3F6SA

Desulfovibrio desulfuricans (atcc 29577) oxidized flavodoxin alternate conformers
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
147
structure length
147
Chain Sequence
SKVLIVFGSSTGNTESIAQKLEELIAAGGHEVTLLNAADASAENLADGYDAVLFGCSAWGMEDLEMQDDFLSLFEEFDRIGLAGRKVAAFASGDQEYEHFCGAVPAIEERAKELGATIIAEGLKMEGDASNDPEAVASFAEDVLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Flavodoxin
publication title Pseudosymmetry, high copy number and twinning complicate the structure determination of Desulfovibrio desulfuricans (ATCC 29577) flavodoxin.
pubmed doi rcsb
source organism Desulfovibrio desulfuricans
total genus 50
structure length 147
sequence length 147
chains with identical sequence B, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3f6sA00
3HA2A 3N3BC 4HEQA 1OBVA 2FOXA 2XOEA 5LLDA 3L9XA 4ESEA 2FDXA 2A5LA 2MWMA 1SQSA 2Z9CA 3GFRA 2M6RA 3FNIA 1RLIA 1TLLA 4QOFA 3OVMA 4PTYA 1CZNA 2M6SA 1FLVA 3W7AA 1CZUA 2QX8A 4QOEA 1RLJA 3U7IA 2OHJA 1E5DA 2AMJA 5F51A 2R97A 1QRDA 2N1MA 2R96A 1ZWLA 4C14A 3GFSA 3K20A 4U7GA 1GG5A 3GFQA 5FA6A 1D03A 5ULLA 4FGKA 1AZLA 1CZLA 4PTZA 1B1CA 1AKQA 3F2VA 4BMOB 3F6SA 3LT5A 4LA4A 2ZKIA 1D4AA 4GQIA 4LTMA 3NLLA 1XI2A 3KEGA 1AKTA 3NHSA 3D7NA 3OX1A 3O73A 4Y9UA 5F12A 1T0IA 2X2OA 3G5MA 2BN4A 2OHHA 2V5UA 2BPOA 2Q62A 1AKWA 1FTGA 1FVXA 1FUEA 1FLDA 1XT6A 3NFRA 3UXHA 1YRHA 1BU5A 1AG9A 1V4BA 3OWXA 4ZVKA 2FLVA 3NHUA 1YCGA 5LBUA 5LJIA 1NNI1 3OWHA 4N65A 3OJWA 1XYYA 4LTDA 4HS4A 1J9ZA 3F90A 1F4PA 3FJOA 1ZWKA 1CZRA 5BUCA 1ZX1A 4PU0A 5LJLA 3B6MA 4M0CA 1FLAA 3NHWA 4LTNA 1J9EA 2QX4A 1KBOA 3FW1A 2QWXA 2GSWA 2Z9BA 1H69A 1CZHA 2QX6A 2D5IA 3TE7A 4DILA 4D02A 4QOGA 2MTBA 4U7FA 3UXEA 3B6JA 2MOKA 3HR4A 3OX2A 4H6PA 4QOHA 2W5UA 3W77A 4GI5A 3K1YA 2QX9A 1H66A 2BMVA 4BMPB 1FLNA 3NHFA 3S2YA 1C7FA 4C76A 3NHLA 4Y9RA 3NHKA 2FX2A 3NHJA 5B3KA 4NULA 1WSBA 1X77A 3GAMA 1DXQA 4QOJA 1AKRA 5LBTA 5JROA 2X2PA 4Y7CA 1QBGA 3QFRA 1QHEA 3W78A 1OFVA 1VMEA 3QFCA 4CF6A 2FAXA 4C0XA 1WSWA 3NHRA 3FVWA 3EYWA 5FX2A 1SG0A 4CETA 5FUQA 2BF4A 4S24A 3O2NA 1C7EA 2WC1A 1AKVA 1YCHA 3NHYA 3LCMA 1BVYF 1AMOA 2KLBA 4XDGA 2V5VA 1RTTA 2B3DA 1CZOA 3F6RA 1QR2A 5F4BA 5LMCA 4FGJA 4NLLA 2HNBA 1KBQA 2F1OA 4OXXA 4ZVLA 4YAFA 4C0WA 1JA0A 3HLYA 2FZVA 4H2DA 3KAQA 3TZBA 1YCFA 3ZHOA 1RCFA 4YQEA 1D04A 3W79A 4R81A 3ESZA 3JSXA 5LVAA 3ESYA 2KQUA 1CZKA 2FZ5A 5A4KA 4ZVNA 4FX2A 4DIKA 4QODA 3R6WA 4F8YA 2Q9UA 5NULA 2Z98A 2MT9A 3OX3A 1AHNA 5EA2A 4ICIA 4YALA 2QMZA 1T5BA 2FVXA 2ARKA 2RG1A 3B6KA 4QOIA 3QE2A 2OYSA 3N3AC 1I1OA 2QR2A 5NLLA 3OJXA 1J9GA 1DX9A 2HPVA 3TEMA 2V9CA 5TGZA 3ES9A 2Z9DA 4YAOA 3NHPA 2XODA 1FX1A 3SVLA 2HNAA 3N39C 3B6IA 4N9QA 4ZVMA 1YKGA 3U7RA 4FGLA 3RPEA 5B3LA 3P0RA 1XYVA 1JA1A 2OHIA 4YAWA 3KLBA 5EAIA 4XDHA 1YOBA 4N82A 4U7HA 4DY4A 2FCRA 4J8PA 4LAFA 3L9WA 4GR9A 1DXOA 1OBOA 1J8QA 3KAPA 2QMYA 2BZSA 3ESXA 4YAUA 1AKUA 1YDGA 3FX2A 6NULA 5EMNA 1TIKA 3EDOA
chains in the Genus database with same CATH superfamily
3AF4A 4QWWA 5TGTA 2JLVA 2XEDA 3KLNA 2HU7A 3OZDA 3KYJB 4DDMA 4UD2A 2HBQA 1CC1S 3IQHX 5I4KA 4E21A 1QX4A 4WNYA 4Z51A 2WUWE 5LA6B 3WVNA 1N6KA 2XE4A 4B1FA 5JH7B 1OFUA 3HDTA 2O0JA 1XB2A 1FNSA 1V7PC 3L92A 3T1YB 2X15A 3NWOA 3ZGZA 1LF5A 2B2NA 4I55B 3JVEA 4ZCSA 1JT2A 3A1NA 3W0LB 5JZBA 5TXGA 3G2OA 3H16A 2YWGA 3TR0A 1QZZA 5BWMA 3C8MA 5HSGA 5B6IA 4BNWA 4UARA 3BE8A 1X9HA 4D99A 2B36A 2AEFA 2HSEA 4LJAA 1NBOA 3SHOA 4EI7A 3DHEA 3WYCA 1C2TA 2OXRA 4MX8A 3ZXUB 4ZJPA 3GFRA 1BEUB 4FNMA 2Z3VA 2OXIA 4HRXA 1A96A 2X9VA 4D9BA 4HWGA 5BR8B 4KVFA 1DC6A 2OP0A 3IP6A 3LHIA 4HGPA 1V2GA 2YHUA 4NENB 4Q9HA 2I4RA 3OVMA 4PTYA 5KNBH 2VEDA 1M3SA 4QPDA 4MUKA 4QJ5A 1HBJA 4QU8A 2FW0A 3DOEA 4EHJA 2Y67A 4O3MA 4N3GA 3GUYA 5ADVA 1X7GA 2CZGA 1T91A 1S6YA 2OZKA 2R4UA 2Q5EA 4KX3A 4MVJG 4RH3A 4II3A 3JQAB 2DUNA 1R1DA 2J8ZA 3EARA 2X3FA 3NPMA 4HATA 2XD4A 3LVRE 4FFVA 3UW1A 4HGNA 2QZJA 2J5XA 4GXNA 4S2EA 1W5FA 4BQQA 1I24A 2QJWA 3B1YA 3NORA 3ZDCA 2D4AA 3OPVA 4N5MA 4UUMA 2UXDB 3PGA1 2NVUB 1E2NA 1X7YB 3WKCA 2GNPA 1U4OA 3GNQA 1V8PA 2XA9A 1GG5A 3GT3A 5H3HA 2Y1GA 3C6QA 3SHTA 4EVRA 5KYWA 4QUBA 1W44A 3L4JA 3K9NA 4CN9A 3BERA 1BA3A 1JEJA 3DZBA 4WV3A 3W9YA 1U2TA 3OETA 4L8VA 3DOCA 5KEIA 3GOHA 4B45A 1O5TA 4IINA 3EDMA 1KJNA 4FFBB 3L79A 4II7A 1DKLA 4KH1A 4AJPA 4PTZA 5FA5A 5EZYF 4FHDA 1Q14A 1VE7A 3R4VA 4GQAA 3ZIDA 3X0DA 4QTTB 2KHZA 1CY7A 2GYYA 2VF8A 3LWNA 2H00A 4O63O 1T4CB 1J99A 2WZDA 3M3PA 1ES9A 3QKSA 5K8CA 2O6LA 2MR6A 5DNWA 5F52A 4LF6B 4QICA 2YDXA 2PL9A 5KTYA 3EWSA 2H2GA 1HWYA 5HKKD 5JQGB 5IANA 1OIWA 5J2TB 3WQQA 5JS1A 3PF9A 5J1TB 3ZHSA 2ZAYA 1E3TA 4ID3A 4R2JA 5HFAA 2X7JA 2BMWA 1J8MF 1KYQA 3O73A 3OX1A 3QU9A 4M1YA 4URYR 4UU7A 1YR7A 2OSBA 4YYEA 1QO0A 1ZCJA 3OTGA 2ZSAA 1GFZA 2QMQA 2X2OA 2B69A 3FCOA 2CMGA 3M34A 4OXNA 3IS3A 3EQ7A 1NQWA 3R3VA 3VPFA 1GU7A 1XZPA 2IPLA 3TD2A 1C14A 1SPBS 3PC2A 1ZOLA 1DL5A 1I0IA 4FOTA 1NVEA 4FD2A 3RTAA 1ZZEA 2SCUB 4OO3A 2H7YA 4Q9DA 3TDNA 1A88A 2JEZA 2XOKD 4ZMRA 3D81A 3I2GA 2BSAA 5LOVB 2HD4A 3HTXA 1RJ9A 5FWAA 2G9ZA 3LLSA 3SVTA 3GP5A 1U2EA 2RB4A 4AZ3B 5BV8A 3DJYA 1W0KD 3JWJA 4OQDA 4U7HA 1YRHA 2G1KA 1A69A 2Z3WA 4NBVA 5FTKA 3H2YA 3Q3IA 3BJEA 1GZ3A 1H4VB 1L5OA 4WZZA 