3HVHA

Rat catechol o-methyltransferase in complex with a catechol-type, n6-methyladenine-containing bisubstrate inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
213
structure length
213
Chain Sequence
b'DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Molecular recognition at the active site of catechol-o-methyltransferase: energetically favorable replacement of a water molecule imported by a bisubstrate inhibitor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 81
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hvhA00
2VS1A 3VSEA 2BM9A 3P9IA 3HNRA 2DULA 2P3OA 4NECA 4LWOA 2PLWA 3KQWA 3GU3A 1QZZA 2UYCA 3DXXA 2JJQA 3PFGA 5EGSA 4GOND 1JSZA 3LCVB 3P8ZA 3LCUA 4DCGA 4R8RA 5LQNA 3UJ6A 2AS0A 3FUTA 1Y8CA 3A4TA 1G6Q1 5KQSA 2XVAA 2PX2A 2AN4A 3HCBA 1JG1A 3FPFA 1SQGA 3GNLA 3BKWA 4IV0A 5C0OE 4YV0A 1JQEA 1YUBA 4CKCA 3KQQA 5BW4A 1I9GA 2YX1A 3CJTA 4CKBA 2ZTHA 3GCZA 2I7CA 4ER7A 5K0LA 3PTAA 5HIJA 5HZMA 3NWBA 4EVIA 2G71A 1TW2A 1DUSA 3MTEA 2O07A 5E9QA 4PYKA 4R8SA 4F84A 2R6ZA 3KPVA 3PX3A 4GOMD 4IV8A 1X1CA 1D2CA 3C6MA 5F2KA 2ZCJA 2YTZA 3EPPA 4GBED 5K01A 1HNNA 3FTDA 3CKKA 1DCTA 2I62A 3OPNA 3T7SA 2NXNA 3EVAA 4XUCA 1UIRA 2UYQA 5E8RA 1M0EA 4ATNA 4OQEA 3B89A 3CJRA 3EVDA 4WVLA 3CCFA 5DXAA 3UA4A 1ZG3A 1JR4A 5K0BA 4RTOA 1KPGA 4PYOA 2ZZMA 3RIEA 4P7GA 1BOOA 1FBNA 3MQ2A 2PWPA 3GWZA 5LQKA 2BZGA 5FWDA 1N7IA 4U7PB 3UJ9A 3UBTA 3G2MA 2PV0A 5EVJA 3M6VA 3V8VA 5FHQA 3P9KA 2AOUB 5EMKA 5T67A 1XDSA 3BWYA 5FCDA 2NXEA 2ZLBA 1EG2A 3BZBA 3G88A 2DPMA 2FK8A 2P3LA 1SUIA 2K4MA 5CM2Z 3TRKA 1NBHA 3WSTA 1X1DA 1ZKDA 2OY0A 2PXXA 3ORHA 3UJDA 1Z3CA 4RTQA 4V0RA 1O9GA 2PJDA 2OO3A 3JWHA 2AOUA 1MJFA 4G56A 3EVEA 3RODA 1D2HA 2LD4A 3PT9A 10MHA 3E8SA 1UFKA 1G55A 3LL7A 1KPHA 5DX8A 4BLUA 3I9FA 5F2OA 1R74A 2YUIA 4EMSA 1RI5A 2ZBRA 3OCJA 3TR6A 1R00A 4PIPA 1XVAA 3KPWA 3GRUA 2Y1XA 2V74B 2B9EA 4CTJA 5E9WA 2ADMA 4FSXA 4JXJA 3C3YA 3G89A 2QE6A 2G72A 4CWAA 1G38A 4GC5A 4YMGA 5CCBA 1NW3A 3A25A 3F4KA 3KR2A 5ICEA 1YF3A 4HGYA 2HWKA 4R6XA 2IPXA 5FADA 5GWXA 3EVCA 2PX4A 2ZW9A 3THRA 5DXJA 3TPZA 4QDJA 3NVMB 2O06A 3ELYA 3GRRA 5T64A 3PLAE 3SM3A 2B78A 4YUYA 3FYDA 1MHTA 2KW5A 5DLYA 1O9HA 3KQYA 5FA5A 5IKMA 4OBXA 1WXWA 3G2PA 3BWCA 3M6XA 3G8AA 3SGLA 4HSGA 2NP7A 3EGVA 2OB2A 4AUKA 1JG4A 2NYUA 4PYQA 4BY9E 2OB1A 4KW7A 4MWZA 4BLWA 3GDHA 5D1HA 5KQRA 2ZSUA 2Z6QA 4RVFA 3HCCA 3G5LA 3FPEA 3M6WA 3FRHA 3P97A 1BHJA 3DOUA 3EVBA 3ELDA 1AQJA 3HCEA 4YUVA 5GIPE 5FULA 5CVVA 1X19A 1KR5A 3HVIA 3I64A 3HA5A 3MCTA 1NW8A 4GQBA 3ANXA 4FT4A 4LWPA 5CVUA 4DZRA 2IFTA 3LX6A 5EKUA 3OFKA 2CKDA 4OA8A 2ORED 1ORIA 4CKEA 3LDFA 3KQOA 4AZWA 3HCDA 4QQKA 4XCXA 4QVKA 4DCMA 4H0NA 2JH9A 5CCXA 1XJ5A 3G7UA 3DH0A 1L3IA 5DTQA 3DLCA 5EHGA 4PGGA 5ICFA 4MTLA 1DL5A 4ZTBA 2AR0A 2PT9A 3FUXA 4RV9A 3ELUA 5FTWA 1I1NA 2JG3A 3HM2A 3EVGA 1SQFA 1NV8A 5DM0A 1NBIA 4PWYA 3GXOA 1P1CA 5K8VA 3BT7A 1L9KA 2AVNA 4QQNA 3QOXA 3E23A 2HMYB 4MQ4A 4X1OA 3OU7A 3AXTA 4Y2HA 3NMUF 4DM3A 3KQSA 3VC2A 1XTPA 1KHHA 4BLVA 4E70A 4ER0A 3R3HA 1P91A 4RVHA 3HA3A 3TFWA 5GM1A 3TKAA 2ZIFA 4R6WA 5JUWA 2N47A 3DMFA 5F2NA 2YR0A 4RVGA 3RW9A 3MCZA 4ISCA 3GRVA 1EJ6A 5C1IA 1RJFA 3B3FA 3HA7A 1SUSA 3I58A 4FGZA 3K6RA 2ZWVA 2IGTA 5LQCA 3R24A 3O31A 1XCJA 1WZNA 4U7TB 1PRYA 4ER5A 1G60A 4V0QA 3UJ8A 1T43A 5KS2A 2BH2A 3D2LA 1QANA 3FPGA 2IH4A 1D2GA 4KDRA 4GEKA 5KVAA 2FRXA 3UJAA 4C05A 3A27A 4BP1A 1FP1D 3KU1A 3OFJA 1KP9A 3BGDA 4B17A 4FT2A 3KQTA 2WK1A 5EQJB 4F86A 1X1AA 1KYZA 4RX1A 2VDVE 4DF3A 4YUWA 3B3JA 5BXYA 2PXCA 3EGEA 3KQPA 4PYLA 1B42A 3LECA 2OYRA 2BR4A 4OBWA 1IM8A 1JSXA 3A7DA 4QPNA 5LQRA 3SR4A 2IDJA 2PKWA 4X63A 4MIKA 1JG3A 5EPEA 1V39A 5DWQA 1KPIA 4LECA 1TW3A 2O05A 3LKZA 4OQDA 5CIYA 4KIGA 1INLA 2G8NA 2AOWA 3PVCA 3CVOA 3P9NA 3ER9A 3GRYA 4DMGA 2PXAA 3AWIA 1FPQA 5C9ZA 2V7EA 1VP9A 1XCLA 4E33A 5FUBA 2WA2A 2P3QA 3ER8A 2ZWAA 5K0CA 5M5BA 2O0LA 5DX1A 3EEYA 2IDKA 2PX5A 3HP7A 3OZSA 4KWCA 3TOSA 2B3TA 2CMHA 3NW9A 2P8JA 4E31A 4PNEA 4A6DA 5GINE 1Q0TA 4AZSA 1WY7A 3I5UA 3JWJA 3MHTA 1AQIA 1WS6A 3M4XA 3NDIA 3P2IA 5CD1A 2ZZNA 5ERGB 3VC1A 2R3SA 4O29A 2C7RA 3ID6C 5CVJA 2NP6A 5HIKA 3THSA 1RI3A 2Z6UA 2C7OA 3E7PA 1ZGAA 1ZQ9A 4ER3A 4YMHA 2CL5A 3HCFA 5FWAA 1KIAA 2JHAA 3REOA 4POOA 3UA3A 1AV6A 1QAOA 2XYQA 3M33A 4DA4A 4DQ0A 1KXZA 2P1DA 2PGXA 3FUWA 3S68A 2P7IA 2PSSA 5FQOA 3HEMA 2FK7A 3FPHA 4PCLA 2PBFA 3CBGA 4XUDA 1VPTA 2FCAA 3AXSA 3L8DA 4OX9Y 3A26A 3B5IA 3MAGA 1X1BA 3C0KA 3UJBA 5LSAA 2XYRA 3KPUA 3IV6A 5B1SA 1VP3A 3T0IA 4EKGA 5E1OA 1XXLA 2B2CA 5E1BA 4DKJA 3Q87B 1M6EX 5EMLA 2GA9A 5EZQA 3P2EA 3P2KA 1NT2A 4YV2A 3KR1A 4PYIA 1TPYA 3NVKI 1RJDA 1L3BA 2GLUA 3SMQA 4KDCA 5DM2A 3C6KA 1ZGJA 2AN3A 8MHTA 4E2ZA 4GOLD 4RSRA 3AJDA 4PYNA 5JR3A 4LG1A 5LQJA 2IBSA 3IYLW 2OXTA 5GIOE 2OZVA 3TM4A 3A7EA 1BC5A 4P58A 2YXDA 5HEKA 2GH1A 3R6TA 2OPBA 3EGIA 4X41A 1SG9A 3K0BA 5EMMA 3HTXA 2C7QA 2YXEA 2ERCA 3DXYA 2O57A 2EJTA 2ZULA 3KQVA 1JTEA 3FUUA 4QDKA 3FRIA 5FHRA 5LQUA 2EG5A 9MHTA 2ONZA 2Y1WA 1RI2A 2ZFUA 1RI1A 1FJXA 1I4WA 2G1PA 3GIWA 2ESRA 2XYVA 2PY6A 3C3PA 1XDUA 5EHIA 1R8YA 1U2ZA 2QRVB 3FZGA 4RYLA 4AX8A 4RTRA 3DLIA 1YZ3A 3LSTA 4OA5A 5GP1A 3U81A 1EIZA 3KQMA 3R9XB 2HV9A 3CC8A 