1G3MA

Crystal structure of human estrogen sulfotransferase in complex with in-active cofactor pap and 3,5,3',5'-tetrachloro-biphenyl-4,4'-diol
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
290
structure length
290
Chain Sequence
SELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of a hydroxylated polychlorinated biphenyl (OH-PCB) bound to the catalytic estrogen binding site of human estrogen sulfotransferase.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords ESTROGEN SULFOTRANSFERASE
total genus 111
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 2000-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g3mA00
2H18A 1YU9A 2WJGA 1Z63A 2OEPA 2V3CC 1XPUA 2RB4A 2RH5A 3GFOA 4BLPA 1CJUC 4G5SA 3TRFA 3KKOA 2HV8A 2ZJ2A 1YR9A 1L8QA 5HTKA 1E79D 3WMFA 2ZE6A 4CT5A 3LAWA 2O8CA 4PHTA 2DWQA 2F9MA 5FTLA 1ZYUA 1L2TA 5LB2A 3ASZA 4PANA 1NP6A 2ORWA 3LD9A 3AVOA 3AGPA 4MITA 5FOSA 3UWKA 1NMXA 4TLAA 3FGNA 5EJEA 1KO1A 2E87A 3KQHA 4M22A 5GVSA 3B2EA 2F1IA 2OO7A 1BO6A 5DH9A 4Z1MA 1ZW6A 3O8RA 1Q57A 1D2NA 1EK0A 2H8KA 1CU1A 3OAAD 4HUQA 3ZH9B 5FBVB 3E1SA 4Q9LA 1G6OA 2Z4SA 4AK9A 1E9AA 1YZGA 4B6FA 4YMUA 3FMFA 1ESNA 5B30A 2IYXA 1G20E 3WNBA 2GILA 4HDCA 1E9SA 4ZCMA 4NCJA 2YZ2A 5TXGA 3K9HA 2AFHE 2OLKA 4NONA 4QHSA 4P4SA 4URWR 1YJ5A 2A3RA 1SVOA 2BBOA 5EE1A 2HXSA 4QG7A 2FPLA 2R65A 4NCIA 1L4YA 1LV7A 2ZREA 3QIAA 5JEEA 4BFZA 2ATXA 3BK7A 3I5XA 3FE2A 1OH5A 4KFRA 4QBFA 2PMKA 1HYQA 2BBWA 1E3MA 1PUJA 3ICEA 1K5GA 3CF0A 1UBFA 2XB2A 2EYUA 2AX4A 2CLDX 1P4SA 4JL5A 1BMFA 4R2HA 5EUQB 4DJTA 5CM8B 4DSNA 2G9NA 3R9XA 4JBWA 3H86A 2P65A 1Q21A 2VTKA 3B1XA 5JSZB 2HJGA 3HPRA 1GWNA 1W0KA 3ZZUA 1WCV1 3RC8A 4LJ9A 4YXWD 5D3QA 3V9PA 1D8TA 3E5HA 3ZIAA 2IEYA 4LJ4A 1GL7A 1E9BA 2G1KA 2MSCB 1S9HA 1GUAA 4M21A 3GJ4A 3GJ6A 2NZ8A 2ZRPA 2WOOA 3OZXA 4DLSA 2VPPA 5IF9A 1TQ2A 4M9XA 2VSOA 4EFLA 2WKRA 3T1OA 1E79A 3THYA 1YVDA 2ZANA 3FFAA 2ZSFA 3SC3A 3FHOA 1FFHA 4MDFA 4DKXA 2B21A 1GG2A 1W4AA 4ARZA 4EJSC 4EIWA 3OIWA 1VPLA 4D26A 1TQ4A 5FH9A 4FMDF 3SDZA 3ZVLA 2XXAB 1XEXB 2CCJA 2WWHA 5CK5A 4JT2A 4D80A 1DADA 5KUTA 4MRSA 1OFUX 4CW7A 2WSSA 1NI3A 1QHNA 2V6IA 3KXIA 1E2NA 1QZXA 1SXJB 2FSFA 4LV5B 4YDHB 5FBQB 1OXUA 4DSTA 4RZ2A 3BORA 1DO2A 5JHGB 5P21A 1NN5A 4BASA 1GFIA 1YZKA 2ZRHA 1F6BA 1KNXA 1RIFA 4OJKA 4LDJA 2GJKA 4YMWA 3A1UA 3P4YA 3VX4A 4JLNA 1OB2A 1KY3A 2ANBA 3R9WA 1VMAA 3EIHA 4TZ0A 4BFXA 2HT6A 4NYJQ 2GBLC 4D0GA 3RS4A 4QOSA 1T0HB 3GJXC 4B3GA 3HYTA 2IYZA 3RWMB 1T3HA 2QROA 8OHMA 2OCPA 4CEHA 1G8PA 2OBLA 5JBQA 4BFVA 4KBGA 3HPQA 4HB2A 4KI0A 1F3OA 4DRZA 2GEVA 4JZKA 4PAOA 1D5CA 1R8QA 4V0MA 1B23P 1ESMA 4POAA 2ZRJA 5GJVC 1IOZA 1G17A 2JLQA 4JMPA 1GRRA 3EZ6A 5HKKA 1KZGB 1Z5ZA 2D74A 3WNDA 3QI2A 2HT1A 3RDPA 1COWD 4O3MA 4YQFA 1KYIA 2QMOA 3EA0A 4ZCLA 3X1ZA 2OCYC 2Z4RA 2H7VA 2QMUA 3CNOA 3I4LA 3T1TA 5L3SA 4GOKA 4TMWA 1P60A 2XEXA 1T91A 3FKSA 4HUQB 4NMMA 3LLMA 3AP1A 3TAHA 3W6NA 3VKGA 4TSFA 4URXR 3K0AB 5FOTA 2KJQA 3PUYA 1U9IC 1PJRA 3K0FB 5L3RA 1N6LA 1A4RA 5DO9A 1MABA 2IXGA 2J41A 2NOAA 3CM0A 3OEED 4LC1A 1DTSA 4AKHA 1VHLA 3IILA 4NKRA 5UKDA 3W5JA 3FTQA 3CNNA 2BMDA 2P2LA 5KDDA 5FTKA 4FMCB 5G40A 1I4TD 1M8PA 3TH5A 5L3SB 1W1WA 2IYLD 4C7OA 2JEOA 2R8RA 2XX3A 1ZRHA 3R8CA 4GP7A 2ZUDA 3D8BA 4M9ZA 1A82A 3RS3A 4LUCA 1E1QA 1QHXA 4KO8A 3HU1A 2OSBA 1KMHB 4JKYA 1NMYA 4Q7KA 2CEAA 1M34E 2QMEA 3IEUA 2N46A 3SBDA 2QENA 2CXXA 3GQBA 4C3ZA 2D7DA 1CULC 1AN0A 4IDPA 2GZDA 3AF0A 4KCGA 2WKPA 3WP1B 2IWRA 1B0UA 4P32A 4TMXA 1TF5A 1FPMA 3PV0A 3GLHE 3GLIB 2ZRCA 1NN0A 4PZLA 1X1SA 5AK0A 2FEMA 5CITA 3MWLA 2HUPA 4QJ5A 2QTVB 2ZYTX 3DL0A 4MUBA 1UBEA 3ADKA 1NBMD 4BE7B 1IM2A 2ZS7A 2DFKB 2B6HA 4ZPXA 3BWDD 5C1BA 2GKSA 2VBCA 1T5LA 5HZHA 3ZQ6A 3A4LA 1XJQA 3KKMA 1TNDA 5A5GA 1KAGA 3U7EB 1XD2A 3UG6A 2Z0MA 4QNMA 4B73A 4D4MA 4TL8A 3MLEA 4YMSA 5KTYA 4GT1A 3KX2A 1KO5A 2FJUA 1IN7A 2CL6X 3DKVA 3PQCA 1KJYA 2OG2A 4R7ZA 3U3OA 3M4YA 2YWHA 3CH5A 4MKIA 4PFSA 2G83A 3ZVRA 2QP3A 1RYHA 1OT3A 1WA5A 1ZMXA 3CNLA 4DXAA 1AQYA 1Z6XA 4TLEA 5DI3A 4NCKA 2W58A 3REFA 1M2OB 3WMGA 4ZDKA 4BLSA 3DOFA 5DN6A 4ACBA 5H8WA 2QE7A 4L9WA 5JI2E 4OI2A 1HE1C 2P6NA 4AI6A 2XTMA 4D4JA 2YWEA 2ZI4A 4PHFA 4I1UA 4QGGA 3CW2A 4IEIA 3I8SA 3T5DA 1T4GA 2GJ8A 3ND9A 3PJRA 2ZSEA 3PVSA 2ZJZA 1JNYA 2VP6A 3EW9A 4YMTA 2XSZA 2W6IA 1MT0A 3AP3A 4JT4A 1ZVQA 4WOPA 3UANA 3TR0A 1ETUA 4IDHA 4Q66C 1JR3A 4JKIA 5KHOC 1JJ7A 5DI3B 1TPZA 4LOAA 4IDNA 4O2LA 3B78A 1ZM4A 1E0AA 1TUEA 3ZS9A 4RD0A 4CYMA 3BOSA 3DM9B 2JLYA 3A6PC 4CDGA 4A1FA 621PA 5JZVA 4WZAE 2AK3A 2WICA 2GESA 1AS2A 5HKKD 4LHWA 1KJWA 3G82C 4QGFA 4Q9KA 1KSJA 3RSLA 4DLTA 2IYQA 1FOEB 4ZDWA 3Q85A 4P4TA 4DT1B 2YC4C 5B2ZA 5E3HA 2O8CB 1XXHA 4D0LB 2H5EA 1Q1EA 5K8LA 3LXXA 4ZI3A 1E99A 2QMHA 1CP2A 1E2QA 3G0HA 4D2IA 4MKHA 2Q6TA 2XOKA 4IDOA 1II8B 3T34A 5J47A 3L2OB 4D4LA 1P72A 2J0VA 4AKGA 3AVXA 4C4PA 1NBMA 1VG8A 2JDIA 1US8B 3MSXA 3THXA 1VG9B 1YKSA 4TL7A 4GOJA 5EUMA 5H68A 2I4IA 2R2AA 4XD7D 2GJAA 1E1RD 1RVDA 3LV8A 3Q3JB 3UK6A 5JS8A 4QHYA 5F9HA 5FPSA 3HWSA 2XNDA 4B2LA 1OSNA 5H70A 2P0EA 1Q22A 1Z29A 4MYUA 3SFZA 5FTMA 3TK1A 2WSMA 1S2MA 3LWNA 2CCGA 2PMDA 4LHVA 4I1SA 4S2EA 1U2RA 2YVUA 4H1UA 1ZIOA 2ZAMA 4V03A 2NO7A 