4CQLB

Crystal structure of heterotetrameric human ketoacyl reductase complexed with nad
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
227
Chain Sequence
HHMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ESTRADIOL 17-BETA-DEHYDROGENASE 8
publication title Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 227
sequence length 239
chains with identical sequence C, F, G, J, K, N, O
ec nomenclature
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cqlB00
1JAXA 1OFGA 3PQDA 5A9RA 3U4HA 1C14A 4M54A 2DC1A 1E1MA 3HG7A 1F8GA 4WLNA 2YHIB 3GGPA 4D45A 4DVJA 4R9SA 4NBRA 2OUIA 1RM0A 1E3WB 1KERA 1NAIA 2J5QA 2P2SA 2AQIA 2B35A 4EDFA 2JCYA 4XKJA 5JDCA 4ALJA 2QYTA 1T2EA 2ZKLA 3TL2A 1I01A 3GN2A 1T2CA 2Q1UA 3AOEA 2I66A 4IGEA 3WBBA 1GYRA 3DZIA 1U3WA 1E3IA 3U3XA 3AOGA 4EUHA 3F5QA 3KRTA 3WS7A 5HRUA 3NTRA 3ASUA 3BMNB 4U0KA 5JY1A 1LDBA 4MVJF 4ZD6A 1K6JA 3KV3O 4ND4A 3RQSA 4NHEA 3WQQA 5T8KA 5JXWA 2CVOA 3JTMA 3WGTA 3Q3CA 3IUSA 3QP9A 2Y1EA 1PL6A 1U3TA 5BNFA 3ROPA 3FF4A 3VH2A 3F9IA 1GZ6A 1RM5A 1LEHA 3ZWBA 2SCUA 4M55A 2VNAA 4URFA 5DN9A 1E1NA 4UUMA 1GPJA 3L4SO 2RBEA 3QVWA 2I67A 1F06A 2P4HX 3N74A 1B3BA 1F8FA 3AI1A 1DFHA 2P9CA 1NVTA 3BMCA 4DPLA 2EWMA 2HK7A 2X0IA 2D4AA 2HQ1A 1A7AA 4HX5A 5JLAA 3VZRA 1UR5A 1PQUA 4OKIA 2AEMA 1QORA 2BGMA 3AUAA 1NFRA 2Z5LA 4R1TA 4CMBA 5KCZA 3BAZA 3PYMA 4D46A 4RDIA 1DO8A 2ZCUA 2QQ5A 4ND1A 3CZMA 1KVTA 3KSZO 1FMCA 3P2OA 1LRKA 2NUAA 3GUYA 3QV1A 2AMFA 3RBZA 3PGXA 1ENYA 3H9JA 3FR7A 1PGQA 1MFPA 3GOHA 4A5OA 2O2SA 1XLTA 2PH3A 4YRBA 2J3KA 5LDHA 4B7CA 3FTNA 1RKXA 5KJFA 1N1EA 1ZFNA 5F1OA 2P9EA 2DFVA 4G81A 1PZGA 1XDWA 4LK3A 3TQHA 1JVSA 4EYEA 4MP6A 5L4SA 4BNXA 2Q4EA 3ZWMA 5KJEA 4HBGA 4K26A 4XWYA 5KNLA 4XA8A 2D5AA 1DJQA 1AE1A 4IDFA 2VZ0A 1C1DB 1PEDA 1WMBA 2BHLA 4NK4A 5C37A 2Q99A 3VVCA 5GZ6A 2VHXA 3A14A 2YHUA 4RVDA 4RF4A 4UULA 