3JQPA 5EJ5A 4I08A 2O8NA 4K6HA 2DEUA 1QGUA 2CF6A 1YZFA 4Q37A 2F8MA 4O4HB 4I6EA 5ER9A 3ZBPA 2OGUA 2VP0A 4M1WA 4GLOA 5JJKA 2WUEA 2QY9A 1KQPA 1GYRA 1NNI1 2ZRBA 4CL3A 1T1GA 2FN8A 1XRRA 4GP9A 1N2IA 3U44A 4ASUD 1FMLA 2HLHA 3C98A 4AB1A 2EFYA 4D9JA 1QIIA 2V7EA 3IV6A 1GU0A 2XNDA 1AQYA 2E4UA 2IEDA 2C61A 2Y6UA 3DBLB 4FMPA 5ALGA 1EFKA 2NZ2A 3IXMA 1L7AA 5CM8B 4C7BA 2XQVA 4RMJA 1V5FA 3NIBA 1ZHHA 2YVUA 4IF4A 2QAGC 5G40A 1EXDA 3LLMA 3LPNA 3OZXA 1AF7A 3WRYC 4RA9B 4DRXB 1SQFA 2QWXA 3IBCA 1KMHB 2BM0A 4GO1A 1JI3A 5K20A 5KOHA 4IX1A 3Q5DA 1NNEA 3N53A 1IQPA 1CFJA 1FYWA 4RY0A 3WMGA 5EHNA 1YMUA 3M1LA 4KRXA 4H08A 1DEHA 1U5CA 1D6MA 4D44A 3HJUA 3LT1A 1BMFD 4R5HA 5LP1A 2OPBA 2WMOB 1CZHA 1K98A 4ZVTA 1KI7A 3KWJA 3OA2A 4GC9A 2JAXA 4QPPA 2D5IA 3K0BA 3SJBA 3UMSA 3V3TA 3DAFA 3HB7A 3TE7A 3GLIA 4DV7B 2DKNA 4KPGA 2J31A 4RPGA 1FYEA 2ID4A 3OZGA 5B1IA 4IIVA 5JLJA 2XKAA 5KTMA 1EK2A 1L7BA 3OM1A 4HN4B 5AKEA 5IAKA 4D02A 3V6MA 4Y8VA 3ZE7A 1S2LA 2GZ2A 2HX1A 2Z30A 3FYSA 3I3SR 5D00A 4EGAA 3WGNA 2HW8A 5C5IA 4H16A 2PUDA 4WGGA 5U9CA 2W6IA 3CO5A 4Y2QA 1WAMA 2WD7A 2I03A 2Y99A 3P0HA 2FUEA 4OXIA 5DV9A 5CCDA 5TQVA 4JZYA 3W3AA 3BUSA 4TXNA 3WGVA 4BXOA 3QFHA 3H2BA 2HMUA 1NE2A 3P4UA 4YEDA 4PONA 4EJFA 1FXWF 1ULTA 1Z45A 2PZ8A 3FN4A 3R23A 2RK3A 5AK0A 4K26A 7MDHA 1SH7A 2B9VA 3TAHA 4C22A 1E89A 2E4AA 3CLSD 3FCYA 3UFBA 1ZA2A 1Z6TA 3NETA 3JR7A 3Q3EA 4W8GA 2FG5A 2VNKA 4NMMA 5AXDA 3ZK7A 2CUTA 3V8NA 3K6RA 2W2LA 1GTVA 1V43A 2TS1A 3UT5A 4EY6A 3AR6A 4BVKA 2HK9A 1E1DA 3NHKA 2O07A 4BJ3A 1UMBA 2BWJA 4NEQA 3CVOA 1P29A 3HKBA 3VPCA 1P2DA 2GFQA 4RHFA 4QSHA 2X4DA 3CUYA 4KUEA 4PLZA 3HL4A 1AY0A 1Y6JA 2OK8A 4KXQA 4OI2A 4XQ0A 3SC6A 3LE8A 3UG6A 2FUKA 4ZYWA 3HKCA 4QOJA 4DC0A 5EG5A 3CZMA 3H8SA 3LF1A 5I7VA 3IULA 4V1CA 3PUYA 3I2KA 1JDNA 4GOJA 4C3OB 3QPCA 1TZJA 2G6TA 2W58A 1I2AA 1KI9A 1WXWA 3HFJA 4NARA 4OHFA 1ECLA 2EJVA 5AJHA 4A0FA 3E9YA 1I7QB 1R15A 3MJVA 1BW9B 4DF3A 5C1OA 4DCMA 4K6FA 3RROA 1QHEA 2P9ZA 3NUQA 4DZRA 1XU7A 5JPDA 2XE7A 1JFLA 1ZD9A 3BRQA 4JQZA 5LQCA 1K5HA 3BDAA 4L4SA 3BRWA 3H1GA 4P58A 4WN9A 1D6SA 4QQNA 5J2UA 3SN6A 3E3AA 1L1EA 1ORDA 2YMPA 3KEFA 1M7BA 2ZIVB 3MAAC 3V80A 1XD9A 2WILA 4C0XA 4DIDA 3UHFA 2OV8A 4YMVA 3WZMA 4PPQA 4D0LB 3GJ0A 4EAQA 4EMSA 2CZQA 3DYVA 4MP3A 1JYFA 4X7RA 3DEAA 4KLCA 4WZBB 2FPXA 2AKYA 1TVKB 1I2MA 3WGIA 4ZVSA 2GF2A 2J7KA 2O2YA 4K3UA 1RRVA 5DW0A 1MENA 2IVFA 2G36A 3M2TA 3P1JA 4K6CA 2WC1A 2XCUA 4JAVC 4XWGA 3RU2A 5AVVA 5E4YA 2Q5OA 3AEUA 3I04M 2COKA 4WCFB 2DPYA 5JVDB 3T12A 3I92A 2X3UA 5AO9A 2VF7A 1VLJA 5D3MA 1MHPA 1MABA 1XXHE 2EHJA 2XVAA 4R5MA 5KOJB 1Y5NA 4UTVA 2I7TA 2AIRA 1VKNA 2UYYA 3GH3A 1Q21A 4E46A 2ZETA 4A23A 5EOVA 4FSDA 1HZJA 3ULKA 3JQ8B 2QTBA 2M6KA 2YOHA 2PQ6A 5T67A 1B8OA 2FSSA 3GLRA 3ILSA 3A4LA 4EI9A 4JA0A 4F97A 4XLTA 5JCOA 5ILGA 3VV3A 4CKCA 1K6EA 2AH5A 4U02A 3TIFA 5REQA 3W4IA 2DZDA 2AOVA 2OHOA 4M9SA 2PJZA 3SDBA 1OFTA 4B3MB 4YFVA 2OPHA 5C46F 2PH7A 3HO8A 4HG2A 1QQ6A 1I94B 3C7DB 4KYVA 1XU9A 3X1ZA 2IOFA 3VNUA 1QZ3A 4DMCA 4TXMA 3UK0A 2VUHB 4KFTA 5KZMB 4WESB 3DDUA 3IALA 4MUXA 4MMZB 1COZA 2PPVA 3TL3A 3Q0IA 4LKRA 2HRDA 3L8ZA 4ZVPA 2C4KA 2GCIA 4HZUA 3ZDDA 3ECSA 1GG8A 1D04A 1RWXA 4PQGA 3DFZA 3AOGA 2WFLA 3ZE2B 4D4LA 4KMRA 1QORA 5HQ3B 3CIOA 1SHUX 2C00A 2DFTA 2X76A 3HFRA 3IUQA 4B6OA 3MWEA 3PBKA 3ZZTA 2J46A 4QT4A 4F04A 3DUFB 5BY2A 4LY9A 4IEFB 2H48A 4ZHQF 2P90A 2VDOB 1U90A 4BHTA 1H1DA 4F56A 2HQOA 3R6WA 4O8CA 3D4NA 3KOMA 1PE0A 5CYGA 4ANFA 1OXMA 4X9XA 1M6VB 4IJQA 2ERXA 5C34B 2PH5A 4A2PA 2MT9A 3IEUA 3JYHA 2IUFA 4Q4AB 2QSZA 4DIBA 2CXHA 3KTAB 3VVLA 4DMUB 1ZMRA 3ENWA 2WZQA 1YBVA 2Z5VA 3KLOA 1GGEA 2GHTA 3KKPA 3KT8A 4A26A 1EWKA 4EYGA 1SXQA 4RD0A 1N33B 1XVUA 1NE7A 2CLCX 1E9CA 3WK8A 1PLJA 4W82A 4L9WA 4Z1OA 2A57A 3SOZA 1SBNE 5K8IA 3B6KA 13PKA 1BCSB 2JBHA 4PYKA 1KP3A 2BFEA 1R0ZA 1GSHA 1M54A 3ESBA 3K09A 3N3AC 2NADA 3C6XA 5BQOA 1OHHD 5KWVA 4MUJA 1DIRA 4IICA 4HWRA 3UWSA 3V8QA 5IVPA 2VJYA 3WV5A 1XO1A 3L4SO 1I13A 3P9CA 4W5OA 1EJ2A 2D2VA 4Q18A 2ZRQA 4U7DA 1JQAA 1E2PA 2GN4A 1HLPA 5A02A 4C04A 1IK4A 4MKXA 4ENQA 1GDDA 2P9CA 2I2AA 2V55B 3HYRA 3PHJA 4ON9A 2GB4A 4AXXA 2ASVA 4BB6A 3FZQA 4YV1A 1F4VA 1NQOA 1ZGAA 2P4HX 5BVGA 1T4BA 1DJPA 4HTFB 4AWAA 4QNNA 1UOQA 2SICE 3S68A 1OASA 2GCGA 1L7RA 2IZ1A 3EWIA 4JKOA 3W6PA 2H3HA 3ANSA 3CNOA 5LD2C 2PBLA 3F74A 3OP4A 4Q03A 5JFTA 4P32A 3PPYA 4PC1A 4QDKA 5F1OA 2YICA 4DJFC 1JXOA 1XTIA 2GXQA 3ITEA 1QOPB 2FMIA 3LNCA 3OIFA 2HWXA 4KE9A 4EUEA 2UDPA 3OM9A 3I6BA 4M54A 4JDUA 4JJ8A 3HB1A 2PIAA 1LLCA 1MIOA 1Y9DA 1R9NA 2DFPA 2XODA 2EZ4A 2QSYA 2H85A 3WLRA 5A6SB 3KQKA 1A4RA 4ZVRA 3KPUA 2O0HA 5FOVA 4F1JA 4WDQA 1H6CA 4OQQA 1CJKC 2ZOSA 3KJXA 3R74A 2EDCA 1LFAA 1JRLA 2Q4BA 2II6A 4UKDA 2PL1A 4KMMA 5FKJA 1K86A 1PL6A 2GKSA 3UJ7A 4OFXA 1SKBA 2H1FA 4A8PA 3I32A 2NO9A 3DDNA 1ISJA 3PUJA 4JITA 2K2QB 1U28C 3TKAA 4P4NA 4BO8A 4R01A 3E0QA 3CE9A 1MXFA 2JIPA 3QOWA 2ZB4A 4G0MA 4AS3A 4DG8A 4FB5A 2JFPA 2JGJA 2VP3A 3WQSB 1RPJA 2OOKA 3LOUA 1Y4UA 4BTVA 4DSTA 3MMPA 1B4DA 1SQ0A 3NOVA 3JD4A 3NCTA 3PD0A 2OFWA 4UFPA 3TRKA 3ETEA 4R71A 5K0TA 3EPJA 1SHZA 3U1TA 2ZI3A 1L8OA 4G0ZA 4DLLA 2H4YA 2GH1A 1G5TA 4QUJA 1WCWA 5JCJA 3B1VA 4RLSA 3H7AA 1CJBA 1JPVA 2I7VA 5LP6A 3JQ9C 1T6YA 