4WZBE 4EQ6A 4A8JC 2JLZA 1YQTA 1CJMA 4OBEA 4ZO4A 1QDEA 4NYIR 1P2VA 2AWNA 4D82A 1OKKA 3CH4B 3DMDA 3PUVA 3TNFA 1IY2A 1K8RA 4DEYA 4MKGA 4TWZA 3VFDA 3SFVA 2WSSD 4AKIA 3GLHA 5DGXA 2HF8A 2G6BA 1E4VA 1W4RA 2Q0HA 1DAFA 3THOA 4D0NA 4G5QA 3PXGA 1E2DA 1VCNA 3I1FA 2QSZA 2KB0A 4RD1A 4UQOA 2IYSA 3U2QA 2PT5A 4Q4AB 4EQ6B 3BXZA 4B34A 3SI7A 5LPNA 4UNNA 4B75A 2WWIA 2GF9A 4YMVA 3BH6A 2FEOA 2KBEA 2ZE7A 3CF2A 3VU9A 4EPVA 2HYIC 2RCNA 5ANRB 1DOAA 3OIVA 5G3ZA 5TVKA 2BCGY 2QSYA 1F2TB 3EZFA 5D3MB 2MMGA 4EAQA 1PZNA 3Q5EA 4GMDA 4B44A 4Y0AA 2GETA 2IYTA 3CR8A 1JALA 4V0LA 2MMCA 3D3QA 4JSTA 2P3SA 3FYHA 2ECKA 4TLBA 1WDTA 2ZYVX 3RWOA 4G5RA 4C2UA 1HA3A 1U90A 1OIWA 3VX3A 1CR4A 2I1VB 1PLJA 2NMVA 3I73A 1OFHA 1W7AA 1SVMA 1UKVY 5G3YA 4UJ5A 1JJVA 2ZJOA 1XEWX 4K81B 4ZIRA 2QI9C 3B1VA 5AJWA 3W6OA 4NYMR 2IYVA 2P5TB 1OB5A 4NDZA 1ZNYA 3FOZA 2ATVA 3B1YA 1R5BA 2EYQA 2QT0A 5JEDA 4KFTA 3DDCA 1SULA 3QKRB 1T9HA 5F9FA 4I4LA 4RKEA 1Z22A 3ZD7A 4LHXA 4M2LA 5DLQC 4XH9B 5CDFE 5KNBA 1JEEA 4YDSA 1NLFA 2D4HA 4QRHA 4LC0A 3TIFA 1W0JA 2QP4A 4HLUC 1KAOA 4B47A 1OYWA 4BPBA 3AF3A 1TQDA 3WMEA 3CRMA 4Q02A 1UFQA 1N25A 3QKSB 1P2UA 3T06B 3QE0A 4ZDIA 3A1SA 2DWOA 4IVQA 5CM9C 2O5VA 4MH0R 3GJ0A 3UMSA 1NJFA 2XSZD 4FMCF 4GPTA 4JYBA 4OI0A 1JPJA 3NEJA 1KHTA 3MWJA 5F2EA 3TSZA 4AG6A 4TMKA 3AF2A 1GILA 1E2EA 2OBMA 3NBFA 1RC8A 4BFWA 3LXRA 4PQRA 4DB4A 5CJPA 2YJTD 4II7A 5AR1A 5JHHB 1TU3A 3IQXA 3AUYA 1OHHD 4KV9A 5EP2A 1G7TA 4A2QA 4UKDA 2EW1A 2Q21A 3QJYA 2GCOA 1E0JA 1G8GA 3LQQA 5HZKA 1II9A 4LX0A 1OLOA 3AF1A 1N0VC 2D06A 4KVAA 3T12A 1KK1A 2WBLC 1E9CA 3SYLA 3OE7D 3NBXX 3TE6A 1N5JA 4YONB 1LS1A 4G01B 4IOLA 1ZAKA 5G53C 2BMEA 4NYIQ 2NG1A 2KSQA 5SZHB 1I4DD 1U8AA 2GTPA 4CIDA 1W4CA 2MSEB 1NLZA 2W2VA 3RS2A 5CB6A 3KJEA 2VP5A 2JLSA 4RY2A 221PA 4MRVA 4LJ8A 5DSZA 2BDTA 2VF7A 3EPHA 2QN6A 4A82A 4OI4A 2GCOB 3I8XA 5JWRA 4FMDB 1JR3D 2PZFA 3B6EA 4JLAA 5FBRB 1AKYA 1Q1QA 2BV3A 5CK4A 4HEJA 4PO9A 5F3WB 4TYQA 4NE2A 1ONBA 4LBZA 5KU1A 2XB4A 5JI3E 5C18A 1XTKA 1NRJB 4QFMA 4RFSB 2HEIA 2Q3MA 5BN5A 1UBGA 1EFCA 4BRUA 2FG5A 3HU2A 4PPGA 1Z06A 3FMOB 2BEKA 1DS6A 2FFHA 5CB8A 2GRJA 4QGAA 2VA8A 1Z0DA 1Z6AA 4I81A 4TL6A 2IEZA 3MD0A 4QJ3A 1R0WA 5GADl 3ND8A 4KVGA 1KNQA 2F43B 4WXRA 1G5PA 2VO1A 4LWZA 1XTIA 4Q1FA 4GNKA 2Q3FA 1XEXA 1ZCBA 2GXUA 5E7IA 1U81A 4MRRA 2QQ0A 3C4JA 3SR0A 4AC9A 2ODWA 3WRXC 2HJVA 1KIMA 1UADA 3NDPA 3T1VA 1KDTA 2BIFA 3BB3A 2EFHB 1FP6A 4H1VA 1W36C 5AWFC 1E94E 3AH8A 4LGMA 1KI2A 4HLUA 2IUUA 5E7MA 4BRWA 1GM5A 2YOFA 4X8MA 3LFUA 2AKAB 4C0LA 3EWAA 2FX3A 5BQ5A 3TVTA 3GEIA 5JCPA 3QXHA 4OKSA 2GEUA 1OXVA 3BD9A 2C9YA 3EC1A 1X8JA 3CWZA 5BW8A 3C8UA 1IY0A 2XOKD 3KTAB 4B32A 821PA 4GSYA 4PPQA 2J7KA 2DFNA 4HATA 3BERA 4IEEA 3CBQA 4DIDA 2A5JA 3QXCA 3QF4B 4OJQA 1CR2A 3EPJA 3THYB 3PR1A 2OAP1 2EVWX 2EFEB 2LWIA 1DELA 2ZVPX 4LRWA 3NC0C 1P2TA 2GA8A 2V9PA 3AVVA 2JJ2A 3AGQA 3WNCA 4A9AA 2NO0A 1GKIA 3N70A 2D62A 5GVRA 3U3JA 1V5WA 5CDFA 4TL9A 4ARZB 1VCMA 1KI6A 3SE0A 5E7JA 1R0YA 1E1QD 5DI9A 1NJGA 2CE2X 1NIJA 2JAQA 3LVRE 4M1SA 1I4LD 4Q1EA 5EZ5A 1H8ED 1P3JA 1NIPA 4PC6A 2GZHA 1XD9A 4ZV4A 2IL1A 3NBZC 5F98A 2C9CA 2ZRAA 3ZD6A 2IXFA 2E9SA 2KWIA 3MAAC 3K0FA 1N6IA 4DDTA 2W6ID 3PEVA 4ABYA 3F3YA 1Q12A 4M8NE 3RRNA 2HYDA 2AFIE 4F92B 3F5FA 5KSYA 3GLGA 1OYYA 3DPUA 2ZSDA 2NPIA 4HZUB 4CGZA 2MSDB 4Q18A 2ZI5A 1GP2A 3RLFA 3VNVA 3LDAA 1Z3IX 4IDQA 1WP9A 4W5WA 5EE3A 4B43A 5DN6D 1Z47A 5FUWA 4BFYA 1AJEA 4NCHA 1RJ9B 2EWVA 2FGJA 4ZKDA 3GLFE 1OFTA 2QORA 3EC2A 3KZ1E 4KBFA 2QUZA 1W49A 1G4AE 2NO9A 3WY9A 1YZNA 3O8DA 2DCUA 3FMPB 2FSHA 5DYGA 2O0KA 3TMKA 1KSGA 1FMLA 1Q20A 1GL6A 3A36A 3EXAA 3VKHA 5EXSA 1MKYA 4CEIA 1Z0JA 3FFBA 4I99A 4DCUA 5DHFA 3GLGB 2J9RA 3OEHA 2V1XA 3C41J 4IKEA 5BWMA 1TAGA 2O8EA 1I2DA 1VDZA 1R8SA 1W5SA 1XMVA 2ZR7A 3AVPA 5CYOA 4CT4B 3AKEA 4PHGA 2VSFA 2P6UA 2IHBA 5E95A 2QNRA 4B76A 3V4FA 3FWYA 2ZRLA 3EIEA 1OV4A 1R6BX 2F1HA 3H1TA 1QHHA 3K70C 2IS1A 4JVMA 3ZIAD 3KXKA 2V54A 3A4NA 3VNUA 2RGDA 1GITA 3C5HA 3ECCA 4DWJA 3HP1A 3I61A 1CXZA 1UBCA 4TT3D 3X1XA 4HI0E 3F8TA 3QPUA 4EPYA 4UNQA 1Q3TA 3VR4A 3VMFA 3HR8A 4LJAA 1G3QA 4M53A 4ILEA 5KSZA 3ZDQA 2ZUBA 4Z54A 4XWOA 4BEJA 4TQUS 2ZS9A 4Q7MB 1EFUA 1PVOA 1XCGB 3LNCA 1M7GA 1YZQA 2AXPA 4UNSA 2ZYUX 2WAYA 3K0EA 1XTRA 5DISB 1F60A 2LKCA 4Q1DA 2QBYB 4FCWA 1W5TA 4B2PA 2VYFA 3DMNA 1YR7A 4N1AA 1BIFA 1IXSB 4PZZA 4EPWA 5AUNB 1Q44A 1QG4A 2QTFA 2QU8A 4XIGS 1CRPA 1QBKC 2G3YA 1E2FA 4RD4A 5FPKA 4O0MA 1AZSC 1OIXA 3W3ZB 3MUFA 3X1DA 4TMTA 5J4HA 1EG7A 1JBKA 2YC2C 5BYKA 3D31A 2XAUA 4FW9A 1SXJC 4PAQA 4BLOA 3L0OA 3MMPA 2NIPA 3AM1A 1CJTC 1MH1A 1UJ2A 4AG5A 3ZGXA 2GVDC 1OPXA 1D9XA 2BEJA 4CZ2A 1N6HA 4A2WA 2XZPA 3A1VA 3DOEA 3P26A 3QF4A 3CX7A 2QY9A 2P5SA 3H4MA 4C0JA 3EA5A 1G21E 1IY1A 2J0UA 1NVVQ 3PITA 2OESA 1TF7A 4TQAA 2WWYA 5CLQA 1SXJE 1NSFA 2J59A 2CNWD 2AD5A 4ZIRB 3JVUA 3QVVA 4FWTA 1BKDR 1BS1A 4M4SA 3WP0A 2FNAA 4QGHA 5BYJA 4LZZA 2F1RA 1P9WA 4WVFA 4UJ3A 4JVLA 3BIFA 4R2IA 5CIWA 4JL8A 2XJ4A 4BZXA 4PO1A 4RD2A 1YE8A 3U6KA 2WWFA 2YWFA 4B3XA 4F91B 4DC9A 5KNDA 4GFDA 4TQ9A 5JRJA 1KK3A 1ZM2A 4JBXA 1NMZA 4BLRA 4Z1MD 4TTRA 4PX9A 4NCNA 3LX8A 1F2UA 1KO8A 2V7QA 4NZYA 1SVKA 5C46F 1KI7A 2FMXA 2OLJA 3BB1A 4DCVA 1YZUA 3CUEF 