2AUTA

Crystal structure of lys154asn mutant of mature apha of s. typhimurium
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
208
structure length
208
Chain Sequence
TLNPGTNVAKLAEQAPVHWVSVAQIENSLTGRPPMAVGFDIDDTVLFSSPGFWRGKKTYSPDSDDYLKNPAFWEKMNNGWDEFSIPKEAARQLIDMHVRRGDSIYFVTGRSQTKTETVSKTLADNFHIPAANMNPVIFAGDKPEQNTNVQWLQEKNMRIFYGDSDNDITAARDCGIRGIRILRAANSTYKPLPQAGAFGEEVIVNSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords AphA
publication title Structural and mutational analyses reveal the functional role of active-site Lys-154 and Asp-173 of Salmonella typhimurium AphA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 72
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2autA00
5AM3A 1ZRMA 3WKEA 1Z4PX 5AW1A 1L6RA 2HOQA 1ZS9A 3QU7A 1ZD3A 4ZEXA 2YN4A 2MU1A 2C88A 3N07A 3OCVA 3BWVA 5AI6A 4E88A 3AR2A 2FUEA 1EK2A 4UARA 1Z4NA 2GO7A 3FZQA 1TJ5A 1CR6A 1RMTA 5AK5A 2ZBDA 4GIBA 2B1QA 3F9RA 3RF6A 3AR7A 1K1EA 4UMDA 3UMCA 2YMLA 2ODAA 4UW9A 3QU5A 5AICA 2WF5A 2QYHA 2IOFA 4XOUA 5AKJA 4HGOA 4UAVA 1QYIA 3B8EA 1RLMA 3SMVA 3ED5A 2GFHA 3WKDA 3NANA 1VJRA 1T5TA 4RETA 5ALTA 3WKBA 2CFSA 4YH1A 3WK7A 2I33A 5ALXA 2G0AA 4CF3A 4Y2JA 3QYPA 2B30A 2ZOSA 3ZVNA 4KYTA 3FPSA 3MN1A 5ALZA 3QUTA 4CF5A 3QLEA 4DW8A 3ET4A 1WVIA 4BEVA 3GYGA 3OCUA 1Z4OA 3A1EA 1U7OA 4QQFA 2HEGA 2R8EA 4BNDA 3UMGA 2CFTA 4AS3A 3HYCA 4KX5A 5AKYA 4UM5A 1WZCA 2HF2A 2ZBFA 1IWOA 3QX7A 4HYTA 4XE5A 1RMYA 2YJ6A 5AK6A 3OCYA 5AKEA 4H1WA 2FPUA 3KBBA 1X42A 4UASA 4UMEA 2WF6A 3QNMA 3AR4A 3NASA 2HHLA 2P11A 1J8DA 3AR5A 3L7YA 1RQNA 5ALDA 3KD3A 4BX3A 3I6BA 4BEWA 5AI9A 2C8LA 4C4TA 1L7MA 5AW5A 1SWWA 3D6JA 3PDWA 1JUDA 1Z4IA 3W5AA 5AM0A 3N8GA 2Q5EA 2GMWA 1Z5UA 4MUMA 3AR9A 4KN8A 3OCZA 3ONNA 3ZTWA 4B6JA 5IS2A 3OCXA 2YJ5A 3ESRA 5AKKA 4FYPA 2I7DA 1MH9A 3I28A 3I1YA 4I9GA 2B8EA 3NAMA 4CF4A 3ZWDA 3WKCA 5AW7A 4QJBA 2Q4TA 3P96A 4HGQA 1NRWA 3N28A 5A3RA 5FP0A 3L8FA 2C8KA 1Z4KA 5ALMA 3L8EA 2Q4RA 4YCNA 2HX1A 1T9ZA 2YJ4A 1QQ6A 2D2VA 3EPRA 1J97A 1CQZA 3ZI4A 4YIKA 2RARA 4OFZA 1WPGA 4CNQA 5AIBA 4BYGA 5E0OA 3FM9A 4EENA 2DQSA 3SKXA 1SWVA 3SD7A 4CE6A 3FGOA 4Y2XA 2WFAA 5AKXA 1RKQA 1RLOA 2EATA 1FEZA 3DAOA 3PCTA 1TJ3A 1Z5GA 3IB6A 5ALSA 3FVVA 4EELA 1O08A 3L1UA 4DWOA 3CZ4A 5AVXA 4Y2PA 5AK4A 4J03A 2B82A 3IRUA 3B9BA 2HI0A 3TLMA 3QU2A 4ZEWA 5ALIA 3KC2A 3QUCA 5AI4A 3UM9A 3EWIA 2R8ZA 1LVHA 4L6CA 3WK6A 3W5CA 5ALVA 4UMFA 2CFRA 3HLTA 1L7OA 4NABA 1U2SA 2HSZA 3U19A 5AIAA 4HGRA 1RQLA 2FI1A 2RB5A 4I9FA 5ALKA 1XVIA 4Y2TA 5ALOA 5AW8A 2YMPA 1ZJJA 5ALNA 1SU4A 3L8HA 1ZOLA 5AVQA 4KNWA 5ALRA 4G9BA 4HAIA 4NAVA 5AKLA 4DCCA 2GHQA 5AM5A 1RRCA 2FPXA 1YNSA 2RAVA 3SKYA 1NF2A 2P27A 5AW2A 3L5KA 5IT0A 3SHQA 2X4DA 2WHEA 1RDFA 1QQ5A 2WF8A 3QXGA 1YS9A 2VKQA 3BA6A 2BDEA 4YIHA 2G09A 3M9LA 4OCZA 3QUBA 3I76A 1XPJA 3WKAA 1Z4JA 4BKMA 2FPSA 4C4SA 5ALYA 1AQ6A 2YJ3A 4PNHA 2HCFA 3WK8A 3FPBA 1VJ5A 4XPZA 1L7NA 2I6XA 1ZD2P 2JAUA 3EF1A 3WGVA 1Z88A 1YV9A 4KNVA 5JJBA 3L0BA 2IYEA 3KOOA 1Z4LA 2IOHA 2JARA 4MWOA 2WM8A 3ZVMA 3MPOA 1T5SA 3ZX5A 3ZW7A 4Y3UA 3PGVA 5AM2A 5ALWA 3QUQA 4AP9A 5AVSA 3ZTYA 3NRJA 1N8NA 1LTQA 3NUQA 3WK5A 5AK3A 5AVRA 5ALQA 3WK4A 4KX3A 3CNHA 3MC1A 1QH9A 3U7FB 2OA0A 4UU0A 5ALGA 3E58A 3S6JA 4UU1A 4GXTA 5IT4A 1KYTA 4JB3A 4BNDB 3WGUA 2W11A 4Y2RA 1VFPA 3L1VA 1RKUA 3ZU6A 4FE3A 3A3YA 4AS2A 3L8GA 2CN1A 5ALEA 5T41A 4BBJA 2NO4A 2PR7A 2PQ0A 5AW3A 2P9JA 2W43A 3IJ5A 3QU4A 5AM1A 3OPXA 1EK1A 5AI0A 2YFYA 4NWIA 2YBDA 2B0CA 3ET5A 2NYVA 4ZEVA 5AVUA 5AM4A 3U26A 2OM6A 3A1DA 2G06A 1ZD5A 4Y2SA 5AVTA 1O03A 2ZG6A 5AVZA 4UMVA 2IOFK 4YGYA 4IG4A 4BX0A 3ZX4A 5AKIA 2OBBA 3K1ZA 1ZRNA 2AUTA 1NNLA 2G08A 2PKEA 2FDRA 2G07A 3OTQA 3PGLA 5ALJA 3W5BA 3B9RA 2G1AA 2ZBEA 1L7PA 2EAUA 1ZD4A 1WR8A 1RLTA 3U7EB 5AW6A 4L6AA 2ZBGA 2I55A 4HGNA 3U7GA 5ALLA 4G63A 4UAUA 2HDOA 3QU9A 3MMZA 3ZWKA 3R09A 5AW4A 2AGVA 1TJ4A 1YJ5A 4Y2YA 4Y2QA 4C4RA 4EZEA 1PW5A 3SF0A 4XQ0A 2GHTA 2B8JA 3U13A 3WK9A 2FPRA 3E8MA 3L0CA 3ESQA 1RMQA 1N9KA 1TA0A 3KZXA 4NV0A 1U7PA 3QGMA 5AESA 3NALA 4OD0A 1Q91A 5AI8A 3U7HB 3AR3A 5A3SA 3VAYA 4FFDA 3W5DA 3SLRA 3OCWA 1U2TA 4OHFA 4EEKA 2HO4A 1RKVA 2AH5A 4EX7A 5A3QA 3ZUPA 3M1YA 4F71A 1RC8A 1TE2A 2G80A 5AW9A 2O2XA 1XP5A 5ALHA 4BX2A 2O9JA 3E81A 4HGPA 1Z4MA 4J2TA 5AKHA 3A1CA 3DDHA 1U02A 2I54A 3AR8A 2JAOA 2YMQA 4RESA 3UMBA 5AVYA 2R8XA 1YMQA 5ALUA 5AW0A 2BY4A 5AVWA 2AMYA 2I34A 1S8OA 2YMMA 2WF9A 5AHXA 1RPZA 2OYCA 3DV9A 3RFUA 2NO5A 4Y2VA 5AI5A 4YCLA 2QLTA 1YDFA 2FPWA 4NFLA 5ALPA 3AR6A 3R9KA 2JGAA 2R8YA 1F5SA 1QQ7A 2YY6A 1Z4QA 2MSNA 2ZXEA 4F72A 2WF7A 1S2OA 3N1UA 3E84A 4EX6A 5ALFA 1L8OA 2EARA 4Y2UA 4JDPA 2FEAA 3ZVLA 2RBKA 5AKZA 3EF0A 2C4NA 2B1RA 4YCMA 3DNPA 3R4CA 4UATA 1Q92A 3N5KA 2BDUA 2JAWA 2HF7A 1Y8AA 2C9MA 2FUCA 4L57A 2W4MA 3J7TA 3KDPA 3NIWA 5AKGA 5AVVA 4DFDA 2IA5A 1L8LA 2P69A 4O8CA 3L0YA 4IFTA 4UM7A
chains in the Genus database with same CATH superfamily
