3HVHA

Rat catechol o-methyltransferase in complex with a catechol-type, n6-methyladenine-containing bisubstrate inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
publication title Molecular recognition at the active site of catechol-o-methyltransferase: energetically favorable replacement of a water molecule imported by a bisubstrate inhibitor.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 81
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hvhA00
4PIMA 4RTOA 2I62A 3EGIA 2OY0A 2I9KA 3SSMA 1YF3A 1YZ3A 5GOZA 2ZFUA 3CBGA 1D2GA 2PWYA 3GO4A 4O29A 4BY9E 5GP1A 4ER6A 1NW6A 2C7PA 2PX8A 1L9KA 3G5LA 4YUWA 3MB5A 2PX2A 4GC5A 2P7IA 4GQBA 3THSA 1MJFA 2IDJA 5E8JA 1ZGJA 3ER9A 2UZ4A 2P8JA 2WA1A 5EOVA 5GINE 2OB2A 4KDCA 4C08A 1R00A 1EG2A 3G88A 3TLJA 3R24A 2B2CA 4RYLA 4U7PB 1EJ6A 2AOTB 5B1SA 1VQ1A 4DZRA 3MHTA 3OU2A 5BP7A 2GH1A 3I9FA 4DKJA 2B9EA 3NWBA 2OB1A 3PT9A 4EK9A 3GRVA 3FRHA 2UYOA 3GRYA 3KPWA 5KYGA 1XDUA 4LECA 1JG3A 4HTFB 2G71A 5BXYA 5DTMA 3CVOA 2QRVA 2EFJA 3NJRA 2JH9A 4DF3A 4FR0A 5G02A 3OZTA 1YB2A 3Q7EA 3ELYA 3LECA 3M6UA 1TW3A 5DPMA 3FPGA 2FK8A 3L8DA 3G7UA 3MGGA 3OFKA 3KPYA 5EMMA 1JG4A 1KXZA 1RI3A 1NBHA 5EPEA 5K0FA 3T7SA 2NXJA 3CGGA 5DSTA 5CIYA 1UWVA 5FHQA 3TRKA 1NV9A 2ZIEA 3A25A 3R9XB 1SUSA 2ZLBA 3HA3A 5JR3A 2GA9A 3AXSA 3KKZA 2ZULA 4CWAA 1VLMA 1L3CA 2BM9A 2CMGA 4WXHA 5BW5A 3FTFA 4AZWA 3P9KA 3KQQA 4Y2HA 4GF5A 4C03A 1P1BA 3G2OA 3LDGA 3PX2A 2KW5A 3KR2A 2IH5A 2O0LA 1DL5A 3ME5A 1FP1D 1F3LA 1JQEA 2JHCA 3FPEA 3BWBA 5EMJA 2CL5A 4BLWA 2PXCA 4BLVA 2WA2A 3EGEA 3OPNA 1ZKDA 4EKIA 3C3PA 2ORED 5E9JA 3ORHA 4OBXA 1YZHA 2I6GA 3GNLA 5DX8A 2IGTA 4QQKA 5CD1A 5LQKA 2UYHA 1NE2A 2ERCA 3G8BA 4RTQA 4P7KA 3GIWA 3KPVA 5FQOA 5EGSA 3KQTA 3AXTA 3HA5A 5DLYA 4AZSA 1PRYA 1XDSA 3M33A 4HGZA 4U7TB 4FSXA 3R3HA 1VPTA 2ZIGA 4QDJA 3BGIA 3I53A 2AOVA 3P9CA 3TM4A 4E33A 4IV0A 3SR4A 1I4WA 3EVFA 5CVJA 2XYVA 3H2BA 1NT2A 4POOA 5K0EA 4DMGA 4PYMA 1L1EA 2BR3A 4C07A 4GOLD 5K0BA 1QAQA 3PFGA 1XDZA 3ELDA 4R8RA 4YUXA 3LPMA 1G38A 3CJTA 3G2QA 2ZZNA 1P1CA 2P41A 3OE5A 3BXOA 3G89A 4B17A 2C7QA 3TKAA 3HVHA 1YUBA 2WK1A 4L7VA 1FJXA 2K4MA 5CCBA 1T43A 2YX1A 1VP9A 2OZVA 3I64A 4GBED 5GWXA 1N7IA 4YMHA 3HCDA 3VC1A 4MQ4A 4HSGA 2O07A 4M37A 2O06A 2PT9A 3ELUA 3SSOA 5GM1A 3EMDA 2AOTA 3A4TA 2H1RA 4YV1A 1AV6A 3ERCA 5HOQA 3TOSA 1QZZA 2Q41A 3DMFA 3V97A 4XUEA 3SGLA 2AVDA 4E32A 3BGDA 4OA8A 2Z6UA 2YVLA 3KQYA 5DX0A 3FYDA 4C4AA 2VDWA 5KQRA 5M5BA 3BT7A 4PGHA 3R6TA 1ZHFA 1SQGA 1RJEA 4HTFA 2IP2A 2OXTA 4RVGA 2AOWA 5P8WA 3A7DA 2YQZA 4PYKA 1SUIA 3WSTA 3EPPA 1X1AA 2C7OA 1U2ZA 3LCVB 4P58A 3EVGA 3UJBA 5FQNA 2ZWAA 2DPMA 3T7RA 5LQJA 1G8SA 3LGAA 1INLA 3LKZA 2EG5A 1G55A 5DTRA 3RIEA 4C06A 3MTIA 3BKWA 2ADMA 4PGGA 5E9WA 1R18A 2PLWA 1M6YA 4JXJA 4E30A 2ONYA 2IDKA 4PONA 2CMHA 4M7RA 3DUWA 5DM0A 2P35A 5U4XA 4E2ZA 3LCCA 4CTJA 3PS9A 4OBWA 3TFWA 3UA4A 1BC5A 1UFKA 2IPXA 5DT2A 2O57A 1NW8A 4OQDA 5FWDA 3TQSA 5EMLA 3UZUA 1RI4A 3IYLW 4P7JA 4NECA 3EVBA 1RJFA 2PBFA 3HNRA 4HGYA 3UJ7A 3VC2A 4V0QA 3UJ8A 2AN4A 1BOOA 4M36A 5K01A 1G60A 4EKGA 1JQDA 4QVKA 5H02A 5CCXA 3SXJA 5C9ZA 4KIGA 1I1NA 1XXLA 5C1IA 2B3TA 4EMSA 2NYUA 1DCTA 3OFJA 3TKYA 4HRAA 4YMGA 3QOXA 1RJDA 2ZZKA 4PYNA 3VYWA 2IH2A 1VBFA 4IV8A 4GEKA 4RTSA 2UYCA 3PX3A 1RI5A 3ER8A 1SQFA 3HCEA 3JWHA 5ICCA 4CTKA 1UIRA 3A26A 5CUQA 2VZ9A 2V74B 1SVUA 5LSAA 4PCAA 3AWIA 3MQ2A 1R8XA 5E2BA 3HVIA 4PYIA 5HIMA 3EEYA 5LQNA 3LKDA 4C05A 4RVFA 1JQ3A 1OR8A 5GIPE 3C6KA 2XBMA 2PV0A 2ZBRA 3A7EA 3JWJA 4P7FA 1KHHA 2OBFA 2DULA 2G8NA 2ZBPA 2ZWVA 3C6MA 3DLIA 4PWYA 5K0JA 3FTDA 2ZZMA 4EQZA 1XJ5A 2N47A 4RV9A 5CVVA 2G1PA 2AVNA 2PXAA 3LBFA 3LL7A 3FPJA 4YUVA 4E2XA 2NXEA 4KW7A 4XCXA 3EVCA 4KVZA 4RTNA 3Q87B 1O9HA 2P3QA 3DP7A 2ESRA 5E1MA 3B3FA 3EVEA 2PGXA 3LBYA 4GOOD 4RX1A 3FUUA 5T6BA 2H11A 3DLCA 4LWOA 1FP2A 2IFTA 4H0NA 1NV8A 2GLUA 3GRUA 1M0EA 3DMGA 9MHTA 1G6Q1 1QANA 4BP3A 3UFBA 4A6DA 5LQCA 3GXOA 1EJ0A 1TW2A 3DOUA 3JWGA 3CJRA 4WVLA 2ZSUA 3UJDA 3REOA 1H1DA 2EJTA 3OZSA 4KIFA 1KIAA 3NWEA 5D1NA 4KRGA 5EKUA 3SM3A 2P7HA 3E7PA 3FUXA 1M6EX 5EKXA 3PVCA 1P39A 5BW4A 2NXCA 1NKVA 3P2KA 1D2CA 3HM2A 3U81A 2JG3A 2OPBA 4FGZA 2FPOA 5FTWA 3FRIA 1AQJA 1L3IA 5K0GA 3K0BA 3CC8A 1KPHA 2OKCA 3B5IA 5LQRA 1VE3A 3UBTA 5DXAA 2P3LA 4X41A 4C04A 1QAMA 3GDHA 4GOND 2BH2A 4FS8A 5E8RA 1G8AA 1FBNA 3GU3A 2HV9A 3THRA 5EZSA 4MIKA 2QY6A 5EC8A 3FTCA 4P7GA 4V0RA 5T67A 3EEOA 4FT2A 2GAFA 4GC9A 1IM8A 3CJQA 5F2OA 2PX5A 3GRRA 3NDIA 3NDJA 3P9NA 4X1OA 2C7RA 5FA5A 2ZTHA 8MHTA 1XTPA 2O05A 1VP3A 3FPFA 4RVDA 5EEHA 1EIZA 2ZW9A 4ZTBA 3TMAA 2FCAA 3KQVA 3KQSA 1BHJA 1Y8CA 4G56A 4PYOA 3FPHA 2ZBQA 3KU1A 3DULA 4YV0A 1PJZA 1KPIA 3GJYA 2PVCA 4E2WA 1JSXA 2IBSA 2XYRA 4PYJA 4F84A 1NW7A 3HCAA 2HNKA 2CWWA 1L3BA 3FYCA 5EIWA 2OYRA 1JR4A 4PYQA 5GM2A 3C0KA 5GIOE 3IEIA 4E31A 1F38A 4R8SA 5K09A 4RVHA 4K6MA 4PYLA 5LR6A 2P40A 1NW3A 5EVJA 2GPYA 3HTXA 5HIIA 2YUIA 5E1DA 3KR1A 3G2PA 4PINA 2AOXA 4AUKA 4CKCA 2LD4A 5ICEA 2QM3A 1I9GA 2HMYB 5DTQA 3TM5A 2F8LA 2I7CA 5DM1A 4R6WA 5EHGA 3EMBA 2AR0A 2B78A 2H00A 4HG2A 2IIPA 1X1BA 1WS6A 3HCBA 3M6XA 4DQ0A 3NMUF 2CKDA 3FUWA 5E9QA 1B42A 1RI1A 1XVAA 5CVEA 3M6VA 4FP9A 