3VR5A 4TYNA 5GJCA 4PSVA 1HT2E 1G8YA 5EXPA 1ELOA 4GZMA 4WIAA 5J4LA 1IHUA 1S3GA 2CLCX 3GJ7A 4FMBB 3WBJA 3FMIA 2VP4A 2J3EA 2ZS8A 1H8EA 2ORVA 2ZIAA 5E4FA 1OXSC 2A5YB 1DAEA 4F4CA 2W0SA 5KPDA 2D2FA 3QXSA 3QKUA 3LRPA 1S96A 5ELXA 4CEIB 4C30A 2JASA 2A78A 3GJ3A 1GKYA 2H1LA 4ASUA 5AJZA 3GMTA 3WRYC 3GLFA 1UAAA 2C77A 2B7BA 2QZ4A 4HAYA 1NL3A 1Q3HA 1ZUIA 3BB4A 2QAGB 1GSIA 1DAHA 1XD8A 3KB2A 2AXNA 3AEZA 4GMXA 2OBNA 5KYKA 3Q72A 2ORIA 2OXRA 1LTQA 2OT3B 3NIBA 1UKYA 1WRBA 4MYCA 1N6OA 2B8TA 4NPHA 4EFNA 5C4MA 3EZ7A 1KMHA 4C9BA 1XZQA 2P67A 2VQSA 3SHFA 3U5ZB 1VG1A 4MGZR 6Q21A 1II8A 4XTRA 4PPNA 3UWOA 3U6BA 1RRCA 2ZQ5A 4JLPA 5K8TA 1ZBDA 3CX8A 3CKLA 1TU4A 1C9KA 4P33A 4KFSA 4LJYA 1BYUA 2W83A 2PZGA 3T15A 2G1JA 4KLNA 1CTQA 2ZRIA 2JJ2D 3OIYA 3LBNA 1Q1BA 1R5OA 3R9IA 3SJCA 2Z6VA 4RCYA 2J87A 1G7SA 1DAMA 1UDXA 3ZJYA 1F2TA 1G8FA 4BLQA 3U61B 4EJSA 2IW3A 1N6KA 2J5XA 4PXAA 4A4DA 2PEZA 2RGCA 3TKLA 4BZPA 3F0TA 4A6PA 4DSOA 1D2MA 3EWSA 4GOXA 5JS7A 2FSGA 1XF9A 5FFMA 1HY3A 2FPKA 4XVRA 3BJIC 1ZM7A 1D6JA 2IYWA 1U8YA 4UXHA 5AJYA 2AKYA 3THWA 1ZUHA 1G1MA 3KUCA 3SNHA 5EZ6B 1KY2A 4G1UC 2GNOA 2ODNA 1R0XA 1QF9A 2XTZA 1P9NA 1KTVA 5JJIA 4QXAA 5AJVB 3B7GA 1EWQA 2HLDA 2VIIA 5CJ2A 5TARA 4KFUA 4Z8XA 1XFAA 4XVUA 4IHQA 1RPZA 3QKRA 1EWRA 1OIVA 5G41A 3PIRA 4Y0VA 1JECA 4ERNA 3H84A 2GBLA 3EARA 1NN3A 3QG1A 4CEJA 2CL7X 3SQXA 5FL3A 2DB3A 1KI9A 4R9UC 1IAQA 2QTHA 2CNWA 4JLDA 4AIIA 2JDID 3AVTA 2X8AA 3PENA 1XX6A 3L43A 3AKYA 5EP1A 2AHOA 4OQFA 1NKSA 3N5CA 3WHLA 4U02A 1G5TA 3T5GA 4B3FX 4KSCA 421PA 3IBYA 3A37A 3ONWA 3B9PA 4DLVA 3KTAA 4MYTA 2IXEA 4E22A 3AV0B 2ZSAA 4N3NA 1ZC3A 4XOIA 2WIBA 1SXJA 2ZSBA 3RRZA 1XTJA 4HB0A 4JVNA 2RGNC 3BRWD 3CZQA 4WA7A 1AIPA 1EX6A 2GXSA 2GHIA 4EDHA 2PLFA 1JXOA 1UEIA 1X3SA 1HT1E 2ONJA 4KITB 3RS5A 2ZYWX 1M74A 2QA5A 4J0QA 3GJ8A 1ZNZA 1ZCAA 2N42A 3IQWA 5L8VA 2B8WA 1T3LA 1CIPA 3NXSA 4U5XA 4QKQA 2W00A 4RSGA 2FFBA 2Q9CA 4DLWA 4TT3A 4CEHB 4LK2A 3SJAA 1RRPA 4FI3C 3OFND 1E2IA 1LFDB 4LYFA 4EFMA 3V4RA 2PT7A 4M1TA 3LLUA 5H1YA 4AKEA 1LNZA 1FTNA 5FOUA 3ZS8A 1GVNB 4NH0A 1T0JB 2FWRA 4JVSB 5BN3A 4LJ6A 2NPFA 4YXWA 2BWJA 2PCLA 1VYVA 3TUZC 5LBIA 3GLFB 4X8LA 3K09A 4HYYA 2V7QD 5DIFA 2QPAA 3THXB 2YHSA 2OHFA 2GCNA 4IJMA 3CRRA 1T8TA 4US0R 4Q47A 3U60B 1JEDA 1XEWY 3CF6R 5KSOA 3SYNA 3T61A 2FFAA 2ZEJA 1J8YF 4OL0A 2YKGA 1E98A 2O0HA 2VEDA 4LJ5A 1DAIA 1IXRC 5TDHA 4GDFA 3FPAA 5JJKA 1E9DA 4X8OA 2FZLA 1XCMA 4LV6A 1VYTA 3KDSE 4S35A 3AVYA 4RJLA 4RVCA 1VCOA 2EWWA 3C16C 4H9GA 4Q4LA 3U7FB 1ZNXA 3IO3A 1AS0A 1M7BA 1WF3A 4HDQB 3W8NA 2FGKA 3M0EA 4RD6A 5JRZA 2DPXA 5TB5A 4LHZA 5JJLA 3OFNA 1TADA 1XCPA 2WMOB 4TN1A 1AGPA 4PC2A 5J5CA 1RW4A 1C4OA 2WKQA 4XWAA 4DLXA 1MR3F 2O0JA 1UPTA 1DE0A 2GK7A 1UEJA 3QXXA 2ZVQX 3EAQA 4TLCA 4EJSB 2NQ2C 1SVIA 2ODEA 1WB9A 3B1WA 2WAXA 2G0TA 2HF9A 1W4BA 3V00A 3M1IA 3N2IA 3TQCA 4KJZA 3DVLA 2ZRNA 3CONA 4W7SA 4QBGB 3FHTA 3THWB 1FQKA 2R9VA 5EXTA 1IBRA 4L5BA 3OESA 4JL6A 2GK6A 1Z0IA 4L16A 2UZIR 5B57C 5FUVA 3MJRA 1XWIA 1DAGA 2IYUA 1KJZA 2VHQA 4BQSA 2F55A 3RNLA 1F48A 3QG5A 2NO1A 3SQWA 3IBGA 1WXQA 3RS0A 4C0HA 5IK2D 3RS7A 2RGNA 3BH0A 2WWWA 5FL7A 1Z0FA 1G291 1S8FA 3QEOA 3RAPR 1HE8B 4NBSA 5EE9A 4A2PA 3K70D 2A5DA 4B3DA 2O8DA 3NVAA 2BJVA 4D25A 3EASA 3D7MA 4K46A 2GCPA 2K5UA 5J4YA 4LV8B 3KFXA 1HURA 4GI7A 1XMJA 3MRSA 3GLGE 4W9MC 1UKZA 1AKEA 2E1RA 4BECA 5TMPA 5SZKB 1XD2B 2YOGA 4JLOA 3W6PA 2CHVA 2J1LA 2GAAA 2XTNA 1DPFA 3IDQA 1RE0A 3RRYA 4US2R 4MA4A 4V0NA 4QNRA 4A15A 3FB4A 1FUKA 4FN5A 1CF4A 2PJZA 3U3MA 3CO5A 2V55B 3GD7A 4GZLA 4XD7A 4F38A 3CLVA 2IC5A 2PCJA 2I3BA 3LVQE 2X2FA 2WHXA 4Z51A 4B35A 2D2EA 4EPXA 4LI0A 1AQUA 5A0FA 2J0UB 2DBYA 4PQFA 3TUJC 1U99A 2IYRA 2YWGA 3I92A 4HZUA 4JJZA 2R6AA 4GP6A 1A5TA 4C0BA 2JJ8A 2O52A 3ADDA 3MWKA 1SVWA 1O87A 3RABA 2C5LA 2QEQA 4DCTA 4OHVA 3IIKA 5IRCD 1AK2A 1CJKC 1RJ9A 5J4VA 4JLBA 3CB4A 2DFLA 3HJNA 2Z5FA 1G16A 2OCBA 2XITA 1PV4A 1MABB 1E9FA 1MO3A 1T3SA 4G5OA 1D9ZA 2Z43A 2RGEA 1N0WA 2W6JD 4L15A 4NU0A 3TJZA 1BOFA 2JCSA 1JQJC 2A9KA 4ASUD 4UNPA 1N3BA 3IHLA 4MYHA 5JFGA 5HCIA 3TGPA 4OHYA 3RHFA 2G88A 4F93B 1ZD8A 2C03A 3AVQA 3DZDA 1G7CA 4V0ME 1FX0B 1R7RA 4ZI2A 4C2TA 1IXZA 1YR6A 4M1KA 3NHBA 3ZLJA 4PSKA 3LH5A 3EX7C 3AVWA 3ZZ0A 2DFTA 2F3RA 4URVR 4LYJA 3BFXA 2HCJB 1Z28A 4D81A 2OZEA 3IEVA 4IW3B 4FXPA 1M7HA 1G6HA 3P20A 5FI1B 3ZYCA 4LYHA 4NYJR 3VTKA 1MO4A 3A1WA 1FUUA 1G9XA 2CVHA 3RC3A 4Q19A 3E2IA 5KO2A 1ZD1A 4RFSA 4HSEA 4LPKA 4F4IA 2GVZC 2QL6A 2UVQA 4PTLA 4B3CA 1E6CA 4CVNA 2DYKA 2WOJA 1FTSA 1R4AA 2IA5A 4R98A 3EZ9A 4W5HA 4FIDA 1IN5A 3BE4A 3P27A 3S1AA 3GCGA 4BFUA 1ZNWA 3LBIA 3Q7QA 1P5ZB 1LB1B 2O8EB 2GJSA 3AF4A 4K8OA 3FVQA 2IX3A 2CE7A 3WYFA 1R0ZA 4MKFA 2F43A 1NVVR 4DVGA 4JLVA 3TW4A 4AY2A 2AK2A 3N2EA 2IUSA 1XNJA 4PPFA 4Z8YA 2EFGA 1X8LA 5HE8A 3VKWA 4LJ7A 4ON9A 3B1ZA 2AL7A 4E03A 2ZE8A 1R10A 4Q5IA 3H2YA 3KFVA 4LPSA 2WIAA 1PLKA 1TL7C 2DHRA 3L0PA 2WTUA 1X6VA 1BH2A 2BMFA 2VLIA 3C14C 3ZVNA 5JECA 1GNRA 5GJBA 4RFVA 3LA6A 2ZI3A 3ASYA 2ZJ8A 2R62A 3CPJB 3AQ4A 4TYWA 2QAGC 1DG1G 3PEWA 1P9RA 2UZ3A 3U44B 3KUDA 1JQLB 4W5JA 3CRW1 3EPLA 4OHZA 3B8HA 1Z6YA 4PQYA 3GLIA 3O8CA 1NG1A 4XWKA 1NKTA 2FZ4A 3UATA 1U8ZA 1EFHA 5FTNA 4IRUB 4FWIB 3R7WA 4I1OA 