3H2BA 3SVZA 4A6EA 4C06A 3HVKA 2HTEA 2A14A 3BUSA 4PINA 3KR0A 1JQDA 4QTTB 5DM4A 2ZBPA 3KKZA 3NJRA 3SSNA 1QYRA 3O4FA 4MHTA 2FYTA 2PX8A 4KRGA 5K03A 4RTJA 2CMGA 4EKIA 4M37A 5EKXA 2P35A 5IH3A 3FTFA 1VIDA 5LR6A 2EFJA 3P9CA 2C7PA 1JG2A 4C03A 1YFJA 1F38A 2VP3A 2HNKA 5CVEA 5G02A 5GOZA 2YQZA 3SXJA 4RTLA 4HGZA 2BM8A 2ZIEA 2Z6AA 2IIPA 3ERCA 5EIWA 3PB3A 2ZZKA 3LCCA 7MHTA 2AZTA 4PYMA 3BXOA 4XUEA 1RI4A 1JQ3A 2BR3A 3VYWA 4Z2YA 3HCAA 5KYGA 2GPYA 3EVZA 3LBYA 2I6GA 4YV1A 3HVHA 3BGVA 5E2AA 5DT2A 5E2BA 5CUQA 5K05A 4RWZA 3EEOA 3KPYA 2YVLA 1IXKA 4K6MA 4KVZA 4WXHA 4EK9A 1SKMA 5FA8A 2GS9A 3FTCA 5E9JA 5HIMA 2XVMA 4Y30A 3SSOA 3B3GA 1NV9A 3GJYA 1YZHA 4AZTA 1WG8A 4C07A 3TKYA 2FHPA 1P39A 4QVGA 4UOEA 5DSTA 3ELWA 2AOXA 4PCAA 3TLJA 4C08A 4X60A 3JWIA 2IP2A 3OU6A 5DTMA 5EG5A 5K0FA 2AVDA 5EEHA 3UJCA 2P41A 3DP7A 1PJZA 4HRAA 2QY6A 1ZHFA 1NE2A 3EVFA 4P7KA 5EEGA 2UYOA 1NW7A 5K09A 2WA1A 2NXCA 3PS9A 4RTSA 3G2QA 1N7JA 1VLMA 3I53A 2JH8A 1L1EA 2H1RA 4M36A 3T7TA 4HG2A 5K0EA 1VQ1A 4P7JA 4GF5A 5EIFA 2H11A 2ONYA 3IEIA 3BKXA 3DMHA 1KYWA 2ZIGA 4PGHA 1OR8A 2G70A 1R18A 3EMDA 3LHDA 4C04A 1ORHA 4R05A 1RJGA 5E1DA 3MB5A 1Q0SA 2B25A 3FYCA 1G8SA 3BWMA 3HVJA 3MGGA 4HC4A 3IHTA 1F3LA 1JTFA 3UJ7A 2HR1A 4KIFA 4QPPA 4FSDA 3G8BA 4FS8A 1NW6A 3X0DA 4PONA 4RVDA 5K0NA 1G8AA 3E05A 4P7FA 5EOVA 2ZVJA 4GOOD 5GM2A 5U4XA 5BW5A 4QTUB 1IY9A 1EAMA 5H02A 3MTIA 1VE3A 5DTRA 2P7HA 3T7RA 5EMJA 5ICGA 1NW5A 3NWEA 5EZSA 4M38A 4RTPA 2IBTA 5LQAA 4CTKA 5D1NA 3GRZA 3ME5A 1RJEA 4EQZA 2Q41A 1P1BA 2CWWA 2QM3A 5DPMA 1QAQA 2PWYA 1N2XA 1R6AA 2OKCA 3OZTA 1L3CA 3O7WA 2ZBQA 5T6BA 5K0GA 2UZ4A 4E2XA 4PIMA 1EJ0A 5HILA 2I9KA 2EJUA 5MHTA 4FZVA 4GC9A 1QAMA 3GO4A 3KPJA 4F85A 3FTEA 2VDWA 3QV2A 1HMYA 2JHCA 2VDUE 3OU2A 3FUVA 2F8LA 4FP9A 5HFJA 4L7VA 3SSMA 3SX0A 3V97A 4AZVA 1EQAA 5K0JA 1UWVA 3B7PA 4E2WA 5EC8A 5HOQA 2P40A 3G2OA 5DRTA 2PT6A 3LPMA 5DRYA 5P8WA 4E30A 4PYJA 2UYHA 1H1DA 2VZ9A 3LDGA 3MERA 4YUZA 2AN5A 3PFHA 2IH2A 4IWNA 4RTMA 2IH5A 3R0QA 1VBFA 3DR5A 5E8JA 3TQSA 3OE4A 3TM5A 3UZUA 4CXMA 3P71T 2EX4A 3DXZA 3PX2A 3DMGA 4E32A 3M6UA 5DSXA 2QYOA 2AOTB 2H00A 4X61A 5DM1A 2NNWB 4BP3A 4M7RA 1FP2A 4YUXA 3GGDA 3CGGA 1YFLA 3UFBA 2BR5A 3LDUA 3TMAA 2AOTA 4E2YA 2GB4A 2PVCA 3UWPA 3DULA 1BKYA 2GAFA 3JWGA 2QRVA 3LKDA 1M6YA 4ER6A 4FR0A 4IKPA 3Q7EA 1YB2A 2FPOA 3OZRA 3NTVA 3CJQA 5ICCA 3LBFA 1SVUA 2XBMA 3LGAA 2YXLA 2OBFA 2JHPA 5FQNA 5BP7A 3DUWA 5E1MA 1VL5A 1R8XA 4HTFB 3FPJA 5DX0A 2AOVA 3BWBA 3QOWA 4RTNA 3AY0A 2NXJA 1WXXA 4GUAA 5HIIA 3OE5A 3BGIA 2E5WA 1XDZA 5CVDA 3DTNA 1AF7A 1O54A 1NKVA 4HH4A 4HTFA 4RTKA 3G5TA 4C4AA 3KR9A 3NDJA 3EMBA 3M70A 3KHKA
chains in the Genus database with same CATH superfamily
1ZD3A 4XFKA 2VS1A 3V1UA 3JV7A 4O2RA 2JFYA 1YIAA 2O3SA 2G9RA 2X58A 2MHCA 2Q1TA 2QRLA 3AY7A 3Q41A 4MW5A 4RS3A 3PXAA 3TZCA 3ZWCA 2ATXA 4E5NA 2IS2A 3EQ6A 3Q7SA 1M1YB 1JSZA 1GXSA 3LW7A 3GBSA 2PLRA 3GELA 3GNQA 3LCVB 4QX6A 4ALKA 3EIXA 2D7CA 2X0KA 1Y8CA 2P77A 3B12A 1Z4KA 2PX2A 3B7GA 4R83A 4JL6A 1H3NA 3FGNA 4XQCA 3HUDA 1QUFA 1CJKC 4LDAA 5DN6A 1TMKA 1D07A 1FRVA 2ZBEA 3B52X 3VR2D 4M1SA 4HATA 1O95D 2GEBA 3QF7A 1NUUA 5T4HA 3QWHA 4RL6A 5ILOA 1LRJA 2GBLC 2WJYA 2IBMA 1GT91 5ALNA 3U80A 1T6XA 3EG9B 5K3CA 4HDKB 4MCAA 4GOMD 4EKYA 5KDOA 5F51A 3DWEX 3A1WA 3ZY5A 2DWPA 2V4UA 1FS6A 3HN2A 4D42A 2W2OA 4O2AF 5LD2C 1MB4A 4RMGA 4Q9HA 5TQ2A 1FTSA 4AY2A 3G02A 1SUPA 5BVHB 3OPNA 1ZD8A 3T9CA 5FTNA 1ZNQO 4JDPA 4OKNA 1AK9A 3ZNPA 2FPXA 3BBPA 3PJEA 3ZVRA 4N3CA 1BZYA 2VZ0A 2DT8A 2FQXA 3NC4A 4H7JA 4YAKA 1VJ0A 3L18A 3CLUC 1W2WB 4RKYA 3RSZA 2YY5A 3QTLA 1L4YA 1XZ8A 2ECPA 4NY1A 1FXUA 1JEQB 1JHAA 4TT3A 3JPYA 1R0CA 2XUAA 3DC2A 1NY5A 1ZK0A 2AF3C 2AOUB 2V98A 2H52A 3VZCA 1Z34A 3IR7A 3PNPA 3EGXA 5EWLA 5FBVB 1MIOA 2VLBA 2OEPA 3DHEA 4ENWA 3UJDA 4ZODA 1GPNA 2X8AA 2C9CA 2OO3A 4MINA 4P93A 4ZOLA 2VXOA 4QYWA 4A03A 2ZRGA 3ITKA 4ZT4A 1PIWA 2IYAA 1KQPA 3JZMA 5KX5F 3QW4B 3KLBA 1PFUA 1N3YA 4IOKA 4NNOA 4BO4A 1LBQA 1GTJ1 3DPIA 1X14A 1Y1SA 2X14A 4Z0PA 3DNMA 5IAEA 2YWRA 3UHOA 3U61B 3HCOA 4IMRA 1RYYA 1H5NA 4OGKA 4H15A 1YT5A 1H0SA 4UTPA 4U9UA 4JR2A 4XIGS 1T3LA 4H2DA 1FFDA 4JKYA 4HLDA 5A03A 1WF3A 2XUQA 4X90A 2QDXA 1GGKA 5JAQA 4B3RB 1J8MF 1AUXA 2HQSA 1FY2A 5FADA 4LJ6A 6PFKA 1ZVJA 1NAIA 2OCAA 3CWZA 1E98A 1E2PA 3HZHA 4G89A 1ADCA 2AQHA 4PCVA 3SQWA 1JTVA 2G76A 3BD9A 5KQPA 2QTTA 2MDTA 2GNAA 1OAOA 3LJKA 2JAQA 1P9OA 4OD0A 1MVNA 2A9JA 5EIHA 4DV0B 5DLYA 3BMOB 2DETA 1NA5A 3NAMA 1EXDA 5FA6A 1FSGA 3BWCA 2NV6A 4CN8A 1ZL0A 3JATB 1TQ2A 3H0KA 1TJ4A 3KYDA 3EGVA 1ZP6A 3MJVA 3I2IA 3MBKA 4AY5A 1ZCAA 1WKCA 2PVPA 1SUFA 5HM6A 5HG0A 1C1XB 3U4QB 2BLLA 1U7TA 1Z8NA 4NZYA 4BNWA 1K66A 2D5IA 4B6GA 4EHLA 1V6AA 3I64A 3PL1A 4IO0A 5EJEA 3BE4A 5IZCA 3AVVA 3H3XA 1H2XA 4O1IA 5ESRA 3LF2A 4HKTA 2XA2A 3PCTA 2J6IA 2I2XB 2BZ0A 3D6VA 4WKNA 4ZD6A 3TR5A 4DG8A 4EAAA 3AEKA 2JLZA 2YNMC 3AFIA 3JARA 2P2SA 3TLMA 1A1SA 3DKVA 1QP0A 4EPYA 2Q99A 3DZ8A 1RVV1 2H9IA 1OW3B 2GCPA 1Y7HA 1V26A 5JW6A 4JD5A 1OX4A 3AIIA 2DFPA 4L2IB 4R9NA 4A8JA 5HKKA 3SJUA 1W34A 2FMTA 1XQYA 1CDDA 4J9VA 3KS9A 2WWTA 1VHLA 4GX1A 4ND5A 3MN1A 4K2AA 4BOYA 4JB3A 1YR1A 2GK4A 3HKEA 4YBZA 4HQOA 5GY7A 4BP8A 1DGQA 5L3QA 5BSTA 