3F6SA

Desulfovibrio desulfuricans (atcc 29577) oxidized flavodoxin alternate conformers
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
147
structure length
147
Chain Sequence
b'SKVLIVFGSSTGNTESIAQKLEELIAAGGHEVTLLNAADASAENLADGYDAVLFGCSAWGMEDLEMQDDFLSLFEEFDRIGLAGRKVAAFASGDQEYEHFCGAVPAIEERAKELGATIIAEGLKMEGDASNDPEAVASFAEDVLKQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavodoxin
publication title Pseudosymmetry, high copy number and twinning complicate the structure determination of Desulfovibrio desulfuricans (ATCC 29577) flavodoxin.
pubmed doi rcsb
source organism Desulfovibrio desulfuricans
molecule tags Electron transport
total genus 50
structure length 147
sequence length 147
chains with identical sequence B, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3f6sA00
1F4PA 4C76A 3FVWA 5EA2A 3HLYA 2XODA 2FAXA 1OBVA 3NHLA 3KAPA 3ESZA 2FOXA 2BN4A 5NULA 2MTBA 2QX8A 2XOEA 3OJWA 3ZHOA 4H2DA 5FX2A 3N3AC 1WSBA 1FLAA 3QE2A 2X2OA 1FUEA 4GR9A 2F1OA 1E5DA 2ARKA 1AKWA 3FJOA 4QOIA 2OHJA 3TEMA 3P0RA 3LT5A 2MT9A 2QX9A 1J9GA 1T0IA 1D4AA 2Z9DA 4N65A 3SVLA 3NHKA 3KAQA 5EMNA 4LAFA 1CZOA 1OFVA 4HS4A 4YALA 3NFRA 1CZLA 2ZKIA 2V9CA 5FUQA 5LJIA 1DX9A 3FW1A 3OX3A 2BPOA 1TIKA 4ZVLA 2FCRA 4ZVNA 4LTDA 2M6SA 1AKUA 3FNIA 3O73A 1T5BA 3S2YA 3NHSA 4YQEA 4BMPB 3KEGA 1XI2A 3TZBA 1RLJA 1CZUA 2QX4A 1ZWKA 1J8QA 3K20A 4BMOB 3U7IA 3OWHA 4Y7CA 4FGKA 1YOBA 1J9ZA 3EDOA 4C0WA 1YCHA 5LMCA 1JA1A 2HNAA 4U7FA 1YCGA 3L9XA 3NHJA 4FGLA 4LTMA 1KBQA 4XDHA 3F90A 3UXHA 1X77A 5B3KA 1VMEA 2Z9CA 5BUCA 4N9QA 4ICIA 1YCFA 3NHUA 4PTZA 3GFRA 1KBOA 3EYWA 2QX6A 1AMOA 3QFRA 1OBOA 1ZWLA 1J9EA 1SQSA 5LBTA 4ZVKA 2FX2A 5F51A 3F2VA 1AKVA 2HNBA 1C7EA 2AMJA 2OHIA 5B3LA 1RLIA 5NLLA 3NHRA 2R97A 3W7AA 3B6IA 2FDXA 3NHPA 4OXXA 1QHEA 2QMZA 1GG5A 4D02A 3ESYA 1FLDA 1I1OA 2FZ5A 4S24A 4DILA 2QMYA 4C0XA 1DXOA 2D5IA 2M6RA 1SG0A 4YAWA 5F12A 2N1MA 4YAFA 2FZVA 2FVXA 1AZLA 2BF4A 4GI5A 3GAMA 2MWMA 3OWXA 1FVXA 3OJXA 1FTGA 1CZKA 4PU0A 3NHYA 4LTNA 4ZVMA 4Y9RA 2GSWA 3NHFA 1B1CA 1CZHA 2OHHA 5EAIA 3KLBA 4R81A 2FLVA 1AG9A 3G5MA 5ULLA 1FX1A 1QR2A 2QR2A 3GFSA 1XT6A 3QFCA 1NNI1 2A5LA 3ES9A 4CETA 1C7FA 2Q9UA 4U7HA 4YAOA 4PTYA 4DIKA 3JSXA 1D04A 1YRHA 4CF6A 3B6JA 3LCMA 1AKTA 3HR4A 1TLLA 4QOJA 3NHWA 4M0CA 5LBUA 2Q62A 2Z9BA 3L9WA 2V5UA 3OX1A 2WC1A 4YAUA 4N82A 1RCFA 4Y9UA 1DXQA 4NULA 3TE7A 1FLNA 1BVYF 2Z98A 6NULA 2OYSA 4J8PA 2BMVA 4QOHA 1JA0A 2HPVA 1ZX1A 4GQIA 4QOFA 5FA6A 2RG1A 1QBGA 4NLLA 5F4BA 3RPEA 4QOEA 3ESXA 3HA2A 5A4KA 3R6WA 4F8YA 1CZRA 2X2PA 3F6SA 4QODA 1D03A 1RTTA 1XYYA 1H69A 1AHNA 2MOKA 1YKGA 1V4BA 1BU5A 3O2NA 1YDGA 4FX2A 3U7RA 5JROA 3K1YA 4LA4A 3UXEA 3NLLA 3OVMA 3F6RA 1CZNA 5LVAA 2KQUA 4C14A 3W79A 1H66A 3W77A 4HEQA 3N3BC 1XYVA 2QWXA 4DY4A 5LJLA 3FX2A 4H6PA 3GFQA 2V5VA 3B6MA 4XDGA 3D7NA 4QOGA 1QRDA 1AKQA 1FLVA 1WSWA 2B3DA 3OX2A 2KLBA 3W78A 4FGJA 5TGZA 2W5UA 2R96A 3B6KA 4U7GA 2BZSA 5LLDA 1AKRA 3N39C 4ESEA
chains in the Genus database with same CATH superfamily
3H9CA 1YS9A 1E98A 3G02A 3OI7A 4MDYA 4RHEA 3KQHA 3THXA 1BWRA 3T7CA 2BMWA 5CNMA 1KEVA 1KETA 1UIRA 1ZOSA 3P9KA 3WHIA 3ZV4A 1CDOA 5IABA 2E6UX 2H4WA 2X9VA 4KJXA 1UJBA 4IIJA 4XOUA 3VR5H 4BO7A 1OBVA 1PUIA 4ZVPA 3AI2A 2HBZA 3I37X 1UAYA 1C1YA 3H86A 4F56A 3AY7A 3OCZA 2VJYA 4JC4A 2QLBA 5HQTA 3TINA 1R4MB 2YZKA 1IG3A 1GPKA 3O8OB 2FOXA 4AKGA 3IIJA 4B6EA 5AJHA 5DN6A 4NBUA 1LH0A 2QRVA 4ABYA 2XI4A 3A1SA 4EKNB 5BNTA 4P5DA 2XZPA 4LC9A 2WKRA 2CFSA 3LUKA 2ANCA 4QFCA 1G5FA 4V0QA 1M34E 3OJWA 1Q19A 1GDDA 1OGIA 3RQSA 5LXTF 1NBEA 3AH8A 2XNCA 4M37A 4UNSA 2WABA 3EBOA 3HO8A 3QOFA 2XDWA 5EE1A 3VYSB 3ZHRA 1IRXA 5FA8A 2PT7A 2XCLA 4C0QC 3ICQB 1QCYA 3HKDA 2B5VA 1SOWA 5DPMA 4F2HA 5CH5A 3MLBA 2DBYA 3CLRD 2BCJQ 1EIZA 1V37A 5L4SA 1P0IA 1NW9B 3HJGA 4G9GA 3GJXC 4XARA 5C0OE 4MJ7A 1LI4A 1ABEA 4AL4A 1MZPA 3C5WP 1OLXB 3UQZA 4V39A 3WLIA 3HWWA 2ZWIA 4OP2A 5F2OA 5TIIA 1EJBA 2BTQA 3IDQA 4I55B 2OHJA 3BCSA 3DLBA 3HRIA 1MPTA 4PPNA 4XB1A 3FCAA 4MB2A 4IV5A 4X7BA 5FNVB 5HR5A 2QDXA 3UMYA 4G4IA 3QKIA 1YRWA 2WIAA 3AETA 1QC5A 5B1IA 4HNTA 4M8LA 3ABQB 4X54A 5ALZA 3T3OA 2HSEA 3PNMA 3LT5A 2WJ4A 2LUOA 4GPIB 2QEQA 2FGKA 2VWHA 3KDAA 1MO6A 1XVVA 2A58A 2QVCA 3BMOA 4UMEA 1SMKA 4DV7B 2MJLA 1H9BA 2PMWB 5K0BA 1B00A 2EP7A 1XNQB 3G49A 4INAA 1HDIA 1HNWB 5ETJA 4OL9A 3UYKA 1NVAA 1MCZA 3V8QA 2Z9DA 2FPUA 3BJIC 4FN4A 1Q11A 4UNQA 3U09A 1DCTA 1UK7A 2WD9A 3JD0A 1T9HA 2FPSA 2KJQA 3IV9A 4AECA 2FPWA 4AO6A 1GQSA 2VNAA 1YFJA 4ROTA 1TFRA 4NU6A 3KQLA 3R9XB 1JB1A 4QNMA 1S9DA 5FHQA 1OFVA 1IU9A 1R0BA 4RGVA 4Y2GA 3SIPA 2W2KA 3Q8WA 3DAFA 1BXKA 1UZMA 5GJVC 6CHYA 1MB2A 1W1WA 3N7TA 3LKZA 1PJSA 2QW1A 2O05A 1RPJA 4RY2A 4YALA 5F5NA 4EB6A 4TMZA 4FVTA 4WA8A 1QV6A 2C4WA 3BXZA 5BV2P 3NONA 3A2LA 3DM5A 2IHNA 3KETA 1CZLA 2SKDA 2Z4RA 3DXZA 1N7IA 3DEJA 3L82B 1RWMA 3P2EA 3P4UA 3E23A 4XFJA 1PN3A 2YFYA 3H87A 4UARA 5EUCA 5ILGA 2XCSB 1V6SA 2V03A 1WMSA 1DJOA 2IHZA 1RD4A 2ZZKA 1MP0A 2WAXA 3RE1A 4YT5A 4CEHA 2ZIAA 4GI7A 3W7BA 1BX3A 1BDMA 4JWKA 2RHOA 1GCGA 2Z4SA 3E6AA 3AK4A 4FFVA 1R9GA 2V8OA 4Q00A 4RGBA 1F0PA 5D00A 4ZVLA 4ALKA 4ZDIA 1Y4ZA 4NHEA 1AKUA 4HP8A 4K81B 3WLQA 1NW4A 3EOZA 1XXLA 4XFKA 1XA0A 