4PIPA 3UJ6A 1IY9A 3FZGA 2VS1A 2V7EA 5FADA 3P2IA 4ATNA 3DXZA 5K8VA 4X60A 4OQEA 4BLUA 3GCZA 1SG9A 3M6WA 2JHPA 3OU6A 3BKXA 2BR5A 4X63A 5ERGB 5FHRA 4CKBA 4ER0A 4DA4A 2B25A 2IH4A 5DWQA 5CVDA 3VSEA 2FHPA 2Z6QA 3EVDA 2AS0A 4QTTB 4DM3A 4LWPA 1KPGA 1ORIA 3BWMA 4YV2A 2YXEA 3X0DA 2Z6AA 3B7PA 3GRZA 5JUWA 4CKEA 2PX4A 5IKMA 3BZBA 1ZG3A 1JTEA 3LDFA 3A27A 3NTVA 2YR0A 3O31A 1Z3CA 3OZRA 4Z2YA 3T7TA 1SKMA 3RW9A 3M4XA 1IXKA 1R74A 3G5TA 1EAMA 3LHDA 3PFHA 4FSDA 1WZNA 3P8ZA 2AOUB 1O9GA 5EIFA 3E8SA 3EVZA 3P9IA 3BWYA 5LQUA 1AF7A 1NW5A 1TPYA 1ZQ9A 1WY7A 3AY0A 2UYQA 3PTAA 1Q0SA 2VDVE 3CKKA 5KS2A 5K0LA 1QYRA 2NNWB 2XVMA 3HA7A 3D2LA 3M70A 4MHTA 3KHKA 4IKPA 3KPUA 1X19A 1NBIA 5K0NA 3NVKI 3SVZA 1AQIA 1KR5A 2EX4A 1R8YA 3EGVA 3PB3A 4LG1A 4RWZA 3MCZA 5DM2A 2XVAA 3FUTA 4FZVA 5DRYA 4YUYA 4RTPA 3TR6A 2YXDA 3C3YA 5HFJA 3EVAA 1XCJA 5F2NA 1JTFA 3O4FA 3UWPA 4GOMD 3F4KA 2FYTA 3RODA 1JSZA 3JWIA 4F85A 4BP1A 2PSSA 4X61A 4DCMA 1RJGA 3IV6A 3CCFA 2YTZA 1Q0TA 3DR5A 3P97A 2QYOA 3AJDA 3KQPA 5KQSA 3E05A 5HZMA 2PJDA 3P2EA 3KQWA 3KR0A 5E2AA 2G70A 3FTEA 5EMKA 4HC4A 2E5WA 1BKYA 2JHAA 1FPQA 3IHTA 3QOWA 3KQOA 1JG2A 3SMQA 1YFLA 4MTLA 3T0IA 1XCLA 1WXXA 3UJCA 4AX8A 3GWZA 3ELWA 5KVAA 3UA3A 5K03A 2ONZA 2R3SA 3ANXA 3MCTA 1R6AA 3I5UA 5DXJA 4ER7A 5E1OA 2BR4A 2JH8A 3DXYA 3LSTA 2VP3A 3OCJA 3G2MA 2ZIFA 4QDKA 5HIKA 1RI2A 1VIDA 3MAGA 4PNEA 2P3OA 2Y1XA 3ID6C 3DXXA 3QV2A 4R6XA 4RTJA 3P71T 2AN5A 1DUSA 1O54A 5CM2Z 3B3JA 4PCLA 2IBTA 3UJAA 3S68A 2EJUA 5FUBA 3NW9A 3TPZA 1ORHA 2GS9A 3LX6A 5E1BA 1ZGAA 4DCGA 1V39A 4KDRA 4FT4A 3KR9A 3B3GA 3E23A 1X1CA 2ZCJA 2HR1A 5DX1A 4GUAA 5EZQA 2NP7A 2BZGA 5HILA 5EEGA 1JG1A 3OE4A 5DSXA 5T64A 4OA5A 5K05A 2HWKA 3KPJA 4XUCA 4CXMA 5MHTA 5HEKA 2VDUE 3MTEA 5C0OE 1HMYA 2BM8A 3SSNA 2QRVB 5FULA 2AZTA 4F86A 2AOUA 3HVKA 5FWAA 5IH3A 4A6EA 3DTNA 4Y30A 1WXWA 5EG5A 4RTLA 5ICGA 3HEMA 3B89A 4RTRA 4RTMA 4E2YA 3HP7A 7MHTA 3LCUA 2PKWA 3NVMB 2HTEA 2P1DA 4M38A 4R05A 2AN3A 5HIJA 4AZTA 5LQAA 2R6ZA 3BGVA 2PT6A 5DM4A 2PWPA 4EVIA 4YUZA 1VL5A 1WG8A 5CVUA 10MHA 1MHTA 5F2KA 3HCFA 4ISCA 2PY6A 1KP9A 4RTKA 4ER5A 4OX9Y 5K0CA 2Y1WA 4QTUB 3PLAE 2XYQA 3OU7A 1YFJA 2NP6A 4IWNA 1P91A 3UJ9A 4HH4A 4ER3A 3DH0A 1EQAA 3BWCA 3DMHA 4RSRA 3BUSA 3I58A 1X1DA 5DRTA 2G72A 3SX0A 2QE6A 3V8VA 1KYWA 4UOEA 3LDUA 1N2XA 2NXNA 2FRXA 3KQMA 5EQJB 4KWCA 2A14A 3FUVA 3HVJA 4QPNA 3HCCA 2OO3A 4QQNA 4E70A 3G8AA 4XUDA 4QPPA 5FCDA 2JJQA 3GGDA 3MERA 1QAOA 5ICFA 5EHIA 4QVGA 2YXLA 4AZVA 2ZVJA 1N7JA 2PXXA 1HNNA 3O7WA 3R0QA 5FA8A 5D1HA 1KYZA 2GB4A 3K6RA 2FK7A 1D2HA 4MWZA
chains in the Genus database with same CATH superfamily
3JZAA 3MUOA 1IU9A 1FTQA 4KSYA 2BAGA 2ZETA 2O50A 3GLKA 1JZQA 4A0GA 4XAQA 5LL6P 2CNWA 4BY9E 2NU7A 3O3OB 5DHUA 1NQ5A 2P7IA 5EJ2A 3QLJA 5LNK1 3BCHA 5E8JA 2FP4A 5JPDA 5JMTA 4L5IA 4IGFA 2Y0PA 3VXKA 4DWWA 2AKAB 4I5DA 4IJQA 1G3UA 5CDFA 2B2CA 2HNAA 4LMRA 1NGSA 3O90A 2GH1A 1S4QA 3IDAA 2OCDA 5PGMA 4LIPD 3DL2A 1E2EA 1PQUA 2LVBA 2XHZA 1LKZA 4A2WA 2WWFA 5IZCC 1I4LD 5H5JA 1HE8B 1J0AA 3GRYA 3KPWA 5LYJA 5HGXA 5ENVA 3PRYA 1T9GS 1RRVA 4HFNA 3W4JA 1XZFA 1C0EA 3IAS6 2IYAA 3ZW7A 4IRXA 2EFJA 1PCXA 3GVXA 1G20E 4L07A 4FR0A 2AI2A 2GCEA 4OF4A 2VHUA 4OCZA 5CNIA 4PPNA 3EC2A 3EXHA 4IHJF 4B3BA 1EFDN 5I7VA 3MINA 4IWYA 3FOFC 3LHSA 5KDLA 2QVZX 3B1VA 4LPKA 2FNAA 3E70C 1SVWA 1F0PA 2WSIA 2EWWA 2ZJ7A 1T2VA 4QPJC 4WXPA 5JR3A 2ONCA 1BDJA 1ODJA 3FZNA 4PG7A 3PQ8A 3ZUGA 2CSXA 4CCYA 4PHHA 2CFOA 3KQQA 2PFGA 2FOXA 2XMQA 1Z63A 5DP2A 4C03A 2VSYA 5JARA 2Z5FA 1W4CA 3D31A 4WH0A 3M6IA 1KSHA 2O0LA 3KKQA 4FI3C 2NZYA 4NOKA 3H4VA 1YIAA 4R98A 4W6QA 1U1GA 1YBAA 3H18A 1FA9A 5L7TA 1M3SA 2VPWA 4PEVA 4TKVB 1LEHA 2BHNA 4BLVA 1NF2A 1GUYA 3U7EB 1DO0A 2FW6A 4MVJA 2UYHA 1C3OA 2ERCA 5EZ6B 2B4AA 4Q1DA 4YRRA 4JA2A 1DLJA 5IKXA 1YZLA 3L05A 3AVWA 1TC1A 2AYXA 5E95A 1GQQA 5JYCA 2EXXA 1MAUA 4YDHB 1ULHA 4J43A 4LOKA 4QYIA 3GJ4A 4UC0A 1DWQA 4QWMA 5C52B 4JLSA 1QOZA 1Q3KA 2VJBA 1FRVA 1NULA 3RJZA 3AEKA 4WJKB 4E1VA 4E11A 5JFTA 1R9JA 4M54A 2QUIA 2RH8A 1YU6A 2CFRA 3BXHA 4X7RA 3RG2A 4BFTA 4RVCA 1JA1A 4F0JA 5BSGA 1NUQA 5KKCA 3CMCO 2A1UB 2IXEA 1RBMA 1Q1GA 3GX1A 2PA0A 1XK7A 2N9UA 3RWBA 2PRIA 3BHMA 4IVQA 2NW6A 4XCVA 5J4LA 3N0XA 2XCUA 3FOCA 4FFOA 4B32A 4I9GA 5HTOA 1AUPA 2OC4A 2II6A 3I64A 3ORYA 5CA1F 2IY7A 3WBJA 1HF3A 2GCOA 3A1WA 5JBNA 3FFAA 3ONNA 4QEKA 5KO2A 2HBRA 2HU7A 4JC8A 3TZCA 4GPEA 1E8DA 2Q99A 3S7ZA 4TS3A 3EZXA 4WNAB 1IJBA 3ISJA 3H3XA 4GWKA 4RFSA 1TZCA 1G2PA 3CT4A 3N7TA 3SSAA 4F96A 2YN2A 2A7XA 2OCAA 4MIOA 2I66A 5AUPB 4H2DA 5JWOA 1SEPA 3FYDA 4G0PA 3I3SR 2P90A 4JVMA 4TYQA 4X6XA 5FWXB 1DIBA 1SVKA 2V8OA 3LH5A 3OCXA 5M5BA 1QYIA 4C4YA 2AE2A 4N18A 3UPTA 1G5IA 4AECA 1DFHA 2RHOA 1HBJA 2POQX 3KC2A 4OK3A 4F3TA 3D7NA 4HXYA 1A2BA 1SO8A 2HF9A 5IM4A 4F7WA 1J22A 4OLBA 2LDBA 4YQYA 2OQRA 3HI6A 4WERA 1OV4A 1CUJA 1RXYA 1ZC3A 2GBLA 2WBLC 3H2GA 3SJZA 2ZUSA 4C6TA 4D9FA 3TSCA 1Y3HA 2EP5A 2EL9A 2KS6A 3L4BC 5E9WA 3TTVA 5JXHA 2CNLA 3VJRA 4MV5A 3U56A 3W5CA 5DM0A 2XAAA 2HDWA 4PXAA 1MX1A 1IEXA 3AO0B 4OBWA 3TFWA 1E64A 4IRMA 1L4GA 3IKMB 3HA2A 3D4IA 2YBDA 3KJQA 4KZPA 1FOEB 3HYRA 2YJ3A 4MWSA 3ASVA 4LQLA 4BAUA 1LD3A 1E9EA 4IJMA 4TTJA 