3BMCA 1D03A 2G9VA 4BNMA 2PGOA 4IJQA 1WDLA 1VM6A 4OYLA 3TFWA 4CLEA 3DLBA 2DQYA 1WJGA 1PJRA 4HXYA 1Y8RB 4F9TA 2JIMA 2HA5A 1KK3A 4ZVUA 3VR6H 3QFRA 2VL7A 1TLLA 1KOJA 4P5EA 4WBXC 1KFBB 2PLNA 2Q27A 3WK7A 3KSDO 4D44A 1DIRA 3MMXA 2ETVA 3NEAA 1B1AA 1V5WA 1ZGCA 4DANA 1W85B 1HUQA 1DEAA 4UAUA 4MLPA 1TVCA 2FX5A 5E0KB 3RROA 1W73A 3GF4A 4FQ8A 1JG6A 1GQRA 1QANA 1UKVY 2Q4DA 2BTOA 3Q8WA 2I8LA 5FTLA 1GM5A 3BSYA 4ECEA 2A5JA 5ALWA 1ZRHA 5E6RB 4AKEA 3VJRA 1FDIA 5EL0A 4AN0A 2FVXA 2D62A 5KWSA 1Q22A 1W46A 4A73A 1OE0A 3DAOA 3ZH2A 1Z6YA 4TKVA 2C29D 3T99A 1N5RA 2BEKA 1VJGA 3AGQA 3QF4A 4YBRA 2PKQP 5F3WB 3FX2A 4RIGA 3K1AB 3RD5A 2BBOA 2EGGA 5AJZA 2ZBFA 1YR2A 3EISA 3TTTA 4QPNA 1VPWA 1K75A 1BD4A 3LQRA 2XTAA 1R12A 4LKOA 3LA6A 3J81k 1TM7E 1IB6A 2QF7A 4DZZA 1NMSA 2GHRA 1MLDA 3GEIA 5DM70 3WL6A 1I94B 1GD1O 1LWNA 4XYEA 1IHXA 3VR6D 2JKYA 3DCNA 2WD7B 2AEJA 1JA9A 2P65A 4LBYA 1NIPA 2V7PA 3ZQ6A 4BV3A 3QE9Y 2SECE 3AETA 1A9XA 1W96A 1QKIA 3MZ0A 2OKGA 3UMRA 2KBEA 3ZXYA 3PEYA 3HP7A 3NOVA 1QU3A 1HDEA 1KY4A 4ZCTA 4YDQA 3QLTA 1CUFA 1R5NA 3R41A 2B8NA 2PEYA 4ACAA 3CONA 3GHHA 4DA9A 3HBLA 1C3JA 2C7GA 3TW0A 4XLLA 4D92A 5KUTA 3BFJA 1ADBA 4QUDA 3OIGA 1FDWA 1W5EA 5CVJA 1UPXA 5HIKA 2YHIA 1W5SA 2W83A 3RRZA 4BC1A 3VR5A 2HZBA 4E4YA 1Y81A 4IDAA 1T36A 4YMHA 3A4VA 4Q82A 4V1CA 1U2RA 3T5DA 3UA3A 1X7WB 2GASA 4YREA 1A9YA 1QAOA 2H4XA 1UQRA 5FTMA 3RI3A 4NYJQ 1Z17A 3WE7A 1U81A 1WULS 2FSGA 2P7IA 3TQRA 4R68A 2HU8A 4BECA 5EMHA 1XCGB 2P67A 3L8DA 1X2BA 2AFVA 3KJIA 2JGFA 4Z1OA 3JYQA 2HY7A 1FW6A 4RD1A 2L2QA 3KPUA 3S5JA 2D1FA 1ONBA 4ZI3A 4S04A 1PBNA 3B1YA 4YRKA 5AYVA 4U2CA 5IANA 1C3VA 1DB3A 2ECQA 5FL7D 1QH1A 2GJ9A 2WJIA 3G85A 2PDAA 3L6UA 3J7AC 1Y4DE 2ZREA 1JALA 1RZUA 2AN3A 2G63A 2J8ZA 1LZKA 2IXEA 3NBFA 4GOLD 3UIEA 4BNHA 2PPLA 4PYNA 4DDHA 4E2ZA 1SCKA 1XXHE 5JR3A 4OBEA 5LQJA 4CN9A 1IZ8A 5DU2A 5AUQA 2JFUA 2WPDD 3A6KA 4EATA 1R6TA 3A7EA 1AA9A 1AMUA 4TL7A 4MR9B 1VPLA 2JIBA 4J1SA 4TLMB 3OZUA 3D7RA 5ES3A 4C01A 5CEFA 2C7QA 4WOBA 3VKVA 4JQOA 5KKCA 3F47A 1SIWA 2Z5VA 3FR8A 9MHTA 1HI9A 1NX9A 4X1IA 4RJJA 4U3JB 4D1YA 1RI1A 1RNLA 1DC6A 2X7JA 3OQ1A 3FR7A 3ANYB 1WCV1 5CR9A 4DV7B 3A37A 4RTRA 3DEZA 3LSTA 4YXWA 4OQFA 1UWCA 3QVUA 4IRXA 3BIOA 3O4GA 4G0YA 4WA8A 3DL0A 4NG5A 1D7AA 5IUJC 5L3SB 2CBXA 2FPRA 3DZBA 4M22A 4C78A 3I6ZA 4IF6A 2BWJA 2G40A 5DHRA 1EQUA 1BGWA 1W0JA 3WYFA 3WBKA 3OTWA 2XT0A 2Z2ZA 3BULA 4UD6A 1VCOA 2PX8A 4RADA 4LSZA 4M37A 1B26A 2QI9C 1OFUA 2R7LA 4LF9B 3LL4A 1JXQA 3EC2A 3VGJA 4N8EA 2NO9A 1F9EA 1USUA 1ZRNA 5JADA 1E59A 5T8KA 3T54A 3U4GA 2TMYA 1TZCA 3SJZA 2CDRA 4RORA 1YHZA 2D1YA 4PYMA 4R9SA 3ENNA 3X1MA 3VYWA 1YMVA 1IZZA 3JAWA 1ZZGA 1GXSB 5AXCA 3WNDA 4TMTA 3LBYA 1RHUA 2A1UA 2H4ZA 3TW4A 2EWMA 4WNCA 3TN7A 2CF6A 3VM6A 4N41A 3L5KA 3Q40A 3P32A 3GJXC 4TWJA 3SG0A 4OH7A 3BB4A 2Q6LA 3R6LA 3E9MA 1C0PA 4A3SA 3E2PA 5DNAA 3TPFA 1RSZA 2HCRA 5FA8A 4RF3A 4Y30A 1TYEB 1P9LA 1T0BA 4B6FA 1ECFA 2I66A 4MR7A 4XD2A 4AO7A 1YQ9A 5ISMA 1BOFA 2IYZA 3CE9A 4QVGA 2F55A 1YC2A 4H1WA 2V7TA 1QF7A 3EHDA 1O8CA 3HPQA 3O26A 1Y1PA 3D4OA 4K3VA 2L42A 1PJZA 2O7QA 4M98A 3WTCA 2B6HA 2ACWA 4TS4A 3MUOA 1J9EA 3RU9A 3ZHSA 4CF5A 2JLWA 4IIFA 2W4MA 2I91A 1YVDA 2FWBA 3GBPA 1S2OA 1EDDA 1C7RA 4QSMA 3T3DA 2G06A 3IFSA 2ZE6A 3I53A 3F6BX 2H1RA 2YZMA 1ZGGA 3EAFA 4HG2A 1IBMB 1I13A 4RDXA 1IBLB 4ETWA 3ZJVA 2HJRA 1OQAA 2YZ2A 4L22A 3AVUA 2YWFA 2QTCA 1TK9A 3VNRA 4B34A 1SXIA 2DUJA 2FU5C 1CEQA 1RACA 1J4AA 3P2OA 1HDOA 1Q0SA 1Z06A 4F7WA 2FFAA 1G8SA 3HVJA 5EWLB 4IICA 1MIOB 2Z56A 2HJVA 3ITEA 4P9NA 3TTUA 1DBQA 5DTRA 4AMUA 3S3TA 3K0EA 3MWEA 3DL2A 2KSQA 1WDMA 3T95A 3FRJA 6LDHA 4RVDA 2EVWX 4I5FA 2ZYTX 1OWPA 4ZOLB 1R6VA 2X4DA 2Z08A 1VL1A 2CVOA 3CRVA 3LLSA 4O4IA 5FPQA 5JZ9A 1CULC 1CY6A 3D3JA 4TMYA 1JEAA 1GKUB 1ICEA 4ZEOA 1JQJC 1U4NA 1QH8A 1CR1A 3O9VA 2GF9A 1NW5A 1WMEA 1K5DA 2C82A 2K7FA 4BKMA 1IEQA 2E4XA 2D5CA 5ALPA 2FR8A 1UDRA 1G17A 4JVSB 1CUEA 2B82A 1RRFA 4KLZA 4DNQA 3ZDDA 3O7WA 1N7GA 2R44A 3HKCA 1JPJA 4HVTA 5E38A 2CJYA 5T6BA 3TXYA 3U3DA 4BYGA 2GCOA 2GN4A 2UUPA 3FTQA 4EQ6B 3KAQA 3OZAA 1QAMA 1QPGA 4M9RA 4MV7A 4B46A 4YAGA 3W5UA 4AQDA 3RYCA 4XRGA 1OH7A 1CRPA 4UE2A 1GFIA 1PN3A 2AK3A 2VDWA 3IDAA 2O7NA 3PE4A 3C2QA 4HNHA 2PGNA 2QG9A 3OU2A 4G6ZA 3KXPA 3NGXA 1NVFA 4YRDA 3W0LB 2WHYA 2EYUA 1R0KA 2D3WA 2I87A 4OI1A 5DRTA 4MVJH 1GA4A 2FN7A 4RFLA 1F7VA 3TXXA 1OBFO 4ZVSA 1CS4C 3GFTA 4M0LA 1IUNA 3ZXSA 3D7KA 1FMFA 5D00A 4GBMA 4J0QA 3KL2A 5DSZA 3MJFA 4X65B 1UMKA 3L8MA 5JNWA 1PK8A 1ZQ1A 3DE5X 4CXMA 3QNWA 1SHTX 1NG1A 2R6FA 1E9AA 3DAFA 1DWPA 4FI3F 4S1PA 4B0OA 2LPMA 1P45A 3KT6A 3MA0A 1X42A 3OM1A 5EE5B 4DA8A 4J07A 1JHVA 3VPCA 3Q9UA 1FS4A 3OZDA 5DV9A 2JGKA 2X5OA 3F5MA 1F4VA 1ZM4A 2JK1A 3ULKA 2J45A 1FNSA 4R31A 3ER6A 4XDZA 3CKYA 2Z3ZA 4URYR 1BKYA 1CR2A 2C8JA 3QKRA 4RXMA 5BSGA 3QXXA 3PQ7A 3AEKB 5TNXA 3RLFA 5EJ5A 4FR0A 5AK3A 4GDFA 4KRFA 4RQAA 1NVMB 5ADHA 3OQ6A 5TGDA 3IUJA 3ZY6A 3C74A 4MGYR 1FFYA 2R00C 1Z8FA 1YV9A 4PRYA 4ZEWA 1CRWG 1CUGA 3L7NA 4FU0A 1UPAA 4HBGA 2NTVA 4MVJD 3LUBA 4X6UA 3RC7A 3RVPA 1KETA 4GUAA 1HORA 3VISA 4B3IA 3BGIA 2ZP1A 3UYKA 4EWLA 3NOOA 5A6VA 3NDBB 5I48A 5CYFA 5L3QB 3HK2A 2EZ8A 4C4AA 2WOOA 3BMCB 3QEJA 4NFSA 