3ZDFA 2AG8A 4XDYA 5HS6A 1MB4A 1OAAA 5EN4A 1T26A 4R1SA 2JCVA 2ZTLA 4JLWA 3AUTA 1DC3A 3IKVA 2EHDA 1EQ2A 1JKJA 3R3JA 1EBUA 4RZIA 4A27A 3ASVA 2GO1A 5DZSA 2EIHA 1ARZA 1W73A 3IJRA 4GBJA 1ZK4A 4MVJP 2VHYA 2V7PA 2HSDA 2PKQO 3HFSA 2V6GA 3ONFA 4KWIA 4GKVA 3LF2A 1KS9A 3WMWA 5A05A 5LDGA 1V3TA 2FZEA 1PQWA 4XQ9A 4RPKA 1BXGB 5I7EA 2X8LA 1I3NA 5L40A 2Q1SA 3DOCA 3JD1A 4O63O 4TRJA 3CTMA 1I0ZA 2WYUA 1B7GO 1TXGA 1UP7A 4XYEA 3VHRA 3DBLB 3OIDA 3AUSA 2R00A 4R3NA 2PZKA 4WLUA 1NP3A 5U9CA 3CIFA 2FP4A 1LBEA 4Y6SA 3AU9A 1ISGA 4YB8A 4K6CA 5CG2A 2WWRA 1TB4A 3L6OO 4JROA 2VWHA 4NFYA 3HE3A 3E9QA 3JCZA 2GCGA 4DUPA 2HKIA 1LC0A 2CZCA 2H6EA 3AM5A 4J9UE 3ZHXA 1DHTA 3WQSB 4ILKA 2PZMA 4XR4A 3JSAA 2PWZA 1PJCA 4ZGWA 2E48A 4NU6A 5TGDA 5GMOA 2FOIA 3GZ4A 4Y6RA 3EDMA 1VJTA 3ZW9A 1U5CA 4MVJG 4L74A 4CM7A 1ISIA 4YT5A 1BWSA 1PJSA 2AEJA 3PZRA 1GEGA 3OICA 1IOLA 3U4DA 3PYXA 2PV7A 4R16A 3WGZA 5AOVA 4RF3A 3WIDA 2GN4A 3JYPA 3E5RA 4CUKA 5L7WA 2CMDA 4LGVA 3AWDA 1V3VA 2CDBA 2D59A 1AXEA 3NT2A 3JQ9A 2BFPA 1O8CA 1E6EA 1LSUA 1MX3A 1NR7A 2O50A 4XDZA 3KYBA 3N58A 2I5PO 1PJ4A 4BNKA 1E7QA 1HE2A 4KUEA 5IZ4A 2Y93A 4QFDA 4E5NA 4C7KA 3GNTA 2FPGA 3MJEA 1UAYA 1I3LA 4YAEA 3ANMA 5T64A 3K30A 4H15A 4BKPA 3G0OA 1WP4A 4EEZA 3I9LA 4PVCA 1ZXBA 3I9JA 3OHSX 3Q9UA 4RLHA 4BNZA 4TVBA 5CDYA 3WB9A 1Y8QA 4GI2A 1QYVA 5I7FA 1A9YA 3ZW8A 1WW8A 4TWRA 1P31A 1F14A 1BHSA 4QFCA 4FCCA 1B16A 1Y8QB 1IYZA 3RUAA 1ZBQA 2GZ3A 3GVIA 3KXDA 1GCUA 3FD8A 5A9SB 4IXTA 3FPCA 3I9NA 4NMHA 3UCEA 5DOVA 2I3AA 5COBA 3RVDA 3WOHA 5A5EA 5ITVA 1HWYA 4NJMA 3VDQA 5KKCA 1LJ8A 2ZB8A 2OL4A 3OJFA 2GN6A 1P74A 4AJLA 4FC7A 3S1LA 1HDZA 2F1KA 1R6DA 2GD1O 2EERA 3TZQA 2E6UX 5DBIA 2Y1GA 2JD1A 4RF2A 2VOEA 4RPJA 3A4VA 1NM5A 2VYVD 4GPD1 1R4NB 1ZZEA 4JBHA 1KETA 4KTVE 2UAGA 1B14A 1Y9AA 4PZDA 2ZTUA 4K1LA 5U4QA 3PZBA 6LDHA 1HTBA 2B4TO 1YXMA 3M1LA 4W9NC 1QYXA 