGQA 2ONCA 2BGKA 4UM8B 4XB2A 4BVGA 4QBIA 5JAMA 5JY1A 1EX7A 1R9JA 2Y0CA 3JVEA 8ADHA 1E3DA 2F6RA 2W2KB 3HBLA 1Y0BA 2XUKA 5GOTA 4K6HA 3PUKA 4UREA 5D2CA 4YV7A 1QIKA 2YFQA 3QX9A 3ZVKA 1GZUA 4A23A 2QVGA 3AERA 1EVZA 4IPTA 3W05A 1TW3A 3W77A 1U4OA 3OE7D 4KIWA 1FXWF 2J9YB 3EASA 1HURA 2R8EA 4KUHA 3W1EA 3EPRA 4F1WA 1J1UA 3WBFA 4DZRA 2MJLA 5AUOB 2OKGA 1QE0A 1WBJB 5BWLA 4BPBA 3WISA 3T34A 4QBTA 3H5LA 4FW9A 3MC1A 3T7JA 3K9CA 3L4BA 3X2EA 4CMIA 4ZCSA 4GZLA 1K6EA 3NX4A 3BWBA 1GYPA 3RLFA 2RH4A 1VCOA 4EYOA 2PKQP 1T36A 2BE7A 3KSRA 3IEUA 2XIJA 2COEA 3EIXA 3D6HA 3GC6A 3D43A 1ZRHA 2NT3A 4C7VA 1ZNQO 1KQGA 3NVMB 4BNJA 3PQ5A 4YMHA 5E9QA 3KE9A 2Q5OA 3AKYA 5EZ6B 1XD8A 1DAMA 1LTHR 4FYWA 3CRMA 1UQTA 5I8WA 2ATCA 1PNTA 4O08A 1XQYA 2ODPA 4L4XA 1VE7A 1XKXA 4IFBA 3CVVA 3D1JA 3QFSA 4MLZA 1NLUA 3ZQUA 4DV2B 3ZGZA 1UIRA 1PQWA 4PGHA 3TLZA 2ODEA 4KQCA 2I3ZA 2B34A 2YFYA 3PD7A 4FR0A 4DBLE 2BI4A 4G0NA 4BNDA 3GGGA 3RREA 1F4LA 2FFAA 2I33A 1OYVA 2LIPA 3B6IA 3A11A 3ANMA 4N3BA 3VHLB 4D9HA 3ITKA 1M5RA 3JQBC 1EQAA 1WP4A 3MTEA 4K28A 3AJ8A 3QE4A 1H94A 1H05A 2GD2A 4BWVA 2YHIA 4R6XA 3NTVA 4EMTA 1AU9A 1B41A 4Z7QB 4EUFA 5IEBA 2V4UA 1J09A 4J0GA 2VK2A 2J31A 4CIYA 1L3IA 4TTSA 2EKPA 4ND5A 4WX2B 1NZFA 5FPQA 2OM2A 4EZEA 4L5JA 3U7IA 3QLUA 3KFVA 1PK7A 4G5OA 1E2HA 2BEUA 3CXRA 4GKAA 4K46A 2DSNA 1EESA 1Z6GA 1XQWA 2XWJI 3I2JA 1BRMA 5JH7F 3SJUA 4GDFA 1TDJA 1NY6A 2A9FA 1GDHA 2GA8A 3B3AA 3GXOA 3IAHA 3IGFA 3TD2A 3TZCA 3B8EA 4YPFA 1PFVA 4N3GA 2MHCA 4J0CA 3C3PA 3NW9A 3BE8A 4I1RA 5LOVA 1GKYA 1JYSA 1JAYA 2IXGA 2RHGB 2VUIB 3LDAA 4AMUA 3TQHA 3PGKA 1ORDA 1X1RA 3M4ZA 4NULA 4ZARA 3S4YA 4EA8A 1VJRA 3B5IA 4B31A 2CHQA 2Z2KA 1P7WA 2BHNA 5JOQA 3M4YA 2PH7A 4D99A 2IHTA 2HCBA 3MJSA 3IR6A 3KTOA 1V7CA 1V6CA 2NSHA 2EZUA 5DNDA 4IUBS 3RAJA 1JHOA 2FN3A 3TAHA 1T3SA 4OJQA 1KEUA 5C51B 1YI1A 2XD9A 1D6SA 1XVTA 3PFWO 3KCQA 4I3FA 1GYQA 3NETA 3LT1A 1LRJA 3BJZA 1XRQA 4I3GA 1AUVA 3VDXA 1JEAA 4A6EA 3L1HA 4CKEA 2F3QA 3B13B 1HZZC 3OICA 1EX6A 3EFOB 1L8AA 3USZA 3TZEA 2ZB3A 2XWQA 1OZFA 3HJAA 5CA0B 1ISJA 4Z5XA 1D1PA 1AZLA 1NN1A 4MVJD 2GVDC 1L4EA 3ETGA 1JA1A 4KIFA 4Q37A 5FNVB 5CH3A 1Z22A 3BQMB 4L1KA 1NBHA 1Z5UA 5I6DA 5DNCA 1OWOA 