3KHKA 5BPFA 4OSOA 5LB2A 1PJTA 4PZ9A 1BX3A 2CVZA 2QRHA 4IQFA 5K8TA 2KBFA 4IO1A 2QLMA 1W581 1Q21A 2DBYA 5CT6A 4V0SA 1XU7A 3DXXA 3KRTA 1XMVA 3B82A 1DBSA 3H5OA 3CE6A 4B6RA 3WRYA 3LCUA 5IAKA 4QOFA 4HR7A 3MS2A 4N03A 3BXHA 3LY8A 4B3TB 2FWNA 3OZGA 4ZAYA 5TMPA 3DM9B 4XQ0A 3L02A 4ARCA 1WQ4A 3CJTA 4QOEA 2I7CA 5KTTA 1QFZA 4HFRA 5BYJA 2ZITA 4EA8A 4F46A 1CS0A 3AR8A 3NTLA 1G291 1T1GA 2AUNA 1D2NA 5ENZA 1XVTA 2X1MA 2EFHB 3GJ8A 5FWYB 1E4VA 4ID3A 3H9BA 3P19A 1UM8A 3QF4B 5K01A 2JFPA 3THOA 1JQ5A 1DIAA 1ODIA 3CKKA 4KPGA 3WB2A 5JJLA 1QRTA 3C3WA 5A5DA 3PL5A 1I6WA 2UYQA 4GL2A 3U09A 3ASYA 4UTOA 4ETMA 1JR4A 1Z4OA 2WU4A 3FMIA 4P7GA 4M87A 3LOQA 4MIEA 2B94A 2HWYA 3COVA 4CTOA 3H97A 5AW7A 2JLYA 2GXUA 3OPXA 2I0FA 4NXNB 4ITVA 4KR7A 2FHSA 3A9UA 2CHQA 2FZKA 1SXJC 3NYIA 4ZAVA 5FPHA 3SC4A 2I78A 1Z0ZA 5JSUA 3V8VA 5DW3A 4OV6B 1GQYA 3AETB 1A9XB 2AJBA 5EMKA 4CMIA 5DGTA 5ALZA 3GDOA 5JZSA 2GHQA 5CCBA 4K40A 2DFDA 1Z0KA 2FAXA 1AKYA 1WUTA 3KJNA 4LOJA 3OCXA 2PXXA 4ND4A 4TXHA 1NATA 3O4RA 1RWVA 2W2KA 2G80A 2PL1A 1MDBA 1N2SA 1R50A 3GAAA 1RPTA 3C1UA 3EIFA 3IXQA 1X15A 3L4BA 1VLQA 2DSNA 4H7EA 4ZCQA 4UNRA 5F2OA 2QPTA 3MT0A 4LXQA 5DHTA 1GZ4A 3SF8A 4D9KA 2PS1A 1NRWA 1L5VA 3EYAA 2H2HA 2Y1KA 3E2MA 3EDQA 3TR6A 5JFOA 3U6KA 3K3PA 4QWMA 4IGIA 2YHIB 3DW1X 1O4WA 2WG2A 3HXKA 5J5CA 3D0RA 1RPJA 4EPTA 4V1CB 4N18A 4K6FA 1IVSA 4LOHA 1IL0A 4YMGA 5ICEA 1U3FA 4D3SA 3CX4A 4FJ2A 3K20A 5EHNA 1EVQA 3B7WA 3LT0A 3TEFA 3PUHA 5AHWA 5GWXA 1WTCA 4P80A 4QXRA 2XWSA 3AB8A 4QPZA 4PYRA 3ZIAD 2O8DA 1RE0A 2VT7A 4M99A 5LZ8A 5BMOA 4Y9RA 2J31A 3I1JA 3RV3A 4JLAA 2P5SA 1R3DA 4GWGA 4ID9A 4J3NA 5JCXA 1Z7WA 4WZ6A 2GPNA 4BNGA 2J33A 5AW8A 1Z16A 1AC5A 4XX1A 4NZZA 5FPTA 3ZBQA 1QH1B 3MHPA 2PO5A 4X91A 4DGQA 1YI1A 3SKVA 1YQDA 3UXEA 4KKXB 4S3MA 2XR1A 2BKUA 2P0EA 3N2KA 3WAGA 4BYMA 4UM7A 3P45A 3O8NA 1DQYA 2DOKA 4BFCA 4ZC8A 1I4DD 4GPEA 3L82B 4K28A 3HCCA 4QO7A 3S70A 4CUJA 1TAGA 4X8MA 3QE2A 4JCCA 4F8EA 2GEDA 2FMKA 4WJKB 3VUEA 2P2GA 2ZI3A 3BYZA 1XD9A 2EAUA 1YRYE 1BO6A 1Z6XA 3PNSA 4YCDA 4NS4A 4R0NA 2ORED 4FFNA 3SIPA 3KQOA 2HDNB 3PQ8A 1L9XA 1N5DA 2I67A 4XCXA 4BJHB 1U2GC 1AV7A 5LPNA 5EHGA 4Z0TA 1KDZA 3MXTA 4Q3DA 3WRWA 4A8PA 4AF8A 5AESA 1VTKA 1QF6A 1XA0A 2W4QA 1KMHA 2FPSA 3H65A 4RK5A 1AE1A 4V39A 1LK7A 3WGKA 2WPNA 1I36A 4L9SA 1EWTA 3T1OA 1CY1A 4AZ0B 2FQQA 1RQLA 3FETA 3AKYA 2HMAA 1JE0A 2GD1O 2HUPA 2B34A 3R77A 3RV4A 1ISJA 1EB8A 5ECDA 3TB6A 4CUKA 1IM2A 3AXTA 2JFFA 3K73O 3OZFA 5JE8A 4TYYA 1WCXA 1E7RA 5KYUB 2ZRPA 1U1DA 4BLVA 3LZDA 4DPKA 4YPFA 3TPCA 4B7CA 1U9ZA 4Q9DA 4DMUB 5GOTA 1JHRA 1K0UA 1YASA 2J1LA 4GEGA 4Y2RA 3GLQA 1FK8A 5EYPB 3VHQA 2BDEA 2R6R1 2YR0A 1VPEA 2I7XA 3JAWB 5AWFC 1IBCA 3HJBA 5DTEA 1YDMA 2A1UB 1DIBA 2C61A 3E3LA 4FDMA 1J25A 3LQFA 5B57C 2G09A 4HUTA 5IDVA 3WMEA 3KLNA 1GKLA 3AYXB 3FWYA 1RWPA 4M1QA 1MV5A 3NM4A 4ZCSA 5KS2A 1SNYA 4V0QA 5FUMA 2ATEA 4D46A 1EK0A 2AA3A 5DCWA 4EA9A 1B0PA 3L8EA 3L6CA 2FRXA 1RS0A 4JKOA 2WIKA 4CG3A 1GUAA 1P61B 3ED1A 2DFVA 3K0KA 4GT1A 4MR7B 1UXHA 3O4JA 4ZAWA 4B17A 1ZC4A 4DZTA 3MUEA 4QELA 1Z4PX 2JANA 1KY3A 4ASUD 2I6QA 2WAYA 3JVEA 1NSYA 4CQLB 2NTYC 3LW8A 2PXHA 4TSFA 2VTVA 4DR6B 5LZ4A 1GIAA 3EGEA 4PBTA 3CH6A 4IIBA 4OBWA 3HLTA 3HV0A 2HLPA 2WP8J 3FMPB 4LTDA 4PQFA 3TRDA 1Z25A 3S8EA 1Y8ZA 4HDNA 2PKWA 2JCVA 4R40A 1LVGA 5DWQA 2OHIA 2XXBA 1M1XB 5DYNA 3MT7A 4EAQA 2GT1A 3IULA 1INLA 3EYWA 3R5KA 4RESA 5JOQA 1KDTA 3CVOA 3P9NA 3B1JA 2I3GA 3UGTA 3K6SB 1CDZA 4L6CA 2PCJA 3HYSA 1XELA 4BAZA 4B6JA 4BTLA 2HGSA 2WIGA 4PZ0A 2ADOA 2B61A 1GRCA 4RZIA 1QP8A 3GZ4A 3MWEB 3GT0A 5FO1A 1KARA 3W34A 3EPKA 2B3TA 2VRWA 3D2CA 3CNOA 3AF6A 1Y98A 4YT2A 1QGAA 3ZE1B 4KMOA 4O4IB 3U17A 3BWXA 3NUGA 2HD4A 4G4SP 5K2OA 1AQIA 5HKOA 3MHTA 1KVQA 5AKZA 5IYZA 3SZOA 4ERNA 2E49A 2HWUA 1ZD2P 3B20A 3VNAA 1QH8B 1Y37A 2JCSA 1XROA 1Y42X 3O4VA 5H83A 3TUJC 4JT4A 3TW6A 1XK6A 2F1JA 4JBXA 2X0DA 1ZXBA 3GH1A 3K6JA 1ESEA 1QNFA 1HDXA 3E7PA 3DMPA 3DE4X 4HNQA 2EWWA 3PZRA 3RVQA 1HO3A 2CNLA 2F9LA 4LPKA 4PTLA 3HKCB 4ZIRB 4KYUA 1YR7A 5FBWB 1R10A 3GLIE 2JDID 4QU9A 4FFLA 5IX8A 1YRLA 1G41A 5DI3A 5I8WA 3ZPXA 1LVHA 1KOGA 4NYJR 2D0DA 3CY6A 3BMQB 4R8KA 2P6NA 2IV2X 3FOFC 1WXDA 3IV6A 4XPIA 4GKKB 1V5FA 5A3QA 3E0QA 1VIVA 2JAXA 4G1VA 1I14A 3OQJA 1I7NA 4HDMA 2ARKA 1TPYA 1Q92A 2P9GA 1RXEA 2WWFA 3M1IA 4CT0A 4TT8A 5JSHA 2XVYA 1N6LA 5LXTA 1M7HA 2C0CA 2ZROA 2BL4A 3KV1A 1OVGA 3ANSA 2OZVA 2Q6VA 3X43A 5LL6P 2GH1A 5K9ZA 4UUPA 2RG1A 1E9BA 2R87A 3WL7A 4JLOA 3LP6A 1GSIA 2ZULA 3IBGA 4PZZA 4WPGA 1CKEA 4B4VA 2XSZD 2N1MA 4KPEC 3FPSA 4O8CA 1GUBA 2DP4E 4IUDS 3QKRB 3MJ4A 1VLLA 1ZGHA 3V7FA 2C0PA 2X1VA 3KNZA 2WB2A 1YE8A 2H1IA 3V34A 1IEXA 3CXRA 4JB0A 4A0GA 2XKJE 2JIZA 2OZLA 3BDVA 1BQ4A 2VRCA 2ZJYA 3EZGA 5H59A 2JW5A 2LBPA 5AVSA 2G0AA 2V7QA 3IVXA 1QE5A 3R7LA 3CEAA 2G88A 4L16A 2WT8A 4F3KA 3IAAA 1J99A 1VOTA 2X86A 2FZGA 3NOQA 5I9BA 4J49A 1JFLA 4MB2A 3IQDB 3MRXA 5EKXA 1MNQA 2VP0A 1BN7A 2B3DA 1LDGA 2RGAA 1J7JA 2W98A 4KGZA 4QT0A 4F12A 5HNKA 1GPYA 1C7QA 3SXJA 5TF4A 1X39A 2ZIEA 1X7XA 4OUKX 1R0YA 5EIWA 4I6GA 4MUJA 5FEMA 2NSDA 2D59A 2WF5A 3A11A 2PKEA 2GRAA 4XIFA 3T7EA 4CIWA 1O08A 4N40A 4ZCRA 1SG6A 2RHRA 4R2HA 2O1EA 5H3LA 4LCBA 3RIMA 3NIWA 