3F6SA

Desulfovibrio desulfuricans (atcc 29577) oxidized flavodoxin alternate conformers
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
147
structure length
147
Chain Sequence
SKVLIVFGSSTGNTESIAQKLEELIAAGGHEVTLLNAADASAENLADGYDAVLFGCSAWGMEDLEMQDDFLSLFEEFDRIGLAGRKVAAFASGDQEYEHFCGAVPAIEERAKELGATIIAEGLKMEGDASNDPEAVASFAEDVLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavodoxin
publication title Pseudosymmetry, high copy number and twinning complicate the structure determination of Desulfovibrio desulfuricans (ATCC 29577) flavodoxin.
pubmed doi rcsb
source organism Desulfovibrio desulfuricans
molecule tags Electron transport
total genus 50
structure length 147
sequence length 147
chains with identical sequence B, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3f6sA00
2R97A 2Z9DA 5LLDA 1I1OA 2W5UA 2FZVA 1D4AA 2N1MA 4DIKA 5FA6A 1AZLA 3HR4A 1YKGA 3LCMA 3K1YA 1D03A 4N65A 4FGJA 4ESEA 3QFRA 3ESXA 4ZVKA 3RPEA 4F8YA 2FZ5A 4Y9RA 5LBTA 3FW1A 1FLVA 2ZKIA 4QOIA 3N3BC 1T0IA 4C76A 4NULA 5EA2A 1J9GA 1CZHA 3EYWA 1TLLA 3FJOA 4GQIA 3NHJA 4N9QA 1WSWA 4D02A 4LA4A 1F4PA 1AKUA 4GI5A 4M0CA 3KAQA 2V5VA 2GSWA 4QOHA 1KBQA 1C7FA 1WSBA 4ZVMA 5LJLA 3QFCA 4FX2A 2OHHA 2FAXA 4YQEA 2KLBA 1B1CA 2V9CA 3NHUA 1AKQA 2QWXA 1D04A 4YAUA 4N82A 1XYVA 5LMCA 1OBVA 3U7IA 4LTDA 5NULA 3OX3A 1FVXA 1ZWKA 3B6JA 4QODA 3P0RA 4NLLA 2X2PA 3U7RA 2BMVA 4ICIA 2MWMA 1YDGA 2XOEA 4PU0A 3TZBA 3TEMA 5FUQA 3OX2A 3B6KA 4ZVLA 1YRHA 3OJXA 2B3DA 1TIKA 2R96A 3GFSA 3D7NA 4HEQA 3NHKA 1YOBA 3F6SA 3UXEA 1CZNA 4LAFA 4GR9A 3O2NA 3JSXA 1H66A 4QOJA 3NLLA 5A4KA 1KBOA 4FGLA 2D5IA 2A5LA 1J8QA 5B3KA 3B6MA 2Z9CA 3LT5A 1YCHA 3NHWA 4YAFA 4YAWA 3F6RA 4QOFA 1XT6A 1ZWLA 1AKTA 5F12A 3OX1A 3ZHOA 3L9XA 4Y7CA 5TGZA 2QR2A 4CETA 1RLIA 2Q9UA 4LTMA 1SQSA 1ZX1A 3KLBA 1RLJA 2Z98A 2RG1A 4FGKA 1AKVA 3GFQA 1CZRA 3R6WA 3SVLA 3KEGA 2WC1A 3FVWA 3NHFA 2MT9A 5LBUA 2M6SA 2BF4A 5LJIA 4U7GA 1BVYF 1C7EA 1E5DA 2OHIA 2X2OA 3GFRA 2QMYA 4J8PA 3FX2A 2XODA 5EMNA 2FLVA 3ESZA 1CZUA 1XI2A 3F2VA 1FLAA 1VMEA 4BMOB 3QE2A 3NHPA 3NHSA 1GG5A 5LVAA 1QBGA 2MTBA 1CZLA 1AMOA 1J9EA 2QX6A 4YAOA 2V5UA 3W7AA 1QR2A 5BUCA 1YCGA 4YALA 4H2DA 2QX4A 1DXOA 2M6RA 5JROA 4U7FA 2QX9A 4R81A 2OYSA 5F51A 3KAPA 1RCFA 2FOXA 4PTYA 3N39C 1X77A 1SG0A 3W79A 3FNIA 1FLNA 4XDGA 4HS4A 1AKWA 3NHLA 1QRDA 2HNBA 2OHJA 3NHRA 5NLLA 4PTZA 3HLYA 2FCRA 1OBOA 1BU5A 2HPVA 2MOKA 1XYYA 4C0XA 5F4BA 3OWHA 2QMZA 5EAIA 1T5BA 1AG9A 4ZVNA 1RTTA 3GAMA 3G5MA 4DILA 4C14A 3W77A 1FX1A 2F1OA 2Z9BA 3NFRA 1DXQA 2BZSA 1AKRA 2ARKA 1JA1A 1J9ZA 4U7HA 3OJWA 3B6IA 3W78A 1H69A 1NNI1 2BN4A 1QHEA 1YCFA 2FVXA 4H6PA 1DX9A 4DY4A 1AHNA 3N3AC 1OFVA 4S24A 3EDOA 4LTNA 3O73A 2KQUA 3S2YA 2Q62A 4C0WA 4XDHA 3OVMA 5FX2A 1CZKA 2HNAA 3UXHA 3ES9A 4Y9UA 6NULA 3K20A 4BMPB 2QX8A 1V4BA 1CZOA 5ULLA 5B3LA 1JA0A 1FTGA 3HA2A 3F90A 3NHYA 4CF6A 2AMJA 4QOGA 2FDXA 4QOEA 4OXXA 3TE7A 1FUEA 3ESYA 3L9WA 3OWXA 2BPOA 1FLDA 2FX2A
chains in the Genus database with same CATH superfamily
1K5DA 3AFGA 1WW3A 3OT4A 2P1ZA 5I9NA 3SJZA 2OZEA 1JTEA 5LU8A 3F98A 4S1WA 4DNOA 5HX7A 4FP9A 4XW2A 4I66A 3TKAA 1P9WA 1NZFA 1H4SA 1GUZA 1RJ9B 2O0MA 4J07A 4RCVA 5FTLA 4C4XA 3U4QA 4G8DA 4FQ5A 1VZ3A 5HILA 2O1XA 3AILA 1NQ5A 3VR3D 4CCYB 5J5VA 4XEUA 4L0DA 3LQ2A 4XWTA 1BVUA 2R00A 3LOPA 3G8YA 4KX3A 1V9CA 1KZ9A 1TA4A 2BMJA 4DHEA 3KQYA 1XTUA 4P86A 1L4NA 1P4JA 1XXLA 3OMWA 3AVXA 3ABZA 4Z9FA 1CVIA 2QP3A 3DLPX 3OFKA 3UMVA 3WK6A 2PVPA 2LCFA 1T4CA 3D0OA 4X60A 1RMQA 3S70A 3WNZA 4C3UA 3EFOB 1N7HA 5D6NA 4I2NA 1B6SA 4YMVA 1FYWA 4FOSA 1PFYA 1DKLA 1MB0A 4Z4EA 3JPWA 5BWOA 1J56A 5IC5A 2VHTA 4CEJA 1O94C 2H63A 3GLFE 3MOSA 2VUTA 2GBLC 3UWDA 4BEBA 2BUAA 3VHXB 2GTPA 2GILA 4B4KA 2PK3A 3AUSA 4QXPA 4Q15A 1UL1X 3MTEA 1DTEA 2CJWA 2BJHA 3EYWA 4ZYXA 1I51A 1NOIA 4LZNA 4W82A 4LISA 5JY6A 5K7SA 1XPUA 1DG1G 3HJHA 3FG9A 1Z0JA 1WQ3A 2C5SA 4XJTA 5SZIA 3ZV5A 1ZGAA 1BMFD 4H7DA 2ISCA 5FUYA 2GF2A 4BNKA 2PNJA 3ANYB 1ESCA 2FG6C 4QVKA 2HJVA 3ABRB 3KNZA 4LV5B 3GLHE 3V7YA 2JVIA 1Z6YA 1XU7A 4MWZA 1M5UA 4ZREA 1G8YA 4ZU3A 3C6XA 4GI7A 3KQPA 1JKIA 3SDSA 1E20A 2OT3B 1ITZA 3IR6A 3DMNA 4KPGA 3B53X 1K2WA 2VJAA 1T9CA 5AKGA 4ZHQB 1U99A 3I2GA 1R5OA 4UFOA 4EPYA 4UTPA 3TQQA 1DG3A 1U98A 2IT1A 3BGSA 4MINA 4YUXA 1B8NA 4XAQA 2R60A 1TYEB 2MDTA 4HMOA 1IAQA 4FEEA 4P4LA 2PIAA 4YMGA 2YXBA 1WMFA 1YDHA 4IJWA 3SYLA 2CUZA 5FUXA 2PO7A 3IPYA 5IBQA 3ZW8A 2XBMA 2IIBA 4I99A 1KPGA 3KKKA 1XJQA 1FFAA 3WQHA 4P8RA 4ZCMA 5IEJA 5L7WA 1XYVA 2RBEA 3STWA 2XSZA 3A9WA 1CUWA 3AEUB 3K4HA 3AUAA 3BMXA 1NXQA 1Z63A 1PJ4A 4U9UA 3SNHA 1FA9A 2ESRA 5AM2A 4L0QA 4IYJA 4UATA 1G64A 2NU8A 4NZYA 1NUHA 3KLOA 1A95A 4M99A 4HF7A 2Q1TA 3GPDG 3OCWA 4MUAA 5LIRA 1YZUA 1I7SB 1UZAA 4IAOA 1P7VA 2P62A 4D46A 2NSLA 1QQ6A 2G72A 2CY0A 4P5DA 4JC8A 5AMXA 3PV0A 2WK1A 1X9GA 4YAJA 1T0HB 2E6UX 4N0QA 4FWBA 4D98A 3FSGA 1HE5A 5F1PA 4RTKA 4CDMA 2RCNA 2VT2A 4IEFB 1YZKA 3VV2A 1RP7A 1G55A 4AJLA 1PL8A 1IYZA 1DX6A 1I2AA 3R7SA 3AXTA 4XVUA 3N8KA 1Q0LA 3U7RA 1YMUA 5EGSA 3CO0S 4GHWA 2VA8A 2VP3A 5FA5A 5K0BA 3I61A 4P1ZA 2FK7A 1LB1B 3WI7A 1XVAA 3GRVA 3L1IA 5L40A 1GQSA 4TWBA 4BO6A 1CNMA 1S4QA 1FRFS 1GZHB 3I5MA 3LA8A 1H85A 4HCJA 4IG9A 4L9AA 