2XZOA 1FNSA 1K86A 1KZGB 4O2BF 3Q40A 2HWUA 2KLHA 5A9SB 1ZH4A 4W8OA 3G0BA 5HEKA 4WOCA 1EB8A 2PQ0A 1OT5A 5IM4F 4J4HA 1M83A 3D6TB 4DWJA 4L76A 1RPAA 2WHPB 3ZQUA 3RHSA 2HHCA 2J7KA 3TIVA 2A0YA 2IDJA 1CVRA 3D02A 4GI3A 3ZE1B 3K2QA 3IKVA 2H2FA 3ETGA 5I7EA 2WJHA 2XRMA 3CGWA 1XZAA 3A37A 3KVOA 3ILXA 2FN3A 3AR5A 4JUFA 2VS1A 2HCTA 3DEKA 4NDZA 4BNFA 4BMNA 3F5QA 1LQUA 4UHBA 4KQCA 3EDOA 2XDAA 3ZX4A 1CXZA 2XD9A 4CCYA 1GUZA 3HXOA 3FGPA 3ANNA 3HCAA 4TTSA 1DKOA 2XTZA 3AUSA 3RANA 4CKBB 4EOGA 1W0KD 1LNSA 4R7GA 1QG0A 2G7ZA 1PLKA 2O8BA 1EWKA 2KS6A 2MYTA 4LMBA 3ZDFA 3ITEA 2X0KA 3LTNC 4P4UA 3I04M 4AF8A 3TCKA 3GRPA 2P9JA 4EJSA 3EA5A 2EFJA 3X1ZA 3CWZA 3A6KA 4KE9A 1XDGA 4BB9A 1SN7A 3DE2X 1CJSA 2OGUA 4XDHA 3BE5A 1C1XA 3PHIA 1RSZA 2EJWA 4Q1DA 4X3CA 2AEEA 1EEXB 2VYQA 1Y9DA 3E3AA 3OQ1A 1LDBA 3P0HA 4KODA 1QGZA 3ZOKA 2VC2B 2NZ8A 4BLWA 2YWGA 2Q6OA 2GCIA 1GG9A 1H05A 2OUIA 3DEHA 4TL6A 5DYIA 4BMDA 1E3DA 4ZD6A 3BGIA 4MIOA 4JL5A 4ESOA 4YRLA 2NUPA 4GRDA 1XE3A 1W6RA 4DEYA 4HH4A 3BA6A 2X4GA 1W46A 3ZUGA 3JARB 3TX6A 3KE8A 1M34A 3F3MA 2ZZNA 5KKCA 1CHNA 2YKGA 2N9UA 3OZGA 2HWYA 2F3PA 2FCAA 3FOZA 1ADCA 1ZGJA 3C5HA 2NU8A 3WDMA 4F2GA 5B7NA 5LOVB 1V45E 3G1TA 4YRIA 1VG9B 1LZKA 4JYBA 4X45A 4HS9A 3KZKA 3WLRA 3OF3A 2GD1O 1YAJA 3VAYA 4ENTA 5L3RA 4UDYX 1VPLA 2YQ5A 4LYAA 4KQMA 5D5PA 3LC7O 3ZLUA 5KHAA 4BFVA 1CRZA 2BZGA 1GAJA 2EX1A 3B6IA 3L1JA 4G0QA 3LBFA 2GHRA 1KYTA 3KZOA 4BVKA 2ACKA 4HRXA 1IEQA 2WW8A 4DNQA 3II6X 3OY2A 2BFFA 3JYOA 4KBYA 1F8UA 4MKIA 3TSOA 5I7VA 2I7XA 4D1YA 2HA0A 1GRQA 3MOIA 3R9KA 3D8NA 4ZV9A 3AMVA 4G37A 3TS1A 1J06A 1GPDG 1NRJB 2DY1A 4BNNA 2XWSA 3QTTA 2HLNA 4JYMA 5G4KA 4C0XA 5BWLA 5FH9A 3AIOA 2AMYA 4TLMB 3SNHA 3VVBA 1S4QA 2J9RA 1TE2A 4RLSA 3LL7A 3UK2A 4EB0A 2YNMC 3JV7A 1A7AA 1NLFA 4HUTA 4O3MA 2IEDA 2OG2A 3QLEA 1V4NA 3U3OA 1RHKA 3R5JA 1NOJA 4LISA 1G9SA 5ALLA 4TTJA 6REQB 1F2DA 4HDRA 3PXDA 4ID3A 1YI0A 5HG0A 2GM4A 1P7VA 3UV6A 4YCDA 1I6WA 3T1VA 1JJIA 1V39A 3CEHA 1CU1A 3I9KA 3NRBA 3STYA 2I3GA 4RX1A 2HQBA 4FONA 1UC9A 1X8XA 2FZVA 4TXNA 4WMLA 5JV5A 1KR5A 4YCSA 2C2WA 3JVUA 3O1IC 2HJVA 4OI4A 3KYDA 3ASYA 1XKXA 1J7JA 2X1VA 2Y1OA 1X7GA 1HA3A 4HTFA 3VO1A 4F6RA 5I7UA 3EQ9A 2HO5A 1SK8A 3ZU4A 2C8VA 2A57A 3K8OE 3DCJA 3MOGA 4J16A 3AZPA 5F1OA 4EHIA 1BXRB 2QNIA 5AM2A 1N7HA 1VE6A 3ZDQA 4ZVMA 1NGSA 4Y9RA 2LDBA 1LRLA 1UBCA 4LZLA 5DRTA 4EVIA 1G3IA 1YBVA 4I55F 5C51B 1U1DA 2V1UA 4D25A 4QRIA 1PDWA 3JQBA 3NB0A 2W6OA 1GKLA 5FWYA 2C4UA 1ZZEA 4O08A 2YXEA 2FMIA 4J0CA 4HUQB 4BB5A 3NUQA 3KLBA 5IS2A 1A9RA 1FFEA 1VL5A 5JWRA 4BRZA 2VWQA 2YXDA 1HEIA 1V25A 1W36B 2B8WA 1ZQ1A 3UJPA 1NN0A 2N46A 3IQFA 1O0SA 1NE7A 3UFXB 1A76A 3OIWA 1P9RA 4OI2A 5M34A 5A5GA 2CV2A 1NYQA 1Z5ZA 5CDUA 1SD1A 1VCMA 2VDOB 4Z9BA 2J3IA 3UT6A 2WWYA 2EF1A 4KTVE 3QFCA 2HDOA 3MJ4A 1QIMA 2NTYC 3BRSA 4PIVA 3WADA 1K27A 3MCUA 4TTVA 3L6RA 2PBLA 4U3JA 4BFWA 1Y5NA 4FW9A 2QRZA 1C7FA 2OP1A 4GO1A 4RS4A 4K6MA 1SRRA 5GGYA 2PJRA 1EFLA 2BRUA 2BI4A 3CLTD 2Q7XA 3LDHA 3KB6A 1LBQA 1VKRA 3TQOA 1B6SA 1DQPA 2PL5A 1JNXX 3EGWA 2PT5A 3DYVA 3FPJA 4DMGA 3OP1A 3T7RA 2DQSA 4V0ME 2G07A 1ZAYA 4KFRA 4M8SA 3ZE0B 2UYYA 2GD6A 3EDRA 4JQOA 5HF6A 1Y7LA 2XXBA 4C0KA 5CU7A 2H08A 2Z3WA 1TJ3A 2AC2A 2JBWA 4KYTA 1Y4UA 5C35A 1A1SA 4DA7A 1K5GA 1Z2PX 2YZ2A 1TLLA 2ZS7A 3OOEA 4RO0A 3ZVLA 2ZUEA 3NHWA 1G6Q1 3R0XA 4P3KA 2JAXA 2EFHB 3JPWA 1O54A 3DQZA 3QMPA 4OFWA 2JGIA 5F7OA 3H17A 4R2HA 4ISCA 3WYAA 4ZYVA 2H0RA 4TMTA 3KO8A 2KSQA 3CW8X 1SU6A 3HLKA 5BQOA 4YCNA 1B8NA 5COQA 1LTHR 4AZWA 1XVIA 1ZCJA 4G0OA 4CMKA 1U0SY 2YHAA 3W8EA 4U2KA 2PU5A 3LUHA 3O4HA 3NWEA 1DJPA 3BX1A 4OX9B 3TFWA 5DM2A 1XLTA 2G6BA 1QP7A 4ZRMA 3GA0A 3EGDA 3U1TA 3DAYA 1TADA 4OH7A 4MYDA 3T1HB 1JHUA 1SJ9A 3A6JA 3DULA 3JQQA 1UPAA 3HR8A 3N6XA 4D9HA 5HKOA 1HT3A 3M5PA 4XAQA 3VR3D 4Z54A 1NJ8A 4M2LA 5AWFC 4BTLA 2BONA 1JYEA 3COPA 1L4LA 5A5DA 5E9AA 3SF0A 3VR4A 1IBCA 2AE1A 2I87A 1QG6A 1PQPA 1ZX1A 2B1IA 3CXUA 3U4DA 2XWJI 3ZBTA 3ZCSA 2ECFA 3OJLA 2IXDA 5LFAA 2RD2A 2Z95A 3HO1A 1YMVA 1QGED 3I52A 4S2EA 3LHIA 4QOFA 4XXHA 5JO0A 2O2IA 3J7AC 2H1OA 3OJOA 5MHTA 4LRSB 1HKUA 3DC2A 5F4BA 4ZREA 2C31A 3RU7A 2BFBA 5BVHA 3E9YA 3OM9A 5AW2A 1KMNA 1ZC3A 1IHXA 4FEYA 4ZFNA 1KH3A 4CKYA 1YQ9A 5I9IA 2AD1A 2N47A 2AFIB 3QU4A 4HWPA 5FO1A 2YBEA 4H15A 4B4DA 5JDIA 1DKPA 2ZR9A 3JQFA 4KNVA 4M0LA 3CB4A 3RG8A 3HZHA 4HB4A 5L7YA 2G70A 1KK3A 2D2EA 1Q14A 3HB1A 3GLVA 4M0DA 2QXUA 1R6VA 2ZP1A 3D3WA 3UANA 3ED5A 3C3CA 2PM8A 3DA8A 3GLFA 1XDZA 1X7XB 1ZD5A 2GEVA 4E51A 4KN6A 1WUJS 2OHGA 3SWWA 1A2BA 1JXOA 5TPZD 3KQTA 5E3HA 4E09A 4OXKA 3CSUA 5EJIA 3EF0A 4BVHA 2IPAB 5EP2A 3UJ6A 1ATIA 3C7CB 3OIYA 4IICA 4DDMA 1K4KA 1RKBA 3PFHA 4CM6A 5KYTA 4Q3KA 4B84A 5L3QA 3QENA 1T8WA 4MUGA 4QFDA 1BKDR 1I3MA 1MEOA 1U80A 3LLMA 2V6FA 5GZ6A 3CZPA 1YZHA 3NV7A 1SC9A 3TTVA 3ZE2B 2G36A 3ZHYA 2ZKLA 3VPXA 4BWGA 5LOVF 2B98A 4EAAA 3RRYA 4Q5IA 4JR0A 4DNPA 4HSEA 5TT0A 2IX3A 1XYVA 5H9WA 3I3SR 4ALMA 2XE8A 3D4OA 4CEIB 3NQ41 1GPWB 2D4AA 1YD7A 2I80A 2X8BA 4Q9DA 1G7CA 2QYOA 4Y1EA 5AKLA 5KUTA 4EX6A 5FNVA 4F2PA 1GZHB 1KJNA 3JZMA 4WQMA 2LRHA 3HADA 3UTDA 1B2RA 3UA4A 5EWMB 5JUWA 1XEXB 2O2HA 3WNQA 3FTCA 2DH5A 3P7MA 4H9GA 5D7NA 4Z4FA 4UM8B 3FYHA 2GWHA 3HNOA 1I3KA 3PQDA 4TZKA 1VP9A 1IEWA 