1G98A 2Q3FA 4KQ9A 1Q1BA 2WMDA 1G4AE 3GJ7A 4N82A 1KO5A 1O97D 1IBMB 2B0CA 1T5LA 2F55A 3IUJA 2VQ6A 2HK7A 3LCUA 2CD7A 3ZS9A 5KYUA 1FFXA 4R8RA 3OFNA 1XAJA 2G9RA 1Y4SA 1ZMTA 1EUZA 2CFTA 2JC3A 1M6HA 2VZLA 4O0LA 3RYHA 3RYCB 1QFSA 2CK3D 3K9HA 5KCZA 2JW5A 5FDFA 5HJEA 2AXQA 2F7SA 1YOVB 2QTLA 5ALYA 2NVBA 1G3RA 2ZI9A 3WTCA 1WBBA 5LIPA 2AF3C 1CQIA 4K9NA 1BC5A 1E6EA 2GQ0A 4OHBA 1YDWA 4KCGA 5GZ1A 1XAIA 1YJQA 2BT4A 1RPNA 3BZBA 4P31A 5BSUA 4LSGA 3HWWA 4E5NA 1WVIA 1F7VA 5KYVA 2V6MA 4JEUA 1XVLA 1XEAA 3A3KA 2ZBEA 4XD7A 3U56A 1A8SA 1B6SA 1WMBA 2CXXA 2PO7A 2X0IA 1AM4D 4ZRNA 1RHMA 2NYUA 3BKWA 4BMDA 4IKEA 1JPUA 3AVXA 3B36A 2PSDA 3SS7X 3VX4A 5CITA 5GTDA 1NRJB 3PXDA 1NVXQ 5K8JB 2YMLA 1GNQA 1WHSA 1CPYA 4IIBA 2RCNA 4ZEMA 1VL5A 3AJEA 3H3FA 2ZI4A 4C6HA 3E22A 5JOQA 1OB5A 2OYRA 1QH1B 3TZKA 3WHKA 4Z4FA 5J5CA 4U00A 4EF5A 1VSVA 1E6KA 2AFHA 3I23A 1GXSB 2V1XA 2C57A 2VUIB 1VJRA 2XNJA 4RMNA 4DMGA 1MMFB 1XDDA 2QR3A 2Y71A 3DDCA 2WD9A 3FKJA 2RI6A 3PFKA 4KYUA 2C7BA 5HIIA 5KHAA 3IAAA 4BPBA 3C1AA 2LKCA 1PDVA 5IKOA 3AIKA 3NWPA 3KS9A 2WYVA 3ZI7A 1F2UA 4NOKA 3BMXA 1JLKA 1J5XA 2EJCA 4L6AA 2ZE7A 1E2DA 1RLIA 1OAOA 1SUSA 2Z57A 4LSWA 1KDOA 1A2BA 2C0CA 2VJMA 4INAA 3R7SA 5CA1A 1CT9A 1XPOA 3QKWA 4QYXA 3ZUPA 4WBNB 1XZKA 2DHEA 2FN7A 1RYNA 1R9MA 4ND1A 4HF7A 4D0NA 5BN4A 3KDSE 3QJYA 4TKVB 4C7MA 4DLAA 3KZOA 3E7DA 3GYGA 2GXUA 3FWKA 1Z4KA 4W8HA 5FNVF 4YRSA 4KN9S 3ER6A 4J76A 2PMBA 1ND6A 4BLUA 1AT1A 2ZYAA 3I2YX 1E79D 2I1WA 2FXVA 4FNGA 1Z0IA 3F5FA 5FB3A 3RO7A 1RQLA 1E7RA 4G86A 2B99A 4PLWA 3I3OA 4JT4A 2HZBA 2PWPA 3IT3A 4EB3A 1FP2A 4MRMA 4HDMB 5BR1A 4M89A 3WGKA 1CJCA 1OW3B 4R2LA 1QR6A 4C2BA 1R0LA 1GYPA 1XP8A 1Z2PX 2H4JA 2JAUA 1WO8A 2R96A 4JWTA 2UU9B 3I76A 3KUKA 3R6GA 3S5JA 1N2ZA 4CT0A 4CLEA 4OLAA 2OCGA 3UHJA 2IIVA 3HCBA 5GJWC 3Q40A 1NMXA 4NMLA 5JMPA 4K86A 4H1VA 3TRHA 1R2QA 4RA6B 4UTNA 2YWCA 4EUKA 2ZQZA 1KZ7B 1MF7A 2XUKA 3DE7X 3PFWO 1C1XB 4E12A 4DE5A 2IH2A 1NQUA 3U6KA 1SRQA 4BFYA 5C35A 2C5HA 2XUGA 2ZBGA 2DU8A 2A7XA 2QMHA 1HLFA 3EIWA 3HJHA 2O2HA 4RHXA 2NV6A 3HRHA 4TVBA 4Y6RA 3FNFA 2MSEB 1ML4A 2OO7A 2ZAOA 3NBMA 4WL0A 3QTTA 4ALJA 1DAKA 3F2VA 3D8TA 3DAPA 4MGIR 4CRWB 4HDRB 1LQ2A 4ZAZA 1D7OA 4J16A 3MJDA 1TLFA 2B8JA 3NASA 4IMRA 3TNLA 3TR5A 4IGAA 3K8QA 2PV0A 3PPIA 3CRZA 5GONF 3R7NA 3LGAA 5IS2A 4FEGA 3QLUA 2PTGA 4LTMA 1SUIA 2Y6VA 2ZPAA 4M86A 3U4QB 1LEHA 4N8DA 3F9IA 1I4TD 2OR3A 3KR2A 5AUOB 2I7CA 4MI3A 2GESA 4YCJA 5CNJA 2B4YA 4B31A 3AK4A 3GHYA 2WY2D 3GZNB 4A82A 1JBEA 1GA6A 1DX4A 1G18A 2OHHA 2LP4Y 3LZ6A 5G4KB 4MV9A 4B3DA 4HP8A 2RHTA 1KOFA 4AO6A 1XT6A 2BEWA 3R24A 3VZDA 4XGQA 1E0KA 2XYRA 1N2BA 3PEVA 4FYPA 4QUGA 5F73A 2CV0A 4QA9A 2LUOA 2QNIA 4GKBA 3RAPR 2PJDA 1GPYA 5K6RA 2ONYA 4M0MA 3LDFA 4KI7A 3VOBA 4B9EA 3VYTB 4CM1A 3NDBB 1AS3A 1JIXA 5EKUA 5JMOA 4HDSA 2XBLA 4NPAA 2BFBB 4IDAA 4BPRA 5B7NA 4ZKDA 1W4ZA 5BSKA 5F5NA 4RENA 5BUSA 5EC8A 1L5QA 1YCGA 1QH9A 1CQJB 2VXBA 4HX2A 3H4TA 4NCIA 3BWXA 4C06A 2G3YA 1GCAA 2AXPA 2IUTA 1BS1A 3OQBA 4R8MA 5IN5A 2X41A 3OEHA 1HMYA 4IEEA 1W36D 2PLRA 4G0WA 3ZGYA 1NF8A 2P91A 5E7MA 4F5WA 1TCBA 4QPNA 3TX2A 4EY4A 3DYIA 1YZGA 4HY3A 5CVTA 3VU9B 4GMFA 4MDHA 5CGZA 5LJLA 2X0RA 1K8QA 4QEKA 4R68A 1LV8A 2RGNC 3C7AA 4MS3A 1NUSA 4P34A 3TIIA 1U7PA 1VGRA 2BKAA 4B3SB 2EIXA 1YS1X 4TS4A 3WOVA 1WCIA 4MS4A 5JHHB 4MW9A 1LTKA 2W2PA 2HBRA 4URUR 4YJHB 3VSAA 1TJPB 3JAKB 3RSZA 1TO2E 4JH0A 3AERA 4MR8B 4KZPA 2INGX 2VDUE 2Q5JA 4BFLA 2ORWA 4DMRA 2NU6B 3FTEA 1Z2AA 4BEJA 1CU1A 1ZKDA 3WWDA 5LWQA 3WIVA 2VYCA 2WSIA 3FUTA 3LMKA 4MI6A 1YZUA 4TYNA 1A50B 1QUFA 3DDZX 3NUGA 4JOCA 3QNUA 5FL7A 2K5UA 1UOPA 4S12A 1PZGA 2G4VA 4FIZA 4H0NA 2GZHA 3PR2B 3ZV5A 4F6RB 1H2ZA 1XALA 3N0TA 5GGYA 3VOSA 4BJ1A 5CPBA 4DARA 1KHHA 3PVSA 1OVMA 1K88A 2LCIA 4Z4EA 3KKMA 3IRVA 4RABA 2K87A 3D59A 1MC4A 4Z1MD 3OX2A 4ZCMA 3AP2A 3T15A 4XOIA 1H23A 3H04A 3ZBQA 1XD2A 3FE2A 2QX9A 1Y3BE 2NO1A 4KSBA 4OB7A 1KSGA 3ZH2A 4EIWA 4A0HA 3G6KA 5KHLB 5JT1A 1RRCA 5IVHA 3JASA 3EF0A 3HKDB 1SD1A 3STXA 3D8BA 3KHTA 2O14A 2JBWA 2QSJA 4GYKA 3UUWA 2JGIA 1QPZA 3HSYA 1YRAA 2P2NA 4GPZA 1IHPA 2HB6A 5TMEA 1IY2A 1Z73A 3C3PA 1O8CA 4NESA 2YY7A 2Q7DA 1KBZA 1P3DA 2IPAB 4MO9A 1OI4A 3OE7D 4TZKA 1JR2A 2YWXA 3I1YA 1DQSA 1DC8A 3QFSA 3FF4A 1LDBA 5JDIA 1P7YA 2JATA 1FRNA 3FWHA 3L8MA 3LBAA 1ECJA 1GD1O 3NHLA 4IIYA 5CXSA 3RVQA 4CIVA 1MJGM 3ASUA 3WBKA 1RRPA 2DQZA 4D8WA 2ZBDA 1ODCA 4JYCA 4EPRA 4F60A 3RRNA 5HKOA 2BEJA 4RMIA 3T5CA 4EJSC 4ENRA 1DADA 5CH8A 5B37A 1MB9A 1G1MA 1JEYA 5DN9A 1XKTA 3MTAA 3UGKA 1WPRA 4HQRA 3GCWA 3VH4A 3VU1A 5DVZA 2VQDA 1W34A 1IXYA 2RH5A 3UNXA 2BBSA 2ZTSA 5LDDC 1BGXT 1T8RA 1HYEA 2GZRA 4IWYA 1CRQA 1O96B 1Y6QA 2P4QA 4X91A 4M0DA 4EYSA 3LHDA 3PVZA 1O9BA 2JH9A 4XPZA 5CGQB 4G01B 5JAHA 4GYWA 4RXMA 3ETJA 1VRVA 1WUKS 3F6YA 1W9MA 2BGIA 2HH9A 1BGVA 1WETA 2HUPA 3KTDA 2P6UA 3I5YA 1IUOA 1R0BA 1WW8A 2GOYA 4MYRA 4ZMSA 3OCWA 2J5KA 3FDXA 3JWIA 4CPDA 5IBRA 5A7HA 2Z5GA 4CF6A 4LMRA 1O8BA 4KQGA 5GINE 2O8CB 2NLOA 1TADA 1QFXA 3C16C 5CAEB 3EF3A 1URPA 4GM0A 4JP2A 1DBPA 1GZDA 3A7EA 3EZXA 4LDRA 5A3VA 1FBTA 3BH0A 4CG2A 1ZOIA 3N8DA 1DRKA 1E2QA 5FOXA 1SRRA 4D2IA 4QOSA 4NBUA 1HT2E 1QHHB 2BF4A 2DERA 4WX2B 3MWYW 1O94C 5DGIA 3U7FB 2VPPA 4E5SA 2IV3A 