4Z3OA 5JWHA 4FPXA 2EP8A 2RAFA 1KQ3A 4BGDA 3WISA 1IN4A 1EFPB 1KYQA 3FETA 3R23A 1IH8A 2C31A 3V42A 3R5FA 5C7YA 5KQPA 4YBZA 3USZA 1ZM7A 4YCLA 3SEAA 4EWLA 1LJLA 1RHKA 2NO6A 4F5DA 1QE0A 3T6KA 2JLXA 3QHQA 1GG5A 2L2QA 2DFVA 3D02A 3I01M 2VL7A 3LOQA 3D2BA 1I0ZA 1PR5A 1ZICA 3RT1A 5CFNA 4MULA 3PQ6A 3WOHA 3WHKA 1K4KA 2GK3A 2A1TR 2GF9A 5K6RA 1XMXA 2J31A 4Q3CA 2D00A 1QFMA 4OUDA 4WZAE 5SICE 3I6YA 4BB5A 1YVPA 1PTKA 4OLFA 2JFQA 2PL1A 3EEYA 3L82B 1GTL1 3U40A 3JAMA 1K66A 2ZT8A 4ZVLA 2XJ9A 4UUQA 4UOZA 1W76A 3HKBA 5CFOA 2W6ZA 1AHHA 1T5TA 4U7WA 2JVIA 3UOGA 1UAAA 3CVJA 2AVNA 3K09C 2PCLA 3UCXA 1WF6A 4FTWA 3IBTA 1Y9DA 3HFRA 2CXPA 2P3QA 3Q87B 5D3MA 5AMXA 3ZZ1A 2J3QA 4GM1A 3SYRA 1IQPA 2V1XA 2GK4A 4BNJA 3WLOA 2QUKA 4RD1A 3IX7A 4AJKA 4D46A 4MUMA 4XB1A 4ZYXA 3KEMA 3ST7A 1G6Q1 4QHYA 2NX2A 3LJKA 5LQCA 3DOUA 1U8ZA 2ARKA 1XPUA 3H8SA 2PUVA 4H3SA 2G3YA 2ZSIA 2FMKA 3N05A 1Q91A 2VF2A 1NXTA 2HHCA 4NYMR 1JIUA 1UMBB 3Q7RA 2P2DA 2XE8A 4LY3A 2RB4A 3IO5A 4D0GA 4O4JB 2I6TA 1PGOA 2NXCA 1ECBA 3JR7A 1NKVA 2OHJA 2NUBA 2WF6A 3KJFA 2VQ6A 1BCRA 4LHXA 4YYEA 3MWJA 1QPGA 4X8MA 3U81A 1EE9A 1MPXA 2C42A 4HNGA 2OESA 3NI2A 1VE5A 3NWOA 4XW2A 3ZLTA 4X66B 5FLYA 3GJ7A 1JA0A 3OZIA 4P93A 1JSRA 3HKCA 3IQFA 1E6WA 1UJMA 1ETHA 2DBVO 2HGSA 3Q9SA 4I14A 1PL0A 1FQJA 2HV9A 1MAVA 3Q3HA 4D2IA 1A2QA 4P7GA 3NIFB 1VG8A 2ZSKA 1SU6A 1RC0A 4LHEA 3UBTA 1OX6A 4UU1A 4K03A 4ZQFA 4EHAA 1Y9AA 3H16A 5JNTA 2B37A 2EDAA 4RF4A 3S1AB 1XDDA 2HU2A 1NVMB 3LP8A 3EEBA 4QYSA 2V7VA 3PIIA 4DXDA 3V6MA 4BNKA 1TYZA 3ADBA 3EEFA 3IOYA 1QRSA 2FCAA 3CNLA 1UOEA 3CCBA 1DPFA 3JQFA 4HXEB 2GVDC 3ZWXA 1Y89A 3AVVA 2J08A 3BHNA 4B2PA 3EODA 3GJYA 1BWRA 1QG4A 3OPYA 4LNHA 2Q2NA 3I0ZA 3R5KA 1KH1A 1K92A 4Y9RA 3UB3A 5K20A 3AFHA 2WKQA 3SQOA 2NO0A 1SNYA 2PAAA 4MW0A 2OYRA 2W6JD 1T2FA 3LWBA 5GM2A 2P9ZA 5JD6A 3FOBA 4MLDA 1KDOA 4DLVA 5KJCA 3DKPA 2J3HA 2QL9A 2KMLA 3A4MA 1CRZA 5A3SA 5K09A 1TQHA 4KV9A 5A2GA 2W8BB 1TKRA 1YJ5A 5BMVB 1RM5A 1E3WA 2HD4A 1KP3A 2K7ZA 3UHAA 4D9EA 4DMLA 4IGIA 1RCUA 4RMNA 1N4AA 4N41A 1SMKA 1B8NA 3EMBA 4NV1A 3NVKI 1CBUA 2I99A 3AFGA 3IB3A 4PZ0A 1SZCA 3VO2A 5I51A 3R9WA 1KZ7B 2UZ1A 1Z16A 4K40A 1B42A 1EHYA 3FJYA 3BERA 5CT5A 5JS1A 3MTAA 5K6AC 2P2NA 1LWNA 5FO1A 2Z98A 4KK4A 3THOA 1T1GA 2OBNA 3MWDB 2HMTA 4CUKA 1MJ5A 1B43A 1NFRA 2HJGA 1ISRA 2J8ZA 1FDIA 1M34A 4O5OA 3GLFB 3RYHB 3PI7A 2A5DA 3UAGA 4DBZA 1A4XA 1NBEA 2D5AA 4X63A 3K0HA 2XMRA 1P3Y1 1MBZA 5CVDA 5BN3A 4US2R 3STTA 3ZWAA 3FHCB 4N76A 1IATA 4RYDA 4TKVA 2G76A 3MWFA 4UCFA 3X0DA 1IUKA 1ULTA 1VGRA 3TD2A 1AE1A 3PRHA 3PCTA 3S8MA 2WE7A 1KC1A 2RB5A 1WABA 1ZG3A 1V3VA 1ZIOA 4PRLA 1T9BA 3TCNA 3TSWA 1GT91 3QE3A 4LNAA 3DMTC 5B2ZA 4UTVA 1EVYA 1KFBB 1NXXA 1EWKA 4CLRB 3IKLA 1EVIA 3U39A 3GLUA 5LKAA 3ZDYB 5JXJA 3WFJA 1BFUA 3UW3A 4KH1A 4MZXA 4XKJA 1NLMA 3DHNA 2EIHA 3GN2A 3M70A 3ND8A 4B79A 2WQ6A 4EL0A 4OB7A 1BMQA 4N54A 3PB3A 3T06B 2X0NA 3QHPA 4LYHA 4B6PA 1DXOA 2C96A 1JN0A 2IUTA 3NS7A 4I4TB 3TD9A 3PQ7A 4LF4B 1RMYA 3LUAA 2Q5HA 2ANBA 2LCFA 2XTAA 4D92A 1PVVA 3HY4A 2Q6OA 1N1MA 5AQEA 1UWCA 3BSYA 1P7VA 1RJGA 3FVQA 4PLFA 4WNAA 4TTIA 3VR5D 3OBBA 3VR6A 2GXAA 5KYYA 2ID4A 3FPCA 2BSXA 3JQBC 3QWAA 3R3SA 5DE3A 1KEEB 3G6KA 2IXDA 1XRSB 4ERXA 1GAJA 4NQZA 1G6HA 1V48A 3UXYA 1Y4ZA 5IYZB 5JRJA 4G0ZA 3GV0A 4HC4A 2RIRA 4B3CA 1XEAA 3KZOA 2XVYA 3L7BA 5LP6A 3GGGA 1DC5A 1CX9B 3AF6A 2BMWA 3DE6X 2NXWA 2GZSA 3CR3C 3UA3A 1U2DC 4IY1A 2D7JA 3BJMA 3WYNA 4PVDA 1X87A 3KEQA 3GW8A 2JBWA 3A1NA 4R1QA 1H66A 4Q3KA 2RJ3A 1RM0A 1WOYA 3OCJA 4L4SA 4IV5A 4ND8A 1DGQA 3UKJA 2VTBA 1D4OA 1ZUNA 1O5TA 1DXQA 1RI2A 1VIDA 2OBBA 3HKDA 2WRZA 4KR0A 4OJNA 2A59A 1LS1A 4R6XA 3LF1A 4E5YA 2RH4A 4C88A 4ZCMA 3U2QA 4N5LA 1XWWA 4GHWA 4QBKA 1EXNA 2HQOA 1E94E 4M98A 3T4XA 3OAAA 3K0CC 1ORHA 1NW4A 1BRTA 5M34A 1NIPA 1FW8A 3PJGA 1M1NA 1AZWA 4LDNA 3ZE2B 3EQZA 1U63A 2V0GA 4Y2JA 3V9PA 5L40A 2V3VA 1TZMA 1XVTA 3MS2A 4L75A 5DHRA 4A1FA 1GKYA 5I48A 3F90A 3SZGA 1HEYA 2HYIC 1QYVA 2H51A 1LJUA 4D43A 4TS9A 1EFPA 1XEFA 4XYBA 1L0BA 5DSXA 5IFLA 4Q3LA 3UMVA 3WGKA 4EJ0A 2ZYSA 4C0KA 3QVKA 2QX9A 4IIGA 3PK0A 1P72A 4PFJA 2C0QA 4UBOA 2PSHA 5FTMA 5IC6A 4RJTA 2PDAA 1XTIA 4XSHA 1OB2A 1T3TA 3DPIA 2WTXA 2VCHA 3QXGA 2YRXA 3JVUA 3FCUB 1RM4A 4P5PA 3RK0A 3I5XA 1R6VA 3JASB 3SICE 1EZ4A 2QLTA 3HR8A 2D5CA 3QITA 5C4MA 5KWIA 5A9SA 2GCNA 1OHHA 2PVSA 1U8TA 1W46A 2VLIA 3BB1A 3A6ZA 3F1LA 5E6SA 4UM9B 2UXDB 3M3DA 3ANSA 2CXQA 1EFCA 1I1HA 5JAIA 1NMSA 1YQ9A 4B6QA 3HWWA 2DLCX 1Z6GA 3L2OB 5ER6A 4A92A 2QT0A 1K7CA 4XLZA 1MD9A 3LLSA 4LQ4A 2CHQA 2IYQA 4PHTA 3VYUB 3IT0A 1ML4A 2ATCA 3FFBA 3OPQA 4PHCA 3H5AA 1E79A 4TRRA 3IEUA 5IX8A 2YIMA 4XUGB 3DP9A 4Z9FA 3ZOZA 1S1CA 5L7WA 1EFAA 2UUPA 1B7GO 1ZA2A 1TUEA 4HR7A 4LWZA 3NFRA 3CE9A 4KE7A 4DSAA 1FYVA 1QDUA 5JMPA 3I2IA 9LDBA 5FWYA 3DOHA 2GFHA 3CR7A 3G9XA 1TJ4A 3BBPA 4UVHA 4CI0B 1QGZA 4B71A 2BP7A 2FRXA 2H54A 2WJVA 3CLRD 3FUVA 4V2UA 2NZVG 3VR4A 4LZWA 2AHRA 2QTMA 1WXGA 2JFUA 3K6JA 4E3WA 1GPWB 3TE6A 1UMBA 3GLIA 3OIWA 4GT1A 2WV9A 4LKOA 4OOFA 5ECGC 3O7WA 1RNLA 3ZLJA 3QRWA 3OH8A 3I6ZA 4OHBA 2R6AA 5EMHA 4U2KA 2QORA 3P0RA 4W82A 2QD4A 2OY0A 2I9KA 2MR6A 3MBOA 1C9EA 4Z9XA 3WSWA 1C4XA 4Q4HB 3C85A 5TVGA 4G63A 