3CB4A 3SQWA 4L7QA 3ZDBA 2OWDA 1JKMA 4QUJA 1SK8A 3L1HA 4HG2A 2X5NA 2V6MA 3DCJA 1QDEA 2HOQA 5EKSA 4MRMA 4M8IA 2VZ0A 2VZ8A 4IF4A 2D5BA 4QOGA 5EKTA 1SFRA 1TFUA 2RH5A 2NUTA 5JRDS 2AS0A 1MENA 1EK2A 1HV8A 1AT1A 3VOBA 3RBXA 2I7CA 1E0SA 3V4OA 4XVHA 3EOAI 1Z0AA 1X3LA 5JQGF 5KB3A 2A9JA 4GIBA 3OEEA 4WUVA 5IASA 1MC8A 2AD5A 2GNPA 4BQFA 4S1OA 2C96A 5IBCA 2DQ4A 1VE1A 4U4AA 2WD9A 4Y6QA 1ZD1A 3BSYA 3TIGA 3CIFA 4J3FA 4NI5A 1DX4A 3UH1A 4IUDS 1F2UA 3OFJA 4R81A 4GKBA 1WOYA 1XN4A 2P5YA 2IZ5A 5KHOC 1BYIA 3I53A 2XNDA 3O92A 3BE5A 3KQHA 3P2JA 3RK0A 3ENKA 3FDJA 4JD5A 4TRJA 3NHLA 4F5YA 5G41A 4IJQA 1I2BA 2G6TA 1HDIA 1GITA 3EOZA 1T13A 3HUUA 3I6MA 4YBZA 2DPLA 1RW4A 1M2EA 3ETDA 3KB8A 3PJDA 1VDZA 5EZ6B 1OW3B 2HYIC 2DBRA 1GR0A 3HB0A 3QOFA 1MO6A 2QTRA 1QDLB 5G0UA 2OO7A 2BFAA 2UYHA 5EYPA 4OOEA 3W8NA 3CPSA 1PBNA 2IF2A 2PRSA 1G291 4J1NA 3M5CA 1PT7A 5FTMA 3K15A 3PGMA 3MXTA 3PKZA 3KTDA 1NBME 4Q1DA 2FLVA 3KP1A 4NOKA 4FFWA 3QELA 3ZLVA 1CC1S 3MLBA 5ICSA 1PV1A 2DT8A 3BMXA 2O7SA 4KVZA 4GOJA 1F12A 4MO2A 5FWYB 3X1YA 5GZ6A 1VIYA 2FGKA 3ACCA 2XODA 4OXXA 1QIFA 4D2IA 5F7ZA 3H18A 4MIYA 3FYUA 4G9EA 4RZQA 2HEGA 5CLHA 1R27A 4X60A 3RVSA 4L8WB 2ZB2A 3CEHA 3VPCA 1GTSA 2Q9BA 4G36A 1CYDA 4GI3A 4J6EA 1PNQA 4BQPA 6REQB 1COWA 1ELOA 3N2EA 4TV9A 4H18A 4R84A 5JEDA 5L40A 2UAGA 4X65B 2JLZA 2GSDA 1NPDA 1XXHE 2VHJA 1G98A 2NTNA 3OOHA 4IHJA 4X45A 3IOYA 1SBHA 3F4BA 4PZDA 5DX1A 5HKOA 3H3XA 4XWTA 1V43A 2Z58A 2QG9A 4KQIA 2ODBA 3CF2A 5GZ3A 4E5UA 2CLCX 4B6PA 3ROEA 1MB0A 2XYRA 4LJ7A 1WMBA 3MPUA 3TEJA 2DUMA 1VM6A 2RGEA 1AQNA 3FUVA 3AR5A 5IJAA 1IPHA 4B2YA 1SVLA 3FF1A 2FP4B 1WUIS 3OVMA 2QAGB 3U09A 3IX7A 1MDBA 1P6UA 4HYEA 1F2VA 2WWXA 3IP8A 4KAAA 3CW2A 1TEVA 4RGBA 4MARA 5JSZA 4MPJA 1AY0A 3OZBA 2O4CA 4K6FA 4L5AA 4B43A 2BM9A 4E2ZA 2HWWA 3AV0B 2FJ0A 2BZ0A 1GRVA 4OQFA 2IGBA 4YECA 1DADA 1Y9DA 1WIWA 2PPVA 2FUKA 1JXMA 1VGRA 2BLNA 3GLVA 2WHRA 2WRZA 1Q1ZA 3BE8A 3ZHTA 3RT1A 2JDIA 3M83A 3NUGA 1RWOA 2ZKIA 1CR2A 2GCGA 3HR8A 3K0AA 5JXHA 4HL6A 1IXZA 1HFEL 1BGXT 1LW7A 2HRCA 2J7PA 3COZA 1G3QA 3ORFA 4I4TF 5EHXA 3OM8A 3IHWA 1T3GA 3AFMA 2PX8A 2FR0A 2HJWA 2IPXA 2Q4TA 2XMRA 3AHGA 3D8UA 2FPKA 2CYAA 1O0SA 3KEGA 3AU9A 4V0SA 4E22A 1LF0A 3GQVA 1E6WA 1Y33E 3L82B 3N70A 5KWVA 4O5AA 3FKSA 4P0QB 2X14A 1JDUA 1PW7A 4ZN6A 4PLWA 1QMPA 5K2MA 1YDEA 4DMHA 1GGEA 3ENZA 2QT1A 5CLLA 1K63A 1C3XA 1MH1A 2Q2QA 5IX8A 1ZLXA 1E5QA 2J4FA 2ZDHA 3FCUB 3BMNA 4FMBB 4H0NA 4GYKA 2DWQA 2RGNC 1I2CA 4HBZA 4MW1A 4PIPA 1TYZA 4WXYB 1VB5A 1GPMA 2VH1A 1Z34A 4UULA 3IBTA 3PNVA 3SKXA 1XZDA 1JZQA 2DFNA 3PGA1 1NBHA 4CG1A 1E6EA 1C0PA 2WFAA 3T5PA 5F73A 3R3YA 5LJIA 4EKDA 2C20A 1MX9A 2GCNA 2HW8A 2JFQA 2YDXA 1Q19A 3UJAA 4RU1A 4C2BA 3HY4A 3W9YA 2XE8A 1R0KA 2FEOA 4EYSA 5DH9A 2PVSA 3DVRX 3GIDA 1YE3A 4IGKA 5DP1A 3UK1A 3WDMA 2Q9CA 2H0QA 3EZYA 3FMIA 5AK4A 4XLLA 3ZC3A 4Q21A 3UJPA 4JP1A 3B9BA 2QRZA 5F3RA 4BWVA 1YB1A 2ZZNA 2HI0A 4QASA 2PX0A 3KOXA 2XVXA 1Z3CA 3VX4A 2WSIA 5IEJA 1C1XB 4LXIA 1PIWA 1HE4A 2VDVE 3FDZA 3M1IA 5KMGA 4PPGA 5JCOA 2LD4A 2LR0A 3D3JA 1KJQA 3IP9A 2FWMX 1M5TA 3BIWA 2Q5CA 3FJYA 3IV7A 4EGCB 1OZ0A 4MQ6A 4ADSG 2VH5R 4AMZA 3R0XA 3HU3A 2IEGA 1JLMA 1YT5A 1Z8FA 2RJNA 1CY6A 2WDPA 2YZ7A 1N8TA 1PWYE 3IUPA 3ZGNA 4BO7A 2XDWA 3LY5A 2VF5X 3AC0A 5A9TA 4GLOA 4F5EA 1HFWA 2I0FA 2WHYA 3O5AA 5BNWA 5HMLA 9GPBA 1SUEA 1IXKA 1MOZA 2JBAB 3EFOB 4UE3S 3TUZC 1R74A 4KBFA 5CT8A 4BRWA 5ALOA 2PZBA 3CJTA 4PSDA 4PX2A 1A50B 2R1TA 2DFVA 3G0DA 1G8YA 2B1GA 1R9MA 4LAFA 1ISRA 3A7EA 1KP9A 1E3SA 2DBQA 2XYVA 4QBFA 3S8EA 5KOHA 4MW9A 1QP7A 1N8KA 3Q88A 4HAZA 5DLQC 1ML3A 1ZSVA 1ZOLA 3P0JA 4KNWA 5CFPA 1TIPA 2A9PA 2ETXA 4LJSA 3FHCB 5CXSA 5ISMA 4M21A 3OD1A 4KXVA 4OAPA 1G2PA 1XZQA 1W9MA 3LKVA 3AONB 4KPFC 3MTDA 1MAHA 3CZCA 1NOKA 5BQ5A 5G3YA 4FYVA 4D46A 5T64A 1QHYA 1OXXK 4D0NA 4UJ3A 1SM4A 3EVFA 1C8KA 1PK7A 3E1KA 5EHGA 4YAUA 5IT0A 3VGPA 3HXQA 1TVEA 3QUAA 4N3GA 3QFRA 5FTJA 3D3EA 2DM6A 4H1HA 4NE2A 5AWFC 2WF8A 2MYUA 5I6DA 2WTAA 5B1DA 4KW7A 4IV0A 2J31A 2G88A 1BX1A 3VR3D 3A58B 1GILA 3DLCA 3C14C 5U9CA 5HTKA 2YVQA 1R6UA 1MF7A 1Z4JA 1B76A 2WZDA 4Q48A 1Z2NX 5D3MB 2VZLA 4FC7A 4PNHA 4IX1A 5T3UA 4S05A 4IDOA 3CB2A 2I2BA 3F7TA 1HO3A 2I6XA 3ZHYA 4NONA 5AXAA 3RRJA 1IEXA 1OBVA 1RI1A 1U2GC 2WFLB 3H6GA 4ED9A 2D5LA 5HQTA 5JD6A 1Z88A 1YV9A 2PQMA 2YCLA 1V1RB 1P9NA 1CP2A 4TTVA 2CLKB 2PU7A 5CXQA 4B3TB 3TL3A 1U6IA 2D3WA 1T8UA 2XA1A 1HEIA 3JD2A 3ODPA 3OJOA 2I1QA 2CVQA 4IY1A 5JD3A 1L4LA 4DA8A 3ER6A 4RC9A 5IKMA 4CM9D 5E9JA 5AVSA 4KFUA 1VPEA 2BAGA 1L7VC 1LTQA 2VUIB 3GMIA 3QBTA 4GS5A 5EPOA 1IAQA 5KKNB 3ZHSA 5L6MB 3WK5A 3O9MA 5AK3A 1EVKA 2C2YA 3GF4A 5DSTA 2AR0A 16PKA 4RLFA 5JJIA 1FNMA 2DWOA 4DRXB 3O3MB 4XZ3A 1RWMA 1QH9A 1XMSA 3PKIA 4PPFA 3WLEA 1Z5NA 4UU0A 1B6GA 4OXIA 1UBHS 3KT6A 3NCTA 4M9SA 4GXTA 4BFZA 1EE9A 2BGUA 4H31A 3MJVA 3WV5A 3AJAA 1OX4B 4JB3A 3LKBA 1VGVA 4GZ5A 4ZK6A 5LSAA 2X6RA 3UB2A 1H2EA 4MVJM 1ZR2A 1VFPA 3PGKA 4C2UA 1WXGA 4Z99A 1QIHA 1RKUA 4P98A 621PA 1GU0A 2HDWA 3A1UA 2F1KA 2HMUA 1P2VA 1DQSA 5LKRA 2Z9BA 5CT6A 1W4CA 1XI2A 2G76A 5DW3A 1YUBA 2PR7A 3QFCA 4O0LA 4XRGA 4IWNA 1AD2A 2I62A 4JI6B 2B4QA 3L0DA 2HK6A 1X9HA 2HK8A 1DPFA 2I76A 3K0FA 3K2BA 1MEOA 1Q0RA 2AF4C 1O94D 3I2FA 1ZC4A 3VTFA 3FZEA 3WJ1A 1CPYA 4HUQB 2P79A 4A2QA 4HX2A 2AC7A 1F14A 3ZDYB 3B3FA 3WNBA 1QWSA 4X92A 5JWOA 2IYRA 3ETNA 1SIOA 2ATXA 4TTAA 3K16A 1PJRA 4QGAA 1X14A 1NU8A 2FSVA 1CUHA 2Q8QA 1VQ1A 3D6NB 3QNUA 5BOVA 2HHAA 5HF6A 3NXSA 4ARZB 4OI0A 1M6WA 2BFNA 1TDJA 1TYDE 3VVLA 4HSEA 4CV1A 3OMWA 