3DXYA 3G8BA 4ZPJA 4HMPA 4A2WA 4U1RA 5JNVA 3TF5A 4Q4JB 3QEBZ 4LUCA 3LC0A 5AVOA 3W5JA 1FW6A 4DLPA 4NNJA 1K9VF 2EG5A 3N0XA 5BSWA 1LRLA 3EZ2A 1MNQA 1U98A 3JAWB 4G0OA 3WNDA 3NWEA 2IP1A 5CB0A 5K8TA 2XZOA 1SUCA 3INYA 4N0DA 5LQSA 3Q6IA 2GF0A 4EAAA 4HX9A 3L1IA 1ULAA 1X0VA 2G8NA 2D7JA 3QP9A 5DRTA 2M1ZA 4ZAXA 3E9ZA 4TUYA 4DM7A 2MSCB 1NYRA 4ZZIA 5LQDA 2BJVA 1TJ4A 4MW4A 2A9PA 3A25A 1V7ZA 2FVYA 1J1UA 3T3DA 4CMKA 2IS2A 1PR6A 3O26A 3P0JA 4WKCA 2FQWA 4OXYA 1UEXC 4YCNA 1X7XB 2DYKA 3CJRA 4PLGA 5E8RA 1JUDA 2ISCA 4EQZA 2IPMA 3JQFA 1X1BA 2GPSA 4KB5A 3T4EA 1VKJA 3O21A 2QT1A 3QGMA 4DAEA 3IEVA 1M0WA 1Q16A 3BICA 4GWKA 4AJ4A 1R27A 4L95C 2P2GA 1JA0A 2X0FA 1QCYA 4U7TB 5MDHA 3FF1A 1SG6A 3DBRB 3R3XA 2X42A 4RKQA 5AVXA 3ND9A 2CKDA 1V7CA 4DQLA 3NAZA 2BV3A 5CVJA 5E3HA 1A7KA 3MMSA 4RHCA 3CT4A 1OH8A 1DHTA 1YCFA 2HO5A 1DKPA 1ODJA 5AYVA 2FR8C 3GXBA 1YTUA 3M9LA 5EMLA 2LCFA 5B64A 5T8KA 4KJXA 1Y3DE 2H16A 2YW2A 3EE6A 5IH3A 3UW3A 1HDXA 1ZONA 4PN3A 2H4HA 1POWA 3CLKA 1PP4A 4UBOA 1A04A 2J6CA 4DOMA 3DHYA 4A6EA 2QD1A 3JRXA 4MQBA 1YA4A 4UOQA 3PWTA 4BFWA 1U9YA 3F4BA 2YZ2A 4X61A 1TM4E 1NJ5A 2JIZD 3N6XA 4FK8A 3IKTA 2PS9A 3ZV6A 3EVGA 3FGPA 1XELA 3FNBA 4LJ6A 2XUOA 2O9JA 4LDQA 2R1ZA 1XWIA 1CX9B 2Q0QA 1UC5B 4WJKB 1A5BB 1XDWA 4UEWA 3PX2A 3V4RA 3JU3A 3T1OA 2EAUA 4N7RA 4ICIA 1G60A 3K0FA 2VRBA 2B4QA 1XQYA 2VRWA 1UUFA 3ZCRA 4H0CA 4MR9A 1B7GO 3WS7A 6REQB 1H05A 3ZY2A 3CUSA 3MIIA 3STVA 1UC9A 2CZCA 2FVXA 3R6LA 4Z8XA 5SZHB 3D7MA 1D07A 2V8BA 1EDZA 2IYWA 2BJHA 3PC8A 4HYQA 4BX9A 1X14A 3GRCA 4EDFA 5JXJA 4J3JA 5CLQA 4R1SA 3L1JA 1B6TA 2G63A 2GO1A 2BP7B 4LE0A 4C6SA 2VTKA 4OSOA 3HB0A 4PCVA 1RYFA 5ARBA 3RR2A 2H18A 3TI9A 1JJVA 1TQHA 1DTSA 2X40A 3BWEA 3D9QX 1YHZA 3K8ZA 4X97A 3R8CA 4E5KA 2C9OA 2E4VA 3UAOA 4B7AA 2NO4A 5T4EA 4LWZA 5JAZA 1KO8A 5K2OA 4E70A 1WPQA 4BYMA 2DH6A 3PE4A 4EM6A 3I5UA 3OUZA 4JJFA 3WLNA 4WMLA 1L3BA 1K7CA 1U2RA 3AHDA 3AFOA 5DNVA 2V97A 3C43A 2IXGA 4J1TA 4ND8B 1U2PA 5FUYA 5C1BA 4RF3A 3IVGA 4XQEA 3TEMA 3W7BA 4G0NA 1S0UA 2H1VA 4HAZA 3MD0A 4FGUA 4MUIA 3NYWA 4TWIA 4M1ZA 1VL1A 2FUNB 3NIFB 2RGAA 3Q7SA 1OMOA 2DOKA 3NHPA 3EXG1 3NT5A 4WKBA 2W2KB 4F91B 3AI1A 2J3QA 3PXBA 2VYVA 3KD3A 2Y2UA 1L3IA 1QC5A 1XBTA 2M32A 2R8RA 3FLMA 4RF5A 4WFQA 3ZDQA 1DZ3A 1EI9A 2AVDA 4DV1B 4H3HB 5DM2A 4QPZA 1KF0A 1N3BA 1AKMA 3O75A 1VMKA 3HCAA 5PGMA 2IV7A 3ROPA 1ORIA 1K97A 4JUAA 3MUOA 3ZK9A 4FMDB 5AH0A 4M22A 2W0SA 5JV5A 1EPUA 4UM9B 4FS3A 3A3NA 2Z04A 4P7KA 3C0KA 1IPHA 1YNSA 2DQSA 2WWXA 1YKGA 4PYMA 1FDTA 1S3FA 3B7GA 3O3MB 4RHTA 1UBCA 4YJ3B 2UUOA 2QMOA 1VE3A 3PIRA 5FLKA 2W2XA 3RPEA 2WU4A 5CNMA 5CH5A 3T5GA 3V8MA 5FBWB 2ZR7A 3OPYB 1CUCA 1XYVA 3ZQ6A 1Q1ZA 4FXPA 2OZVA 4ARZA 4DG9A 2GCNA 3I28A 3HV0A 2AOTB 1VECA 5ALWA 5TMBA 3QKRB 1PQ4A 1STOA 4J0GA 3NDRA 2ORYA 3JAMA 2GA9A 2PGXA 1I2BA 4H60A 3CVUA 3GMDA 2BW0A 1TU3A 1Q7EA 1B16A 3H5WA 4J7AA 4K46A 4GWGA 4QFDA 3UGJA 4G5FA 4JR2A 1OT5A 1GGJA 2J32A 2PUHA 1P9RA 1GPH1 1S1CA 2VBCA 3LPMA 3O1IC 3EXHC 4RVSA 2WE8A 4HAXA 2IBMA 2CF5A 3DV2A 3SX0A 3W2EA 1ADJA 2G5PA 4A8JC 2REOA 4CM3A 1ZS9A 4TQUS 4ZJYA 5KINB 3DE0X 3WADA 2V4MA 3M82A 3U3XA 4UOZA 4ZGWA 5D8DA 2MDTA 5EMNA 4BX8A 1TJNA 1GTSA 1SIWA 2BI7A 2R6HA 2AMLA 3W5SA 3ZTWA 4EPVA 2XDWA 3KUDA 2X9LA 1HGXA 5A71A 3LC7O 1F2VA 5JCZA 2XSZD 3NATA 3FDIA 4CLXA 1XEXB 5F5LA 1T1EA 3TQTA 3CUKA 1JPJA 4FYWA 4UHHA 3T3NA 3G5LA 3MMXA 3GH1A 3USES 1BVHA 2BDEA 3NNDA 3O8OB 4RDHA 3RVNA 5FQNA 3LT2A 1HKHA 1ONPA 2WM3A 2XOKA 4MYSA 1OE0A 1Z7GA 2G83A 4OQZA 1PT8A 4QUIA 5IP5A 3TW6A 3WGUA 1BXKA 3HFSA 4K03A 4C6TA 1GL7A 1KI8A 1ULUA 4WASA 4DLVA 1B2LA 1ISIA 1N34B 4DPLA 9ABPA 4ARVA 4N5IX 1T8PA 2DHDA 1W0KA 4PY2A 4BO9A 3OIDA 4ZGGA 1HPLA 3MCVA 1KXJA 4IIHA 2IHTA 3QA3E 3R41A 5CHEA 2BFNA 2C98A 1UMCB 2I29A 1JFVA 1G20E 3E2MA 1FP1D 2FFBA 3NO4A 1NFRA 5H68A 3V7NA 2WYHA 3FR8A 3P9PA 3V8RA 4DCTA 5AW2A 1PR3A 3WYDA 3M4JA 4FHGA 4XWTA 3E58A 4D9GA 1BIFA 4KRYA 2IPNA 3PR3A 4M6WB 3CEHA 4ALKA 2WAYA 3K70C 1SB9A 2I1VB 1RJFA 3BXEA 4ASUA 1OYVA 1CF9A 1XCJA 4PC6A 4ZYVA 5BW4A 5DASA 1NR1A 3UHPA 2DWOA 3FRIA 1P2VA 4QDOA 4O08A 2VATA 3C14C 4FILA 4F4UA 3L82B 1SUDA 2ZANA 2D74A 2TMYA 2DE0X 4NU8X 5H7XA 4RLHA 1Y3FE 2ZEJA 2WT9A 4CJXA 1E18A 2OHJA 2R8XA 1NVTA 3GEEA 4ZT3A 1E5DA 3STTA 5JD5A 4LOKA 3ZQ4A 3G5TA 4Y2JA 1CCWA 3E8SA 1Z74A 2L42A 4PYNA 4LCEA 4BNIA 4D3YA 1WXXA 1X1AA 3QXJA 5AW0A 1A27A 3LWBA 3FZYA 1DCTA 1O9HA 3IV9A 4U7PB 3SJCA 5JYCA 4YO8A 2XA1A 3E6AA 1BMFA 3EOAI 1M1YA 4K6OA 5CUQA 5ALIA 3WSWA 4ZI5A 1G7RA 3FMGA 3U3JA 2ZP1A 1R7RA 2W2TA 4U7WA 4X3OA 1SKYB 3PUIA 4LI3X 1XCMA 2PHZA 1YZTA 1HL3A 4ZQGA 1JXQA 1YSCA 1LJ8A 5EXPA 2UZ4A 8OHMA 4H7JA 2IS6A 3IMEA 3BA6A 4BB5A 4R7ZA 3V2UA 1QFJA 4LRTB 3F5MA 5BOVA 4BLSA 1CP3A 2XTNA 1SOUA 3UJPA 5D84A 1O2DA 2VH5R 4ZTUB 2NX2A 2BH9A 4IZHA 5CDSA 5KYTA 4YDRA 4GP7A 2XCLA 3F6SA 1D8TA 4PW0A 2OT3B 3WFJA 3VFDA 4CMIA 1JXMA 1P4AA 3PXAA 4JBIA 4P81A 1WNTA 2ZSEA 3F47A 1ONNA 2CVPA 4IVPA 4LZPA 2BELA 1L7PA 1OREA 3T4UA 4MQFA 3I62A 2YV2A 1L8AA 4COOA 1TMKA 4RPKA 3ZHQA 4UTRA 2XOXA 3F97A 3FIUA 1ZVKA 1AQ6A 5F12A 3DLBA 3DFKA 1ZLYA 3W1WA 3IAFA 5EFOA 2C4WA 2WSYB 2IEZA 4AF8A 5CFMA 2QN9A 1DWUA 1RQRA 2VJCA 2VT2A 1JJBA 3WGHA 1MO5A 4I9GA 4NZMA 4RUKA 2UZ1A 4KQ6A 4KOAA 1UIRA 