4Q7LA 2VH5R 5LDDC 1H8HA 2KE5A 3Q5DA 2BJWA 3MGCA 4Q7JB 3M6AA 1F2UB 3KQNA 1IN6A 1ZM9A 2IF0A 3IIMA 4ZDJA 1XEFA 4Q48A 4HAXA 3MFYA 4DUGA 1IJEA 2ZJBA 1FW6A 2TMKA 2AN9A 3JVVA 1KI6B 1JI0A 3KJHA 5FUYA 3PEYA 2PEYA 2W2TA 3HYRA 2GZAA 4E5UA 1J2JA 2C95A 2ZITA 1CKEA 1CR0A 3K0CA 3QNUA 4WZ6A 4KHZA 1U94A 3UIEA 2XJ9A 1LF0A 2FN4A 1FP7A 1XPOA 1E2MA 2KBFA 3DHWC 3W9YA 4IOMA 1QHSA 1LW7A 3NH6A 2CL0X 1MV5A 3IPXA 3LQRA 2WJVA 2WJJA 1Z6GA 1OXTA 2NZJA 2OCAA 1ZJ6A 2WV9A 3EPKA 3TBKA 4NTZA 1RRFA 3P1JA 2A5FA 4MGKR 4G5GA 5DHAA 5JWOA 2ZPTX 3W8RA 1E4YA 1G3UA 3AUXA 1DG3A 3K53A 2WPDD 1JAHA 2REOA 2BM1A 2WJHA 1JR3E 1UDWA 1Z2AA 3NKVA 4MGIR 5IHPA 3CWQA 5C4GB 2BC9A 5DE3A 1W47A 1E0KA 5FI0B 2IK8A 4TYYA 3K09C 4CF7A 2VP0A 3QBTA 5KDOA 4Q00A 2JIZA 4Q1CA 1ZC4A 2DWPA 2VSXA 1KKMA 4ZCIA 3TAUA 3QQ5A 4B71A 3I5YA 2VL7A 1XXHE 1YHNA 3RANA 1XTSA 1ZUNB 3K70B 4A6XA 5HE9A 4V02A 2JGNA 4MQBA 4XJXA 1L4UA 3P32A 1KKLA 1KGDA 1X86B 3T35A 5FUXA 4ESHA 4QM7A 2FE4A 4WXPA 1ZM3A 4DT1A 4MUAA 4LBYA 1VKJA 4M9QA 2VHUA 4NP6A 4DCSA 2IS4A 5HR5A 2F3TA 3OHMA 1W44A 4LY6A 3RYTC 1EXMA 3U4QA 1E1RA 2OUKA 2VHJA 3G5UA 1FMJA 3NWJA 2ZTSA 5L3QB 4HAUA 2X1VA 4B33A 2HDNB 4M1MA 1DO0A 4FCTA 1CR1A 1XDBA 3UG7A 2J7PA 1VG0B 1U98A 4KXFB 2VP9A 1DARA 1J8MF 4KLZA 3QUSA 5J40A 4BLTA 4EUNA 2C9OA 3A58B 2A2ZA 4OQLA 1X1RA 1JXMA 1N6NA 5B58C 4PHHA 2FSIA 3HDTA 4A92A 3U3RA 4IOJA 2IYYA 1U0JA 2CK3A 1KI4A 2QBYA 2OFOA 4WBSA 4DEXA 1Z2CA 1IN8A 4D6PA 3EG5A 2OM2A 2QPOA 4AYXA 3L0IB 4Q1BA 4DIEA 2JLRA 3SZRA 1H65A 4WW0A 5JSZA 1HUQA 3FDIA 2L0XA 1TEXA 2QP9X 3FKQA 3O47A 3KKQA 3X1WA 4EPRA 2ZRMA 2PBRA 1NY5A 2IT1A 3ADCA 3K1JA 4P4UA 4Q4HB 4OHXA 1K5DA 4N0EA 1N2CE 2F1JA 1AZTA 1WE2A 4OK3A 1TMKA 5CLLA 2JIZD 1KO4A 4X8HA 1EESA 3PEUA 3K9GA 4PR0A 5TY0A 3GLHB 3GLIE 1COWA 1S1CA 3A4MA 1E9RA 1N5IA 4QBIA 1NNEA 1CEEA 4C0SA 1Z8FA 2QE7D 5FPYA 2BOVA 5FR2A 4BUJA 2RGAA 5EE0A 3QKSA 3PUZA 3VHXA 2GXQA 3IO5A 4GRAA 1G41A 4Q4HA 1E9EA 2ERXA 2H57A 3SBEA 4URYR 1JB1A 2QRNA 1OW3B 2VRWA 3PCRB 3DO6A 3BAFA 3H0KA 5IDVA 2ZI9A 4IVPA 3SN6A 1ZU4A 4L4UA 4M1OA 2JJ1D 1QVAA 2BBTA 2EQBA 2P6RA 3ADBA 2IS6A 1GIAA 5CYPA 3QEJA 2A5GA 1ZP6A 1C1YA 3BBPA 3QF7A 2WMNB 2A7QA 2JA1A 5FPTA 2YNMA 1NY6A 1LVGA 1T5IA 2IF2A 1G4UR 2ZJ5A 4A8JB 1BYIA 4LYAA 1SVLA 2ZUCA 4RZXA 2H92A 4D4KA 2DR3A 3B5JA 4AYTA 5JWHA 2PLRA 3UKDA 3KL4A 4HB4A 2C04A 2ZETA 1ANKA 4AYWA 4TYPA 2JATA 3J81k 1RRGA 2NGRA 1GNPA 3PUWA 3WXMA 3DEFA 1DAKA 3CPHA 3Q8XB 1AS3A 1HEIA 2YOHA 2NO6A 4DHEA 2O8FB 1LY1A 3PUXA 3NH9A 3R20A 1W2GA 2UKDA 3KQUA 4NHOA 1LF5A 1MO6A 1E96A 1CBUA 1H8HD 4GBMA 1E2GA 1TX4B 2BVNA 1RFLA 2IS2A 3QSYA 3CR7A 1LS6A 1Z0KA 3QPVA 4A8JA 2QG6A 1A1VA 2IUTA 2BHRA 1W2HA 4IFBA 1NLYA 2DY1A 2GDJA 2C98A 3AKDA 1GL9B 1TTTA 1Y3AA 4TMVA 1R5NA 5HCNA 1G64A 1P7CA 5KSPA 1NVWQ 1KI1A 5EXXA 1J7KA 2BKUA 4JBYA 2J0SA 4R71A 2REBA 1II0A 3I72A 1Z83A 4FCVA 5L3QA 3K8YA 3VR6A 5LD2B 1IQPA 3X1YA 4QHTA 1XMIA 1E2PA 1S9DA 3WBKA 3NDBB 2FV8A 2BMJA 4OQXA 3REGA 3WYAA 4YLGA 4G3XA 3C15C 1OHHA 1XRJA 3CX6A 4DCNA 4ZKEA 3TQFA 1W0JD 1XMSA 3UXMA 2ZRKA 5LB4A 4BEBA 3TW8B 3DM5A 2D3WA 5AJXA 2ZE5A 1SHKA 4OHWA 1D2EA 2PX0A 2CDNA 3CIOA 2W0MA 4KU4A 1T8UA 2FH5B 2PX3A 721PA 2ZJAA 1E2JA 1ODFA 4IXMA 1NN1A 1QHHB 4M1YA 3ZVMA 2GXAA 3GFPA 4QM6A 1QVRA 4UNRA 2HLDD 2OXCA 2VP2A 1GOTA 1O3YA 2WJYA 3B85A 3T1QA 4DUGD 3C5CA 2ASEA 4Q9JA 2ANCA 2WZQA 2C96A 5FR1A 3W5IA 2JLXA 4JIMA 5EE5B 2EFCB 1XBTA 2LKDA 2OILA 3IGFA 4TZ6A 4QL3A 5EQTA 2EU8A 2JJ1A 5M04A 1G8HA 1CS4C 3JZMA 4U7DA 2QM8A 1DBSA 2F6RA 4HLQB 5A4JA 3BH7A 4A0FA 2ZRGA 4Q9IA 4HUTA 3LW8A 1W36B 1SXJD 4KYIB 1S4QA 5DNYB 4HAWA 4ESVA 1IN4A 3NTUA 1NSTA 3OAAA 5SZJA 2ZM5A 4QC2A 1AGRA 5D3MA 1P75A 2JLVA 4HLDA 5BXQC 2PL3A 2XNDD 1WBDA 4URZR 4C0QC 4E09A 1X8KA 2I1QA 2RKOA 3QY0A 4E07A 4BFSA 3SHWA 3SYKA 3A8TA 3OEEA 4V0OA 1N5LA 1RKBA 2YYZA 3U44A 1E2HA 4FINA 3GEEA 1R2QA 3RVBA 2B92A 4L8GA 4JLMA 4B74A 2FU5C 4MDEA 2ZXUA 1KZ7B 1N6RA 2H17A 5L3VA 4PZYA 1JR6A 1IJFA 1N6PA 2V6JA 1OKKD 4DSUA 2RGGA 4BWYA 1OXXK 4DLRA 1KI3A 2JLWA 4XSGA 2X19A 5JMTA 2WM9B 1F5NA 1KDRA 1VTKA 1N5KA 5AUPB 4BZQA 1XZPA 1SZPA 3VHLB 2R6DA 3QKTA 2ZRFA 3TVDA 1G18A 2VHCA 3NBYC 5KOYA 3UMFA 3TLXA 4DDWA 1GZSA 5FOXA 1KI8A 2ZI7A 2OAQ1 1OE0A 4DBLC 2WWXA 2N1BA 4OK5A 4IVRA 5B64A 2YINC 3LW7A 1KK2A 4ITRC 4AD8A 4Q1AA 1QG2A 1YRBA 1P62B 1XU4A 3D6TB 4DDVA 1GDDA 1A7JA 3IUYA 3AP2A 2O8FA 2GAOA 5JCZA 3K9NA 2CMKA 3I3SR 2CJWB 3SS8A 1UM8A 4P0TA 2BCJQ 4DZZA 1Y63A 1EFRA 1J70A 2GF0A 4TTQA 2ZRDA 3P4XA 2V4ZA 4EKDA 521PA 3NHAA 4KSBA 1PLLA 5EP3A 3NEYA 3BGWA 3KKNA 4QJ4A 2GEDA 3DZ8A 3ICQB 3L0SA 5EP4A 3MG9A 3PFIA 1W48A 2CK3D 1SKQA 1AA9A 1U9IA 3QPWA 4RZ3A 2REXB 1HTWA 1W46A 3S1AB 2ZJYA 4PC7A 4OQMA 5IT5A 2CJWA 2GWHA 2ZRBA 3Q7PA 1OJLA 1SKYE 4A0GA 1E69A 3B60A 3BS4A 3W3AA 4TMZA 4KODA 2QQEA 1E0SA 1US8A 3B13B 1RYFA 4M9SA 1FX0A 1G3RA 3E70C 1G3IA 1VYUA 1EGAA 2Q9BA 2VF8A 1OH8A 2ONKA 3KKPA 2WPDA 2RGXA 3K0AA 4NYMQ 2ZU6A 3U4QB 2R6FA 1XB2A 4US1R 1G19A 1W0KD 1GRNA 3MCAA 4DLYA 3WHKA 1G5RA 1Z07A 3DKPA 1MRNA 2PH1A 2XNSA 2IBMA 2D7CA 1FNNA 4HAZA 1GNQA 1A2KC 4Q01A 4Q21A 3SOPA 4B3BA 2ODBA 1KK0A 1YZTA 3LY5A 4UXJA 1CLUA 1XTQA 3OIUA 2C99A 2ZR9A 4B6EA 5K8UA 1S1MA 1UF9A 5CIQA 1VCIA 1OFIA 1KDPA 1ZD9A 2H16A 