4QA9A 3VR4H 1Z83A 1E79D 4ZAVA 1KFEB 3F0TA 2JF0A 7AT1A 4DN6A 1RZRA 4ERNA 1NRJB 3ZXSA 3Q5DA 2FWPA 4YJHB 2HL6A 4L28A 2AW3A 4EMBA 3HFSA 1ZBDA 1M6EX 2DFTA 3BXGA 3K7EA 4PAMA 5ALJA 4Q1BA 5AFSA 5FTKA 3ZHUA 5B2FA 3COJA 3EBLA 2J8ZA 1K3FA 5EJIA 2O8BB 2ET6A 1IH8A 2C94A 2PAAA 2XSZD 3DOEA 3PHLA 2GRUA 3TECE 1FMCA 1M2JA 3R5XA 1ZO8A 1MO2A 4DYVA 3PQ5A 3D6UA 1GUFA 3IBCA 3ZPXA 3B1VA 1CIVA 4UAUA 2JZCA 4IZ6A 2IUUA 1OQAA 1ZCJA 3KXLA 4DWJA 3RYCA 1VRWA 3O8OA 3G9XA 3R09A 4O4LF 2PZLA 3ZOKA 4ZICA 2X1LA 3WL8A 4KWIA 4MLDA 3PRHA 4FZJA 4TWJA 3F73A 4TKUA 3VR5A 1E9CA 2D13A 4M22A 2R68A 4OJNA 4P36A 4DLWA 1XWWA 1FUKA 4E12A 1MHPA 1IHPA 1QAOA 4O4HA 4PG5A 1YJAA 3RLFA 1NJGA 1NT2A 5KVQA 3JQCA 3RIMA 3PBKA 5HOQA 2IXGA 3LY7A 2HBYA 2FE4A 2PLWA 3QGMA 3RYHA 5FAXA 4HB3A 4EMUA 1KI7A 4PC1A 2EXXA 4TKVB 1SG9A 4OQLA 5FA8A 4B6QA 4C0AC 3CURA 4N5IX 1K6JA 1GG8A 3R20A 4MUYA 4TXJA 2YZNA 3CVXA 4INPA 3MGKA 4LZNA 521PA 2BFDB 1RPNA 3I32A 4Y1EA 3WY9A 3QW4B 3WB2A 1DZIA 5GOTA 1RI2A 3EHEA 3U4MA 1XQ6A 1UBCA 5ITWA 1T0PA 2NO0A 4NBTA 5MN4A 3K0SA 5AUQA 3NPAA 1SPBS 4AF8A 3QVTA 5KOIA 3G5MA 3RSZA 5JD5A 3VJKA 5AW9A 2OCXA 2V3WA 2WG0A 3E9YA 1H4VB 1Z07A 1BU5A 4HMPA 3R7WB 1SKQA 1TYEB 1EX9A 1ZK1A 2V98A 4D82A 3JVDA 3KR2A 4M8LA 1EMDA 1VSQA 1V8OA 1VMAA 1UPTA 4F4DA 1ZH0A 3CBQA 4HEA1 4GDFA 5DK4A 1QHFA 3ADBA 5J3JA 1BQ3A 1GFWA 1U0HC 1GWNA 4UBOA 2RGUA 1FMJA 1FRZA 2CXOA 2R6DA 5EKXA 4JI2B 2GK3A 1TEZA 1SCAA 2F1IA 2P35A 2Q0QA 2FG5A 1D4OA 3JRNA 3R41A 3TLKA 3U9TA 3JARB 1ZQ1A 2ZSUA 3HVIA 4NCXA 4HH0A 4YRPA 4YMHA 5CFZA 3K94A 3QTLA 3C3JA 3PHIA 3IPRA 2YR0A 1AJEA 1RRPA 3IE2A 3JQ9A 3STWA 2IHJA 2CMGA 1ZI6A 2ICAA 4LOIA 2OXTA 3RAPR 4CR7A 3F9CA 3JQ7B 4BVLA 3HJFA 1KU0A 1QGED 3TRKA 5TQ0A 2NO5A 1V2HE 4C4OA 4O4IB 3I9OA 1NI4B 3M4XA 3SYNA 3VRHA 4TZKA 3CQ9A 4NFLA 4L4SA 4WGGA 5JOQA 1F8YA 4MIKA 3R9XB 4J6FA 1JDZA 4PS0A 1KVSA 2C2BA 3DB1A 2YW2A 1SUDA 2PUBA 1T36B 1WCV1 2HJRA 4TWAA 4COOA 4G0XA 4E5MA 4QYTA 4KE6A 1XMOB 1WOMA 3TUJC 3QIAA 4BFSA 1UC5B 4C7BA 2D1TA 3G02A 4BVFA 2DTEA 4JDPA 2WUVA 2Y1EA 5DXJA 3KZVA 2CDBA 2B6NA 2JCVA 3VR4D 3THSA 3GLFE 3IO3A 2B1RA 3ZV7A 1RQ7A 1KZHA 3B89A 3OFNA 4FMPA 2YFKA 4B7XA 4A82A 3KJFA 1JWLA 2NTEA 3I01A 2WUFA 3MS7A 4UCFA 2GWRA 3Q3IA 2TS1A 4NTZA 2C2GA 5AVJA 1AH2A 1EB9A 2EKBA 1M2KA 4V39A 4O3MA 1RKXA 4MGHA 1C2YA 2P69A 2FZVA 3SR4A 4E6PA 5J4VA 1J2JA 2Q2WA 1NBMA 4Z5XA 1NWCA 4TKMA 1XE3A 4BU1A 3A2NA 3EXG1 3TOZA 4CQJA 3ETHA 3BMCA 3KJIA 2OYRA 1KU6A 3D4NA 3QEMA 1T4CA 4FYMA 3MHPA 4WFJA 4N0PA 4F4CA 1NA5A 1IJEA 1HDZA 1PL8A 1ZS9A 3LF1A 3PEWA 1R8QA 1I30A 2GUWA 1U99A 4W9RA 3ISVA 4TTIA 1SKBA 2CF5A 3GN2A 4S24A 4XD7A 2GN6A 1CY4A 2PCJA 2ZJ5A 3FZQA 1NT4A 2FRXA 1HZZC 2ZT7A 3HRHA 4OI1A 1JHZA 4XQGA 3I37X 4R9RA 1FQOA 1P8JA 3L4JA 4BN4A 2B1QA 1N0HA 5HBGA 1X2BA 3I83A 3LX8A 1DVRA 1XXHA 1WNTA 2JGKA 4TUYB 4U7FA 4ENUA 1CYEA 1K1EA 5FJIA 3TB4A 5H82A 5LD2C 1SVUA 2V7UA 4LY6A 1Q84A 3G2IA 2TSYB 3I4LA 2E48A 2O1SA 2X9GA 3EZXA 3FI0A 3KYJB 1QK5A 4HOYA 4M98A 4YRDA 3RYFA 4OQZA 1DFGA 4H3KB 4W1SA 4YJGB 3SMVA 5BVHB 2LVBA 2IIPA 1LQ2A 4M46A 5FJJA 5K03A 3II6X 4PLCA 3KZCA 3EUFA 2A57A 3H42B 1IK4A 4EVQA 4UDOA 4D25A 3MJRA 4ZJYA 1D1SA 4QT0A 1O5TA 4GC5A 1T5HX 3UATA 1M1ZA 1TIKA 2JJ1A 4CMGA 2RD2A 2FX2A 2HT1A 4GWGA 3WLMA 4DCMA 3KDAA 1ECGA 1I51A 3KQQA 2ZOSA 3MRXA 3DHYA 4FYXA 3FPSA 3F4LA 1CVRA 3ABOB 3DHVA 1M72A 4E08A 4CNBA 3C3WA 1DBQA 2P8SA 1OIWA 3ONEA 1E7RA 1BAPA 1K08A 2Q5HA 4ZAGA 4G5GA 4NJMB 4ERXA 5CAEA 3O1IC 4WX2B 4ZVRA 1QC5A 3J81k 3AY6A 1VHQA 1JR3D 4CM1A 1TB4A 1LK5A 4LF4B 1RT9A 4BNDA 4ALKA 1JR6A 5DW0A 1XIVA 2G9UA 4J90A 3TMAA 1D6MA 2XGSA 3HYCA 5T57A 1BS1A 4AMBA 4Z3OA 4A8PA 4D9JA 4OGWA 3TLBA 4LXHA 4HAXA 3U7IA 1TX4B 2IXFA 1SCQA 5HR5A 2C9DA 4JYPA 3OSZA 4W5OA 3WTCA 2AN9A 1ZCBA 5IULC 1QR6A 1RMYA 4WZAE 3HCNA 2ZR8A 1UC4B 1C0KA 1UIMA 3WLJA 5IH3A 4F7WA 3T9EA 2FHPA 2WWYA 2W2TA 4DG9A 2VNKA 1E1KA 4B3MB 4FJ1A 1A9QA 2EQ5A 2VXOA 1YL5A 3OPYA 3UXYA 2WILA 1GRQA 2WF6A 4TXLA 4W4TA 2Z83A 4AP6A 5BWLA 4RCZA 5J2TB 2BWJA 1PFUA 3I3OA 2O8FA 2CL0X 2C7GA 1JIKA 4HQKA 2R7NA 1LS1A 4R68A 3IPCA 4YXWD 3U3ZA 1MOPA 3D6JA 4HAOA 4EKEA 3SS8A 5FUQA 1SC3A 1C4XA 2D0PB 2VJBA 3MWDA 5KYWB 2I7TA 3NWJA 3S28A 2FMXA 3D7KA 1AB5A 2OFPA 2ODQA 1ABFA 3EF3A 3EWNA 3L1IA 4KQMA 2J0QA 4KN8A 2R2GA 2NVUA 1U7ZA 3G59A 4YAJA 5D85A 5FI1B 3N58A 3OTOB 5EWMA 3HXOA 4LJLA 2IYNA 4V0QA 2BELA 3PLRA 1K68A 3N2GA 1L5FA 4DWWA 3QG5A 1UL1X 5JBIA 3OIVA 2UVDA 3QXCA 3GDOA 1Y3BE 4AD8A 1RACA 3D81A 4PSVA 4FM9A 2I7DA 1YQWA 4R6WA 2N75A 3MGGA 4TLBA 2C2KA 3F3KA 1HQCA 1VKJA 2OYSA 1I3NA 2P2LA 4KOAA 1BCRA 3W2EA 2O0JA 1U6JA 2QJRA 3IUNA 5CA0B 4Q03A 4R1LA 3OEWA 4TXMA 3WLOA 3TBFA 4DIBA 4LRWA 1Z7EA 4XASA 5CNMA 3JV7A 2RI6A 2FRVA 2F8TA 2YL2A 1KORA 1GGVA 4YMGA 2Z1DA 2GM9A 3FETA 3GJ3A 4NU5A 4ARUA 1IQPA 1T4GA 1O97D 4B33A 3N86A 2P9BA 1YB2A 5A7FA 3TN7A 1QG2A 2E1RA 4YIKA 1YQGA 3O95A 4FFRA 2GX6A 3M6UA 1M1YE 2H4YA 4BKPA 1IAVA 4DMFA 4KL8S 3HYSA 5BSUA 1DCTA 1AVTA 2AG0A 3G5LA 1KJNA 2JFHA 1RQGA 5A04A 5LJLA 4GPZA 1FMTA 2C5EA 4JBWA 4OTZA 4S0ZA 1NULA 3IALA 5IXJA 1J99A 1P7YA 3KB6A 4WT7A 1KZ7B 1A7KA 3HZOA 4N7RA 5TPWA 1AO3A 2QTLA 4TSRA 1IY9A 3WXMA 2JFPA 3ZCSA 1O9BA 4YMTA 2E4YA 1XTJA 2GEDA 2XB9A 5DV9A 4NYJQ 3ZEAA 