2WTEA 3PFFA 3DZHA 3ZY6A 3ANYB 3JZAA 4WFIA 4O29A 3DCJA 1ZEJA 3K7EA 1QS0A 3TSOA 4G8CA 3EMVA 4A15A 3ZZMA 2BFFB 4U8GA 5YASA 3P2IA 1JH8A 1ZRHA 1TAQA 4BNUA 1OXSC 5A9RA 1WXHA 2VSYA 2F2TA 3OPMA 1DKMA 1BU5A 3UEOA 1Q0PA 4YP6A 5AUQA 5LQNA 1G5IA 1NQAO 3DZKA 3G6WA 2PYZA 1EQAA 4MW6A 1RLMA 2IP2A 4KI0A 2BKVA 4RS4A 2WICA 4KXUA 3B2NA 5EJGA 5ERGB 5LJIA 1W581 3E4DA 3GVIA 3IAHA 1YAJA 3Q6NA 3QFTA 3VR6H 5C5CA 2JGDA 3BYZA 3W2IA 2FEOA 1EE2A 1XYYA 3EG5A 3FJYA 4HS4A 5DCLA 4LQ4A 4RTRA 1XL0A 2RK6A 2D6FA 4LCJA 1VSTA 1GL6A 4E5PA 2VJOA 5BP7A 1NDUA 1YC5A 1S7CA 1SCDA 1YGPA 3G7NA 3DEKA 2VDVE 4L3VA 1ZWKA 4UPVA 1GQYA 3PDUA 1EVEA 1TCVA 3ZWAA 1VJ5A 5BUCA 1YC2A 1JV2B 1UBKS 1G20A 1MV8A 1Q12A 1SC4A 1UBNA 3GCGA 4UEQA 3E3MA 2CLEB 2BTOA 4IMIB 1C9KA 3PHHA 4DLZA 1J33A 1G9TA 1KBOA 3DZCA 2Y27A 4B87A 3Q7IA 3FMIA 2JEOA 1NVKA 4LNUA 4UCFA 2X5JO 2FPIA 2AI3A 3GFBA 5L3ZA 3RJ5A 4QNMA 2XGGA 2GDJA 3JALA 2W6MA 5K1ZA 4WA8A 4EHDA 1UADA 1ZNZA 3WBJA 3HK2A 1ORHA 1IJKA 1R0XA 3E2PA 4R1TA 4YA6A 4OYHA 4LE1A 4KWIA 4WN3A 5AK3A 3I9LA 1KEZA 2P6OA 1P0CA 4RD6A 5IABA 3KZCA 3QUBA 1A7AA 4EW1A 1DDGA 3AU8A 4URVR 1Z7BA 3NZEA 2PMFA 1VB3A 3OWOA 2CJXA 2COUA 3G5UA 4U7FA 4ENWA 4C4ZA 3HA3A 3FUXA 2OUIA 2CNDA 1X38A 4LQDA 2QLNA 4ZQHA 2MOKA 4ZTZB 1EDEA 3JQGB 3VR4H 1Z07A 3RS3A 2V5AA 3KSAC 2F4VB 3MT9A 3ZVKA 3AU9A 1IVYA 2Z4TA 2ZSDA 4FJ2A 4PAGA 4BIIA 3ER8A 4DA6A 4M0UA 1QE5A 1H2YA 3EGEA 1W29A 3P97A 3PQFA 4NCXA 3BZWA 5BN1A 5CU7A 3H17A 4V0SA 5SYAA 1WPXA 4IYJA 5F7JA 5FOTA 2P6MA 1K66A 3RS5A 5EHQA 2VR1A 3GEBA 3NEAA 2I5PO 3L0OA 2EFHB 3NHFA 4U2BA 2FP4A 2GSDA 2IKSA 4OPMA 1VIAA 4J1TC 2OP1A 3P2JA 4Y2YA 3NC4A 4LXHA 4Y6QA 4C0KA 2EF0A 2FFJA 2O7RA 3SDSA 4ZAWA 5KSYA 1PU2A 4EVSA 3L7LA 3FR7A 3H65A 3L7KA 2YHAA 3ICPA 4PG6A 2HRQA 4LOLA 4WNAA 4JT9A 4ZO6A 4Z4HA 1QG0A 1C50A 5GV8A 1NJ2A 1WDLA 1F0YA 3DL7A 4U6NA 4KQMA 2XHEA 1WQ4A 3ACDA 5I7AA 5D5QA 1N5RA 3M5DA 3DLIA 4CV3A 3MUNA 4LVNA 4EJ0A 3BB1A 2IYTA 3ENQA 4Z8YA 1Q6ZA 4DV3B 1B15A 3JQBC 3DAGA 3QVSA 1RWKA 1H1TA 3L0CA 2ZIUB 1U7XA 1DEOA 2IYZA 4BO5A 4UAGA 4DDUA 2R4TA 4Y6SA 4I1PA 2CSXA 1GGHA 4WOPA 1J56A 2Q8QA 5FPPA 1E2BA 2ES4A 3FYCA 1FMFA 3ZWQA 1BN6A 3HLKA 4X1KB 4F3RA 2OORA 3PWZA 1OWNA 3WL5A 1O6ZA 3OZBA 5JADA 3DNPA 4WW0A 4RZHA 1K9SA 4Q34A 3WK5A 2HBYA 1XZQA 3AZOA 3GIDA 1IN4A 3QUCA 5IDQA 5KMGB 5TVGA 3A1WA 3ZD8A 2Q50A 1GSIA 2VCHA 1J8YF 1ULZA 4Q9AA 4IKPA 3DTNA 1N2OA 3K35A 3VYRB 1XFDA 4QGFA 2O3SA 4P7JA 1NV9A 5ENZA 3A3PA 4CMCA 1NSYA 2HF9A 2R44A 3C5EA 3K1JA 2ZIXA 3HEBA 5F2KA 2EKPA 1MQ9A 2Q3HA 3WC4A 4RZSA 4MW7A 2JA2A 4QM6A 2EFGA 3UMVA 3S99A 2AW5A 3H5LA 4A8TA 4EA8A 1YONA 3OZCA 3BREA 3I53A 3KUUA 4J1QA 4LV5B 1FX0B 4OREX 5H4HA 4GLLA 5LXTF 4JDPA 4XQCA 1GKIA 3V4OA 2O5EA 3J81A 2XI4A 3VDXA 1FYDA 2LR0A 1UBOS 4G2TA 4EEXA 3NG1A 2R6CA 3CEMA 3UXMA 1UJ6A 1UT6A 4FOPA 3CLUD 2AG6A 1EZ1A 1W48A 1XF9A 4RESA 2QVGA 1OX5A 2RI0A 1GPAA 3DB2A 2VZ0A 4TM7A 3DEZA 5B1SA 3E48A 3NTOA 4ZK2A 2VCEA 4CI0B 6Q21A 4C9BA 1YZYA 4EGCB 1NX6A 1VMAA 1Z26A 3T7SA 3V7WA 2X4LA 1G17A 4ZQCB 1Z5ZA 2C82A 4OM7A 3DPSA 4YV7A 1LRKA 1VLLA 1DBRA 3AM4A 1YFJA 2FGKA 3HNPA 4KIUA 3IHTA 1TFRA 2I4OA 1YULA 2JFQA 3UANA 5ADHA 2O2JA 5F1PA 4AUKA 1UPXA 4GI3A 4Q3EA 1XAHA 3UJCA 2ZU0C 3PHLA 2FKNA 4DDVA 3BK1A 3I73A 4TTSA 2QRZA 1U0BB 1JTEA 2EFCB 2C7OA 1OBFO 1ZMXA 1H0RA 3U6BA 2B8WA 1FFSA 4RETA 5FBQB 3PFNA 3P7MA 4XFJA 2C9ZA 4B4VA 3P96A 3MAGA 2CB0A 3I83A 3CW8X 4MJXA 5DLDA 3B2EA 4MWZA 5DN6D 1RXSA 5KTSA 2KJQA 1ADYA 1FZQA 3BD6A 2A9RA 4DCGA 1VZ3A 1XSEA 1XG5A 2JKYA 1PKXA 3H42B 1JTVA 1R8XA 1QGZA 3O91A 5EHIA 4CM8B 3BAZA 3WV4A 2GEVA 5MN6A 3OH8A 4OU5A 2E37A 1USWA 2PSJA 2YVLA 4QELA 2FHSA 2UUBB 2WNSA 2A3NA 2VDWB 3HJCA 3O82A 4XX1A 1PUJA 3CV3A 5G53C 1IEXA 1UKZA 3U4AA 1ECCA 1I01A 1R6BX 1CJMA 1M10A 1N9GB 2Q5QA 3BQ9A 4LPKA 4PZLA 4BKUA 4C3VA 1QKJA 3DVRX 4K8RB 4LXQA 4WKPA 2EP7A 3AESA 3D0RA 2J87A 3AO0B 3MWGA 4KQ1A 2VCYA 4G1FA 3OM0A 1MC8A 1N7IA 2CHUA 2CK3A 2EWVA 3W5VA 1KQFA 2Q0XA 2OB2A 1VPTA 2AZMA 2P2LA 3OX3A 3FSGD 4MPTA 4MQMA 1KE1A 1GQ2A 3R7WA 4MKGA 4AUEA 2UKDA 4E4RA 1JI0A 5TDHA 2ZYRA 1AGYA 5SV2A 3D7LA 1PL7A 1PL0A 1CR1A 2LXNA 1N6HA 2F9FA 2R8BA 2ZROA 4C0SA 2ATVA 4BGUA 3MEQA 1DRWA 1ZN7A 2VH2A 5MFZA 1OXBB 1EBUA 3GA7A 2IYXA 4QO8A 4YUXA 3PDHA 5C7LO 4DXHA 2MHCA 3DD5A 1FQOA 1QAOA 1EUCA 3H97A 3P27A 4WZ6A 1AIPA 5MGBA 2JJYA 3GDFA 2FMXA 4A0QA 2NSDA 4KQFA 1RQGA 2N47A 3QVKA 4M8LA 4D4HA 4TV9A 3CC8A 4N49A 3P5SA 2I2XB 2WPDD 1SKAA 1RADA 2CMHA 4LRYA 3D3QA 1VHWA 4LC0A 2H1IA 4IDEA 1U1IA 1E7YA 4FZ5A 1Z4NA 3I34X 1V9CA 1UBJS 1USKA 3T1VA 3KWFA 2IZ6A 1D7AA 3B38A 3JATB 1QHYA 3T3PB 3HR7A 3PC6A 2BGKA 5HK9A 5IZCC 5FNZA 3NXSA 3ZE1B 4CIAA 1NY6A 5HJ5A 2OCIA 2W93A 1R8QA 4OK3A 4RKYA 1O57A 2CDCA 3GGCA 3NEYA 2ISSD 5M7EA 3UYKA 2PZEA 3OZRA 5CA0B 4OD0A 4OYLA 1PJBA 1DWOA 2IF0A 5HP4A 1BXGA 3VDMA 4LXUA 1EZ4A 3E9NA 2JKVA 1KXZA 2WYWA 3B3AA 3EG9B 3ETLA 3LUBA 4I1RA 4MVJP 2GN1A 5ICMA 3KAJA 3ZDEA 1EJ0A 2O8DB 1GPJA 3AW9A 3B3GA 1E79A 3K1TA 3N39C 1E3SA 4KTVE 5HQTA 3TLAA 1I2ZA 1GL9B 1CUHA 1T0UA 4JYBA 4AX8A 4FR5A 1SKQA 3R9XB 4N8SA 1ZKMA 4LI0A 4ZGBA 1LFDB 7ABPA 3KJHA 3SS8A 4BB0A 4JC8A 2R6R1 2O2SA 4TXJA 2C0QA 2WWVD 4ZT2A 3CWZA 2ZUEA 4TM8A 2YRWA 5EKTA 2C9MA 4B2YA 4C3UA 3CR8A 1FXUA 2L17A 