2CVFA 2G4VA 2YRWA 4LE0A 3C14C 1FS6A 4QSHA 3L07A 4JJIA 1E6UA 5FI3A 5FUVA 1OZAA 4FTWA 3QXCA 4MW7A 1CD5A 3T41A 3NZEA 1LBEA 3HR7A 4I9UA 2PQ6A 3EW9A 5K8TA 5ITZB 2Q3BA 4RIGA 4Y2RA 1FZTA 1KI3A 4MQUA 1ULHA 2IS2A 1I51A 4V24A 2PWYA 1LCIA 3ASVA 1ESEA 4J0IA 1VYUA 4Q9NA 2CUNA 1E9AA 1OHHD 2QY9A 4AIIA 4EFMA 4AM8A 1AU9A 4WIAA 4EY5A 2R8EA 1XDUA 3EJ6A 3FWPA 2NUTA 3V00A 2P11A 1Q84A 4KSCA 4QYSA 1C7JA 2XWBF 1ZZGA 1QAQA 4IILA 2YJTD 3PNPA 4DM3A 2VYCA 4YRGA 2OZPA 5GWXA 4DA9A 5JCXA 2GA9A 2FLKA 5B1DA 3QW4B 3B5EA 1LWOA 3CN9A 1JR2A 4PG8A 3TQHA 1H6AA 3Q6MA 3NM4A 2LDXA 4V0MA 2HU5A 3AFGA 4DE5A 2RE8A 3M8KA 1JJBA 2DR0A 3HKEA 1IZYA 1RQ7A 2RH8A 2X3YA 3AHCA 3MRTA 2PAFA 4L6AA 4RHCA 4C6HA 4ED9A 2XE6A 3HA5A 1DAMA 2HMSA 4YMWA 3O90A 4NZPA 5BV7A 4KYVA 4L0CA 4QAQA 1E79D 3CS3A 4JODA 4HAIA 4G0XA 2MTBA 4IG9A 1R27A 1XNHA 2Q5QA 3LOQA 3KTFA 1ONNA 3UAZA 4YIKA 4TS1A 3TZEA 1XRNA 5HBGA 2QJOA 1Z0KA 4RWZA 1T9GS 3KYIB 1E5LA 1QVZA 2AVNA 1EFUA 4LY6A 1M6YA 1ZGAA 2OQRA 5BUQA 2QN6A 4DDWA 1GQQA 1TCUA 2EARA 2IU4A 4QU8A 5BWBA 2ZS9A 1IWBB 3BWMA 2WJIA 1PAUA 2O8FA 3EB9A 1KQ3A 4ND5A 4RTPA 1GA4A 1DAGA 2F67A 4GYWA 2JIZA 4NS1A 3S81A 2D0OB 3DP9A 4XZ3A 4Q9HA 1QYDA 4J91A 1MC1A 3UK7A 5KQPA 1L9KA 3IQDB 4PSKA 4W6ZA 4QE3A 3N6VA 3UKJA 3WL6A 2DRIA 2YNMD 2LXNA 2XMQA 4H1UA 4KAAA 2QAIA 3LCRA 2ZCUA 3UXYA 4DV4B 2VVTA 3I39X 4XYGA 3SU8A 1FCJA 4X97A 4NSNA 4J0KA 2FW8A 4EYEA 4ZDJA 4Y3UA 4XDZA 1KVTA 3CVOA 3H5LA 1ODLA 2ZRIA 5TEWA 5B4UA 2GZ2A 1DE0A 4L15A 4NNJA 2D5LA 2VDPB 1QO7A 1ISFA 4ZGBA 1NFFA 5FLKA 1E9BA 3TLKA 4XWGA 1KDOA 1SCQA 4L08A 4NPCA 4IHKA 2H1CA 2GEJA 4UUNA 5T4HA 4QXMA 4OMUA 3QPVA 1H6CA 1NP6A 1OREA 2MSNA 3EMDA 4IP0A 5KYXA 1SU4A 1P5RA 5KDDA 2ES4A 4BMXA 1R6TA 3HO6A 5AI4A 4RYDA 2FSIA 1ZK4A 3KTDA 4IEEA 1CY2A 4V0LA 4ESHA 1W0JA 2ZJFA 2YY5A 3AGPA 4DHEA 1PQYA 1UDBA 3FJ1A 4TTAA 3RTEA 4KH0A 5D3QA 1JMKC 2VNKA 4LOHA 4PXSA 3NHMA 3HMQA 1A5TA 1DAPA 1X92A 3NDJA 3NAMA 5ICGA 1BGXT 5T6MA 4MCHA 2IIVA 5D3KA 3FKJA 5FJJA 5JSYA 1G20A 4BFYA 1M0WA 1XR3A 2DYKA 3CY6A 5CITA 5IVHA 4RY8A 2XRYA 3E58A 1H2XA 1X7WA 3W9BA 5JADA 1T1EA 4EY7A 5B7PA 4RF5A 3RKRA 2NVOA 1JQJC 1XKTA 1QE0A 4HNSA 2F9LA 3OY7A 1MIOB 3QPWA 3USCS 5LQAA 1Z4IA 2EL7A 1KKUA 2GBIA 2V9CA 5BN4A 4YCLA 1KTVA 1ZUNA 3UH1A 5L45A 2PR2A 1HE5A 3BSSA 1KFBB 2GD0A 4DKXA 3FKSD 5TRTA 5DVZA 1B0AA 5IBPA 5EXPA 3V7UA 3PCTA 5K5EA 5KVAA 3TI7A 3SE0A 1B42A 2BPOA 2FPOA 1KEWA 4OQXA 5FBZA 1DBWA 2QDKA 1HYBA 3EVTA 2IIPA 2AFIE 3GFOA 3RYHB 2AOXA 1XA4A 3O73A 1KQOA 5A03A 3IIMA 3MWJA 4RC9A 3LT2A 1EI9A 1VE5A 3OM0A 5CXSA 4F7DA 4ZI7B 1ONBA 1DDGA 5JNSA 4JEUA 1THZA 2WHXA 3OEHA 1E4EB 1NVDA 4U2DA 1NYRA 2GAIA 1Z29A 3VKGA 4N7MA 3EE6A 4J1TC 1ETUA 2DU8A 2QD4A 3DZIA 1UKBA 5CGZA 1FP7A 1GPAA 4MPJA 2IV7A 1KYWA 1MMFB 4WBSA 3ZH9B 4B71A 3ZWBA 3ONWA 4KGZA 4XFDA 3VR6H 4WJLA 4RBNA 3ICEA 2JDID 4HMOA 4AXXA 1MUUA 1WQ1R 1C3OA 1RWXA 4EB3A 3LQFA 3W5JA 3RSHA 1KKMA 4Y7CA 1US8A 3R3UA 1XPOA 4J4TA 3GQVA 5JE8A 2RCYA 3SVZA 1SUEA 5LMCA 3D4LA 3MUFA 3CBGA 5DKFA 5J9FA 2JFFA 2D5BA 1SBTA 5E9WA 2ZSHA 3DC7A 3F71A 5J2TA 2PWPA 1QJCA 1IN8A 5DJ5A 6LDHA 3SJAA 1UKYA 2CFTA 2JI8A 4R1NA 4X8MA 4IBOA 4H1WA 4C4TA 1VIAA 2AEFA 1GCUA 4YJGA 3T9EA 3OZSA 3UA3A 3HVIA 5SZHB 4EO4A 2D06A 2W2PA 2IXFA 1JWLA 1RP7A 1A72A 3E4CA 3P9YA 1PEDA 1JHVA 1SM4A 3I04A 4UBKA 5KNDA 5AW4A 1RR6A 1LSJA 4Z0PA 1JI3A 4D41A 4OUDA 2P5TB 1EGVB 4YAGA 1QH1B 4GQAA 4JGBA 4RZ3A 2FRXA 1Z6QA 1Q0LA 4JP3A 3ZWOA 5KPDA 3LM8A 5KJFA 2FHPA 4D2IA 4F2WA 5CAEA 3WXBA 4LI3X 4HN2A 4FIDA 3DH0A 2B5OA 5K3DA 2VTBB 3E5MA 3I72A 2EG9A 4L57A 4HDNB 3JWEA 4PSCA 1A8PA 4ZQEA 3W8RA 4DC0A 4E5VA 1WUIS 2XKBA 3R6DA 2YS6A 5LYYA 5LBTA 1JQ3A 1N6HA 2IHTA 1ODSA 4C3OB 3P26A 4TT3A 4WXYB 4YFYA 4C5BA 1H85A 1FP2A 1L7AA 5H0IA 1PT9A 5LP1A 5GJBA 1W36C 5DT9A 4BQPA 2B6HA 5ISMA 5AR1A 2QTGA 5K8CA 1RS0A 2P90A 1Z0DA 3I0ZA 2P7IA 3JRXA 3LH5A 1UBNA 3O5AA 4MRNA 3LVBA 2QZZA 4P4LA 3ROKA 3PV0A 1O8BA 3KEOA 5JJBA 1ESCA 2H85A 2WIFA 3BD6A 4HLQB 5C34B 4MW0A 2NT3A 1Q92A 4KI7A 1DOAA 4EHHA 2JARA 3V1LA 3RROA 3L06A 2FQ1A 5AICA 2VFAA 5TPWA 1IHYA 3AJ9A 5B53A 4ANFA 1OH8A 4GXQA 3AF6A 3BF7A 3KSBC 5GJWC 2VWPA 2BZ1A 2VYVD 1KEEB 4FWTA 4TTIA 3R9WA 3TNFA 3CRW1 1FLDA 1Z82A 4HNAB 4Q7MB 4X85A 4EUEA 3QJYA 1P45A 3OA2A 1R10A 3PIIA 3ZZTA 1AH2A 4G25A 3EIFA 2FZKA 1XA3A 2ZB8A 1E0KA 1BVRA 2GXQA 1IUKA 2UXDB 5REQB 2R1VB 3BEDA 1GL3A 3V2GA 1IZ7A 4NXMB 1EP3B 4LCJA 4DQ0A 4J03A 3H6GA 3PFNA 4Q1VA 3URMA 2FW0A 3ESCA 2ZIEA 4OTZA 4BMSA 4DANA 1XYGA 2LVBA 3MW8A 4JSTA 1U11A 1ZA1A 1JV2B 2F3SA 4FYXA 3TTWA 5JS1A 1T29A 2XEDA 5DDIP 2GZ3A 4BKQA 1NJ2A 3DJFA 1QVVA 1EBUA 1XMVA 3D1VA 3FNRA 5I48A 2FN7A 5TF4A 3ZYZA 4O4LB 3ZWNA 3FN4A 4KO3S 3EJWA 1P74A 2NWQA 1EXVA 4DNOA 4MWGA 2I8AA 4R8VA 2GXSA 1S89A 4X20A 2ZFUA 1YGYA 3K3PA 3PKIA 2FE1A 1YVDA 1XDBA 3ESDA 2ZVPX 4MB6A 3ZD9A 5LUAA 2FPGA 2VDLB 2AYYA 1XKQA 3L8ZA 4Z9AA 1XWIA 2FQXA 2G1KA 4PG5A 1FS4A 1MTOA 2GRAA 4KV7A 2JATA 5KX5B 1JSLA 4ZGWA 2ZPTX 1O2DA 1THTA 2AJBA 4UU8A 2WOJA 2X5KO 3FLMA 4AWXA 1GVHA 5JPIA 4YREA 4R0NA 1INLA 1BMFD 2MINA 3FSRA 3GDFA 4GUAA 5EHZA 5I4CA 1WXHA 4R1TA 3QF7A 1I2MA 3L01A 2UUPA 2BGRA 4RVCA 3COJA 2QGFA 1ZL2A 1EMDA 2JCGA 1ULBA 2EJUA 2G25A 2QRLA 3KXLA 2AZ4A 4AI6A 4AKHA 1J5XA 1G3UA 3WGQA 1PFUA 