3TSYA 2QVXX 5C8VA 2F1IA 3ONNA 1O96B 1EA7A 2NZUG 3DZCA 3IUEA 1QCZA 1B41A 1N4DA 3O9MA 3T38A 2QL7A 1PWEA 3C1TA 4JI0B 4EJSC 3EEOA 3EQ7A 1PWXA 1Z15A 4GAEA 4KO4S 2IHZA 2YVLA 1IXKA 3C5VA 3WGMA 1MB0A 3WHLA 1ISIA 4FOOA 1X3SA 5D8DA 5H9WA 2CEAA 5IJWA 2MSKA 4FFWA 2REBA 4MVJG 5FBKA 4CEJB 5G4KA 1WBDA 5DBOA 3W8DA 3KTAB 3LQKA 3ZDRA 4B45A 4BFZA 3E27A 5FWNA 2DHRA 1EHIA 1Y80A 3RS8A 3WWEA 2P1RA 3HA2A 2QR2A 1TZMA 2KI5A 3OU6A 5EG5A 1UJ4A 2I22A 1SB9A 2QW1A 5CB4F 2DFTA 1XFDA 2AFRA 2QTBA 4YIKA 3EB9A 1DEOA 1PS9A 1DJLA 1KZGB 3VKHA 4WLVA 1G2PA 5DNUA 3ZVKA 3NHPA 2GLXA 4X3PA 1TA4A 4JVNA 4DLXA 2IHBA 3AEQB 5D87A 5A9SA 2OAP1 4YI5A 2YV1A 1PFGA 5CM8B 1LLFA 1DTWA 2XRMA 3E82A 2H11A 2X76A 2YRXA 3N6XA 3DMHA 1KAHA 3HHPA 3W5AA 2ZTUA 1XZCA 1OR8A 2AB0A 1WABA 3I9KA 3TD2A 1J56A 4UTRA 2QXTA 3QYFA 1P2DA 1DFGA 2ACVA 2XY4A 5JY6A 2QQ0A 4CMIB 2BKVA 4HMPA 4XDYA 1JTFA 2PG3A 4NHEA 3ZDEA 2ODNA 2WJJA 3VC3A 1XMPA 2QUHA 1VZ2A 1AIPA 4P38A 4O0MA 3RT1A 3NM6B 2PUDA 1W75A 3EZNA 2FRVA 2I3AA 2VBCA 3PNQA 3TZQA 2QQEA 2E37A 3D3WA 2HH9A 5I4CA 5IKEA 2BGTA 1EAMA 1KFJB 1PKEA 4HEQA 2PZGA 4UHHA 2W43A 1ADYA 1V11A 3SY8A 2J3IA 3T7RA 3NAGA 1CE8A 2I3BA 3ME5A 1T5BA 2VCEA 3NXSA 5G0UA 4IYRA 1G7RA 4NLLA 3WGLA 2IE0A 3IDFA 4DR2B 1JB1A 1JF8A 2W7TA 3T5BA 3MWDA 1R9MA 5CTJA 3WFIA 1PJCA 2B7CA 4W9NC 1J21A 2XMDA 2G1AA 5DULA 3GJ0A 3O9ZA 4O4JF 3FCOA 4DG9A 5BSUA 2O8DB 4Z2AA 1L8OA 4ROSA 3W1WA 4MYCA 4XAQA 4I4TA 2EBFX 3M5WA 3W4IA 3I39X 3G2OA 4JT8A 2YRFA 4G8JA 1T9CA 1NMZA 1JDBC 2EL9A 2OP0A 2Q6IA 1ZR4A 3GVCA 3KELA 5ALOA 2REOA 5AOCA 3UZUA 3UW3A 3N2KB 3U5TA 4Y3UA 1KI9A 3DMGA 3ANMA 4ILKA 1OBVA 4PZYA 2QYOA 1OROA 1X1EA 2NYAA 3QPBA 2HLDA 4M0KA 3SC3A 4ZRMA 5DASA 2FETA 3GGDA 5EJAA 4NC9A 4NH4A 3WB0A 1NPYA 2WZDA 4Z7NB 4ZI5A 2GF2A 3BIJA 3M9WA 3RSQA 4B84A 4KQFA 4ALMA 5JI3E 2OHJA 4IJ6A 2DWCA 5EIBC 1G8HA 1ZNYA 3E7XA 4H35A 4WL0A 4F3TA 1WSDA 5HE8A 4E12A 4EUSA 2QLJA 1HFKA 5JPCA 4LYDA 4H27A 1HXHA 1I7LA 4NABA 4TV9B 2J7PD 5GONF 3V1MA 4BQQA 4EKEA 4MYSA 1EAYA 2BHLA 2HT6A 1KMHB 2PIDA 1G1AA 3O0TA 5KNDH 1Z37A 3SX4A 3DD1A 5EZ6B 2PU7A 1ZPDA 2OFOA 2XBLA 1KRXA 2CEKA 3K35A 1DRUA 1I10A 3BWBA 3GEPA 3KVVA 3NHRA 2WFLA 3DA8A 3UK7A 4V1CI 4XFJA 3MJTA 1I5EA 4I1YA 2VG8A 4G5XA 1AD2A 3VVMA 2FEOA 1M7BA 3GJ6A 3NHUA 5A62A 1I7QB 4LE1A 4Z9XA 4CIVA 3O1IC 2VF2A 2FFBA 2ZUUA 1CWUA 3GFOA 4U7FA 4XEHA 3IIJA 3EBLA 4G1CA 4ND8B 3GU3A 4BMCA 1DAIA 1JWLA 3D8UA 3A0UA 1NN5A 1U0SY 1V1MA 4EG7A 1STOA 5JD4A 2ZJ2A 1IIBA 1LRLA 3IOYA 1YS7A 3GLHB 2OENG 1KO4A 3GA0A 4GSLA 4OJMX 2YN0A 3M89A 1CF2O 2F8MA 4CIBA 4HGOA 4CL0A 5JAHA 1DEHA 4YV0A 4ER7A 2NO6A 3U31A 5ENVA 1VECA 2ZJAA 1U9JA 4RGQA 4P08A 3IPRA 3JVIA 1V8PA 3A1TA 2A8YA 2FEPA 2FOXA 2PMCA 3ETJA 2QVLA 4D3ZA 4XX0A 1I1QB 3EFOA 1CF9A 1MP0A 1KDOA 2YYAA 2HMWA 2R79A 1JHDA 4CIAA 3DJYA 3FTDA 2F4NA 4Q1AA 5JCJD 1SBTA 1ZWKA 2ZM5A 2Y4OA 3IR5A 4FKMA 2WUWE 1VI6A 1Y34E 3WY9A 3VYRB 4UXIA 2IPMA 2J59A 3IUYA 4CLRB 3AW9A 3QVTA 1CVRA 1UBSB 4RH0A 4MSUA 1ZI6A 3OY7A 1SXGA 2NM0A 4TUYF 3UJ9A 4UBKA 3M6VA 3S1SA 4W5NA 3EXFB 2X2FA 4Q1FA 2CB9A 4GMHA 2OC4A 3PUKA 4MPDA 3IPCA 4N3GA 3PENA 3TSWA 4BB9A 4EFDA 1EG2A 2C9MA 2QN2A 2FK8A 3G88A 3MQFA 1KVRA 4IOLA 3RSFA 2XB2A 1M3SA 4E88A 2X15A 2W11A 2W6QA 3VMMA 1SHLA 4RMNA 3GFVA 1S8NA 4XYGA 4MRNA 3LTNC 4KAJA 10MHA 3C39A 1JIKA 4EHJA 4LA4A 3THXA 4RE6A 1P2SA 2GJSA 1GV1A 5IYZB 2CNWA 4RQUA 4HAYA 1IONA 3DE6X 4LYHA 4YWJA 1EXMA 4LY6A 5E9WA 4IIUA 3AM5A 4M83A 4JMPA 3C3YA 1D4ZA 4M9CA 4OO3A 5TS2A 3KKPA 3BWVA 3M34A 2CW5A 4YY3B 3O47A 2JLQA 3L8YA 1YF3A 4BXOA 4OXYA 1UODA 3I23A 2V0NA 5BWCA 2A0KA 3UB3A 2A59A 2IPXA 3M5DA 3NU1A 3INGA 3UPTA 3OEHA 1LVUA 3QMPA 3IXMA 4O2BA 4TYMA 3OX3A 3FF4A 1UWKA 3HWWA 3IESA 4XPIB 3KALA 4QUHA 2VSFA 2BFNA 1USVA 3O8QA 4UATA 4B79A 5DN6D 5L51A 3TUZC 5KKAA 1JDSA 3OLQA 4HDMB 1C7JA 2G7ZA 5I7AA 5KDLA 2G5CA 5A9TA 2B2NA 2P2DA 5DWVA 5LXTB 5IT0A 4MV4A 1MZPA 3KYCA 1UBHS 2W2QA 2J6HA 2YW2A 3NIDB 3ROGA 3OP1A 4ISBA 3UBMA 2WBLC 3C15C 4WBNF 3D4PA 4EFNA 4AKSA 3QPAA 3BA1A 3D3NA 1KGDA 2C2GA 1OYOA 1G8KA 4AIIA 5JHHB 3ELDA 3H11A 4UVIA 1KA9H 4M9XA 4AP9A 2VWHA 4X92A 4EG6A 4EPVA 5SY4A 3HVIA 1IYZA 3CR7A 4LWPA 2OM6A 4V3CA 3WQRA 3P9YA 4HXGA 1GOTA 5EKSA 3HVUA 1PR4A 2G4CA 1CJCA 4EUFA 1FRNA 1XJWA 1YRHA 2X19A 4EUKA 5LMCA 3ZCRA 4OREX 3G9ZA 4RJLA 2FFHA 4CVNA 2IOFK 3N2NA 3VKWA 4ZTBA 1N8NA 4QVIA 1LDYA 2PH1A 1UZAA 2RJ3A 2W9XA 2YFQA 2BYTA 4MUAA 4NHOA 2XNJA 3VZQA 3QLJA 5WRFA 4HQKA 4PC1A 4IVNA 4IOJA 3LAWA 1BX0A 1M0TA 3QYPA 1NBIA 1LBHA 4REOA 2C2XA 2I4TA 3EXHB 2XIJA 5AIBA 4UU8A 1UK6A 1V7QA 2YWBA 3B1WA 2RHBA 1G6KA 4FMCB 1TAUA 3OBBA 3HB0A 2ZJ7A 4EDFA 3PFCA 4IIDA 3QVSA 3NWPA 1P91A 4BNUA 1M2EA 1DC5A 2ZSBA 4R6WA 4MKGA 1V4VA 5JG7A 4W63A 4GQIA 4CM5A 2A0FA 2MCFA 2QJFA 2RK4A 3AU8A 5ABPA 2CXUA 5ECWA 2I8AA 2XHEA 4N82A 1XZEA 3HXOA 1N6HA 4CHGA 4UEQA 4B5KA 1VCIA 1P6XA 2P4EA 2OQVA 4PE5B 2VPPA 2WFZA 1OBHA 3G59A 1CY0A 3R9KA 2OK7A 3L6EA 1T8RA 3HUUA 4HS9A 4LXGA 3D2LA 3O3NB 5FOXA 4NRDA 2WSSD 1E9RA 3R44A 2FSUA 2ZVDA 5EUBA 4JJFA 4GEKA 4Y2YA 3VX3A 1U7OA 2H08A 1QH9A 2JLSA 3R40A 3DQZA 2YIVX 4B7ZA 1FJ2A 2J9FB 5K3FB 3LO8A 1K0FA 3WRXA 1PLKA 1QHSA 1UDXA 4WXPA 4F86A 5GADl 1ULAA 4LX0A 3CNHA 5KOHA 5SZIA 3KZOA 