4CQLB

Crystal structure of heterotetrameric human ketoacyl reductase complexed with nad
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
227
Chain Sequence
HHMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords ESTRADIOL 17-BETA-DEHYDROGENASE 8
total genus 63
structure length 227
sequence length 239
chains with identical sequence C, F, G, J, K, N, O
ec nomenclature
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cqlB00
4E5MA 1F8GA 4DPLA 1JDJA 4TZTA 4DQXA 2WM3A 1Q7BA 4PG7A 2YZ7A 1HZJA 3JQAB 4RPJA 3U4HA 1GPDG 1GV0A 1Y8RA 3A1NA 3HNPA 3TDKA 4Y9DA 2GLXA 1E3SA 2VYVD 4CMHA 4RVDA 2C5EA 4K26A 4S1VA 2D5AA 4RV9A 4QQRA 1DFHA 1Q0QA 3BTVA 1GYRA 3NJ4A 3AI2A 4NI5A 2YYYA 3E9MA 5KWEA 2IRWA 3GVPA 2VHYA 4CMJA 4JK3A 3U49A 3ZU5A 1PZFA 2PGLA 3FPLA 4OMUA 1Z82A 1NTOA 5JSFA 1GZ4A 1AHIA 3S1LA 3UGKA 4C7JA 1GQQA 5B4VA 1RM3A 2Q45A 3E6AA 3VKUA 1E1LA 4WCFC 5I9NA 1I24A 4FOSA 2VT3A 3BMOB 3C7DB 5CG2A 1R4NB 3F3SA 2ZCVA 4RVGA 4MIOA 4XZ3A 4ZQBA 2UUPA 1ONOA 1PWZA 2W90A 1SPXA 3WSVA 1E7RA 3WFJA 3HB4X 1IE3A 4R69A 1K2WA 4LN1A 4WLOA 1PZHA 1LLCA 4QUKA 5JLAA 2G0TA 1PJCA 1UP7A 2JHFA 4O63O 1E0DA 1PJQA 4D0SA 3MTGA 3DBHA 1X0VA 1W73A 5DULA 4E2YA 5JXWA 3TJRA 1XA0A 4E21A 5ENVA 4ALKA 5FEUA 4BV9A 1A72A 1EDZA 1WW8A 2PD6A 4II2A 4LISA 4DRYA 4WEQA 4XD2A 1V8BA 1EFKA 5KJ6A 3BMCB 1R4MA 1QV7A 3QE3A 1C1XB 1MFZA 1XU7A 5JY6A 4BOYA 4UULA 4YWJA 4ZICA 3CKYA 2DBRA 1LEHA 3ROPA 5A3JA 4PLWA 1W4ZA 4I5GA 3DBLB 2Q49A 4PRLA 1Z6ZA 1GQ2A 4NBRA 5KJCA 1DIAA 2OXIA 1PU2A 3U3XA 3AFMA 3JQ7A 2V6FA 3GPIA 3H9JA 4ZHSA 2NLOA 4KQXA 4D3SA 4FFPA 5ILOA 4DYDA 3RU7A 2IXAA 3MOGA 2HQ1A 1E3WA 2W2KB 3DTTA 3ZH2A 3PYLA 4Q9NA 1GD1O 4BO4A 1PJ4A 2POQX 1LSUA 2GZ1A 3IJPA 5CEFA 3FNEA 2YW9A 3TQHA 1ISGA 3KB6A 3JQBA 4RF3A 3QVXA 1H6DA 4DVJA 2PWZA 1LRKA 4E5YA 2OUIA 4MINA 4X54A 3VHRA 4BS9A 4L9RA 4WCDA 3RC7A 2VN8A 2GZ2A 1TLTA 1ONNA 1V3VA 2Q3EA 3D3WA 4XB1A 1PEDA 3JQ8A 4FPXA 3T4XA 3DEYX 3RC2A 4W99A 5HRUA 4YJDA 1DEHA 4GAEA 4IM7A 3OIGA 1Y7TA 5L40A 3CE6A 4BV8A 4YT2A 2DQ4A 3OM9A 1K6XA 4YDRA 3K92A 3L6EA 4B7UA 4CUZA 5IAAA 3I4FA 4XX0A 3EAGA 3QW2A 1HYHA 1U3VA 1OBFO 2AXQA 2HMSA 4CMCA 2EJVA 5JCJA 5JDCA 1U2GA 5JC1A 3W6UA 1ZNQO 2Y1OA 3GNSA 2Z1MA 1DHTA 4U8GA 3ZW8A 4XGNA 3OBBA 5IN5A 3ZWOA 3LT0A 1I3MA 1E92A 4OXKA 4YJFB 4R9RA 5L4LA 3C85A 2X23A 2PK3A 4CMEC 1KVRA 2D3TA 4IPTA 3PYMA 1K0UA 1TEHA 1ZIDA 4Z3DA 2BLLA 2QYTA 1E1MA 1I8TA 3RI3A 3VVBA 3O8QA 3I1JA 3BHIA 2A35A 1KS9A 5JAMA 1P44A 5A04A 1PS9A 1NPYA 3QY9A 1NPTO 4N5LA 4FC7A 4W7IA 3KHUA 2I66A 1JU9A 1U1IA 3JQCA 1NYTA 3MJEA 1TA4A 1MXHA 4BNXA 2O7SA 1P1IA 2IEDA 4IS2A 1U7HA 3L0DA 4YQYA 4MJLA 1SB8A 2OMEA 4J1NA 4WE3A 4BNTA 1Y1PA 1NFQA 1Q7GA 3WYCA 1BRMA 1YB5A 3T7CA 1GEEA 3GEGA 2FWMX 4URFA 1U4SA 4R9SA 4DREA 4I8XA 3JQ9C 3VZQA 4ND2A 3N58A 1YDEA 4BO0A 1RYDA 4MVJG 1ZEMA 4RZHA 5KTKA 1Z45A 1PJLA 3GVHA 5KJEA 3ZWBA 4P8RA 3T7EA 2O2YA 3Q6IA 3C1AA 4FFLA 3GK3A 4RLHA 1Z74A 4AG3A 4QECA 4FJ2A 2PZJA 3BMNA 2J5QA 3GOHA 1MP0A 2GDZA 4BNIA 5BR7A 5JDIA 4J2HA 4XIJA 5HM8A 3PWZA 4GBJA 5DCUA 1PZGA 2I6TA 5EINA 4YA6A 3EUWA 4A26A 5CDGA 3F5SA 5ILGA 5ICMA 4M1QA 3H9GA 2A4KA 2YFHA 4GX2A 1YL7A 2O3UA 4D3DA 4YJHB 3AY6A 4K28A 4Z9FA 3VOSA 4OSOA 2P9GA 2OO5A 1PJTA 3H2ZA 5CDYA 3L4BA 3OJEA 4D42A 2QQ5A 3PFWO 2VTEA 4J9UE 3VZPA 3K2BA 2Y0EA 1YB4A 1H2BA 2GERA 4GVXA 5KJ1A 2E82A 2Q99A 2I67A 1XIVA 3NEPX 1X7DA 4B4VA 2JHGA 2Q50A 1E3WB 4WLVA 3H4VA 1WWKA 3M2TA 2AG8A 4DUPA 3FPCA 3OH8A 9LDTA 4FS3A 4ND1A 1YL5A 1UR5A 1WMAA 1Y6JA 3NT2A 1YO6A 2B37A 3OIDA 3O03A 3AU9A 1FDVA 1K6JA 1T2EA 2OBNA 1P1RA 3HWRA 4YPOA 5HS4A 1W6UA 3UKOA 1MUUA 1MB4A 1EQUA 2IZ1A 4GX0A 4TRRA 2FZWA 2HDHA 1ZXLA 4RLSA 1A7KA 4R5MA 5ADHA 2WWRA 4RVUA 5AXCA 3E5RA 3S2IA 4BGVA 3MZ0A 2YV3A 1SB9A 3NDRA 1I01A 3BMOA 3BHMA 5KKCA 3V2HA 3GZNA 4MKRA 1GQYA 3KM0A 2Y68A 3BMCA 4L74A 3MWEB 1DFGA 5B4UA 4J7XA 4PLFA 3LF2A 4NHEA 1VJTA 1E1KA 4PLCA 2H6EA 4AJHA 4DIFA 4NJOA 5EESA 1R12A 4ID9A 1HE2A 2P4QA 1D4FA 3GR6A 3ON5A 4Q3NA 5FI5A 4CUJA 1VI2A 4BNUA 3D4NA 1D8AA 4NU6A 3U62A 2DPHA 1E7QA 3DBHB 3COSA 2QIOA 5DP1A 2C2YA 3RROA 4R1SA 4N5MA 2YHIB 1MG5A 1PJ3A 3FD8A 1NWCA 1TB4A 3DMTA 4YT8A 3UICA 3HB5X 3GG9A 4DPKA 1ZJYA 4LK3A 2JKVA 2XXJA 1LJ8A 1FXSA 1H5QA 1ZK4A 3WGOA 1L7EA 5I9MA 2ZYAA 3JD4A 3BMQB 1ZW1A 2DBZA 4RQTA 1I32A 5IXSA 3ICPA 2EF1A 2BFOA 3DHEA 4Y8VA 1LUAA 4EJ0A 1PJBA 3DBRA 3E18A 3QWIA 5BNFA 4CM8A 1BDBA 3KSUA 2VTDA 3CIFA 4KMSA 4PZEA 2ZQZA 1LSOA 2LDXA 5BSEA 2B4RO 3KYBA 3D3EA 1I33A 3ETGA 3WMXA 1J5PA 1Q7CA 2AG5A 3TSCA 4RQUA 3OF2A 4CM5A 1LDNA 2NTNA 4R51A 1XQ1A 4YJHA 3U09A 2FR8A 2I99A 3RC9A 2FMUA 3AM4A 4HX5A 3JQ6A 5DNAA 1E7MA 1N8KA 4BMSA 8ADHA 5A9TA 5EL0A 3JQFA 1B26A 5TIIA 2J6IA 5ES3A 2QRKA 4ZVVA 1F17A 4J1SA 3ZHBA 2V6GA 5F5NA 1ADGA 2CVZA 3NT5A 4PG5A 2QHXA 3PZBA 2J3IA 4E33A 3K31A 1VRWA 2PY6A 3HG7A 4AJNA 4CM8B 1BXZA 4HNGA 1DBVO 4BO2A 5ENDA 3WNVA 2NNLD 1VLLA 4QO8A 1WPQA 3Q1LA 1LLDA 1C0PA 2PV7A 2VWQA 3INRA 3PP8A 4J1TA 4TROA 3RJ5A 4NBVA 2PKQO 3ADPA 3GMSA 4YT5A 1BTOA 3ANMA 1J6UA 2DTXA 5DBIA 4HBGA 3GLQA 3ENNA 3G79A 3PGXA 4MVJE 3KXDA 4AICA 1OFGA 4FIZA 3ZV3A 4PZCA 1NQ5A 4J3FA 4B3HA 4CR7A 4BUCA 4IQ8A 4WECA 3FBTA 2B36A 4CL3A 4F46A 