4I19A 2NNLD 3PR2B 3GLKA 1H2HA 2ANBA 4N3AA 2PLNA 3PEWA 1GKKA 3GRVA 2X22A 2QG4A 5LD2B 2A5LA 5AHXA 2ETXA 2HBQA 5JS2A 1T6NA 4A9AA 4QBKA 1PV4A 3B38A 5FA5A 2GEUA 1XUOA 1C0EA 3KEQA 1XMSA 4AXBA 1H22A 2GAJA 4ZCPA 5DISB 2JZOA 4BB6A 2TRSB 3S0JA 1MEEA 1OBCA 3TUIC 2BH2A 1L1EA 4D5GA 4MKRA 2AVDA 1ZNZA 2I71A 1FX0A 1G3QA 4RW0A 4M86A 5DTQA 1D2EA 1Q12A 2PX6A 4PYRA 4H3KB 1E1DA 5KKAA 2DBRA 1HG1A 2DBZA 1EJ6A 2JIRA 4M9RA 6ADHA 3SMVA 3DE3X 3WNDA 3ZUPA 4CEIA 5L3SA 2YXLA 1IPHA 1SWVA 2IOYA 3FF1A 3I6BA 1NVTA 4JBNA 4U9HS 4YAJA 3WLOA 2ZRCA 5GINE 2OSVA 1IULA 4QIHA 1QF9A 1BQ3A 2L69A 2O7NA 4H7HA 5EKSA 3KJFA 4OSEA 4LYYA 4P80A 4UPDA 3UMCA 1WWKA 4CQLB 4DMUB 3L92A 3RC3A 3JSAA 4BLVA 3NEPX 3D64A 4E5YA 5TV2A 4CFZA 1EBFA 1RKQA 1Y1QA 2DFVA 3HCPA 1N4DA 3L93A 5FBQB 5T6BA 3T5GA 3VDXA 3UAOA 4ZI7F 3RH0A 3O1JC 2BZ0A 4DIUA 1V2HE 1DXQA 2O8DB 3CB2A 1YK1A 1HDRA 1P1FA 3ZHXA 3AUTA 2J3HA 2D0PB 4X41A 3VPHA 3CPSA 3BD7A 4X95A 4A3SA 3A6DA 3O21A 3IB6A 2VTVA 2WWFA 3M6VA 4PLVA 1M2GA 3AL0C 3O75A 3A1EA 3UC9A 1ORWA 1PNTA 2QVXX 2W71A 1ESNA 2FUCA 3OZEA 2AUNA 4FIZA 4N9WA 4PYQA 1EUDA 3NVDA 4PGFA 4PS1A 3ENQA 2YMLA 4QPPA 1ZRHA 3AUJB 3DE5X 1M2KA 5F76A 4MWZA 1AO0A 5C1IA 4EZBA 4QTYA 1OVGA 5G1NA 4OHMA 2AZDA 1MGPA 1R9JA 1VM6A 4KWTA 4R4JA 5BQ3A 1FW8A 3O1HB 4INPA 4JS0A 1U0OC 2FJPA 1T4GA 3AI1A 4TMWA 5BSHA 3WAGA 4IWNA 4N54A 5AKHA 1TPYA 4HAXA 3BAFA 2XUIA 4RH1A 4YO7A 1NW5A 1R00A 1Z15A 4I2VA 3QOYA 5CB4A 1D03A 1RLUA 1I5EA 2VT2A 3IJRA 1JN0A 2QUIA 3GUUA 5DI3A 4Y7DA 5J2UB 1IHUA 4D9KA 3FRHA 2HHLA 4ARVA 1L5FA 4BZWA 3AHFA 5FORA 5A62A 3KR0A 1IH8A 2CMKA 3DBRB 1TYCA 1P7YA 1Y63A 4FHDA 4MYTA 1O94D 4QHYA 3X1YA 4C07A 3Q3HA 3GR6A 5BPHA 3MZ0A 4LDQA 1B73A 3RWBA 3GRKA 4S1NA 3SDBA 4BKMA 2P6MA 4PG6A 3BFXA 5EQJB 3IRUA 4YPFA 5IT5A 2QW0X 2WU3A 4URVR 4P3XA 2J9FA 4RM2A 1L1RA 5LNK1 4DSNA 2PUAA 4RSMA 5B1HA 4DLLA 2B6NA 1TUBB 3GPIA 3OFKA 3EG5A 2W22A 2H5LA 3CF0A 3GJTA 2WAAA 2C9DA 3H13A 3GVPA 1UODA 4P3OA 4UEQA 4W9NC 2QF7A 3WRXC 3MBOA 3B7WA 5J4VA 1TEHA 2BMFA 1A82A 3B8HA 1Z6TA 1V7ZA 3K9CA 3CW9A 4QASA 4MGHA 2KQUA 4LNUB 2OYCA 1QQAA 1R9MA 2E48A 4FR2A 1GSOA 3WVNA 4BQSA 5FWAA 2QRUA 3RJ9A 4A92A 3P9XA 2H9YA 3UCFA 1E9FA 4LXYA 2QQ0A 3RABA 5KIAA 4UTPA 1G16A 1PJCA 2E5LB 4DV2B 5JQWA 3K96A 3GRCA 3NHZA 2CLKB 2G1UA 4ZQGA 1NHGA 3BC1A 1NKSA 1VFNA 4B8ZA 1JEJA 1V5EA 4H17A 1JHYA 2R6ZA 1UFRA 1YS6A 4OOEA 3H1BA 3P2MA 2V5VA 3RYIA 2A4MA 4FD2A 2X9LA 2FEMA 2QVYX 2VK1A 2Z2ZA 3C3KA 3L0CA 4D0GA 3RREA 4E22A 3ZGLA 2ICAA 3LSTA 3BMNA 3ER6A 3QELB 5AJWA 2AOTA 3HVKA 3IHWA 3PJDA 2HGZA 2NQ2C 2W2MA 1XZBA 2PKCA 4J90A 3VV2A 1WZ2A 4BHTA 3ZZ1A 1CKEA 1DWUA 1YWGO 3H42B 1H4VB 1Y3DE 3Q2KA 2E87A 1FFAA 4XJSA 2Y0EA 5LN1A 3RB8A 4OMDA 1ZHHA 5HBRA 1JKJB 1IEXA 1P2VA 3SFTA 4XYLA 1KMIY 3H2ZA 1SH7A 5M04A 4E1AA 3WYNA 5FQOA 1HX7A 5KDLA 2ADFA 2FMKA 4OSPA 2QJWA 1Z6AA 2J9YB 3NC4A 4HDQB 1CEQA 1GSAA 4KBGA 3ROGA 4BU1A 3Q3GE 1CRQA 1QBKC 2WJJA 2OO3A 5K03A 4DWOA 1S6YA 1HE8B 1IZ8A 1E4YA 4G5OA 2ZBDA 5KTRA 1TD1A 2KI5A 1T34A 2JBHA 2K4MA 4D56A 4EPTA 4GZ5A 3GI1A 4M4SA 4OLHA 4AMYA 3QUTA 4L8WB 4UATA 4O4LF 5CCDA 3N8NA 5HQJA 2VJOA 3QLTA 2CLHB 2GX6A 3KUXA 4JKYA 2P35A 1MW9X 2OBLA 3RVQA 2PD6A 4OU5A 5K6RA 1QS0B 1TNDA 3EBLA 4JT2A 3BTSA 5CH3A 3PQ2A 1ZXLA 4X64B 1EA7A 2CXTA 4B8WA 1SXPA 2QVZX 2WJAA 4NH4A 3UW3A 1SA0A 3MVEA 4QUKA 3H3JA 4Q1CA 1JDVA 3IT0A 1FY2A 1RMQA 3IPLA 5EJ2A 5HHTA 5KX5F 3BWEA 3KLNA 1XTQA 3BDVA 4MVJH 3CZCA 2B99A 3KPWA 5CYOA 2G76A 3TZLA 4MS1A 3AR6A 2OO5C 3U17A 3GNLA 4CM5A 2XA9A 3VH2A 1E92A 2B9EA 4WY8A 5JZOA 4L5CA 3OTOB 1GZDA 1TCCA 4N49A 5D3ZA 4ESVA 1HFJA 3ZIAA 3I61A 3HV2A 3PC6A 4WK0B 2GERA 2C07A 3C98A 4MKHA 4EO9A 3ND9A 2BKVA 4TVKA 2X14A 3EVDA 3H65A 3L7DA 1WRBA 4NE7A 5DNEA 1EDOA 2G9QA 3AR4A 4D3SA 5ALMA 5K0SA 2C4TA 1OAOC 3AKYA 4HKTA 4KOAA 4KSYA 2VXCA 4LMAA 5PNTA 4EECA 5BOSB 1U0EA 3AX6A 1QGUB 2W6CX 5CLFA 1CYEA 1P4SA 1MH1A 4U0KA 4X9XA 4DB2A 2BEWB 4MYHA 1JQ5A 1WTCA 3HBNA 5AVQA 4BWYA 2VJBA 1B8UA 5CTAA 1ZGCA 3NM5A 3PE3A 1NATA 2MMGA 4KIJA 3TMAA 3R3YA 3U3XA 1ZO8A 3OHMA 3U7QB 5AQ1A 4B44A 1OC4A 3K09A 4JU9A 1GFSA 3UOWA 1D9XA 1KK0A 1N2EA 4NMXB 3GRZA 3KOYA 4I6GA 4MW1A 1VP3A 3DMTA 3KDSE 4ISBA 3ORYA 1G60A 3M9XA 1PT5A 1PR2A 1UMCB 4M38A 3KL2A 3TZCA 3ZY4A 1P9WA 3LXUX 3TW4A 5CYGA 1FUIA 4NZNA 1TMKA 2P41A 4FE7A 4MYSA 4XX1A 5IYZB 3VA7A 3TRDA 1GM5A 4OM7A 2WYIA 1CV2A 3KB1A 4L5BA 1COWD 3IDZA 3CKMA 1P60A 1XQYA 3G2PA 121PA 3M34A 3G89A 2GLXA 4HQ0A 1O5TA 3PWTA 3A1CA 3OLWA 4ZZIA 4TTTS 5EMNA 1O77A 4II3A 4QZVA 1ZVVA 1EGMB 3OG9A 5JJKA 4DUGA 1VLHA 3HJAA 2NZYA 3Q9NA 1NC1A 3KOUA 5EFZA 1M66A 2P8JA 4BZPA 2VTBA 1JU3A 2IV3A 2QSJA 3MIIA 2JGAA 3AKCA 3IALA 4U02A 4ZT5A 1GT91 1SVNA 2PYIA 2NVUA 1KARA 4CXMA 3HVJA 3EY9A 1JBQA 1EFAA 4XIIA 3UT5B 1P4RA 4UUOA 4X8HA 5G1OA 3MJHA 3IBTA 1DRVA 2WKSA 5CG1A 1VPEA 3PIDA 3QXJA 3TPZA 1W75A 4TV9A 2EBWA 2J3LA 1GY8A 1Z4NA 4J3FA 4ARIA 3R7BA 4BQNA 4DW8A 3F7NA 3VTKA 3E48A 2E4XA 3P94A 4GC9A 1V9LA 5K0JA 5FUMA 4QWMA 1EFVB 1AQIA 2Q3EA 2O8CA 2QN8A 3N6RA 4IAOA 4U6NA 5FR1A 5AFSA 4UHFA 4BO4A 5CEJA 3M2PA 2HT6A 4Q48A 5JD3A 4B32A 1RAAA 3F74A 2R8RA 4X84A 2X86A 3R7DA 4JVSB 3UENA 5JASA 3DL7A 1T8TA 2A4KA 4AZ0B 4D8XA 2XRFA 3J7TA 5A4AA 3UY4A 3CVJA 4BTVA 3O8QA 2YDYA 1KE1A 3GGPA 