1LSSA 5TMDA 4LZWA 5JADA 2DTXA 2GEVA 3EXAA 4LJ4A 2A9FA 4KNWA 4Q4HA 4XSHA 2VPYA 3CKLA 3O90A 4NENB 3A11A 4ZQFA 3U3JA 1E0KA 2ZUWA 3FMOB 3I9V1 1SC4A 4MVCA 1S5PA 3PTAA 2W0SA 4WGFA 4ZVOA 4AB1A 2VAXA 4RX1A 6PFKA 2NO6A 4Q21A 1MF7A 1NM5C 1Y1KE 4H3VA 1VGQA 1MVNA 4ZEVA 4G4SP 1MNQA 3JQ7A 3LA6A 1QJ4A 3MLEA 3OU6A 4PSDA 1COZA 1HRDA 2YWBA 1U1FA 2H1VA 3PC6A 1P1IA 3SKYA 3AK4A 4Q9JA 4Y3UA 2OG1A 4JGGA 1FYEA 5H7XA 4LV6A 2W6MA 1NKSA 1YMVA 1XZQA 3BGWA 4CV1A 4DIDA 4L72A 4UHDA 4S04A 2P9TA 5GADl 5J2TB 3EVBA 2HFKA 2BHSA 3T3IA 2AI2A 1ZD8A 3KOMA 2OGZA 3HXPA 1Y82A 3ACDA 1H2YA 2FHSA 4EUSA 2R0QC 3ZQ4A 4BQEA 2J5RA 3PGJA 4WN9B 2M2IA 3W4IA 2XGSA 3G0IA 3I9JA 1L2TA 1N6RA 3RC1A 2QUHA 1RQGA 4M38A 4UD6A 5LC1A 1EDZA 3CJTA 3N74A 4KLAA 1XAJA 1KXJA 2HCBA 1B3BA 2IXEA 4AN0A 1EVEA 4LQ4A 1EHYA 4BO1A 1Z22A 2PMBA 4DIFA 1YZHA 2ZT7A 1Q77A 4MK4A 4FGLA 3BRWA 3BCRA 2YXLA 4DMMA 1DUVG 4B4UA 3G13A 3QY0A 3CLKA 2PGNA 5DLDA 2Q8NA 4LWZA 2C2XA 4K87A 4BB9A 4Q9KA 1JFVA 4F6CA 2ECOA 4LFBB 3NNSA 1QONA 4BX8A 4AZVA 2CFOA 1ZVKA 2WRZA 3IUPA 4FFSA 3I32A 5HCUA 3U9LA 4CM3A 3CSSA 2NU7B 1SIWA 4YAWA 5BN4B 3Q7QA 4UU8A 4ZU1X 3M6MD 3G2PA 2MR5A 3P9KA 2AJBA 1OTHA 2IP4A 2NM0A 3TUJC 3CB4A 3U37A 4YNBA 3RBXA 1HORA 1BEUB 2C96A 2FYTA 4MPJA 4JEHA 4Y7CA 1GRQA 5HKOA 3DE7X 3O93A 4L0MA 5KQLA 1A8UA 3AM3A 3O3NB 1JN0A 3SWWA 1WLYA 1OWMA 3TLGB 1VE9A 1DOHA 2IZZA 1E2PA 3LBHA 4FFPA 5GJVC 3F8WA 1P6UA 1W4CA 1ZZEA 2ZRFA 2PN1A 4LI3X 1P4HA 3JQEA 5I8ZA 3AZOA 5FNZA 4A2WA 4L5IA 5DXJA 1BCRB 3R4CA 2ZIZA 1GRCA 5T57A 1QGED 1Z6TA 2QU7A 4XI9A 3ROXA 3QVSA 5JAZA 1RE1A 3WZLA 4IDDA 3HKCA 3GDHA 4QXMA 1BGWA 4JWKA 3THWA 1Z0DA 3FPFA 2QXYA 3LUJA 5AK6A 2AYXA 1B3RA 2ZW9A 2V65A 4YLGA 1GZ7A 1QCZA 1EHIA 3PXEA 2O20A 2I0FA 1B15A 1J42A 3EOZA 2EYQA 3PXDA 2NQTA 4L15A 4EOGA 1X86B 1W0JA 1TD9A 3BGOS 4IDBA 1X9IA 2FW8A 2Y9PB 4B32A 4QJ3A 3OE4A 2IHNA 5HJ5A 3M6IA 5JSHA 1NC3A 2HY7A 2YQZA 4CKBB 2QP9X 3FGNA 1SRRA 2H85A 2PX8A 3THRA 1C0PA 4CI0B 1K4YA 5CPFA 2B5VA 1KA9H 1QH8B 1R3UA 1V6SA 2ZPAA 3L5KA 4EHLA 4OJMX 2FPXA 3PC7A 1O9GA 2FX3A 4IIJA 3WICA 4JOQA 1TF5A 4LYEA 2CYAA 3QBDA 1HG0A 3IRUA 3PRHA 1N5KA 3HDTA 3VC2A 4YT2A 1NASA 4RJJA 3NVKI 4B17A 2BD0A 1A4IA 5DIFA 1FVFA 3THOA 4CHGA 4G4SO 1K5HA 1N3LA 2A9KA 2YVAA 5JD3A 4URXR 1UEIA 2FZLA 4QHYA 4TXLA 5FOWA 2JFZA 1PDOA 1NUAA 2VTDA 3G9XA 2Q3LA 5FF9A 5GONB 1QGYA 1EUCA 2VK2A 3PNKA 1M34B 2EYUA 5CTAA 1II8A 1HOXA 2ZQZA 1PKXA 1L1QA 1UC8A 2EOAA 3CO5A 1QV9A 1Z13A 3QU4A 5KAMA 2E85A 2Y1OA 2GUWA 1O0CA 4AO6A 4DV7B 1ZJZA 4K26A 4KSBA 3ROGA 1UZUA 3MWLA 5GGYA 1CRQA 1NMXA 2SKCA 3AVOA 3H5AA 5I7UA 3EHEA 2AMYA 4MV0A 3BORA 3NBUA 2C2YA 2JBHA 3KUXA 3T06B 4KREA 1A7JA 3Q3IA 1JJBA 1XTBA 4LJLA 4RORA 1NURA 2NU6A 2K87A 2NT3A 2XA1A 4OHXA 5JFGA 1KQ3A 1XU4A 1EX9A 2GM5A 4XIGS 1DFGA 3WK8A 5G0VA 1OX5A 2EQBA 3JCZA 1N0VC 2NVBA 2HH9A 3P0HA 2C2WA 4PLGA 1UXOA 2P9EA 2HXYA 2J3HA 3DUFB 4OXRA 5CT4A 2J85A 3SOPA 1WVMA 3TL2A 3DJFA 4MTCA 4Y6GB 1C4XA 3TO5A 5AM1A 5CBPB 5D84A 4B7UA 5K8JB 4CTOA 3SHWA 1W85B 2VSXA 1NNLA 3K92A 2JIPA 4RKQA 5IXSA 1VMDA 3QPAA 1WUYA 4YRIA 3HJFA 4EF6A 2JG3A 1NJ1A 2BP7A 2W4MA 5DT2A 3TAXA 2QTVB 3OKFA 2AC4A 1XJ5A 3EZGA 1J8YF 3LQ4A 2OM2A 3SS8A 2NTYC 2QX4A 3B3JA 3C6QA 2QAGC 2Y67A 4I7EA 4AJIA 3HWRA 1EXNA 2O0HA 2RG7A 4CCSA 3AY3A 2C9YA 3ZY6A 4Q1BA 4OUDA 3HEAA 3PX2A 5C1IA 4IY1A 4UXHA 3S2IA 3UPTA 4DV6B 3FNQA 4IXNA 4GOND 5AK0A 3VPHA 1Z6ZA 3EZYA 1J0CA 4LNUA 4PO8A 1S7GA 1J20A 5C5IA 3VNRA 3ER9A 4K9DA 2ZYWX 1NJGA 1A2BA 4DZZA 5LL6P 1F9EA 3MJ4A 5IYZB 2Y1EA 3IQDB 1G6HA 3K96A 4JLOA 3HWWA 3G0HA 3UQYS 5BMVB 1CS4C 2QRNA 3EW7A 2IZ7A 3ASYA 1Y3DE 4GF5A 2V1UA 3H04A 3NANA 4C2UA 3KP1A 1RRFA 4RLQA 4YMSA 2OBXA 3E9CA 4BVHA 3CW8X 2HNBA 2ATCA 3P45A 1K3FA 3TZHA 1VLLA 4KCGA 5CM8B 3NWPA 1ZUIA 2AHRA 4ASUD 1FJGB 1YB7A 4DR1B 2FU5C 2ZE7A 4MJLA 3DOEA 5BNTA 2WWTA 5KB3A 5KBYA 3AFOA 1MMFB 3UAYA 3IQGX 4ZN6A 5TNXA 5IJZA 4A1OA 2QTRA 4CCAA 2HO4A 4DQLA 2C2ZA 1LKZA 1S3IA 3HKBB 5ESDA 1R9JA 3CH5A 3SE7A 4KO2S 1F9AA 2EKDA 4R6WA 3A9TA 1OC4A 1M83A 1JI3A 2Q9CA 3O21A 3MINA 1JXQA 2C1ZA 4JS0A 3OZTA 4MP8A 3GGPA 4P58A 2EBUA 4Q6WA 5E6SB 1SKAA 2FFBA 2Y66A 3SXPA 4QLOA 1Z4JA 1VSTA 2VUSA 1B8VA 2VEOA 2W0MA 2XBLA 4Y1FA 4M7WA 3UK0A 1JR6A 3S5UA 4JBWA 5JNVA 1GNQA 1HE1C 1SXJD 3G85A 1WZIA 3DVAA 2EGHA 4BV3A 1R66A 2HGSA 1PP4A 1ZGJA 1ECPA 2P9HA 3RYFB 2IA5A 3UIEA 2BE9A 3OBBA 2BHLA 4ZOLA 1A27A 3N53A 3TD2A 4CV3A 5IN4A 4JROA 1LW6E 3RRBA 4CF3A 1XZDA 5FIUA 3S0JA 4S35A 1ZP6A 1T0BA 1N77A 4ZZ2A 4RH0A 3GQBB 3HCPA 1SOMA 4ND6A 3F5SA 4OXIA 3TTSA 5KQPA 5EYPB 2VXCA 3AL3A 1YNSA 1Z35A 2TECE 5KEIA 3A31A 2CBZA 4RA9B 3VNUA 3ZTYA 4F2PA 3Q2KA 3GGJA 4XIFA 4AF8A 2Y1GA 2C59A 1PQWA 3H11A 2V7XA 3HV0A 3LKZA 3INYA 4FPXA 4YRNA 2I6QA 5MN6A 5BOSA 2FUG6 3KG2A 4TSFA 1YI0A 2HA2A 5THXA 1LLUA 4KG7A 4OIMA 1LPBB 3SYKA 4UTVA 1UMKA 3JVEA 1DAGA 2RK3A 3L4BC 4OGWA 3BL8A 3LLUA 3LVQE 1C81A 1IZYA 3C74A 3IAM6 5HZHA 4FK8A 3AJDA 1FP4B 4IIFA 3LHKA 2UZAA 4PG6A 4BRWA 1ZR2A 1X1RA 2ANCA 3F7OA 3U81A 4O2AF 1PKEA 1CNEA 4TS9A 5CCBA 1V8OA 1VBNA 1ZVMA 2W2OA 5PGMA 1I94B 1CZKA 3QPCA 3UXHA 2F00A 1C7RA 1X1AA 4OH7A 5FLKA 5KYXA 4B87A 3U44A 4GW3A 1X13A 4BQNA 4YRAA 1P4AA 2ATXA 1G38A 3TNDA 1XL1A 2E1PA 4YJHA 4WESB 2X58A 2W2MA 3SS9X 4I55B 