3GEHA 3KB1A 3CRQA 3FHCB 4RD3A 4LSGA 4RKFA 2R6CA 3L8YA 3KQLA 4M1WA 2ZROA 2RAPA 4DLZA 1P2SA 1W36D 1XJ0A 3X2SA 3OF5A 3U3KA 1NVUQ 1QHGA 1TUIA 4OQNA 2VHTA 2F7SA 3OE7A 4DDUA 3LBHA 4O25A 2WWGA 1JPNA 2ZAOA 1DVRA 3UPUA 1GTVA 1SHZA 5C2JB 4Q4AA 1E32A 2PZEA 3B82A 1VECA 1IONA 1S3SA 2V8OA 2OFWA 4JS0A 2Z83A 1VHTA 3AKCA 4F4JA 3ZZTA 2FPMA 1SVSA 1WMSA 2XZLA 3SJBA 1MO5A 5FOWA 1BMFD 1G3MA 4BGDA 1OF1A 3O8BA 5FPHA 4AWXA 1OH6A 3SU8A 4HAVA 1AM4D 4ACAA 1HV8A 2FFQA 4URUR 4B2IA 1TEVA 4F7WA 3KJGA 2J45A 4DB2A 4N0DA 4TLDA 3U7GA 1XP8A 1XJCA 1S0UA 1J90A 4PO8A 2AR7A 4EPTA 1QHYA 5HPYB 3GPLA 1Q0UA 1HQYE 4A0HA 4MRPA 4B48A 2HCBA 1NF3A 1L7VC 2ZU0C 4A36A 5FOVA 3CRVA 3ETLA 4P3YA 4YC7A 3K0SA 4RCZA 1JAIA 3KXLA 1U0LA 4LCBA 1P6XA 1Z08A 4C0AC 2HXYA 2X2EA 2CCKA 2O8BB 4AURA 2V1UA 1V43A 5LD2C 2RGBA 2ERYA 3IPYA 3L82B 5TV2A 4CRWB 2FOLA 4NL4H 1GAJA 3MWYW 4PSAA 2J0QA 1SKYB 2BM0A 3W90A 1ZINA 1J99A 2RHMA 2AWOA 2QAGA 2EFDB 3BFKA 3OEHD 2CBZA 1HQCA 1M1YE 1UKEA 2CHQA 2JLUA 1M6NA 2CVFA 1P73A 2R6GA 3Q9LA 3VQTA 2GJ9A 1DEKA 3KJIA 5KNCA 4IFEA 4O2RA 1FNMA 2SHKA 4MGYR 2O8BA 2QPTA 2A30A 1SQ5A 3TUIC 3W34A 5DYIA 2CLSA 3KQKA 3PG5A 1FL9A 3U7HB 2Q9AA 1SGWA 3EZ2A 3MJHA 4PC3A 2ZI6A 3CPEA 3K9LA 2QAJA 4JJKA 4GL2A 4BFTA 3QXJA 1GKUB 1EFRD 3BC1A 4Q4JA 1WBBA 3AVUA 1KSHA 3VR2A 3GFTA 4C7OB 3QBVA 1YZLA 3A1TA 4TSFD 1P61B 2PJRA 1CRQA 4OI1A 3VR1A 2QGZA 1FZQA 1XXHB 3VAAA 2X77A 4XTCS 2FA9A 1PUIA 5FL7D 1YR8A 1KSFX 2NTYC 3HR7A 1EX7A 3GJ5A 3L8ZA 4P4SB 5GJWC 5JLJA 1ZU5A 3JZAA 3NC1C 5K8IA 1WQ1R 1Z6TA 3IKJA 3SJZA 3LX5A 4M0LA 4IXNA 1E2KA 1KO7A 2FF7A 3I32A 2J46A 2XGJA 1MOZA 2J7PD 3TSOA 4G0NA 3QENA 2G0NA 4Q4JB 4UXIA 2ZR0A 3ZQJA 1I2MA 1G7RA 3CZPA 4IOKA 2KI5A 4JLKA 1QHIA 2OE2A 4PAMA 2WJIA 2FDCA 1K6MA 4XSHA 3WYGA 2LCFA 3R8FA 3BFVA 1KOFA 5AUOB 3FKSD 5SZIA 4V0KA 2YV5A 2AD1A 1VIAA 4LHYA 1EFTA 1ZIPA 2QRZA 2C78A 4HDOB 1TQ6A 4U00A 3QVUA 1RZ3A 1FQJA 4MRNA 1NBME 1Q1ZA 2IHYA 2RMKA 4PC1A 4HZIA 4OYHA 4Q9HA 5AUQA 2C8VA 2B7CA 2QGNA 4KAXA 3LO5A 2W6JA 5BN4A 3IHWA 1GRQA 1E2LA 2RHDA 2G77B 1N0UA 1MRSA 3I62A 2QT1A 5KDLA 5IK2A 2BBSA 4DLUA 4I1VA 4RZUA 2IWHA 3TR5A 2CHGA 2QM7A 3RSOA 4A0RA 2WVJA 3R7WB 2R44A 2XZOA 1HH4A 3B9QA 2F9LA 3K0CC 4JSYA 2Y8EA 4XVQA 4P31A 4QBHA 4LBWA 3TSWA 1TF2A 3C7KA 4Q03A 2O8DB 1KMQA 4FD2A 4HB3A 3RRMA 3NG1A 4TTPA 4JYCA 5FTJA 1YRAA 1Z0AA 1NG9A 1U0HC 1KDOA 3HU3A 1XPRA 4L9SA 4KYUA 3UMRA 3QOFA 2OV2A 3SEAA 3IIJA 2XXAA 1A2BA 1CJVC 1QRAA 1T6NA 2Q3HA 5J4KA 4LBVA 2OFXA 3VU9B 5FBWB 1OH7A 2W2XA 1VIYA 1NVXQ 3VR3A 3GP8A 2C2HA 2BKEA 4C0KA 4CEJB 4JLJA 3AB3A 5FBLB 3EIQA 4OK6A 121PA 5KPJA 4WAUA 4HLCA
chains in the Genus database with same CATH superfamily
1GR1A 2H18A 5JT1A 2B8EA 3CLRC 3ISTA 1PZXA 2CVOA 1UC9A 3M3HA 1UP6A 4H6WA 1RJEA 1UK7A 2RB4A 2RH5A 3GFOA 2POCA 3LZ6A 4G5SA 1EHCA 4R4JA 4BLPA 4X62B 4PYRA 4QX6A 1DQSA 1ML3A 2O3TA 2ZJ2A 1JPVA 4E31A 1C1HA 5HTKA 5JPIA 3WMFA 1F1BA 2H4WA 1J49A 2FWNA 2J9ZB 2UYGA 1SD5A 2ZE6A 4MVYA 2PUJA 1B1AA 1YQWA 4HNGA 2O8CA 4PHTA 3DVSX 4OYYA 2DWQA 2ZTVA 2AI1A 1SC4A 1Y8RB 4YRJA 4IFTA 3ZU3A 1MU0A 1L2TA 2Y0CA 4F9GA 3PR2B 1GV1A 4R41A 2IHJA 1MJFA 2ORWA 1MB2A 2YL2A 2YYAA 1ECBA 4MITA 4W6ZA 1UUFA 3OUTA 2PRKA 3PIIA 2EG5A 3NWEA 1XRQA 1M1YA 2ECOA 2CNLA 5GMOA 1NMXA 4TLAA 3UWKA 4XVHA 3GT0A 1DJOA 5EJEA 4J0KA 2Y1EA 3JARA 2E87A 2WKWA 3A31A 3GCZA 3H5RA 2PZLA 1V3UA 1BN6A 2V59A 1TAHA 3IUPA 3IVAA 4CLXA 1N34B 3Q2OA 2HSGA 1HNXB 1NPTO 1Y1TA 2OO7A 5CB8A 2QUAA 4BBJA 1Z8DA 1Q57A 2H8KA 3JASA 4P5PA 1CU1A 1UOEA 4R2WA 2BTEA 2PGOA 3ICPA 2QD4A 1C81A 4Q9LA 2Z4SA 3UWSA 1YZGA 4B6FA 4D4HA 3FMFA 1G9SA 3R5SA 4MW6A 4QRDA 2KYRA 4I50A 3IP1A 1E9SA 4JMLA 4D6YA 4NBRA 3ZIDA 2P2CA 1OR8A 2YZ2A 1OZHA 3D4BA 4RS3A 1RT9A 5H82A 4K6KA 5ITWA 2M1XA 3LJKA 1KC3A 3K9HA 1L3BA 1XL0A 2AFHE 4YJDA 1RPNA 3GVPA 2ZJ1A 2BGRA 2IEGA 2YQ5A 1CY7A 3IP8A 3PNYA 4QHSA 1JEYB 1SVOA 2BBOA 3HUFA 2PUGA 4CM3A 5DT9A 2ONZA 1CVLA 2FPLA 2IHTA 1WX1A 2ZREA 1L5OA 4ZRMA 3HVHA 3O8LA 1YH3A 3M49A 1DB3A 5KYUA 2RIPA 4HK4A 4S12A 3CY6A 4B6QA 1SBZA 5MFZA 1VJGA 4TVSA 3ABRB 4F1JA 4RJJA 1EDOA 1K5GA 2QD1A 2W6CX 1KVUA 1SOVA 2DPMA 3D6NB 4M87A 5KJEA 4OXNA 1P4SA 3T9EA 1BMFA 4FE7A 1JVSA 5EZYF 5HQ3B 5KVVA 1NE2A 4WE3A 2P65A 3TJMA 3R40A 1RQRA 4IUCS 4FJ2A 4QBKA 4C7MA 2SKCA 1SPXA 3CHYA 3L05A 3L8HA 3JRNA 1QFZA 3ASVA 2BI4A 5ERGB 3ZZUA 1WCV1 2GBIA 4D3SA 4R9VA 5DWVA 3V1LA 3HU5A 4LJ9A 5EVCA 1IBKB 3V9PA 4C4AA 1ZEMA 3S8MA 1GY8A 1H2RS 1YBAA 1YDFA 4RFLA 4E5SA 4LJ4A 4RDCA 4MHTA 1GL7A 4ETNA 2QM3A 3PGMA 1S9HA 1VQ1A 1GUAA 1IRXA 1ZHFA 3GJ6A 4BBAA 2ZRPA 4DLSA 2ZCVA 5IF9A 4JCCA 1TQ2A 2B4YA 3GZNB 5KHAA 1F9EA 3IVMA 3IOMA 3MCUA 3GK3A 4RMHA 1KMIY 2HRCA 3IP3A 4KE9A 4JU9A 3JQ9A 3T1OA 1BHSA 4IM7A 4BNNA 1OA1A 2G6TA 3THYA 5DTMA 1VJ5A 4E1VA 2P8JA 1YS6A 4EGSA 4F0JA 3F5MA 3FHOA 1NRWA 3LYUA 3PNVA 4HFNA 2Z1NA 5A9TA 3DJFA 1SXQA 1EJ2A 1MOSA 4ILKA 4QXOA 4D26A 1TQ4A 4N54A 2G9ZA 3N39C 3TLKA 2ILTA 1GNVA 1AB6A 3HGTA 2XXAB 2DSTA 5DJ5A 2CCJA 1G38A 2QTGA 1LPMA 2ZB7A 4KH0A 1ZPDA 2Q0XA 3DT9A 3PHLA 1V9LA 4F86A 1IIBA 4CW7A 1XSEA 3NUZA 1JLLA 4DYHA 3H2IA 3FRIA 4DJDC 4UUQA 2AUMA 1NI3A 4H1HA 3WB9A 4CF5A 1DQNA 1RC0A 2QN3A 3ZV6A 4DSTA 3GAZA 4QTUB 4EBFA 5K0CA 3JWEA 1T0IA 1CUJA 1YS9A 