3T52A 2D1TA 3LYAA 4J4BA 3ZTWA 5HUJA 4YC7A 4TZKA 2XGSA 1NNSA 1RYBA 5IF3A 2HRZA 2Q5IA 1IZ9A 4P6VF 4AJNA 4RL4A 3V7UA 5A9SB 4M9UA 3SU8A 1LPPA 5CIYA 2Y76A 3D6FA 3ONWA 1RXVA 4AWBA 1Y3DE 1D8AA 1SVSA 5D3MA 1NGSA 1N0UA 2O2SA 2ZRKA 5EJGA 1QLWA 4IUBS 4HAZA 4R1PA 2OMKA 1XAGA 5F78A 5J2TA 1P18A 1E3MA 5DX1A 3WQQA 1N25A 3HR4A 2M2IA 1WIWA 3RKRA 4TL6A 2XOKA 3W04A 3PQCA 3TOSA 3FPKA 3Q8XB 2HF2A 2XDYA 3BE8A 1PHRA 3E4CA 4NQZA 1TRHA 2A0UA 4GRAA 4J7XA 1K3UB 4BNXA 5IBCA 4LJSA 3AW8A 3VR3A 4PC7A 5KTNA 4WWHA 2YV4A 4A0QA 4A6XA 3VC1A 1V11B 4EHKA 3E9YA 2RCYA 1Q15A 3WNZA 3R5FA 1ZHOA 1CE8B 2FCRA 1RI3A 1RHQA 3BXGA 4L50A 4DDVA 3BB1A 3RAEC 4BUCA 2VXBA 4JBYA 2VK4A 3HCFA 3ICVA 1QB8A 4OLHA 2PAAA 1AV6A 1JG7A 4D99A 1MVLA 4ES6A 3OJWA 4HRVA 3MWDB 2GBLA 1CJTC 1XSEA 2JIOA 2PSSA 4G41A 4Q1VA 5IAGA 1LPBB 4A15A 2Q8PA 3RADC 1VPTA 4OX9Y 1WLYA 2SKEA 1BMDA 3ZWYA 1TEXA 3UJBA 4P3PA 4FX2A 4D4GA 4I4TB 1S9DA 1ZD1A 4ZJZA 7AT1A 1L5SA 1ZNXA 2OFPA 5EJ6A 2Z6AA 1IHDA 4HPJB 3UKJA 1AO0A 4UUMA 3M49A 3GRCA 1WHTA 1WZUA 2IRWA 4GHWA 1NLUA 4BNIA 1KYVA 1LF0A 3AINA 4G0XA 5DM2A 5AO9A 3SMQA 3ZS8A 4FC7A 3V8RA 1MXHA 2HWWA 5BNTA 1OIXA 2RARA 1COWD 1NVBA 1SIBE 3VVCA 1USKA 1TU0A 3W06A 1QIDA 5AUPB 4AF7A 3CINA 1WW2A 2Y1CA 1CSEE 4R84A 4XGKA 1ACMA 2NG1A 1RAIA 3M1YA 2W6OA 2AW3A 3HDTA 2QRQA 4D3YA 4OYHA 1LDEA 1XZLA 2YXEA 3CLSD 4CMJA 2PFSA 3GHYA 4QDKA 2EG5A 2WICA 1DOAA 1O6ZA 3F9RA 3O6VA 1I4WA 1QR6A 2HIHA 2OXEA 4FQ5A 5GMOA 1XDUA 3FBWA 4WRRA 4NOKA 1JH9A 2VPTA 4MQ6A 4OBBA 2IYPA 3IJPA 4ZZ0A 2VAPA 1T0UA 3T5TA 4UMVA 2WJGA 1GUFA 4C06A 4QXMA 3F5FA 4G5OA 1Q7CA 2N9UA 3BUSA 1Y4UA 4HB2A 4QTTB 3BMNB 1ISHA 4K6CA 3FOZA 1WXEA 1T26A 1DWUA 3KM0A 5EXXA 3VDNB 1V95A 3TFOA 2YC4C 4KRGA 4CMBA 4UPEA 2X6RA 3DOHA 4URXR 2A88A 3D6HA 4NCBA 1P81A 1N34B 5FP0A 3LPAA 3FTFA 2JL1A 1SUWA 3K0AA 1YZKA 3BFXA 2HNKA 4YALA 2D1RA 5ALKA 3R3UA 4PEVA 2QEQA 5JALA 3KUXA 4GVPA 1WW3A 3I0MA 3SFTA 2O2HA 4P3NA 4BX0A 5KYYA 3UK1A 1J1UA 4PZCA 7MHTA 4PC2A 4HDSB 2WWWA 3ZH9B 1E5DA 4C21A 4RABA 4KAXA 3VR5D 4BGVA 4H7PA 2Y0CA 3WNQA 1F06A 4MAFA 4CDGA 1ZRSA 5K51A 3R7SA 1NXVA 4B8YA 2Y9MB 5JQGF 4X66B 4CG1A 5COQA 3RKSA 1LFAA 1RABA 2E87A 1VPVA 2W48A 4QNMA 5J4LA 3WA7A 5DT2A 1RPNA 4IHQA 2VA9A 3AKZA 2Q4BA 5HKBA 1EDZA 3KPYA 1LC3A 2QZSA 1HTTA 2OT3B 2RGWA 4I8IA 1UM9A 3W8RA 5E3HA 5DBGA 2PRSA 4KVZA 1BDBA 3VA7A 2RC6A 5E9JA 3K70B 4JVMA 1W76A 4Q7MB 5BQXA 2F1KA 4GKJB 1NV9A 1CQPA 3H1EA 1KWKA 1IUOA 3AJRA 1SEVA 1FUUA 1VFPA 5AH0A 1AS3A 3IVAA 2BPOA 1K2VN 2WZCA 1T9HA 1Q3KA 1J5XA 3DGFC 1W4BA 3SHWA 4AK9A 4DREA 1YHYA 4RTSA 1XTBA 2Q8NA 5T41A 1NVWQ 4U2FA 3TIXB 3GRKA 1VLMA 1S5PA 1UFQA 4UREA 3T7TA 7YASA 3X3HA 1H2FA 2WWVD 4MV5A 3NETA 3IELA 5CW2A 1TUBA 4B33A 2E21A 2BMEA 3FHCB 4C6SA 2LV8A 4BNKA 3VO2A 2VJKA 1LNQA 2WLSA 4HGNA 4X85A 2JGIA 3MB5A 1G1MA 3I2YX 2V1UA 2Q4RA 1XTTA 4KH0A 4OJYA 1B2LA 1K7YA 3AV3A 4TS3A 4QG3A 1KIMA 2WAXA 3ABOB 3IEPA 4S0ZA 5GZ6A 4AD8A 4C0WA 2ODPA 5K0NA 4IZHA 3TFQA 2DUNA 2ID8A 3A4IA 1VFNA 3HL0A 5LDHA 1OI4A 1W0JD 3W7AA 4KDEA 4YDHB 4RKEA 3GEBA 3HRHA 1KI8A 4QOSA 5SZHB 3IIKA 2J46A 2XZDA 1IUPA 1JVNA 2WWRA 3G9QA 1WBBA 2G83A 1O94C 3W2EA 4F2DA 3VUFA 3JW8A 2F1RA 1D6NA 3K5IA 3CCCA 4V2IA 3AEUB 3QG5A 1T35A 2Q0SA 1KNXA 2WYWA 1FYVA 1QAQA 4GI1A 1EVEA 3IP5A 3IPXA 3WLOA 4WK0B 4N7MA 2FTKE 4E2XA 4PN3A 3VU9A 4UHFA 5HILA 4R7TA 4FYPA 1RXUA 4Z51A 1PQYA 4O2BB 1X38A 2B4TO 4C7KA 4CKZA 5HRCA 3TLKA 2ZRJA 4XSGA 1XL1A 2IX9A 3P9ZA 2ZQZA 4NCIA 3R7WA 4J3JA 1VMKA 2C4KA 1U3GA 2CLDX 2HMTA 1HE4A 1GZHB 4GDMA 5KQMA 1I4TD 4ZC1A 3CV3A 1DPFA 3IKTA 4ZVLA 1ICIA 2EEPA 1D1TA 1K2WA 3KTFA 2Y8EA 3D64A 4AJ2A 4J0GA 1TZBA 3JTEA 4RTMA 5G0TA 4E7PA 1E6CA 2IH5A 2QBYA 2IXGA 3DFIA 5BSRA 2RH9B 2QLTA 2Z2IA 3G9TA 2PL5A 5ED0A 4BVGA 2XUDA 4NV1A 1MXFA 5IW8A 3V2IA 5BQFA 2O8EA 4DLLA 5DSXA 5F64A 3KX2A 4N5NA 3SC2A 4YCSA 4DDMA 3MD9A 2VBFA 3OF2A 1C4OA 3JCZA 4A5SA 2ZR8A 1XJQA 2OAQ1 2PSJA 1LJ8A 3CGGA 3D0KA 4BVKA 1YL6A 3HHEA 1YR9A 3JRNA 4QDUA 2EZTA 3KOMA 2AOTA 5CYPA 1KZ1A 4MV0A 4AN1A 4E2YA 4YRZA 2ZK7A 3QY9A 3G2IA 2VJQA 2JVIA 2WT9A 3H5LA 1XTIA 2WHRA 1Q57A 2QRVA 3ICWA 3JWGA 3NGMA 1T1SA 2NW6A 4Q9LA 3LOPA 3RC1A 4Q4DA 4PNPA 4UM5A 1IWPB 1LSOA 1NUQA 2E1RA 2VAXA 3LBFA 3UUEA 3DEFA 1YQGA 4DFDA 2YXLA 5CDYA 3L8GA 3H2ZA 3FWPA 1E2IA 2CGEA 1GNVA 1S4QA 1VE7A 1G5TA 2Z8YM 3OZXA 4ZQCB 2X8JA 1NQAO 1TCCA 1ZN9A 4UCWA 4FFSA 2BE7A 3DO6A 4NENA 5EXEA 1X8XA 1UJCA 1XAJA 3OIWA 3RJTA 4PXSA 2OSBA 4LWQA 3IKMB 4C3VA 1D1QA 3G5TA 3IO3A 2YBDA 5BYKA 3STWA 1LPAB 1ZXLA 1PJ4A 3Q2OA 5CFMA 3ORQA 3HNRA 4NECA 2AMYA 4LWOA 4Q18A 1C4XA 2PLWA 4Q03A 3G0CA 1N77A 4YMTA 2PKCA 3OJEA 3TL3A 2XKKA 2F59A 2VQ3A 5EJIA 4CQJA 1ONNA 1KBZA 3LTEA 1QZ3A 2Q3CA 3FUTA 3A4TA 5DT9A 1VB3A 1EDOA 1Z5WA 2JI8A 2YOHA 5KQSA 3SWWA 3WL4A 5G0WA 1JG1A 4OY3A 2QTGA 4UULA 3AKCA 3L07A 5FUXA 1KE2A 4W9MC 4JYBA 4ZOQI 1Y3HA 5K6AC 2AC4A 5K0LA 3OEYA 4ZCLA 5C2JB 1C0EA 2WIJA 1XL0A 4FONA 4LFCB 3P9RA 1DUSA 2HN9A 2OG2A 1T2CA 3FCYA 5C8YA 1BN6A 3L6BA 2JNWA 3HO1A 3FDXA 1E5QA 2CY0A 3FFTA 4KFUA 4PO3X 5C7YA 3E3AA 4F5EA 5IABA 1S2MA 1ISMA 1O2DA 5JBIA 2B8EA 4FWIB 3HEAA 3WMGA 3IUPA 1CNFA 2YTZA 5KOHB 1QG0A 5TGZA 1QLHA 4NKRA 4IKEA 4YVFA 5SZJA 2PX0A 2W2PA 3REQA 4TV8A 2XF2A 