3U7RA 3QKUA 3I6IA 1VB5A 1O0SA 1FNBA 3OD1A 1SBYA 4IG9A 3ZHUA 4UDOA 1XPRA 2I7DA 2IQIA 2QM0A 2NU7B 3PSAA 3QE4A 1V5IA 3WGQA 5KQMA 1D1PA 1RRKA 3ZDBA 1U0OC 4FE7A 1V6CA 1PZNA 1NBMD 2IHVA 2V59A 3KZXA 3UV7A 4HLUC 5KX5F 2V65A 3T5BA 4GXQA 5G1NA 3RBVA 2ZTHA 3ZJ5A 1C7JA 4OTZA 3L9WA 1G8YA 2CLIB 2GEDA 2GPTA 3CCBA 3JQ7B 4QATA 3TLMA 3VYSB 4C4TA 5CB8A 4PAWA 1NZFA 3NDIA 4GR9A 4ZALA 3GJXC 4X6XA 4CNQA 1U7HA 5EXXA 2H9IA 2ZSJA 3AEQA 1Z4JA 3QV1A 1XZGA 2YV3A 5LM3A 2NQ2C 1PEAA 3GZTB 3REQA 2JFWA 3L6RA 4MV5A 3N2ZB 5DTRA 3TTXA 4YAUA 2POCA 2VHWA 3T95A 3LT4A 5CFLA 1BZYA 3EDOA 3KOUA 3MWDA 3PUXA 4O5OA 3OPYI 4TKLA 4BQNA 1YO6A 3IIJA 3BL5A 2D1FA 3QUAA 1VPWA 2RGDA 1JAHA 3WB0A 1QQBA 3H99A 4C4XA 4AU1A 1V1RB 4OBXA 1L4MA 3EPKA 2FSFA 4KODA 5K0JA 1Y3HA 2P40A 2VAMA 1ORWA 3BMQA 3PD1A 1TD9A 2A67A 3ZNNA 2HMSA 3DDOA 2PBRA 2ZAIA 2WU1A 1EXMA 2I6UA 1EP1B 4FZRA 5LC1A 1HDYA 4Q66C 3G2MA 3O94A 5F33A 1ZK3A 2P30A 4V39A 1EE9A 5BXYA 2BE7A 2P0YA 4D4MA 5CDTA 1YRQA 4IF6A 1ORVA 3H5OA 1AX9A 3EWNA 3IEKA 4RPLA 5ALQA 1HTTA 3ITDA 5AT1A 1WBDA 1T24A 5JAQA 4ZDKA 2Z83A 2HCJB 4C01A 5C5DA 4ENVA 4V38A 5CG2A 2SKDA 1EWVA 1U9IA 4V0ME 1Y37A 3QUQA 4W1QA 3G2IA 4N3CA 3DZFA 4W1RA 4ZO9A 4ALNA 4OKNA 3WQRA 2AB0A 3TZEA 5A3RA 1A7JA 1LSUA 4MYDA 2A6PA 7YASA 3RSOA 3V2IA 4D8YA 3PFGA 3HCEA 3ZUGA 2Q3MA 5AW5A 5A9TA 4IDOA 1AUXA 1CUXA 1ZOPA 4PZZA 3PB3A 2DSTA 1RLJA 4R3WA 3EVCA 1TM1E 1GGKA 2HU8A 3AUSA 3GFTA 2BEUA 3UJ8A 3HI4A 4L15A 4YUAA 4KXYA 1XTUA 4X24A 1A3CA 3G0OA 3BMCB 5M29A 1CE8B 5LL6P 4B3BA 5JU6A 3EVZA 4N40A 2RK4A 1GPLA 2ZXEA 4TX1A 2GT1A 4IVQA 4ALLA 5IBCA 3TUZC 1RMTA 4B71A 1LC0A 1LGYA 5F3RA 4C1BA 1MVOA 4E32A 4DTCA 5JSZB 5BVHA 2YS6A 4DL9A 2P0AA 3SQDA 3CCCA 2QRKA 3DHWC 4PZCA 4UE2A 2VF5X 1AXEA 1TC1A 3MT7A 2GZMA 3ZOZA 1UK7A 1Z75A 5B3AA 3FETA 2BCEA 4D96A 5E4TA 4HBGA 4FGKA 4IDDA 2XT9A 5JWOA 3PQ8A 2XTZA 4WCDA 5J5VA 1CDDA 1NVWQ 2JEYA 2QL7A 3O4IA 4C2TA 1VP3A 3HABA 4IDNA 4PZAA 3VHXA 3ZW7A 5C4GB 1P2FA 4OI0A 1B3BA 1PJQA 3E5RA 5JBQA 2JZNA 2XUAA 5EHGA 3LL4A 3ANLA 3SAJA 2YZGA 1ULSA 1ARZA 1VSQA 2YYSA 1F4LA 4Z3OA 4I4TA 1OJLA 3AR5A 1ST3A 4K7JA 1INLA 4HL6A 3CJQA 2CDBA 1C1DA 2W2QA 3ONDA 1FP4B 4GSYA 4NL4H 2OLKA 3ZWPA 3GVHA 1RXIA 3AR8A 4PXAA 4ZCLA 1A9QA 2B20A 3TOCA 1YS9A 3KOXA 1D4AA 3UF0A 2JLBA 2AI2A 1PYGA 3IVAA 2ZDQA 1C3XA 3ANXA 3NGXA 5ICFA 2JG3A 3AUAA 3PLNA 3AEXA 5TMPA 1G2OA 2NW6A 4JI5B 1QHFA 4BUZA 1CDOA 5IEBA 2GN2A 4QRDA 2B7LA 3OE7A 4UM9D 1OWOA 1U0RA 4EB8A 3U80A 1B8VA 3FB4A 3S1AB 1CSEE 1X7YA 4EENA 3QX3A 4PLFA 2QUBA 3GZ4A 2RBEA 3B5JA 3WYFA 5BR7A 2Q62A 3QVGB 2ZRDA 4EZEA 2P5YA 1PTJA 3BXHA 2XITA 2IHZA 3GD5A 3ILYA 3PCTA 1RLUA 1E1YA 3HL0A 4R9VA 2HDNB 4D6YA 3DEYX 1XRLA 1DT3A 3ZVNA 2XR1A 2YXPX 5SY6A 2B5VA 3G8YA 4NZPA 3OU7A 4Y7DA 3AM1A 3GYBA 4FFBA 1T13A 4XDYA 4FDVA 5KTPA 3WFIA 4R0NA 3DM5A 5H82A 3TUJC 4OA5A 1A9ZA 2IPXA 2VJBA 3H7IA 3WG9A 2CFOA 4EKIA 3GB9A 2C5GA 2SNIE 2RGYA 1SELA 4JGIA 4XYLA 4GAEA 3Q7RA 4AKTA 4KFRA 5ES4B 2O8FB 3V1LA 3PXXA 5CA1F 2RHDA 3SKXA 4KBYA 5J2TA 1EVJA 1Z0DA 1IWPB 3IUEA 1IEVA 3PK0A 2X8AA 2RE8A 4YYZA 1GCOA 4S1OA 2JJ2D 1JYSA 1PFVA 1QP7A 5FF9A 2P41A 1Y6FA 3KWMA 1TKRA 5KQLA 4O2AA 1U7ZA 1RJDA 1I3KA 1UAYA 4IOMA 4HMOA 1LVUA 2RCYA 5TQ2A 1GDTA 3B6MA 1FB5A 4B7CA 2ZTLA 2QUZA 4NYJR 4CQMB 5LUAA 4P8RA 1O97C 2D8AA 2EFEB 1L2TA 2IHBA 5DHPA 4ZZ2A 1NQXA 2WHXA 2ANCA 4OB6A 3WMWA 1SVWA 5I9NA 3JXEA 4GZLA 1SCIA 3I4FA 1Z6GA 3LC1O 3SLRA 5BMVA 2RBGA 4ZHSA 1ESZA 3JD1A 3W34A 4PGGA 2YZ7A 4I19A 1I36A 5LOVA 1SHJA 4M36A 1C3VA 3GLKA 2C8KA 3PQ6A 4YMIA 3WY9A 1Z2CA 5C8XA 2PYIA 3W4JA 5DHAA 5MN5A 1XK6A 2C2XA 3HN2A 4G4IA 4LOIA 1XMOB 1P9WA 3HI6A 1NR5A 3HYNA 2GCOB 3F46A 3M4ZA 2AQIA 1LBIA 4FHEA 4I4CA 1LLQA 1F8FA 2J9RA 3GAZA 3DG9A 4WZBE 4Y1EA 3RUFA 3UXEA 3VR4D 3ZXYA 4XSHA 3MJSA 3BSWA 2J6BA 3B8HA 4G5YA 3MAJA 3TQHA 2IY7A 5I7HA 3PHGA 3O4HA 3TL6A 2PDAA 2YJ5A 5CEFA 5A2GA 4DABA 2IFTA 2Y9MB 3BILA 4XR9A 4ZV4A 3UENA 3PKIA 3GPLA 2VXYA 4TMKA 1A9YA 2OO5C 3ZU4A 4JELA 4ZI3A 4BB9A 1CF4A 5KVQA 3ZU2A 1MG0A 3IBSA 3R5KA 1BDHA 3PEYA 1PN3A 3DZGA 1EM8B 3B51X 2DPMA 3QJ5A 5KAPA 4BRZA 2FN4A 2QZ4A 1Z17A 4G8DA 1IHXA 1RXCA 1EGVB 4RV5A 5LQRA 1OILA 3ZTYA 3ADDA 3DAYA 1KMHA 2ANBA 3AEKB 5C8YF 5FWXB 3FFTA 2C4TA 1USVA 1Z38A 3U40A 1HNNA 3V7YA 4NBTA 3V1TC 2PJRA 1O1YA 4GQBA 3EVBA 4ZO8A 2ZJFA 2JCVA 1P2UA 1CLEA 2HWKA 3U49A 3RADC 2J3LA 1W6UA 5LNK1 2W4MA 3QOYA 5AK6A 1ZN2A 1Q1AA 3FTNA 3L4BA 2RJNA 3OHPA 3BIJA 3H8WA 4BFSA 1O58A 1V6SA 4N0MA 5AP9A 5F78A 3NT4A 5TEVA 2OGSA 3QWIA 2JIZA 3DC7A 4KDFA 4CMHA 4DIOA 1NATA 4KLZA 4M9RA 1Y42X 1QNFA 2PGOA 5BWLA 1OXKB 1W2WB 1FY2A 2Z8XA 4LRUA 2QBYA 1KFBB 1PQUA 3IAXA 2A59A 1J1IA 3O8BA 1SOAA 1IAQA 1AGRA 3DWEX 2CNOA 2PUFA 1IHUA 1PUXA 1SUWA 2I9PA 3PPVA 3PUKA 3GBPA 3R0ZA 3UHAA 3GRYA 2VRCD 5EZ6B 2ZZMA 5JS6A 1F9AA 1O5IA 3BBLA 3LX5A 1CR2A 2ZE5A 3CR7A 4FTWA 1J2EA 1EXNA 3ELWA 4JIGA 1D5CA 4LNAA 3H0EA 5T6MA 4EPYA 4ER7A 3LCJA 3IAS6 1THZA 1R0YA 1MO2A 2LTAA 4BVAA 2WJHA 3W8NA 2REQB 2J9FB 4K9MA 5IYZB 3NONA 2B21A 4BC1A 4URWR 1ATZA 2I54A 4MYHA 5A4AA 1TRKA 4X62B 1DC4A 3USZA 1NLYA 3DVQX 4ZK6A 1JFFB 1AU9A 2ACVA 1E0SA 2EDAA 3C3EA 3G49A 5FFMA 5LQJA 1DE0A 4LDJA 1N32B 3F8WA 1X8XA 4JT8A 3AOEC 3WLTA 2KW5A 3M4XA 4JXKA 2JFBA 4QQFA 3TAXA 1DCFA 