2HK7A 2UZ3A 1CS0B 1XLTC 5CD9A 3UW1A 4WUTA 4WI1A 3X1DA 1RFGE 5JNRA 5C32A 1T9BA 3IRUA 3S55A 4MICA 4ZVVA 1YO6A 1H9CA 4U7PB 4AI6A 2L69A 1LX7A 3QU2A 2F43A 4NZOA 3OZUA 3D8BA 5EMNA 3EAGA 5GQSA 5FYQA 4B17A 1J2YA 1FL9A 5JSKA 4YMIA 2JIZD 1CR0A 5HS4A 1DAPA 1SVOA 2F3QA 1QGOA 5KSOA 3MCWA 2D5IA 2REOA 3TKYA 3UW3A 2EWVA 4QUDA 4NOLA 4Z4EA 1MVNA 4OKSA 1Z28A 3TRDA 3SP1A 1T3LA 4EK9A 4DNOA 3H1FA 4GUDA 3ZI0A 2E87A 3MUNA 4GBGA 4LC1A 1DEHA 4OFXA 3SC2B 1AKMA 2O5EA 4G09A 2XXAB 3FBTA 4MEBA 4MYCA 5DM60 2EEPA 3HLTA 1L7OA 1QX4A 5MGNA 1Y7TA 1T10A 1VHWA 2IKQA 4E2FA 1XCPA 4HGRA 4R1SA 3M6WA 1QX3A 1KZYC 2NM0A 2W6OA 3ICWA 1MO5A 4F9GA 1X7HA 1NATA 1UQUA 3V1MA 3ORSA 5BO5A 1LI7A 3AESA 4HMOA 1SU4A 3OE1A 4LE1A 1PUJA 5A2GA 3H2KA 4RZIA 2XUHA 4TT8A 5DYTA 3OF3A 4FINA 1W6RA 1X1QA 4CG2A 4G8DA 5ALRA 4C4XA 5C81A 1Y7HA 4LJ8A 1XQYA 2B37A 3WLKX 3CX7A 1PJQA 5FBHA 1M6VA 1YNSA 1P73A 1ONPA 3BKXA 1X8KA 4FR2A 5CEJA 3S2ZA 4L5IA 4DV2B 3RTCA 5JFOA 2PKQP 1LRKA 5JS1A 3W5HA 4A16A 1JHAA 4CIVA 3C24A 4B3GA 2D8MA 3GU3A 4PGMA 4KKXB 4LF9B 1XZCA 2IDMA 4HVAA 4DNQA 1KZ4A 1MC4A 3KJXA 3WB1A 2P1DA 2QL5A 4XFKA 4JASB 4ZCPA 4YIHA 2UVQA 2AJDA 3F71A 5IDYA 3TGPA 4JT9A 1FMFA 3X1WA 4C6TA 1GNRA 1P1CA 3DR3A 3CY6A 2H57A 2P9GA 4MR7A 4ZARA 3WIEA 2DFDA 3ZE0B 4C4SA 1P7WA 5JFGA 3DB2A 3HSSA 4MW7A 4RXUA 5FOSA 3DEZA 5IZCC 4RUKA 4YJ2B 3HFGA 2VCEA 4R16A 3CPJB 1KAMA 1N0WA 3LSYA 4WK2B 3GRCA 3HBAA 5D00A 4R3UC 4K9SA 3KOOA 1GTJ1 4BLTA 1J07A 3N2ZB 2UVPB 1J8QA 1VYHA 1DC6A 2AQHA 4MTCA 4PVDA 4QDUA 3MPOA 3UWSA 4DJJA 1P4AA 3K70D 3ZX5A 2DCUA 2VWQA 3ZW7A 3GDHA 4BWGA 2OXIA 1MQAA 4OF4A 3OJWA 4M0MA 2ZJOA 4BV3A 4PN7A 5BN4A 4W7SA 4C4YA 1W8DA 1L3CA 3W6NA 4XQ9A 5LP6A 1NJ5A 2O1EA 9MHTA 3BCHA 1NVAA 1PWZA 1EFVB 1GPAA 1QFYA 2ZTVA 3DOFA 3BRWD 3FHOA 1G8AA 4QHTA 3EXG2 3SYKA 4F72A 3JAWB 4YQFA 2PXXA 3DZCA 4KX3A 4KR0A 5FNVA 1ISFA 1AKEA 2LUOA 5EP2A 1IONA 1XVTA 5ECGC 2B7BA 1V7CA 1GNPA 2I4OA 3G2JA 2GJ8A 3PQ6A 5EWJA 3MTEA 1TF7A 3H0KA 1NVXQ 4WD3A 1VCNA 3HUDA 5DO9A 2Q8PA 4N1AA 1PFQA 2VXBA 1OFTA 4K0RA 2CVZA 1JBQA 2BMFA 4IDQA 3WGUA 2QBYA 4X8HA 1P5ZB 2H65A 3BTSA 1A8HA 1YVDA 3DBVO 3GT4A 3NORA 1ISIA 5DE3A 4HVTA 4FFBA 5IVDA 3GUZA 3JAKB 3TSWA 3W78A 3OZWA 1Z0DA 1GLVA 4G4SP 4KXYA 3IPLA 1IIRA 2W98A 5C8XA 5DFAA 5IEBA 2C1ZA 1JLKA 2Y8EA 3JQ8A 3K4HA 3KXPA 3B8HA 2W43A 4YEDA 3UT5A 4PGHA 3TI9A 1X8LA 3KV1A 1GUZA 4TQ9A 5CHEA 3ZHZA 4GVXA 1Z8DA 1JB1A 2HC9A 2PIAA 1ULZA 1X7XA 1STOA 2B0CA 2NYVA 2C78A 2ZJZA 4MW2A 4QTZA 3ROGA 2EJWA 4A0QA 2WWVD 2JIOA 2I03A 1OC2A 1Q16A 4ZIRA 4LYFA 4OHBA 3HVHA 3F5DA 1KDVA 3R5SA 2VDJA 1I2MA 3SXUB 5B7QA 1KRXA 4MQBA 4XSGA 3ADKA 3SQLA 2EZ9A 2I6GA 2PRIA 4Z4GA 2OFWA 4UMVA 1ULHA 2F62A 2SHKA 4XDYA 4QOFA 5E1MA 4BFUA 1GG2A 2WLTA 5EA2A 1J0DA 421PA 3DF9A 3PITA 4X63A 4DDUA 1ZRNA 3AEQB 4A15A 1A5TA 4CKWA 1HURA 3I23A 1IZ8A 4DIMA 3QMPA 2YCBA 3MD9A 1NP7A 4LCJA 3Q12A 2C4WA 2ZZMA 2IZ0A 1ISGA 2AUMA 5HILA 4NCNA 4F56A 1W46A 1M8GA 3GPBA 5H3LA 2W70A 4PYJA 4B80A 1KI1A 3C3AA 2XB8A 5E6UA 3L07A 1Z7BA 1JYSA 1USUA 1RLTA 4DKXA 2V96A 1A97A 1PKXA 2YWFA 2ZE6A 2E55A 3HGMA 1IOVA 2QTBA 1LVGA 2QNBA 2BIFA 4W1PA 2IWHA 3W3ZB 5K20A 5FBVB 3P9RA 1SXJE 1PVVA 3ZCVA 3AEKB 1QGUA 4KGXA 4RTRA 3UJ8A 3UMYA 1DAHA 2I9PA 2QLLA 1A4XA 2VHUA 3IRVA 1YRLA 3SF0A 2AN5A 3ZI7A 4BGUA 3A6DA 3FCCA 1RHJA 4N3NA 3HA5A 4MXDA 5D01A 2QT9A 2QSJA 4AM8A 1FLDA 1TI7A 1YZKA 1JAYA 2RAFA 1HNNA 2XR1A 3ZWOA 5EI5A 1J42A 1NYLA 1XD2B 1L5ZA 4IDHA 3BL5A 4NV0A 4X6XA 3TW4A 2R9VA 1ZUWA 4FBMA 3MOGA 2N0SA 4ROTA 5FFNA 2PBLA 1CCWA 3CRRA 4MVJH 5DGIA 2A8YA 1A8QA 1HYHA 2O5CA 4DZZA 5IAJA 3USCS 4W6ZA 4J7AA 1UJNA 4AY6A 2JB9A 4ZV7A 1KXZA 1QUEA 4Q16A 4X71A 5ELLA 2B92A 5I7RA 2P2CA 2C5LA 3JZAA 1J33A 3KFXA 1V5GA 4LZAA 3SFVA 4V0LA 2P0YA 3GLFA 4RA9A 2VSNA 3R1IA 3SDSA 2PEZA 1W36B 1G21E 3M4ZA 1USWA 4CDRA 1ZIPA 1GR1A 3MRSA 3CM0A 3MGAA 1PUXA 2H7XA 3Q41A 1A2BA 2NQ2C 4BAUA 2GRAA 4L51A 5AKHA 3DC2A 1G8GA 3K32A 3O8QA 5EY5B 2VSYA 5LZ8A 3OE7D 4BO5A 1E9SA 4F6CA 2PX4A 1AIPA 5JSFA 2G77B 3PJGA 3GARA 3H1TA 2L17A 2CCJA 3E23A 3C6KA 4R9NA 4BQOA 3AVQA 3HB7A 3QBVA 3R3UA 3QX9A 1KBOA 1EVYA 1Z2DA 1N1EA 2ZT6A 5DM1A 3TYXA 3VHXA 3D2LA 1ORHA 2OO3A 4ZZ2A 1BA2A 2FB9A 3K9QO 2J6CA 2J3EA 3HKEA 2XGJA 4IIUA 1WQ4A 1YZQA 2OWEA 1GYPA 2Z3VA 4OHMA 4OH1A 1JG7A 3HKCB 2OCLA 3TVDA 2VDWA 4UBIA 4H4EA 5TF0A 4Q9JA 1N1GA 2IP4A 2QLTA 5C5DA 1FXWA 1THGA 1YDFA 1IHDA 1EXDA 2EEZA 1QQ7A 1KQGA 3JVIA 1J1UA 1AKQA 3VAAA 3PX3A 4ZGGA 3JASB 1DTEA 4Q4JB 3HMQA 3P9QA 3TINA 3U49A 5BMVA 2WIBA 3L77A 1UBGA 2ZITA 4TMKA 3U2QA 1LDEA 3OD5A 2ZPTX 2JHFA 3SE0A 4EFDA 1EGHA 4JLAA 3VPSA 3GLUA 4GGPA 4LI0A 1RPTA 4ZOAA 7MDHA 1I9CA 3HPQA 5JASA 2WC1A 3VO2A 3EBPA 3NFYA 3K9FC 5B6PA 3FYSA 2C4NA 1FIUA 1WLYA 1AKVA 3V8BA 3VR1A 1MABB 4CMEC 1B14A 4UXIA 5BRNA 3LXUX 2BDUA 2B4TO 2Q3DA 1ZITA 3NHBA 3JRXA 2BFMA 5IJ0A 1HXHA 3AERA 1S7GA 5HBRA 3K5WA 4YR9A 2YZGA 4ZK2A 1O77A 3PA6A 2OBMA 3NC4A 2Z2IA 2JVIA 4GEKA 4P83A 1JHRA 4EJSA 4J4HA 3LV8A 4X6UA 1SBZA 2C5BA 1R00A 1FSZA 1KSFX 1P3Y1 1VIVA 2F00A 3AB8A 1XTTA 4YREA 4BQQA 4EAAA 1LSJA 4EL5A 3DYVA 2V3VA 4HNGA 1DKMA 2Z56A 3ZHQA 1CUBA 2P9ZA 4C01A 3OC0A 4QU0A 3BFJA 1D7OA 1Q1AA 1U4NA 2GQ0A 3KYDB 3HJHA 3USES 5AW1A 3UAVA 1GCUA 3PTZA 4Q7LA 1NR7A 3C3CA 