2I9PA 3WMEA 3HE3A 1EFKA 3MYRA 1I24A 3QXSA 1CZOA 3CRVA 3QHAA 2CCGA 3OJOA 3VBEA 3DFKA 2Q0QA 4D44A 1JA0A 5E7MA 3UB2A 4K88A 3ITDA 3SMVA 1H6DA 1Y1QA 1Q15A 1ZJ4A 3D43A 4KR2A 3WGLA 4J75A 1QH1B 1MU0A 2QD5A 4QOGA 2DZDA 2GZHA 4AS2A 2HPHA 3OZ7A 4XLZA 5FA8A 1P19A 5U4XA 5K8VA 5KTRA 2PT9A 1IJBA 3IPCA 5DGHA 5EZSA 5AW6A 3MWGA 4E2WA 2DKFA 4U2KA 4I8DA 3S7ZA 3WNVA 2WVJA 2PX3A 3G2JA 3KHTA 3HXQA 2O8BB 4KWHA 5DLQC 3SZGA 3TX2A 4LHXA 2C4TA 3FCXA 4IKPA 1Q91A 5FEUA 2AI3A 3DMYA 3R9XB 2JJQA 2IC5A 1PTJA 2D2IA 3IULA 4DLTA 1LC0A 2V98A 3QOXA 3N6XA 4OHBA 3H2BA 4DQKA 5LLDA 4GXRA 3L8HA 3RHSA 4H1HA 4FFNA 1A50B 2OD7A 2C0QA 1PIWA 5HM6A 2CBXA 4I4CA 3DCIA 5L95A 2ZWVA 1SNYA 3IOCA 2WWXA 5GOTA 3CF4A 3LNTA 3NZEA 4PHFA 1IBKB 1EEHA 4DT1A 3ASVA 4TMKA 4HVAA 2Y1KA 1NWHA 4D99A 1R0BA 1WCV1 4OLAA 3DE6X 4Q9DA 1PJ8A 1HM5A 1T2CA 5AO9A 3AI2A 3C7CB 4OYYA 3BVPA 1B1AA 3HR7A 2O7VA 2BWJA 4Q1FA 3VPCA 3N75A 2I9KA 1E9BA 3RJMA 1UFOA 1ZRSA 2KBFA 2I29A 1ZM3A 1ULTA 3GOQA 4TTQA 2EXXA 4YCAA 3RTGA 4NV3A 3FPBA 4RF3A 1AZTA 1I0IA 2FRXA 3CX3A 2QORA 3WA6A 2A14A 2A9VA 2I54A 1ZJJA 1FLVA 5GV7A 1NBWB 3CCFA 4B2LA 2YVQA 1PFQA 2NZVG 2C77A 3RVMA 3N3BC 1HZZC 4AY2A 4YPOA 2BUCA 1CQJB 3I0ZA 5CFPA 1GA6A 2FSVA 4TT8A 3HXKA 1VXRA 3A2LA 4C20A 1CZHA 3ZYZA 4A36A 2PIDA 4TRNA 5HK8A 1VE5A 4XLLA 3K0CA 3RSLA 1BHSA 1DCMA 2QVLA 4L6AA 2H57A 1S2GA 2XIJA 4O0LA 3WYFA 1FMFA 1ZVJA 2GD0A 4LJ9A 4AX4A 3MJHA 5IS2A 1E1YA 4FDAA 4MVJH 4YJFA 2HAEA 4ZVPA 1RE0A 2PKEA 5EZYA 2PZ8A 3GX1A 1XIVA 1U8YA 1YRQA 2H1LA 3ROFA 4Z7QB 2ZE8A 4MS1A 2QYHA 1CEYA 5IAEA 3OZXA 2FA9A 3LKDA 1BEEA 1YASA 4X20A 1XB2A 2XVYA 2VT3A 3H18A 5BSTA 1EFPA 2JBWA 4X63A 3BRCA 2OHHA 2OQRA 4JBLA 5LZ9A 2XTAA 4REQA 1GFWA 4CQJA 4XUGB 1SCJA 4F2DA 1JWAB 1W5TA 2ZTSA 5KTYA 2L19A 2BBWA 3VA7A 2XZDA 1QHNA 1NV9A 3VU8A 2ILTA 1ZO8A 4K6KA 1D04A 3M34A 3NHMA 4TWRA 3TI7A 1P0CA 4QM6A 5AHKA 1NDHA 3I8OA 4MLZA 2Q1UA 3L6DA 2QAGB 1G291 1E2QA 2DKOA 2R6ZA 2XEDA 3SF8A 1WMBA 1E96A 2OB1A 4PE5B 3WLAA 1QHHB 3FR8A 1WKCA 3NDRA 4GEKA 3ZWKA 3USES 1ONNA 2IYLD 3HCBA 4N40A 2AN9A 3FFTA 5ES4B 1KWGA 3GZJA 5J59A 3QVMA 2XPCA 4MQ5A 3I2IA 1IEWA 4O4IF 3TBFA 3V8QA 3WKDA 1F48A 1RLOA 1TYCA 2HMVA 3B3GA 3CEPB 3IBGA 3LXRA 3QITA 1WABA 4FIDA 2XD4A 2I76A 3EA0A 3A3OA 3RU3A 4MVJD 3SJUA 4D8UA 2VDRB 2CZCA 4ZEXA 2PFSA 1BMDA 3UG7A 3E8SA 3VC7A 5DHFA 1NXVA 1WY5A 2F3UA 3N8HA 4TV8B 2PL5A 4P3OA 5A5EA 1VHJA 2PJDA 3HCWA 1N78A 3HGTA 1C9KA 3I4CA 4IICA 2MWMA 3EEYA 3RYHB 4XVCA 1QHIA 2VSFA 1KMNA 3GT0A 1NU8A 3E7XA 5COAA 2HHHB 1GUFA 5HE8A 3E1SA 5SY6A 5TQ0B 1RPAA 3HBMA 4XM1A 1NOKA 5CFQA 3AL0C 1GSHA 3FIJA 1DV2A 3FNFA 5DXFA 4DCSA 5AI6A 4LY6A 5BR4A 4N9WA 3QRWA 3P9CA 1OAAA 1EE1A 4GP9A 2GFHA 2HF8A 2H2DA 2KB0A 3AUTA 1N75A 2QVCA 3B6KA 3ONDA 5CVEA 4MI1A 2ONJA 2VWGA 3SGLA 5BUZA 2VSNA 5KAPA 3JD0A 3KT6A 3U56A 2CHGA 1N6OA 2EATA 1U9CA 1TM1E 3C1UA 3KCQA 5KSPA 4NQRA 3UJNA 4FW9A 1F5SA 4E4YA 4JC5A 4S0XA 4ALNA 1YBFA 5DYIA 2DX7A 3V6LA 2P0EA 4QNMA 4G37A 4DV4B 3IVXA 1Q0ZA 4BKUA 5M04A 1HUQA 1GSAA 2Y76A 1G7TA 2UYYA 1GGHA 4K9QA 4RF4A 2F48A 1QSGA 3QJ5A 4B7XA 2VBGA 4OREX 4LYHA 2NMVA 5GPBA 3OF5A 2YIMA 3IP6A 4E3WA 1U3CA 1ENYA 3OZVA 4MMXB 2VLBA 4O4JA 2O7SA 4FKZA 5L3QB 1NI3A 2VNHA 1GQOA 1WDTA 1ZNZA 2PO5A 2YDYA 3HSKA 4C1BA 3EWSA 5A62A 3AVYA 2ZSKA 1QHGA 1D8AA 4NV1A 5SYAA 4ROTA 3LZCA 4S1PA 1RM0A 2FUEA 5G0WA 1IY9A 3P2YA 4EARA 3DTYA 2FWJA 4H1UA 4ZQGA 3E1KA 2WIAA 4HAZA 5F23A 3MMNA 1Z83A 1YZQA 1XZFA 5IARA 4UZSA 2PCLA 5TMEA 2X0IA 1VC2A 1OREA 4M0DA 3T5BA 4DMRA 4UTRA 3C3YA 3CUVA 3EQ6A 5CDFE 5JSUA 1USKA 4B3RB 4AI6A 4RULA 1CRPA 4PLHA 3JQRA 5C5EA 5LR6A 3U40A 3PRJA 5A0FA 1I3LA 1KJ9A 1N5DA 1Y34E 2WZBA 3B6MA 3EN0A 4PAWA 3DR5A 3WO0A 5A4IS 3T8YA 3REGA 2DR2A 3CEJA 3GLFB 4LDZA 2FRVA 3EMBA 3R23A 4US2R 4EJSA 5K2OA 2WB2A 1ZINA 3N70A 2VJDA 3SX4A 3EARA 3GJTA 3LUFA 4A8PA 2C7PA 2FNAA 3PXAA 3ADBA 1YHZA 2G4LA 2ZBVA 2ZP1A 4YUWA 1LX6A 2Z4TA 2G70A 4HMQA 5B7GA 1KYXA 4FHCA 4BV2A 3HDVA 2Q8PA 2XMZA 3SYMA 2H07A 1JQJC 2OGWA 3SNKA 3PA8A 4MROA 3K3PA 1JLLA 4RSHA 2P7IA 1EWYA 1HRKA 4QQRA 4G1CA 4YCDA 5BSRA 2QJRA 2VF7A 4DXDA 1B16A 4LUCA 3V7NA 1YQ9A 2IYPA 2VHXA 4Y30A 2YDXA 3GLHB 4LXUA 1QIFA 4KWEA 3TPFA 3CT4A 1RYFA 1GTZA 4KXNA 4EL0A 1SKUA 3TOZA 3SXUA 2EL9A 2BR3A 3P20A 3GDGA 3RH0A 4L8GA 1I6KA 1FU7A 1XF1A 3AM4A 2OXTA 1UFRA 3GBSA 4EHHA 3GQVA 721PA 2QN3A 4Q37A 2YJ6A 5EMKA 2B9EA 2PUHA 5JCOA 1G20E 3A6LA 2CFSA 4IQFA 1XUOA 2YXNA 4LCBA 1NRXA 1Y1PA 1PL6A 2VYND 3NJRA 5GM2A 2IU0A 3TTXA 3HEMA 2YJTD 1V8FA 3IAFA 1UOQA 5FO0A 4R98A 4N7JA 3UHOA 4ZVRA 4ISCA 2HQRA 2WC1A 3ETLA 5D00A 3WLSA 2Q5LA 4G3XA 1VIYA 2V7VA 3IXLA 4K7JA 1CUJA 1THZA 2R7MA 3CVWA 3ZJYA 5DTQA 4Z51A 3GP3A 1V1RA 4ACBA 4B7AA 1RM3A 1MIOA 1TZBA 3FD8A 3KPWA 4Q4LA 4QNRA 3ZEIA 2EBHX 3LYHA 2DPHA 2MT9A 1LSUA 5E3HA 4LBVA 1O54A 4GX1A 3A26A 4WOJA 2NTJA 3AWIA 2M6SA 3GYBA 5G3YA 1GPUA 1C30B 2J07A 3CX7A 4HDSB 4ALLA 3LUAA 2HJRA 2D5BA 4BUZA 3MOGA 3OLXA 1ECJA 1GV0A 1OX4B 1TT5B 5TSDA 1C3LA 3HRIA 4M8KA 4ZVVA 4F12A 1M3SA 4EKNB 2J7KA 4RXTA 5ALFA 4LXTA 1F14A 3SAJA 5KWEA 2FDRA 1FSZA 3D8TA 1C7EA 1K6XA 4WH0A 2VTBA 3THXA 2ZJFA 3ZDAA 5KX5A 4CPDA 5DI3B 5ADUS 5JPDA 2DPGA 3TSWA 4A6XA 1D6NA 4EFMA 4B31A 3FX2A 2IQ5A 1Y6GA 4AKGA 2GZ3A 1QGAA 2PD4A 4NCIA 