4BO8A 1HYEA 4J16A 5L9AA 2B5VA 2C5AA 4Y8VA 3PIDA 3H3FA 3WGGA 4YRDA 1D7OA 4WASA 3PJFA 3TSCA 1CERA 1GCOA 3INGA 2FR0A 1LQTA 2NTVA 4GMGA 1BVRA 5IZCA 2PGJA 3FRJA 1MG0A 4MVJA 1XQ1A 4B4VA 3ABIA 3MJTA 1N5DA 2GDZA 2O3SA 4G2NA 3ZCXA 4UUNA 2IXBA 2UVDA 3ICCA 1NBOA 4WOKA 3PHJA 3SVTA 3GQVA 4E2XA 2J5RA 5TS3A 5COAA 3RU9A 4L0QA 1XQ6A 4LMRA 4GGPA 2XF8A 5GY7A 4HV4A 1V3UA 4MIYA 3DMTC 2CVZA 1YQXA 3ZHBA 3NJ8A 1XEAA 3QIVA 4AJNA 2X9VA 1EK5A 1Y5RA 3H9QA 4J1QA 1Q7CA 4F6LA 4FJ2A 3KYDA 1E3JA 4BKOA 4CMHA 1NTOA 2DM6A 2IEDA 2O4UX 2VWGA 3DDNA 1TLTA 1KEVA 1ZSNA 2GLXA 4IZHA 4YJFB 4YWJA 3VOSA 1YBAA 5JC1A 4IS2A 4J3FA 3OQ6A 5JAQA 1IZ9A 2OBYA 3FI9A 2DAPA 3ZV4A 3DBHA 4KUGA 1DC4A 3IDSA 3I9KA 4D42A 1VKNA 5TRTA 2DKNA 4NFHA 4CM4B 1P1IA 2IODA 3HSKA 5B4UA 1VKOA 1S6YA 2Y67A 3KYCB 3QSGA 4BV9A 4D41A 4CLHA 1RPNA 1N7HA 5BNIA 3COSA 4AJ2A 1PU2A 3FWNA 2DUWA 4PLPA 4S3MA 4WOJA 5CEFA 3ZWYA 1ZK3A 3UFXA 3WX0A 1P9LA 4DQXA 2ZJ1A 4TROA 4TRRA 5DULA 4BGEA 3ADPA 2PFGA 5L4NA 3H7AA 2X9NA 3DBRA 1NPDA 1EQUA 3LU1A 1LDEA 3DAFA 5A02A 1GL3A 1I32A 4TVOA 3D3WA 5C7IO 2EKQA 2PKRA 2HRBA 2PA3A 3DBRB 5FF9A 1OMOA 5JW6A 2P5YA 3HB5X 4YQZA 4IIVA 1E7YA 4E5PA 4QTZA 3ROQA 3TWOA 3GZNB 1WNTA 4BNMA 2NVWA 5CEJA 5KVSA 4BO9A 1U7TA 1Y8RB 4O0LA 1QLHA 1H6AA 2HDHA 1GY8A 1PGNA 3PHGA 1OBFO 3O4RA 5AYVA 1VRWA 2R6JA 2D0IA 5DNAA 1R4MB 2HRZA 4G5HA 3LLSA 2YV3A 4P4NA 2HMTA 1M75A 1Y1PA 1SEPA 1YOVA 4QSMA 3PHLA 3LZ6A 3WWZA 4I5EA 4ALKA 3W8FA 3QWFA 4PRKA 1I30A 5C7OO 2C5EA 2YUTA 1ADFA 1ISFA 3DB2A 3BTOA 3EUWA 3PJGA 4CMIA 4NG5A 4XGIA 3E9NA 1X1TA 2X58A 3P7MA 4BOYA 4U0JA 5U1PA 4Q3BA 4BNFA 3I5MA 4KUHA 2X9GA 3QWAA 1YS4A 4IDCA 4W7HA 1GYQA 3PFFA 4R69A 3D64A 1NAHA 2BFAA 3CMCO 1A5ZA 3R0IA 4KZPA 1XWFA 4L76A 2X7HA 3PWZA 2IXAA 1K6IA 1YE3A 4JJIA 2VHVA 5TF4A 1U4SA 3HDJA 3EC7A 3RUEA 4BGIA 4E3ZA 3GGOA 3RBXA 2NM0A 3FNGA 2Y66A 3O03A 1BW9A 3PJEA 2YV2A 