3BMQA 2PD3A 1BXGB 1A27A 1I3NA 2X1HA 2ZTVA 3M1AA 4GWGA 4PLYA 1H9BA 5G0WA 3I83A 3D0OA 2BGKA 5GZ6A 5IFLA 1ZK1A 4EZBA 2WD8A 1O89A 3LQFA 4KP7A 3ZHZA 2JCVA 4QFCA 2IYOA 1LRJA 1T1RA 1O95A 3IS3A 1BGVA 1QYDA 4IXTA 2H5LA 5KNLA 4CV0A 2HK8A 3H6KA 2I9PA 4PIVA 1WNTA 1D3AA 2WSBA 4HNHA 1N1GA 4CMBA 1EUDA 1XLTA 1K5HA 2G1UA 1BVUA 2GYYA 3S55A 4YEDA 2B35A 4ZQEA 2FN7A 2CMDA 3ZWWA 3QVWA 5H81A 2I76A 2OORA 3K8ZA 4A7PA 2O3QA 4CM7A 4FGSA 3OJFA 4XJSA 3UW3A 4IY1A 4OSPA 1RJWA 3C8MA 3GEDA 1FF9A 4DC1A 3U0BA 1ADBA 3JQEA 1DIGA 2Q1TA 3I6QA 1GUFA 1SMKA 4IDCA 1WAMA 3C3XA 3LF1A 2CDBA 3U4DA 3SLKA 4FOOA 4L8VA 4XYLA 3WTCA 2NVUB 2J8ZA 1SEVA 5CEEA 2DTDA 5AQ1A 1HXHA 3OIFA 4RVHA 4CUKA 1JVSA 3D4OA 4UUOA 4K1LA 2FPPA 2P68A 1IZ9A 4BO5A 5JAIA 3OEYA 5T57A 3WS7A 3IAHA 4ZQFA 1WP4A 1N1EA 3M6IA 5G4KA 4BNFA 5GZ3A 1N9GB 2VNSA 4E32A 3IQDB 1EK5A 1UJMA 2X9VA 1KOLA 4KTVE 1YBVA 1DIBA 2PKRA 1OZAA 4LMPA 3EMKA 1NHGA 1C0KA 4I1IA 1DC5A 1WLYA 3PWSA 2HK7A 3WGIA 1E1NA 3INTA 3DBRB 3K30A 3OECA 3ONEA 4D3FA 1Q0LA 4M54A 1E77A 2CVOA 3DMTC 3F1KA 4FJ0A 4EEXA 2VWGA 2WJPA 4CQMB 1JTVA 1T25A 2X5OA 1ZSYA 3WGQA 4NH4A 3GFBA 3HE3A 1SEPA 1HDCA 2B5WA 2VRCD 3KLPX 3OICA 4Q39A 3OA2A 4RDIA 4MVJH 3V1TC 4J43A 3DZBA 3NTQA 4WASA 5AXAA 3VTFA 3IKTA 1LX6A 5MGBA 1VC2A 2WMDA 1KBZA 1EMDA 4YAEA 1N5DA 3PLRA 3OEWA 4B4OA 4E2XA 4IJUA 2QZZA 3SXPA 1MG0A 3PTZA 3L4SO 5I7EA 3EY4A 3RKRA 4BO1A 1QSGA 3ZZNA 2EKQA 4R1TA 4ROSA 1ENPA 1UXIA 1WZEA 1HE3A 2QZ9A 4W9NA 2NVBA 2VZ8A 3QWAA 3R1IA 1O8CA 2D8AA 4YJGA 7ADHA 1RWBA 4Q3CA 1LDEA 3UH1A 7MDHA 1LNQA 2PH5A 3DL2A 4WPGA 2FSVA 4XQ9A 1MV8A 1LSSA 1PQWA 4L76A 5KVCA 4J4TA 4PG4A 4RJTA 2Q1UA 1H0KA 1QP8A 5FWNA 1YB1A 3G3EA 4O0LA 3IMFA 4E5PA 3LC1O 5H82A 2FR0A 4B8WA 1UZLA 2NTVA 4M8SA 2Y66A 1UXKA 4IUYA 2NADA 2G17A 1TVEA 1AGNA 2VZ9A 1U9JA 3OHSX 2J3HA 4K6CA 4FR5A 4HFJA 4PCVA 2C59A 1IB6A 1LTHR 1BWSA 3JV7A 3U9LA 4DPMA 3FCOA 5I9LA 3V2UA 3CMMA 1HDRA 2ZCUA 3QWBA 4YT4A 1PWXA 3JYPA 4J90A 3Q9NA 4CLRA 4M87A 2O50A 4H3VA 4E12A 1UXGA 4AJPA 1K6IA 3WQSB 4ZU3A 1GDHA 5I7SA 5L9AA 4FFRA 3LLVA 4NFSA 3FNHA 2ZTLA 3WOHA 1P1KA 2F1KA 3A14A 2JL1A 1C3VA 3WGGA 3KYCA 3TOZA 4PZDA 3UF0A 2QYSA 1JWAB 2VCYA 3W4JA 1EE2A 4UVEA 5B37A 4PVDA 1FDSA 5GY7A 4EI2A 2CZCA 2XPCA 4RF4A 2ZJ0A 3AUSA 3X2EA 4CV2A 5AYVA 1E3EA 1EVIA 2CD9A 4LGVA 3FSRA 4WNIA 1ENYA 1ADCA 5G2OA 4GKBA 2HJRA 4BMVA 4IQGA 4RF2A 3VDQA 1EZ4A 3HDJA 4JXKA 1B3RA 3ZWNA 4B4UA 5HBRA 2YJZA 1C1XA 1AN9A 2X0JA 2VUTA 3WIEA 4NR0A 4TSKA 3WLEA 3H5AA 2AEJA 4CLEA 3DZFA 3K96A 1LU9A 1MFPA 3I5MA 4XYBA 1U3UA 4BB6A 4QO7A 1HTBA 1WZIA 2AE1A 3P5SA 2JFFA 1JAYA 2Q1SA 4O1MA 4DC0A 4XQCA 4K9DA 3MTJA 4CMEA 4EUHA 1ULUA 3W4KA 3AM5A 3BIOA 4P4GA 1R0LA 4WEOA 2FR1A 3S2FA 1VL6A 3PJGA 1AHHA 1XHLA 1BHSA 1GY8A 2Q4EA 3GAZA 2CY0A 2NSDA 4RDHA 3VH4A 1ZSVA 3QWHA 4KWIA 3QWFA 1VKNA 5DT9A 3PIIA 1GUZA 2VHXA 5JE8A 4PLTA 5I8ZA 1B7GO 2ILTA 2P9CA 4QX6A 4NZ9A 1PR3A 4OKIA 1BW9B 4TQGA 2GO1A 4IZIA 4BNKA 3WTBA 6ADHA 5F5LA 1V35A 2X9NA 3JYLA 4I5FA 3RUFA 3EVNA 4OYRA 4Y67A 3V1YA 5TGDA 3PYXA 1RM0A 3RC1A 3ZV5A 4D0RA 2AW5A 1A4UA 5K9ZA 1R16A 1TT5A 3AWDA 3IL2A 4HADA 1PS0A 2X5KO 2WD7A 1PX0A 1IZ0A 1SC6A 1YQDA 1H93A 1YBAA 3BA1A 3NTOA 3VPFA 4IJVA 4IIUA 5F1PA 4E30A 4OM8A 2UVDA 1NM5A 3RCBA 2JFHA 4A73A 2XF8A 1UP4A 3BXXA 3O4RA 4G5HA 2G76A 4FD3A 1JKFA 3W6ZA 4CM9A 2IE0A 3W8DA 3OETA 1I2CA 1NVGA 4CLRB 3L77A 3FWZA 4P4LA 1NASA 4Z9YA 3UOGA 3VH1A 3OQ6A 3I23A 4II3A 2C82A 5FYDA 2GSDA 2FY8A 4MIYA 5I7FA 5I7VA 3FI9A 3WG9A 3RD5A 1D1TA 5KOIA 3VC7A 1IHXA 3MJVA 1Y9AA 4DLAA 5TSDA 2XAAA 3I9MA 3TZCA 3PDUA 3PHGA 1DIHA 1U2DA 2RH8A 3D64A 4MVJM 4R41A 4CM3A 1QYCA 3PZRA 1TI7A 4YCAA 5CDTA 4MVJA 5C3MA 4OH1A 1SZJG 5A03A 4NG5A 2PKQP 4GSLA 1X14A 1Z7EA 3AY3A 3GMDA 1OOEA 4FN4A 4CM9D 5EJ2A 3HDHA 2A94A 2EP5A 2WE8A 3VH3A 4YAKA 1EBUA 1EVYA 2O3JA 3ETEA 4J7CA 1FK8A 2OHXA 1DIRA 3Q0EA 3BAZA 4LSWA 2WEKA 2Y1DA 4UVHA 3RUEA 1XGKA 2H9IA 1JA9A 3JQAA 5L51A 4CMIA 1KEUA 2ZJ1A 1EQ2A 3UUWA 2AHRA 5TT0A 4E5KA 4WCFA 3SX2A 3T4EA 3H5RA 1OC2A 1GR0A 4TWRA 3VVCA 5I8WA 4E2WA 1V3UA 1A5ZA 3IIEA 3PQEA 3MEQA 4YJGB 1XSEA 4J2OA 3AUUA 4WNCA 4Z0TA 1B8VA 3ITKA 2H1SA 3EC7A 4I5EA 4XQGA 5DDIP 4BQPA 3BYZA 1C1DA 1P0CA 2FPGA 4W6ZA 3ZW9A 5FF9A 1DPGA 1B3BA 1VSVA 1Y9EA 3BZUA 4WLUA 1HETA 3NGLA 4ND4A 2BFPA 5JAQA 2DUUA 4YRBA 3PHHA 2RH4A 4J16A 3WLFA 1HE5A 2PGJA 3BTOA 4D7AA 4EDFA 3WJ7A 3UCEA 4AJJA 4UVIA 1V9LA 3NUGA 2JFGA 4WUVA 1PJSA 4U5QA 1IHYA 3QQPA 4E5NA 1HZZA 5L4SA 2EV9A 3NKLA 1VL8A 2F00A 2HRBA 4NK5A 5IZCC 3VPSA 3GDOA 3PJFA 1MC4A 1P1JA 1E5QA 4P22A 3DBVO 1NXQA 4M55A 1ORRA 2B4TO 1BDMA 2PR2A 4GMGA 2JAPA 5IG2A 3HDYA 3TRIA 3H9UA 3EK2A 2HMUA 4FFNA 2VHVA 2B83A 4NMHA 2P91A 3PXXA 1M2WA 4NJMB 4CPDA 1ZEJA 2PA3A 2PLAA 3L9XA 4IDFA 4D43A 4E3ZA 5ICSA 4CR6A 5BT9A 2ZK7A 3MCVA 4FC6A 2EKPA 2GRAA 3WQQA 4JQCA 4LVUA 4RCVA 4ZJUA 4BNHA 3ABIA 2HJSA 1VKOA 4UUMA 3DDNA 1CIVA 3IUPA 4YJFA 1E7WA 1M6HA 1MGOA 2J3JA 2NU9A 3AU8A 1FMCA 1RKXA 3FF4A 1P74A 1QXSA 2Q1WA 3PEFA 3ZWAA 1Y8QA 5IDWA 3PIDA 3AI3A 4IS3A 4CM6A 1G0OA 2Q2VA 3KSZO 4KQWA 3Q2KA 1XG5A 4MVJI 3L07A 4XIYA 4FB5A 1ISHA 3QV1A 4BNGA 1EFLA 1HLPA 4D45A 3AFNA 1M75A 5LC1A 1IPEA 1DC3A 4NFYA 2R00A 3C1OA 1YVEI 2I3AA 1NWHA 