3E84A 4ZXPA 2MJLA 4CUKA 1HQYE 1POXA 2VTDA 3LCMA 2HWWA 4IHAA 4INJA 4PV7A 5JYBA 2DLCX 2TSYB 1M2OB 2A1TS 4OHOA 1I80A 4LQLA 4PYOA 1VIDA 4ZDWA 3UB3A 3U60B 2J08A 1Q0ZA 3KLMX 3TO5A 2I2DA 4GZ6A 4CYMA 2WEKA 4FYYA 1MAAA 1UZMA 1ZXLA 3EGXA 4GBMA 2AUNA 1BW9A 3ABOB 4M8IA 3SX4A 2G0TA 3WGGA 5CCEA 2V96A 4NNOA 1U5AA 2EKZA 2OV3A 1XDSA 3D1LA 4TSRA 1YS2X 5KNDH 2PR7A 2FDCA 3HLTA 2G76A 1WZ2A 1TTHA 3NGMA 3GT4A 4HAIA 2KMLA 5I9BA 3RNOA 4QYIB 2JGEA 5I9IA 5JSQA 1TW2A 3I09A 4ZP1A 1Q1GA 3M8KA 1ZNQO 1UKBA 2CLSA 4BV3A 1FSPA 4URZR 3X3HA 4KNYA 1U94A 2ZCVA 2YY6A 4TLLB 2I55A 2YHBA 1UOOA 4IGEA 4HRYA 1TVKA 4WZBA 3G0CA 2E89A 5HS4A 1CY4A 2A8YA 4MARA 4M87A 3THOA 3ASVA 3W5BA 2XTJA 4RNDB 2IYFA 4QIHA 2R84A 1Q77A 2VPWA 2C3OA 4BE9A 1E9FA 1OFGA 1YUBA 4W99A 3ZV7A 4K3VA 4B73A 1FUKA 2WSMA 1EDOA 3W5DA 1NVVR 5D1NA 1NKSA 3N2GB 1CRPA 1AF4A 3U7GA 3QIVA 5EI5A 1MX3A 1MJ5A 1PGOA 4FBMA 3HCNA 4H27A 4OMUA 5EXEA 4BTEA 3QE9Y 4NEHB 1AQLA 3OSUA 3BF7A 5KOJA 4J43A 4CLRA 1MZVA 3REGA 1LH0A 1VE1A 1U0NA 1V16B 5AKJA 2O54A 1E98A 3OOJA 4R2WA 1CZKA 1NY5A 2ZKLA 3VR5H 4ZVNA 4MV0A 2ODQA 3QBEA 4AQDA 3QXSA 4L6IA 5I8WA 1W7AA 2AEJA 3DEFA 1AVTA 1J0AA 1QQ7A 3FMPB 1Y8RB 2QUAA 4ONEA 4P38A 4Q9LA 4UJ5A 1DTWA 3I2HA 3H3XA 1PO7A 4PWZA 3TTTA 4B3RB 3CEJA 3DF9A 4FQ7A 1A8IA 2AYYA 3GQBB 3WWZA 3NV9A 1CNEA 2PH1A 4Q3OA 4PG5A 3ZPXA 1BWQA 3VNSA 4LY0A 1IY8A 4XWWA 2NZVG 3N0VA 1FVHA 1CDEA 1GUYA 1EFLA 2QLJA 3CBGA 4KPUA 1W4CA 4IMJB 2QTZA 4XH9B 4CTOA 4J6EA 2X77A 2XSZA 3I9NA 5IF3A 3CX3A 1BTOA 1YRLA 3IJ5A 4HV4A 2F67A 1YK1A 4CV0A 4QJBA 1TNDA 3BK2A 3BHJA 1YVRA 2ADOA 2IX9A 4YRJA 1KAQA 1AMUA 1PG0A 1I7SB 3AFHA 1LSSA 2A5GA 1U9JA 3C7TA 2OCPA 4OJYA 3EA0A 2QGNA 5JBIA 3AUUA 3DMGA 1MOPA 4NZZA 1IB6A 3KL4A 5NLLA 2C31A 4L4UA 3TQSA 4F71A 4YY3B 2A1IA 2NSJA 2R48A 1WUYA 3DUFA 4DMFA 1SKMA 1A5AB 5KS2A 1BMTA 2QD5A 3ELDA 4QJIA 1H3NA 821PA 2HJVA 1W87A 4M46A 3UUFA 4QE3A 2FJ0A 3HPRA 3H1FA 4FWIB 2AS0A 5TQJA 1WB9A 4MRVA 3LLVA 3V4LA 1H2BA 2YJTD 2XKBA 4J0IA 4P80A 1FTQA 4RYLA 1LWNA 2P9FA 3PFCA 2IITA 4GLBA 3MHTA 5EYPB 2ABWA 2IYQA 1DFIA 4UNSA 4XIJA 1UKEA 4G09A 3PWSA 4TUYF 5CB6A 1ESEA 3DL2A 1J7JA 3FYTA 1L8QA 3NJRA 5H9VA 4FDTA 3A6FA 2GPNA 1TAUA 2XB6A 1Z6XA 1PVDA 1M2FA 3VKGA 1T6BY 3CLRD 3PQEA 1GPKA 2BGNA 1Z15A 5HEKA 4AMYA 1E8DA 3AP1A 2E48A 3NDPA 1M72A 1T2CA 2CSUA 3B6IA 1FFYA 2NSLA 5A0FA 4UPEA 1C41A 3IAS1 1MUUA 3I6MA 3CYFA 3IDOA 3NC0C 4Y1RB 3RK0A 2I3AA 3DT6A 4E88A 3PGJA 3TZQA 2M2IA 3M4YA 2J3IA 3HUUA 3K8OE 4FZJA 1PR5A 5AVKA 3BTSA 1G2QA 1LXCA 3RGWS 1LPBB 1OB2A 4OLFA 1QJ4A 1KA9H 2FN3A 3NHZA 2HSWA 5B57C 1DX6A 2HMAA 4EHNA 3ROZA 1PFGA 1ZVQA 4E1BA 3CLHA 5EKXA 5DOVA 2MU1A 1GLGA 4I66A 1P4JA 1R0SA 1Z0KA 4BRSA 5I3ZA 2ILVA 4U0KA 5CT5A 1LJLA 2IHJA 2D0OB 3AFIA 3FNHA 3RFCA 2RHOA 1YOBA 4Y2XA 3RIMA 1V41E 5EHZA 5KNLA 3HY6A 3N59A 2HZ7A 1UZUA 5JSKA 1P74A 2E7ZA 3BXZA 3DMFA 2BHSA 2FCRA 4H1UA 1EAMA 2AOUB 3GPDG 5FI3A 1GNLA 4KSYA 5C3UA 2EKDA 4YDHB 3R6DA 5L3SB 3QZUA 3GRPA 3OLVA 4DHEA 4QVIA 1OJ7A 2BBOA 2ZIEA 4KP7A 4RQBA 2B35A 2LE0A 5EZSA 1DAPA 1U02A 2QNRA 2Z8YM 2G67A 5A6SA 1OTXA 4K0RA 3CZ4A 4FBLA 4N7JA 2NTJA 2VFAA 4WVFA 4ZJUA 5LQMA 4DQXA 1SEVA 2JHFA 3QFFA 2WK1A 1VYHA 1KO4A 2H4XA 5AVJA 3LD9A 1TF5A 1PGPA 1LBEA 1M8JA 1X94A 2DG2A 3A2LA 3GCDA 4UHEA 1SUAA 1S5PA 1B14A 1TIKA 3JVIA 1B0AA 4XJVA 3RKRA 3CNQS 2CHQA 2GJ4A 3NBQA 3GLUA 4YR7A 4GR4A 3TUIC 4F38A 3JTMA 6PFKA 1A8UA 2OZPA 3QYFA 2FOXA 4JASB 4HH4A 2P1ZA 3IIMA 1DMRA 4JBXA 1EX7A 1JPNA 4UBIA 4UNPA 5I7EA 4Q48A 3FWPA 4OL9A 2XQJA 3QM1A 3L9XA 1DRJA 2LWIA 5ARDA 1CJTC 3ANNA 4JSYA 3UWMA 5CNKA 1T36B 3SEAA 4UASA 3S8YA 5L6LB 4J03A 2XMZA 1QWOA 1K6MA 2PGLA 2MIIA 3PUHA 1X9IA 5T3UA 4KR9A 2NXJA 4JS0A 5A4FS 3AUFA 4X1IB 3GDGA 4QVGA 3X1DA 3OBIA 1U3DA 2GBLC 4X6LA 3VGPA 4EVQA 4UD6A 1Z0ZA 5DYTA 1GGVA 3AR7A 3W6OA 2ZS8A 4ZI2A 4CVNA 5CBPA 3FOCA 5G0VA 1E1LA 4HYTA 1WTAA 1Z4IA 4R2IA 1PLLA 5BQ3A 1RRFA 3F4LA 5LKAA 3VO8A 1YOVA 1HDOA 1H8HD 1E99A 2YJGA 2YHIB 1ISRA 2VT3A 5CFQA 3VJRA 1S4MA 4L7QA 4D9KA 3UKJA 1XCOA 2UYGA 1FLVA 2OM2A 2C07A 3THRA 2LIVA 3L7AA 4HUQB 1M34B 4KO3S 2X8JA 4LSMA 5JSHA 3L8DA 4AY6A 1F2TA 1CZUA 1IAVA 1E0JA 1T8WA 4OQ4A 5JE8A 3AG5A 2F00A 5BNZA 3ZHRA 4DREA 2R7AA 1UFKA 1L7EA 3LWDA 2R5WA 4BNTA 1CUGA 3OKFA 5BYBA 2IJGX 4KQ2A 1V8ZA 1SM4A 3ACBA 5INTA 3SZUA 1PV2A 3IPAA 3K0HA 1CV2A 3OIWA 1W8IA 3WI7A 5AVQA 2R00A 1CVIA 3OQIB 3PYMA 3QMPA 2I8CA 2A4KA 2WIFA 4FLMA 3LLCA 3ELBA 4UUAA 4MINA 5HIMA 4DEXA 4F21A 5DGDA 1NW9B 3S55A 1I6KA 1WCYA 2WJGA 4FYVA 4WXPA 5J5AA 4AJEA 1Z37A 5JMTA 1ODLA 4O4IB 4OU4A 4YJ2B 5JFOA 1FC0A 2RI1A 2JIQA 4WY2A 5KJEA 2W4QA 1DS6A 1IE3A 2HSJA 1VG0B 2UVDA 2VHUA 2FMTA 3FTQA 1BS2A 4HFJA 4IHJF 3WGZA 1RE1A 2J41A 3ZLVA 5EJMA 1J0XO 2W2NA 2XF8A 5DHQA 2WMYA 2C8VA 4GX0A 5HMLA 2IXBA 4TWRA 4JI2B 3RUAA 1Q19A 3EXIB 3MTEA 2NXWA 4EFMA 3NAQA 1RVDA 2ZUBA 3EA5A 1XCGB 1YJBA 1ORRA 3C97A 4JP3A 1GTZA 4XEUA 1J7KA 1T9ZA 3PU6A 2ZUFA 1KDTA 3IOEA 2IUSA 4GMHA 3BXOA 4NCJA 4Q1BA 1L6IA 1PQYA 1BRTA 4X90A 4RY2A 2G9NA 4JJ4A 4ZPXA 4FOSA 4X60A 3LVQE 1M74A 4RKEA 4LZNA 1AKTA 4LE2A 3T41A 3GJZA 1LNQA 4G9EA 4HDMA 5F9HA 2NO7A 3TRJA 4EGJA 1EMDA 5ITWA 1SXJB 2KBEA 2H2IA 2VHYA 3OT1B 4K9SA 4NZYA 4H3SA 4G3XA 1K8ZB 3IILA 2ONJA 3G5MA 4FJ1A 2P67A 