3IA7A 4R51A 1D8TA 4A0RA 1H8EA 4CIXA 4DJFC 1SQ5A 1HNWB 3WGKA 4QU8A 2JD0A 3E23A 1W4ZA 4YO7A 2Q07A 1FLAA 2XB4A 1JDUA 4RTRA 2RHMA 3P7MA 3UF0A 2ZUEA 2YY7A 2NX2A 3F3YA 3QE0A 3UJ7A 1NMSA 4CM6A 1H1LA 3Q3CA 3P9NA 2AKAB 5MHTA 5FNVF 2IIPA 3O3MB 3EG9B 3RCBA 1VBMA 2ZRAA 3C98A 3I4LA 4IOKA 1SXGA 1L8QA 4TMVA 3VPDA 1T4DA 3CKKA 3E03A 1JFTA 4J4BA 5AVOA 1DKMA 1ZN8A 2G9NA 4KBFA 4FW8A 4P7FA 3SQMA 1K89A 3MMXA 1O1YA 4J1SA 3ST7A 5BW4A 5C32A 2EJWA 2VNJA 4N3CA 1AY0A 4UHEA 2DPLA 5KHLB 1QU3A 3PR3A 3F71A 5A9SA 1J23A 5JJKA 3Q2IA 5DGIA 4MEAA 4WINA 3VZSA 1R4ZA 2H00A 4K9RA 2UXDB 4R8MA 1DXOA 1PFKA 2BDEA 1P77A 4XXHA 3U09A 1PWYE 1GGJA 4JU9A 2FLKA 4NAVA 3TKLA 4XB1A 2BFFB 1EWRA 2FOXA 4Q3CA 2D2VA 4BX0A 2AJTA 5B2EA 3B2QA 4IWXA 5FI1B 4FBLA 2QE7A 4L27A 4D9FA 1HTWA 1JLRA 2V8OA 1FDUA 1M6NA 2G9ZA 2QHXA 3K0KA 2CXOA 5ECGC 4DUYB 5C7IO 2JKYA 3FB4A 3L82B 1ZUNB 3V8VA 1RAAA 2PT6A 2DERA 3FGOA 1LDYA 1AK9A 3GEDA 4G1VA 3NTUA 4E2ZA 2ADOA 1HDCA 4JX9A 5KTOA 1B2LA 2OO5A 2PD6A 3EBPA 3LJKA 4FS8A 5JYCA 1OIWA 4UNNA 1W34A 4L74A 4TTTS 2IK8A 3QWHA 5BPHA 3DAGA 1OIXA 5KU1A 1C1HA 4E0BA 2CLOB 5E9AA 1Z18A 3K9NA 4U9IS 2BKXA 2IXBA 3KXPA 4X90A 3HR8A 1Y7IA 3EUAA 4Q4DA 5HE9A 1Y33E 2AXQA 2PMCA 5EOVA 1PUIA 5J1TB 4DFDA 4F93B 3WK7A 5P21A 5K0GA 3HXTA 2WSMA 1T5BA 5DP2A 1ADGA 3UJDA 3T9CA 4P54A 4FYVA 2JGDB 3M4JA 2G7ZA 2Q29A 4FXPA 1LC3A 1DJQA 3DFIA 3KKPA 5DTRA 4C2AA 1AO0A 4ECAA 5A1TA 4JGIA 3BH7A 3VR6H 4XPZA 2F1OA 2GJ8A 2LNDA 3F47A 4MS3A 5CAEB 3MTBA 3R20A 2HJ9A 4BAGA 3ZDBA 3TM4A 1K8ZB 1W25A 2HSEA 3A6EA 3HN7A 3H99A 1U28A 4KWCA 1SBYA 2Y93A 5DV9A 3RROA 1AHPA 1NLZA 2XDQB 5HCNA 1SU8A 1LCIA 2YMMA 5ALXA 3D1JA 1LV8A 1MN6A 2H18A 4MDYA 3HTXA 3AKYA 4E6PA 5KOHB 3KVVA 4WJZA 1GSOA 2DY1A 3BYZA 1T2AA 3QKSA 4OMDA 5T41A 3UT5B 4HEA1 4AQYB 3MT7A 4OQPA 2HA6A 2C7RA 2QUKA 1P8AA 1FRZA 3L7MA 1JBEA 4EVQA 4RY0A 2WPDA 1UH5A 4TS3A 4JJ6A 4ZZ3A 4N8DA 5IKEA 1XP5A 4RH1A 2GZDA 4KN5A 3OQIA 1RBYA 2A35A 4R84A 2ACWA 3U19A 3T35A 4HVTA 1XQVA 2BMDA 2NZYA 3BJEA 4MUBA 3S2YA 4TM7A 1EJ2A 1JHOA 3WYCA 2W22A 2KJQA 3JVIA 2A1TS 3M6LA 3LE8A 4LJ8A 5E2IA 1GPBA 1USIA 4BVBA 4WVFA 3VKFA 1WIWA 4HQOA 3PE6A 2ORYA 3SIWA 2GZ1A 2GM4A 2PD3A 1DIBA 2GBFA 3DAHA 5FX2A 1Z36A 5L3SA 3O8OA 5TARA 4KI0A 4YMHA 5L4NA 3QTBA 3CNOA 4MI3A 1KO1A 2Q41A 4UFNA 3T7DA 3VZCA 3RHZA 3VR6D 5AUNB 1Z0SA 4YRPA 3BHIA 4RQAA 2PZBA 2WHRA 5D3QA 5HFJA 4P38A 4A73A 3ONWA 5K20A 4QUIA 4F4IA 3D64A 2ZIWB 2QX8A 1ID8A 1VM6A 3F6BX 3PFIA 3LHFA 3SJCA 1Y89A 1TEVA 1XFDA 5CRIA 4AULA 2PXXA 5C5CA 5DM60 5K5EA 2G3YA 3USZA 4EHNA 4EI9A 2OAGA 2CL5A 3RLIA 3VYWA 4YMTA 5H9VA 4AZSA 5KYVA 3OJ0A 3MQ2A 3ROPA 1EWKA 3ZW7A 1TAUA 4L8YA 1PTKA 3GCZA 4OXXA 3W3AA 2MSLA 3IQWA 1PS9A 1TUGA 1IWBB 1SVIA 1TTHA 2AA3A 2QV0A 3OLZA 5IKXA 4UVIA 3W2GA 2WVAA 3PFBA 1SG6A 2UV8A 1MC5A 4IIXA 1KY3A 1YB6A 4LYFA 3FROA 2WWVD 2FPUA 3PEFA 4GOKA 5BSHA 5BSVA 3DEZA 3CCBA 5HUQA 3V4OA 1J8VA 1K08A 2SKDA 3C48A 1ZSYA 3WXBA 3H19A 4DRZA 3I9OA 4MWGA 2N1MA 3PIRA 4NU8X 1M1XB 3FJYA 5KI6A 1RRCA 4ZCIA 4Y0NA 1Y5MA 2D3WA 2WKPA 3NJ8A 4B6JA 3QOYA 2BTEA 1WL8A 1N2OA 4O2AA 2FZKA 3PDIB 3V32A 2WV9A 4YRSA 4N65A 2QTLA 5H80A 4LQCA 1WXIA 1MDBA 2O57A 3IKJA 4A5SA 2CN1A 4ANFA 4DXHA 3KSZO 4IHJF 3TEFA 3A1WA 4K9NA 1JKJB 3PNPA 4RF5A 3O3OB 4L4UA 4YEDA 4OY3A 3VX3A 1M2OB 2VAVA 4H3KB 4Q9LA 3O92A 1C8KA 1JT9A 3V8NA 2ZATA 2JLZA 3R0VA 5A6SA 3F7MA 3BD7A 5CB4F 5D1NA 4JL8A 4I4NA 1KFJB 3KFVA 2IYEA 1J39A 3DXFA 2DR0A 3L8GA 3MERA 4GC5A 3MJVA 1T8WA 1NXOA 1K98A 2FETA 3ABIA 5I9BA 5KREA 2AXEA 4TZKA 1WCIB 1X70A 1XRJA 1ZD4A 1XKTA 3B5EA 3DL7A 1K2VN 3R5HA 4S12A 2X6TA 2ZR7A 2YZ2A 1QUFA 5SZKB 1KK0A 2GZAA 2VJKA 4XGKA 3IS3A 1UBMS 3KYDA 1XMOB 3GLUA 5HTOA 5KHOC 4BLRA 3GAZA 3ENKA 1SBZA 3PWKA 2XA9A 4KVGA 4TYYA 3PIDA 1IOVA 3PNMA 3N28A 1JPNA 3FUCA 2AC7A 4L4XA 4TSFD 3R1IA 2QIOA 1RRGA 1XEXA 3KOUA 2YOGA 3LQRA 3CVYA 3L0CA 1Q44A 1R9NA 3DKKA 2IE0A 2V5VA 1X7DA 4V24A 4UMVA 3DL2A 3L92A 3LV8A 2GH1A 4QOHA 4ZT2A 1JDSA 3PGKA 1PHRA 3GP5A 1I14A 1W0CA 4A91A 1NXTA 4EP1A 4NZPA 2AFHE 3W8DA 5JI3E 1SXPA 3ZGNA 1LGYA 4E31A 3F78A 4FFBB 1XD2B 4C03A 4R1UA 2CNNA 3IDQA 1GN8A 3K0FA 3R7WB 3RSHA 2ODWA 4NYJQ 4EBBA 1U4NA 3SLRA 2BSXA 3V4VB 4QLAA 2X1LA 1UMCB 3F2IA 4P3PA 2QLJA 2JZCA 4TZTA 4WK2B 4ZTBA 1DXYA 2P5YA 3P9SA 3Q0TA 4J43A 4UQLA 1LS1A 1PR9A 2FXIA 2MU1A 1X7ZB 4QJBA 2A1IA 5A6VA 4CIAA 4QELA 4XVHA 5ICSA 1KI1A 5DYNA 1RJEA 4GMDA 3D7RA 1KDTA 4FJ0A 1JU3A 3DQZA 3NATA 2HEGA 3ORYA 4N82A 2Q9BA 4NJEB 5CXSA 2LCQA 1US8A 2P4UA 3GEBA 4KW7A 1F51E 2C7OA 5C7LO 3FOWA 1OVGA 1NLUA 2FUNB 2FW6A 4B4WA 1OBFO 3WIEA 2ZRQA 1RZVA 3EDQA 3NC1C 3LPNA 4GIBA 2Z5LA 3TRFA 5AVVA 2PUGA 1PT8A 3KWMA 1NW4A 4PGGA 1UP7A 3A6GA 2QZJA 3FPGA 2G0TA 5T4HA 2AOTB 1YGYA 5TQVA 3WYAA 2OWEA 2NADA 3TSCA 2BFBA 2KS6A 5KYNA 2XT9A 4ZTZB 3TL3A 4PRLA 1MG0A 4TT3D 4U2GA 2BGGA 3LO8A 3NOOA 4O3FA 1X8XA 4MQMA 4PINA 3J81A 1EG7A 4MV1A 1GCAA 4C0JA 2D1QA 3GZTB 4GSYA 4DTCA 8MHTA 1Q83A 4DRYA 4F3KA 4UFPA 5LYYA 4FCTA 2EAUA 2YY6A 5HFNA 4ZEMA 5C3MA 1ML3A 2ZU0C 2ZRHA 3LS2A 1KI7A 1CEEA 2JW5A 4FUQA 4D45A 3CZPA 1CVRA 1AN0A 1Q1ZA 1FP6A 3CH6A 3I01A 4R8RA 3TEMA 4GSKA 5KUTA 5CX1B 1KTVA 4EY7A 5T67A 4D0NA 1PD1A 3CLSD 1U1DA 1X6VA 4PXSA 4F85A 4ZYZA 3EGCA 4W9NC 5HNKA 1VYUA 3PLAE 1U8ZA 