2PBFA 5E7JA 4HDSA 1FFSA 1CIJA 3AM3A 2VHVA 3NIBA 3GP5A 3FXAA 3NBXX 5KMGB 3OZBA 3E84A 2CDCA 1XAIA 1MV8A 3IJEB 1XRMA 1Y5LA 2R1VA 1I1NA 3TD9A 3IVXA 5ALRA 3RLIA 3ZCTA 2SCUB 4TOIA 1QZUA 4FKMA 4UU1A 3HKCB 3EGCA 1CZUA 2WIDA 4WI1A 1GGNA 4X0EA 1OWLA 3WR5A 1RQNA 3BK2A 3KYCA 3VMMA 3I45A 5JOQA 4BMOB 4UASA 5AK6A 4WADA 4E4RA 4B40A 1FRFS 1S01A 4EL5A 2RK3A 3NKVA 1DMSA 1UQRA 2BFCB 2NO7A 3GRAA 1TCAA 1T35A 2OGTA 2HU7A 2WFZA 3A8TA 3FVVA 3TWOA 1QUEA 1AB6A 3OOHA 4O1MA 3WQQA 4EEXA 1AN9A 4EF6A 3HQ4O 4G63A 1G5QA 1W581 1UMDB 3ELYA 2Q0HA 2HNAA 5SV2A 3IP9A 4HXGA 4FE4A 5C5DA 1W0KA 4RELA 4NBRA 1TVKB 1H0HA 2JHAA 3PWSA 4QPZA 2PLRA 4UBNA 5CA0B 1MB9A 1QHXA 1U7TA 2JGJA 3T3HA 4BNGA 3Q7EA 1FFDA 1JUDA 2GEFA 2JBAA 2Q2VA 3L8CA 3VHQA 5DW0A 2EOAA 4DWVA 1IY8A 1PZFA 3PQ6A 3RNLA 1O5OA 3VRHA 3ZHTA 5IZCA 3I6IA 1RAEA 3LY9A 1RQ2A 1ODIA 4GEKA 4YYEA 3S55A 2I9KA 4DLXA 3OM8A 4P7GA 2NPFA 1U8ZA 5F1KA 4WE3A 2JRLA 5CT6A 4ZT6A 1V35A 1NN3A 2GR9A 3AU9A 3K5PA 3K0HA 1TMOA 3ENKA 2ACEA 1LDEA 2IYPA 2JCXA 5IZCC 2EFDB 4KQ9A 2QX6A 2A5JA 2AOUB 2C2MA 2X8JA 4Z2YA 2QLMA 1DOHA 5ESDA 4QLOA 4IIUA 2YV3A 1XQ9A 1FPQA 3DDOA 2PVSA 1U2ZA 3K0AA 3FCOA 4B9AA 4FOSA 3REQA 4I36A 3PQFA 3SXUA 3SYTA 4DQXA 2MR6A 4MR9B 4GMGA 3ESQA 5ADUS 3WKAA 2H1RA 2VL7A 3N5CA 1QQ5A 5U4QA 3O4JA 3UMJA 1QDUA 2GK3A 2PRIA 3DNFA 4TLEA 5BSMA 3UN1A 4DT1B 5HTKA 2GMWA 2QENA 1OFHA 4GF5A 1IM8A 1VJ5A 2A3RA 4ENVA 2OHIA 4G2NA 4OHYA 5AM5A 3BK7A 5NLLA 1TT5B 2VH2A 3LTEA 4Y9TA 1PZMA 2ASEA 2I4MA 3CUWA 4H1VA 4EW3A 3FYDA 2YHIB 3FZNA 3QMVA 1VQ1A 2WPNA 2GPSA 3UBMA 1I94B 1LDGA 2V4UA 4IKPA 3OLXA 5ECWA 5H4HA 2Q1UA 3O82A 4UFPA 5LD2C 4A6XA 3EZ7A 4DTIA 1KI4A 5DEIA 4MUBA 1FDIA 4PBSA 3RV4A 4UJ5A 3AP1A 2IZOA 2X9QA 2VJDA 3JWGA 3MTIA 5H68A 5HSGA 5FPYA 3K0SA 2VIIA 1JG1A 4EIWA 3O93A 5EE0A 4NOMA 4MX8A 2OZKA 5EHIA 3NBUA 1RXEA 1BOFA 3NETA 3F0TA 3QVOA 5JNRA 1BQ4A 3G7NA 3H0EA 4QXPA 4MS3B 1OOEA 2QRMA 2IOFK 5A7HA 3ZHBA 1QZ3A 3I2HA 3AKZA 2C7VA 5EIBD 1RTKA 1O6FA 1WHTB 4O29A 1H94A 1Y3IA 2IY8A 3RUHA 4L4UA 5B5SA 4AKIA 1IPEA 1YI1A 1HDEA 4LG1A 1LLQA 1H23A 1K2WA 2OP0A 2RK4A 3K94A 4G07A 4HEA6 3TLMA 1EFHA 1T1RA 5C1BA 2BJWA 5FOTA 1R9NA 3ABRB 3O2QB 1ZD9A 1E60A 3MUNA 4MMYB 4DUYB 2RAPA 4BMZA 4A2PA 1BG6A 1RXYA 5JW6A 1VLQA 5L4LA 3J81A 4RK5A 1WTAA 4KXMA 2RARA 3OWXA 2YZGA 3TRIA 1OI3A 3ZLBA 1NMZA 2R0QC 4PLGA 2B83A 2DFLA 1M75A 1SFRA 4DYDA 1ZD8A 5FKJA 4M9SA 2G7MC 1N2CB 3E7XA 2OAQ1 3K5HA 2ZANA 3WLJA 5K0EA 1WF3A 3UUWA 1JKIA 4CMHA 4CDNA 4Q4AB 3DOIA 1WO8A 3L7NA 2P9FA 5I7OA 5HRUA 1OLSB 3ZNQA 3RYTC 4RHUA 1U2GA 1HUQA 5EAIA 2ZT5A 1IFXA 2YHSA 5DV9A 4CKXA 4R81A 1HE3A 3IVMA 2VBCA 4JT9A 3RVPA 3GJ5A 4CL2A 2C04A 4GP9A 4E3ZA 5G0SA 2OESA 5BMOA 4DHWA 5J2UA 1E32A 5F9HA 1GZ3A 2Q4RA 1T8RA 1LK5A 5J4KA 4OFXA 2BFEB 2XNSA 3A4YA 1LPSA 4BV9A 3BZBA 4NG5A 1II0A 4UTOA 1YZFA 5D5QA 1K7XB 1G55A 3QFSA 1SPXA 1X9HA 3RT1A 3MCZA 4W5HA 1PVDA 1XT6A 1Z26A 2I6SA 2JH3A 2W48A 1DFIA 5EIFA 3DOJA 1PIWA 2PNFA 4TKLA 2VNIA 4WNAB 3KJZA 3ABZA 3MK31 3UCEA 4EG0A 1QYCA 721PA 3FY4A 4QOSA 2HQRA 1MVNA 2V7EA 3QBDA 2VEDA 1Q3KA 4I4TA 5SY4A 2HRDA 3QP9A 1EDZA 3JWPA 1FFXA 3W04A 2VF7A 3NEAA 2ZIVB 4NBLA 4U7HA 5E4TA 3W8DA 1RZRA 3F6CA 4PTYA 4BBPA 3T4UA 5IAAA 1MAHA 4O8ZA 3WLMA 3IQHX 3M82A 4BLUA 1YSCA 4NEQA 1UBLS 4Q3OA 4DA8A 1HV8A 5KYUB 1YRHA 1NMYA 2I2CA 3R3XA 4D7AA 4GMXA 2FPIB 1GA1A 2XNDA 1TJYA 3AJEA 3Q0IA 4JCCA 3WWEA 4EKDA 5IU6A 3GBVA 1NAIA 4U5XA 1T6ZA 2IEAA 4Q6BA 3NOVA 1DWQA 4Y0VA 1ZM3A 4TUYA 2JASA 1JGTA 1QKIA 5C5EA 5KOIA 2I6QA 1I2ZA 4WKPA 4ZYTA 3JAMA 1GUDA 1G3RA 2WJWA 2WAOA 3D8RA 2PZAA 4LFAB 3EXHB 3PSAA 3KXPA 5KNCD 5A4FS 2ROQA 2XXJA 4AW9A 1U3FA 4CDGA 4GGPA 4TLLB 5CFOA 4HATA 2DBQA 3PVSA 1JQBA 4D4IA 5JXWA 1IVSA 1SUIA 3IDAA 4JC8A 3PX2A 4Q6WA 4AZSA 4DA0A 5B3JC 1NQAO 1QHHA 2WFLB 2JFZA 3DHNA 4JI0B 1KZ7B 5ECGC 1Y6QA 4K9NA 3QX8A 4KI0A 4CIAA 4LJ4A 1LNQA 1JWBB 1YRAA 4R8LA 4FWBA 1G1MA 3GGSA 2WWVD 3U9TA 5HKKD 1J6UA 4IJ6A 5F98A 2QROA 3WKEA 3ZI7A 1ZEJA 2WA1A 3EULA 2G06A 1X15A 4J8PA 4LY3A 9MHTA 3D6FA 4G0WA 1CS4C 4MV8A 1X8LA 3MB8A 5KJ6A 4L2IB 4R1OA 1U28A 2Y4NA 1BS9A 2C5HA 3LGXA 4UCFA 4K0KB 3E81A 3L2OB 4DMCA 4MA5A 2PWAA 4Y6PA 4KXFB 4A5OA 3OLCX 4KAXA 1FDVA 3PUYA 2FQWA 4KWHA 1N5MA 5D51S 4NLLA 4ZZ0A 5E6RA 1LKZA 1GAXA 3M6IA 3I1FA 4C22A 3WJ7A 5CT9A 2XYGA 3PCRB 2VZLA 1XP8A 4S1TA 3U48A 3K6SA 5A4KA 4KNYA 3HP4A 1E1RD 3NOXA 1XCBA 4ND3A 2RH9B 4X7RA 4RZ2A 3QY0A 2A0KA 4YJ2B 1CQIB 3U0BA 3H11A 5CA0F 4O6VA 3UAYA 4GD3Q 4KW7A 4UHDA 4HHEA 3VBCA 3HJUA 3SR4A 3QXSA 4M8KA 3PFIA 3SLKA 4LF7B 3DDNA 1JU4A 5HFJA 5K4AA 1WMDA 2UXCB 3IDSA 4LGCA 3Q5DA 2MOKA 3WZLA 4Q47A 2XE7A 4G1MB 2O2XA 4JH0A 5J43A 5L51A 1F2VA 1YDGA 3M9WA 1CK4A 2I4TA 2FK7A 2YOGA 4FW8A 5TPZA 3U7RA 4DAEA 2AW5A 4N47A 4JNCA 2AX3A 2BP7B 2R00C 2OORA 2YICA 4R1SA 1U9IC 1DFGA 3JYLA 2QUZA 1KNQA 4NESA 3TF5A 5KINB 1ANKA 2VJPA 1SD5A 4V1CI 3D7SA 1K1EA 4G23A 3VZPA 4JKOA 4MK4A 1XL1A 1CZNA 4Q05A 2G4LA 4I3FA 4WOBA 1N9GB 1ZL0A 5FEMA 3U31A 2QJTA 3DUFA 4M0KA 4WKGA 5ERXA 3HBJA 5ES3A 3E61A 4B87A 1HDXA 2BEVA 3NKFA 2JCYA 1Y8CA 2JF0A 1I4TD 5ALXA 3WGUA 3ZVNA 1GKIA 3JQPA 3M4XA 4QLAA 3AEXA 3B60A 3EZ9A 3IUEA 4TXMA 4BVFA 1WZUA 3F4LA 5TLSA 1YB6A 4QRHA 3QMWA 3HFRA 4JA2A 2A9RA 3MD9A 2GK4A 5CDFE 4JIMA 4M1ZA 