3DBVO 2DPGA 1YBVA 3OJOA 3I3OA 4HNGA 4KMSA 4CODB 2AXQA 1DIGA 4WECA 1H2HA 1PZHA 1W8DA 4EI2A 3IJPA 4Z3KA 3E82A 2W2LA 1XA0A 4GAEA 4E30A 3UAGA 2HLPA 2OZPA 2JFHA 1A27A 4FGSA 3BMOA 3KVOA 4RZHA 1C1XA 3I1JA 2VZ8A 4L75A 2WD7A 2FR8A 3PPIA 5TQVA 2J3IA 1H93A 1GDHA 4O1MA 2DQ4A 1NFFA 4WLFA 3ROMA 3STHA 1PS9A 4PLCA 2HK9A 2P5UA 1U4OA 4RV9A 4YAGA 4JN6B 2J6IA 4DWVA 1YL5A 1UZLA 3D4NA 4P22A 5G0SA 4WKGA 1YL6A 4IDBA 4AJHA 2JHFA 4INAA 2BKAA 1BXKA 1A4IA 4LSWA 3S2EA 4WEOA 1EUZA 4ZQEA 5DP1A 5TSDA 7MDHA 4Z9FA 2V6FA 3RC1A 4DLAA 2OORA 3W8EA 1Y5MA 1BMDA 3LLVA 1TVEA 3FNEA 3M1AA 4NQZA 3CUKA 4CLEA 4Z6KA 1H94A 1BDBA 4WUVA 1M6WA 5L53A 1K0UA 3GDFA 4LCEA 1SC6A 3E48A 1ZXLA 4DIBA 5CPFA 2W4QA 1J0XO 2PD6A 1BDMA 2JFGA 1AHHA 4PLHA 4DRYA 3U09A 1E3LA 3ZWAA 3ZNNA 4O59O 3P5SA 1YL7A 4R51A 4BNWA 1P3DA 4YDRA 4BUCA 2DBQA 1ENOA 1PX0A 5B4TA 4NK5A 2I9PA 3WTBA 4JJGA 4BNGA 2EJVA 3BTVA 1Y81A 2BRUA 1SO8A 3PVZA 4A2CA 3GF4A 3JQGA 4XQGA 1MFZA 5KOIA 1XSEA 3PQFA 4WJZA 3BMQB 2VNSA 3LT1A 1LX6A 2YQ4A 5G4KA 3RASA 3O26A 3RC7A 3FNFA 3VPXA 2CF5A 5F1PA 2H1SA 1FDSA 5AXAA 4RORA 4FOSA 2YV1A 1NHGA 3QWIA 4TMFA 2X0NA 1YJQA 3NGLA 5DBGA 3AI3A 2VUSA 5KTKA 4YT2A 1T1SA 5LC1A 2G76A 3C7CB 1ISMA 2AW5A 3JYQA 2C07A 4HFNA 4RPGA 2X5OA 1Z7EA 2BELA 4WCFC 3DHNA 3HQ4O 4P38A 4CR6A 4M8SA 3AW9A 3DONA 3MJSA 3QY9A 3UN1A 2PZLA 3ZV6A 3DC2A 4PLYA 8ADHA 4UVHA 1E7SA 3I6IA 1NR1A 3L07A 4YA6A 4EZBA 5MDHA 1HE5A 3E03A 4J1SA 3DQPA 3DXFA 5A3VA 3WYEA 1HDGO 1Y7TA 3ZWCA 4K6FA 2PGLA 3GNQA 3KZVA 1XU7A 1T2AA 3OIGA 4XQCA 4R1NA 1MXHA 1DLJA 2WM3A 4IQGA 2QYSA 4OGWA 1U9JA 2NACA 2AA3A 2VQ3A 3H3JA 4BMVA 3BXXA 1O9BA 4GX0A 4DC1A 3JQ7A 3ZV3A 1HKUA 5TT0A 1Z75A 4MIEA 3D5TA 3QE3A 1VL6A 5GZ3A 1MP0A 1X7DA 4UEKA 3C1AA 4MVJH 1UXIA 2Q2VA 2VTEA 3T4EA 1YB5A 1DJNA 3JQ7B 4ZQGA 4NIMA 1WZIA 4RJTA 1CF2O 2EGGA 3FR8A 4GSKA 4R5HA 3JQ8B 4B7XA 3SX2A 2WSBA 4GWKA 1PJLA 