2AC2A 1RXWA 1C3VA 2FEWB 4U7TB 5I47A 1ID8A 1T2DA 5HMMA 4XVUA 2YV5A 2JEOA 4G8JA 5FOQA 4PSUA 4HS4A 1HT2E 1E9FA 5KC8A 5B12A 2ZYDA 3C70A 4QNMA 1Q7RA 3HC7A 4KPYA 3H9GA 5LDDC 5KQMA 2IH2A 4MVJD 5HFAA 3TX6A 1F0PA 1HQYE 4DQLA 4WZAA 4D3FA 4TVOA 4DPLA 3I8SA 2YHBA 4ZO7A 1SZJG 3TLCA 4B71A 4RKYA 1YB7A 4PNZA 3D02A 2J32A 4IQ0A 4Q9DA 3WMRA 3AF1A 5AKJA 3GP3A 3UCXA 1A1SA 1GGHA 2AOTA 2QX9A 1CRZA 1NKSA 4XEHA 4CL3A 4F2PA 3T7AA 2J41A 3KT3A 1J7KA 1Z56C 2ZVQX 3NOXA 4HDMB 1TKRA 3GUCA 4ALLA 1V48A 1DIHA 2FK8A 2QUAA 3GGJA 4D4GA 3EB9A 1IN6A 1L7BA 2GBPA 2I33A 1U8TA 3QPDA 4R8LA 1P5HA 1VXRA 3EYAA 2NXWA 1U2DA 1UZAA 3LT4A 3N53A 1Y1RA 1Z35A 4ZVPA 1IMOA 1GZ4A 5I7OA 3AM4A 1I7LA 3I73A 1ESZA 1XYGA 1MGOA 1DTWB 4M1SA 4JJAA 2A3RA 5HKKA 4LISA 5SY6A 1WDWB 1CQIB 5TDHA 3IAEA 5TMEA 3KU1A 4O3FA 4V2UA 1MX3A 2XUJA 3EIFA 2GKOA 1WWKA 4DW8A 3Q72A 4R1OA 4LOHA 2OENG 3F90A 5F2EA 1N75A 1UPCA 2BM1A 2QMYA 3EEBA 3HBMA 1H5QA 2NU8A 2FAXA 3WLAA 1RXCA 2FSGA 3QXXA 5JXJA 1R9NA 4ZT3A 4F85A 1UDAA 1R7RA 4JEHA 1JB9A 2H7CA 2Y76A 4QYWA 4IIVA 1CDEA 2ZTUA 3AU8A 4RAOA 1JEOA 2IBSA 2RKWA 1ZNXA 3AOGA 4MS4B 1WTAA 3KZMA 4LHSA 4XDZA 2BKVA 2EKDA 2CUKA 4LWPA 3JALA 3KUUA 3U6BA 4G1EB 1GG9A 3BAFA 3GBVA 4G25A 1E3TA 1QFZA 2Q5LA 2WKQA 3RS7A 1DNPA 1S2MA 1M1YA 5BW4A 4FFMA 5D5QA 1C30A 1JIIA 5JNLA 2IYAA 4MJXA 2ZM6B 3IURA 2BFPA 1JXQA 4Q9AA 5DNAA 3BCRA 4U9IS 4DHEA 2W8BB 4ZYZA 3G0BA 2JGLA 1RQNA 3MTBA 1IDOA 3H04A 4D3XA 3AYXB 1CDZA 1C5KA 1HQKA 4K86A 2J09A 2C8LA 2G9ZA 5IDVA 1H0RA 1J8VA 1II9A 1SUIA 4Q66C 1HYGA 4BTVA 2UZ4A 1L7RA 1V16A 1JUDA 1N6HA 1CBUA 4B75A 3W5AA 1LRJA 1MEJA 3N8GA 1V1MB 4HWKA 5CDFE 1U7DA 3K5HA 4ARIA 3HM2A 3LUFA 3U48A 3GLGE 4QHYA 1F6WA 1O95A 3SEAA 2O5VA 2C2HA 1GY8A 1K89A 3CS3A 3M3HA 4I4IA 1A7JA 1N6RA 4LKRA 2Y1GA 3EIHA 4HAVA 5U1PA 2BGRA 1GCOA 5TR9A 3RSOA 2Q1TA 2GWHA 3KYCB 5ESWA 4YQEA 1MJNA 3RAGA 4MW4A 5GADl 3ASZA 2AC4A 2IEIA 2UYGA 3LOQA 3D4BA 4JUCA 2J3IA 3TR5A 4A27A 4GQBA 3NHZA 4ZVLA 4P8RA 4DSNA 3RKRA 4NX2A 4U63A 3QKIA 3D3WB 5A3RA 1ZUHA 2O8CB 2B5WA 4ZOBA 4MV1A 1QRRA 3B1XA 3P5SA 4NCKA 2C8JA 1QJ4A 2JLBA 4JEIA 3MMSA 4HRAA 3GL9A 3PNYA 1L5KA 1HEUA 4D42A 1W30A 3OA0A 1JJBA 2XKKA 1KIMA 1BDJA 1T1EA 3FSEA 3H1EA 3OX2A 4C7XA 2V7BA 1NF3A 1QQ6A 5EUMA 4NQRA 1MO3A 5HIIA 3SQNA 1V1JA 2O4UX 1DKOA 3VU3A 3ICQB 3WRXC 3B38A 4P4SA 5D6NA 4H60A 1OWLA 1A77A 1ENOA 5AHWA 3G82C 4FNOA 2NVWA 1WV0A 1QYRA 3N8IA 4P0TA 1ZVVA 3DZHA 3NNSA 1SELA 1CZKA 3RW9A 1RLOA 3QEBZ 1X7WA 1FNCA 1IJKA 4X3PA 4XA8A 4ZOLB 3R6LA 3MTQA 3SNHA 1WABA 2FVYA 4ZHQA 4JHLA 1AGPA 2PGDA 4RD6A 1PNRA 3AL0C 4RJTA 2R00C 1VGQA 3ZE8A 3PFFA 2XRMA 4PGFA 2J5QA 1GT6A 3EC2A 4J7CA 1XT6A 1PSZA 2G25A 4J03A 3ZWVA 4MJ3A 1J4AA 1TTQB 5BV1A 1GZHB 1QP8A 4HPJB 3F2VA 4WVFA 1X86B 1RJEA 4OXKA 2V6BA 4LGYA 3KO8A 1JKFA 1IZ7A 2F3SA 3KL4A 2FWRA 3GPDG 4ZCMA 4O25A 4OBEA 4XJVA 1BYUA 3TTWA 1SXPA 1D04A 3HKDB 1XZJA 3BVPA 4DM3A 3A6JA 5CA1B 2OSVA 2B94A 4OK6A 2ZB3A 3BG5A 1R6TA 4WCVA 5BRJA 3TSOA 1KMNA 3MW8A 2HQ1A 1FFXB 3PQFA 3C3DA 4U9UA 3VPXA 1IBLB 1DFIA 1U8CB 5FBWB 3GBSA 1AKTA 2A9FA 2GVZC 3HLYA 3NZEA 1IQUA 4HNAB 3MQFA 1P0PA 4D9CA 1NXPA 3AF3A 3AVYA 1VHTA 4JY7A 1N77A 3R9IA 2FOXA 3A9SA 1XPRA 4EB3A 2IY8A 3H99A 2ZRGA 5CVTA 5KWJA 1W5AA 1MJHA 2FPIA 1IUPA 1UJ6A 4J2OA 3H9EO 3SU8A 4CUZA 3TTXA 2QUBA 3CH5A 1HE1C 3E1GA 3K1AB 4UUMA 1FJGB 3A4IA 3FVTA 3ZNNA 3A1TA 3GN1A 3SKYA 1UMKA 1XRSB 3F97A 3H75A 3MILA 3Q2OA 5EZYB 3KKLA 3TQOA 4AG6A 3DOJA 4DM7A 4I5FA 5FBLB 2D74A 3L5KA 4EKGA 5KYNA 3DBRA 4YMSA 1YKFA 1UMDA 2BEVB 4K6GA 1I24A 3PNKA 5FO1A 3KLMX 1GQFA 2A3NA 1GTL1 3VHLB 2G09A 2B4KA 3I05A 3U3KA 5HQ3B 3QQ5A 4KPUA 2VJDA 4XYGA 4L72A 2VBIA 3HJTA 4WBNB 5EQTA 4G4JA 4DQXA 4QYMA 2R8RA 2HCFA 1K8RA 1XBTA 4QNRA 4IHJF 1N36B 4J2HA 2JD1A 3NM6B 2VHTA 1X0XA 2RDMA 2X0KA 2VDUE 4R4JA 4QT4A 4OEHA 3F47A 4B3BA 5JJBA 1GZVA 4MR9B 1APBA 1LCIA 1NMZA 3TRIA 3ZZ1A 3M33A 1A9XA 4MV0A 4PF1A 1YU9A 2FEPA 5K0EA 3QE2A 3E03A 2H1RA 3CVJA 3DE7X 1U0FA 1QYDA 1WCIB 1IC6A 4G5SA 3MYRA 3W3AH 5AM2A 4Z86A 4AP9A 4FPXA 3T95A 3MUFA 5KX5A 1CF9A 3KAJA 4L78A 2CE2X 3QG1A 1R37A 3QLUC 1KI2A 1WLSA 2ZI9A 1VPVA 4B44A 2GPJA 3B70A 4KE9A 1PFGA 4TX1A 4LPSA 2ATVA 5ALQA 4RJIA 2QVYX 1QZ3A 5EINA 4W7HA 2BZSA 2PVPA 4C30A 3QE0A 1UPFA 2NZXA 3WBJA 4ME6A 2X1HA 4KIJA 4OQMA 4QEZA 5ALGA 5TQVA 3NDRA 4GPAA 5JLJA 1DUSA 3NWPA 1MB3A 4H1TA 1RZUA 3U81A 4PSCA 5I7EA 3WISA 1DDOA 2A86A 3COSA 3UKDA 1YZLA 3QUSA 3MB8A 3I2YX 2JI6A 1Y6QA 3GWGA 4LXXA 5C4MA 4GD3Q 4NATA 2OHJA 3L1VA 3IUBA 4JP3A 4TM7A 1EQ2A 1ESMA 1SXJA 2CVOA 3VH2A 1QE3A 3BIFA 3LTNC 2FMHA 3AQ4A 3KQYA 5JAMA 4EHKA 3UYLA 1E18A 1VHDA 3DBHA 4MGIR 1RS0A 2QN9A 3D2BA 3I2IA 3PLAE 2BISA 3A25A 3GQBA 5M34A 3IJ5A 3QMWA 4P6VF 4FP9A 1Y5MA 2G70A 3NATA 1KP3A 2KW5A 1JEEA 2QEQA 2C61A 1RWNA 3FNRA 4HSGA 3NBKA 3ET5A 3K9LA 3WLSA 3KWFA 1Z6AA 3DEKA 2DHCA 4LX8A 2Z8ZA 5FWYA 4IUYA 2QP9X 2I91A 5COBA 5EVCA 4Y2GA 3I5MA 4Y9UA 5HK8A 2ROQA 2WHPB 3SEZA 3VPDA 2NMVA 3GJZA 4QBKA 4JGBA 2A1IA 2ZRKA 3WFIA 1E77A 4RE5A 2PWZA 3WBBA 4RXMA 3VDQA 2V97A 2XUZA 3OEED 4HWSA 4ECAA 1A9RA 1DIGA 1O97C 3C2QA 2Q5FA 3F2IA 4EG7A 2FTKE 5J47A 4ZTUB 1E2LA 4X20A 1NG1A 2WD7A 2FQYA 4IIEA 5H3CA 4E0BA 1YBFA 2OGZA 2ZSDA 1NNUA 3ABZA 5KBYA 3GG2A 4JSRA 1M6NA 2HSWA 