1KMNA 3IKJA 2RCYA 4MI1A 3TZ6A 4Q4CA 3I39X 3GFFA 1DJNA 1FFDA 3AESA 4L22A 1KRXA 2W93A 3OCCA 4ZYZA 2RHCA 1FNBA 3DDOA 4YDRA 4D8VA 1FFGA 4LBVA 1H2BA 1UZNA 5CLQA 4F8EA 5BW4A 4DQDA 2EW1A 4LOLA 2C94A 3KAQA 5CHYA 4DR3B 1O6ZA 1RP7A 1NYTA 3O7MA 1ODCA 3ONDA 4E94A 1RTKA 1Z35A 3G79A 5GOZA 2KLHA 3HXLA 3ZS8A 4WCFB 3WK7A 2IHNA 2FRVA 2YYSA 1ECJA 3I6QA 4DKXA 5F7OA 5MF6A 1QDUA 4E0BA 5A62A 2QR2A 1HY3A 5SY4A 2AW5A 1CP2A 1S02A 1U81A 4PRYA 1NW9B 2BCJQ 2EERA 2PJZA 3D3NA 3ONWA 2ECPA 2FCAA 2O2EA 2PJUA 3ESAA 4G1MB 2NXEA 4MQLA 5K0ZA 4CKZA 3DOCA 1RXVA 1J4AA 4UHDA 5JXIA 2WIGA 3L4BC 4IHQA 2W6MA 2IZ1A 4LZLA 3NJ8A 4S1TA 2OWDA 4XPZA 3ABSB 1C3JA 1P4RA 3FDZA 1O97C 2CL0X 3P97A 5GJCA 4A2QA 2Z2JA 3OPXA 2CFTA 1QPGA 3DNMA 3NFRA 1ZMTA 4EW3A 4N12A 1AGYA 3DMYA 3QFCA 1E7YA 2J4FA 1NBWB 4GSYA 2W43A 3CLTC 3LL4A 4XVHA 3OH8A 5C7OO 2AKEA 2W6IA 4N3CA 5BSUA 2BFCA 4YRZA 1ZP6A 4NBKA 4CR6A 2XOKA 2XZLA 3EF0A 3LCCA 4D9NA 2GGSA 1BRTA 2YXNA 1ULBA 4O8ZA 1MOSA 2WUFA 3C7KA 1U0TA 3PFKA 5E6UB 3RTAA 3VTKA 1CK4A 3D4IA 4UOZA 5KYYA 3DE5X 3NONA 1W1WA 1XZEA 1DKQA 3AJAA 4OX9Y 2C83A 3WL5A 2O8DA 1QCZA 4KNVA 3CIOA 3TTVA 3ITDA 4K2AA 4S2UA 1SA0B 3CVYA 5CDFA 3SR3A 3BKXA 4BOYA 2V9ZA 4LV8B 1IEVA 4PSAA 4X7MA 5EZYB 3TRHA 3WLFA 4BFLA 4CMGA 2C99A 4XSGA 5ITVA 1HNZB 3KZOA 2FZEA 2QX4A 1YUBA 2F1IA 3A7DA 1NUAA 3FWNA 2VPWA 1TVKB 4PC1A 4OQMA 2OGSA 3C7AA 2RI1A 3Q0TA 2GKGA 2AN9A 3D3QA 3KWFA 4LHVA 3VV2A 5BSVA 4PS0A 4Q1CA 3C3CA 1FTYA 5DNWA 1F51E 2WIKA 1W0CA 4D46A 2VDOB 2ZIAA 4FLMA 1KFEB 5CA1F 4YDQA 3E3MA 3L06A 1TTPB 4JJ4A 4PXAA 3FZEA 4L15A 4R54A 4XR9A 1XK6A 1R9GA 4Y6QA 2YZ2A 3FB4A 3BCSA 3ZY6A 4E4RA 3PA8A 4YMTA 2BKVA 2QROA 2CKMA 4NV1A 4RH0A 2O0LA 4JLPA 5BNFA 4A36A 1FZQA 4BAZA 4I4CA 5BQ5A 1MN6A 1EG7A 3FG9A 1J9EA 3AO0B 3COYA 4IEFB 2BEWB 3GUCA 5CDYA 3COVA 2G5PA 4J2OA 2PZMA 3C3XA 3B9PA 3EVZA 2HJVA 4KBYA 1QYRA 4I8IA 1P62B 3LXMA 4FWIB 2X9LA 5D1NA 5ITWA 3IP1A 3UAVA 1YVRA 3D8RA 1VCMA 4MPTA 2QXTA 3CUTA 4C20A 3WAGA 1QFJA 2F59A 5L45A 1ZIDA 2D2FA 3PRKE 2I67A 3I6IA 4YBRA 1TGVA 2YOGA 5FNVA 2Q3EA 3SE0A 1HG1A 3HXPA 4OV6B 1UINA 3KJHA 4R98A 3V33A 1FCJA 5AKZA 2GD0A 5B12A 3P2YA 3V2UA 4X7RA 5C2JB 5H70A 5LM3A 2GCGA 3ZGOA 3BSYA 5FWAA 