1EEHA 2OFPA 2VWPA 3DHYA 3L4BA 4I5GA 4S1VA 4XR9A 1ADCA 2FMUA 2YHIA 3ZHYA 2HMWA 2X1HA 2GN8A 2Q46A 1SAYA 4RQTA 1LLDA 3LC1O 4YYZA 5BNTA 1E3WA 4FD3A 1BSVA 1ONOA 1X13A 8LDHA 2O3UA 1NWHA 4DIFA 1KVRA 5CEEA 4JK3A 3QA9A 4DBVO 1ISHA 1G1AA 1DRVA 3INTA 3W6ZA 3C24A 1P1HA 4ITUA 3VDRA 2YY7A 1X14A 1HETA 3L9WA 1VL8A 2ZYGA 2G5CA 1UXJA 4M1QA 5ENVA 1VM6A 3BMNA 5T8KC 4CJXA 3V1UA 2A9FA 2ZQZA 2Q2QA 3F3SA 1ZH8A 5I7SA 3PXXA 3T7CA 1SPXA 1E6UA 3ZWWA 1KC3A 3DHEA 1PWZA 3G79A 3ZU3A 4PLVA 4U5QA 3QVSA 5JMWA 4IBOA 4R68A 2GNAA 4UUOA 5F5NA 3QHAA 4WNCA 4IDGA 3RC9A 2V6BA 1QYCA 2OO5A 4MKXA 4CM9D 4YCAA 1P1FA 2QIOA 2ZB4A 1DBVO 3SJ7A 3VPGA 3SC4A 3HDYA 3DMYA 1PSDA 1Z6ZA 1C3VA 3TL3A 3ZN2A 1OOEA 1VJ1A 2RH8A 3E1KA 4R4JA 1VPDA 1NNUA 2EV9A 1O6ZA 4CMJA 1IULA 1Q7BA 5DT9A 4DBZA 4FFPA 2AG5A 5ILOA 4OOEA 5CPBA 3U5TA 3W4KA 3MWEB 3NTOA 3JQFC 5DCUA 3KLPX 4J4TA 5K9ZA 2Q4BA 4J7UA 4UEOA 3OF2A 4YBZA 5TC4A 2O3QA 4H7PA 2B5WA 4HFJA 3UUWA 1I36A 3ZU5A 4YEDA 3ETGA 4D3FA 2B69A 3QQPA 4I8XA 1P0CA 4YXFA 1AUPA 1JAYA 1J6UA 3HNPA 4Q39A 2ZYDA 4CPDA 3ETEA 4E4YA 1D3AA 5CDSA 1XELA 1E1KA 4Y9DA 4TRMA 3ST7A 3RSHA 4TKLA 4JXKA 4CM8B 4WCDA 4IDDA 3C7AA 4LISA 1Q0HA 5JO0A 9LDTA 1B15A 1PWXA 2O2YA 4J2HA 2X86A 1EUCA 3IOYA 4LCJA 1D1TA 1GU7A 3PDJA 4TZKA 3H4VA 4BO7A 3TNLA 3H5RA 2DU8A 1C1DA 5THQA 1VLLA 1QMGA 4MVJM 1PS8A 5TNXA 2QG4A 3K92A 1DB3A 3ZV5A 4AJKA 2EJWA 3LT4A 4CMGA 5CDTA 3KLMX 1N7GA 3PGJA 4PVDA 2BGLA 3GA0A 4QECA 4IPTA 1B2LA 2W2KB 3CSDA 3FCOA 1S7CA 1OZAA 3WDSA 4JGBA 4KQXA 2HAEA 1X0VA 3PP8A 1DAPA 1HYHA 1HSZA 2P91A 3KSUA 1JWBB 4DA9A 3GVHA 1J5PA 4YAIA 1KC1A 3B1FA 5MGBA 2BGKA 2XXJA 4QEDA 1RWBA 4QO7A 3W6UA 3ZWVA 4DIOA 1K6XA 4WNIA 4BKUA 3C85A 5TIIA 5LCXA 3RUFA 4ND3A 5AXDA 1BXGA 4IS3A 3NT5A 2E82A 5BSEA 2O48X 3NT4A 4BO3A 1PGOA 4TZTA 3DBLA 2GZ2A 2C82A 2PZJA 3P19A 2UUPA 1A72A 3GVPA 5CHEA 4CM3A 5JSFA 4N18A 4Z0HO 3OJ0A 