5COAA 4BNWA 3IKVA 3PQFA 4BO9A 3GN2A 1B14A 4GX1A 4QTZA 1GUYA 2DLDA 3WWYA 3CINA 5AVOA 4KTTE 3DMYA 3M2PA 3A28A 5IZCA 2C5AA 1JW9B 1SAYA 4DLLA 2VUSA 4MIEA 1WVGA 5IZ4A 1DDOA 1KETA 4IDBA 3AOEC 4NFHA 1XDWA 2NQTA 3N7UA 4JCOA 4R01A 4YTEA 4GGPA 4J4BA 2OOSA 4OQYA 5JCJD 1GCUA 4TRJA 5EN4A 2GF2A 3A9WA 1LDGA 1NR7A 4TVBA 4I9HA 1LC3A 4JJFA 4OOFA 1BSVA 3K6JA 1JQBA 1B0AA 4CLDA 1IPFA 3TFOA 4E0BA 3E1KA 3AW9A 2EW8A 2Y05A 3HFGA 4L4SA 4GI2A 3UVEA 1KY4A 4BHTA 2HO5A 1JN0A 2DC1A 4CQMD 4WCFB 4BMNA 3DB2A 1E7SA 5DCWA 3NJ8A 1CRWG 4WGGA 3H3FA 4IDGA 1LRLA 5F1OA 4TRMA 3UN1A 3I9OA 1WDLA 4OAQA 2TMGA 4PN3A 2ZTMA 4RPGA 1J49A 3I4CA 2HMVA 3CH6A 1PZEA 3ZDFA 4BB5A 3TN7A 4KDEA 3L6OO 2DBQA 3WIDA 3AK4A 3HJAA 3BTUA 5JNLA 4XDYA 3UXYA 3W8EA 3WWZA 5C37A 2BKAA 4IGFA 3E8XA 3RSHA 4MDHA 2X0RA 3E9NA 2OL4A 4OXYA 3PRJA 1Y8RB 3TL3A 1E6EA 3OJOA 3RFVA 5LCXA 2C7GA 4ZGWA 3H5NA 4INAA 2ZYGA 5DBGA 4YR9A 3HDQA 5F21A 1ZMOA 5AXDA 3JQ8B 3P7MA 5G0VA 3F5QA 3ULKA 1E3LA 2VUUA 2OFPA 4XKJA 5CFZA 2O48X 3EDMA 4YAIA 2YHIA 3LSYA 1EBFA 2Y1FA 2C07A 1A7AA 3UFXA 2P5UA 2BF7A 3TZQA 3WBBA 4U0KA 5JBIA 1UH5A 3ZV6A 1U4OA 4IZHA 1CQJA 4O6VA 3WJAA 4DIOA 4DMMA 3PWKA 3OQ1A 3RWBA 3DBLA 4OQZA 4GX5A 3WX0A 4B4WA 4N54A 2C7VA 2DBVO 3F1LA 3L4BC 4CQLB 2HMWA 3LZ6A 3DXFA 2E49A 1KEWA 4GQAA 4IXWA 4IDDA 1P1FA 1C14A 1NX6A 1I3LA 3VAZA 4FFOA 2DAPA 2ZYDA 3ZI0A 4ITUA 3DWFA 5TLSA 1ZVMA 2Y93A 2CF5A 5JMWA 1F12A 5L7TA 2BELA 5K0ZA 4HP8A 1NFFA 2CVQA 4LCJA 1P3DA 1GCOA 4CMAA 5A9SB 4RPKA 3I9JA 1ZXBA 5TRTA 1UDBA 4W82A 3K73O 4LSMA 4BNVA 2PZKA 3ZWVA 5JDIC 4PLVA 2HAEA 3VPHA 3WB9A 5L45A 2GCGA 3GQVA 2NVWA 2ZIZA 1H6CA 2RBEA 2D2IA 2IYPA 2YQ5A 4F6CA 3PHIA 5U1PA 4UUNA 3JQ9A 1DJQA 1HE4A 4JX8A 4KDFA 5CDUA 5GZ1A 2FZEA 3IP1A 5T6BA 1B8UA 3F9IA 1UXHA 1N92A 1CETA 2NVUA 3AJRA 1GEGA 2HRZA 3B1FA 3ZU3A 2ZB7A 1LXCA 2PFGA 1YOVA 3RFXA 4G81A 3KLMX 3EVTA 2NQ8A 3WFIA 5MDHA 5ITVA 4TVOA 4CODB 3AUTA 1NVMB 3AUAA 5A3VA 1XKQA 4NPCA 5ER9A 3QA9A 4YQZA 4BGIA 1KC1A 4PG6A 1LLUA 4Q3EA 4IIVA 3ASVA 4O59O 2HMTA 3DHYA 2NTJA 3EGOA 2RHRA 5L4NA 1V6AA 1Z7BA 4AJEA 1V0JA 1RPNA 3F46A 3EW7A 3JQDA 4U7WA 1NQTA 5ITWA 5KVVA 4DTIA 2VHWA 3HUDA 1I3KA 4Q3BA 1YDWA 5CAEA 4ZRMA 1YL6A 3SJUA 4J9VA 4OO3A 4YYZA 1KVUA 4G65A 4Z0HO 3OP4A 2NU8A 4MP6A 1GADO 2VYVA 4YXFA 3E5MA 3R0IA 3NTRA 1B2LA 4KZPA 1MA0A 3CPSA 4F3YA 3RFTA 5U9CA 3WGTA 4AFNA 1CDOA 4ND5A 1VJ0A 2X8LA 4EW6A 1RM4A 3AM3A 2YHUA 5K6AC 1SBYA 4M49A 4JP2A 1U5CA 3LU1A 4L0QA 1GL3A 2J5RA 4OKNA 1B16A 1H2HA 1N7HA 2EG9A 3GH3A 3WGHA 1U8FO 3S2GA 3VDRA 3ST7A 1ZJZA 3EZYA 3ASUA 3LK7A 4D46A 1CQIA 2W98A 1VJ1A 3QLJA 4BO6A 2HU2A 2O2SA 1PGJA 1VE9A 3BMNB 1ZK0A 4WLEA 1QLJA 4BNMA 3HQ4O 4DGSA 4DYVA 3JQGA 4FFMA 4H7PA 4CM1A 3WICA 2YDYA 2X22A 2IZ0A 3GVIA 2EHDA 3GZNB 1CWUA 2H63A 4JJIA 4E6PA 1KVSA 5JDCC 1GYQA 4RZIA 3KO8A 2BFMA 1YE3A 4CM4A 1DC6A 4DA9A 3IUSA 3KETA 3FNFA 3D7LA 1EUCA 3MJCA 1WMBA 4MPDA 4CMIB 3I3OA 4QXMA 4TMFA 5G0SA 4YRAA 4XGIA 2O4CA 5TJHA 4RVFA 5IDXA 2CDAA 2VWPA 6LDHA 2E37A 4A10A 4UUPA 1LQTA 4F45A 4BKOA 2OP1A 3E82A 1UXJA 3LVFO 5JS6A 3IDSA 1HLDA 2DFDA 4J49A 1QKIA 1T2FA 1W0CA 2WTBA 3ZWCA 5DF1A 4CQMA 3W4IA 3LT4A 3RUDA 2W2KA 2C2XA 5EERA 3JQBC 1V3TA 3JD0A 3D4PA 3PHLA 3OJ0A 4R3WA 5CEJA 3I9KA 1DRWA 4AJ2A 3R3JA 1KY5A 1O0SA 1YOVB 1BXGA 2WYWA 4HKTA 3PDJA 1GZ6A 1GAEO 2B5VA 8LDHA 1PL7A 1ULSA 4XR9A 3V1UA 4IBOA 4BVAA 1T2AA 1P9LA 2VHZA 4J1QA 5T67A 3WDSA 3JYOA 1Y5RA 1HYEA 1ZH8A 4R1UA 5HS6A 4W9NC 1QYVA 3ZU4A 3KRTA 1XWFA 3WMWA 3WQRA 1H6BA 1WDMA 3CSDA 3NGXA 2PZMA 4UREA 2R2GA 4EITA 5DCYA 3RUHA 2DT5A 2Q2QA 4CLOA 3GNTA 1X7HA 3VZSA 1D7OA 1DAPA 4D79A 4AVYA 1QR6A 4CMKA 3EYWA 3QVTA 1ISFA 2PGDA 3ENKA 5KCZA 5IN4A 3CZMA 3DZIA 4N7RA 1P0FA 2G82A 4C4OA 4Q3DA 5A5FA 5L7YA 1B8PA 4DQUA 5TNXA 2CF6A 9LDBA 3PI7A 5CDSA 3P2OA 3G1TA 3CZRA 4XEHA 4GKVA 4P4NA 4UEOA 1F06A 2AEMA 3HFSA 4TKMA 2BFAA 2W2LA 4FBGA 5A9SA 4BIIA 1IY8A 1X13A 3O26A 3FRJA 2NU6A 2SCUA 4JBIA 1X1TA 3C7AA 2JJYA 3ONFA 1A4IA 1ZKMA 3RUCA 4GL4A 4RF5A 4RL6A 5LDGA 1ENOA 4L4RA 5ER6A 4IMRA 1E6WA 3ZN2A 3X2FA 4QSMA 5HTOA 4AJLA 3ZNNA 2GASA 4DWVA 5FI3A 1PQUA 1HSZA 5BQFA 4GPD1 1I30A 4I9NA 1BVRA 3F4BA 2J5KA 2OP0A 5U4QA 1X7GA 2O23A 3GZ4A 4MKZA 5B12A 1I5RA 3SVTA 2XXBA 1UP6A 4KUEA 3S8MA 5G4LA 3ZNOA 4S3MA 3O8QB 4PGFA 1NVTA 1ZBQA 2X0NA 5KVSA 4M86A 1XCBA 3GG2A 4IMPA 3KVOA 1EVJA 1O5IA 3DAFA 1LSJA 4CR8A 2DM6A 2GGSA 1ZCJA 3A4VA 4AJ4A 1HF3A 4LVCA 4BKRA 2AEFA 3B1KA 5CPFA 3DOJA 3VPGA 2EP7A 3N74A 1ARZA 2JCXA 4BGEA 5LDHA 4PVCA 3ZWXA 1T4BA 4AJOA 4CQLA 1Y8QB 2X4GA 1SOWA 5T8KC 3ONDA 3GHYA 3IOYA 3MOIA 1AUPA 2EEZA 3KSDO 3P2YA 4TRNA 1M66A 5A5EA 1J0XO 4TZKA 3PQDA 3ZWMA 3VKVA 4R3NA 4UVDA 2ET6A 4HV4A 2NWQA 4L75A 2GN4A 3LLSA 2EXXA 3JTMA 1Z73A 5AXBA 4EGFA 1NNUA 4WK6A 5F1KA 3D1LA 5G4KB 3JD1A 1KIFA 1CJCA 1EUZA 3OQBA 4UAGA 1MLDA 4QEDA 2FHSA 2RHCA 4UEKA 3RBXA 2C20A 1UAYA 3ZU2A 3KEOA 4FSHA 4BQRA 5T64A 2DKNA 5CPBA 5A9RA 4XYEA 2RCYA 5TS3A 4HY3A 4Y6PA 5C7OO 3QSGA 2EERA 4BKQA 3O38A 1KEVA 1KC3A 1MX3A 2W8ZA 2WYVA 3DAPA 4E13A 5B1YA 1XELA 4R68A 1PTJA 1T4DA 4Y6SA 4PLPA 1X1EA 1EEHA 3DZGA 2CSUA 1DRVA 3JYNA 1NQOA 2VQ3A 3Q9UA 2LDBA 1UAGA 3JQFC 3SJ7A 1E7YA 1LI4A 1HDZA 4LRTB 3W1VA 4XYGA 2ZB8A 2PD4A 