3IBTA 4YFVA 3PQ6A 2OV4A 4LQ4A 5SY6A 3VPGA 1NFQA 3OM8A 3SEFA 5HBGA 1GN8A 1FMCA 1L4LA 1WSDA 1DBPA 3C0KA 3HXTA 1JU9A 5KYTA 1OB2A 2ZWIA 1XKQA 2V6GA 3EIHA 3DVQX 4BV8A 5C34B 1G5FA 1LX7A 4EB8A 3RS4A 1M54A 3GLRA 1M8FA 1QTRA 4PZCA 2AR0A 2IYZA 2PJUA 4JOBA 3KJZA 5T5QA 4G1MB 3RWMB 8OHMA 4CEHA 5HFAA 1ESZA 2OBLA 5E1OA 3FVWA 5KNDD 1FFYA 3TPCA 4BFVA 3DAPA 3HPQA 3K2IA 3MK31 1B23P 1YS7A 1TGVA 1ESMA 3OWHA 2A9FA 3QWAA 2JLQA 2VRCD 5IP5A 4JMPA 4H59A 5HKKA 1GYPA 2IEDA 1KZGB 3WNDA 2DHEA 4AP6A 1FSFA 1OFUA 4ZO7A 1V4VA 4BGUA 2C5GA 4X7MA 2AZXA 2HT1A 3K1TA 4YQFA 1KYIA 3EFOA 7REQB 2P2YA 3HZZA 3R3WA 1XC7A 2WJ3A 1O5OA 2Q6OA 3CLRD 1T6YA 3N7TA 2GB4A 3AUJB 4Z4EA 5JQGF 2H7VA 1BZYA 2QMUA 5B1SA 3T1TA 2ISQA 1P60A 4I66A 3G7NA 3QW2A 3P97A 1T91A 2RK6A 2QTCA 2YVQA 1PFQA 2PFGA 2F1OA 3ACCA 2ZBFA 3FKSA 4NMMA 3A10A 5U4XA 3W5VA 3PLAE 3DCYA 3PHHA 1SC3A 2XVXA 3U13A 1UMCA 2OAGA 4F5YA 2BFDB 2DWCA 3H8VA 3PUYA 5A4DA 4IR7A 3T7AA 1U9IC 4WCDA 1ECGA 4C0XA 1PR9A 5LZ7A 1A27A 1N6LA 4FZVA 1A4RA 4JWTA 3LA8A 4TVOA 5AVKA 2IXGA 1PJAA 2J41A 3CM0A 1WXGA 3FH0A 4MV0A 1LRLA 3IPCA 3AM3A 3HKEA 4JUFA 2IU3A 2OYRA 1QF6A 1NM5A 4BQQA 3G2QA 3ZVKA 5FTKA 5BN4A 5BOVA 5JDIA 2JGMA 1B4DA 1SRQA 4XFDA 4YCSA 4IJUA 4RTJA 2IYLD 1EVZA 4QUIA 4DC1A 2M32A 3U0VA 4M0EA 1T4CB 3U17A 1WDMA 2PGDA 4MP8A 4FNOA 3SIRA 1WP4A 4KO8A 4R1QA 3HU1A 1NZDA 3BGVA 3P5BA 3VYVA 3KHTA 1JZTA 3ND6A 3ZI0A 3KJXA 4D79A 5HQ3A 4PZEA 3UQYS 1QG6A 3W9SA 2ZM6B 3LOQA 1OWLA 7GPBA 1IQUA 3SBDA 3WL6A 1KL7A 3GQBA 4C3ZA 4HZGA 5T57A 2I22A 4IDPA 2Q1SA 1RYYA 2IXTA 3FR8A 1PBNA 3AF0A 4FD3A 2AFVA 2FX5A 1A9TA 3EVEA 2QTZA 4KCGA 4LRSB 4ARBA 4CLRB 1B0UA 4P32A 2NZWA 1FMFA 3HBFA 3HGMA 1UC4B 2H59A 3ROMA 4DUYB 1NN0A 1T8WA 4RVDA 3BZWA 4IG9A 4TKZA 2G72A 5AK0A 5EIAA 5GOTA 3ZY2A 5IVHA 3MWLA 4OB8A 2HUPA 2QTVB 1T26A 3DL0A 1AHNA 4LG1A 4P7GA 4RF5A 4JI1B 4NV3A 3ADKA 2TECE 2E4ZA 1FUEA 1ZA2A 4S0ZA 1RXVA 4BE7B 4Q3DA 4Q6WA 4OXKA 1H22A 1D4FA 4ENTA 3K2QA 2W11A 2YZNA 1TD1A 2VBCA 3K4PA 3WJ1A 5LDHA 1T5LA 2PYIA 1FSZA 3OOJA 5HZHA 1B2RA 2WJWA 1NYLA 2Y68A 5K4GA 1XD2A 2Z0MA 2A33A 5K3FB 4D4MA 5TGDA 3U49A 4TL8A 5FNVB 4EZEA 8AT1A 2GSDA 4GT1A 3HVJA 1CNEA 3KX2A 3UBMA 5AVQA 3PQCA 4P3KA 1KEVA 1TTPB 3W05A 5IAGA 4RVOA 3T38A 1JQAA 2WC1A 4RJTA 5AK5A 1ZD3A 3PPIA 1A96A 2DHQA 1AQYA 4TLEA 2QL9A 4MWZA 3NIWA 2WD7B 3MPUA 3R7BA 1CY2A 1MHPA 5KMGB 2HH9A 1M2OB 5AXCA 4RW0A 3KWJA 5DN6A 5JSUA 1TPYA 4YIHA 2PX2A 3C3MA 4V39A 3HA5A 2Y4NA 4L9WA 1P4JA 2XYPA 5KNCH 3RIMA 4GXRA 4HADA 2EX1A 2XTMA 1X9GA 5EQFA 2QN1A 2ZI4A 3INYA 4IV0A 2FW1A 4E5NA 3I8SA 2GJ8A 3E84A 3KT3A 3RCBA 3D0QA 3UK2A 3RVSA 1JNYA 2VP6A 1TT5B 2XQVA 2IEAA 3L93A 3M6UA 4YRTA 2AJTA 2ZBVA 3JQRA 1X7GA 4NAUA 4KPFC 2CUZA 1UM9A 4IDHA 4PO3X 2YXNA 4NBTA 1KYQA 1JJ7A 1THZA 1EGHA 3EMVA 1TPZA 1WABA 4PCLA 1V4NA 1QHEA 1RCTE 5D84A 1NW7A 4PCAA 2JLYA 4CDGA 4A1FA 1YOVB 2WICA 3HL4A 2FQQA 1SXHA 3AONB 2GESA 2RH9B 5DTEA 4RNCA 1NGSA 3H65A 4D9CA 2YXBA 1NUAA 3G82C 4EYOA 3EUWA 2MINB 4QGFA 3RSLA 1RPJA 2YY6A 4RGQA 2IYQA 4U2GA 1NVKA 4J6EA 4UCFA 3FNQA 4DT1B 1NR5A 5B2ZA 1IOLA 3H75A 2I8CA 1CFJA 1YA8A 3F3KA 2NSJA 2VPQA 2N9UA 3E3OA 3IXMA 3LXXA 4ZI3A 2WTNA 1UCFA 1CP2A 1KQGA 2QW1A 5M7EA 3HI6A 1SNYA 5FA6A 4MKHA 4R1UA 1TZBA 5CX1B 2Q6TA 1NBHA 3R0JA 3T34A 5J47A 2A1TS 2D5IA 1VZ2A 2X6QA 1P72A 1HSOA 3OO1A 4RXUA 4B6GA 5B6JA 1BD4A 1KY5A 1FBNA 2HA6A 2FEXA 3DNMA 1J8QA 3GW8A 1JFLA 1XN4A 2LR0A 3L7CA 3O92A 3OZIA 1AQLA 1O03A 1US8B 3V46A 4ZYYA 1RHMA 3GMDA 5EUCA 4B82A 1IL0A 1YKSA 2VSYA 4QUEA 1JVBA 4INPA 4YWJA 5H68A 4BJ1A 2HLPA 2QRVB 4PGFA 5ABPA 2GJAA 1JUDA 5F9HA 3TDMA 3NNNA 4AU1A 1BMDA 3MINB 4ZJYA 5FPSA 4JQZA 4KR6A 4D45A 4PLCA 5AJHA 3HWSA 4UFPA 1ODJA 4FB4A 2QZJA 4YCAA 3D02A 4TWBA 1WUYA 2LPMA 4ZQBA 1BX1A 1VBFA 1S2IA 3MT9A 3TOXA 4ZALA 1TI7A 3PGKA 3QVWA 3TK1A 3LWNA 1E63A 1FS5A 3QFHA 2R25B 4I1SA 4LHVA 4PW0A 4KE8A 3KQTA 4MR8B 2J6BA 2OBBA 2W8BB 4RVNA 5EZYA 2G4LA 4DY4A 4OSPA 4X54A 3T3NA 2C00A 4GPAA 4A8JC 3VBCA 1YQTA 1CJMA 4OBEA 1CUEA 5K0JA 3I83A 3DLHA 3UCXA 1XK6A 3HNRA 4MHSA 3G3EA 4O4IF 1C50A 1V35A 2AWNA 1QS0A 2X14A 5ALDA 2Q0SA 3DB2A 1SK9A 1T3GA 3ESAA 3CH4B 3F46A 4G9GA 3WIDA 5BUSA 2LUOA 2B99A 1A7KA 1J09A 1L8LA 4RGYA 4BKPA 4DEYA 4YDQA 2C83A 3CG0A 4MKGA 3OPNA 2I2DA 3VFDA 5A0VA 4G84A 4AKIA 5DGXA 4NV0A 4X91A 2G6BA 2HF8A 4YJHB 1XQWA 2Q0HA 2IYAA 4LE2A 3AU9A 3L7JA 3FUCA 3B6KA 3HVRA 3PXGA 4PSDA 2QSZA 2VAMA 3GZ4A 4RD1A 4WXEA 4DLAA 2G8LA 3U2QA 1VL0A 2C7OA 3AVTA 1JHAA 4YCBA 4E5YA 2JAWA 4B75A 2OD2A 1VM6A 2WNSA 4YMVA 1QH9A 4H6XA 1X9IA 2KBEA 2ZE7A 3EEBA 4LVNA 3VU9A 4EPVA 2R8PA 5IYZB 4KACA 2OWEA 2BCGY 4EAQA 1F2TB 4UE6A 5CA0F 2MMGA 5KJ6A 1PZNA 2GETA 3C3BA 4B4UA 1KQPA 2VAXA 3D5EA 2C2WA 1JALA 1GAWA 3CA8A 2BFOA 3D3QA 3PYLA 2P3SA 1O97C 3FYHA 3SXPA 4E51A 2A7XA 2ZYVX 3HJTA 1CK4A 4ZEMA 3PFFA 5LU8A 2OHHA 3RSCA 1X80A 1CR4A 3ANNA 2I1VB 3RSZA 3ZDBA 1U8CB 1OFHA 1NNUA 1Z8HA 3PWTA 2BR4A 3WB2A 2ZJOA 1BEUB 3FOFC 3W6OA 1P4HA 1XAJA 2QTAA 3H99A 3S3TA 4EJ0A 1XHLA 2IYVA 3UCFA 2P5TB 4MICA 1ZNYA 1R5BA 2EYQA 4YUZA 1GSAA 4KFTA 5F9FA 4J16A 1UBTS 4LHXA 5I3ZA 4WLOA 4BV9A 3WQRA 1GTJ1 1PTJA 4OVKA 4QRHA 4KL8S 4RNDB 4UVGA 3TIFA 3EDOA 3CLHA 1KAOA 2VXCA 3C1TA 3HFSA 3IQHX 1NOIA 5E3HA 4BPBA 