1IXYA 1QHHB 3OFVA 2G9UA 2M1ZA 1THMA 5KBYA 3EG5A 3G5LA 4JC5A 1LGYA 3PLRA 4RY8A 4M6WA 1E7RA 2P0EA 2G0TA 5H82A 1Z0AA 3LTEA 3TAHA 3IP8A 1FS6A 1QONA 3HVRA 2WHPB 4F2PA 4EHNA 1DEKA 1IZYA 4CF6A 3OBIA 4FQ8A 2JJ2A 1TTPB 1G17A 2HF2A 4B31A 1YKFA 3AHDA 3WLHA 3NWBA 2OB1A 2PWBA 3IUNA 1L4MA 1PN3A 3NEYA 3I1YA 2VRCD 2F1OA 1XDUA 2V9ZA 1LBIA 2XUIA 3OE1A 1ST3A 1F2UB 4RHEA 1KMHB 2G71A 1KO8A 3AM5A 2V4UA 5LM3A 1T5LA 2JI4A 3CVOA 2W58A 4RSMA 1GUFA 1N7HA 2I22A 3WQHA 5IUNC 4MKRA 3V1NA 3QPAA 3EFOA 5K4HA 3R8XA 2OXIA 2ODBA 4TL8A 2WMDA 1KJ8A 3KKKA 1P7CA 1JG4A 3KTOA 4US0R 1IY2A 5EMMA 4MNTA 5AVOA 3CGGA 3SQMA 4AJIA 4NKRA 5TGTA 3EF0A 3JQ7B 4XIFA 1JHXA 4IZ6A 4NZNA 2V7QA 1VHWA 4IUDS 4D8VA 3T4PA 3AFNA 1V6SA 4YUAA 5ITVA 4H6XA 2CLLB 1F4LA 2Q07A 1JHMA 3A0UA 1R4MB 4HY3A 3W8EA 4KI7A 4ARCA 1KMQA 4C7XA 1RYZA 1GG8A 4RVOA 4LY9A 3MWDA 4F4HA 1SWWA 3G1TA 3ICVA 4XEUA 1C9MA 4M1WA 3VKFA 4JLDA 4MS1B 3NLLA 3T4EA 1EM8B 2X9LA 3EGEA 3PDWA 3WL6A 2NPOA 4S0XA 1R5OA 4TSFD 2R48A 4YJGB 3QKWA 5C8YF 1G4UR 1H0KA 4Z9AA 3FWHA 1UFOA 2E9SA 4D44A 3RS4A 2Q50A 3F5QA 3E3LA 3VZRA 4BNNA 4F7DA 3GRAA 2VXOA 1HH4A 1U94A 4OL0A 1UKVY 4G9GA 1YR8A 1XKQA 1RMQA 4TSRA 4DMUB 3R3HA 5IZCA 4QDJA 1SHLA 1ZNZA 1NPYA 4ND2A 3P9CA 1GL7A 1RFLA 3TM4A 5AYVA 5GJVC 2WJWA 2DOKA 4AG3A 3EBPA 4QUHA 1V9SA 2WF8A 1G6OA 4LDAA 5ELXA 5EI5A 4N49A 1YI8A 1KAMA 1SG6A 3JYLA 3O8OB 5JMWA 4DM4A 1CR4A 3R7BA 1QRTA 5TARA 2OAEA 3S1LA 1GUZA 5KYXA 2ZZNA 3BXOA 3G89A 1A3CA 4GI3A 3IO3A 2RONA 4FR5A 4RIEA 4YK7A 5GJCA 1MH1A 3RVOA 1E0KA 3E3MA 3MHPA 1VP9A 4BFLA 1BGVA 1Q1AA 2RI0A 2P65A 4EI7A 2ZT7A 3BD6A 3TQQA 5JZVA 3LQRA 2O5CA 5IF9A 3HP4A 1PX0A 2GWRA 1CY8A 3CT6A 4JT2A 4PU0A 4WHMA 3OP1A 3AEUB 3R2JA 4LYEA 1K7YA 4TTVA 4LYDA 3TOSA 1H2ZA 4KTVE 1DNPA 2AQ8A 2VDKB 5AVJA 4ZK2A 3HO8A 1LPBB 2YYSA 1MOSA 5A4JA 4WXYB 4QT0A 5DX0A 2ACVA 4P82A 5D6NA 3UXHA 4BC1A 2JJ8A 1I3NA 1XR3A 3OX3A 4LC0A 3LOPA 3R6TA 1N7GA 4P3OA 4GBGA 4P2BA 3WKDA 2AEEA 1E0AA 1OZAA 5FF9A 1E1KA 4KLAA 4KXUA 2JFYA 3P0IA 1YCDA 3GEDA 3OE7D 5ECWA 3W9BA 5DGTA 5C5DA 1KRWA 4R1LA 4Q03A 1BXZA 1G7SA 3GAZA 1BQ3A 4NG5A 5HKLA 5JWRA 2BSQA 1R6TA 2V5VA 1K5HA 2IDMA 3LKZA 3WGVA 5TJ9A 2R1VB 2P9FA 3PNVA 1PW7A 1SCIA 2F48A 2NTYC 3M8KA 2WE8A 5J5AA 2ADMA 1QU3A 1V3QE 3GT0A 1EGHA 1Y3DE 1EVJA 1KF0A 1Q50A 1T3LA 3DEJA 5A3QA 2LKDA 4ZU1X 1HNZB 2VDQB 3W0LB 4EW3A 3DLBA 1E7QA 1JWBB 3KLMX 3TZ6A 1M2EA 4A9AA 2DT5A 4JSTA 4KPGA 3OQPA 5EJ4A 1CTQA 3JRXA 4BV9A 1KKLA 4DJ5X 3UK7A 3ZU6A 1XK6A 2Q6LA 3TLKA 4MVXA 4FDMA 2IX3A 3FNEA 4JUAA 2WFMA 2XUPA 4ZT7A 5COBA 3ZDXB 4PTYA 1T5OA 3LC7O 3UJ7A 3FDZB 1P9OA 2I80A 2QRKA 4EB8A 2A0YA 2DFDA 1VKJA 2AN1A 4HB3A 4U4AA 5AKXA 3VVCA 4ZI7F 3C2QA 4BLRA 4QLOA 5C9ZA 4WCDA 3CE6A 3DDOA 4EMSA 5IT9A 1LRKA 1SOVA 2QTBA 4MMZB 3OFJA 2XUZA 4HRAA 4R0NA 4OHUA 4IAOA 5DSZA 5TQ2A 1C3VA 2HXYA 1QGUA 3SBEA 1M1ZA 2ORIA 1JR2A 3I5MA 3I8SA 5BUCA 3E15A 3L8FA 2I34A 5SZKB 2REBA 2QVLA 2VNIA 4DMKA 4IP0A 1Z4LA 4NAUA 1KAQA 2ZITA 4RC9A 5L45A 1NJ8A 3SFZA 3HSKA 3NHPA 4DA8A 4HVTA 3C97A 2HIMA 1EVKA 3H9BA 1HLDA 4OQPA 1Z17A 2OQVA 3ZX4A 3IAFA 2MDTA 4BJ6A 4DHEA 1T1JA 5LDDC 2OA0A 1OT5A 3DBVO 4JP5A 2HRCA 1UOOA 1XLWA 3L4BA 1P5JA 3OEWA 4ESOA 1GVHA 3FDXA 4L8LA 5CBPA 2D59A 1S2DA 5TQ0B 2Q3HA 4EQ6A 3GLGE 4LVOA 1ESEA 3B8EA 1U0RA 3SHTA 4RESA 3WRWA 3EGXA 5JCOC 2ZRLA 1R9GA 4OU5A 3EZLA 3MCVA 1KZ4A 3GEEA 3LYLA 1HFKA 1ZONA 3GXOA 4IZIA 1NJGA 2QRQA 1C14A 4GOJA 4QOHA 1NN0A 4DQUA 1HNXB 1AZSC 4P98A 1A7KA 4BYMA 1Y8QA 1SC4A 4TZ0A 1R0BA 2Z04A 2DHCA 5EJMA 2BKUA 2CXTA 2PANA 1XCBA 3BFJA 4DQVA 2D5LA 4HP8A 2IV3A 4NAVA 3WL8A 2OAGA 4CL3A 3MG9A 1XZDA 4EB6A 4MLCA 1LUAA 1RLOA 2NO5A 1NVKA 4NJEB 4FGZA 2Y93A 1YOVB 3TRFA 2JGJA 4O2AF 1TX4B 3CC8A 2OAQ1 2ZJ3A 3D2CA 3AB8A 1KJQA 3FPLA 1UKAA 3PHJA 4FBLA 3ORFA 4KQEA 3DZBA 4BE7B 3WYDA 2OE2A 3S0JA 5FBLB 1P77A 3CLSD 3GU3A 3MEQA 1L1RA 3P2OA 4K46A 4BVJA 3RFCA 1U0NA 3NORA 2WM3A 1U8EA 3CJQA 2AV6A 2W48A 1NRWA 2BTQA 2IPAB 3KX2A 4P3PA 3WGNA 4UNRA 1NWCA 1FUEA 1QHHA 2PHZA 4AP5A 3GPBA 3JRWA 1RABA 1IEQA 4PBRA 2OGTA 5JNSA 1D6SA 3RSCA 3URKA 1Y8CA 1Z6QA 4L8WB 4CF5A 5CVTA 2I2DA 1T8UA 2HWWA 3K09A 4B48A 1KPIA 3DBHB 1QYDA 3N8HA 3NBXX 5BY2A 1KRXA 3PD7A 4AMUA 2DQ4A 1HDXA 1ZCBA 4X90A 3INGA 3EGWA 4KR3A 1IM5A 3HBNA 1OFGA 1YAHA 2WF9A 3BIJA 4Y7DA 3SJAA 1IBMB 5GIOE 1TTHA 2EARA 4F71A 1FLAA 5TY0A 4RVHA 1PVOA 4RCZA 3U0BA 3PGLA 2O0KA 4DVJA 3HTXA 1OI7A 4P83A 1YR7A 5E1DA 3K71B 2QM0A 1KMHA 1KZ1A 4D9JA 1DU4A 1XZKA 3E2MA 3H2ZA 4X8LA 4MPRA 4CDGA 3WK7A 3HWX1 1NE7A 3A1UA 3ZU3A 4GQAA 4YLGA 1G0NA 2B8TA 3BREA 3MT0A 1CDEA 3LS2A 1X7WB 4E5NA 5AI4A 3WBFA 5K5EA 1GTSA 1JDJA 3HE3A 3NPMA 4M0DA 4Q1VA 1WS6A 3ET4A 5JS2A 3EDYA 3F47A 2NSJA 2P5UA 5AKKA 4BC0A 3EPRA 3CSUA 1KK2A 3AP3A 3OQMA 4ZOCA 5LMZA 5AM5A 5L6MB 3AI2A 1IY9A 1H2WA 3QVSA 4HNTA 4QLAA 3GA5A 3L6DA 3EIWA 2V3CC 2B69A 2FF7A 1CIVA 1SXJC 3MIIA 3QXCA 3ZV7A 4AULA 3AHJA 1CY1A 1RJ9A 3DE0X 1M6WA 1Z75A 4IDAA 2RSLA 3M6WA 3KO8A 3OPXA 2YIJA 2HMUA 3EF1A 1U28C 5ERGB 2AFHE 4PZDA 3R7WA 3HLYA 1XQYA 5KKAA 2OGWA 4YMVA 3JWEA 3SJ7A 2ZVPX 4TPKA 4LTMA 3VI3B 4Z54A 3GJ8A 4Q4AB 3B70A 4HQOA 1JQBA 4WN3A 3O4GA 4Z3KA 1OXMA 4GP9A 3I5AA 2Z56A 1K6JA 3OLZA 4KODA 3Q6MA 1GZVA 3WWPA 