2W2LD 1CF2O 4ONEA 3SEFA 2UV8A 3JCZA 3ZHXA 2GR9A 5THQA 3ZNQA 1HDOA 3L9WA 3SC6A 5GMOA 1NAHA 3QP9A 1DOHA 4Z6KA 2EGHA 1P1HA 4HFNA 3RKUA 1ZFNA 2FSSA 3JQGB 1UDAA 3A06A 2D1YA 5G0UA 1HSOA 2EWMA 3RUAA 3EHEA 1DAOA 3G0OA 1NBOA 3QRWA 4LMRA 3TOXA 2GN6A 1FDWA 1EK6A 1JKIA 1QV6A 1C0IA 3ICCA 1DRUA 1ONPA 4HUJA 1I36A 3GT0A 4XR4A 4IDAA 4NBWA 3JSAA 4E4YA 1I2ZA 4ALLA 1PSDA 2UDPA 3FWNA 3NV9A 3K5PA 1F0YA 1Y81A 2Z5LA 1UUFA 4EUEA 2E6UX 4MVJF 2EIHA 3NDIA 5EPOA 2YFQA 1E3IA 2AQKA 2BD0A 3ZGYA 4ESOA 1S6YA 2X86A 1FJHA 1VL0A 2VOJA 3FBGA 4U6SA 4KUGA 3ZV4A 1YJQA 1QORA 4O5OA 1ZO8A 1E6UA 3INGA 1BMDA 1YS4A 5KJFA 4IQ0A 1OI7A 4GH5A 2CUKA 4HXYA 4FW8A 2I5PO 1J4AA 1VSUA 4AJKA 4Z0PA 5DOZA 4JJGA 3H3JA 4XB2A 4YBZA 2O7QA 2QX7A 3H7AA 4OIMA 4ZA2A 4NDNE 1NP3A 5JPIA 1YONA 1DO8A 1QMGA 1R4NA 2AA3A 1QG6A 2O3TA 2VYNA 1I10A 3Q2IA 3D5QA 4B8ZA 5JCXA 4XCVA 2IEBA 1KERA 2EKLA 1GTMA 5CG1A 4P38A 4B3IA 3H8VA 3MWDB 2ZTUA 3GRKA 2QRLA 4EJ6A 2YQ4A 1ADFA 3IP3A 3ZCXA 4BGUA 4EJMA 2UAGA 3KBOA 5JO0A 1PIWA 3DC2A 3TZ6A 1AXGA 1YRLA 4FQ8A 1T24A 3CTMA 3PK0A 4JIGA 4U0JA 3DOCA 4PG8A 4CLOB 2O3RA 2IDZA 4RORA 4GGOA 4XRGA 1EDOA 3TNLA 4BNZA 3PFFA 4U6QA 3RJ9A 1U7TA 1R15A 4ALJA 4CV3A 1YXMA 2WDZA 3TF5A 2OZPA 2I65A 1FDUA 4LCEA 1M6WA 2OBYA 4XGKA 3KOUA 3GVXA 5EQDA 3ZWPA 5C7LO 1S7CA 4ZQGA 2DPGA 4PFJA 4JNKA 5L53A 4OXNA 3GC6A 3IC5A 3MJSA 3TFQA 5IXYA 1QLHA 3E9QA 5BSHA 1IYZA 1HYGA 3FR8A 5EIOA 3VPXA 3TL2A 3RASA 1JVBA 1X15A 5L3ZA 1QYXA 1AXEA 4PLGA 2ZATA 3AOGA 5AOVA 1C1DB 2WE7A 1AE1A 1T2CA 2AQIA 2DVMA 4YAGA 3WYBA 4NBUA 3I6IA 1R4MB 4KOAA 2FP4A 1H6AA 1HDGO 1K3TA 5JY1A 3RIHA 3GF4A 3ROKA 1ISMA 4JN6B 5FFFA 4C7KA 4FJ1A 3NT4A 3LC2O 1HRDA 2O4UX 2RIRA 3ETDA 3QIVA 3MJTA 3H9EO 3U4IA 1R66A 2GN9A 3H2SA 2GUGA 1I0ZA 2D0IA 4NBTA 1ENZA 3ADOA 2XOXA 1W8DA 3CUKA 3E48A 4B79A 1IOLA 2D5CA 4DBVO 2P9EA 3ITDA 1N7GA 3RAJA 4NJMA 1DLIA 2FRDA 2Z1NA 2X5JO 2BI8A 2Y67A 4MP3A 4MVJP 3RQSA 4JROA 1E5LA 3VH2A 3PGJA 4CLXA 4CM4B 1XYGA 1RYEA 4JLWA 1ISIA 1LDMA 4RPLA 4WOKA 4LRSB 4FDAA 1Q0HA 4R1NA 4J0EA 3DZHA 3ROMA 1DHRA 1QYWA 4LW8A 5A06A 3B20A 4EUFA 2B69A 1EVZA 1GU7A 3DTYA 4MP8A 3R3SA 2V7PA 3TWOA 3LT1A 3PVZA 1X0XA 3D3WB 1VPDA 3UHAA 4PLHA 1T2DA 4BKPA 3GGOA 5KKAA 1UZNA 2QRJA 3AI1A 3LDHA 4Q3AA 1HEUA 2PH3A 3MJ4A 2AMFA 4OOEA 4WJZA 2CNBA 3WBFA 2HLPA 3JQ7B 2GNAA 2BHLA 3B6ZA 3U5TA 2V6MA 1U3TA 1YKFA 2IZZA 1KYQA 4YVFA 3KTDA 4MKXA 5A1TA 2RAFA 1I2BA 3PHJA 1R0KA 4R5HA 2WD7B 4NK4A 3AY7A 3VTZA 1N9GA 3OSUA 5EQFA 3DHNA 3ZNPA 4A27A 3WYEA 4D41A 4EEZA 2EW2A 3B70A 1A71A 3CXRA 3KV3O 4KUHA 4E2ZA 3GA0A 1F14A 4A5OA 2PZLA 4DL9A 4AJIA 4IINA 3TZHA 3R6DA 3DQPA 4FGWA 2NV6A 2WYUA 4MVJD 3S2EA 3WGYA 5JYDA 1DLJA 1R6DA 2X7HA 1GPJA 2CDCA 1NAIA 3OFSA 1HWYA 4ZN6A 1FDTA 3QJ5A 4ALIA 1PGQA 1TT5B 1U28A 1YBMA 3RVDA 3GN1A 5J23A 2Q2WA 4GSKA 4XRRA 4PRKA 2VRBA 4XQEA 4HFMA 5TT1A 1YQXA 3HHPA 5K6AA 2HUNA 1PQPA 2AQ8A 1IL0A 3Q3CA 3GRPA 3OMLA 1PGOA 4YAJA 5L95A 4JBHA 3UAGA 3GEMA 4D44A 1BW9A 1DC4A 4DXHA 5H83A 1YQGA 2GD1O 2JD2A 3V8BA 3OJLA 3FNGA 3KUXA 4BKUA 5C5IA 5C7IO 3KYCB 1O94A 3G1UA 4KWHA 4BNJA 2NACA 3D5TA 5A02A 5A4DA 1U5AA 2B4QA 4CL8A 3KYDB 3H9QA 4H16A 4J7UA 1G6KA 2D59A 4I5DA 2P4HX 5IF3A 1LC0A 3U4CA 2HK9A 4QFDA 1ID1A 4GMFA 1KEPA 1LBEA 4IJKA 4RPHA 5L7WA 1GV1A 3GGPA 2Y0DA 2FOIA 1BXKA 3FTNA 4NNJA 4ZD6A 2P5YA 2GN8A 5TJ9A 3RUIA 1DXYA 4XYMA 1PGPA 2UYYA 4W7HA 4B7CA 2VRCA 2X6TA 4YB8A 2AQHA 4RO0A 3C7CB 3I52A 1M76A 2IODA 3SLGA 2Q46A 2BMAA 4DBZA 2ZB3A 5KIAA 2EJWA 2VWHA 4IJWA 4R4JA 2YY7A 4OHUA 5IDYA 5HWSA 1JLLA 1QRRA 2BRUA 4F6LA 2NU7A 3GHHA 5BSFA 2VOEA 1ZUD1 4ALNA 1L7DA 2YV2A 4WKGA 1JAXA 1EE9A 2A92A 1ML3A 5T5QA 3K2EA 1P45A 4ZQHA 1ZZEA 4RGBA 1OMOA 3P19A 3JQAD 4ND3A 5TF4A 3SC4A 1T26A 1ZMTA 3FHLA 3Q11A 2NM0A 4JBGA 2DUWA 2VZ0A 5B4TA 3QVSA 1LLQA 2QG4A 2Q4BA 3GY0A 1GYPA 2IXBA 1LQUA 3I9NA 5BNTA 3NYWA 1LA2A 4R54A 4Y98A 3DFZA 4TKLA 3FTPA 4BNLA 1R0SA 2BI7A 1TXGA 1JWBB 2PTGA 4G2NA 4YACA 4WOJA 1KVQA 1SCUA 1SOVA 4NU5A 5DBFA 4K6FA 4ZRNA 2P2SA 1KVTA 2DTEA 4QT0A 3UCXA 1ZK3A 3ZHYA 1A9ZA 3V5NA 4AJ1A 2QW8A 2R6JA 3K9QO 4CLHA 2BH9A 2PNFA 1HDYA 4Y6RA 3ROQA 3C1TA 3NX4A 3JYQA 4BL5A 1YJ8A 1RM5A 3H65A 2Z95A 3OA0A 3PPIA 4FCCA 3TPCA 3TZKA 2OGUA 3DR3A 2X9GA 2YUTA 2BGLA 2UUOA 2O3SA 3JD2A 4DIBA 1NPDA 1PR9A 3QHAA 4YRDA 2B0JA 1BG6A 3M1LA 1IUKA 2AE2A 5JAZA 1B15A 2V6BA 1XR3A 4OJNA 3ANLA 4N18A 4JGBA 5CHEA 4OL9A 3F6YA 1H9AA 1H94A 1C0LA 3PJEA 1NQAO 2C29D 4B7XA 1OC4A 3WSWA 3NDJA 5COBA 1PL6A 1SO8A 3FN4A 3GDFA 1PL8A 4HFRA 4XDZA 1UDCA 1ZSNA 4A03A 4MOWA 2VYND 1SNYA 3EZLA 4HWKA 1NHWA 1NR1A 4NQZA 2E48A 5KVQA 3VZRA 4CMGA 1K89A 1F8FA 3GUYA 4PLZA 2HSDA 5JW6A 2HCTA 4R16A 4RVSA 3DO5A 2ZQYA 1D1SA 1Q1NA 3CMCO 2Y99A 4B3JA 4AL4A 1NFRA 2X58A 5JC8A 2GPTA 2JD0A 4EYEA 2C54A 3GAFA 1CERA 3GNQA 4BNNA 4CV1A 5JMPA 2JCYA 2NUAA 3LT2A 2JD1A 5A05A 3SBOA 4GWKA 2ZB4A 3NRCA 4BNYA 1P77A 3G49A 2I3GA 4ILKA 3FR7A 4A2CA 1XQ6A 1M67A 5TX7A 3F47A 1UZMA 4NIMA 4WLNA 5DN9A 3W8FA 5DZSA 2ZKLA 3G17A 5BNIA 3RBZA 2J3KA 5G0TA 1G0NA 1CEQA 4DLBA 4L73A 2W4QA 3GFGA 5BSGA 4E31A 1HT0A 1HKUA 4XWYA 4WLFA 3C24A 2Y1CA 1LDYA 4BO8A 2X0IA 1LDBA 3CEAA 4H15A 2V65A 4DMLA 4IGEA 4XA8A 4Z9XA 2G5CA 1DJNA 1DB3A 5DOVA 4N5NA 