3F2VA 2BBWA 3T7AA 1NP3A 1EFLA 2BDUA 3C43A 1A0OA 1J00A 5BSRA 4YAIA 3NHBA 3DOEA 4GM4A 3KYCA 5DO9A 3BPSA 4YJ2F 4MUYA 1EA5A 2QU8A 4N8EA 5TARA 3USES 3JY6A 3W2GA 4G97A 3HXTA 5KTKA 3BD8A 2I6FA 2FWRA 4Z0PA 5K0LA 1TF2A 2NU8A 3AF1A 4RTPA 2XYRA 1SXJE 1Y33E 2QUKA 4HWSA 1KOLA 1T8TA 2AFIB 2E4YA 4H0CA 2V8OA 4NBSA 1MG0A 2JFHA 5EMJA 4OKIA 3W6ZA 2QD3A 3GLIA 5AJWA 2IA5A 5KX5F 4Q4HA 5T4BA 1KMHA 1SVSA 3AR8A 4AXBA 1OD6A 3TAXA 4XJTA 4ENQA 4NX2A 3MJFA 3EJWA 1FSPA 2YWGA 4YONB 4WXEA 2J33A 2KW5A 3O8RA 3IXQA 3I28A 1JEQA 1LC0A 1QONA 5GM1A 3MWYW 1O97D 3KT3A 1AY0A 1GTZA 2WSYB 1MHPA 2IHBA 1J0EA 1DOZA 5F5NA 3M33A 1L7XA 3T3DA 4FGSA 1EWVA 3QJ5A 2FQQA 521PA 4K03A 4OOEA 3ESRA 1TYCA 2XNJA 5EMMA 2VJYA 1VHTA 1BGWA 3UTCA 1P91A 2XA2A 3OP1A 1N5MA 2J30A 2VT2A 5SZKB 1ODLA 1EHCA 1X86B 4OH7A 1J49A 4HXGA 4L50A 2E4XA 3ROGA 1P9WA 1XRLA 3CNOA 3KETA 1T4GA 1BXGB 1EDEA 2QTTA 3PLRA 1XRNA 4PAMA 2A3NA 2PD6A 3UW1A 7AT1A 4WLNA 1R0SA 4OMUA 3S44A 4D9EA 1G8YA 3KPVA 5AK6A 1QOQB 3C8ZA 1R10A 3FWZA 4UBKA 2R1VA 2C2GA 3ON5A 1QGOA 2QTVA 5JSHA 1UBFA 2XQIA 1JEYA 4L8WB 1NPDA 4AJ1A 3ZZNA 3AVOA 2CYCA 5TT0A 3HCBA 2EP5A 4MSUA 2XVYA 4W8GA 1DKLA 2VRWA 2ZRDA 3ECAA 3EY4A 2OQVA 3DL4A 1MC8A 5L3QA 2EX4A 2Q4DA 4CHTA 5HEKA 1AN0A 1D7OA 2QM8A 3LLMA 4QXAA 1VIVA 1BOFA 2MMGA 1W4ZA 4ASUA 1OH5A 2HRDA 3RV4A 1QVZA 2X5KO 1LWNA 1BXKA 2PUVA 5T7BA 1L7EA 3HQ4O 3KQQA 4P81A 1XMSA 4CEJB 1TA9A 4OPMA 1L4FA 5CURA 2QBYB 3BEDA 3M34A 1R2QA 2FPPB 2ZREA 2OV8A 4HQFA 4QEKA 3GJQA 1Z17A 4YLYA 4B4WA 4JT8A 5L6LB 3DTNA 4OHXA 5KNLA 3OBBA 1K3FA 2JK0A 1OXBB 3C7TA 1II9A 1MX3A 1QOZA 1TOAA 4MA0A 3LBHA 3VUEA 3WTCA 4EY4A 1Y3HA 3G2IA 4J0QA 4MQEB 1QFSA 3SLRA 4YCJA 1L7VC 2JCBA 5K8IA 3B48A 3B1JA 5CW1A 1G3UA 4RENA 5AI6A 1NL3A 3TPZA 3CEHA 3DLTA 3VX4A 3GRKA 4DDHA 3JQPA 2FRDC 1SO8A 2XLBA 4HEJA 4U4AA 1VDZA 2J3JA 4HQ0A 1XMXA 2BEWA 2FSFA 1SQ5A 2X41A 4U5QA 5FA6A 1Z33A 2DU8A 1SHZA 2PMKA 1KDVA 4HH0A 4PY2A 3Q0IA 1X9IA 3ROEA 5EJ6A 3OTIA 5ALVA 2JFBA 3DE0X 3PJGA 4HXEB 4WZZA 2H9AA 2BGRA 4BV8A 4F7WA 3W6NA 3NHRA 1TQ4A 4C4SA 4EQZA 1JHQA 2G6BA 3TQCA 2VJOA 3EWIA 3OSZA 2J3MA 1FE8A 1GKUB 4HLNA 5HA5A 2H4XA 3ECCA 3TIVA 4YUXA 4OU5A 4XCQA 4YB8A 2UUBB 2BV3A 3SSOA 1J8DA