5BUSA 1QKKA 1Z35A 2PX4A 3Q7IA 4PSAA 3UMRA 1B3BA 3OFSA 1L7VC 1Y5IA 3V7FA 1B2RA 1EVZA 4L4XA 1UUFA 5IT0A 4PAGA 1UJ6A 3UMSA 5BMOA 3NAMA 4OHXA 1XRRA 3SG0A 1PKEA 3V4PB 4DQLA 4RTOA 4D9IA 3FMGA 1N5KA 1QIEA 2HKIA 2J07A 2GZHA 1AKWA 2HJWA 1ZI6A 2BCEA 2QMOA 2NUPA 3ADPA 3GUYA 3WIVA 4AZ3B 2WY2D 3MRVA 4HADA 3O8OA 4G0OA 3RKSA 4MMYB 4WCFA 4HDAA 4BKPA 5HS4A 2WNIA 5EIHA 4BGVA 2I2XB 1NBIA 4MQ5A 4MYCA 3ROGA 2OORA 5KTSA 2EW1A 3OLWA 2ZJOA 3AONB 3H5IA 1Z6AA 2ODQA 5K6AA 5HFNA 5IAJA 4V03A 1UP6A 3NJ8A 5I7WA 3MPOA 1I6LA 4TWAA 5KTKA 3VTZA 4UXJA 2IWHA 1FC0A 3LD9A 3OAAD 3QEOA 4QBTA 3X2FA 4G9EA 2PSSA 4F6LA 3IV6A 4IJVA 1KJJA 3AEYA 3WIDA 1TUBB 2H1LA 1K4YA 2XNJA 3SCZA 2B6NA 1I7DA 1ZH8A 2AC7A 1ECPA 3E61A 3HXLA 1KKMA 5GY7A 1RC1A 4XYLA 2H5LA 3OIGA 1DQPA 1P8AA 1U9JA 5KQGA 1QRDA 2A30A 1OASA 2KWIA 3EFBA 4QL3A 3IJ5A 4DQDA 1O87A 3KXPA 3HCPA 5KREA 3EE6A 5EJGA 5HCIA 4MUFA 3P4UA 1W8IA 4ZYTA 3DDHA 3EZNA 2AZMA 3IFSA 2H0RA 1U5CA 1P2DA 3ANXA 2A5YB 4FFDA 4D9MA 2R1VA 3IEKA 3N8NA 3DMTA 3W05A 4RZUA 1WRBA 1Z8DA 1RIFA 1E66A 5AKGA 3KTDA 3OA0A 1ZLYA 3OCWA 4IF4A 4J0IA 3QV2A 4I9UA 4GRIA 4L3WA 4XASA 3TINA 5JBQA 1I2BA 3NIWA 3U19A 3U7GA 1CR0A 1LDNA 3TPZA 2GS9A 3O4VA 1QHIA 2GN4A 5G4KA 4C4XA 1C41A 3CRQA 4QHTA 4WESA 1DJPA 3GPDG 5I8ZA 1Y0BA 3KR9A 4H4DA 4ZJYA 4AI6A 2J3EA 3FDZA 1EMDA 3KJEA 4ZXPA 3AWDA 3V8QA 1V1MA 1RQRA 1UZMA 4WADA 4X7PA 4ZAZA 4AO7A 4LXTA 1MV8A 5M2QA 1QH1B 5EEGA 3VOSA 1K7FB 4BV8A 4DGSA 1T6NA 4HZIA 3NTXA 3ZS9A 3RS9A 1X94A 3RC8A 1TVCA 2EOAA 5FXMA 1P9LA 3U48A 1J0CA 1WP4A 2Z0MA 3SSNA 4FJ2A 2O52A 3JQBA 3WGLA 3UMYA 2ZB4A 2HWXA 3NR2A 2P5SA 4CKYA 3GLHE 2ETXA 4X91A 5IH3A 4A6EA 1CE8A 4EHIA 1Z4IA 1DZ3A 4D81A 5BQ5A 4X95A 3J81A 3LRTA 1E6KA 2GN2A 2JGAA 3FMFA 4R05A 4KR7A 3KVRA 5DYWA 3KVYA 2GXSA 2QVXX 1TMGE 4I7EA 2EG9A 2DQSA 1JFRA 3RM3A 5BN4A 4CMKA 1U2DA 2IUEA 5I9SA 4ZGGA 3MXTA 3G9UA 5A7FA 5IW8A 2Y1WA 6LDHA 4FUTA 5MN4A 4TWBA 5C1PA 4JXXA 4F97A 2KQUA 5HZGA 3ZDBA 4H27A 2HRBA 4Y6OA 4QGGA 4I9NA 5FPHA 3GB9A 4KGXA 1J4AA 3GJTA 4JR2A 1NMYA 3AGQA 3EXIA 3T5AA 1G64A 2W6NA 1FRFS 5JASA 3THYB 1F20A 3K0CA 2JJ2D 1U98A 3CURA 3IAUA 1U3VA 4BVEA 5CDUA 1DC6A 1MORA 2E87A 3A4IA 3LCMA 4L8VA 5G0TA 5JCZA 1KYWA 3O92A 2PGJA 1UBTS 2FSFA 3CIFA 5AW5A 3SLRA 5IXJA 1E7MA 3G8AA 2PUBA 1CR2A 4QPPA 3GVIA 2CCKA 3B3QA 1A88A 2IJGX 4QVGA 4BX3A 3OC0A 1N7JA 4MV4A 4RLQA 5THQA 1BH2A 3CZQA 4NJEA 3RSSA 1KWKA 2AL7A 2CZGA 2Q6IA 4Q93A 3SSMA 1G8GA 4FJ0A 3WGQA 5LLDA 3K53A 1TEXA 2QB5A 2QTVA 1YFZA 2RFLA 3WLKX 2CBGA 4ER6A 1NW6A 2LCQA 5AJYA 1HTBA 1FRNA 5FEUA 2QLLA 4X20A 4JC0A 3I1IA 5EOVA 3B1JA 2FSHA 3ND6A 2OB2A 3VYSB 1EUZA 3LYHA 4JB8A 4RL4A 2XA9A 3Q6NA 2E4UA 5I3CA 4BFZA 3ZK8A 2QPTA 4UDOA 2Q45A 4HNQA 3WL7A 3THWB 3OICA 4G86A 5AM2A 3CU5A 4RKQA 2FUEA 2RGEA 1HFJA 1K8YB 2ZJ0A 2E55A 4ZQHA 4BO3A 1YKSA 5HPYB 3NHZA 2HSGA 2HMAA 5J23A 1ZNQO 5CA0B 3ZJVA 3PJDA 4G4JA 1O58A 4QDXA 4EHJA 4EVRA 3ESYA 3N5CA 4BKMA 3CXRA 1RQXA 1RQGA 3QTTA 3Q7EA 1KDTA 1P31A 2H7CA 3BWXA 5C7OO 1P1HA 2GASA 4PQFA 4DIBA 1LW6E 2OLEA 2BHRA 3CUSA 4FDUA 3AIMA 3HUFA 4GS5A 3L8HA 1N92A 3R76A 3STHA 3SC6A 4CIAA 3N39C 2VRNA 4ZCTA 3JQGB 2H2WA 1E3JA 2CNKA 1YRHA 4WNCA 1NSTA 1NG1A 3T3MB 4CWAA 4FMDB 4S1OA 5CLIA 5JVDA 5KWVA 1J99A 1IBCA 1DBIA 4YGYA 3ZNPA 3ZVRA 2DM6A 2WU4A 2PUGA 4COOA 4G97A 1IXSB 4B87A 4B73A 1N9GA 1DL5A 3SQNA 1NVDA 5KWEA 4K9SA 3F9RA 3FSGA 5AK0A 2ZR9A 4ZHQF 3P26A 1IHOA 3PHIA 5E9JA 3ZCRA 2IZ0A 4KLNA 3RDPA 3ITEA 3PZBA 4IFIA 1PL6A 4MUNA 4NCIA 4BQEA 4J0DA 2Y1FA 3ZWBA 1AMUA 2OV1A 1EWTA 4B3MB 5T7BA 1VMEA 1LTHR 3ETEA 3LQYA 4Q4AA 5DLYA 3C8HA 4IILA 2QTLA 1RQ7A 3AU9A 3GR6A 3IR6A 4OK5A 5GONF 5CAEB 5JDIA 1SQSA 3AVUA 4GOKA 4B44A 3VH2A 3PFFA 2AOVA 2WIDA 2ZR7A 4FX2A 4IV0A 3EUFA 4UVGA 3OIVA 3PFKA 3W6NA 5K0EA 1JWAB 3HVUA 3KJXA 1HSOA 3NU1A 4MV9A 5KB3A 2MINB 3LZCA 2O20A 1W30A 3THXB 1BN6A 1DG1G 1EP2B 1A1SA 2AD1A 4B74A 1VJTA 1W88B 1LDMA 3LPMA 3SM9A 1QVZA 4LJ6A 4ZJUA 1TI7A 1NMZA 4BJ5A 4B17A 1CVRA 3IR5A 1XVLA 2BUBA 1JB9A 2GXUA 1UBGA 5E4YA 1YQUA 3JATB 5HDQA 5A1JA 5GWXA 3PTLA 3LPCA 2VATA 1YRWA 2VCYA 1IMOA 2VRWA 3H0CA 2JC3A 2HEIA 3S2EA 4RIFA 1ZL0A 1OQAA 4BLPA 2G4LA 3NWPA 1LK7A 1NG9A 4YV1A 3UF0A 1YE3A 3JYQA 3U7QA 3ERCA 3VX4A 2QJTA 3EQ2A 2WU0A 3O4RA 4YDSA 2AVDA 3T35A 1KI8A 3HJNA 5DB4A 3U80A 5AIBA 4KXWA 3KE8A 1QQ6A 3C98A 1XHLA 3IQDB 3ILYA 3N87A 2ZRPA 2IP2A 3PQFA 4RVGA 4GDFA 2YJGA 3R4CA 3RUEA 3T5MA 4DC9A 1SUIA 1H9BA 4IMJB 5TMBA 3JYOA 3K15A 4BGUA 4D3DA 4IQ0A 4XM1A 2Y2UA 3K9BA 2GESA 5LZ8A 3UTDA 2B0JA 4Q47A 4LJLA 5DNUA 3BHIA 1W2WB 4IDOA 4JBLA 4E08A 5JD5A 2EG5A 4GBJA 3NM5A 1CZLA 1L5KA 3TZHA 1TL7C 2A5JA 3MTIA 3RT7A 5TDHA 2M6LA 4BRSA 5KQLA 1AN9A 3ED1A 3KZNA 4EEKA 2ONYA 1V5WA 1YR2A 5LZ5A 3DUWA 3K6SB 1F0KA 3G17A 4IJ6A 2QWXA 4MB2A 3IPRA 2MYTA 3RYFB 4RDIA 2O5RA 4F8YA 4DV3B 4JJ6A 2ZSAA 4NMLA 1UPFA 4Q1BA 4GKBA 3MFYA 1AKQA 4EUNA 3CO5A 4ALIA 1QGAA 1OC2A 1WDWB 3DBLA 4O4LF 4ZVTA 2O0HA 2XD9A 2AYYA 4IDNA 4F5YA 4L4YA 1Q1ZA 3PR2B 1SR8A 1TK3A 3DMYA 4EMTA 1VI2A 3FSRA 3WLTA 3ZY4A 5HTKA 1QQAA 1KI3A 2OEPA 3L8GA 3WYGA 3CW8X 1MA0A 1QF6A 1JQDA 1WMBA 4Q0MA 3N2GB 4CQLB 1Y9JA 3F3YA 4W1SA 5IVIA 3RRMA 4JT9A 2I3BA 5L4NA 4OQFA 3WV4A 2Z5GA 4BQNA 4NBLA 2AMLA 