4NYMQ 4WZBB 3IVGA 4BFXA 3KZCA 5ICCA 1M72A 2YCLA 3I8OA 1E5XA 2E18A 1YC5A 1YJ5A 2YR0A 2V7PA 2D1QA 2XZLA 2NYRA 2BFMA 2GS9A 3ICCA 1L5ZA 4RZIA 1G6OA 3L79A 5ALJA 4ZC1A 3V7YA 4RESA 1R0YA 1GEGA 2VPPA 2IP1A 3H2KA 4RD4A 4B4OA 4NFHA 3WWPA 1ZMRA 3ILYA 5AHOA 4BQIA 2HWKA 5C7IO 1PQUA 3A3YA 1DAHA 2ACWA 3SZMA 3O3CA 1HK7A 2Q4BA 3PA8A 1WCWA 1WR8A 4EI8A 4WBNB 1AQYA 3KBBA 3Q5EA 4JLJA 4PQYA 2Q99A 2FR0A 3S1SA 1X13A 4P0TA 3TQSA 3CLSD 1DJNA 2C83A 3CTMA 4OJTA 4R05A 2ECQA 1B8OA 3N2GB 4O1HA 4RMHA 4X3OA 2KB0A 1UBEA 2ZTLA 4LHEA 4FGJA 1ZM2A 1RPTA 1OHHA 3V5NA 4U7GA 2ZRBA 5E8RA 3IPRA 2JS7A 3B1ZA 1AF7A 1W96A 5I9MA 5KVCA 1U99A 2ODPA 3EXEA 3N39C 2DWCA 3C48A 3ZKWA 4JJ4A 2CV1A 2DWQA 3L7YA 4GC5A 1MXHA 4QPNA 9LDBA 3CURA 3L02A 1M2EA 3P27A 3N2IA 3OQIA 3V1MA 1NOIA 2QSYA 1VGVA 2Q2QA 4KXYA 3ND8A 4KQWA 5EXTA 1VJDA 3D4NA 3QM1A 3IILA 3CO0S 5JSKA 1U4NA 1YR2A 3GYBA 4G8JA 4J2TA 1IZ9A 3UNXA 1T0JB 2J0EA 4Z3OA 1V11B 3JQ9A 2VQSA 1G64A 3CV3A 1SKAA 3C4JA 3DD5A 1CS0B 1SBZA 3KVYA 1K5DA 3K2EA 4H7IA 3W5HA 1C3EA 2C4NA 3RF6A 5C3MA 1F51E 1QTRA 1L5KA 1WS6A 3TBHA 2XOEA 1V6AA 1VBKA 3R44A 1A4UA 1XFAA 3E9EA 5KPJA 1QRSA 5AVOA 4FGZA 1Q1NA 1V7CA 2F9MA 4QVIA 2VNSA 3ZCVA 1WUHS 4RGQA 3DZGA 3AV0B 1XO1A 4RACA 2YYAA 1XTSA 3N3AC 4MPPA 1KK2A 2FPRA 3P0FA 3TMYA 5LQKA 2GGSA 4EGFA 1A8HA 4JY7A 4M3NA 1BS1A 1KYXA 2CSXA 3EIEA 1XMJA 2V4ZA 3DR5A 4KPUA 4QHTA 5BUZA 5JDCA 1KRXA 5AHWA 4QNNA 5JAOA 4UM9D 1RW4A 3SM9A 4KKVA 1W5FA 2H5EA 2CVPA 2BGJA 2FPPA 1GZSA 3A27A 3T9BA 1NXVA 4GR9A 2FMHA 1UJ5A 4CF4A 2KE5A 4HI0E 4B4KA 4Z0HO 2PVPA 1LBHA 4PS0A 4D9MA 4FFBB 4FOOA 4GRAA 4OL0A 3AF3A 4G0UA 4COOA 1ENYA 4JEMA 3A3OA 1D4OA 4J0JA 5CFRA 3FDFA 3WGTA 4BQFA 4RTOA 2AMLA 4Y6RA 4NJOA 3AF2A 1RRMA 3B9RA 4DZZA 3IO3A 4NCXA 1QVAA 2PL1A 1WSAA 3DB2A 3HBFA 1KDRA 2AI1A 1HURA 4TYQA 4WD3A 4C03A 4E32A 5KJCA 1C8BA 1UM9B 1NURA 1JWAB 1JVNA 2QL9A 1MEJA 3BICA 3OFVA 2XUGA 4ER0A 5EL0A 4C7OA 1U8CB 2OHOA 2V7TA 3OE4A 3P9CA 1D4AA 4U6SA 1BD4A 3WAKA 4KWCA 2C98A 1G2PA 3WHLA 5AOCA 3VSEA 4F9GA 3DE0X 3MWLA 2V6MA 3ZH2A 3A6GA 3KSAC 2K2QB 1GGEA 2WAYA 4B4WA 3G2OA 4CT5A 4YPOA 2Q28A 4LF9B 3BG5A 4R7TA 4EMTA 5IK2D 2ZSBA 1ZGGA 2I6UA 2G0AA 2ZDHA 5TQ2A 2Z3ZA 2A0XA 3PD1A 4B3GA 3FSGD 3NX4A 3S99A 2FQYA 2LCFA 1P5HA 1RIIA 1QO9A 1VE1A 1YB4A 3T7EA 2VAMA 2M32A 1GTVA 3DW3X 3K0FA 3T06B 4R1QA 4DIDA 3T99A 3VI3B 2WWIA 3BJEA 4EFLA 3BWBA 4RABA 1YDHA 1TVCA 3FCYA 3R5HA 4QUJA 3ZZ0A 1IYZA 2GPWA 2B35A 1WDKA 1GPMA 4JYPA 2HJSA 2L2QA 4GWGA 1RVV1 4RD0A 5FHRA 2GFIA 1H5QA 4M46A 4J76A 4AYXA 3VR4H 1Y5RA 2VSQA 4ZOEA 3TLBA 3KR2A 4EPVA 3DZJA 1OX4B 2EJTA 2BJVA 2W2QA 3JU3A 3F6PA 3FKSA 2IDMA 4RGYA 4EDFA 4MQMA 3LE8A 5DCUA 1EVEA 5J58A 1ND5A 2HW8A 2OLKA 4M0PA 4PIPA 1J8MF 4MXDA 1NU6A 5ECDA 2FRVA 3ZWMA 5IFKA 3OQVA 4C0HA 1U8XX 1HH4A 2ZCVA 4JUIA 2ODNA 1CCWA 1UBGA 2R8BA 1BE6A 4MQLA 3I2FA 4TWAA 4GWKA 2GFHA 1FNDA 1JTEA 1BD3A 1OMOA 2ZVJA 2JLUA 2WEKA 1KVSA 5CW2A 2EGHA 3RVMA 4GI1A 2VK8A 2TSYB 3K9BA 4B2IA 1K92A 3KEGA 2ACVA 3KZNA 4NMWA 3D3NA 4YJ2F 4G24A 5FF9A 4CQNA 2D6FA 4IFIA 1C29B 3FM9A 2EU8A 4IXDA 2GZ1A 1QUFA 1EM8A 1BZYA 3G2HA 4GSKA 2NXNA 3IMGA 4B43A 1UPUA 3CUSA 3IAEA 3GG2A 3RSOA 1XCPA 3FMGA 1FJHA 4KLAA 4G9BA 1WL8A 1WKVA 3AXTA 3T95A 2JDIA 5EJ9A 2XGOA 2B2XA 4LBWA 2ZUCA 1X7ZB 3BGDA 4WL0A 2ZI4A 4BEBA 3OPYI 1NJFA 1KVUA 4CFYA 2YN4A 4U9UA 3OHSX 1W4RA 4MUXA 3EGXA 2E55A 3EFEA 3RKSA 3F8SA 1GUAA 2Z4TA 5H81A 3LCJA 5LA6A 4MR7A 1E2QA 1UJ6A 1XZ8A 4R9UC 1SXJD 3TSAA 3O84A 1DXYA 3F7OA 4WOKA 1GKUB 1BU8A 1WIWA 1CR1A 1OX6A 3D0QA 3AJDA 3N2KA 1CNMA 1U0HC 3MB5A 3O2SB 4JJAA 2IFTA 5IN5A 1YR6A 1KMHB 1CR4A 1QX4A 2DBVO 3A6PC 4WZ6A 5BYBA 2EVWX 3L7OA 1SQGA 4R2XA 4UTZA 3BSYA 4WZBE 4XWAA 4YV1A 5JTUA 2OCDA 1YQGA 4Q4AA 2JLSA 1JVSA 2X8WA 2DGDA 2DPLA 4D44A 1X77A 2HFKA 1HC7A 4L72A 5HUJA 2AE2A 4XSHA 3VTZA 3OIDA 5BUCA 1WHSB 4ZAFA 1OZ0A 4DFDA 3TGPA 1YCFA 4DCOA 3WRWA 2WYOA 2O8BB 1T2AA 1XWWA 3RVDA 1XJWA 4FBGA 2J31A 4E12A 1QRAA 3OTQA 1H4QA 5ALTA 1E3MA 1Y8QA 2PPLA 1KIMA 2V65A 3INNA 4J9UE 3P20A 4RA6A 2W90A 4YJ3A 4RPCA 4WZZA 2I7VA 2Q5EA 5LKRA 1ZAKA 3HDHA 4PG4A 3TBKA 3EXG1 3P45A 4D9FA 4LC0A 2WUVA 4IS2A 1E1LA 3BJRA 1C8LA 4P4SB 1YR9A 1YONA 1FDRA 1DAKA 1KMCA 2YN2A 3BFJA 3R0QA 3L0IB 4YACA 5AVJA 4WBNF 7AT1A 3ADCA 2MYUA 3WDLA 3W5BA 1T4DA 2CLLB 2QPLA 4IIEA 4NU5A 4QULA 4QYIB 2YBDA 1PZGA 4Y6OA 4OGFA 3B78A 1PS0A 2WPDD 1RRFA 4P0QB 2BR4A 4IHJB 3KUKA 1RLIA 3OQMA 2QZSA 4ER7A 1A1VA 1M67A 5B58C 3I05A 1EK6A 3EWNA 4BNWA 4N03A 4EHJA 2RDMA 4JLBA 1H4TA 2GK7A 1LDMA 4GE0A 3T61A 3T5MA 1KS9A 2BUBA 4MEBA 5THQA 2BLNA 5BT9A 4KWEA 2BV3A 3K8YA 5CM8B 4BC0A 4OQLA 5AKZA 2R47A 5K8UA 3FLAA 1UWLA 3ESYA 1JL3A 1RYEA 5IXSA 3WQHA 1MABB 1ENOA 2CWWA 1FUUA 1ILEA 2PZKA 4UOQA 1D9ZA 1V9SA 3OIUA 5E3IA 5G0WA 2QMQA 3D7LA 3NXSA 4PFJA 2YJGA 5CJPA 2E4VA 1QYVA 1E2UA 1UWVA 3PYLA 4Q03A 5DYYA 2YIVX 1MO2A 3ANLA 3KOWA 4YMHA 3K9QO 4MPRA 1DJMA 1VMAA 2B8JA 3PJRA 1KF0A 4TRNA 1Q0TA 2HA4A 1SC1A 1UJ4A 5KYWA 3MT8A 5E1OA 3H2HA 2CZGA 3KTOA 2I8CA 2WFLA 4BX3A 2NVWA 4WLUA 1G4AE 1MO5A 3AVVA 2CB0A 3EXHC 2XV1A 4DCTA 4GAEA 2FSUA 3ZWAA 1H3FA 4XX0A 2OVBA 3W5VA 4H6VA 1E4VA 2CE2X 1NBME 2NX2A 2XHZA 3EFHA 4JI3B 1GRRA 1Y6JA 4L27A 5A2GA 1ID8A 2O3TA 1KGSA 2GVNA 1LK7A 1WV0A 2VXBA 4ZQIA 