4RDHA 4GKVA 1XZEA 3CRMA 4MI1A 4QYMA 3ENNA 4IZOA 1L7EA 1ZL2A 1YIAA 2R60A 1P81A 4R3UC 1EP9A 5CCDA 3SKYA 3DXFA 2OORA 5HM6A 4Z7OB 1ATZA 4Y2XA 2XSZD 1I1QB 4G8DA 4JYBA 2AFIA 2ISCA 3HBAA 1JPJA 3F47A 3NEJA 4FP9A 4RPHA 4F04A 2P4SA 2VF5X 4DMCA 1C9YA 2R4TA 3VGJA 2Z1MA 1QTIA 1E2EA 3NBFA 3O8RA 2J0EA 3BXOA 4PTYA 4Y6QA 3VYRB 4BFWA 2WQ7A 1AG9A 2B3DA 3LXRA 4G8BA 4PQRA 2B34A 3BRQA 1C1DB 3MOGA 3QWIA 4FC7A 1C1XB 1N75A 2WMDA 3AUYA 1OHHD 2D8MA 4G0OA 4KV9A 5F12A 5FYQA 1GPAA 1MPXA 2UZ0A 3K96A 3CVXA 4UKDA 4P36A 3CNEA 2EEPA 1U1IA 2Q21A 4CGYA 1YNSA 1I8TA 2GCOA 3HCRA 3Q0EA 3RD5A 1ZJWA 1G8GA 4L5IA 3S2SA 1JXAA 1II9A 5HZKA 1OLOA 1OCEA 4DEVA 1OASA 3T12A 2O6HA 3C6BA 3QPBA 4YONB 4LTDA 2J9FA 1H6AA 4PBRA 2ABWA 2QRVA 5CLIA 4G4SP 3L84A 4HWGA 3NGLA 5HZMA 5G53C 4YPFA 2YJNA 1KFJB 2NG1A 2EP7A 5KX5B 2GTPA 1V26A 2GZ1A 1HC7A 1K0FA 2MSEB 3QIVA 2OV3A 2WD9A 2XWJI 1GAQA 2V97A 2XHZA 3T7IA 2JLSA 2C2GA 3AFGA 2I66A 2RHJA 1E60A 2G70A 4OLBA 5DSZA 3MN1A 1I4WA 1SOUA 5HRCA 1ONPA 4TV8A 2D59A 4IS3A 2XRFA 3OQBA 5F76A 4G89A 4UEKA 1WG8A 5FBRB 1AKYA 1HLPA 2BV3A 4FXOA 3H5AA 3IPAA 3E3NA 1A76A 1R4MB 3PJGA 4OO3A 3IXLA 4HEJA 1OAKA 2I80A 4W8OA 5F3WB 1TD9A 3OHSX 5ENZA 1XELA 5K4AA 4ZMRA 5CXSA 3WGMA 1ZIXA 2WD8A 1HXHA 1U3VA 3H0EA 3QE9Y 1B6SA 3O4IA 1JDVA 3VC1A 1KAMA 3ETEA 3KTOA 2HEIA 2Q3MA 5BN5A 4KR3A 5K6AC 5IZCC 1EFCA 2GM3A 3SBXA 5JDCA 1N7GA 3FMOB 3O4FA 1DS6A 2FFHA 5AKYA 2QUJA 4WNYA 3HXOA 5HF9A 3WGKA 5CD1A 4PAWA 1GPDG 3W5BA 4TL6A 3NRCA 5A4FS 3R8XA 4CT0A 5BSKA 3C70A 3TVYA 1E4OA 3ZOZA 4DNOA 2DUMA 3ZE8A 2VO1A 4EUKA 5JJBA 2AI2A 1RQ7A 4Z4QA 4MB6A 4C03A 5BV7A 1GPWB 4RJKA 4JLDA 1FP1D 1RI3A 1X7ZA 2ODWA 3WRXC 1XAIA 2HJVA 1PUXA 1FIUA 1WXFA 3GOQA 5I9LA 4N4AA 2D2XA 1KDTA 1C29B 1GFSA 3U19A 4EAAA 1NJ1A 2ZVJA 4QYIA 3RE1A 2FQWA 3KQVA 4I50F 1LBTA 1SH7A 2I4OA 1E94E 3CR3C 3IAEA 5FADA 3T3GA 5G1OA 4FYHA 3OUZA 1WVGA 4L4SA 3TB6A 3LFUA 2P11A 1P74A 3FLBA 4HPXB 5KTKA 3OX3A 3GIDA 4EKGA 3TVTA 2VDWB 3GEIA 5JCPA 2HBQA 2OHXA 2JVKA 3X1JA 2WRZA 5JSYA 3EC1A 4Y18A 1H9CA 5JAHA 1P7PA 3G5MA 3CVVA 2HN9A 1ZR2A 3S81A 4EX6A 2VOEA 4GSYA 4OB7A 1VL6A 2ODQA 2PGIA 2I2XB 3G85A 4K2HA 2B4TO 4PPQA 2DFNA 2UZ4A 2JI4A 3I5MA 4IEEA 3KVOA 2JD2A 1YJQA 2FZCA 3BQ9A 3CBQA 1P3Y1 3QXCA 4OJQA 1M34A 3NTVA 3OWOA 4ZQFA 1Q1AA 1U6KA 1L6RA 5PNTA 3FCSB 3EGDB 5IXJA 5BV2P 3AIKA 1SIWA 3AMVA 2NO0A 1KBQA 5HF8A 1EE9A 2D62A 1P7WA 5GVRA 3RVRA 1VI2A 4MXDA 5EKXA 5CDFA 4DF3A 4Z2AA 4MW9A 5K0FA 2CDAA 3HBMA 2Z3WA 2GD1O 2DQSA 3ETDA 2EGUA 1R0YA 4EYGA 4W4TA 1HKUA 2CE2X 2JAQA 3ELBA 1ODIA 1I4LD 4BKQA 2ZIXB 3AILA 2QIOA 4BNUA 4ZV4A 1DI0A 4AVYA 2XE8A 4YO8A 1KDYA 4KQWA 2C9CA 2YBEA 2BPOA 3ZD6A 5DM70 2IXFA 3HKDA 3CZ4A 1OX4A 3C48A 3NFRA 3R3HA 4RK4A 2QB5A 5ITZA 1N6IA 2WDZA 5G2OA 4JQSA 5DVZA 4RIGA 3OLCX 3DD5A 4YAEA 1CYEA 5LJIA 3GLGA 5KWEA 4OREX 1VE5A 3R3UA 4XWGA 4OM7A 3IEPA 2NPIA 5E4JA 5LYJF 1BC5A 3F78A 4Q18A 5HNKA 4ARUA 1XLUA 3M5PA 3Q6IA 3RLFA 4MO9A 2GZRA 2ZJFA 3T6KA 4DJFC 4EF4A 4IDQA 2MINA 2GAFA 3T8YA 3P71T 4B43A 3K3PA 3WK7A 2AKEA 1Z47A 5FUWA 3LCVB 3H1BA 2ZULA 4BIIA 3CW9A 1IUNA 3VM6A 4HVCA 2QORA 3GPBA 2UDPA 2V58A 3KZ1E 3KQPA 1ZJYA 3JVIA 2G7ZA 2NO9A 4U39A 3WY9A 4HT3B 2YFYA 4I4TA 2FSHA 4YP1A 5FP0A 3ZUPA 5DYGA 1VLQA 1FMLA 1K3TA 1SCIA 1BHQ1 5EIFA 5HXAA 3PQ7A 5EXSA 1MKYA 4U9HS 2Q1YA 5EZSA 3WGZA 4E70A 1Z0JA 2ACEA 1OJ7A 4I99A 1W2WB 2PQ0A 3N76A 3OEHA 3C41J 4MVJH 1N5RA 5BWMA 1Y8ZA 2ONCA 1OREA 1V1JA 1CZHA 1I2DA 1VDZA 3A04A 3A06A 2IP1A 4K9QA 2QXYA 2ZR7A 4MNTA 4QQ8A 3GBPA 2ET6A 1HFKA 1MNAA 2HADA 2VSFA 3JSAA 4U6SA 3BIJA 4YN3A 2IHBA 3MHTA 1DCKA 1DKQA 4M86A 4NU5A 3OQMA 1EB9A 1R6BX 2XRMA 1BVUA 1WZUA 3JR3A 3BKXA 2YV1A 3EVAA 3OQJA 2GOYA 4WRRA 3TD2A 1AO3A 4JVMA 3ZIAD 4WECA 4XGQA 1W88B 2RC6A 1XQXA 1ZH6A 1S01A 1OI7A 1P33A 4N9WA 2RGDA 1GITA 4TV8F 4DWJA 2DULA 2BGWA 1UBCA 4JBHA 1PT7A 2O2ZA 4HI0E 4TT3D 1G8JA 3X1XA 4EPYA 4CUZA 1FYEA 3KFLA 3UJBA 3FYTA 4OA8A 3VR4A 3SVLA 3ROEA 3HR8A 4LJAA 4M53A 1Q0ZA 1FFBA 1OZFA 2ZYAA 1PK8A 4ILEA 3WKAA 4KRYA 2ZUBA 3LCJA 4Z54A 4QE3A 2WF7A 4TQUS 1BQ4A 2B1IA 2F64A 4Q7MB 4U6QA 3VPCA 1XCGB 1Q7GA 2C59A 3WQBA 2OO3A 1IIRA 1J56A 1FFAA 1BWQA 1YZQA 3LO8A 2ZYUX 3MTJA 3PGVA 2NSDA 3K0EA 1QIMA 5AM0A 4YAGA 3MJFA 2O1XA 3AESA 5DISB 1YUMA 3VVMA 2LKCA 2G06A 2QR3A 2F62A 2VNJA 3DTVD 3NT2A 1W5TA 4FCWA 4JQOA 5IM5A 3D6VA 5A06A 1Z4MA 3MVEA 4LXIA 3SDSA 4EGCB 4EUSA 3DAYA 3ZE1B 4XD2A 1W30A 1DUVG 4BNJA 3JYHA 5BMOA 2BFAA 4EGAA 3LP6A 1KYXA 3HJFA 3H1PA 4NZNA 4XIGS 3MM4A 4MJLA 1QBKC 1T3TA 1YSCA 2X40A 1W59A 2PGAA 4YJ2B 3THSA 3H4TA 4XAQA 1R50A 5FPKA 4K40A 4O0MA 3DBVO 3J81A 3SFTA 4E3WA 5HK8A 3MUFA 4FX5A 3KLBA 4FHGA 5LXTB 2RK4A 3HTXA 4FHDA 4R8MA 1EG2A 1QRRA 1U3UA 3AR5A 1DEHA 3K7EA 4M8KA 2XAUA 4YAFA 3LPCA 1Y4SA 1QZTA 1WLSA 1MH1A 1UJ2A 3DL4A 3ZGXA 3D2CA 1L5HB 4NY1A 4XWWA 3GAFA 1D9XA 4LVUA 1ILEA 4EG3A 1K9SA 1N6HA 5DLDA 2XZPA 1N5DA 3FTEA 1U9YA 1S7GA 3CX7A 2QY9A 4IUYA 4CMEA 2G0AA 3S29A 3V9AA 1G21E 1YMVA 3C45A 5CEFA 1IY1A 1NVVQ 4NPAA 3PITA 2AJDA 1SCKA 5EY5B 2KQUA 1SXJE 3SHOA 2J59A 3UYKA 2QLNA 1HDCA 2PSFA 1BKDR 2XZTA 5FKJA 3QEAZ 3WP0A 4PLPA 1SQ0A 4RYDA 3PJEA 2F1RA 4X41A 1UPUA 3GEDA 3FDJA 3GDHA 1S8AA 3H2ZA 4W7IA 4JL8A 5ULLA 4BZXA 1I24A 3T9CA 1EK5A 