1M1XB 1O4WA 5AVXA 2EFHB 3D6JA 1RJDA 4LYAA 4TUYF 1SC1A 3TVDA 2LDXA 3W78A 3BH0A 2EKLA 4S1WA 1RI5A 3FYUB 5H0IA 4D0LB 5EAIA 5J40A 2P9EA 3N8IA 1TYDE 1M74A 4FDVA 1RW4A 2VZEA 3ROTA 3N1UA 4MYHA 2P4HX 1BS2A 2VAMA 3MQ2A 2ZRCA 1DMSA 1JALA 2I3GA 4YEDA 2AFIB 3FPBA 4IIFA 2JLRA 1SBHA 2G9NA 4Y6LA 3GMSA 5FFFA 1MJHA 4OQQA 1ZCFA 3E7FA 4QTZA 1PO7A 4TV8F 1SB9A 3OM8A 3Q4GA 3ZI4A 1LPSA 4F21A 2PUWA 5GAJA 4D98A 2QJWA 1K8ZB 5C80A 4QARA 5ULLA 3SVZA 3AUSA 1V8DA 4P0QB 1OFIA 3EG9A 2PCJA 5F52A 1JEAA 3WWEA 4D26A 2A0WA 2QU8A 3N2EA 4MW6A 2A3NA 1TZ2A 1M2NA 3RS8A 1Y4AE 1BXGA 4NCKA 2NUTB 1TW2A 1SCDA 2YZGA 3QUBA 4N9QA 3ONVA 4PF1A 3REOA 3ZDZB 3OZSA 2IBMA 2VDPB 2D0IA 2FWMX 4WVFA 2CLDX 3C7AA 3C1AA 3G5UA 2AMJA 4O1HA 1N57A 3BFKA 5EWLB 2N75A 3LI2A 4N0PA 2IYNA 4DYHA 1R8JA 4B09A 2XWQA 2W2LA 4WBNF 3H5WA 3L7JA 1ZITA 1P7ZA 2R5NA 2H5JA 4IXNA 3D6FA 1MFPA 5K4GA 1UDCA 4XXHA 2G7ZA 3CRNA 2WD7B 4FDTA 4W6ZA 3T1NA 4RQAA 2ZCUA 1HFEL 5JDIC 1Q7CA 2I8CA 2JEYA 3K0EA 4PTZA 3NBKA 4KGZA 5LMNB 1DC7A 3BQ9A 3I1FA 1SM4A 3E1SA 3NV9A 3QU5A 1FFBA 1PDOA 1LPAB 1TEVA 2G0AA 2H57A 1SUDA 2MWMA 1N6HA 2W2VA 4OP2A 3WX0A 4CTNA 1Z0KA 4V0RA 3DEFA 2PGDA 1Z4OA 2R8OA 4MVJE 5LD2B 1UQRA 1VZ2A 1SELA 1I3CA 4N1AA 5EQDA 3GUCA 3F7OA 2M6KA 5SV2A 3WS7A 3KVNA 2C20A 2ZTHA 2IYLD 1YA6A 1JU4A 2CBZA 2AIRA 2UUCB 1EWYA 3BE8A 1OYYA 1NUAA 1UPUA 2C95A 3IPLA 3JPYA 2HHLA 2MMGA 1M8GA 4G56A 2W8ZA 4NHEA 5FWNA 3LWDA 2Y6UA 4CM4B 1Y37A 3ENVA 2GYYA 2B8NA 3CBQA 2EGGA 1WE2A 4POAA 3HCAA 2HU5A 3PD1A 3GP8A 1YBMA 3D1LA 3THWA 1ZH6A 2V4ZA 4FNAA 3ONDA 5JCOA 2EZ9A 4MRAA 1H42A 1EVQA 1OPRA 3ND7A 4HDNA 5KX5F 3MGAA 1ZMRA 1EA7A 3DKIA 5CA0A 4FFSA 4H7FA 5LVAA 1NZFA 5ALNA 2FG5A 2F4VB 3L84A 2LD4A 1EBFA 1RU3A 3DVRX 1DKMA 1TM7E 1GRQA 2WSBA 3IV9A 1G21A 3T3EA 1G1MA 1GGVA 2COKA 3ECAA 3U37A 3IPAA 1QH8B 1DKOA 1PLLA 4FGLA 4NENA 4ARVA 4AKIA 1H6DA 4AUEA 1QS0B 3GEIA 3DO5A 5DBOA 4AURA 1ZVVA 5K3EA 3JQGA 3IOEA 4REQA 2VPPA 1LV8A 1P5FA 5CH3A 5JJIA 1H5UA 3PVZA 4GI2A 4RK6A 1N2SA 1XOIA 2F9LA 4ROSA 3V2UA 5KU7A 1PQWA 3WB9A 2Q49A 5TR9A 3WLPA 3VKUA 1EINA 4M49A 1KERA 2C2XA 4ER0A 1AO0A 4Q12A 2IH4A 4DYDA 3WK4A 2YHAA 1NC1A 4U9HS 4CR6A 5TS2A 5EGNA 3PNMA 2CLCX 3C1TA 2BFEA 3O75A 2PJZA 2YHIB 4KG7A 4UHJA 1GPMA 3V1KA 1N33B 3SF0A 1XQWA 3N07A 3NRCA 3STXA 2VKQA 4I1PA 4IHJB 2G1KA 3BZBA 2LBPA 2JS7A 3GJZA 5COAA 4FYMA 4NOJA 4RBNA 1FFWA 3TSOA 3H11A 4HWRA 4BEVA 5JATA 4ZKDA 1TZKA 1SUPA 3NPAA 4B3SB 3PLNA 3TI7A 1YV9A 1E1DA 2I7TA 1TQ6A 4LRYA 3ZE1B 2X5OA 4ZRNA 5B3LA 3K1AB 4PLPA 5KTYA 2EKZA 2JD2A 3QEJA 4WOJA 1XE3A 4ZMSA 2VHWA 4MVYA 1DSSG 1WJGA 1YVRA 1Z4NA 4L73A 2YOGA 4DLSA 1NW5A 1TFRA 4J3JA 3UB4A 4ZEVA 1WY7A 1LSSA 2C8JA 1HX7A 3Q11A 2O2JA 2MINA 3CNHA 3TE7A 1UXHA 1NP3A 2GVZC 1Z5OA 2VDVE 4NE7A 1YVEI 3BL6A 3M6LA 4KNYA 2V0NA 4DR2B 2QQFA 1UKEA 1Z4MA 3RVMA 3IBFA 2ODPA 5IAAA 3H1BA 3KWJA 2EKPA 4UDYX 1AGXA 2OK7A 4I6JA 3O82A 1NI5A 1T0HB 2AJDA 3HU2A 2VPXA 5REQB 5HQ3A 3D64A 1E6EA 3JATA 4D5EA 3K0SA 4EPTA 2F8TA 1P4GA 4RPIA 1D1QA 3Q9LA 1JTFA 3AI3A 1K0FA 1OU0A 1SXJA 1V8FA 3ESQA 2QW0X 1L5YA 2B83A 4KXNA 4J9VA 4BP1A 2A4KA 3TX2A 5I7HA 4CF3A 1E3SA 4QU5A 4KXQA 1JFVA 3LT2A 1U28A 4UFOA 3Q3GE 5ELLA 1L5HA 5EERA 2O2EA 3RSOA 3A4YA 4HPWA 4X97A 4DB4A 3HZHA 5I45A 1P1IA 1MB0A 1DFIA 1DUVG 3F6RA 4H6VA 3ABIA 4EL5A 4NBKA 2YXNA 1AC5A 1YCFA 3W6UA 3WKCA 3K70B 2QN8A 3MMPA 2D0PB 4NSNA 4AMZA 3E8XA 4MUEA 1K68A 1SD2A 3F3SA 1CUDA 2P9BA 2DG2A 3VZBA 1Y48E 4DRXA 3KZMA 5ILGA 1R6AA 3SF8B 4ZDKA 1I01A 3W5UA 4C7KA 3BD8A 2I9PA 3LSTA 3TXAA 2VP3A 2PX6A 4PLZA 2ZUBA 4RMGA 3IURA 2BFCA 4ZAWA 1U0JA 2J1LA 2GJKA 4ZYLA 2AI3A 1JUDA 1P75A 4C4SA 3IQWA 1SGWA 3K6SA 3QY9A 3T7AA 2MSLA 1WVIA 3RYFA 1P0MA 3HR7A 2WJIA 3PFCA 1EI9A 1QGYA 3G2HA 4K87A 5ALMA 1ETUA 5FUBA 1VKOA 4H7EA 3UWSA 4EJFA 2O8CA 3PJRA 2O2YA 1ZGAA 2W2XA 1HPLA 3C7DB 2DBQA 1V39A 4AJLA 1CNMA 4NF2A 1R6UA 2JIPA 1KYYA 2EYQA 5JQGF 3L18A 4MV3A 4TXJA 5AXBA 3TW6A 4JJZA 3W5JA 5EZQA 1TIPA 1UPCA 1D5CA 3I32A 2ZBEA 4GP7A 1Z0DA 3OE4A 2BM0A 3PE4A 4HLCA 1XNHA 5I7UA 2C3OA 4L5CA 5F5LA 1Z7EA 1DKUA 1WKBA 2FQWA 3KAPA 3M5DA 4XGQA 5CD9A 2BFBB 4MRPA 4BNYA 3SBXA 3WBKA 3X1JA 1D1SA 2XT0A 3ZHBA 1NOKA 3FMIA 1W29A 2HA6A 4Y67A 3UFXB 3RAPR 4F04A 5KNCA 1NVEA 2FSVC 3HEMA 3FNBA 4IF6A 1E2BA 2WFLA 3WMXA 5LBIA 3BA6A 3I0NA 1NY6A 4JU8A 2NAPA 2QUHA 4C6SA 5J43A 1EUYA 1EPUA 3Q7QA 3D5TA 3TNDA 2PX0A 1NF3A 2O9JA 2IPOA 1YK0A 5BOVA 2ECKA 5EYPA 3AHIA 3KM0A 1DEHA 2RGNA 2VK1A 4PX9A 2WJAA 1K8RA 2WIAA 5LQMA 3S27A 4QTUB 1U90A 2SKCA 2REOA 1ZS9A 3KLPX 3WWYA 3UG6A 2ZM6B 1SKQA 2O8FB 4NVRA 3QZUA 3NUQA 3QKTA 1TA9A 1E1LA 4RS3A 4RSRA 1E69A 3PUIA 3RAGA 3WGHA 3ANYB 4C2UA 4YRJA 5T5QA 2GEBA 1Z0ZA 3D1JA 3CSSA 4L5AA 5FBRB 3VTAA 5TC4A 2OSBA 5HG0A 1TYEB 4IIXA 5E7MA 1GADO 1JFSA 1C9NA 2RG1A 2O2GA 1T2NA 2ZJ1A 1L9XA 3M9XA 3VV2A 3G0CA 1HORA 5E3HA 1P1FA 3JAWB 1RXIA 2QSYA 3O9MA 1HDZA 1OBCA 1Z5PA 3RBVA 3VNSA 1U9YA 3B8HA 3SI7A 4BNMA 3LUKA 4CM7A 1SXHA 4XPZA 3TLAA 2BY4A 3SIPA 4FCCA 2YN4A 3HYCA 1WHTB 3H2SA 4GSKA 4M1OA 3ROEA 1TAGA 4GX0A 1XCPA 3NHWA 721PA 1AS0A 1WQ1R 2H5IA 5DM60 2FR1A 3T9DA 3OTHA 2VSFA 4W8GA 4DG8A 5M29A 5M7EA 2FPXA 1WV1A 3NC0C 1PJBA 3NKVA 4N5DA 2HLPA 3OJCA 2JBAB 2ZSDA 3P4XA 