3AOEA 3GPDG 1OAAA 2BGMA 3HN2A 5DP2A 1YGYA 3DONA 3NAQA 3LC7O 1A9YA 1L1FA 1U8XX 3PJDA 1T1SA 3BHJA 1PJ2A 2DU8A 2E4AA 1XEAA 4GVLA 1WDKA 3F4LA 3WNQA 2HKIA 3WGZA 2VNAA 3GVCA 3IJRA 5CP8A 3L6DA 4IDEA 2Y1GA 4XJTA 1GFSA 4GLOA 2R00C 1ZK2A 1O9BA 1U3WA 2YV1A 3DAGA 3GDGA 2EGGA 3QVOA 3BTSA 2Y1EA 1YWGO 2GZ3A 1Y5MA 3HN7A 1CYDA 1WXDA 5EMHA 3WR5A 3DFUA 1HDXA 1VM6A 3GGGA 4I9UA 1YH3A 3KYDA 3DZJA 5TQVA 1PGNA 1MC5A 3PLNA 5F3RA 4BO3A 1IULA 4UEJA 5IJZA 2C0CA 4ALMA 4CJXA 4GLLA 3KEQA 4J6FA 1XU9A 3STHA 2VT2A 2A9FA 5TC4A 1GZ3A 2YDXA 4UVGA 3V2GA 2TMDA 1DFIA 2D4AA 4BO7A 3B1JA 3RBVA 1G1AA 4L4XA 3WXBA 1TT7A 3HSKA 3HADA 4Z3KA 1HL3A 1Q2XA 3GUCA 4J0FA 4J4HA 1P33A 1P31A 5COQA 3LYLA 3DZKA 5THKA 3KZVA 5JFOA 3ORFA 1Z75A 3JD3A 1N2SA 1E3JA 2FPIA 3DOOA 3UCFA 5IDQA 4JP3A 2JAHA 1MXFA 1R37A 5JYEA 5JO9A 3RU9A 4DQVA 3HZZA 3I9LA 3ZWYA 4J91A 1ISJA 4EBFA 4M89A 1PS8A 4I08A 4W4TA 5T8KA 4A0SA 3O9ZA 1JKJA 2Y0CA 1O6ZA 3ANNA 3E03A 2DFVA 5HA5A 2CFCA 4MO2A 1DSSG 4OGWA
chains in the Genus database with same CATH superfamily
4ENTA 1F8GA 4Y7CA 2PZAA 2PUBA 3M6UA 4DQXA 5LZ7A 1VCIA 1AUOA 4I2NA 4JJ4A 1P9NA 4GDMA 4PG7A 2A3RA 1HZJA 3AP1A 3JQAB 1GPDG 1GV0A 4ZT6A 5GJCA 4D3YA 1HOXA 1IEQA 2GN1A 1OQAA 2WQZA 4Y9DA 5SICE 3F6PA 2SBTA 3TDKA 2F9LA 2WIAA 3HJUA 5JD6A 3NNDA 4FW9A 4RV9A 4S1VA 2QSZA 4U2CA 4QQRA 1WUYA 1U9CA 1I9CA 1L9XA 4O25A 4D4GA 5K8LA 3BTVA 3S8YA 2VDMB 2CDRA 4NI5A 5HCUA 2IRWA 3PGVA 3TMKA 1C50A 3HLTA 1QH0A 4FM9A 4IDPA 2PGLA 4NNOA 3EISA 3FPLA 4B43A 5AOAA 3K4HA 5B53A 4M9ZA 4HXFB 4LG1A 3HZOA 2JA1A 4C7JA 1RM3A 3DWIA 4M1TA 3VOBA 4BQEA 1G291 5B4VA 5K20A 3EEBA 1KPIA 3O92A 4GOJA 5I9NA 2IYFA 3C4QA 3NBYC 1PUJA 2QUZA 5CG2A 4KO4S 3VKHA 3K6RA 4EQ6A 2ZCVA 3NONA 5A6SB 4G5FA 1PWYE 4MIOA 2VCHA 3KR0A 4RHXA 4EVIA 1CE8A 3L7CA 1J2RA 1F6DA 1U0EA 2HZBA 2A1UA 3FNRA 3PTAA 4JJZA 5GOZA 1Z2EA 2RGXA 5K4GA 2EJTA 4IIJB 1K2WA 2WYOA 2HLDA 4ASUD 4TKVB 3O4VA 5K0LA 1PZHA 2JK0A 3UBMA 1QQBA 4UHHA 3RRJA 1HFEL 1PJQA 1VE5A 3U3RA 1TOAA 5I01A 4QEKA 5HE8A 4N41A 1W73A 3ESRA 3LMKA 4YJKA 2JH3A 1SUIA 4ZVLA 4E2YA 1GKKA 5JXWA 2Z8ZA 3KPVA 4YCMA 3MAGA 2HBZA 1E2PA 2P35A 3IP5A 2FK7A 3VXKA 2PD6A 1EDZA 4C4AA 4DRYA 4JC4A 4V1CB 3GLFE 3VR2A 2WPNA 1E1QA 3WGNA 4R2XA 2GN2A 1D6MA 2OEPA 1B0UA 5AIAA 1TD1A 5FA5A 1K66A 1QV7A 1HG1A 1SPBS 2D1SA 2PRYA 2WTAA 1N5KA 3RTBA 4Q12A 2HU8A 1EP3B 2GXUA 1MFZA 1XU7A 5JY6A 4BOYA 4UULA 4ZICA 3CKYA 3C15C 2DBRA 4OHFA 1LEHA 2QN9A 5J2TB 2F6RA 1RVDA 2Q7XA 1Z6ZA 1GQ2A 3BERA 5KJCA 3FOFC 3KQSA 1LNZA 1Y5LA 2OXIA 4S35A 4C14A 4FK8A 5IKXA 2Z2IA 1XTQA 3X44A 3JQ7A 4LDQA 4BRUA 1KFJB 3GEPA 3H9JA 4XWKA 4WKCA 5L6LB 1JXOA 2J7PD 5DO9A 1MVOA 1OVMA 1Y6QA 1KFKB 2QE6A 4FYYA 5IVPA 3DOFA 4ZOLB 2AFHE 2HJVA 3UFBA 1E3WA 3LAWA 3LXRA 1XMOB 1IBSA 1XZNA 3D6TB 5AKGA 4Z4IA 1F7UA 1TEXA 1OBOA 2JJ2A 2Q6KA 2R65A 2X9QA 1GD1O 3OX4A 1VLZA 3PYLA 4J0JA 4XPIA 1N0UA 5K0SA 4CW7A 1IBLB 5LJLA 1YGPA 4I46A 5CEFA 4INJA 4NCBA 3PL1A 1XN4A 2G5GX 3KB6A 4Q18A 5C1OA 2QDKA 2PWZA 5A0VA 4UTOA 3WA6A 3KAKA 4E5YA 4MICA 1G8SA 2XUIA 3IPLA 4BS9A 2I2CA 4PZZA 4NYIR 2EKDA 1AZWA 4QOSA 4PW0A 4XB1A 5KWJA 2HHLA 1PEDA 2Y0BA 3L8CA 4KW7A 2WF7A 4LJKA 3TW4A 3OU6A 3DEYX 5IEJA 1DAMA 1XVUA 2YVAA 3FPSA 1YACA 4W8GA 4GAEA 4K9PA 2IV2X 4HWOA 4FSDA 4EG3A 2V9ZA 2ON6A 3P9YA 3A1DA 1M72A 2QB5A 4YT2A 4YUWA 5CVDA 1W0JD 4NOLA 1J9ZA 2FGKA 2I22A 4CUZA 4E08A 4GS5A 5KYUB 5CB4A 3QW2A 5HPYB 4MCJA 1R7RA 5LMZA 1FTNA 2EJVA 1M1UA 4BBPA 4OI4A 4X00A 1J7JA 2V5AA 4WZ6A 3DA8A 3T38A 1A9PA 1GRNA 3D1VA 2WWGA 3E7FA 3GNSA 4XGNA 3OBBA 3MNFA 4OQXA 3ZWOA 5F2EA 4HMQA 4FFDA 4OXKA 4U2EA 5C81A 3AKZA 3H75A 3HV2A 4DKJA 4X3CA 1T5TA 5FL7D 2PK3A 3NJRA 3V7FA 1NYRA 1CR1A 4KACA 5CXQA 3LA6A 2Z56A 3VYUB 5IT0A 1DRKA 4WX2B 1XTZA 1A96A 1MH1A 4TLDA 2HHAA 5B2EA 1I8TA 2DWQA 1MOPA 3M3PA 3HR8A 3O8QA 5A7HA 4D4LA 2W7TA 3BHIA 3ILXA 1JQLB 1KU6A 1XWWA 1P44A 1XZHA 2QUAA 3HSYA 4RMGA 4A92A 4D80A 4D8TA 3COJA 3B8HA 2XOKA 2ZR8A 3WJ2A 1JU9A 1U1IA 7ABPA 3JQCA 4KK3A 4WFKA 1PV4A 1NYTA 2QJWA 3M5WA 1BKDR 4Z8YA 5IUJC 4UU1A 2BF4A 2Z3VA 5ALKA 1MXHA 1YOBA 2W37A 4L7VA 2O7SA 5D86A 4GBED 4GZ6A 1Z5OA 4ZEVA 4IS2A 3VYTB 3DVAB 4X6XA 5KUTA 1TTHA 4MJLA 1SOAA 1SB8A 3AUFA 3EH1A 1UAAA 4F6RB 3DT6A 2EFHB 4PHTA 4X71A 3T7CA 1GEEA 4LTMA 5ICCA 1WZUA 1L3CA 4R9SA 2YWDA 4I8XA 3JQ9C 3LP5A 2HQOA 4KPUA 1ZINA 3M5PA 3GPCA 3JARA 4TSFD 4RZHA 2RGCA 4DIUA 3I9V6 4D5GA 1N78A 3GVHA 4JVMA 1A8SA 2PFSA 1JX6A 3C1AA 3Q6IA 4O1IA 1ZM9A 2ZI4A 4GNKA 2ZSAA 5B1DA 2DPYA 3AUXA 4LRUA 4XVRA 4RMJA 1E98A 1VP9A 3BMNA 2WNHA 2J5QA 4C6RA 1Z2AA 2R6DA 1G20E 4DYHA 1E0KA 4AXBA 2G88A 2KBEA 1KQ3A 1XL1A 2P40A 3BSSA 2UZIR 4JSRA 4R9VA 4HTFA 2F8TA 4EKIA 2IL1A 4A26A 4N0PA 1QS0A 4C7VA 4OQ4A 4LDRA 2CD7A 2A3NA 3H9GA 5CJJA 2IFTA 2P62A 1NVWQ 4YJHB 2CNNA 3H3XA 4ECEA 3AY6A 5LMNB 1ZI9A 3N8KA 5E6UA 5KYWA 1EA5A 2LUOA 3OHPA 4TMVA 1G17A 3NKFA 1HQKA 3R5SA 1FLAA 4FKZA 4M21A 5L3RA 1CT9A 5CLGA 4D42A 1K7SN 2PJUA 2F55A 4HYTA 1MAHA 2NW6A 3OCJA 4PO3X 4TXJA 2A9RA 2WIDA 2MCFA 3AIIA 3G5TA 3GX1A 3MJDA 3L6BA 3SC2A 5L3SA 1F0PA 2VJLA 5CDFA 3K2BA 3V9PA 4JEIA 2Y0EA 2RHJA 5AVKA 1MO3A 1WDTA 2GERA 2Y1XA 3FY4A 1I1QB 1PF7E 1E6KA 3NEPX 5CBPB 2Q50A 4WLVA 2WUWE 2LE0A 