2DT5A 4TX1A 3OJXA 2PH5A 4L2IA 4MI3A 5K0FA 1ICIA 1MB0A 5HMMA 1SU8A 3DFZA 5KTMA 2NN3C 3S8MA 4FCVA 4YJFA 5J47A 4YRQA 4FNMA 1P0QA 4EEKA 4HZGA 3FUTA 4B9EA 5BNWA 1KQGA 1FXSA 4ZOLB 2GAAA 5FBRB 4DRXA 5EERA 2Y71A 4B3RB 2K87A 1AGXA 3FH0A 2YY6A 3E35A 2ERYA 2WJVA 3UYLA 1BMFA 1V0JA 1GT6A 1Z0JA 1H6BA 1C0KA 2BY4A 4XOIA 5HVNA 1JU9A 2HK6A 2RSLA 3JALB 8LDHA 3L43A 1PNVA 1KI1A 3A4VA 3NDIA 4PAMA 4QU0A 2Q5CA 3SF8B 3COWA 2O2YA 2ADMA 2C2ZA 2ZSJA 1PF7E 4HSGA 1UADA 4BUCA 4X1YA 1FX1A 3H7AA 4G65A 4Q9IA 2JI4A 3FETA 2QGNA 1IY0A 1X1BA 3FG9A 3N07A 2UVQA 4D96A 4CTMA 3FCSB 3QPDA 4JYAB 4ND6A 3CUUA 1WY7A 2FJ0A 1TQHA 4YJKA 4BLRA 5KWSA 3IBSA 2F8TA 3Q3JB 3ES9A 1U9CA 3V97A 1T13A 2D62A 1QHGA 5HZHA 4WY5A 2UVPA 2C1EA 1ETHA 4ZTBA 1A8IA 2XRZA 3EASA 1UXHA 1QYWA 3BSFA 3EEFA 3GP3A 3DKRA 2YWJA 3ICPA 2A1TS 3CVUA 3T3NA 3B9PA 1NMEA 2PN1A 1ZUWA 3QGMA 1GYRA 2NNWB 5L6MB 4IRUB 4I5DA 3B6JA 1Z88A 4QGFA 2FX5A 5DP1A 3ETDA 1BYIA 3H7IA 3GVXA 3NTRA 5KCZA 1CSEE 1SUWA 1C0IA 3HR4A 4I50B 3C6XA 4O3FA 3TOVA 3ZJYA 4AO7A 4CGYA 1GXSA 3H04A 3LF1A 3FE2A 1RI2A 1JW9B 1AQNA 2QJFA 2A9PA 3WB2A 1U7UA 3LUFA 3MWKA 3NBQA 3OZVA 1QE5A 4BLSA 1XDWA 1G7RA 1HDOA 4D80A 1W8IA 3H2YA 4UNRA 4BP8A 1ZK0A 1JTVA 3ORFA 3M1LA 1TEVA 2O7VA 3WTCA 1QRUA 1DG3A 3E7PA 1YR8A 4YRBA 1GO2A 2NU6A 1PSDA 5AK0A 2OT3B 4R6WA 3ZVMA 2BVNA 3BTVA 2VRCA 3NRJA 3TAUA 3SHWA 1I7DA 2YRXA 1J39A 2ZATA 4B6RA 5EKTA 1V43A 1UBSB 4OGWA 2CHVA 3VC3A 2DQZA 4D5EA 1C30B 1HQCA 1SB9A 2PJUA 4P36A 3BWXA 1W44A 2GLUA 4S12A 4WECA 1Y8AA 1D6MA 4L85A 4G5FA 4W5WA 1WCIB 2BDEA 4HDAA 4D9JA 2IHVA 2BR5A 3F3YA 3E1GA 1ECBA 3I9MA 3QUCA 4URWR 4CEJB 3VU1A 1DTSA 2JGDB 3ZV6A 4AUMA 2EFEB 3NBMA 4F2DA 2HPVA 4Q9LA 3VH1A 2PSDA 2NV2B 3EYAA 3W9YA 2VO1A 3AEKB 4QRDA 1OR8A 2Q5FA 3EGIA 4IVNA 2ECPA 4GQIA 3WGMA 2J0VA 3FAKA 3R4CA 2R8XA 2QTNA 4NZMA 3AOEA 1QVRA 2GT1A 1H6DA 1J8VA 2GRUA 1EQAA 2R6DA 3G2IA 2PGIA 1GNTA 1OU0A 3IVAA 4GOJA 4NIMA 4P82A 1PCXA 2HUNA 4QOEA 3UHAA 1RABA 3LVRE 4Y6SA 2C9MA 3NGXA 1R0RE 3OQ6A 1YZNA 4JGIA 4EF5A 2XTNA 2OMEA 4JUDX 4KX5A 4QODA 2FMUA 4LYDA 1ISRA 2HIAA 3BQMB 1JIXA 3T5PA 5DGTA 1U2DA 1XQ1A 1YA4A 3F8TA 2OHXA 4RM3A 5KQMA 1OE0A 5JZMA 2P62A 1TF5A 5JBQA 5IAKA 1NIPA 3OUUA 2WT9A 3KKMA 3EVCA 4FJ0A 1O94A 1LX7A 4TLDA 3FMVA 3U4IA 5H3HA 1RU3A 1UT6A 1QDLB 1PT8A 4O2AF 2QGZA 1W19A 1BXGB 3GGCA 1ZITA 4KR0A 1JEQA 4QGHA 5I01A 5G0VA 1ZJ4A 5AKXA 2H57A 4JDPA 2X77A 5K0ZA 5ENDA 2IYAA 1Z0IA 2VAWA 1TYBE 3PWKA 4GLOA 4Q93A 5DLYA 1PNRA 5JSZA 3LXRA 1EK5A 3I9OA 3EAFA 2GASA 4Q39A 4Q7JB 3ACBA 2VBIA 3DKVA 3E9MA 4HQKA 4LJ8A 3F6RA 1E8DA 3BIFA 3D2AA 3OT5A 3RIHA 3T7DA 5A9RA 5CEFA 2GCEA 3U13A 4DLUA 1N2OA 1DAIA 1N2JA 3Q3IA 1NBMA 1H66A 2Q1WA 3O3MB 4L75A 1T9BA 2DPMA 2QWXA 2ZBVA 3N3BC 3OH8A 4JXKA 2HLDD 5CDTA 1RBZA 1UR5A 5I8PA 1M6NA 3FX2A 4O4HB 4H6PA 4OAOA 3TGLA 3G0OA 2EHDA 4DMMA 2FU5C 5G02A 4IHJF 3ENVA 3KAJA 1OYOA 4Q02A 5K01A 1F7VA 5DM4A 1BJRE 2AR0A 2VDWB 2REOA 4O1IA 4C29A 5J3JA 1UM9A 1ACLA 4QUEA 5BYJA 3VOTA 4B46A 3E5NA 1V5WA 1W0CA 2A9FA 2O5CA 4UFNA 4M6WB 4HADA 5IM5A 2XMZA 4MW5A 4QOGA 4BJ1A 3WZMA 3RRBA 2AN1A 1M9NA 4MUFA 1CIPA 1E61A 2PUJA 2HZBA 4JFRA 1CLEA 4NZ9A 2IUSA 5FWXB 4QJ3A 3O26A 1J1UA 1E64A 3ND5A 3HN6A 1AQJA 2AOVA 2F1IA 2JI9A 5BW4A 5IVIA 1XJCA 5JEEA 5AESA 2ZT7A 3IPAA 5TF0A 4EA8A 1R0KA 3IVRA 1MAUA 4DS3A 3HBLA 1DMRA 2FUG6 2XHEA 1P7ZA 2Q6TA 1S3SA 1M1YB 1T0BA 1JJVA 3CEMA 4DLBA 2Y76A 4HLUC 3N87A 3BZUA 4R84A 1NI4B 4PX2A 2NQTA 3GEEA 4B0OA 1PJLA 1V16B 3G88A 3LMKA 2ECKA 2R7AA 3FGZA 1U65A 3L6BA 2PZLA 4LJKA 4I5EA 4NBNA 1FRNA 3M1YA 4LOLA 3GAFA 4Y2QA 1LI7A 1KEUA 3A9WA 3ZXSA 3TB4A 4RSHA 1NQ5A 1VPVA 2OFPA 3CEPB 3EIQA 4RPGA 5ADWA 1XMQB 3ME5A 2G09A 1QIHA 3PDCA 5KYVA 1RT9A 3UG7A 5JBIA 1JLLA 1G5PA 3A04A 4H27A 2AIRA 1TRKA 5EKUA 3AY0A 1HE4A 2A7XA 1U0TA 2I76A 3MGAA 2DFDA 5I51A 1MKYA 2A5FA 4CM4B 8OHMA 1M1NB 1NJ5A 1PR4A 1LF0A 4KEAA 3KAPA 4MINA 1BROA 5HE9A 2LV8A 1QFJA 4ZVVA 1DB3A 2ZAMA 2JLXA 2JJ2D 4BIIA 3U4HA 2QYTA 4O5OA 4R16A 4ZOLF 1IHOA 5MF6A 4HB2A 3FSJX 5BW6B 3GEBA 4UNPA 1KYZA 5D5HA 4DDUA 4EMSA 4A0SA 4HVLA 2FZCA 5FX2A 2AKYA 1UBHS 4GKKB 1FUKA 2A1UB 2OXFA 5DO9A 3WLNA 5K3OA 1WSBA 4GZ6A 1VBFA 2QVBA 5DNYB 3IE0A 3RADC 1PWYE 2Y0CA 2YW9A 2PV0A 3T3DA 2ZROA 2VQFB 4NCAA 1JLMA 3MERA 2ZBGA 4P7FA 3TDKA 1JFTA 1OFUA 5CK4A 3GXBA 3GZTB 5D1NA 5GM2A 2X2OA 1USUA 1NQOA 1QCDA 1YBFA 4FFDA 1E5DA 2EKDA 1M7BA 2ARKA 3C3WA 3ET5A 4OVKA 3FTFA 1D2AA 3FJOA 4HDOB 2FP4A 2ZR8A 3Q8XB 4QJ5A 3LXXA 4UHKA 3RT9A 3H0KA 3CPHA 1MR3F 1CDZA 2HAEA 3WGIA 4KFCA 2VK2A 3AVQA 4B85A 2FX3A 4DIOA 3B12A 3KU1A 1C9JA 2IPLA 4UNNA 3GJ4A 4ARZB 4G5YA 4C1NA 2P9TA 3TI9A 3Q2OA 4PPGA 3PGMA 4B7XA 3SQXA 2XADA 4O4JA 3TN7A 1YR7A 1PZHA 4TYYA 3DW1X 3HCRA 3PG5A 5FADA 1BSVA 3BHJA 2H1HA 1RYDA 4DLTA 3TKYA 4JJ7A 2IF2A 3LDAA 1A04A 3LVFO 4I50F 2I2BA 4OJYA 1XZHA 1COWA 3TQIA 4LJ7A 4W5JA 2H17A 1Z0ZA 2IC5A 3VDRA 3GQBB 4DR4B 3MXTA 2XCIA 5CYFA 1GTRA 2ZYRA 2XYVA 3LW7A 2DQ4A 1F3OA 3T7AA 4AMVA 4XE5A 4YONB 1R6UA 1XV5A 2Q6KA 2IPMA 4ZEWA 3B89A 4CV0A 4BNDA 2A2ZA 4LQ4A 4LXIA 5KYKA 2FTKE 3TSZA 1J8FA 1MJ5A 1TLTA 2GM3A 3DFUA 3FGNA 1WCV1 2PMBA 2UZ1A 3L1KA 3O8LA 4FNAA 5ESXA 1E7WA 4B31A 5IJ9B 3UAVA 2B7BA 3BGVA 3H1EA 1D6JA 2E4UA 4FYIA 4QBFA 5EYPB 3RYFA 4F85A 2GNAA 5A5FA 