2R8EA 3PR3A 1VPVA 1ZGJA 2RI6A 3HABA 4RZHA 4CM9D 5K99A 4TVSA 1UC8A 5KX5A 4Y1GA 1MRZA 5GPBA 3E27A 3OOJA 1XMOB 3AC0A 3TLJA 4X64B 2HIAA 2QGNA 4LKRA 3D3EA 4YJ2F 2XV1A 2Q27A 3FSGD 4R0MA 2B1RA 4CM4A 1FX1A 1GP2A 1DARA 2CXUA 4ZO4A 1Q0RA 5DTJA 5BWMA 1U2TA 4LDZA 4PAOA 5ADHA 2P9TA 4MCAA 2G9RA 4HTFB 5BXYA 1T15A 4MWDA 3N2KB 1YULA 3EXAA 2BBOA 3CUTA 5E4JA 3NJRA 3VI4B 1ORWA 2ABWA 3BXPA 2HTFA 5CBKA 2QDXA 1KSGA 4HMOA 3FPGA 2FK8A 8MHTA 2A84A 4GZ6A 4NCXA 1A50B 1DQYA 3INRA 4G67A 3PNOA 1RLJA 2PJRA 1JXQA 4YRQA 4JQSA 1P7WA 5I7FA 1NV9A 2Q2VA 4JFRA 4CEHB 4YRTA 2G1UA 2C04A 3HA3A 1TXGA 3HB5X 4D97A 1KEZA 2A9QA 1KDYA 2GJAA 4NIMA 1N5MA 3LX8A 3D0KA 5AI9A 4IHQA 3KSUA 2YWGA 4Z49A 3SS8A 1GY8A 4BX8A 3LDGA 1P1JA 1D6JA 2Q9BA 5FPQA 3UY4A 4CIYA 1E2JA 3WKEA 4P3XA 3KL2A 5EE1A 5TPWB 2PXHA 4J7XA 4BS9A 3BWBA 4B4OA 1P2SA 1OIXA 4LYYA 3GNSA 3MOSA 3A6PC 5MFPA 2ORED 3DZDA 4GPD1 2VCEA 5DI3A 3G2NA 3L0DA 3GRPA 4CV2A 3CN7A 4BO2A 1W47A 2CDCA 4PR0A 4MGYR 2FCRA 3N0RA 3MWEA 3WL5A 1VHJA 2I1LA 2YHIA 1KQGA 1ZRSA 4HGOA 3FF4A 1KYVA 2H4YA 2QQ5A 1CRPA 1X80B 1ZK2A 3IH5A 4PG4A 3E3AA 1KXJA 4JGGA 4IIYA 4TLAA 1YVDA 3RSZA 2VH2A 1XRNA 2J3LA 4OAPA 4BVGA 3VRHA 4G25A 5ESWA 4YI3A 2AXNA 1MOZA 4ZVVA 1GL6A 4C07A 1QAQA 4DDKA 4F1JA 3QVGA 1T4CB 2JRLA 3HXQA 3K1AA 3RS0A 1V35A 1G38A 3KTFA 1IL0A 4YMIA 4UTRA 5ISMA 1O9BA 2D1RA 2GQ0A 3PGKA 3WQSB 3FNGA 5JROA 1VG1A 1XKTA 1CVIA 3DVSX 4AW9A 2H2HA 4PR3A 2HAEA 2XB2A 3U4DA 3KLNA 2VP5A 1X14A 5BWLA 3ZU5A 4ZYYA 3S2IA 1DE0A 2Y8EA 3DVQX 5REQA 4LXXA 2BEWB 3V1YA 2FGJA 2XPCA 3W6OA 3IPYA 5CITA 3K2QA 1XTZA 5HOQA 5IN4A 1PEKE 4DA0A 1XF1A 3EGDA 3H4TA 5AVVA 1UJ2A 4R3NA 1DMRA 1X38A 3IE1A 1SC3A 3BTSA 4E51A 3QXXA 3RYIB 1G63A 1OC4A 1PDVA 3DOCA 3PQCA 4HNSA 5F7JA 2J41A 2K87A 3VR2D 3WSTA 4BU1A 3WA7A 3D8UA 3LUPA 3UJBA 3W34A 3WIEA 1IVSA 2DRIA 4BPRA 3IA2A 2O7NA 3L01A 4OHMA 1V1RA 1RHRA 4J6FA 4NPAA 3RIEA 3BCRA 3EQ7A 1ISIA 1C0LA 1Z25A 2W0SA 4DDMA 2QMEA 4V02A 4ZAVA 1U8UA 5DK4A 2X0DA 3ZTTA 1TT5B 4FIDA 4A0RA 4CJXA 4DUGA 3LFHA 3D81A 3E22B 1DOAA 1M6VA 2H85A 2X6TA 3TOCA 1Z88A 4D41A 4BNHA 1KU0A 3MN1A 2Q7OE 2Q3CA 5K2MA 4Z1MD 3PWZA 2Z1DA 4Y2TA 3GQBA 1FTNA 1AQYA 2QXYA 2DKOA 3R77A 3ASZA 3AHGA 2R4TA 1WDLA 1ZSNA 2CK3A 2P78A 3IIIA 4J0FA 4IDEA 5F5NA 3AEQB 1OIVA 3EB9A 3JD1A 4XD2A 4E5SA 4J91A 4MUJA 3V5NA 2E7ZA 2NYUA 4CCSA 2PZMA 2YZ7A 4LCJA 3W8RA 1YUMA 2A9OA 3HBLA 1W5SA 4ALKA 4PXYA 2OHHA 1FUUA 2QTCA 2FQXA 4F9GA 1ECJA 2ZOSA 4II3A 3IUEA 4JEIA 4HNHA 2ATEA 2ISQA 3DMRA 2J9RA 4QECA 3U13A 2QLFA 3K1JA 3UK6A 3L6RA 3MAAC 2W2LD 1W8DA 3DUFB 3F8WA 4PSVA 5KTTA 4S04A 2BKAA 3RUHA 1GQSA 2A7QA 4JT8A 4CKWA 1X0XA 2ECQA 3G7NA 2B34A 2F3PA 4UFNA 1S3FA 2AUNA 1RXEA 2HK6A 4HHEA 4AY4A 1NVBA 4B2LA 5KYUB 2VK2A 2ODTX 2DULA 2BGUA 3KUUA 3I9KA 3PENA 3V3TA 3U4QB 4GICA 3TRJA 2NAFA 4G6ZA 1AK2A 4RV4A 5KYTA 5F9FA 1NBAA 1ZUWA 1WSAA 2YBEA 4KW7A 3O4JA 2VPTA 1FQWA 4DLYA 3X1MA 5C46F 2ON6A 3AR3A 1MO5A 3EYAA 3ON5A 4YJHB 4FKBA 3BMXA 1EYZA 4BX2A 1V8PA 4MYRA 1B1AA 1TVKB 2Q1SA 3QVXA 4HEA6 3RIMA 4LGVA 3GRUA 1L7XA 7AT1A 1S1MA 1NNI1 1XQ6A 2XBUA 2J0EA 3OT1B 1WUHS 1EA5A 2NM0A 1U2PA 3Q8XB 3QVTA 4XH9B 1B3RA 4EG8A 4EP1A 2O8FA 1VJ5A 1ZXBA 2DWCA 3OJFA 3PHBE 4KIFA 1MJGA 3RARA 2ZRBA 4JCOA 1N2EA 1OD6A 2E37A 3FE2A 2PV7A 2R5WA 3FUXA 2J3KA 3MUNA 1RYDA 4MUIA 5ARBA 1Y6RA 5HIAA 4K0KB 3DL7A 5F33A 1ZD4A 3DFKA 4XGRA 3WHIA 4MVWA 2ZUTA 2D2VA 4DLZA 1UM9B 3IODA 3AJ8A 3F5SA 2CL7X 1FF9A 1STOA 4O25A 4PG6A 3I1JA 3C3CA 4RENA 3A1EA 1AQJA 3M34A 2ZQ5A 5A71A 2PD4A 3JAWA 5DXAA 4C04A 2XYPA 4YPOA 4GOND 2VBIA 5KTMA 4YJ2A 2H2DA 1ECGA 2PKCA 4IGEA 5HP4A 1PNRA 3GLFE 3ZVKA 3NXSA 3IAS1 2P68A 1VLLA 4NI5A 4ZIRB 3FLEA 4Z4QA 2XUKA 2BN4A 3F74A 3SEQA 4IFEA 4LF9B 5IANA 3D3JA 4HMPA 4CQMD 4JXZA 4OTZA 4ZMRA 1S2NA 2B8JA 4K9PA 4ALLA 3NKFA 5CCDA 1N6RA 2Q5EA 1Y5LA 4D4GA 3AOEC 2WF5A 3PYLA 1WKCA 1Y1SA 5EHXA 3RUDA 2V58A 3L6EA 1JSXA 2HA5A 1E60A 2DFPA 3K2EA 3BRWD 1SRRA 4UD6A 1CUGA 2NO4A 4PZPA 1MF7A 5EZYF 3ZV4A 3ZWYA 4DV6B 3O2QB 3B52X 1S0UA 4OXNA 4EB0A 2XUJA 1I3MA 2SHKA 3A9UA 3KJIA 4F4CA 1D2NA 5KWJA 1L5QA 3ZWOA 1HGXA 3AGPA 4EA9A 2JIMA 2YRFA 3W6PA 5C8VA 1FU7A 2GO7A 2IEBA 4NU8X 2YUTA 4GO1A 2CNBA 4LRUA 2BHLA 1B8VA 5DN6A 4A91A 1F8FA 1J21A 4P53A 5IMSA 3GGCA 1N9ZA 5HRCA 2R8PA 3ETCA 3HRIA 3PWTA 3GQVA 3TM5A 2FRDC 3V1UA 1A76A 4RJIA 5ENDA 2IIPA 4ANFA 3C3WA 4R83A 2GYVA 1WP9A 2GGSA 1IQUA 1BXRB 1E5LA 1D2EA 1X8XA 2D5IA 2ZATA 3DOFA 3IT3A 4DLUA 4HCJA 4TKUA 3SDZA 1V5IA 4OLHA 3UJ6A 3WA6A 1B41A 16PKA 2HUNA 2PKXA 3FZGA 4ML3A 4NU5A 4H3VA 3P2IA 4RELA 4WX2B 3UK2A 2GK7A 1DQSA 1OTYA 2JJ1D 5I7OA 2DFTA 4OQEA 3CKMA 1QMPA 2UYYA 3IP3A 1WBDA 5J59A 2Y1CA 3F7MA 1J8VA 4A23A 4LC9A 3VJMA 3IS3A 4LMPA 2P30A 2WYWA 4BMDA 1NHWA 1VSBA 5DWQA 3VSEA 1VFPA 2JLAA 3BZWA 4NYIQ 2IHUA 4OQZA 3R9KA 3TQOA 4YB8A 1SXJD 3JVEA 2YXEA 5BUQA 1RADA 2OUIA 3L7KA 5CPFA 2Z6AA 1E62A 2GX6A 1S2IA 4XTRA 2NUAA 4HGRA 2ECOA 3M2TA 3NBFA 1NAHA 4CPDA 5E3IA 2IGBA 3LAWA 3SE0A 2E21A 4YH1A 3D59A 4EGCB 1C4WA 1SC6A 1JHAA 1DAFA 2FEPA 2GCPA 5FL7D 4L51A 3UENA 2LIVA 2ODAA 3GBSA 4L08A 3WK8A 4BP8A 4ZZ0A 1X80A 4WKOA 8OHMA 1R6BX 5CGQB 3REQA 5EIFA 3B78A 4X6YA 3UHJA 3UQZA 1CP3A 2AKYA 2PWAA 1RR6A 2V6IA 1J5EB 