5JY6A 4WPGA 3DZFA 4I9NA 2PY6A 3OBBA 4ZA2A 1GV0A 3RBVA 3WNQA 5A4DA 4LVCA 4XZ3A 3NEPX 4XQEA 4Z9YA 1JDJA 1JA9A 3E8XA 1E7MA 2IZ1A 2PNFA 3GY0A 3ANNA 3D3EA 1DIHA 1UZNA 2X23A 4Q3EA 1P0FA 4CV0A 4JQCA 4U7WA 3VH3A 3GDGA 3GLQA 4EJ0A 1GQ2A 3ZWXA 2W90A 2WDZA 3JQEA 4GLOA 2GGSA 3C1OA 4BIIA 1HYGA 3FBTA 4L73A 1O95A 3ICPA 3TRIA 2GN9A 3I4FA 3NDJA 2HMUA 3QWHA 3WLEA 3JQ9C 5K6AC 3L6DA 1DPGA 1RJWA 4F3YA 1R0LA 3B20A 1DAOA 5JPIA 1N1GA 2NTNA 1HLDA 4ND2A 3G17A 3JYOA 1VSVA 3Q9NA 4R1UA 3ULKA 2WE8A 2NU9A 4DPKA 3S55A 5B1YA 4E33A 3KUXA 3NUGA 4L8VA 3VAZA 2J3HA 3ROKA 1J49A 4KTTE 4MVJI 1Q7GA 3GUCA 5KVQA 3WGHA 3AU8A 2VRCA 4CLRB 4XIYA 3BHMA 2E4AA 2XPCA 3BYZA 4OO3A 4XYLA 4J9VA 4BNTA 4HFRA 3AY7A 4EJ6A 4XRGA 2X5KO 3QJ5A 3SBOA 2FSSA 3IQDB 2OGUA 3HWRA 5TJ9A 3UKOA 2J3JA 1BG6A 2NQTA 1YKFA 4D43A 5A9SA 2V65A 3H5AA 3WYBA 3HB4X 3MCVA 1GR0A 1Q0LA 2TMGA 4GWGA 5HBRA 2JL1A 3JV7A 3UXYA 3AFNA 5A1TA 1O5IA 3CKYA 3IMFA 4DQUA 5ICSA 4CV1A 3L9XA 4JCOA 4ND5A 1I2ZA 3CZRA 4GQAA 1WDKA 1VI2A 4AFNA 1XU9A 4EUFA 1UXKA 3U62A 4TSKA 4YTEA 1DIAA 4XB2A 4UVEA 2AE1A 3VKUA 1PS0A 1R4NA 3IC5A 2B4QA 4PZCA 2B36A 3WNVA 1PL7A 2CVQA 1H9BA 2BD0A 1CDOA 4CLXA 2XAAA 3JYLA 5ICMA 5CDGA 4FB5A 1Z7BA 3INRA 2C2XA 4OIMA 4A7PA 3RKUA 4CM5A 2YZ7A 1K2WA 1E5LA 5G4LA 1U8XX 3M2TA 1NQTA 2CSUA 2NQ8A 3DZJA 4F45A 1BTOA 5J23A 3GRPA 2TMDA 3QRWA 4BO4A 2XXBA 1MC5A 4RVFA 2YFHA 3BHJA 4F46A 2I6TA 1KIFA 2VWQA 4BB5A 1LDGA 2ZQYA 4RVUA 5HA5A 3ZU2A 4KDFA 2QZ9A 1QRRA 4ALMA 1DXYA 4CMEC 2Q50A 4YJGB 3V5NA 3OQ1A 3GDOA 5I7VA 4I1IA 3ZNOA 2JD0A 3B70A 4A0SA 4AVYA 4EW6A 1X7HA 1YB4A 3KHUA 2X0RA 1UH5A 1ONPA 4DREA 1KVQA 4AJEA 3BTSA 1B26A 3ZWPA 4J4HA 3EVTA 5JS6A 3K31A 4YJFA 5AXCA 2CDCA 1L7EA 1YDWA 1HF3A 4W9NA 4B79A 2UUOA 1GUZA 4W4TA 1E5QA 2C2YA 3OMLA 4CM4A 1SOWA 3KYCA 3LYLA 4B4OA 4JNKA 4BNLA 4JBIA 5CG1A 1IZ0A 5B4VA 3Q2IA 4D0SA 3KETA 1KBZA 5L51A 