5IANA 1H3EA 4OLJA 1USWA 3VJMA 5LYJB 3FPCA 1F8YA 1SVKA 3QH4A 3P8ZA 4YY3B 3LG2A 4PEVA 4UHEA 3SY8A 5FDFA 1RHUA 1U0RA 4OMFG 4YDQA 1LSSA 4H1TA 4CGZA 4FZVA 3AVPA 2AG1A 1Z8FA 4C7KA 4HWOA 4LJRA 1HT0A 2UYQA 3MD0A 4RKYA 2EZTA 1TIKA 2JB9A 4ND1A 3TZQA 1Q7EA 4DDVA 2K7FA 4QBIA 3CU5A 2KPOA 1EVKA 3CCBA 1EEHA 4DQKA 4CCSA 4YIHA 2C2KA 2YWEA 3IA7A 2D2VA 1UOEA 4QBGB 3STXA 3CF2A 2NXWA 3GFFA 4U39A 1MIHA 3NJ8A 1VJRA 2DUUA 2FEWB 2G6TA 2JGLA 5CPFA 1YZKA 1OTXA 4OGKA 1SK9A 3VZRA 1MABA 5ER6A 1XN4A 2FF7A 3PDJA 1CEYA 2BAGA 1IOLA 1ZD2P 4HDKB 2GN8A 3RG2A 3GFTA 1KAMA 1X1SA 3HDQA 2VDNB 4Y2TA 1V8DA 4YMUA 4Y9SA 5JTTA 3PQ3A 1WVGA 1F2UA 2FW7A 2G67A 2P2DA 3EQZA 3VU8A 5FL7A 1P31A 4GNRA 5LQMA 3N0RA 2NU9A 3CUYA 3PDHA 4YCCA 3W5DA 1XAGA 3OIVA 3Q1LA 4RMIA 1T2EA 2OKGA 2BHTA 3CWCA 1J2JA 4YHBA 2QTVA 1BFUA 1FDSA 4ND2A 5TR9A 1FU8A 4NU8X 3TNDA 1NL3A 1QIIA 3FHCB 3K8ZA 3IXMA 1JX6A 2OWDA 3T9CA 2W6NA 1YACA 4ADSG 1KFCB 2E49A 3S2FA 1U5BA 1XD9A 3DE1X 3M3HA 4I5FA 5A7FA 1BA3A 5KQGA 1AMUA 3UHOA 1K68A 3KKLA 1X80B 3AERB 3EQ6A 3NPAA 4BNJA 5HNKA 4N7RA 4ZT7A 1RRPA 5BVGA 2EX4A 5FYDA 4E70A 1ODCA 4LZPA 4RJTA 3IMCA 1YCGA 3OT1B 4FHCA 4UEKA 3ZU2A 1GU7A 1RYMA 1TU3A 2AJ8A 1IAQA 3LCUA 4XYEA 4MQFA 3UGJA 1L5HB 4E2YA 4KO4S 1U98A 2EFCB 2ZWAA 4BP3A 5H9VA 4ZI2A 4ML3A 3A58B 3JYHA 3UXHA 5TJ9A 4JYCA 4PHCA 3BILA 4QEZA 5TQVA 4PPFA 1F4LA 1U3WA 4DG8A 3DOHA 4CLOB 4O4HF 1GN9A 1RI1A 1UFQA 4MARA 3JTMA 4YGXB 4CQMB 5JH7B 3TG2A 3AVYA 2RI0A 1P6XA 3GFRA 1GL6A 1VL8A 1RJDA 1PYDA 3GFBA 3DDCA 3H5RA 4HWKA 4HX9A 1FL9A 1G9TA 2CFOA 2CL0X 3SYRA 4QJIA 5HFAA 4DSTA 4EHDA 4WNCA 4C4YA 1G8YA 1N5JA 1H1LB 2R85A 2MSLA 2ATIA 5EESA 4AN4A 2PA3A 3G8YA 5BMVA 4NEHB 3E22A 4OHWA 3LHFA 4RHYA 4PLYA 2F7SA 3AILA 1G5RA 1YDWA 2RB5A 3KTAB 3OBBA 4MJLA 1DQSA 4NC9A 5K7SA 4B6OA 1H2AS 2WIGA 4PHHA 2HU8A 3HSYA 4XLZA 1G63A 3C5VA 1Y7TA 4CI9A 2C4KA 3SX2A 3T5TA 2PX3A 3SOZA 2X8LA 3ELDA 3VNSA 2GPBA 2DHDA 3I09A 2XKKA 1ZINA 4LV8B 5D86A 3V9PA 4XGIA 3DL0A 1V5GA 1W34A 4WN9B 2BM9A 4R51A 2OENG 3F49S 2Y1FA 1RZVA 2J9GA 3IJPA 3BN3A 3UJ8A 4BNYA 1EAMA 1GRCA 1QQ6A 4JJ6A 4I5GA 1NPTO 3S5JA 3S29A 2P9BA 4P7JA 3IS3A 2F59A 3QA3E 3SR3A 2H7CA 4PCLA 3MCVA 3DXFA 3OTGA 3NWOA 4E1VA 5EWJA 1ECFA 5CLIA 2E5WA 5A4DA 2C4HA 4WGFA 4XVQA 3AGQA 1O89A 3KQNA 2C61A 2VJKA 2Q5JA 1DXOA 5K3FA 5JT1A 2BUCA 3CSSA 4U2EA 1ZGBA 2HSJA 4W1PA 3M6WA 3AI3A 2O9JA 3AESB 4KLRA 3H5WA 2CDNA 2ZBFA 3Q72A 4JBIA 1ZEMA 1X74A 2D3WA 3MTGA 4M0MA 3ZY6A 4S1VA 4A5SA 3QRWA 1YJAA 1DIOB 2VYFA 1M2VA 2CUTA 2ZIFA 1IVNA 1CF9A 1PWHA 5ICMA 1QIGA 4CMIB 1FXWA 2WMYA 1C30A 1E3QA 5F12A 4XASA 3ZGXA 1VHQA 4K05A 1K75A 3O47A 3UM9A 3NGLA 5C46F 1SVWA 3A1UA 4JN6B 4XCVA 4CEJA 4AJKA 2E37A 4QUGA 3D3KA 1CZKA 4REQA 1Q2UA 4MS4A 2B1JA 2D54A 1EGQA 4PNPA 4MH0R 2VT6A 3NHYA 2RGWA 4QGAA 1Z6YA 3X1MA 3E1SA 3O3OB 4G81A 2XLBA 2WV7A 2FRDC 3IP3A 4C2TA 1RI5A 4OFZA 1HYQA 2GUWA 1SQ5A 4RANA 2C7OA 3AEQB 4CU5A 4U7PB 4HGNA 2QRGA 2O48X 1BS2A 4LZJA 2OHHA 1R5BA 2ZIZA 2PO5A 1O95D 3ETLA 4TKVA 4UCQA 4ES6A 4ZV4A 1M6EX 1MX3A 3WO0A 1L5MA 2ENUA 5IFLA 1SCAA 1AY0A 4ME6A 1UKEA 3C6YA 1IOVA 4R5MA 3PX7A 1UZNA 1AKYA 2XQIA 5DM1A 1H0SA 4CR6A 1FBNA 3RRMA 1ZFNA 3T1TA 4B33A 1PG5A 1PR9A 3PHHA 3KSDO 5D84A 1NSTA 3EVBA 2JLVA 4J0FA 3K2IA 3OFSA 2QL6A 4F4HA 2QD3A 4MPDA 2HHAA 3BB3A 3COVA 1OASA 2FOIA 2YYSA 4NZOA 1Z5NA 3WMEA 5FTJA 4JQSA 1Y4AE 4LJ9A 1N8KA 3UK0A 4IM7A 2ZBUA 2HCFA 4IV0A 4X66B 2GDZA 2OBYA 5CP8A 4CFSA 5J5AA 3QV1A 3GY0A 5FXMA 1EDDA 2RHHA 4C4AA 2QV7A 4HF7A 2WTMA 3IULA 1N75A 3SMQA 2AFVA 4NPHA 4BX0A 4CF6A 3ETNA 3NDPA 3LP5A 4O4IA 4WXEA 1J1IA 3LCMA 5BOVA 5LYJF 1SCKA 1ZK1A 1YULA 2ZYSA 2XCQA 2CDBA 4NL4H 2VQ3A 4WW0A 1DAFA 1ISIA 5AXDA 1GQOA 3M6XA 4YXFA 5ED4A 1H4SA 2C5AA 3I2GA 1DGQA 1QHSA 5ERGB 3ZQJA 3BMCB 2COEA 3LPCA 1MVLA 2TS1A 1NXSA 1UH5A 3E9NA 3CLHA 3VZSA 1PE0A 2Q62A 4KLZA 5KNCA 4BBAA 1TJNA 2VP3A 2HD4A 1AS2A 3ZS8A 3PUVA 3HV0A 2XYQA 4M83A 1NXPA 4PPYA 2O0MA 4M6WA 3DNMA 1T1SA 1T2CA 3RUAA 3G23A 5ESWA 3DLCA 4BN4A 4BRWA 5FWXA 3ZX5A 1M0TA 2PRJA 2QAGB 2UUOA 3IUNA 5CNKA 3UK6A 2EJCA 3DBOB 4NJMA 2ZM6B 4LWPA 2B69A 4NABA 1EHIA 3DLAA 1Y5IA 4Y2HA 5FPSA 5KREA 4K0RA 2WTUA 2R8ZA 4HEA1 5HKKA 1ZUHA 2R2GA 1EVYA 2Z5VA 1P1CA 3KKEA 4IY1A 3F7MA 5IC5A 1U3DA 4BKUA 1DCFA 2IBTA 2ZCJA 2JFNA 3DZDA 4AX4A 1P29A 1ODJA 2IJGX 1EFRD 4IJVA 3LGAA 3LBAA 1LPBB 3O9MA 1VJTA 2QMOA 3O74A 2D8MA 3ISVA 3OC6A 1TU4A 1N6NA 5ELLA 3VNBA 2Y68A 1IBSA 3HZOA 1UKAA 4M98A 3X1XA 3MWEA 4LJLA 2DWOA 3RSQA 3K9HA 1AA9A 1OSNA 1JHAA 4UW9A 3R5FA 1E1RA 4YP7A 4EARA 3EPKA 2F4VB 4TRJA 4MUKA 1ZOIA 3KR1A 4CM4A 1NFRA 1TMYA 3HP1A 1PWZA 4KUEA 1PZXA 1Y1RA 1GEEA 1YDFA 3BS4A 1YU6A 4AZ3B 5BSGA 5JMOA 5A05A 4EY8A 4EI2A 1RCTE 1SXHA 2W6ID 4TMKA 1VE3A 2W2XA 5ARBA 3AB7A 1QYXA 3KHSA 1VBNA 3I53A 3VYVA 1FDTA 1H93A 1BU5A 5DNCA 5LZ7A 4FFWA 4ZP1A 5JH7F 4BZZA 1XVAA 4BC1A 2QN3A 4GL2A 3PEUA 3AINA 4R54A 1K8ZB 1OXUA 3DAOA 5JVDB 5LU9A 1QNLA 3G6KA 1L4KA 4NPAA 3NXKA 4NYMR 5AJXA 4BL5A 2FSVC 2ABWA 4TLAA 4NFYA 5DSTA 2PTHA 3V8MA 1TA0A 1UDRA 5DEOA 5HCIA 5DX8A 2JZNA 1TLFA 3H8WA 4M9XA 2QUKA 4ZHQA 1AMNA 4OYLA 1CUUA 2C8KA 2OV4A 1YZYA 5ICSA 2VATA 3ZWDA 1PYGA 3ZDZB 1V3QE 3SQOA 3O1LA 1QHYA 2AF3C 2Y0PA 1GIAA 3KKNA 3VR5D 3E5RA 3U16A 3IEVA 1K5HA 2V7WA