2IUTA 5JSZB 1IBRA 5IPFA 5LSAA 3PC4A 2BR4A 3NAQA 5DSXA 4A6EA 5BXQC 4X84A 3QE9Y 1ABBA 3M3HA 3A0RB 3ZX4A 1OFUA 1P31A 3DULA 1H9CA 2B99A 4C0AC 2NSHA 1N8NA 4HEQA 3ZZMA 5IDXA 2JFQA 3PQ2A 4WJLA 2C4UA 1PWHA 2AB0A 2AQHA 1W73A 1X3SA 1EU1A 3B9PA 4YP1A 1BVRA 3ET4A 3VSEA 2QY9A 2PL9A 3DGEC 3TG2A 3DUWA 3LHIA 3H8WA 4HRAA 4OXQA 4FD3A 5EPEA 3DOHA 4Y18A 3B48A 1G8GA 1TC2A 2I6FA 5CNMA 4RL6A 1JYFA 3OBIA 3EGWA 1PDWA 5DN6A 521PA 3A9SA 3R6LA 4NE7A 5LBIA 1PR4A 3MWEA 4Z1MA 3T34A 3T5GA 4GZ5A 4QRDA 3L4KA 4O4IA 4TQGA 4EY8A 4CV2A 3T12A 1G4UR 3IX7A 1XYGA 5KSYA 1GKYA 2OBMA 3WKCA 1ZN9A 1USGA 4JX8A 4ZDWA 1W4LA 1C29B 3WZ2A 3WMFA 1X1SA 1KI9A 3OESA 1RD4A 3G2IA 1GRVA 4UMEA 2PUAA 5G0TA 1AXEA 1Z2OX 1O4VA 1RKQA 2OZVA 3VVLA 4MCIA 2PX0A 4FEYA 5D8DA 5CB8A 3R24A 5TF0A 4DWWA 2WTEA 2VJPA 1BYIA 1MT3A 3ICPA 3KOWA 3TNFA 3THYB 1NW9B 3D3EA 4EB0A 2GPSA 4B82A 1KK3A 2X5JO 1N0WA 1O6CA 1JFSA 4BE7B 5DNCA 2CEKA 2E4YA 4IWYA 3GUCA 3OU2A 1M72A 4QUDA 5TS2A 1BGVA 3I23A 4K9SA 4ERXA 1BROA 1WU7A 2O59A 1AF7A 2W4IA 3NPMA 4EUFA 4YCJA 2HIMA 5F98A 3CF4G 3ONFA 3OX1A 3D4PA 2Y1DA 4JB3A 4G63A 5DX0A 1NFQA 4DTIA 6YASA 1L8AA 3ILVA 4IX1A 1ISFA 3NT5A 3VPXA 3Q8KA 3OZAA 4MEJA 3RRZA 4XJSA 1Z0UA 3Q11A 3GNTA 4TLLB 1HE4A 1E6CA 5F2KA 3Q5EA 1RLIA 4PHCA 3SQDA 1U02A 1MFZA 2Y2VA 1USVA 3ABOB 3LBIA 4HEJA 3ZIAA 4FU0A 5JYEA 3DTNA 2DCUA 4GI3A 3HO1A 2BMEA 1Z34A 2RAUA 4Y6LA 1M0SA 1ZH4A 2XBUA 3KPJA 1E1KA 1TZKA 2W2VA 1MB4A 2HU5A 3P8ZA 3Q1LA 4DA0A 4ER5A 4DRXB 2EW1A 3WB1A 3F67A 1LY1A 3WNDA 5B4TA 3ZWQA 2F8LA 5TQJA 5IBCA 1B0UA 1JG3A 1E9SA 4EL5A 1NSFA 1FEZA 4UHJA 4QE3A 5H4GA 1KVQA 1KVUA 5F7JA 4D9EA 5FAXA 4IXMA 4EVRA 2VKTA 3IALA 1E1DA 1C3VA 2Q50A 3AESB 3ELUA 3KZNA 3ZNNA 1F2VA 2G88A 1G2IA 3EASA 3WNCA 5JQGF 2HQSA 1NT4A 2BOVA 2E4AA 2I4TA 5HMLA 4CJXA 1NG9A 4HXFB 4QO7A 1W47A 2REOA 4FGWA 2W2LD 2Z30A 3CLTC 4IEIA 1QU2A 3OHMA 4Z9XA 3FTNA 2NAPA 5JS6A 1EUDB 2GHTA 3L8CA 4KLCA 3S1LA 2TYSB 3MT8A 1P75A 4QUAA 2WMNB 2XAUA 1M7BA 2RI1A 4BXOA 4EPXA 4MW0A 1ATIA 1D7OA 1JE0A 4WUTA 4NWIA 4MCAA 4F11A 3OCYA 1EESA 3W2EA 1X8KA 4L4YA 3UN1A 1VGVA 2RJ3A 2B7BA 3ORRA 3FRJA 3ISTA 5ALTA 2BCEA 2J3LA 2PUVA 3L7BA 3Q9NA 3BRSA 3LQQA 3L6OO 3IQIX 1A2OA 3UAVA 1M1YA 3BT7A 3IEKA 3IYLW 1WG8A 2D5CA 3B82A 2FQ1A 1DEAA 3AIIA 1LS6A 3OOHA 2CCKA 4FI3C 4X54A 4C01A 1QYXA 1ZH8A 1C3JA 4J2OA 3WYBA 1BKSB 1W4BA 4F9GA 4G5GA 2X0NA 2OHIA 3EXG1 3F7NA 1L5OA 3A3YA 3KTOA 3PWSA 4G86A 5CYPA 4OMUA 4LKOA 4AJKA 1Y5IA 1VECA 3WQBA 1GADO 1V5IA 2EKZA 3BCSA 3BZBA 4PHGA 4AF7A 1LBIA 1X2BA 5K4GA 3HXMA 4PX9A 3LHDA 3HWX1 1GTVA 4CTNA 2AK3A 1SUIA 3OIGA 3ED1A 4GVPA 5C35A 1D0IA 3F2VA 2C9MA 4MKRA 2FJPA 5SYMA 2XW6A 4IDCA 3V7WA 4RPJA 5ALRA 3ZLUA 4KC0A 1NDQA 5AWFC 5EQFA 4INAA 5JMWA 1EWVA 1SK9A 4XQGA 4AP5A 2W48A 4JBIA 1EQ2A 3TG8A 1UJCA 1DT3A 2AG1A 2P0AA 4BNUA 4YY3B 2R8OA 3O4VA 5LA6B 4YIKA 3ZDDA 1SGWA 2QX6A 2XRYA 4CUKA 3N8GA 3AF1A 1K4KA 3LRTA 3IIMA 1RVDA 3LCUA 4NG4A 4GRAA 3VFDA 3VYVA 4MB6A 4BJ3A 1KJIA 1LX7A 3HKDB 4ZXPA 2WSYB 3TLMA 4ILKA 4M53A 4JR0A 4F0JA 4B71A 2DWPA 2H4YA 1RACA 4TKVA 4ZJPA 2PMKA 2L82A 3VTZA 1D2AA 1FTNA 2QZPA 2XZPA 4JCOA 4CTKA 2DFVA 4OM8A 4TYPA 3QYAA 3JRWA 3UT0A 3W7VA 4RTSA 3A6PC 4O2LA 2OYSA 3GJ6A 3K31A 4HL6A 4MGEA 3PUKA 4FGUA 4J7XA 4KHZA 3KAKA 4MW6A 4MUNA 4BWYA 2N1BA 2H2HA 2JI9A 2C99A 1P33A 4NBUA 4AQ7A 2VDMB 1GAQA 4YJ3F 2WJVA 3ETHA 4TPKA 5A5GA 1HDZA 4HNTA 3U1BA 3P9YA 2QRKA 3SX0A 2YYZA 4MARA 3UH0A 3PDUA 4J2HA 2IEGA 2IDZA 2KHZA 5ABPA 1EFAA 3HBJA 4CLRB 1PS0A 1Z8DA 2Y77A 3FZGA 1E5VA 3O4GA 3E70C 1GZUA 1H65A 2REQA 4MYCA 1WMSA 4K6MA 4BASA 1QK4A 2JEYA 4NFSA 3NTQA 3YASA 5FR1A 4QQ8A 3LDGA 4F7WA 2BFDA 3M6VA 1FFXA 2FQYA 1PGPA 1G4AE 3GFPA 5ALUA 2XDWA 2Y1CA 4IKOA 5GJBA 3D59A 5ALQA 3CGGA 4DWVA 1BU5A 1B41A 5KSZA 3A1FA 3AHJA 3ZNOA 3MBKA 1P2GA 1WHTA 4HDQB 3OPNA 4PAQA 5FNVA 3W5JA 1EB9A 2P4QA 3GGGA 1BU8A 3H6KA 2QMZA 3MWDA 4H59A 5LZ5A 1C8LA 4Q66C 2O5RA 2GNAA 1P6QA 4GD3Q 4M88A 1G6Q1 1Y80A 4X1IA 4HGPA 3CZQA 3EXHC 4F21A 4OFZA 3OHSX 4OBEA 2PZMA 4H3HB 4R1MA 4YP5A 3AEZA 5IDWA 2YN0A 4YRDA 1SXJE 4KR7A 1T3LA 4ZQIA 1RAGA 1CUVA 5EJ9A 2NUBA 3BMNA 1JKFA 1AKRA 4IIUA 4R3UC 5DB4A 3V3KA 3N59A 3HA7A 3LQFA 3A25A 4C2TA 3UFXA 1QGUA 2XHEA 3DPIA 3ECSA 1F0KA 2HLDD 3H5IA 3WLRA 4P31A 4C6RA 1MO6A 4EHBA 2NP6A 1Z2DA 2ZVDA 3RARA 3OEHD 3WIUA 3LX8A 1PLKA 3FKQA 1L7PA 1T36B 5IZCC 5ALGA 1L7VC 4I1PA 4NMHA 3GVCA 5KU7A 4B9AA 1EINA 3SHQA 2Y6VA 4DR2B 2AG8A 2AKEA 4Q7JB 2PGIA 1UKBA 1Q1EA 5EWJB 1NQXA 2CVPA 2VVTA 1JQEA 3ILXA 2ZJBA 3HU1A 3KQSA 3CKYA 4HGRA 4UBNA 5LCXA 5TDHA 3X1ZA 1AIPA 3KZXA 5I4BA 1W88A 1DQRA 1GPJA 4RS3A 1ORWA 3UOAB 2COUA 3LT4A 1GTMA 1LEHA 4FFWA 5F21A 1OY1A 1W75A 2ERXA 1PQYA 1ZZGA 6REQB 1ZW6A 2QDXA 3V2IA 1C7IA 5IN5A 4HHEA 3RYTC 1IN8A 3OJCA 5BY2A 2DBQA 1WXHA 5AK4A 4J94A 3ZVNA 2DAPA 1NV8A 2EQAA 4LGYA 2XCUA 3IRVA 2YRXA 1K4MA 1FJ2A 4NYJR 1WUIS 4Y9UA 1Y7LA 4YBRA 5JDCC 1BD4A 4D4KA 4DA8A 2Q8QA 3LBNA 1F2TA 2I7TA 3KR1A 4IVQA 1U9IC 2ZROA 3E58A 3LWNA 1YR7A 2OOSA 2WHPB 4GZ6A 1APBA 2WF9A 4W5WA 4FEAA 4FSHA 3TRIA 1RAHA 4WY8A 2JIMA 2VYCA 5JS7A 4JXZA 2IUEA 3IKMB 3DOOA 4M0EA 1SUWA 3CC8A 1IEVA 3Q9UA 5K0CA 2XX3A 1XJ0A 3DT8A 1NPTO 1M1UA 5GWXA 1R0WA 3M3DA 4CFZA 4EFDA 1DBQA 4BVKA 1UJ5A 2V0NA 3OJEA 2G76A 2VH2A 