3K9HA 1WWKA 4M53A 1PKEA 2AG8A 2WKQA 4LYEA 3OH8A 4FUTA 1KJYA 4DSZA 1ZA2A 5F23A 2CV0A 3SQXA 1WMAA 2PRKA 1DAFA 3GUUA 3C87A 3OQJA 3PPVA 3MQFA 2OKCA 5EYPB 3DLBA 1AKVA 3OIDA 2UXCB 1NW4A 1FDVA 4LX0A 5CHYA 3FMFA 2C4NA 3BZBA 3EDCA 3KHTA 4G4SO 5ALPA 3RK4A 3C0KA 1M2VB 1JBQA 4KQ1A 4TV9A 5HS4A 3UKOA 1A8PA 3WA7A 1V4VA 2ZJ8A 1QIGA 3E7PA 3T61A 3ZBTA 1IB0A 3OZIA 5FWXB 1APBA 3EIUA 1M8JA 2HDHA 4JOCA 1ZXLA 4R5MA 3OKCA 1FX0B 2XY4A 3BPSA 3EYAA 4RVUA 2XNDD 1I6KA 5CLIA 1KE2A 3ZY5A 3S2IA 1U2ZA 1SB9A 3D3NA 721PA 5KKCA 4DV1B 4BBZA 3R44A 2RHGB 4GP6A 4ENVA 2RGGA 3TTWA 1BGXT 3N53A 3OLQA 2GBIA 3HGMA 1DFGA 3MWEB 3QUSA 2QMEA 1GVNB 1MBZA 4PLFA 3SMQA 4BWVA 3VAAA 2AMLA 1TIKA 2IPLA 1HV8A 4PLCA 1SD1A 4G97A 4AJHA 1USGA 1FP7A 4IVPA 1SXJE 5EESA 5HUJA 2GMWA 4BLRA 1BXRB 1CQJB 4HAZA 4TVSA 3LQ2A 3I0NA 4JLMA 1AZLA 4R1PA 1ZQ1A 1VI2A 5EXSA 1Z28A 3RHFA 2B25A 4BNUA 1IUPA 1D8AA 1H2ZA 3NBKA 221PA 2PZ8A 4BX8A 3VR4D 5A5DA 4ES6A 4N5MA 2COKA 4C6TB 3EUEA 4ZV4A 1TIPA 2O1XA 2YHIB 1PJ3A 3FD8A 4Q4JB 4X9XA 4WZBE 1RKQA 5BQPA 4JBLA 1WXIA 2FPOA 3HB5X 3GG9A 2PYZA 1WW2A 1RJDA 2ODWA 2EQAA 2FJPA 4KN8A 5CB8A 4OHRA 1FXSA 2AZ4A 4BLWA 3IQGX 3LYHA 1H5QA 4JQYA 3TECE 5K4AA 4Q1FA 2BGWA 2ZYAA 3DKVA 3BMQB 1HQCA 1Y0BA 5FA8A 3OQOA 3G0HA 3ICPA 2BGRA 3MT8A 5EHXA 2JAXA 2YWHA 1LUAA 2G8LA 3E22A 3EIQA 4R1MA 4DZTA 1BDBA 3H19A 2BAGA 3ZDXB 1A7UA 5EGNA 5LZ4A 2VTDA 3BBPA 1MH9A 4Y6QA 5BSEA 1ZA1A 2X0FA 1NXOA 1SCJA 4ITRC 4NC9A 2M6RA 1J2TA 3CLRD 3D3EA 3RM3A 4EFDA 5AW8A 1AHPA 2JHPA 2WKSA 3HKDA 2AZXA 4QGGA 2HB6A 1G6HA 1QBGA 3OF2A 4RQUA 3U3MA 1PV2A 2IF2A 4R51A 5E95A 4P81A 2DY1A 1P62B 2I99A 16PKA 5LZ5A 3UV7A 3AM4A 5LNK6 1W52X 2IIBA 2ZUTA 5DNAA 4OUDB 1N8KA 5C53B 1OIVA 3IPCA 4P86A 1GAJA 1TZJA 2W6QA 5A9TA 5TEVA 1KDVA 3FPFA 4OGFA 3AR9A 1YFKA 2H4JA 3CS3A 5AJUA 3CVUA 5F5NA 1ADGA 3P1JA 4PG5A 5AVJA 3VOAA 1GU0A 1PTJC 3PFBA 4I3GA 2Q6TA 4YNBA 4AUEA 2C7QA 1LTKA 1Z36A 3USES 2ZE6A 4QOJA 4YCDA 1C3XA 4BO2A 1MV5A 3WNVA 1NF8A 4NS4A 4HVTA 4BVKA 2V8OA 1Z13A 3Q1LA 4JMPA 5AK4A 2WFLB 2XGSA 2VWQA 1IRIA 3PP8A 3RVRA 2PKQO 1TM7E 1YRAA 1BTOA 4H08A 1WUTA 4CKZA 3ANMA 1T8UA 2DTXA 5KYGA 3DV0A 3ISTA 5DBIA 2H2FA 3GLQA 3WMEA 5IWCA 3PC4A 1GXSA 3ENNA 3EFEA 3RNOA 3KXDA 4AICA 2JBAA 4FIZA 2ZBDA 4AF6A 4PZCA 2BMDA 4K9NA 2PIAA 3Q98A 4G0ZA 2VF7A 1U63A 3UK1A 1I7QB 4BXOA 4JZKA 4BUCA 2K6GA 2AXNA 5C1IA 1H8ED 1ZGZA 1T8RA 4U7PB 3GUZA 1XEFA 1DWPA 3WRXC 3TTUA 3KR9A 3K72B 3EBPA 2IBTA 1ZD1A 1A27A 2ZWOA 3M1AA 4XI9A 1VB5A 3LVRE 3DXZA 4N3BA 3RS7A 1NW7A 3D0OA 4DWJA 2BGKA 4YUAA 1Q91A 3LHIA 5EXPA 1OLSA 5IFLA 2J1LA 1NC1A 4K2HA 2B7LA 1L5HB 3I3SR 3WC4A 3GW8A 4KBYA 5FBHA 1YE5A 3ZHZA 4C3UA 2IYOA 3RRYA 3E8MA 4BPRA 4C6TA 3AVYA 2UXDB 1GZUA 1LRJA 5J4KA 2BSQA 4KB5A 1BGVA 1QYDA 2E4UA 3CF4A 4K9KA 3W0LB 2WUGA 4IXTA 5KNLA 2BM8A 1D5WA 3PG5A 1CR6A 1E2FA 2GI4A 5DIFA 3AO0B 1WLSA 4PIVA 4FDVA 3QPVA 4YPVA 2FUG6 3B52X 1D03A 3TVDA 1K5HA 1R6UA 3BRWD 1E1DA 5FPPA 3E5NA 3PLAE 2CMDA 5H81A 2ZU0C 2I76A 2OHGA 2OCGA 3K8ZA 3HFRA 4U7TB 5H68A 4A7PA 4EHJA 3UW3A 5FNVF 4YJ3F 1L4NA 4R6WA 2BMJA 3GLHE 1RJWA 4OSPA 3GEDA 4G8CA 4D81A 1EFUA 2KHZA 4DC1A 4MWBA 2FPWA 1VCMA 1ADBA 4H17A 2H5IA 5JSQA 4FYVA 1XCGB 1IEWA 1O3YA 1W19A 4PR3A 1SCUB 5AKLA 3U56A 1HGXA 1OYYA 2JBHA 4FOOA 2JJ1D 1ACLA 1M1NA 2FSHA 3Q0TA 4WZBB 1VP3A 2GJSA 3TIIA 2NVUB 3WTCA 3HB7A 3MS2A 4L5BA 3RS3A 1SEVA 4YRZA 2DTDA 3L1JA 4HDOB 1HXHA 3FE2A 3OIFA 1Q0UA 5CEEA 2AW3A 2VFAA 3TLGA 5NULA 2RE8A 1FMFA 4E22A 4UE3S 3T7RA 3D54D 4HDRB 3WYDA 3L0BA 5EE3A 2VDVE 3U13A 4CT0A 4GOLD 5JAIA 1S1CA 1KMMA 3WS7A 4D9CA 2LBPA 1J8YF 1N1EA 3OCZA 5G4KA 1F2UB 3FVQA 2VP3A 3FNQA 4RJ2A 1UJMA 3NLLA 4J16C 2GILA 1Y8ZA 2C78A 2WM9B 3MGGA 1OZAA 4BCBA 4R0MA 3FUWA 1CB7A 1DQPA 2A5JA 3O83A 1AKTA 5AI6A 2Q6LA 2FN9A 5JH7F 4HX2A 1FFXA 1O6BA 2WT8A 3RRNA 5BORA 3G2MA 2FSIA 4RD2A 3Q8MA 3AEKB 5IWAB 2VTVA 4RKFA 1NA5A 4WINA 4PM4A 1W2WB 3DPIA 1JTVA 5KYTA 1QAOA 3BXZA 3OIUA 3U44B 1U2DC 4YV7A 1MB0A 3SYTA 5IT5A 2IWRA 3Q87B 4Q39A 5B6IA 2V96A 1G18A 2BW0A 1LFDB 3OA2A 3PRHA 4MVJH 3WO0A 2OCYC 3NWBA 2APJA 1QHGA 1OV4A 3S6JA 4I99A 1H8EA 1HURA 3UENA 3B3AA 1IWPB 1QGUB 1VC2A 4FX5A 2Y4OA 1C3JA 5BT8A 5H3LA 1EMDA 2ANBA 4YAEA 3MS7A 5HK8A 4B4OA 3R23A 4IJUA 4M60A 1ZH0A 1H2YA 2A88A 1JEDA 3SXPA 3TRKA 4AN1A 2VP4A 4P3KA 3PTZA 4JUAA 3HM9A 2WR8A 2QE7D 1G4UR 2WAMA 1MDFA 3H11B 3ZZNA 3OMXA 1K6MA 1H65A 4FLEA 2QD3A 5DKFA 5FO1A 4I9GA 3AVXA 4HGOA 2QZ9A 1BIFA 4JHLA 1TQ2A 2X8AA 3AIOA 3EIFA 4IXNA 4B6RA 3JS5A 5BOVA 1OIWA 1DARA 2O0HA 2QTVA 4KVZA 4Q16A 3TQFA 4YRLA 1RWBA 1ZICA 4PX5A 2SCUB 3BQ9A 4JKYA 3EFOA 3CWZA 4WPGA 1RC0A 2BM9A 2P2GA 3DE7X 3WL3A 2G28A 1JKMA 4XQ9A 1KO4A 1IFXA 4PC2A 4QHTA 1TF7A 2QTCA 3SSNA 4AF7A 4ZI7A 3ABQB 5KVCA 4F2GA 3H5WA 5LQSA 2Q1UA 3SMVA 4KLRA 3RF7A 1RVV1 2NZVG 3PI6A 4Q1AA 1UZLA 4N9QA 1ZOSA 1DKUA 1XTJA 4M8SA 2XKKA 5FWAA 4IUYA 1CY1A 2NADA 1AGNA 2VZ9A 1J33A 4LGYA 5I3CA 1H2AS 3F73A 1N1MA 1MMFB 1XJ5A 2Q28A 3GYGA 4B85A 1HOTA 1KPGA 2OCKA 1YBFA 4EK9A 1QHYA 3RSSA 2F64A 2O1SA 2P6NA 2WIGA 1GA1A 2Z0MA 2C59A 4GOND 3TW8B 1S0UA 3JV7A 3U3KA 2XMQA 3U9LA 5JQGF 4KLZA 1TE2A 5BPFA 1TVMA 2OESA 3DDZX 4ZOLF 1UPBA 4O2AA 3OOWA 3IHKA 3ZOZA 2AG6A 2OBFA 4GPBA 