4HK4A 4RF5A 1ZQ9A 1Y1PA 3QTBA 4O1IA 5B3JC 2IPLA 4K5QA 3SNHA 1YBVA 2JGDB 1FMCA 4HDOB 2R86A 1T4CA 1SZPA 1XXHB 2R8YA 4RVNA 4A16A 2R00C 3GGPA 4MHTA 3BH7A 3TB4A 6PFKA 2GOYA 4JLVA 1AQIA 1GTRA 1DBSA 1PWYE 3PNYA 4NFHA 5IAGA 5C8YB 2O2CA 1YZVA 2WD9A 2GPWA 3TNLA 3VC7A 2DUJA 4LZPA 2HB6A 1JIKA 4IDPA 1NC3A 3TTXA 4CKZA 3L7DA 3IMGA 2BH9A 4U5QA 3RPEA 1GZ3A 2I2CA 3NT4A 5K8LA 3FSEA 3V55A 4JI3B 2BEWA 1A77A 2D4AA 2VH1A 2FG7C 3MA0A 4QU9A 4AY3A 1YI1A 5FP0A 1SU4A 1XJQA 1XZLA 2XUQA 5CNMA 4X1IA 1OFUX 5FYDA 3S2UA 4M0FA 1ZRHA 1JHUA 4IDFA 1IDOA 4LE0A 4Q7QA 1DAMA 4J07A 1YJ8A 1YNSA 2P0AA 4WECA 1R0KA 3RK4A 4BE9A 2P62A 4U2FA 3EZ6A 4HN9A 1OX4A 3T0IA 1YK1A 4KQGA 3WICA 4OX9B 1R4NB 1OYWA 2YY7A 4LZJA 1J2JA 2HHHB 1M2KA 1ISSA 4UTOA 5LDGA 1XPRA 5ITSA 5DXJA 2ZE7A 1QPBA 2QYHA 4JJKA 2LRHA 3VZDA 3MXOA 5KNCD 4UBKA 3VKVA 4DLRA 5B64A 4CDMA 3EPKA 4QDKA 1X2BA 2Q0SA 1BQEA 3ZCSA 4G01B 3AETB 4G1VA 1GHTA 1T9GR 4RTJA 5I4KA 4C7VA 5LXTF 1NVVR 2CJYA 4XIYA 5LPNA 2CMKA 3AF2A 1O54A 4KPYA 1J00A 3E22A 5FV7A 4M0KA 4QSMA 1Y8RB 4TV9F 3ZDAA 2Z2YA 1R0XA 2VT3A 1G0OA 2O2ZA 2WWVD 1YGPA 3RU7A 3K0KA 3FWYA 3H9QA 2F1JA 2HCTA 1ORVA 1YASA 1ZJ6A 4RMIA 3P2MA 4WOKA 1SKAA 2FY8A 2VJMA 3JPWA 4WFQA 1F12A 4M1ZA 1I5EA 1SA0B 4QJ4A 5GMOA 3T38A 4V0LA 1YRYE 2C7VA 4OA5A 5FORA 4XUCA 5IMBA 3VYTB 3NNSA 4CXMA 2F1KA 4O4HF 2J59A 3FLBA 1WTCA 2O7QA 1SHKA 2IS1A 3EZ7A 3SOZA 1TKBA 2BT4A 2VUIB 2VWHA 3OQIB 4Y2QA 4Z4HA 3DFFA 1SQ5A 5BN5A 1U3TA 4GLOA 1OY1A 3CPEA 1XF9A 1T91A 2H7YA 4I9FA 1LI7A 4N03A 3V4LA 2AR7A 2FN7A 5CFMA 1E8NA 3DUFA 2NU8B 3T5PA 3Q7SA 5B4TA 1EGMB 3V2GA 3DDZX 1QRUA 2PNFA 1I13A 1UOQA 4TXLA 5EE9A 3WO0A 1OVMA 4NBVA 5BSEA 5F2KA 4AM8A 4YWJA 2C1XA 4RLFA 1NMEA 2PRJA 4ZI7B 4WLUA 1NYRA 4Q15A 1HDRA 2XZPA 1R2QA 3BGWA 3DZIA 3TZQA 1RS0A 1DJNA 3HKEA 3K94A 4PLWA 5DNVA 3PLAE 4IWNA 4AB1A 1AQNA 3FGOA 4ENWA 3O47A 4J75A 5BOSA 4X3CA 2XZOA 1EXWA 1W59A 2CXNA 2VR1A 1Z6ZA 1ITZA 3R5JA 5SZHB 2FEWB 4OB6A 2JLZA 2YVAA 4RKFA 3AEXA 1JL3A 3I6BA 4EBBA 4IOMA 1DXHA 3WZMA 2VNSA 2YJ4A 4MAFA 5HR5A 5LOVF 2K2QB 4RXTA 1PFQA 4B83A 1O0CA 4NK5A 1Z5GA 2EZTA 1GA6A 5KZMB 1OKKA 2AK3A 1KEUA 4ICIA 1C1DB 2Q21A 3DFUA 4IG9A 4LJRA 3OIDA 4L2IA 1ONSA 1QWSA 3IKJA 3VNVA 4QZVA 1KYZA 1Q21A 2B4QA 2ID9A 4DJJA 5L6LB 4HZGA 2CV2A 1OFTA 4K2AA 3VPAA 3W2IA 3H17A 4EG0A 3I9V6 2BFPA 5GOZA 2ZFUA 1OAOC 2VJAA 3DWIA 1BYIA 2FSVA 1UZUA 1XD9A 3ECCA 3GEHA 3LYAA 4MEJA 3FROA 4G5OA 4NYJQ 4O29A 4TYMA 1GU0A 1NI3A 2G0NA 2HPZA 2QM7A 3HUDA 4N3BA 3TXXA 4B3FX 3O8BA 2JLUA 1YL7A 4QRHA 1ULAA 3LP5A 1ZPDA 2IDJA 1KS2A 3KXLA 3NYWA 4QAQA 1Y8AA 1ZH4A 2WA1A 4LHSA 4ZIRA 1Z2OX 2RAPA 2RHWA 3AI7A 4YMWA 4C08A 4HDMB 4D4KA 5GINE 1VE6A 3G02A 4BRZA 4Y6PA 3G88A 1ATZA 8ABPA 3B2QA 4LZNA 1U9IC 4XE5A 3KOWA 4UMDA 4QULA 5BP7A 4O2RA 3I9FA 1K98A 2CHVA 2B9EA 1XKXA 3T9FA 4MEAA 5KOJB 1B2LA 1ISGA 1QDLB 1SPXA 3GJ3A 1FFCA 3V7YA 2GM4A 3RJ5A 2G17A 3FRHA 1M7GA 4KDEA 5KYGA 5I4IA 3ZVNA 2F6RA 3R41A 3VDRA 4YVFA 4D0SA 1E6MA 4XZ3A 3F71A 3IJPA 1FSFA 3GBVA 4QOIA 1C1XB 4R54A 1GNQA 1BWQA 4KREA 2WJGA 3I6IA 1OPXA 4BWYA 3PEEA 4PLTA 1XNJA 2Y9PB 3A06A 3RAJA 4RA6A 2DECA 1RI3A 2BZ0A 1NBHA 2Y2VA 1OYOA 4ZO6A 5CB4F 2WTMA 3FNQA 4XLLA 5ALQA 4YT2A 4LQCA 4EY8A 4LGYA 3R9XB 1N9KA 4YCJA 5HUJA 2AEJA 4PHFA 5CRIA 4U7DA 3LZ6A 4KAFA 3B53X 1K6EA 3ZHYA 2CBXA 3CZMA 1V7PC 3Q3EA 4IJUA 5IN5A 1L3CA 5KOHA 1VSQA 3EXEB 4G0NA 2PE5A 4H6PA 4MP6A 2QKYA 1UXGA 2R6FA 3GLVA 3JARA 4JY7A 4BMSA 2WSSD 4BB6A 2FPSA 4HZUB 3KAKA 1H6AA 5CEFA 2P0YA 5LU9A 3ZXSA 1T3HA 1UDXA 3NWJA 2P2GA 1EKXA 4E6PA 3KEGA 4RHCA 3VHXA 1DRKA 3ZI7A 3QF4B 3LHIA 2CFSA 3QKRA 4EG1A 5ED4A 1D2AA 1JR3A 1JQJC 2BI8A 2VAPA 4GGPA 4HH1A 3AESB 4JX9A 2VK8A 2PWZA 4GBMA 4D3ZA 3G8BA 3KT6A 5EINA 3WYAA 5KNDH 2VDJA 3Q1LA 1NX9A 5BXQC 1S5PA 3C3EA 4FBMA 3RFVA 1QPZA 2IE8A 4H35A 1Z5ZA 1JX6A 1RWVA 3I28A 4HYTA 3ACDA 4X1KB 4EX6A 1KMNA 1ZCJA 4IH4A 4TS1A 3L4EA 2CD7A 3K8OE 4FEYA 2XOXA 3B6EA 1R64A 3EVFA 4POOA 1TUIA 4OPMA 5J2UB 1G3QA 3T61A 4LOHA 3M5WA 1PK8A 1EP3B 1JVSA 1K2WA 2P5TB 5F9HA 3LIPA 1CNEA 1E5TA 4RM3A 3PFGA 4NBNA 4A73A 1CP2A 1NIJA 1UK9A 1XDZA 5CFLA 1RFGE 1QJCA 4YIKA 2HSZA 5F76A 3PCRB 7REQA 4H4CA 1EUCB 3E9ZA 4LXIA 3Q9NA 2HK9A 3JQAA 4IX9A 4ARZB 4QEZA 2OZVA 3GT4A 3FGPA 4S35A 4JLBA 2I4RA 3H13A 3ETJA 4M37A 1WLYA 1XTVA 1VIYA 5H3LA 3HCOA 4ZPXA 4EFNA 5JU6A 3I9LA 4ISBA 4II2A 2R62A 5KAMA 3J7TA 2GAIA 3NHUA 1JWLA 1NSYA 3PHCA 2IUFA 4CMGA 2J3DA 4QNRA 4ZA2A 3LCJA 3MWYW 5JTUA 1V9LA 5ALPA 1JEQB 3H6KA 3LT4A 2E89A 1IN8A 1ZHFA 5CNJA 5CPBA 2F8SA 1OFUA 2DZDA 4FCVA 4MR7B 4A3SA 3OURA 3A3OA 5B7NA 4L5JA 2GBPA 1K63A 1V5FA 3EPPA 4P3YA 5HZKA 5LXTA 4P58A 2BFDB 3ASUA 4BMZA 4BMYA 1NVFA 2I33A 2DKFA 3G8YA 4GSYA 4YA6A 5FAXA 2XA2A 4FYIA 1HUQA 2ZJYA 4BCCA 3NBYC 3WWCA 3QXSA 4G1CA 5L9AA 2OHGA 5IK2A 1X7DA 4HX9A 1G41A 3ZTWA 2VA9A 3D4LA 2XMBA 4BO7A 4YT8A 1VGVA 4RCVA 4RKWA 3FD8A 5J5CA 2H4ZA 1OVGA 3SU8A 1AQUA 1BC5A 1Q12A 1YBFA 3G6WA 1C7RA 1YMUA 4Q4LA 4RNCA 3PPYA 1FQKA 3DZKA 1JBEA 2AC4A 1NW8A 1F9AA 3V6LA 5BSWA 2FEOA 4Z4FA 1YRAA 3STVA 1JHVA 2WHEA 3SYMA 3UT5B 4O4HA 2SECE 4JP8A 3RRJA 3NOOA 4DS3A 5M04A 1AS3A 2NU9A 3UWMA 3WGYA 3L8MA 3U6KA 1G60A 3U7JA 3PKJA 3IR7A 4U39A 4J9UE 5ALZA 5H02A 3I2HA