5JNUA 2QE7D 1ELOA 1NT2A 2ID8A 4U7WA 5AH0A 5EUQB 3U17A 2Y1XA 5FPQA 1CB0A 1VMIA 4PZDA 3UICA 1X80A 1QO0A 3LAWA 3DCNA 1A97A 1K8XB 1NY6A 2NZWA 2V54A 2AFRA 4U7PB 5FUBA 5HDQA 2CE2X 3H97A 4JBHA 2ECPA 3L0SA 1JLSA 4NIMA 3R7AA 1QG2A 3G0DA 2ZIEA 4YMUA 1E2BA 2R2AA 3SDBA 4M8SA 3OQPA 1SC9A 1X7XA 4GO1A 4L07A 5F2OA 3OZSA 2BEUB 1EE9A 3IMFA 4UVDA 4DARA 5DHAA 5DHPA 2EX0A 2GAFA 4NAHA 4BNFA 1YBVA 1ADJA 3MLBA 4GMXA 4LJ7A 3UAOA 1DADA 4KFTA 4E08A 2C5EA 2I1VB 4X3OA 1THMA 5I47A 1LV7A 1YE8A 2PMWB 4F1JA 1RTKA 2Q7OE 5A4FS 3JYPA 2J3MA 1ONOA 4DCNA 4KN9S 4FGSA 1HG1A 5EJ5A 1HDIA 1UC4B 1FPMA 2VR1A 2GBGA 4KQ6A 4UOZA 5T64A 5IDQA 4FGJA 4LDQA 1G66A 2EFGA 1YV9A 3WK9A 2WFAA 2PLNA 1V3QE 3QSGA 1QWOA 5J2UB 2JC3A 4M1YA 1LVGA 3ZU2A 4EG3A 1L9KA 3I1YA 3OU7A 5L4SA 4I4LA 4PSAA 2IOFA 2CMFA 1RP1A 1HR0B 5C34B 5BWBA 7MHTA 5B2FA 4HH3C 3X0DA 4YCSA 1E66A 3RT9A 3B70A 1I8TA 3R5KA 5AHWA 4PFSA 5DDIP 4PLTA 2QRLA 4LK3A 1HYHA 5LDGA 2Q46A 3EOAI 2JRLA 1V71A 1DEOA 2HRQA 1YCDA 2NO1A 2HPAA 4ZARA 5IBPA 3CWQA 2F67A 2RB4A 2AR9A 3JWEA 1EFRD 4TTAA 3OQ6A 2CLKB 2FN8A 4IF6A 3FZEA 3NALA 1JWLA 4OLJA 1ZOOA 3NEJA 4JBXA 4ZOBA 4MUHA 1W0KA 2O14A 4BO9A 4I9UA 1WWKA 4NEQA 4R1OA 3LP8A 2Z6AA 1WXXA 4UE2A 3U13A 5C7OO 2B6NA 1IN6A 2XNSA 4M0CA 1HURA 3JX9A 4B46A 2PUDA 4ETWA 4MX8A 2I3BA 3EG5A 3H17A 3WIVA 2ZJ5A 4GDFA 5AVRA 2FEPA 4DLKA 4IJUA 1ENPA 2HI0A 3VSDA 1B42A 2JGNA 1FFEA 3N2GA 4NPHA 3ZI7A 4E1VA 2Q3MA 5LJLA 5J4KA 2DJ5A 2UAGA 3QFCA 4KDEA 3HMKA 1HFEL 2FPRA 1TD1A 2WAYA 2FAXA 3DVSX 4E4RA 3E8XA 1M2KA 2FFAA 2C2KA 2OAQ1 2QG4A 2WJIA 3VPSA 5JRZA 2FR1A 4Q4JB 2V9CA 4M7RA 3NHUA 1ZKMA 4CKEB 1WNFA 2RC6A 2VPXA 3BMOB 4G5SA 1I3CA 1UK9A 3B13B 1H2XA 2D2FA 4DR5B 4GVXA 3HVUA 4BUJA 2O52A 4HLDA 2G28A 4G89A 1XZCA 4MP6A 5D86A 1QQ5A 1Z2NX 4LRTB 1WBBA 2VDKB 2I1QA 2QAIA 3FPJA 3GUUA 2IHZA 3PTZA 1SBCA 4KV9A 3SD7A 4GM0A 3RJTA 4HUTA 1QYVA 3DZGA 2X8BA 4DJJA 4YV1A 1NJ5A 2IHJA 3L7NA 4NMLA 4WLUA 4ZZ0A 3O4HA 1ZL0A 2BRUC 2PFGA 3JQPA 1D2NA 3EVDA 4NECA 4I19A 3RIHA 3U6KA 2GPYA 4QUKA 1E8NA 2V6GA 1EM8A 1RYNA 3ADDA 3UV3A 1IQUA 3TQTA 1LVUA 2OPHA 3T6KA 4BFSA 5IVHA 4MVJE 2C20A 5EESA 1QQBA 2CNDA 3GT3A 1QM5A 4KEAA 4HVCA 5JXGA 2SICE 3I2KA 2C98A 1BRMA 1KE1A 2GYWA 1PNQA 2MJLA 2O5VA 2WD9A 1L7EA 3G1WA 4EVIA 2W37A 4WI1A 1LF5A 2JFOA 2Z2KA 2IH4A 3DDWA 5IUKC 2PLAA 1XPOA 3HJAA 2KBEA 1Y9ZA 3OZIA 3KD3A 4OIFA 1OROA 2TS1A 3G5LA 4W99A 3P27A 4IZHA 5F4ZA 1UZLA 3TKYA 4KE9A 1YRAA 5EWMB 1TQ2A 1FNMA 4R1LA 2HRBA 4B7CA 3IJEB 1OXMA 1DTWA 2EP8A 1QLHA 1Q21A 2AJ8A 2YUTA 1JDJA 2QZSA 1O58A 2YWXA 5D3ZA 3TLKA 2B2NA 4C29A 5KC9A 5DWVA 3ONVA 1TFRA 1M6VB 1U5BB 3IOEA 3AR9A 3K9QO 2R1UA 3CZMA 3BXFA 3NBQA 4M89A 4BBZA 1H6AA 1W1IA 1B26A 1GPYA 2H2FA 2FEMA 3V3TA 2JFWA 3D3KA 5IW8A 2ZM6B 3BL5A 1NW7A 1TF2A 1M67A 5LKRA 4L3VA 3EXHB 1KQNA 5T8KC 2BMAA 4AY4A 1L5KA 3EXFB 4BVEA 1V6CA 3P0FA 4QPNA 1R2QA 4HDKA 5AXDA 1QK3A 1J8MF 2IY9A 4IGEA 4I50A 5ECYA 1V2GA 2ZRLA 3TQFA 1Z4PX 1NPYA 1V41E 3M7IA 3GB9A 3PQEA 3W9BA 1B8UA 3UTCA 2W2TA 1E8DA 1O6GA 4RMGA 1ISPA 5TVKA 6ABPA 2QTGA 5EE5B 1S8FA 4BLUA 3K32A 3L7DA 1Q16A 3O2NA 1L4HA 4KXVA 1I33A 3G8AA 4PYNA 1UBUS 3GUVA 5HF9A 3WLIA 2J6CA 1JDBC 3UPUA 3CR3C 1LSOA 5BN5B 1MRZA 4L7VA 1S1MA 2BE7A 3TMYA 3FNGA 4CDRA 3KSRA 4EMSA 3ESQA 3GLTA 3CINA 3UKJA 3DZDA 1F7VA 1K6MA 2X0FA 3GPLA 4RXUA 4TSRA 2WUEA 3P9PA 5IJ9B 4KNYA 5TF4A 2QXTA 4O02B 4EWLA 2CWDA 4BC0A 5AI4A 1U0SY 5ES3A 1P7CA 3O8RA 3R7NA 3AF4A 1VIAA 3EPLA 3CQ9A 1M0EA 2VCHA 2VJMB 1VYVA 1AV6A 1C8VB 2YMPA 1QWSA 3P97A 4IGKA 4P08A 3H9EO 4M7OA 3PD7A 4IDEA 4QYMA 3IVRA 3MTIA 3QOWA 2JLAA 4ND1A 3F6RA 5K99A 4CLOB 1HL7A 3AY0A 3FTDA 3HPQA 2HLHA 5BP7A 2C92A 1Z39A 3DWIA 2P8SA 3DMRA 5HG0A 1G0OA 3H42B 1A9ZA 1D0SA 1N0UA 4PLZA 4D82A 4C1NA 1SOWA 4ON9A 1RADA 5BXYA 5DMHA 4JP3A 1DMRA 3O0DA 5CEJA 2E87A 2VQ6A 1X1CA 2APJA 5HIKA 4DBZA 1JYSA 3PVSA 1RLMA 1M8KA 4RMIA 2IU4A 3C8ZA 5EE3A 4EKGA 2E1RA 5DWQA 1MPTA 1QE5A 1R8YA 4J6FA 2Y6UA 3AH8A 3E9EA 4HDAA 1VPEA 2AQKA 5E6UB 4RVDA 1IZ8A 1Q17A 1J33A 1TZ2A 2NZUG 2O23A 3GK3A 1JEYB 1Q7BA 2XDYA 4W9MC 1JVBA 2PBZA 1B6RA 2GYUA 4BLVA 1JAIA 3EX7C 1PSZA 3KLNA 4FCVA 3F3SA 3QLVA 3GRFA 4K8OA 4OGKA 4AJ1A 2PSDA 4GBED 2D0PB 1JJ7A 1KYZA 4YCBA 3OO1A 4AMBA 2G8LA 2HX1A 3DTVA 3JAKA 4PLYA 4C5AA 4DVJA 5JJBA 1N4DA 2OO7A 2Q6IA 2OFWA 4EPTA 3MAAC 2FZ4A 4LHSA 1O3YA 5JJLA 2XQJA 3QPWA 4JB8A 4R7TA 3V2GA 4WE3A 5MDHA 5E3IA 3GRAA 4ZO8A 2CZGA 1G4HA 2EDCA 3O0TA 3PZBA 2OYRA 3SEAA 2FN3A 1TZCA 1P1RA 3T9FA 4EAAA 4LWOA 4ER0A 2ZT5A 2A0WA 1QX3A 3GD7A 4EGSA 4URHA 4CMBA 5K03A 3NDBB 4KR6A 1I3NA 3DA8A 4Z0PA 3RSFA 4NZ9A 1E6WA 4W5OA 1RLTA 1VZ2A 1KMHB 1M8FA 2HSJA 1I4EB 2QZZA 1DIHA 2YCLA 3EE6A 2FR0A 1G3IA 3NCHA 4H7KA 4W5QA 3Q5GA 4QGSA 4IDAA 1AUVA 4Q00A 2A9JA 4DEVA 1ZUWA 5T5QA 1KQFA 3JATA 5B37A 421PA 5DLYA 1TO1E 1YR6A 2ZRPA 3DQPA 4EUEA 4ZGGA 4YP0A 4ZCTA 1N8TA 2XWBF 3S68A 4PNHA 1H5UA 2JVJA 1HC7A 1TLTA 2OFOA 2QUAA 3NTLA 4RY2A 2ISQA 2ZBFA 1KZ7B 1MGPA 3BEOA 2PKWA 4LGVA 3OQNA 4HUQB 1MP0A 1AO3A 1SQGA 3C6BA 2WVGA 5ALYA 1MTOA 1SWWA 3PC2A 4ME6A 4LN1A 3ZWYA 1VG9B 5L7TA 5J4LA 1S2OA 1TU0A 4HLUA 1XDGA 1PZGA 2FMHA 5GVRA 3QWAA 3UOWA 5FCDA 3ZWNA 4XYLA 1T3GA 1N1GA 3MGKA 3VAZA 4ZYLA 3G2KA 1PR5A 2DOKA 1U3VA 3LVFO 3ZK7A 2P9BA 1X8JA 2FQXA 2W6ID 