4R8KA 3A6ZA 5JISA 2E1RA 1VL5A 1EXNA 1ECLA 2Q41A 3VPDA 1JJFA 4B1FA 3G82C 2CBXA 1MKYA 4PYQA 4E12A 7REQA 3W90A 2PMDA 5JXGA 2P6UA 2J4CA 2V4ZA 2J3LA 4YASA 2GEFA 4J7AA 2CEAA 3WGLA 1V96A 5I7SA 4G1EB 4FFRA 3UUGA 5BN1A 2ZRLA 3JWHA 5B7GA 3PXDA 5LKAA 2ACWA 2LXNA 2NV2B 2ZTLA 3WOHA 3F9RA 1RADA 2F1KA 2X3FA 3A14A 2JL1A 5LBTA 3ZWKA 3TLEA 3A4MA 4JQZA 2DJIA 1AKWA 3TOZA 4LFBB 1A4XA 1JWAB 3OM0A 1OKKD 2PTHA 2GHQA 5GY7A 3L5KA 2CZCA 2FXVA 2YW2A 4KYTA 3X2EA 2IY9A 3AEYA 3L1IA 1CRQA 3R0JA 2WP0A 1RBMA 4YCSA 3C3YA 5AYVA 1M1YA 4Z3OA 2AF4C 5LYJA 2GYVA 2PLNA 3M0EA 2Q9AA 2I7TA 2Q29A 1JYEA 4M0MA 2A0KA 4ENQA 4GUDA 2CHGA 4KCGA 1CIPA 4L2IA 2C4TA 2FOXA 5CFMA 1ENYA 1XMIA 1H3FA 1ZPDA 4QEZA 1ADCA 2V5VA 2OK7A 4QFMA 5G2OA 1ZGCA 4JVSB 5D2CA 3EXIB 4RF2A 3QKRB 1WB6A 1HFWA 1B3RA 1LI7A 1JHPA 2YJZA 4JI0B 1C1XA 1AN9A 3STXA 1GAXA 2X0JA 5BW6B 2CL7X 2NTEA 1RQ2A 2VUTA 3G5AA 3WIEA 2GRJA 2PH1A 1E9FA 1ZH4A 4MRPA 2BM0A 5FHRA 4EDHA 2JAQA 3KCQA 3MXTA 3R4VA 1HTBA 1KQGA 1OPXA 1Q20A 4IR7A 2EWVA 4O2AF 3IRVA 3KT0A 3ZVMA 3EWIA 4O1MA 4DC0A 4I7EA 5A3QA 4MK4A 2QM7A 4WNAB 1Y7HA 3W4KA 4LFAB 3AM5A 3BIOA 3HYLA 3NHLA 4TLBA 4ZAVA 2YMPA 1K08A 1VL6A 2FKAA 3PJGA 2AG1A 1NI3A 2SKCA 1BHSA 5F78A 1C30B 2MYUA 1JG1A 4EKDA 2CY0A 2C5HA 2V7XA 3TW6A 4D6PA 1UFQA 3QWHA 2V55B 4JEUA 4XJXA 5ALSA 2FZGA 3H1EA 4QXAA 1W49A 3AFGA 3NBMA 1UWCA 3BFKA 1YCFA 5DT9A 2NUBA 2AJCA 2VHXA 3TW8A 5TMPA 1XRQA 1NN1A 4BUJA 1V5WA 3KXIA 4GHWA 4AYXA 1R27A 2CMGA 3H6GA 4RYDA 3JZAA 4HDQB 2ZT7A 4TQGA 2LW7A 2GO1A 4LXTA 5HF9A 5K2MA 4JJ8A 5F5LA 5I7OA 2R7NA 3SI7A 2QTFA 1BHQ1 3HMKA 1IOVA 4HD8A 4CTMA 4I5FA 3RUFA 3EVAA 3EVNA 3IAXA 4OYRA 4Y67A 5ALJA 3V1YA 1XQYA 2OPHA 4C6HA 5TGDA 1YULA 1ABBA 1B8OA 5BV2P 3PYXA 1RM0A 4Y2SA 4JQSA 3UT0A 3MERA 4AKEA 1A4UA 2V6IA 1V95A 2Q3LA 4E3ZA 3SSAA 1CJMA 1ZISA 3IL2A 4IP0A 4HADA 1IZ0A 1SC6A 5IJXA 1FB5A 5K7SA 1E79D 4B9AA 5LXTA 3MUOA 4L27A 1R0BA 1Z47A 4D0NA 1JFLA 3EWNA 2I6XA 3VPFA 2DOKA 4HTAA 3KOYA 5EWLB 5F1PA 3I76A 2UVDA 4G1VA 1N3IA 1YQTA 3BS4A 3O91A 1R9GA 1RRGA 1UC4B 4FFBB 1NLFA 1KH3A 1XLUA 3AEUB 5K8CA 1WQ4A 3H8SA 2VA9A 2Q4OA 1IZZA 4FD3A 2YFYA 4QQ8A 4PPYA 4R7GA 5KWVA 4Q7QA 3CPEA 3I45A 2G3YA 1SBTA 1KJZA 1A97A 2EVWX 3DWEX 2WAOA 2G7ZA 3OETA 1NVGA 2WA2A 4I50B 4MPRA 2J5BA 5I7UA 1NASA 1RCTE 4NONA 3OQ6A 2QJTA 2RC5A 4UMDA 5FYDA 1Q95A 1VG8A 2ROQA 5I7FA 5I7VA 3FI9A 3WG9A 2A9OA 1F2VA 4RZUA 1RXYA 2CB0A 2C9ZA 2OAP1 2VJBA 1EGQA 3MINA 4DJ5X 4KBFA 5GONA 4CF7A 1WE2A 5D1HA 4P31A 2G70A 4TTRA 5FWYA 1ADJA 1K9VF 1F9EA 2YICA 3DUFA 4UMEA 4DLAA 3DMPA 5C7YA 5EJGA 2XAAA 3I9MA 3E35A 1DCKA 3PHGA 3PDUA 1U2DA 1FPQA 3AYXB 2FFJA 2FW6A 2ONCA 1B0ZA 3TUIC 3WGUA 1A7JA 4NYJR 3RYCB 2Q8NA 1YUNA 4MVJA 3REQA 4FR2A 5DBHX 4MV7A 4ZVPA 2Q62A 2DH5A 3E7DA 4GSLA 1FCJA 4EB8A 4JGGA 3GMDA 1ZNYA 2EG5A 2VBIA 3EVZA 2ETXA 3ORQA 4N8SA 5CRIA 5AW3A 2JKZA 1NBHA 4JD5A 5IKOA 4CM9D 1ZJJA 1Z5UA 2EP5A 2LIPA 2WE8A 2OZLB 3CLUD 1Q0SA 3CLUC 1Y4SA 3HNOA 4QXPA 5LA6B 4YAKA 1OWOA 3ETEA 2HA7A 4HVLA 4J7CA 5EZYB 2NZWA 1EJ2A 1PNQA 2GAOA 5JPCA 4LSWA 2OSVA 2I55A 3K1AA 5JNTA 1UINA 2B8WA 1N25A 3JQAA 1JA9A 3RK0A 3KZOA 4E2FA 3ZCUA 3KVNA 5L51A 1L7AA 4CMIA 1KEUA 1IHPA 1KYZA 2ZJ1A 4OCZA 3UUWA 2AHRA 1T35A 4FBLA 2GM4A 2PSHA 1US8A 4CEHB 1T9AA 3NHBA 3BXFA 5LOVA 3R75A 2H2AA 3P9SA 3GP8A 5F7ZA 1U2SA 4HEA1 4XD7A 1Z4QA 4E2WA 4QYIA 1P5RA 5EKTA 4TTPA 3PQEA 3RYIB 2QTVB 5FPYA 5TV2A 3OTOB 1DEAA 2JA2A 1UDWA 3ITKA 4PAQA 4X45A 3LOQA 2FMXA 3QITA 1M5TA 4I5EA 4OB6A 4F2HA 4WZBA 5FD8A 4MQEA 4M22A 2YOHA 4YLGA 3EJWA 3UJ6A 3BYZA 3K1ZA 3V32A 2Q0HA 1WMEA 2H7XA 2WJWA 1N75A 5TS2A 1NY6A 4YN3A 1TYBE 4L0MA 2WWXA 3AV3A 2GETA 3UXEA 3BZUA 4WLUA 1NW9B 2JI9A 3RVKA 1TLFA 3BFJA 3C2QA 2BFPA 4O29A 3QVJA 2FUNB 4ROTA 3SZMA 3M6WA 1TJPB 3ZOKA 3H6HA 2IUTA 1Z4KA 4MCIA 4TL6A 3ZE6A 4D7AA 3A6LA 2OCPA 4EY5A 1YIOA 4UHKA 4O4HB 3GLIE 3I62A 3BD9A 3MTIA 5E6RA 1U65A 3U17A 5TGTA 4PSVA 3H1GA 2ZSKA 3M3DA 1JDPA 2JFGA 5EHGA 2VLBA 2QAGC 2D00A 1IHYA 4Q19A 4XX1A 2O9JA 2ID8A 1P3JA 1QHXA 3GDOA 1RKVA 2Y6UA 3P96A 4P22A 1Z8FA 5EGSA 1KJ9A 4PXSA 1UEJA 2R7KA 1VTKA 2B4TO 2V7QD 1BDMA 2PR2A 1U9YA 1XJQA 2H29A 3OZTA 3WBJA 3ZJUA 4PY2A 2QQ0A 3HDYA 3ABZA 1VL2A 1VBKA 2JBAB 4G1BA 3SKXA 3WSTA 3EA0A 2VHVA 1SU6A 2XNCA 4WTOA 3HBFA 1PFWA 2QN7A 3R7WB 3DUFB 2PX3A 4B3XA 1ZEJA 2PA3A 3QPUA 1BA2A 2RHHA 2F1HA 1N6LA 2XWJI 3UPDA 2OCLA 4P4SA 3VZCA 3ROFA 5JYCA 3LDFA 3AIMA 1R4AA 3MCVA 4FC6A 3N2YA 2GRAA 5BQOA 3SVZA 3WQQA 2VDRB 4QJIA 4KYVA 3KSRA 2WQ7A 5CCXA 3DDNA 3CT6A 2QW0X 4URUR 5K8JB 3DO6A 5DMHA 3HY6A 4S1OA 1DX4A 4GYYA 3W34A 1JDTA 1RKXA 3OM1A 5LJIA 2XVYA 1X7XB 3DL0A 3FF4A 2Q1WA 4QPNA 1CUYA 4TVKA 4EYQA 1Q44A 3K8YA 1Z5ZA 3EVDA 3GRVA 1XG5A 2PRSA 3OQVA 1H5NA 5LU9A 4XIYA 1BDHA 4RJLA 1EXDA 1ISHA 1ZLXA 1RCFA 1ESNA 1GGFA 1CS0A 1TKRA 3AFNA 1IPEA 3NM5A 1DC3A 4FOTA 4MRAA 4KR9A 3TPFA 5JNRA 2R00A 1IRXA 1YVEI 4RACA 4R2MA 4BNWA 2R44A 3IKVA 3PQFA 2YWXA 4ARAA 2E4ZA 2NUPA 3OCVA 4UARA 1AUQA 2MYPA 1B14A 1DKPA 5J2TA 2H16A 3WWYA 2C2KA 3OD5A 3CINA 4DRZA 2H4WA 3ORYA 1ZC4A 4KTTE 4X1IB 1AC5A 1PE0A 3GCDA 1ODCA 2XQFA 1NJSA 3PC8A 3FFBA 4I50F 4PXAA 3DTVD 3L7DA 5DX8A 4FONA 1NL3A 1KETA 4YRCA 4IDBA 4NFHA 4R2IA 1XDWA 5FR2A 2F59A 