1I4DD 1G21A 1T2FA 5D84A 3HDVA 4MW0A 4Q82A 2UXDB 4BO2A 5T4HA 2X9LA 3C1AA 2Y93A 2ONYA 1FLVA 3CLVA 3LE8A 2E85A 2HQSA 2QRUA 1TM4E 2JFYA 3I6YA 5GJVC 3TZ6A 2W4IA 4FZ5A 4NP6A 1GIAA 3I45A 3SF8B 3RS0A 3VMFA 1JW9B 3GNQA 4EQ6B 1WXWA 1JECA 3IUSA 4MS3A 1ZK2A 4U5QA 3QYAA 1K86A 1U8XX 1WPXA 2V5UA 3JQDA 1EG2A 2ZR7A 4QQNA 4AZ0A 4FD3A 4OKIA 3ZWKA 4NFSA 4H4DA 5LQSA 3VTAA 1MUUA 5TLSA 1N2JA 1Q0QA 5EIWA 4D8UA 4IPTA 4O2BA 1E5VA 3QFSA 2OHOA 4Z9FA 3KSUA 2G5CA 2X5OA 2DBZA 1GPBA 1I0IA 5E0KB 2GM3A 2V7PA 1ML4A 4BXOB 1J25A 1E98A 2ONCA 3QQPA 5DTJA 2CHGA 5ENZA 3RS4A 4B4WA 5HHTA 1ZEJA 2H31A 1YS4A 2BCJQ 5AI8A 5CG1A 1BIFA 5HRAA 1QUFA 3AZOA 3F3SA 5BV2P 4WEOA 2FPMA 4WHMA 2C9BA 1OASA 2WIGA 3P4YA 1GFZA 4JJGA 4J3NA 4EEKA 5K4HA 5L7TA 4CN9A 1NXVA 1VL0A 1WMEA 2OBYA 3IQHX 1G9XA 4BLVA 3ZD7A 1NBWB 1YR3A 3R7BA 1NDHA 3THXA 2NTYC 2BFFB 1FFEA 1INLA 2FGJA 2MINB 2PMFA 1JU9A 2QMQA 2YH2A 2ZZKA 1C9NA 2ZRPA 1NURA 2NUBA 3S70A 3W3AD 3WNVA 1ECPA 3UXHA 4E4YA 3SSMA 2JA1A 3DO8A 4W1RA 4AMGA 1A4RA 1KK2A 2XXJA 1W4RA 1ZUNA 1B7GO 4PC2A 3ZDCA 4KP7A 2JHAA 3CT6A 4MV6A 4BX2A 4ZQBA 1AZWA 2ODWA 3T9BA 4V0ME 1NNSA 1EDBA 2V7XA 3ND8A 1PS0A 3P27A 4FNGA 3SSOA 3AZQA 3E4CA 4NICA 1NUTA 4DA0A 4UHJA 1SNYA 3L4BC 3PPYA 2Q1UA 3MEQA 1XROA 5FUXA 4BFCA 4D8YA 1DJNA 1CJUC 13PKA 2G67A 1HG1A 2C98A 2J3DA 4TMVA 4A6DA 3GI1A 1LY1A 2R8XA 4PCVA 3ZHXA 3ZBTA 1SMKA 3U1TA 4B8YA 1ZOIA 4RTQA 3EW9A 5CFNA 5AW0A 2YIJA 1N3BA 2V7WA 4MIEA 2QTNA 4M0EA 4XM1A 1Q14A 2AEFA 3AUFA 4FW9A 3ETCA 1JPUA 3SYRA 1RPZA 2RHHA 4IYJA 3FAKA 1N0VC 3SPXA 5C5IA 3RABA 3WL3A 2AMLA 1CJKC 2PFGA 3QKRB 4ZYLA 3SHWA 3QEKA 1W44A 3HCRA 1FNDA 3C6BA 4HPWA 1PV4A 1JG1A 4HEHA 4JOBA 1G2OA 1MFPA 4E5NA 2JIMA 3AP2A 3TTSA 2FPLA 3Q7TA 4Q3CA 3N6XA 2G28A 5G1PA 1WG8A 4RHEA 3U44A 1VDMA 1M0WA 3MLAA 3K70C 1E0DA 1R3UA 5AT1A 1N6PA 5I48A 1XAGA 5JZMA 4I4NA 4RD4A 1XLUA 4BJ5A 4JOSA 4Y6RA 1EZ1A 2IC5A 4Y2UA 3DGFC 3IEPA 3PUKA 4DGQA 2VH2A 1L4EA 3GLHB 5DHUA 3SBOA 1YK0A 4TMYA 1WSAA 3T7IA 4YRMA 3R8FA 3LQFA 2ZU0C 2OGSA 5ITSA 1MO4A 4J1TA 4REQA 4WE3A 5EP4A 1Z38A 5I7UA 4CQMB 2A5YB 1GO2A 1UBFA 1K7FB 4NV1A 1DG9A 4H77A 1ESNA 2G6BA 3O0TA 3EODA 4HDKA 3I62A 2WYIA 3R6WA 1P4HA 3EIEA 4NK5A 4PYOA 3SFZA 3B2QA 4AJJA 3PEEA 3TD2A 2GSWA 1OIVA 4G2TA 1TQ4A 2PH7A 3DAHA 3I9JA 2D3TA 4GPTA 5DHQA 4YRAA 5ES4B 5HX7A 3IOEA 2A1TR 4JB2A 3ZQ6A 3LBYA 1BX3A 1SHLA 3R7SA 1VE5A 4D9NA 4KKVA 2OV4A 1PJBA 4P5DA 3BF7A 3F7OA 3PIDA 2IYSA 5HKBA 3ORQA 3NHFA 4FVTA 1AUQA 1ZRMA 2BE7A 3QWAA 4NYIR 1Z4PX 2WMOB 1YQDA 1J8FA 3BE4A 1ZP6A 3NWOA 1HDYA 4U6QA 4WDQA 1AF7A 2CNBA 4FX5A 2ZB4A 2Y1LA 1ZGGA 3HBFA 1U5CA 2C88A 4YJDA 1HFJA 5D86A 3SK0A 1I0LA 3TLYA 1H9AA 4RPGA 4E88A 2F90A 4RTSA 4A6EA 2PMCA 2B1JA 3KT0A 2PSDA 2O8EA 2P67A 3HR4A 1BGVA 4YRQA 1T0BA 2X5XA 4HC4A 2IIVA 1G7TA 1FDSA 2WJAA 4Q7QA 4JC4A 8ATCA 3SZGA 1Z13A 5DMHA 2J0UA 5EMMA 1XJ5A 2UZIR 2E5FA 3RGWS 1N3YA 1VYUA 2LGJA 4AUEA 1E64A 2FQWA 2QL6A 4UMDA 3UK2A 1U0BB 1DXHA 3AOEC 3I9MA 4Q4AA 4M1QA 1IN1A 4EO4A 2V65A 2SKDA 1QYIA 3GNTA 2C2WA 1RYFA 2ACVA 3LUCA 1FCJA 2H1CA 1YZUA 3R7DA 3WKBA 2ZYAA 4BFVA 4DCJA 2CFSA 4EO7A 5A4IS 1HA3A 4QSMA 4W9MC 3OT4A 3OLVA 3KVVA 3DT8A 5F7OA 2RGYA 4DB4A 1NM5A 3GRYA 1YMVA 3GA7A 2FF5A 1BWSA 4Y2JA 1EX6A 3BH6A 1TYBE 1P0QA 2P7HA 5CMLA 3HO6A 4LFCB 5CDFA 3D4PA 4O4HF 1U1GA 1US8B 3CEAA 4V3CA 4GNRA 3GLGA 5TEVA 4MUNA 2DTDA 1IXSB 5B4UA 3U37A 3KFLA 3E22A 1X80A 4I55A 4N65A 5LYJA 3OQVA 2P2DA 2J9FA 4OSPA 3VC1A 4M55A 5JH7A 3OWXA 1V8FA 5DNYB 1M8KA 2V54A 3WC4A 4PTYA 1AV6A 2QM8A 5JAPA 4CM5A 2J4DA 3SY8A 2V8OA 3MAGA 4KXFB 4BL5A 3TF5A 1C7QA 1YL7A 3ZIUA 3V1KA 5SZIA 5DI3A 2BP7A 2R8EA 4M86A 5JISA 1VIMA 1FDIA 1BN6A 2HO5A 3LG2A 2IP1A 2KJQA 1F2TB 3QI2A 2HJVA 4JITA 4LJAA 2ID8A 3K92A 4JAVC 5BSMA 4Q7MB 3RIYA 5JRJA 3PWZA 3PVSA 4WXHA 3T61A 2VF2A 1JMYA 4ZZ0A 3DPIA 2Q6IA 3PNBA 2PXAA 4ALNA 5BVGB 4O1MA 2QPOA 3FX2A 3WGLA 1W5BA 1T0UA 3WIVA 4AKTA 2NXNA 2IXAA 3ESXA 3H9CA 3KBBA 4C0QC 5JIBA 3IUEA 3T7TA 2JCXA 1ABBA 2WJGA 4UMEA 1ZK0A 3WYAA 5I4KA 4A03A 5JD4A 1YFLA 3HI6A 4PNPA 4NARA 2J59A 1IXRC 5LIRA 1EA5A 3NW9A 5DB4A 2J0SA 3I6BA 1YZYA 3B5IA 1L5HA 1R0BA 2PWPA 1GUBA 4J0CA 4U5XA 3TL2A 2VUUA 3QI7A 2HEIA 3B2NA 5GJCA 3ZG6A 4EG8A 1G0NA 5EXDA 3U3XA 5HM8A 2Y3IA 3I64A 3LGAA 2B8NA 1TOAA 3THWB 2B61A 4MUMA 1VLVA 1JFLA 1CP3A 4JZYA 5SZHB 1ODFA 4KSBA 1H5UA 4PLPA 4H7EA 2ENWA 3O4VA 4HXGA 2Z5FA 5F76A 1TM3E 1BW9A 4WKNA 1TZBA 3WA6A 1N6NA 4ZQCB 3GAMA 2QNRA 3P1JA 2W37A 2GXUA 3RVPA 1L5VA 3UKOA 1EGQA 5AKKA 3U6KA 4P3KA 1UFKA 2WMNB 3GA5A 3K6SA 3GZNB 2MYTA 5LA6B 4TMFA 2ZSBA 4CF4A 2FFBA 5JS2A 2B8EA 5EIOA 1EKXA 1WSWA 1JHPA 2XE4A 5F12A 2LW7A 4BFYA 1RD4A 2C0PA 1C9MA 1E8NA 3B53X 4BN5A 3D0OA 2WSBA 1PZXA 3GJSA 1OYYA 4LDZA 4TL7A 5JSQA 3OM1A 5A0TA 5EJ8A 3ZWQA 1EX1A 4FDAA 1ISHA 1OX5A 2BUCA 4JJEA 3WNCA 2BSQA 3ZD6A 1FVFA 2MSCB 3CEPB 3PPIA 2QE7A 3IDZA 3NHJA 5KWSA 2VAMA 4IQGA 3ZWXA 5JECA 1A69A 4ZI3A 2AFHB 4UVIA 3ADPA 4W8GA 2JLRA 5BUQA 5K7SA 2LV8A 5E6RA 4OFZA 2QRLA 4DSOA 4L73A 2I66A 5IF3A 2W6JA 1W96A 1V0JA 1H94A 3QKTA 3TK1A 3PC7A 4GH5A 3QWFA 4NENA 2Z30A 1P1IA 2BEUB 3EWSA 4RXTA 3QKWA 4KLAA 1RVV1 4QUEA 5BR1A 4N0DA 3GFGA 4G8BA 2IH5A 1LLQA 1GL9B 5B1IA 4ZCRA 2RHJA 4HNHA 5AYVA 4EY4A 2JCBA 3OCJA 4DWOA 