1I51A 3V33A 3OQPA 4AKIA 4LYFA 3VO2A 5BUZA 2VHQA 2ETVA 3HHEA 5HRUA 4RV9A 4H1TA 1XMXA 1O95C 4XCQA 3EQ2A 4MVJM 4Z3DA 3LECA 4FFLA 1C1XA 3ZG6A 2BUAA 4IDCA 3WXBA 4MLDA 2ZYIA 3C4QA 5JISA 3R3HA 3ENZA 4FZ3A 4F9FA 4BNFA 5HJ7A 2R65A 4WZAB 1PGJA 4XB6B 1EVLA 1V4BA 2G17A 2OKGA 3IQEA 4RFSB 3RU3A 2RMKA 5A06A 2Q3CA 2O23A 3NHUA 4JROA 5JI2E 1TF2A 2A9JA 2F43B 4D3SA 1BGWA 3RRZA 4Q1AA 2C3UA 4I1VA 1XZNA 2WYOA 4MP8A 3B9RA 3OJWA 1UJBA 2WRZA 3PNYA 4BOYA 4UVDA 3BWMA 3VAAA 1QCCA 4FZVA 4LISA 3WX0A 2JRCA 3H2ZA 1SOVA 4J3FA 5EVCA 3JZFA 3E53A 1MDBA 3OU2A 4KO2S 4P3NA 4WCFC 2AE1A 4LJ5A 3L6CA 2UAGA 2ZYHA 3H9EO 3QMVA 3WLPA 4W5TA 4J2TA 2CDRA 4JBNA 4EG7A 3DL0A 3TE6A 4XLZA 4Y2HA 2FOIA 3TJZA 3WICA 4BKRA 3AYXB 3K71B 4R69A 3R2JA 3H6GA 4O59O 1JG3A 2YXNA 3LPLA 1AK9A 4F3CA 2XYGA 3PQCA 1TKAA 2QX4A 4RW0A 4D46A 3KVVA 1P72A 5F7XA 1ZJWA 2PZKA 2W6NA 5FO1A 1UWKA 2PS3A 3IHLA 5BW8A 3EFOA 4P54A 4LFBB 1Z4PX 2EC5A 4ZO7A 4K9KA 3I9V6 4M9CA 5K8UA 2VP2A 3Q7EA 4PIMA 5HE8A 2CGEA 5D01A 4TVKA 4UHCA 5TRTA 1NVFA 2PWBA 4IKOA 3OU6A 4MIYA 3EAFA 3MTJA 3PNMA 3WA6A 3VH3A 1MJGA 3LUKA 2X9GA 3TKLA 4N47A 4ZU1X 2JIDA 3QEOA 4URHA 2VTVA 4CT5A 5AI8A 1L7MA 3AG6A 3BQNB 2GJAA 4XW2A 2JD2A 5CB4B 1KAOA 1GEEA 1CQJA 3KL2A 4AG3A 4TYMA 1NIPA 3FDZB 3BN3A 3NHAA 4M9XA 1NPTO 5DP1A 4MVJH 4V3CA 5B5SA 1HOXA 5LYJB 1LQUA 1Z3IX 2B1QA 3MTIA 1TW3A 1I7NA 4PHHA 1L5MA 1ZK0A 4E6EA 4EPTA 2QYTA 5FUVA 3N8HA 2ODNA 3JZDA 5K7SA 1P9OA 3K1YA 2C3PA 3T34A 1ISHA 2H65A 1L5SA 1E3IA 1X80A 1TM5E 2C3MA 1NBME 1OBHA 1IQRA 4JOSA 5CJ2A 4EJSB 5DOZA 4J4BA 4NV1A 3B7WA 3JWPA 1PX0A 2BGUA 2JLQA 4GBED 5DF1A 3TPFA 4OEHA 1N5JA 2Q7XA 2JFUA 3WYAA 1PD0A 2W6QA 4OH1A 4IP0A 4Q3CA 1QGDA 4UXIA 1Q83A 1GZ5A 4KKXB 1BX3A 4JKIA 4WNCA 4FKZA 4YJHA 1C7FA 4B76A 5DN6A 1D2AA 2WA2A 4C76A 3OCZA 1WMSA 3RBXA 1YB2A 3SS9X 4LBYA 1SXHA 2NU6A 3KFLA 4Y9RA 4YQFA 1VL0A 4KTTE 1IRXA 4KR0A 3EZFA 1BH6A 5H1YA 3P2KA 3V2GA 1ZK4A 5AQEA 4RL4A 5ILOA 1QVWA 3ANMA 2A9FA 4LECA 4S35A 3U13A 3K0KA 4NMHA 4H3KB 3UH1A 3NHMA 1DXQA 3P9QA 5TB5A 3JV7A 3RK4A 5IX8A 5D5HA 4RWZA 1OLUA 1R9JA 1ZC4A 1JHXA 2P6NA 2Y1FA 4NFYA 2VH1A 4Y6LA 2QYOA 4P0PB 3M1AA 2P6PA 2VBGA 2YJ6A 1P5HA 2Z0MA 4HYYA 4GX1A 5F64A 1XF1A 3FSGA 1C7IA 3UK1A 2DTEA 1UFVA 2G88A 2PZBA 3QU2A 3TG2A 1E64A 2O7NA 4HO1X 4BL5A 4J9UE 4L9AA 1YBAA 2CVOA 3CH7A 4NZOA 3PUZA 2H1WA 1UMKA 2Y1DA 1UJ4A 3B1FA 1YUMA 3F9CA 1O0BA 1PNQA 1U5BA 1N0WA 3H1EA 4J0FA 4R7GA 4EK9A 5KQRA 1E3MA 3I0ZA 2O50A 4ISBA 1I7LA 4AJNA 3UT6A 1E3WA 4AN4A 3QEKA 1X7ZB 1DKQA 2D59A 3FVWA 4E13A 4EF4A 1X9GA 5DSXA 3BE5A 1GCGA 1Y1PA 3QVUA 5CR9A 4OA8A 3KUXA 1QGOA 4ZVQA 5H3LA 5KYGA 4RDXA 1P3Y1 3HDYA 5DM70 4FCTA 4KGDA 2VWQA 5ALLA 1XJ5A 2WPDA 3CPHA 3VPGA 3J7TA 5IF9A 5KDDA 3QVLA 2FWJA 2X1MA 3U3KA 1KRHA 2AK2A 1X3LA 3EDQA 3Q1KA 3EXEB 1TMOA 3F1LA 2B4KA 4HXYA 4Q0MA 5E9AA 4RK6A 1K0FA 2CLOB 1CUSA 4HDKB 4L9SA 4KX5A 4BMCA 2BGLA 3GP3A 1RTTA 1EFPA 3B9QA 3E4CA 5KNDD 2C2HA 1YA8A 5TR9A 1R6UA 3M2PA 1IEQA 3PDIB 5AD1A 1YIAA 4WOBA 3FUUA 4AJOA 4XIGS 5TJHA 5ETJA 4L75A 3UK6A 2QN7A 4X1YB 1A7UA 2H5LA 5K3OA 3EC7A 3NYIA 5THXA 5EZYA 4CZ2A 2IE0A 4MI1A 4N5HX 4KNWA 4RH1A 3QVTA 3CRW1 3EAQA 4JUFA 2GUGA 4Y98A 4B5KA 2AC2A 4WNIA 5AW4A 1MG5A 2RGXA 1P3JA 3D6MA 4Q7MB 3RFXA 3MRTA 1K63A 5L3QB 3VXKA 2O8CA 2E87A 5KC8A 2P9BA 4Q7KA 2Z1MA 4QUAA 4XGKA 5K5EA 2BMDA 4ZJZA 4US2R 5K4HA 3SYMA 2N0SA 3B53X 1C30B 1ZJ4A 1U80A 3EPRA 4AYXA 2FZVA 2IQ5A 4OFBA 4UUOA 1XTJA 5JLAA 4OBBA 1QHHA 1ZI6A 3IEXA 2GZAA 3KAQA 1L7QA 1QCDA 4A1FA 2GN8A 1JB9A 4R83A 4UATA 3MCTA 2J5RA 4JJKA 1L4YA 5DSTA 3TH5A 1DFGA 2YWDA 3EDRA 1T2AA 2P7IA 5L7WA 4TROA 1Z5OA 1KMCA 4CR7A 3JAWA 1BDMA 3DL4A 4P7BA 5P21A 4Y2RA 4B0OA 3B9PA 4NRDA 3UJ6A 3ABQB 1D6JA 1FQWA 3F7TA 3FCAA 3SLKA 1LK7A 1FMJA 5BSFA 2XGOA 1FPMA 1II0A 5DLYA 5DTMA 4DIKA 4INOA 3GUZA 3OQNA 3RHZA 2Z3ZA 3I61A 1J20A 3ISTA 3PNVA 4IOLA 4MRRA 4P22A 3O1HB 5KWJA 3V2HA 3IQGX 1KOJA 1E59A 3OQ6A 3TEFA 2X86A 1T2NA 5IXSA 4JUIA 2CVHA 2K4MA 1KKMA 4ECAA 2CXSA 2NZYA 2QS9A 2GD0A 1CJVC 1BMQA 3LXMA 5I7RA 4WECA 5AKLA 2PRYA 4LF7B 1GKKA 2H1RA 2I2BA 3BFVA 1SVNA 3N07A 2GVZC 3GJ5A 5A0VA 4BGEA 1NN0A 3BM5A 4IXWA 2JFHA 2Z2KA 2WAXA 5A62A 2XE6A 3DTVB 3EBLA 1YVPA 1CUYA 2BEVB 4IBOA 2UVPB 4HEJA 1NFFA 1ZRSA 3BIXA 1WDKA 4PHGA 2HUNA 2RHHA 3PIDA 5DIZA 4HPWA 4CHTA 2D2EA 4EMTA 1OWLA 4KBGA 1GYQA 1Y7PA 1U1EA 2QRVB 3EPPA 2YKGA 2C03A 1J00A 3Q72A 1DJOA 1SVOA 5K3FB 3P9NA 1Y8QA 1Y9AA 4Q1EA 5DX8A 3N2YA 2HIGA 2DX7A 1QSGA 2P7HA 4CMGA 1WXEA 2Q3BA 5DB4A 4Z4GA 1U2GC 4B8WA 4O4JB 1Q50A 1DJLA 4FI3C 4JLPA 3DWIA 4PX2A 5HM8A 4S04A 1DU4A 2AR9A 2PX4A 3DP9A 4KXXA 4NBKA 3ZVRA 2AL7A 5C8ZA 3EVNA 4PCUA 1I5EA 3OUTA 3HBLA 1DIBA 2B9EA 3JR3A 4IZ6A 4NBNA 4DLYA 2BTQB 4LJ4A 1FPQA 4IZIA 4L74A 1I0LA 2ECKA 3TTUA 3ZOKA 4B84A 1Y6ZA 1G21A 1GZ7A 1LI4A 2OD2A 2PJUA 4OUDA 4WQMA 5EJ6A 5GIPE 1UXKA 1TECE 4P33A 5I6DA 1JU3A 1YGYA 1U3WA 3BTVA 4IVNA 4X8MA 3KK0A 5TPWA 3V7FA 2OC9A 2WWYA 1S8FA 1CUEA 3NEJA 5EE3A 2IUUA 4COKA 2RSLA 4GMDA 3F6BX 5E2IA 1NLZA 4E1AA 2IIPA 2KE5A 1YS6A 4K9LA 1JFRA 1ELOA 4D0RA 3H84A 3P2OA 1JEYB 1THGA 5DH9A 3FCXA 3T6KA 2ERCA 3KHUA 3RHSA 3RVDA 1NXTA 1KH3A 2ZZNA 1XU4A 1Y4ZA 2YIDA 3T38A 3PEFA 4CEIB 3DOHA 1F51E 3BG5A 1AV6A 4AP6A 4HB4A 4NE9A 4OBWA 2CC2A 3DONA