2GN0A 3N7UA 2IYNA 3MGCA 5AUOB 5GTDA 2XX3A 1NVUQ 3L2OB 4UHBA 2H1IA 4KO1S 2HRCA 1GCUA 4TRJA 3J81A 1JH8A 1MAWA 4N9WA 4Q9IA 1LDGA 3DFFA 5BW8A 1LC3A 1POWA 2VJDA 2OGZA 5JALA 4Y2TA 1JDSA 1DV2A 4DY4A 1NKTA 1BSVA 3HJNA 1FFDA 4C2BA 1H23A 4QGHA 3LUJA 1TRKA 2VZEA 4WRRA 1Z16A 1IPFA 3PQ6A 4M8LA 4WKOA 1KE1A 3AW9A 4Q7MB 1E1YA 3G7NA 1U99A 3HFGA 2H08A 2Y05A 3FOAA 3VO1A 3ZGVA 4QYIB 4EG8A 5JLJA 4DA4A 4L4SA 1C81A 2MMCA 1TYCA 1T9ZA 4GI2A 3UVEA 4TS4A 3ZDEA 1JQ3A 3U40A 2ECOA 3QEOA 4PPQA 3BD7A 5JQGB 4BMNA 1QTQA 1E7SA 3EPRA 1UJBA 5IC4A 5LUAA 2X4LA 1CRWG 1MVNA 1RYBA 3KKLA 3KUKA 5HBGA 5DTRA 4E7PA 2FEAA 4IDGA 2FQWA 3O95A 1LH0A 4IHQA 1IZ8A 1RMYA 3WZ2A 1J06A 3IP8A 1E2HA 1BS2A 2H52A 4OAQA 4MX8A 4YECA 1C7QA 5DU2A 2W4IA 1W88A 2X2FA 3FOCA 1MJGM 5T7BA 1RRFA 2ZTMA 4RPGA 2PSJA 3CH6A 2YXEA 3CRVA 5LWQA 4IMJB 4DV3B 2QXTA 3ND7A 5F2OA 4BB5A 4OX9B 2X6QA 5FBKA 3HKCB 3VKFA 1DAKA 3AK4A 1HORA 3HJAA 4L8LA 4ETNA 5C0OE 3PPXA 4P3OA 5DWDA 2XYGA 2IS2A 3I6MA 2OGWA 1SVKA 4XDYA 3W8EA 1Z6XA 3DKKA 3F90A 1F8YA 1W0JA 3PWTA 1GTRA 3AR6A 3KS9A 3PRJA 4UXIA 3A2NA 2ASVA 3O4IA 3OJOA 1S2MA 2P77A 4TUYF 5EPUA 4PQYA 1RXWA 3WKEA 1H22A 4KGXA 5DBGA 2WOJA 5DHTA 3ZTTA 4RABA 2GK6A 3HDQA 4KVFA 1QQ6A 1XRSB 2NU7B 3P7MA 4KR2A 4BQOA 4DCMA 1AN0A 3KFVA 2VUUA 4Q9DA 2OFPA 4CCSA 1VMEA 3VUFA 1JLSA 3EDMA 2HW8A 1BX0A 4ETIA 2BZSA 2M2IA 1N2GA 4EGJA 4YAIA 1XTUA 2JK1A 4ZYXA 5KNDA 2C07A 2RHMA 5EEGA 2P5UA 2RD2A 4M83A 4BECA 3BN3A 2ZWPA 3TS1A 4KPEC 4ZCRA 2Q27A 4U0KA 1B00A 1PWHA 2ZJYA 3P0JA 4U2BA 3R0QA 1ZR2A 4G0VA 1K7FB 3ZWDA 2J0QA 4IZHA 2EW1A 1BHO1 3NTUA 4O33A 3A9TA 4BAGA 3P9IA 4DMMA 3ZQUA 2AXEA 1YZQA 4B71A 1QWSA 2BMFA 2DBVO 4RSRA 4JI1B 3LZ6A 5IMBA 1E3DA 3DXFA 2FRXA 3W1EA 3FJ1A 4GQAA 4IHJF 1NX6A 3A6KA 1I3LA 2O2XA 4J2TA 4FFOA 4ERNA 4UCXA 3ZI0A 2WILA 4D4MA 3ZXXA 1CY2A 3V48A 4XUGB 4F5ZA 2C42A 4TKVA 5LZ8A 1YJAA 2I7CA 3IR5A 2GLTA 4EOGA 4ZO7A 1X80A 4GI3A 2P27A 2BELA 3A9SA 3BEOA 4GMHA 4HP8A 4LCJA 4EZIA 1P3DA 1JE1A 5LB2A 4RA9A 1XXHB 5LQRA 2AUTA 4HQ6A 5J2UB 2GCEA 1PZMA 1M3SA 1ZH2A 4LSMA 4BNVA 3ZYZA 4YC7A 3WZMA 1U11A 2Z58A 3KIPA 3PNMA 5ALZA 2GCGA 3EWAA 5L45A 4ZOAA 1U8EA 1C9YA 2NVWA 2GF0A 1YI8A 2LVBA 3SYLA 1ZCFA 2F3SA 4JBWA 2QD2A 2DJ5A 1FMLA 2VS1A 4EI9A 5KYYA 2Q0QA 4OB8A 1TJNA 5ELLA 1DTWA 2Y8EA 1C7ZA 1MB2A 2Y9MB 4K2AA 4M0EA 1KI1A 4MRMA 5AJVB 3PHIA 1XTBA 5JCZA 5HIJA 3ZD9A 1LKZA 2I34A 3JQ9A 5IAKA 4BJ5A 2FRVA 3EG5A 4TTIA 2RJOA 4ASUA 5GZ1A 2FZEA 1DWOA 5T6BA 2IV3A 4ENSA 1JR6A 1N2CA 3HLYA 4BCCA 4BQIA 6REQB 1GTG1 5K01A 5JTUA 1QP4A 1N92A 2ZTHA 2A1TS 4FI3F 3VYSB 4EAQA 2LPMA 2ZGVA 4U5XA 1OZ0A 3SP1A 4Z7NB 4BFVA 1NVVQ 1G21B 1YOVA 3CZPA 2RHLA 5ALUA 2ACVA 2ZRKA 1EP9A 1Y4ZA 2ZG6A 2XB4A 4GFDA 4RXTA 1QHFA 5J63A 5C1PA 1OH6A 2R85A 4TWJA 4E1VA 2XUKA 5MDHA 2ZUWA 1L4LA 5KTYA 2J33A 2OD9A 3D6FA 2GOYA 4QNMA 1JJVA 2JW5A 3ENWA 1NVMB 3RK1A 3TX2A 3VO8A 5A3VA 3FYUC 4TZ0A 2ATIA 4N76A 3WOVA 2B8TA 1GNTA 3OLYA 5LP6F 3QA9A 3TSAA 4O2BB 5IC6A 3UMVA 3KPUA 3RFFA 1KC1A 4KJXA 1LLUA 2C83A 3ESAA 3RTCA 3B3JA 1R0CA 3ASVA 4A3SA 4DS3A 2HMTA 2NTJA 1SQ6A 2DT8A 4N8DA 5DXJA 2GJ9A 3UJHA 3U7GA 4IXMA 4DG5A 5JAUA 4AJEA 4H6WA 1RPNA 2LR0A 1QO7A 3DZ8A 4DTIA 4YGYA 3SXJA 3BFVA 4E3WA 3FWYA 4D9JA 4KIFA 1YDWA 4Q3BA 4ZRMA 2C5BA 1GAQA 1USKA 3SJUA 3IPRA 1KVUA 4WBSA 3L5OA 3OP4A 2NU8A 4EB6A 4P54A 2A8YA 3NBFA 3NTRA 2CNKA 3OPYI 5F64A 4B6FA 1KZ7B 4KZPA 1MA0A 5AM5A 5A0TA 2LCIA 4TMZA 3TNJA 4H6PA 4CVNA 4ECAA 3DEAA 1OTXA 1DAGA 4EW6A 4M1ZA 1TZBA 1SVNA 3GA7A 4P36A 1C9JA 1SBYA 4KFUA 3PFGA 2UUAB 2JLCA 1E1CA 3EFBA 3KZ1E 2B6NA 4JP2A 4QPPA 4RNDB 3C6YA 4IMIB 1U5CA 2CHFA 1TK3A 1TTQB 1GL3A 2QV7A 1CDDA 2DHQA 2LIVA 1XRJA 2ZR0A 3LU1A 3PGKA 5CNIA 4B3SB 1B16A 2EG9A 2IHYA 3GH3A 4ETWA 4HN9A 3HL0A 1X1BA 1E2JA 2F1IA 4MQ4A 3TTXA 4TSRA 2GZDA 3IKMB 1JQJC 3EZYA 3AHIA 3ASUA 4D46A 1W581 1MF7A 2RHBA 2V7UA 2FHPA 1P5HA 2V7TA 1M8GA 2FDXA 2WSLA 2VATA 5TQ0B 1C9DB 2PUCA 4QUIA 1GRQA 4YHBA 1ZK0A 4BNMA 1BH2A 4TQUS 2DLCX 3T5GA 1E0SA 1FNBA 4H7PA 3LUCA 4HEHA 3WICA 4EO9A 4TMTA 2X22A 3BF7A 2EHDA 4MR7B 3QVVA 4PFSA 3V4SA 5EIXA 4IWYA 4JJIA 3W05A 3T5BA 3HXTA 2UYQA 2QUKA 1A2QA 1JHVA 1DKOA 1UBUS 3UV3A 5F7XA 1SH7A 4B44A 3OF5A 1DC6A 3P8ZA 3KQLA 3ML1A 4LWPA 4YLYA 4PYKA 1DBRA 6ABPA 3FNFA 1VGRA 3D7LA 2CHEA 3GRFA 3MJCA 3ZCSA 5KQMA 4G4IA 3I3OA 4NECA 4QXMA 4TMFA 1CTQA 1OZHA 5JJLA 5TJHA 2XRMA 4MDFA 4CKBB 4JASB 2CDAA 4ZREA 3B51X 4A6XA 1WSBA 3BX1A 1NC3A 3I2FA 3P2IA 5FOTA 3VHLB 3CRZA 1L3IA 4BKOA 1UXJA 1C3LA 1Y3BE 3P9XA 4HN4B 3KJEA 1HLDA 4J49A 1QKIA 1T2FA 1KMNA 3EZNA 2KE5A 3BL5A 3IOEA 1ZI8A 5DF1A 3RFUA 4CQMA 2A9VA 5JMTA 3R9XA 3OLZA 4F4IA 1YCGA 5BOSA 4RTKA 4MUIA 5EERA 3JD0A 2QZSA 5CEJA 1M0EA 3PHLA 3R24A 2WUEA 2DB3A 3T4PA 1KP9A 4X63A 3R3JA 4M1KA 3OX2A 1PKXA 5CTJA 5K1ZA 2WYWA 3UHFA 5KB3A 4NESA 1SUEA 1Q14A 2JAOA 1GAEO 1WOYA 4OK3A 2D2VA 1FU8A 3HRKA 5DM60 3QFHA 4XR9A 2ZE8A 4IBOA 2ZOSA 4PAGA 3OKFA 2FRDC 4ZVRA 1FW8A 1MJFA 1QM5A 1T2AA 2BFCB 2XKJE 4MYRA 2VHZA 4MHSA 4AM8A 3IUJA 1OX6A 2L82A 5T67A 3GI1A 2OLKA 3O8DA 1XK6A 3FPJA 3T52A 3WDSA 4C0BA 1OH7A 1Z17A 1HYEA 4R1UA 2NYAA 1AQNA 4CU2A 4OHBA 3KQTA 4OVKA 5LLDA 1V7QA 2XF2A 3KRTA 1X7XA 2FKNA 2RGBA 4N3NA 3IJ5A 4YH1A 5E2I<