5BUSA 1UFQA 1BVHA 1V25A 1OHHD 4FLFA 4NPCA 3S44A 2VJMB 7ADHA 3OQJA 4J49A 1HDOA 1SBCA 1RP1A 3A6EA 3MJTA 3ZE7A 3EBOA 1FSGA 3UJ9A 4BLSA 2YDYA 4UPVA 3BGSA 2FX3A 5JJLA 1W85A 4ZGWA 1KE2A 2DBYA 4CV0A 3IAS1 2QROA 1NX9A 5AI4A 2R4UA 3UM9A 2PMKA 3VR5D 2Z04A 5TT0A 2VC2B 2JL1A 1ZKDA 1DC7A 1Z0FA 2J3KA 3E5NA 3FB4A 4QJ4A 2FQXA 2O3RA 1RSZA 4CUKA 4YA6A 4XM2A 2HBZA 3QV1A 3SIWA 2OAP1 1ZI9A 4Z0PA 3MT9A 4NEGA 3W7VA 3VR2A 3IVMA 2FZCA 5CLFA 3PD1A 5LVAA 3BMOA 4XYLA 2VIIA 2YWCA 1KTVA 2NSDA 1JIVA 1RQLA 4CDNA 2PGOA 3IR7A 4LJ9A 3AIIA 1Y7LA 4YO8A 4UDXX 5DLYA 4A0FA 4ZI5A 1U6KA 3C4VA 1PJCA 2J6HA 3E9NA 3FBWA 1TT5A 4HO1X 4ND3A 4MWEA 4KQEA 5EUQB 3UK0A 3ZV3A 3UPDA 2QXUA 3MS4A 1QH0A 3SDZA 4WFQA 2AK2A 3HP7A 4B3IA 3CEMA 4G81A 1EA7A 3ZEIA 4FBLA 1N7JA 4LNHA 3WS7A 2RAVA 1EWQA 1KH1A 3AP1A 1I10A 1H8HA 4JI0B 3BULA 4QTXA 1YVPA 5A02A 3QRWA 1U3WA 4JUAA 2X4DA 3OMXA 1Z25A 4RABA 4Y1RB 3IMCA 3A1VA 3TTUA 3ZLBA 5JWRA 4E5DA 4HH3C 5L45A 3OTIA 2BBTA 4OATA 1PGOA 4U39A 2X2PA 3F6RA 4ARAA 1UZNA 3ROKA 1IN4A 1J0BA 1W52X 4AY5A 4BKMA 5C3MA 2H54A 1TM1E 1Y9ZA 3QVGB 4OLFA 4IGIA 5EE0A 4NBSA 4EPRA 3A05A 3ZGLA 4ZC8A 1ZD2P 3FTPA 3GJXC 3EF1A 3PWTA 2AE1A 5I5GA 2NO1A 1EFHA 1XELA 3GIWA 4KNVA 2XT9A 3OQPA 3MF4A 2Q0HA 5DBEX 1NG9A 1DXYA 1FP2A 2WM8A 3ZVMA 3U3OA 3EEFA 2MT9A 4YI3A 2OQ2A 5JU6A 3GEEA 2OQVA 1F8FA 3D1LA 4WY5A 5FIUA 1UAGA 4KFSA 3L4SO 1ZXBA 2BLLA 1QO7A 2Q5IA 1N8NA 3C4JA 3ANMA 3KSZO 1M3SA 3O26A 4L0CA 2FW6A 1PG2A 3ISTA 4GFDA 3E9RA 3W2TA 3U16A 4IYRA 2E21A 2AFVA 4M88A 1YH3A 2YHIA 2ZBPA 2X0NA 3WMFA 2WAYA 2I6TA 1F2DA 1PZGA 5KQRA 2YXDA 4XWWA 1ZSNA 1QOQB 4W5TA 2H51A 1PR1A 1V7PC 1T0IA 3ENWA 1YHNA 3QW2A 3A32A 4MQEB 4OA5A 1CJCA 2YTZA 3I0ZA 4PCLA 3K0CC 1QXSA 5GWXA 4MHOA 1Q6YA 4N9QA 3O8CA 4X95A 3V8QA 2FOLA 1J7JA 1G55A 3EG9B 5FADA 2A14A 2GTHA 4KR6A 3TI7A 4YPOA 1F51E 1KEVA 2ZJ0A 3PRKE 1JN0A 1I3MA 2IH4A 2KI5A 3DUWA 4F38A 3I5AA 3Q2KA 4TV9B 2BSXA 3RWOA 4ZJPA 2XAUA 4WGFA 5MN6A 3A3NA 1HZJA 3JQAA 4GPBA 4K81B 3DUFA 4PLGA 1THMA 4HVCA 2ESRA 5A6VA 1ZHHA 3G89A 1RYZA 1T8PA 2O3QA 4EA7A 1UKEA 4CF7A 5HFNA 3X1KA 4XD7D 5DF1A 1K4YA 3NX4A 2V7EA 4FT4A 3RDPA 4I4CA 2V9PA 4YPFA 4GSYA 5EC8A 1Q0PA 4NQZA 3GLIB 5CRIA 3W05A 5JSZB 4YGYA 4KQ6A 3WB0A 1O87A 3L8ZA 2WKRA 4KFTA 3VVMA 3NB0A 4MOWA 4OBBA 5E6SA 3A36A 1ZNWA 3CRNA 1QYCA 3V1YA 4UU8A 4BO8A 1M1NB 2FW1A 1G41A 1R0YA 2VNAA 4UQPA 3LAWA 3RLIA 2I65A 3TZLA 4FGSA 4GMKA 4BRZA 1WBJB 1UJ2A 4NESA 2GZMA 4V0MA 4X41A 2H1VA 3TMYA 3BJZA 3K0AB 1B6SA 4X6LA 4MPTA 1K27A 2ZB8A 3EA0A 2WU4A 3PX2A 4CVNA 2GTIA 2EKLA 4DLYA 1DC8A 1KA9H 5ALLA 5FWXA 3U7GA 2JJ1D 5EHZA 5B64A 2CHQA 1PTJC 2VJOA 1LVUA 3U17A 1A1VA 1E61A 2JLCA 3DM9B 1OBHA 4C78A 2C7PA 4L0MA 3FUUA 4O6VA 3QVOA 4ZT2A 1T2NA 2GM4A 4OY3A 5K8TA 3SQMA 4MWDA 5FR1A 3DAGA 2NU6A 2VQDA 2EJUA 4R54A 4Y67A 3R8CA 3U13A 4PXYA 4L50A 4HRXA 2IPNA 1M73E 5ESXA 1XZ8A 3G9ZA 3D6AA 1KARA 3RM3A 5KS2A 1ETHA 1Q91A 2X77A 3TJRA 3EQ7A 3FGNA 5IC6A 4LF7B 3BQMB 2ZWIA 3PI7A 1G6Q1 1UF9A 2ANBA 2Q29A 3D6TB 3SLRA 2GZAA 3TEMA 2HO4A 4E11A 4LYJA 2W2KA 4AL4A 2AH5A 3G8CA 1IOLA 4UEQA 4XQCA 4EX7A 5JZVA 3PSAA 1AE1A 3M1YA 5CYOA 4F71A 4N7JA 3HS3A 5EIAA 5JANA 2RH9B 4URFA 4X3OA 4AJEA 4TM8A 3D5EA 1GPLA 5F3WB 2AZ4A 5TGDA 3K3PA 4IJKA 2YJZA 1FF9A 1S02A 1XU4A 3UGTA 4P3NA 4ZKEA 3B60A 3UGKA 2VNJA 3FCSB 1VYVA 3RUEA 5JNUA 1TZKA 1SRQA 3HZHA 1NMSA 3K6KA 1NVTA 3OQHA 1WMDA 4LHWA 5ALHA 1ZX1A 5IFKA 1VPTA 3FDZB 2FE1A 5KMGB 4PHFA 1XRJA 1EGMB 2H52A 2P5TB 3AX6A 4ZVNA 3F67A 4RDHA 1K0FA 3ZDRA 4BNYA 2DERA 3AEUA 3FCXA 4IMRA 1CY1A 2A0FA 3D3NA 3RANA 3VO9A 4EJ0A 4CHGA 3KVRA 5FULA 1EDDA 3O4JA 3VC3A 3UMBA 1EX7A 1NW5A 2B3DA 1T3HA 3KQPA 1E1CA 1XZAA 3AHJA 4GWKA 2BGNA 4PG6A 1JSXA 3AFIA 1P1KA 3PE3A 1M2HA 3QVWA 2A30A 1CZLA 4G0MA 1HDGO 2PL9A 4MA4A 4JMLA 2Q3LA 3GJ4A 1E1NA 4QJIA 3K30A 2W90A 1SVSA 4OI4A 3FOFC 5IK2D 4D9MA 5G1NA 1F8UA 2R1TB 4EBFA 2N1BA 1E4EA 2BVNA 3C1TA 3DV9A 4DKJA 2QVLA 3NWEA 4CM8A 2AJLI 3U56A 4OHXA 2XF2A 3CR7A 3EXIA 5B1EA 3VDRA 3ASVA 4EYEA 5LP6F 1Y0BA 4P53A 3SJCA 1Y8CA 2GCPA 1RM3A 2H3EA 2YXNA 1T43A 1PN3A 3T7RA 1AUOA 1COZA 3JU3A 3GVIA 4CKEA 3C3YA 4V1CI 3CZRA 3WWCA 1THTA 4YCBA 3MAAC 3R40A 2F48A 5T4FA 3TE7A 4NZ9A 5GIPE 1QFSA 1UOOA 1XA4A 1JJIA 2V6GA 2WWTA 3CZPA 4QBTA 4DLAA 4Z7QB 1SZPA 2WY2D 1TQ8A 3WL4A 5JYEA 1L8OA 2ZYTX 1G7SA 4DDKA 1RIIA 4KQHA 3OX3A 2FLWA 1FSFA 1OOEA 3ETGA 1BWRA 4YCMA 1DKRA 1UBEA 3IAAA 3Q9SA 8LDHA 3N5KA 1Z5ZA 1R4NA 2ZANA 4G2NA 4I4LA 3W4KA 1CJBA 2B34A 2X0RA 4GOMD 1GA6A 4LNAA 2HF7A 4DE5A 2C57A 4AZ3B 3RH0A 1YA4A 3RU3A 2IV2X 4OHYA 2ADMA 4G86A 5LLSA 4EHIA 4TN1A 3R5TA 5DXAA 4OGLA 2H92A 4HFNA 2Q9AA 1L1FA 4DEVA 2MJLA 5B3JA 5CB4A 4L9SA 1BH2A 4O8CA 2AQ8A 4WERA 2G4VA 2NZWA 2A58A 1LFAA 3IODA 1Y98A 4M9XA 4NL4H 4KUHA 2G5GX 2Q3HA 1PFKA 3L6CA 5DGCA 4OLAA 1YTLA 3U1VA 8ADHA 1M8PA 1V11A 1C3EA 4GM1A 3DEFA 3DKRA 3ORYA 4MNTA 4RWZA 3AG5A 2H06A 4URYR 1CK4A 1ZD3A 2FJUA 2PRKA 2YN4A 4KR2A 4KXUA 2DLCX 1E7QA 5KSZA 2XWJI 4XIIA 4UARA 2RCNA 4DTCA 1B2LA 5FWDA 4OSEA 2VJYA 1L5LA 1OAAA 3EZ6A 1E5TA 2OCDA 3G79A 2BEKA 1RMTA 4LGCA 4MPPA 3NDBB 1HNWB 5HUJA 1HC7A 4RCYA 1C8BA 1NVVR 1C3LA 1KPGA 1KL7A 5HF9A 4HPXB 2YVLA 1RLUA 4D6XA 5C7YA 1VSBA 2ERYA 5A0FA 2VPZA 4RA6B 4QREA 2IHNA 1JVSA 2VBGA 