4FBGA 4RVOA 1XTQA 3T7SA 4HQFA 3CF4G 4MUBA 4PQGA 4WVLA 5MN4A 4W4TA 5DXAA 1XZAA 5LQMA 3K1ZA 4L5CA 2AHRA 5EE9A 2ID7A 4X3CA 1ESNA 3GLKA 4J7CA 2B7LA 5D3MB 4UNPA 4XKJA 1AMNA 4GLLA 4UW9A 3SBXA 1E3IA 3G2MA 4XGQA 1TTHA 3GRPA 4H1HA 2JJ8A 1DIOB 2X9LA 5C1DA 3P9KA 5J2TB 1F14A 3CX7A 1SB8A 2H1SA 4MYDA 1RM3A 3BZBA 2A9VA 4C7BA 4CTMA 2DR2A 1DCFA 2OZEA 2PD6A 1F2TA 3QEOA 1IMOA 4IDOA 3UXYA 4B1FA 3V8NA 2ILVA 4OG2A 4V0RA 1L8XA 2ILTA 1GPMA 1KYQA 1PFVA 3F5DA 4UUAA 3WDLA 4V0OA 1Y6FA 1E1MA 5A71A 1WCYA 5KTSA 4W82A 5FI5A 5TGTA 4ENQA 5EJ9A 5LOVA 1HE8B 2JC3A 3WMFA 3NIFB 4BIIA 1A5AB 3SIXA 3ZWVA 4ZAZA 4MAMA 5FI1B 1QZTA 1Y5MA 2DY1A 3GRUA 2P4UA 5A4JA 4F93B 5JH7A 4OHYA 2GKGA 1GRNA 2B0CA 2YVAA 2E2WA 4D5EA 4OHPA 5ES4B 5D2CA 3URMA 3V7NA 1XQ1A 2IYYA 5CVTA 2ODWA 1UWLA 3CSDA 4WMLA 4FHGA 4FNMA 4LNHA 1YA4A 4KITB 2RC5A 4JEUA 2HWKA 2O3JA 1R0ZA 2BTQA 4NEQA 1M2FA 1XEWY 5JBQA 5JYDA 3U19A 1YO6A 1DJPA 2IEIA 1UP7A 5T64A 4A2QA 2OGUA 5LD2B 4CLXA 5G53C 3SM3A 2BGNA 5AVQA 1WAMA 1N2IA 4R2IA 4RA9A 1IEWA 2UYGA 4BO7A 1O9HA 1T5DX 4N3BA 1WHTB 1WXHA 5LBUA 1AGNA 3UJPA 2H31A 3ZZUA 2ZU0C 4ZCIA 3HBFA 3EXEB 4CTNA 4FOPA 4QZVA 4K8RB 1IY1A 2BEJA 2W0SA 3PA8A 1L7VC 4F2GA 3TWOA 2JBAA 4U1RA 5H81A 5TE9A 1T10A 4YP6A 4BE9A 1F8FA 4PLWA 2Z9CA 3DB1A 2QVBA 3FDZB 4Y0VA 4BLWA 1UXKA 2H3HA 1X7YA 2Y1DA 4KSCA 1NF2A 3WIBA 3EZYA 5JCOC 3H04A 2B5WA 4MPTA 3EVBA 1VJDA 2WKRA 2WJ6A 1GG8A 4QYSA 2QRKA 3EVNA 4R3NA 1E77A 2F9MA 2WAMA 4ZVQA 2QRPA 3RJZA 4EG5A 5I7FA 3HA5A 4H7HA 1TVKB 2FSHA 3P7MA 1MU0A 1J0CA 1M2OA 1NXOA 4V0ME 1FFBA 4AG6A 4D4IA 8ATCA 2FMFA 3JD3A 1TJPB 2Y0DA 4KLAA 6AT1A 2OG1A 1QRUA 3OE1A 4EMTA 4CM4A 4F1WA 1XCMA 4X1YA 4FQ7A 3SQNA 2IS6A 1YQQA 3ML1A 1Z38A 2DSTA 5B1EA 2AR9A 2H4WA 1OVMA 4INZA 4MARA 5B12A 2XNHA 3BG5A 1HPLA 4LSWA 4UASA 5DTIA 2JG3A 1WU8A 4ARAA 5T57A 1PR3A 5AVZA 3FSGA 4MQUA 4XPZA 2XI4A 5ALUA 2ZBVA 4JGGA 2LWIA 3K0AB 5FBLB 3LCJA 2COKA 1TD9A 2XZTA 3NIGB 3B6KA 3I30X 2WSBA 2XNKA 4M1EA 1PEAA 3I92A 2EQAA 4Y8VA 1FJHA 1AHNA 3TVTA 4Q7EA 3AONB 4FDUA 4KQMA 5AK0A 5EP2A 5KYYB 1WKBA 4K0RA 5TF0A 1FP7A 4E7OA 4RD6A 5F2NA 3OICA 3QEAZ 3G8YA 4MX8A 2DXIA 2D3TA 3NC1C 5GGYA 1G7SA 2GYUA 3FB1A 2JRCA 3DF9A 1Q7BA 4L5AA 4FHZA 3HA7A 5AM0A 1Q7GA 3H2GA 1E7YA 3HEBA 1TYAE 1IJKA 1XCJA 5CFNA 1PRYA 1MFZA 4ESEA 3QJYA 3M1LA 3HY6A 3RSLA 3CZCA 4CI0B 3UTCA 1ILWA 2HBZA 2FSPA 5EXPA 4E14A 1KYZA 2Y6UA 1B3BA 2MJLA 1A7JA 4FE7A 2FQWA 3AHIA 3BCSA 3ZQJA 2BR4A 2BVNA 4BQNA 2CVQA 1YGPA 2C92A 4AS3A 1I8TA 2Y77A 3LGXA 1TADA 2VK1A 3NKLA 3SS9X 2DFKB 1RHRA 2CVFA 2WKQA 4J94A 4KIGA 4WY5A 3LHKA 1OJ7A 1TUBB 3NALA 4Y2PA 1RRGA 3TOXA 1MAUA 4G8BA 1OBOA 4UQOA 4DEVA 4QEZA 3SXUA 2DKNA 2P6RA 3IQHX 1JVSA 1X70A 4EJ2A 4XW2A 3CNNA 3W9BA 4B83A 4GWLA 1J90A 2ZUWA 1EE1A 2HF8A 2PX5A 3IE2A 1UPTA 2LCIA 4OAOA 1CQIA 3C5EA 4D0NA 1RQPA 3MTJA 4EGJA 1GL3A 1DELA 1J1ZA 2QN8A 4AN4A 1WR8A 3K72B 1G5QA 1Q0TA 4I1OA 4IG9A 3RH0A 3J81A 5THQA 1C1HA 1N8SA 4G4IA 4LDQA 4XYBA 2P9QA 5D86A 3HZRA 5CFRA 1R5JA 1BRTA 1ZGAA 3IRUA 1VJTA 2IU6A 3NORA 4FS3A 2OQ2A 4IWXA 3HUFA 3L7YA 3AEZA 4GVXA 5F3DA 4E07A 3PC6A 4X64B 5KTMA 4EB6A 1U1IA 1RADA 1QDEA 4R1TA 1VBNA 3VU9B 4A2WA 1UBLS 2H0AA 5A7HA 5B36A 4KCGA 3ZQ4A 4WLOA 3OZBA 3Q1KA 2VIIA 4Z9AA 3PC4A 3IEMA 4N5LA 4ZPXA 5G1NA 1NLZA 3C87A 4IDFA 3R7WB 3M8KA 5J4VA 3PEUA 1E94E 2VHEA 1TT5A 4LC0A 4ML3A 5FJJA 3RAGA 3W90A 4MUXA 2NZVG 1S2DA 4HTAA 1IIRA 1TM2A 2HQ1A 2RBEA 3A1VA 3IB3A 3NEJA 1YR8A 3VAYA 3PR3A 1QK5A 1YDEA 2G82A 1OXMA 2AH5A 4UEOA 3J80A 2AI1A 2QGNA 3ZWOA 2Z9BA 3GGJA 3AR5A 4RSRA 2RKWA 1E9FA 4WDRA 4I5DA 4MJLA 4RJIA 5GIOE 2O8EB 3QUCA 2C4TA 4GYKA 4NK4A 3SC2B 4DM4A 4R41A 1SXJA 3E0XA 4TSFD 1GPDG 2OPBA 2VTBA 1QHXA 3QXCA 3PDJA 2ERCA 4MWBA 2GKOA 3KQVA 4IJVA 4TMVA 4BNNA 3DNFA 5L45A 2J67A 5EUQB 4D4LA 3PUYA 5B3AA 3R7FA 1PU2A 2P6MA 1E1KA 3GFFA 2A3RA 1DAMA 1O97C 2VF5X 4FFPA 2QRVB 2GPWA 3L79A 2SKCA 1ZA1A 4J4HA 2XUGA 3U81A 4N47A 3RASA 2FLVA 1XNRB 4PX3A 4UVGA 1ZNZA 4Z4CA 3MGBA 5D7BA 3Q7IA 3QVVA 1KJYA 2MYNA 3KR0A 2YMMA 1WUJS 1J7KA 2Q3LA 1QDLB 5FBQB 4DQXA 1QYWA 1L8LA 5IT4A 3EGDA 3PRHA 3QVOA 4KQHA 4YCJA 1RWWA 3O4FA 3W1EA 2W37A 4ZYLA 1K8ZB 1JLLA 3IRVA 4GRIA 4BFUA 4GE0A 4NENB 2GX6A 5DJ5A 5JSFA 3VNSA 3I6QA 4EGSA 4DCCA 3PITA 1PAUA 4KTTE 5A4KA 1M33A 1MBZA 1P7PA 4JK3A 1DARA 5B4UA 4MGEA 1MJGM 1ODFA 3LCCA 1MAHA 1QFMA 5K4AA 2C20A 2EFDB 3VKGA 4E6EA 1GTMA 4G9GA 4JZKA 2D2VA 9LDBA 2WD8A 4KO2S 2P79A 2AFIE 4ZDKA 4RFSB 1ZX1A 3DW3X 1PUXA 2R66A 2QENA 3DTVA 3LM8A 4H31A 3K9FC 3NLLA 1QPZA 2Q0XA 1AX9A 4KN9S 4RWZA 1EBFA 1DS6A 5KJFA 4B73A 4NNJA 4K6MA 3K9HA 1CZKA 1RCTE 4K6GA 4HYTA 4QOJA 4QUAA 4YHBA 3RF6A 4CR7A 2PJZA 1B43A 4NMMA 4PNZA 2W2LD 5B2ZA 4P83A 4ZVVA 1J8DA 3RPEA 4GKAA 2CLSA 3NBKA 3H17A 3P9XA 3QE3A 3BOSA 2R6DA 4G0VA 3PP8A 4DWVA 4LMAA 4BWVA 1KO5A 3OH8A 3TLJA 3L8ZA 3UUFA 2VAWA 1YQTA 2G9UA 3REQB 3WYEA 4BBPA 5K0FA 4KMSA 2IX3A 5ALMA 4NBVA 2GSWA 1U2GA 2HZ7A 2ZAIA 3KZCA 3ZHBA 2ZPTX 2XGMA 3EVFA 3RS3A 2Q3JA 2I1LA 3HRKA 1E92A 3CWCA 3I6YA 3CZMA 4XD7D 1EX9A 3ZHZA 4B40A 5LM3A 1N7JA 2I8CA 2B7BA 3A9RA 3KSUA 2JGDB 3S8MA 1O6CA 3MIIA 4EJ6A 3Q88A 2Z4TA 1D6SA 13PKA 4IVQA 4UARA 4P3XA 1BXRA 2Z6VA 1X8JA 3DDOA 3QGMA 3LLUA 1DO8A 1K27A 1SOAA 4CG2A 