4OJYA 5IKPA 4O59O 3FHJA 1X7YA 4X00A 3H86A 1ND6A 3QY9A 3ROEA 3TH5A 1FDOA 4OI1A 1DAHA 2OQVA 4KE7A 5EGNA 3V1TC 3PU6A 3FTCA 3QVVA 3AVPA 3NVMB 1KYYA 1PW5A 2FPPB 1YDFA 2WD7A 4DCMA 1R88A 3SBDA 4C7OB 4Q4AB 4LYAA 5AVZA 1BS1A 4Q3DA 1ZRNA 4PVCA 1B7GO 3S8EA 1I6LA 1VCMA 1Y3BE 1XXHE 2RGCA 5DRTA 4WKOA 3UWMA 3C3BA 4XUEA 1WDWB 1CZLA 2HU8A 2UZIR 3A3NA 3C1OA 4LXGA 1I7PA 3G23A 4QFCA 4QX6A 1EGQA 4YECA 5JQGA 3FLMA 4QDJA 4URYR 4B7ZA 5JI2E 2O8CB 5DJ5A 4F56A 4PZ0A 3IUJA 3OURA 3D6HA 3OZWA 2E4WA 2XT0A 3O4FA 1HNZB 1CQPA 4BN0A 1ZGZA 2PX6A 4B48A 3AHFA 1NA5A 2W43A 1NVAA 4TMXA 4UUAA 1N5MA 4W8HA 4YQFA 4ZIRA 4KQHA 4F4CA 3DDOA 4G36A 4YPFA 1M2NA 4E3ZA 3KAPA 2WJ3A 3NKLA 3V8EA 3X3HA 4BNIA 4QDOA 4QPCA 1F38A 2Z1NA 3BIJA 4KFUA 1PYDA 3HB1A 4NMXB 4B1FA 2P9JA 2WOJA 4YT8A 4DIOA 4NCAA 4UDYX 3CE9A 1UDBA 5EJIA 2QD2A 1JU9A 2GMWA 3DBRA 3OQBA 4M0UA 3W5HA 1Q0TA 5SZHB 2A9PA 1E0DA 4HDMB 1NL3A 4COKA 1IBSA 4EMBA 2PWAA 3QG1A 1LVHA 3N2YA 1JBQA 1P5FA 3ZXYA 1KEUA 4HS4A 2OL4A 1TUBB 1YR9A 4L8LA 1ZEJA 3FKSA 5GOZA 1P8JA 1Y6QA 2P9GA 4PLVA 4V38A 2YHIB 4JI7B 3AOEC 1SXQA 4WECA 1QVWA 2R79A 4MGKR 2QP4A 4EB3A 1E3TA 3HB0A 5IK2D 1NTRA 2IU3A 2Z2ZA 3CLUD 4MQ6A 4MZXA 3ANXA 1IUNA 1ZKDA 1JSZA 4WKPA 1ZC3A 1K0UA 4ZEWA 2IZ5A 1M6WA 1WF3A 3M1YA 1JR3A 4CMKA 4OHUA 4WK0B 3EDMA 3TTYA 5AUOB 4Z9BA 5CYFA 3G88A 1FX0B 1WJGA 3C3AA 2WSSD 2QTBA 3B20A 3OIWA 4W1PA 4INPA 4D9IA 2O3QA 4Z4QA 4U2EA 2JJYA 1M2FA 1T0PA 3S27A 4ZVNA 3K4PA 2IF2A 3A4NA 2VA9A 2X8JA 2XCSB 3TR0A 2DPXA 4C6HA 2HT1A 1YVPA 2O2XA 4B3TB 3CLRD 1CUGA 3BHMA 4XQ0A 5I4IA 3JALA 4I1IA 2CNLA 3L07A 3TLBA 4DJEC 1CR6A 4ZO7A 3KZKA 1N4AA 1KK1A 3D54D 1JA1A 1XHLA 4J03A 1NATA 2FF7A 1Y6JA 4N54A 4TGLA 3QIAA 3B6IA 4XEHA 4K28A 1YZGA 2QN2A 1QV6A 1KP3A 2HFJA 1PZNA 3DDZX 4Y2UA 3ZU5A 1YONA 4G0PA 2IH5A 2CSUA 4JVLA 1YC5A 4J7UA 4AC9A 4YJ3A 1ODIA 3BH6A 5HZKA 1FUUA 1DX9A 5DOZA 3AR4A 1PAUA 2G67A 2PKXA 5F5LA 3VR5A 3CNHA 5C31A 1ZNXA 3R3VA 2ET6A 5A7HA 3IILA 2BMFA 2G40A 4GC9A 5I7VA 3AEQB 1XEWY 4MS4B 3UJ6A 3QV1A 5LXTB 2VQDA 3TIIA 1OB2A 4BNXA 1TM7E 5HA5A 1CQZA 4KI7A 2D7DA 1E3IA 1U2ZA 1JDBB 4HQ0A 3I52A 4MYDA 3TR5A 3IPRA 1DJNA 3RAJA 1Z5PA 4D92A 2KM1A 2UVPB 3IEUA 5IAJA 4EKEA 3GT7A 5CTJA 4CBVA 4H31A 3OVMA 2IUFA 2IXGA 4F2WA 2LWIA 3TZ6A 3F6YA 1KYTA 4LSZA 2VP4A 3ZVKA 5A0VA 2C9CA 4HQLA 2W8ZA 2XB6A 4JEUA 3WK5A 4BKOA 5HRAA 1ZOIA 2HCFA 4PAOA 1TNDA 3WP1B 4QO8A 3HHPA 4OAOA 1M8PA 2AVNA 3RIEA 3O9ZA 1I1NA 4YRGA 1C1XB 2A9QA 1QZ3A 3IE0A 4JFRA 4MH0R 4AG5A 3T1HB 4I4TB 3DKPA 3UMJA 3IPAA 5C4IA 2R48A 1Q7GA 1LI7A 2W2QA 3QNMA 3HRHA 1R4NB 2F43B 3B9RA 1KIAA 4L9WA 3ZDYB 2IVFA 2YFHA 1O94D 3SPXA 3CJQA 3KZVA 3ZZ1A 1K88A 2XGGA 2OCBA 5JXJA 4EA8A 1MEOA 2O05A 1DG9A 3KOXA 4IM7A 3ICQB 4PZYA 1SPBS 2E9SA 2VS1A 1JFLA 1KJYA 1PVVA 1Z7EA 3U62A 1O97C 821PA 9ATCA 5JW6A 1Q2XA 3WGZA 1KBZA 4XD7A 1P18A 1JAHA 4NOJA 4X85A 4RIEA 1NTOA 3LC1O 2GKSA 3SIPA 4HB4A 2BFCA 2Z9DA 5I9TA 3ROKA 4TLBA 4A1FA 3FMFA 3OZRA 4RD4A 3HA5A 4RD3A 3UYLA 1U0NA 4MUKA 5JHGB 5I7EA 4D97A 1X7WB 2PGJA 4BP8A 4B74A 2Z09A 3D1LA 4BWGA 2ZSAA 4G0OA 1L7MA 1M5TA 4DDKA 3D9QX 4PFQA 5TC4A 1I32A 3HFSA 1VRCA 4UBLA 3VO9A 4YMWA 5F5XA 3RS4A 3DE4X 4V0NA 3EEOA 4RKFA 3ZK9A 4X8HA 3BXPA 2E18A 3F8SA 3FPKA 3U4HA 2RGEA 2VPPA 3IODA 4OU4A 4KNVA 4ESEA 4ARUA 2XE7A 1JDNA 1W5BA 3BK7A 2C07A 3PXXA 2OQIA 3UMSA 4MR9B 1ZM2A 3IDAA 1UOEA 4R8KA 2MCFA 3VSAA 1T2DA 2PJUA 2QR3A 1O8CA 4NONA 4B6OA 4Y9RA 1MPXA 3LX5A 3PJEA 2NG1A 3W5BA 1FCJA 4Q9IA 3UJ9A 3LF2A 3WFJA 3OCVA 1EK2A 2A1UB 1OI3A 4ENWA 4RYDA 5E4YA 1E1QA 1GUAA 3AIKA 3AJAA 4C0KA 4CL3A 4ZKDA 1N3YA 2AOUA 5AJXA 2G36A 4EG0A 3A05A 4BRSA 1G3UA 2P7HA 2R00C 2V7QA 3DDUA 3EK2A 1ZI8A 1T2EA 4DY6A 5KTNA 3VXKA 3UWPA 3AP3A 1JPJA 1H8HA 1WXWA 2PH1A 1JHXA 3KVRA 3OIVA 1QORA 3Q6MA 1J2EA 3SZRA 4EYKA 4D1YA 4NCKA 4UAVA 2BT4A 4QTUB 2DSTA 4RGBA 2BKAA 3U7EB 5JTUA 3COWA 4C4AA 3GJRA 3AVUA 1E89A 3F4LA 4DWOA 4IJQA 1E9FA 1K6IA 1U8XX 2BM0A 5TQ2A 2YJ3A 3RANA 1PJBA 3KEFA 2AR7A 3IOBA 4PPYA 5IG2A 1OLUB 4ESHA 4WCDA 1L5NA 1TX4B 3VOTA 4UDOA 2OBLA 4KAXA 1SXJB 4FR5A 5KWIA 4M1MA 1LBEA 1W29A 2WFZA 1TQDA 2ASEA 3P4YA 2O2SA 1U6JA 1KI6B 1VMAA 3PE3A 1C7FA 1DU4A 2JH8A 5AVSA 1Y8RB 3AY7A 3KKNA 3BMCB 3E7FA 4UTZA 1SBNE 1GITA 1FSFA 4FMCB 4AZ3A 5LP6F 2OC9A 3L8EA 4KODA 2E0IA 2X8LA 3IIIA 5DPMA 4DMKA 4EFNA 3B51X 3GJ7A 1VFPA 3KTAA 4NJMA 3GEHA 2Q49A 4KDRA 1KZYC 2J5BA 3SQNA 3DCJA 3MWYW 4RVFA 4QHTA 3LVRE 1Z7BA 3FCYA 4ZT4A 1JILA 4UE6A 3WTCA 2WABA 3DZJA 1T1IA 4BJ5A 4QJ5A 4DPMA 4YAUA 5ADWA 3G79A 4E5PA 2QW8A 4UBIA 1VL0A 5AK5A 1N57A 1NI4B 3LFHA 4Y2SA 4DKXA 4FNAA 5JALA 2BM8A 3A2MA 1QJCA 3PXUA 3IEXA 5J23A 3PUZA 3IESA 4CR8A 2J7PA 4ND2A 4WD3A 5LFAA 2J9FB 2Q1SA 2W42A 3WOHA 4D26A 1BXGA 3UHFA 3HYCA 1AUXA 3GFOA 2E5LB 1PBTA 2GJKA 2REXB 3IP9A 4G8JA 5EPOA 5B1IA 3RJ5A 2FY8A 5L3VA 2IHYA 3F97A 1NX6A 1T26A 1DBPA 1VQ1A 3P2OA 4UTXA 1F1JA 3R2JA 4XCXA 4X24A 5ALZA 5EHNA 1QIJA 4UQOA 1ZMXA 2BGNA 2B8TA 3QFHA 4TLDA 5LQRA 1T35A 3ADOA 2XDAA 5K8TA 1VE1A 3TNYA 1FOEB 3VVBA 1OH6A 4GOXA 4HZUB 4N5IX 4AG3A 2YWFA 4AX8A 2O4CA 1C9EA 4FLFA 3U3KA 3WAGA 2C88A 1G2OA 3KSUA 3L7CA 13PKA 2R6AA 4GM1A 2ZT8A 3BERA 4HTFB 4HX5A 4QJIA 1OPXA 1ZMRA 2MINA 4X8MA 2W2KA 1PHPA 2CVFA 1XMQB 1DCFA 4QU9A 5CJPA 3HKEA 1CB7A 