1HSZA 1ZMTA 4XOUA 2QTWB 4GBJA 1C7ZA 4U0KA 2B7LA 5HDQA 3F6PA 1RLMA 3PC4A 2R4QA 2W2NA 1HNXB 2WTMA 4LYHA 1Z08A 1TMYA 4DBVO 1A5SB 4M1KA 1B1CA 1YJBA 4GBMA 2CDNA 4MYTA 3OQIB 4EUFA 1B73A 3G8YA 1O96B 3UJNA 5KAPA 3X1XA 2CC2A 3ILXA 3ICEA 3PC2A 5BXQC 2VYFA 3HV0A 1EWTA 1OI2A 2IU4A 3K0FB 4QUKA 2DPYA 2R86A 2QD4A 2W2QA 5SYNA 3SR0A 3QEAZ 1O4VA 2QSUA 1U11A 1P17A 1WW3A 3AEYA 2FG7C 3S1AB 3W5UA 1TECE 3KKPA 1UWKA 2F3TA 1A5BB 2HPAA 2PSFA 3AEZA 5HF8A 3RU9A 4C7JA 3O47A 3QJ5A 4GL4A 4WL0A 5B4TA 2Z4RA 3PD0A 1OSNA 4A0HA 1RJWA 2O2SA 3QHPA 4XI9A 1KBZA 3R24A 4J1QA 3PCRB 4BZXA 2C7BA 5LM3A 1I7SB 4N48A 1MRZA 4TTSA 4Z1MD 1L4FA 3BJMA 2VYQA 2HUNA 3LYAA 4I1RA 1GSIA 2QLNA 4N03A 4NBKA 3UPTA 3DLIA 4ENQA 2EJCA 5ESRA 4HQ0A 2EQBA 2IU6A 4QQFA 1U5BA 2XD9A 1EFCA 2PLFA 1QPBA 2VP3A 2Q7XA 2WA1A 4OXQA 3WAJA 1Y7IA 4Q3BA 4AY4A 3INRA 3NTOA 1W19A 1KOFA 1WB6A 2QVBA 3FYUC 1ZHOA 3WGTA 2BI8A 4WXMA 3FUWA 2VK8A 4URHA 5CFMA 3C3PA 1QIJA 3H0CA 3IT2A 1ZGAA 5CM9C 1R5NA 4DV4B 2AYZA 2A7XA 1VCIA 5FHQA 2GKSA 1DJOA 4KR3A 1GKYA 2YKGA 3EEQA 2WJ6A 5IZCA 4LQLA 2DECA 4BZPA 5IN5A 5HK9A 2PUAA 3SC4A 1G4UR 3UWMA 2QJFA 1J9EA 3ASUA 1UOEA 1AKYA 3O8OB 3T4XA 4F2GA 2VHCA 5IM5A 1DDGA 1S1MA 2P11A 5B1SA 4A8TA 3MELA 3TRFA 2FDCA 1X92A 1RFLA 1E66A 3KD3A 4TKUB 1JHOA 1KXJA 1QLWA 2YWXA 5FCDA 4EO9A 4P7KA 1YE8A 2VK2A 4N3BA 4C4TA 2BR5A 5G40A 5K3AA 3ZHOA 5AW5A 5IYZB 3OQOA 2PY6A 3MIIA 4R1PA 1G18A 3EAFA 2IJGX 3LM8A 1X7YA 3KTAB 3EZ2A 2IFTA 4HS9A 4YAEA 2HCBA 3PRJA 1JPJA 4D92A 2GK6A 3HWX1 1SUPA 1X87A 3VUEA 1JVNA 4GYYA 4JQYA 2V5VA 3NVDA 4AF6A 5LQJA 1SJ9A 3T5DA 3D0QA 4V1CA 2P68A 4R2WA 1FXWF 2VDKB 3CUEF 3GWZA 3OCXA 4EPWA 3ESRA 3OAAA 4FYPA 2F55A 2DETA 2VJNA 3PUYA 4YLGA 5A1TA 3TQFA 3BERA 3DONA 5E7MA 2AN4A 4BO9A 3ETLA 1UADA 1VYTA 4RD0A 1I2DA 4QC2A 2LCFA 1N2SA 3DMNA 4MA0A 3ZWDA 4ZCIA 4ZV4A 3DW3X 3GRRA 4QJBA 1N1MA 2O54A 4K9KA 2VHQA 3R77A 4MSUA 5FP0A 4PINA 3L8FA 4D3YA 3E3NA 5FQNA 4YALA 5LOVA 3H5LA 1BNCA 3LVQE 3BXXA 2E4AA 4BBPA 4BZZA 2I80A 2ZAMA 4PW0A 2PGNA 3ANLA 3I04A 3RRYA 4P2BA 4FYYA 1IZ0A 4OA8A 3NHUA 5KJ1A 2D1FA 3IA2A 1ORWA 1KDZA 1LS6A 1QVVA 3BHJA 4URZR 1P2TA 3KKNA 5ERGB 1JR3E 3PNOA 3DWGA 4XFDA 3SICE 3IIEA 4DXHA 4YCSA 3KJZA 1RAHA 1GZ5A 1ZCZA 4UM9D 1SWVA 3TGLA 3M89A 3QSYA 4JLDA 1OLUB 5JDCA 2A1UB 1NPYA 3SJZA 2UZAA 1KI4A 3PDUA 3R6GA 2DY0A 4YMLA 1FFYA 5JMWA 3LNCA 4R8SA 2FPGA 4BVJA 3CZ4A 1MT3A 1JWBB 2AJCA 4JVNA 1TAHA 5TQ0B 4LVOA 1EFLA 1P0IA 2CFCA 3VDXA 2B82A 3X1ZA 1EDZA 3BGVA 3QOWA 3ZW9A 1OFUA 1CKEA 2BFWA 4WA8A 1NN5A 1XDSA 1MX5A 1UPBA 4F8YA 4HV4A 2YC2C 1GTMA 3RBVA 1KAHA 1TUGA 3ENQA 4CCYA 5ARBA 1Q21A 1NVEA 4RYLA 5JQGA 2OECA 3FYCA 1IUKA 4EHHA 5KJCA 1KZ1A 5KWIA 1R50A 5FPSA 2Y1WA 4R9VA 2AB0A 1Y6JA 2FPOA 1VKRA 2VL7A 3GMDA 4UHEA 5DM2A 1JIQA 5JCOC 4LJ4A 5JRZA 1KR5A 5H9WA 4IW3B 1P9RA 1WB5A 4QLOA 1CJVC 3KB2A 4YN3A 5JAQA 1T3TA 3DCYA 1R0WA 4ODIA 4JQZA 1GQ2A 2ID4A 3R6DA 4L8VA 1QHXA 4MKIA 2WZCA 4IFIA 2VP4A 1S4MA 1RBYA 1LJUA 2EHJA 2QZSA 3CCBA 3L9WA 4OB7A 4OVKA 2NZYA 2MSEB 4CT5A 4F2HA 1TT7A 3M9XA 5MHTA 3PGXA 4O1HA 2P9YA 3M1AA 3Q7PA 5J1TB 4C22A 1I3OA 1S4QA 4TV8B 3GT7A 4S2EA 3BMCB 1EVZA 3F74A 3QEMB 4TRMA 2AUNA 1T4CB 1RRCA 3LQRA 4O2AF 4JROA 2B83A 2NUAB 5BN1A 2IDKA 2V0GA 4FDTA 7ABPA 1U4OA 2Q3EA 3ZS9A 1T2CA 3BDAA 2FZEA 1D5CA 1TK2A 3S2SA 1YCGA 3FKQA 4OJKA 2VDOB 5ADUS 4MRSA 4OUDB 4W5RA 3TPFA 5JCJD 2RKOA 2WV7A 1L4GA 4B7AA 1KQPA 4AX8A 3UFXA 2AW5A 3WGGA 1BJKA 2J67A 2Z09A 1XXHB 1TJPB 3HGTA 3ICCA 4LV8B 1DJLA 2JFXA 2ECFA 2GNAA 2RGXA 3LL7A 1Z0ZA 5GP1A 3G8BA 3IAXA 4Q6BA 3IXMA 4LHVA 1Z5OA 4ER3A 3L6UA 3AJRA 4R7GA 3CLSC 3HCCA 3RREA 4ZDIA 4O29A 3VOTA 1TXGA 3RYFB 5C18A 2XI4A 4WCFA 2B69A 1NAIA 5CT9A 3OLQA 1DP4A 4G5RA 4CIYA 3SLGA 1V3QE 3M2PA 4R8RA 2A0YA 4RPKA 2X8BA 5F5LA 3WRWA 4RFSA 2FEKA 3FTCA 4KQXA 5TRTA 3ZS8A 3ZIDA 5I9IA 3RKUA 2WSSA 1E2KA 2X4IA 4MUHA 4Y3UA 2DHRA 3RVBA 2JH9A 4ARVA 4GRAA 4Y1FA 4KSYA 4XWGA 3DZKA 2XDYA 5F2OA 1GZ3A 1PAUA 5A71A 2ZUVA 3KQOA 1CXZA 2Y0BA 3I12A 5ITZA 2ATEA 4O1IA 3EPJA 3DAFA 3H7AA 1L9XA 1NY6A 1RP7A 1V5FA 2IE8A 4ER7A 3NJ4A 2VEDA 3MC1A 4HGYA 1UWVA 5JADA 1ECFA 1JIXA 4QTTB 2CHFA 5F33A 4J91A 3KU4A 5ARCA 1FS4A 1Y8RB 1U80A 3L0ZA 4RLQA 4UBLA 2PX3A 3EGXB 3OEYA 5FWNA 3HJNA 3PS9A 1ITZA 3FH0A 2ECOA 4NMXB 5THQA 4BNDB 4KBYA 4WKPA 1WZUA 1VSVA 1GARA 3D7RA 4KQJA 5HS6A 2WQZA 3BSFA 4QG7A 2WAMA 2XCIA 4GC9A 4XM0A 4HDNB 4GL2A 4Q9HA 3U4CA 3AW8A 3WG9A 2YXLA 3N2IA 4W5NA 2QMOA 2NGRA 3IELA 4PZ0A 3TPCA 3MTGA 1VFNA 2JFUA 1SQ0A 3DMGA 4REOA 4Z0TA 3Q7RA 2Q1SA 1NN1A 4HUJA 1SN7A 1EK1A 1USKA 2JHGA 4PQFA 5FKJA 3MWEA 4R0NA 4ZVSA 3V4PB 2XZOA 3WWYA 1FYDA 2NWQA 1JT9A 2I3DA 3LX5A 3B3JA 4S1PA 2B1IA 4JUBA 3KX2A 3CWZA 3EZ7A 4C4PA 3N2KB 1A2OA 1G20E 4OMDA 3TZBA 1DT5A 2HA7A 1TPZA 4IJVA 2O8FB 3S29A 3I1JA 4XSHA 2VWGA 4DRZA 5IU6A 1CUDA 3DOHA 2HY7A 2I87A 3FJ1A 4KTVE 4TLEA 5JS8A 2JGIA 4J76A 1CETA 3RR2A 2PX2A 1H5NA 2AXNA 2WTBA 2FSVC 2HTFA 1PS9A 4IR7A 1MQ8B 4NKRA 4WKCA 4ZHQF 4M6WB 4DANA 5IDWA 2AUTA 1NE7A 1O94A 3CVOA 2PKEA 2NVUB 3LK6A 1TZ2A 1WS6A 5EWMB 1E8MA 2QS9A 1P39A 3OICA 1JFFA 4HD8A 3R3JA 4QDTA 3HDQA 3LYLA 1DV1A 2BONA 3N2GB 5CYFA 4ZODA 2D2XA 2Y4OA 5B2ZA 3M6AA 3JPWA 1QIDA 3A06A 4ESVA 4ZRMA 4M0KA 2A5GA 2IZ7A 2R62A 1ZD4A 1NFQA