3G79A 2IV3A 5IDXA 5K0GA 3OOEA 4NP6A 1M74A 1VL0A 1ZCZA 2VWGA 4I14A 2VK8A 4LVCA 4HWRA 4JA0A 2OGTA 2JIZD 2LDXA 1QC5A 4NX2A 4X7RA 1F2TB 4FSDA 4DCTA 4PLZA 4PZEA 1CR6A 1D09A 1WMBA 2V7QD 4G25A 4FE4A 4ZJPA 1RYZA 1QZUA 3CB4A 3ZXIA 2DYKA 1WLSA 3P0RA 1B8OA 2XMSA 2SICE 5KKNB 3MTGA 1EXVA 3CVVA 5LYJA 3EODA 1CZOA 1IK4A 1IY9A 2FLWA 3Q7RA 2BSQA 3EZ6A 5ALDA 5JH7B 2OYCA 1FC0A 5KSWB 4XUGB 4F4UA 3JXEA 1P60A 1PGJA 3CPHA 2DZDA 3FXAA 3G0OA 1QHIA 5B58C 3RYIB 4OHMA 1JJVA 4BKPA 3F6EX 3HNOA 5KU7A 1IAVA 2I9KA 4YAUA 5COAA 5ARCA 4F4CA 1OA0A 3D1LA 3O3CA 4OOEA 4ESHA 5C7IO 4PC3A 1Y0BA 1ONPA 4JLBA 4XGRA 1L5LA 4RTKA 1W93A 2UZ1A 4NFLA 4URWR 1KRHA 1GCOA 1ZUIA 4A16A 4RA9B 4YJGA 3TNDA 1EX6A 1KIFA 3HU1A 1BHSA 5HMMA 4KXMA 4AS2A 1KAEA 2ODBA 3PFHA 1TEVA 1E8MA 3DV0B 4LF8B 1TJ3A 1XU9A 4UQLA 2J4DA 1VBFA 3A4LA 5HX7A 4O4HF 1S2NA 2JBAB 4JQCA 1U1GA 2VSQA 2Q50A 3N2ZB 1JDPA 2CBGA 2GN8A 1I0LA 2Y71A 2IYUA 1VYHA 2OHOA 3IDZA 4FYHA 4RGBA 1N5LA 2C95A 2R751 1SXQA 4ZU6X 4BGDA 4UJ3A 3SZLA 5AMXA 5KYKA 3OUTA 1RRMA 1NBAA 5BR1A 4HEA6 3O8RA 1TXGA 4HX9A 2BR5A 3FDIA 4HX5A 3USZA 3QLUA 2PUCA 4TTPA 3AGPA 4DCNA 3QU2A 4ZT2A 2PVCA 1OGYA 4MLZA 4GO1A 6NULA 2RHJA 1S4MA 2GAFA 3LKDA 2E55A 1B76A 3AERA 2FPOA 2QD5A 3P9PA 2EXXA 4IIJF 2IY9A 4O0LA 4X1YB 5LCXA 3RYTC 3S1AA 3STUA 2CD7A 3I52A 3S44A 1XQWA 1TKBA 1P9NA 1NFFA 1SVIA 2RONA 4I8DA 4MVJM 4LYFA 1JEOA 4MRPA 4BMZA 1AVTA 1H2EA 2OR3A 4XOIA 1VL5A 1CT9A 2D7JA 3L43A 2RE8A 4KR2A 1C41A 4YMWA 4EF4A 4EOGA 5DP1A 2NZXA 1T4CA 1XDZA 2WG1A 3DTNA 1M2HA 4MDHA 4WSOA 1Y1KE 2YWHA 5CVDA 3UAGA 4QXAA 2OVBA 2DLNA 3ZV6A 1G59A 1UBCA 4AY3A 2J9GA 2JGLA 4U2BA 2VZLA 3AFHA 1NASA 1E3QA 4OFZA 3EZ7A 3LVBA 2RB5A 1FMCA 5LZ9A 3H1GA 1S7GA 2V59A 3JZFA 3ZDXB 3ETCA 5I4IA 3K9NA 4K26A 2JJYA 4CQNA 2NZ2A 4NFHA 5LA6A 3FUCA 4TQ9A 3BFVA 4IUCS 2AS0A 3D6JA 4M2LA 1FS5A 2XB4A 1RVDA 2QNRA 1ODCA 2YYSA 4PHCA 4RPLA 4EY4A 4R9RA 4DC9A 3AVOA 3OZVA 2NX2A 2N0SA 4YJDA 4MLCA 4CFSA 2A3NA 2D0PB 4KR0A 5IJ0A 3D1VA 1GU1A 2IHJA 3ADOA 1EBUA 3RUCA 5BSVA 2ETXA 3WLJA 1TA9A 1WB5A 5AUOB 2IODA 1GR1A 1CUZA 1K89A 2R6ZA 3PX3A 1UMBB 3T3NA 1ZM9A 2POCA 3DZKA 4URFA 1X1CA 1PHPA 2P6OA 3BRSA 3QITA 3AR7A 5F2KA 5IK2D 3HFGA 2CJWA 1Q7RA 5BRJA 3ZJ5A 1ZSVA 1GYPA 1XMXA 4D9GA 4ZWNA 4DR7B 5DHFA 3KDPA 1Z82A 4OQEA 2HLDD 3IUBA 2VUUA 3S55A 3D8HA 3T9EA 1P1HA 3GIDA 1QBKC 4PYOA 1HE1C 4IIVA 2AMLA 3V6MA 2ZZMA 4LDJA 3SR3A 3U4AA 9GPBA 5EZ5A 2PWPA 4YRTA 4PG8A 2RGGA 3JQEA 4LZOA 5FOUA 1DV1A 4LI3X 3SXUB 3DCYA 2HK8A 4MRMA 3KOZA 2YWDA 3UKOA 1UMDA 2H1WA 1MEEA 5CBKA 3N2EA 1XDSA 2ZCVA 2EL7A 3KHTA 4IINA 2W8ZA 3QQPA 2NUTA 2CMDA 3K0CC 3I73A 4DIMA 2UUOA 1C29B 2X1HA 3C3EA 3QMVA 4Q7LA 3UKDA 1T2VA 5CB4B 3H86A 3GA5A 4RQTA 2CXHA 1M73E 5H4GA 1D2HA 2Y1GA 3PT9A 4YJ2A 1FRQA 1RM4A 3LK7A 1Q19A 2I7TA 5E7MA 4EECA 3DBRA 5HJEA 5KYWA 1XVAA 1YQXA 2QPOA 2ZYDA 1PL8A 3RAFC 2X4IA 4DLPA 5FV7A 3U1TA 1PGOA 3IPAA 1GAQA 4D8WA 5BRAA 1II0A 3AUXA 3LUHA 2O14A 3RS0A 2ADMA 1XCPA 2G17A 4OQQA 4X97A 1YRQA 3TCXB 1AO3A 1P2BA 2FSIA 2TRSB 3A2LA 4I3GA 4EB6B 2VDQB 4WZZA 3EH2A 1V0JA 1XLUA 1TECE 3JQGA 5LP6C 2RHLA 2H51A 3DYIA 4CE6A 1Q1GA 1IU9A 8GPBA 1U4OA 2CSUA 4YWHA 3SS8A 3EVCA 3PFWO 1Z88A 3B9BA 1KYYA 1RWXA 5F76A 5I7RA 5IN4A 4CL3A 1UP4A 3K71B 1NPTO 4ZREA 4MWTA 5LC1A 2ATVA 4B8WA 2MT9A 2W58A 2B78A 5AK6A 2C8LA 5J23A 1MHTA 2V6MA 1TT5B 3VPXA 5ADWA 3PHIA 2IITA 1ABFA 3C1AA 1LDBA 4KK4A 1U6KA 1VL6A 3OC6A 4M8LA 4W7IA 1N2HA 4QNNA 4N3NA 3K70D 1HE5A 3A14A 1V6CA 5KVSA 2BKLA 4J1TC 4DAEA 4FBMA 2XB9A 1QOPB 2X5JO 2CJFA 1KEVA 3G2HA 3I2KA 3PR1A 5AKKA 2A4KA 5CA0F 3FN4A 5D1HA 1AKVA 1SXJB 1CRLA 3FRHA 2VTBB 3GGPA 1N2GA 3OI7A 4WN9A 4Z0NA 3RHTA 1VLZA 3E4DA 2XTNA 4AUMA 4NAHA 1HOTA 3I04A 3S2EA 4Z3DA 3NP9A 4EPXA 3NHKA 1P6UA 2PD4A 5HXAA 1I2AA 4MUGA 1Z35A 4HI0E 4LBWA 2A9PA 3MSCA 4QVKA 5FFMA 4PPQA 4G0PA 4B35A 4XA8A 4A8HA 5KOYA 5ICMA 1QP4A 3V42A 3WNBA 3TI9A 3VPGA 1WV0A 4NBKA 5JBNA 2JLUA 4WAUA 3LVFO 3DKKA 3VOSA 2PT9A 2XODA 2UZAA 2P3SA 3D02A 1FDSA 1Q1EA 3PQ2A 1QS0A 3OZCA 5ETJA 4ARSA 1JLSA 1KYIA 3EGDB 3BJIC 4B9EA 1PR2A 1PV4A 2ZIZA 4GIBA 1JLLB 2ZRMA 3MWJA 4IX9A 1V8ZA 3KOYA 4DIUA 3FMGA 2FA9A 3OE7A 1G20A 4TWZA 1TQDA 1UC9A 1N3BA 3VC7A 1CRQA 5I45A 3FYUC 3KQSA 3MUFA 1XTVA 3ZDYB 4W9NA 3I9OA 4KQJA 3VC2A 5FR2A 5ADVA 4HPXB 4E70A 5JAMA 2CNWD 5GJCA 5EP1A 4AY4A 2GPTA 3OA2A 3LKVA 4KWTA 3QY0A 1KSGA 3C4QA 2C04A 4BE4A 4B09A 2A9QA 3K2IA 5CDHA 4U0KA 4MO9A 4U2EA 4ZXPA 4EFKA 5CD9A 3W5DA 1DX4A 2OHXA 4E5KA 3BJEA 4OH1A 1NP7A 3IUNA 4UAGA 2IGTA 1OH8A 4FYWA 1DBWA 1E3JA 1B8UA 1UEIA 3R5HA 4KE6A 4ER5A 4QUIA 3BAFA 3OEHD 4XASA 3TL6A 1QX3A 1AGPA 4BNZA 2QS9A 3H9QA 5JV5A 2W6PA 3I1FA 1H1LA 2HSWA 3L05A 4C05A 2GJKA 2M98A 2VR1A 4NJMA 3AX6A 5EE3A 3OFJA 1EWRA 2DFNA 3L46A 5CLIA 3I9V6 4H16A 3LBHA 1ZU4A 1WB4A 3KU4A 5JLAA 1C3OA 5H70A 1TZ2A 2PXCA 4LPSA 1B42A 2R6GA 1U04A 4V02A 1ZM2A 3TEMA 5HIAA 3AUJB 3V2UA 1BE8A 1MO3A 5DP2A 4R01A 3B6MA 5AQEA 3GNSA 1FMLA 1GPJA 2JCBA 3E84A 3L93A 3U4DA 3UV7A 4F1JA 2WJHA 3B9QA 1WVIA 3I9MA 2W2MA 5CJ2A 1YRBA 2G1KA 2I4MA 3JD4A 1GILA 1KZ9A 1XBTA 3P52A 2GEKA 5BW8A 4EF6A 4N76A 1RAEA 1BXRB 3I34X 5F3RA 4N5IX 2IUUA 2LKCA 1C1YA 3AMVA 1KP2A 4L76A 3S2GA 1Q20A 3AG5A 1P7ZA 1JFFB 3KBOA