5CW2A 1RKUA 2IYOA 2J67A 5CFZA 1S2LA 1QBGA 1Q6ZA 3MRTA 5LBTA 4TQ9A 4B3XA 5TJ9A 1GLGA 4DC9A 5IULC 3ZI7A 4Z1MD 2AJCA 2VA9A 2RE8A 1FRZA 1JB9A 1DWQA 1MHTA 1KO8A 1O94D 2QXUA 1JA1A 4RQTA 3M6VA 1SVKA 2VTVA 3G0BA 1KI7A 5J9FA 1JAZA 1PVVA 2OLJA 4K2AA 2WFAA 3H5OA 3HKCB 1YZUA 2I7DA 1QV6A 3CUEF 4LF8B 1TECE 4TYNA 1PJZA 3T5BA 3K30A 2FPOA 2V03A 1NVMB 4BC1A 5BSVA 3GGCA 4N47A 1E2BA 5F7JA 2IUEA 5F2NA 1E3SA 4QYSA 4I8XA 3BD7A 4XUEA 4RQUA 1WXHA 1VSTA 3MWDA 1JHXA 3GFFA 3NMUF 4IZ6A 2NV2B 1LBIA 2V0CA 1U28C 2QTWB 2VUUA 3O1LA 3F8WA 4EW2A 1V11B 1PFKA 4W8HA 4EK9A 1HDOA 2W0SA 4JC5A 4OBWA 1P44A 2YJ4A 2PPLA 4WLVA 5HKBA 1T9GR 4C30A 2JASA 3SX2A 1EK6A 2Q1WA 1AHIA 2H1LA 4QRIA 4OQ4A 3WRYC 3GLFA 4BKUA 4WLNA 3LS2A 1AB5A 1W9HA 1UAAA 3SQNA 2B7BA 1KR5A 2QZ4A 3NV9A 4TOIA 3UZUA 3ZV3A 4REQB 3VTFA 4ZVOA 1XD8A 2CFSA 3EG9B 2EGGA 2AXNA 3AEZA 4NSNA 2E49A 2OBNA 5CDUA 3BWCA 5JOQA 3Q72A 5KYKA 2ORIA 3JYQA 4U2EA 5HGXA 5H7XA 2NU8B 1Y1LA 1XXLA 2K4MA 2OT3B 5A1TA 4EG5A 2E7ZA 4MYCA 2UUOA 4H7JA 2E5FA 1B26A 2HI0A 1EXDA 5C4MA 1KMHA 4C9BA 1E8NA 2WG0A 1XZQA 2P67A 3O8QB 4W5RA 2J9XB 2X8JB 3FBGA 4UU0A 4WSOA 5FORA 1EJ6A 1RRCA 2UAGA 4JLPA 4LN1A 3H3FA 2QX9A 1QTNA 4NG4A 3SF8A 1SRRA 1U63A 2ZZMA 3RYFB 2OXFA 4JJ8A 3TZHA 4N65A 1HGXA 1I14A 5A5VA 2NVBA 1LSUA 4Q4CA 3C3EA 4O2BB 9LDBA 2DR2A 4WEQA 2G1JA 4OB6A 4BNLA 2J3KA 1CTQA 2JFXA 3PNLA 5EI5A 3COVA 2YJZA 4CXMA 1UBOS 3IOEA 1OU0A 3KWFA 2Q4RA 3LBNA 4QUAA 4PG8A 4RTNA 1R5OA 3R9IA 2Z6VA 3N2GB 1RNLA 2E4UA 1DAMA 1G7SA 1UDXA 1Z2EA 1H5UA 1Z7WA 2FMKA 3KXPA 3ZJYA 3U61B 2Z5VA 4WD3A 2J5XA 4ETMA 4RMJA 3WFJA 3F0TA 3U3DA 4EOGA 5BWLA 5U1PA 1Q1NA 3OO0A 1YJBA 4GOXA 2XQJA 3P2KA 1G42A 2DWUA 1XF9A 2PKEA 5LYYA 2IYWA 2HA5A 1GXSA 1U8YA 3ZGLA 2RD2A 1FX1A 2AKYA 3BAZA 3PK0A 3THWA 1ZUHA 3O9ZA 3B6MA 3H9UA 1DBIA 1G1MA 1Z3CA 1K88A 2IEBA 4ESOA 1Y80A 4CODB 1YQQA 3UUEA 3PUHA 1R0XA 4KDRA 1QF9A 3KLNA 5IRCD 1JIJA 1EWQA 1K0UA 1I2ZA 2DT8A 1FYWA 3MJEA 4HNAA 3N5KA 1JXQA 4Y1FA 3JS5A 4AKTA 4XVUA 5EMHA 1DZ3A 2RFLA 4QU0A 1NDHA 1OIVA 4MWTA 3U4GA 4BB5A 5AHRA 3G0OA 4Y0VA 4HNQA 4PF1A 4ERNA 3FYCA 3H84A 3HVKA 1NXOA 5CLFA 4IIUA 1UWKA 2CL7X 4CEJA 5FL3A 2FDRA 3OTQA 5C4IA 3D59A 2CNWA 1KZ6A 2QTHA 3AEUB 1EFVB 3AHEA 2JDID 1DAPA 1JHRA 3K94A 4MR9A 4AIIA 2D5LA 2MT9A 2TS1A 5F64A 1YZYA 3PENA 4GEGA 1YCFA 1XX6A 4MQ5A 4MV4A 2XNKA 1I80A 2GO1A 3IEIA 3O4HA 2MSNA 1VC2A 3N2KB 1DDOA 5EP1A 4EMTA 5IAOA 3S6JA 1PEKE 1NKSA 3N5CA 5CJJA 1PT5A 4UUBA 5HHTA 1WB4A 3HA2A 3R44A 3ADPA 1FTQA 3BCSA 3GA7A 4L8FA 4M9UA 4U02A 1L7PA 4N03A 4YAJA 3T5GA 1RYZA 3ZGOA 3ZV4A 421PA 1PTJC 2Y71A 4KXLA 4IIEA 5BSEA 3B9PA 3FSGA 4MYTA 1KKUA 1C9JA 2R2GA 1W581 2O07A 3AV0B 4EO9A 1UINA 4LOKA 1ZC3A 4LF6B 5ED0A 2WIBA 2PL9A 1U0TA 4EJ6A 1XTJA 5REQA 2C5SA 5LIPA 1UPAA 2QX8A 2UZ1A 1LPNA 2MSKA 4XM2A 1LX6A 1L7NA 1YKGA 1QGZA 1HZZA 1HSZA 3CUKA 3W9UA 3EGDA 4EI9A 1P4RA 2BM9A 3HUTA 4QULA 3FTFA 4L73A 1Y7PA 3BJRA 3G17A 1HLFA 5ALPA 3VZCA 4BEWA 3U31A 5AKEA 5EIEA 1ACJA 5I6DA 4YY3B 1D2GA 1O97D 4AZ0B 1M74A 2QA5A 3EZLA 2X9NA 1SUFA 4KQIA 3C8DA 1PKEA 4GL4A 5K3BA 2X7JA 2J9FB 3TMAA 3UMMA 3EN0A 3IQWA 3MJ4A 5L8VA 1T3LA 1CIPA 1XMPA 2FWPA 4HOYA 4RSGA 2FFBA 2Q9CA 4TT3A 1W5BA 2Q6KA 3D2BA 1KERA 1JDBC 2PMBA 1E2IA 1B0ZA 1LFDB 4LYFA 4ER5A 3V4RA 4EI2A 4RIEA 1E5TA 3BPSA 3DW1X 4AKEA 1LNZA 5CFRA 1WXEA 2BFCA 4D8WA 2I6GA 1LV8A 2JGJA 4XRGA 3K1ZA 2FZEA 4BQPA 1EFDN 5BN3A 4YXWA 1CQJB 2BWJA 1R3DA 2PCLA 1TM7E 1G20A 4QSMA 3E4CA 1JPUA 4X92A 4FHZA 4UTZA 3ZHQA 1H23A 5KREA 4X8LA 3GLFB 2IUYA 1QGUB 4HYYA 5F1PA 1FA9A 2JCBA 4YJ3F 1OLXA 2B6NA 3DZIA 3IBSA 3TFQA 3OA0A 4KPEC 4YRQA 3T9FA 1T8TA 1MX5A 2VCEA 2ZTMA 1TFUA 3HQ4O 3LLSA 3QU5A 4KK4A 3CF6R 1YVUA 2GYUA 9GPBA 1DO8A 3PVZA 2QN9A 4IDBA 2FFAA 3N8DA 1N92A 2ZEJA 3KTDA 4LVCA 1TVEA 5KQLA 1E98A 2QD3A 2FPXA 3RTEA 4OQZA 2VEDA 3IOBA 1L4GA 3IOCA 1IXRC 5TDHA 3SQOA 3JWIA 4O4JF 2P0YA 1T5DX 4WXYB 3S55A 2F8SA 4L1KA 4X8OA 2FZLA 1XCMA 4S35A 2W2KA 2JHAA 1SG9A 2E37A 4RVCA 3J80A 3U7FB 2XE7A 4Q4LA 1RLTA 3I5UA 3P96A 2BAGA 1XLWA 1RZVA 2WM2A 3IO3A 1M7BA 1QV7A 4IILA 4QUHA 5CTJA 5IC5A 4BCBA 2FGKA 2I7XA 2V6MA 1HNNA 1VXRA 3IDOA 4FFBB 5TGZA 2C82A 5A02A 4ZTBA 1XCPA 4OCZA 2VNSA 4P3OA 1PD1A 4ATNA 5J5CA 1RW4A 2YUIA 3VAYA 3MFQA 3QTLA 4HDNA 4XWAA 4BATA 3GRPA 4D9NA 1DJLA 5LQNA 3AW9A 4X65B 4TLCA 5F1YA 2O48X 2GKGA 2NQ2C 3UOGA 5GINE 4KGDA 1SVIA 1ZQ9A 2A0UA 2ODEA 3DHYA 4FZJA 2O2EA 1JKXA 2H31A 3B1WA 2VWQA 2WAXA 3KOOA 1DRJA 4FR5A 2HF9A 4MW4A 5JROA 1GTMA 1Q0LA 4UULA 5ADVA 3M1IA 2WYUA 3N2IA 3WZMA 4ABTA 2P62A 1ULTA 4W7SA 4QBGB 3Q0TA 3FHTA 1CUSA 2Z2XA 3IXQA 4GX0A 4UU1A 2R9VA 2Q99A 3A25A 1Z0IA 2O23A 2IYFA 3EFBA 3WMWA 4A0QA 3H7IA 2YWCA 4KVZA 1DAGA 5I7HA 4RY0A 2CMGA 1GNTA 2VHQA 3K1AB 3RSQA 4DTCA 3PI6A 3RS8A 2QYSA 3SQWA 1OWPA 4Z9YA 3RS0A 3D7LA 1ZI8A 2BZGA 2RIRA 2ZW9A 1XA3A 3HCCA 2GWRA 4XYEA 5EGNA 5IK2D 3BH0A 1BU8A 1Z0FA 3Q8MA 1S8FA 1HE8B 4JIGA 5TR9A 2HXGA 1GA1A 2RAUA 2YXEA 2R6JA 1LNSA 3DPSA 3TQRA 3TRJA 2IIVA 7YASA 2O8DA 1BRTA 3EASA 1LUAA 3D7MA 2XT6A 2GCPA 3DT6A 3EXG1 2SCUB 1HURA 5LQRA 3CVWA 1THGA 3MRSA 3GLGE 4BECA 3ZCTA 5K3SA 3HA7A 4N82A 4LKOA 1BJRE 4HWTA 1GRVA 1CIJA 2C7VA 1ZVKA 4I4TF 3NAMA 5FAXA 4GPZA 1RE0A 3VI4B 1ZK4A 1MB4A 3KKZA 4FDLA