2EJVA 3GY0A 4RZXA 5CVJA 5BVGB 1TM2A 1G5RA 5C1PA 3ZDQA 4ED9A 1CYEA 2JZNA 3OE5A 4DB4A 3QKIA 3I6YA 4RFLA 5CCXA 1OYYA 1DOAA 2GCOB 1W96A 1VA4A 1WZCA 3LP5A 1E4VA 3MUFA 2VF2A 4GPD1 5K3FB 4DCTA 4R16A 5LQMA 3S1AA 4A03A 1H3NA 2F7SA 3HUEA 4EGCB 2D1FA 2JGAA 1Q7EA 1WBDA 3D81A 4FJ2A 5ICFA 2VTEA 4NZOA 3EAFA 3TZQA 3ENWA 3H6GA 4RHCA 4KXLA 4GOLD 5B5SA 2IV2X 5C3UA 5JVDF 1AGRA 4ESOA 2ZUUA 3RT1A 4RLFA 4CKCA 2V6JA 4TYMA 4RMHA 4PZAA 2O19A 3O8NA 5EC8A 4RM3A 4S1NA 1G6OA 1WVIA 3Q3GE 1ZW1A 2X7HA 1EFUA 5AVXA 3W9YA 4BRZA 3PCXA 1NIJA 5I6DA 3AV0B 1PZXA 4JJ7A 4EENA 4F9EA 1A2QA 2P3SA 4GVLA 3K8YA 3JSXA 4DV2B 4X61A 1FMLA 3PXCX 2VDWB 3ZWAA 1TW3A 2WP8J 4XVQA 2D6FA 4BCCA 1BH2A 5HQ3B 3SHVA 2VNSA 4BUCA 4FB5A 2CGEA 2HEIA 3O2JA 4LJYA 3ZUGA 1NJSA 3F5MA 4NU5A 4V0OA 3HB4X 3TWOA 4O4LB 1JL3A 2RAPA 5REQA 1FDWA 3M33A 5KMGA 1AUOA 1CKEA 1T8UA 4FN4A 3HYTA 2YS7A 3GVXA 1WW2A 5TX7A 1QUEA 3PL1A 4RHYA 4B6FA 3IVMA 3ZHYA 4LRWA 2IUYA 2QXUA 2HDHA 5CK5A 4RD0A 3KUKA 4CQNA 3L0DA 3A6FA 5M29A 2Z9CA 3VU9B 1R8SA 1YCHA 1BHQ1 5E1BA 1XCGB 2GRJA 3RVQA 3WFZA 4QOFA 4ZKEA 4C04A 2WUWE 3KZ1E 2PYZA 4JVNA 3E4DA 4YHHB 1FC0A 3KPYA 3JRXA 1H2EA 4EG1A 3AB8A 5KVCA 4ZI7A 3OZFA 1MR3F 2ZTUA 1KR5A 4L95C 4R0NA 2QR2A 3PQ8A 2NN3C 1NLFA 2VWHA 3MA0A 3NUZA 1XK6A 1O5IA 4AKSA 4LYDA 3VPFA 3E2IA 5J63A 2WAXA 1UMBB 3DEAA 1SUSA 3CKMA 4FYPA 2V7BA 1RRPA 4G4GA 4JR2A 4YCCA 1UPXA 2J08A 4EDFA 1IBCA 2OD2A 1SQSA 3FSRA 1SRQA 4P32A 1CY0A 5B1SA 3DL4A 3UMMA 2VI5A 3OQVA 5C8YF 1U4SA 3KQHA 3PFKA 3H4IA 1Z47A 4IFIA 4HBZA 3FE2A 5JLAA 5CFMA 2FEOA 1QNFA 2PWYA 3I72A 4WOBA 4JBGA 2QAJA 2O6LA 1V9SA 3AETA 3KSAC 2JAOA 5B30A 4U7DA 5HPYB 3PRYA 1KC1A 4QKQA 1CZRA 1AVTA 3LC0A 1JHYA 2X86A 3RSSA 4Q18A 4CU2A 3JYQA 2ZVPX 4RGQA 4S1OA 1QP0A 1DAPA 4K6HA 1XQ6A 3IEMA 4KSCA 1J70A 3C3EA 5FWYB 3A1NA 1LZKA 1WCXA 2G0AA 3HC7A 2D59A 4ALKA 4BCDA 5KWJA 2R1VA 2ZRGA 4EELA 4RUKA 1ST2A 1P72A 2R1TB 2W8BB 4MKGA 1HEYA 4RIIA 3TW6A 4JQYA 3AUJB 1FQJA 3RT7A 4RV4A 2HK8A 1F60A 4LY9A 4BNMA 2OCGA 1HT3A 2HIGA 4O3MA 1J0BA 3ECCA 1N7IA 3K1AA 3RYCA 4P83A 3FVWA 3D3QA 1SOUA 5KJEA 3GCWA 3I30X 3REFA 1KSJA 2WU4A 1BXRB 1E6MA 1JMVA 1OW3B 2BGKA 3GJSA 3QJGA 2CDNA 1Y4ZA 4MR7B 2M6LA 1CUIA 1OE0A 3IBSA 1JFFA 3PE4A 1DSSG 4PWZA 2PT7A 4FE7A 1HDEA 2CHEA 3H5NA 1CR2A 5LZ7A 3RTBA 3BFJA 2J1LA 1SOVA 2FPWA 3MQ4A 3PSAA 1ISRA 3TOXA 4HEA6 5DASA 4KGXA 3SFTA 4FOPA 4G5YA 2LE0A 4QFBA 3PP8A 3ZN2A 1IXYA 4BMCA 1MZPA 3L41A 3MSXA 3GJQA 3K16A 2O8CA 4DA4A 3QEMB 4BV8A 1HA3A 2C94A 3U4QB 4EGJA 3ZE2B 2IXDA 2IHKA 3KYIB 1G8SA 1EAMA 2YIJA 3HVJA 1IXKA 1WX1A 4LXYA 4UNSA 4JI5B 2QEQA 3RFVA 1ZM4A 3ESZA 3GPIA 2OCDA 1WOYA 3EA5A 4I5EA 2B4YA 1OJ7A 1DXHA 2E4ZA 5MN5A 3QBEA 4W6ZA 3CPEA 1OGJA 3ILHA 1B8PA 2OENG 3PQ6A 3KDSE 2J4DA 3Q9SA 2WIDA 2RHLA 4RHEA 3HUUA 1UCFA 1JNYA 2FSUA 2WTBA 1G2QA 4ZRNA 1DAKA 4D9GA 2AEJA 4MO9A 3FOFC 1YSCA 3GD5A 4UOEA 1QRUA 4S2UA 2Y0EA 1OU0A 3ZQJA 1PJLA 4CEJB 2RHCA 4R9NA 2GDZA 1T5LA 1YQXA 1ZCZA 1UPUA 4V02A 1Z33A 4JLDA 1QPZA 1DKUA 3BD9A 3CISA 1ULSA 3S2UA 2CJWB 2JD2A 2YJGA 1GZ4A 1ZICA 2NVOA 4FQ8A 4OP2A 5CM9C 5AICA 4Q1CA 1EGVB 4CEIB 4U7FA 4L75A 1X19A 2XQIA 4KR0A 3UC5A 3SC3A 2O7NA 4K9LA 4JC4A 2VHWA 3LQ1A 3QVGA 2XUAA 3T9DA 4M1EA 2GEFA 2EV9A 1E1RA 1Q22A 3AR5A 3C6MA 4HDRA 5CBKA 3PL5A 1U1CA 4G26A 4C0LA 4QT4A 1LRKA 3DF9A 1TK3A 5FUVA 3DB1A 3ND7A 1N8SA 1RLUA 1XLUA 4IINA 1PW7A 2PVSA 1O2DA 4IRMA 4A5OA 2ONKA 4FTWA 1JIJA 3I04A 1IUOA 1DRKA 2DETA 4FHZA 4BGUA 3EZ2A 1WR8A 3BHJA 1EFVA 2B4RO 3T1VA 1UXHA 4ARBA 2ZETA 3AWDA 1Y42X 3ELWA 3PFFA 1ZDMA 2CWWA 3DTVD 3F5FA 3PPWA 4JJKA 1E1LA 2DF8A 4D41A 1V5FA 5LZ2A 3IP7A 2W2XA 3AHHA 1O87A 3KWJA 1KQGA 3J80A 1AKEA 1Y7HA 2JLBA 2IDMA 4OB8A 1PR2A 3EPJA 4G56A 4X97A 1FDSA 3BTUA 1CLEA 3ICCA 2CT8A 4A2CA 1J1IA 1F8XA 4DLLA 1IXZA 2MOKA 3M6UA 3NBKA 4DWJA 4V1CA 1DKNA 4DV3B 3ERCA 4U4AA 4IFBA 3T3MB 5EMLA 3I6ZA 3N7AA 1DL5A 1M10A 5JRJA 2C7QA 4R2IA 4JJAA 4MQFB 4RFVA 4AK9A 3WB0A 1R5NA 2IYWA 3MAGA 4QGGA 3TJMA 5AD1A 3IT0A 1Q19A 1FMJA 1RTTA 1ZBQA 2GGSA 4PR3A 2A4KA 3LX4A 5HUJA 3M82A 3ZU4A 5HZMA 1VOTA 4FHDA 2NU8B 2GJSA 1XRPA 1Z4QA 3W6ZA 3GA7A 1XNGA 2B3TA 3GELA 5JCXA 3EFOA 1XELA 1V7CA 5ED4A 3FN4A 1U3UA 2RHRA 2R9VA 3FOAA 1RFGE 4KVZA 4MJ7A 3RAEC 1VHLA 4ZCPA 1J9ZA 2BM1A 2A67A 4U7HA 5CW2A 4N5LA 4HH4A 3BDAA 1RRVA 2BBTA 2ZGVA 3W78A 4BZWA 3PITA 4EATA 2AC2A 4HN2A 2RIPA 4YS6A 4N8SA 1YCFA 4F6RB 1E5LA 3GIDA 3MJEA 3TZLA 3ORFA 2RBKA 3WLQA 3HM2A 1YJ5A 3CWZA 3NGLA 1RT9A 3KOYA 3AEXA 4Q4HB 1KWKA 3N3AC 4BZPA 1I2DA 4KGDA 1L5HA 4RBNA 4UBKA 2Y92A 3KQUA 3C6YA 3O1LA 2G9UA 3MCZA 5BV2P 1M76A 1D9XA 2OUIA 1Z0FA 4CMHA 4YROA 1JBKA 3SJBA 3LGAA 5DHQA 1O0BA 5AM0A 2CEAA 3TLEA 1GDDA 3IKLA 1B6GA 1GG8A 4C0WA 3I4FA 4CM7A 2GHRA 4MPRA 4BKMA 3WLLA 2GZRA 4EHKA 4NCJA 4IXDA 2QM7A 1FJHA 5E95A 3EC7A 1NPDA 1KEVA 3UAGA 1V1MA 1P1BA 3U0BA 1Z5NA 2JIDA 1L7XA 1BNCA 3UFBA 1T9GR 1UBCA 1G21A 2JLQA 2XRFA 3FFWA 3MG9A 2CNOA 3I8SA 2JA1A 1QP7A 2ZDQA 3HN2A 3IMGA 1THGA 1GAEO 4F4JA 3EAGA 5CNKA 2ZR9A 4UUQA 1SKBA 4NCBA 2X15A 1NW8A 2OZKA 3HV2A 1NR7A 2AS0A 3ZHZA 1CHNA 5CDUA 3E22A 2OQ2A 3SR3A 4P7BA 4IIVA 3D3NA 2HWXA 3WRYA 5HQTA 1YIAA 1O96A 5HK9A 3QVLA 1RC0A 3DZBA 3WSTA 4B2PA 3AEUA 4EZBA 1AJEA 3GVPA 5K3OA 3QFSA 3L6RA 4FMBB 4N5MA 1KY4A