2YFQA 2Z95A 2DPHA 4J2OA 2IE0A 3F47A 3TJRA 1QR6A 3OECA 1EE2A 3VH4A 4J90A 1XHLA 2DFDA 4ALLA 1SZJG 5H83A 2YDYA 5CAEA 1HZJA 2CFCA 1R12A 2VRBA 4NBVA 5G0UA 3K73O 1H5QA 4BMNA 2EKLA 2GSDA 1M67A 4GL4A 1EVZA 1OC2A 1W0CA 1LC3A 1FF9A 5JNLA 2O3JA 3DMTA 4B4UA 1VE9A 3O38A 3V2HA 1JU9A 3C1TA 1RM4A 3TPCA 2P68A 3LSYA 4I5FA 4C4OA 4NU5A 3O8QB 4OYRA 4PZEA 4AL4A 1DC6A 1HE3A 5AVOA 3GZNA 1PZFA 1CIVA 2PD3A 1U5AA 3ZU4A 1Y8RA 4IUYA 4MJLA 3GAZA 3TF5A 3FN4A 2V6MA 4MVJD 1VSUA 2VHWA 1PGJA 1V8BA 4OL9A 3TZ6A 1R4MA 5JC8A 5C7LO 1ENPA 2PLAA 4YAKA 1WMAA 1M76A 3VZQA 3GRKA 3WR5A 4CQMB 3NX4A 4PIVA 5HWSA 1JQBA 3Q0EA 2CY0A 3ANLA 3R3SA 2DLDA 4FFMA 3CMMA 3FPLA 2DTEA 4FJ1A 4D7AA 1FK8A 3IL2A 4II3A 1LI4A 1W6UA 1WPQA 2POQX 1EFKA 2OOSA 4GX2A 1LDNA 1ZW1A 1N9GB 2Q1TA 2Y1FA 3DAGA 3F6YA 1G0NA 2WD8A 4GVXA 4OSPA 3WJ7A 4AG3A 4GH5A 4WLVA 5B12A 2BMAA 3EHEA 3RROA 1IUKA 2DTXA 4PG4A 2HUNA 4RGBA 1EDZA 1B8PA 1KVSA 1GV1A 4P4GA 1T24A 1YH3A 1XYGA 1D4FA 1E92A 1N2SA 2AQHA 3BHIA 3CINA 3RD5A 2FR1A 3L6EA 1LXCA 3VZSA 5JAZA 2UYYA 1GQQA 3IP3A 1SCUA 1EUDA 2Z1NA 3G49A 2NU6A 4J7CA 1LSSA 3CEAA 3KTDA 4X54A 5AQ1A 4XEHA 3NGXA 3QVTA 4B8WA 3ZZNA 4BO2A 3TN7A 4CM1A 2NTJA 1YVEI 2XOXA 4E2YA 1PZEA 5ER9A 4E31A 1ADBA 4WK6A 3BZUA 3FWZA 4WE3A 1SNYA 4NBUA 1LA2A 4NFSA 5A04A 4TRNA 1CQJA 4AJOA 3RAJA 2CF6A 5ES3A 1IPEA 3GPDG 4I9UA 1K5HA 1LTHR 2H9IA 3KBOA 5L7YA 4YVFA 1HDYA 1TEHA 5IDXA 3F1KA 3FTPA 3GVXA 5A9TA 3K8ZA 1O0SA 3RKRA 1PJTA 1ZCJA 3GT0A 3EYWA 4FFLA 4D3DA 1P44A 3PHIA 1D8AA 3HADA 3EZYA 3RJ5A 1WDMA 4IM7A 2X6TA 4QT0A 5EJ2A 3RFXA 2HU2A 2DBRA 4N5NA 4A73A 1BGVA 1T25A 4GVLA 5JYDA 4MP3A 1LSOA 1B3RA 3D5QA 2CD9A 2ZJ0A 1YO6A 1BXZA 2WYVA 1NPYA 3WGIA 3B1KA 4WGGA 3UCFA 2PR2A 4FW8A 3JQAA 3RC2A 4BNVA 4FJ0A 4DLLA 2JFFA 3I9MA 3ORFA 4TKMA 4AJPA 3F1LA 5EQDA 3U9LA 2HO5A 2D8AA 4RPHA 1WVGA 3CPSA 3KOUA 4FC6A 4UAGA 4ZRNA 4A26A 4EUEA 4P4LA 3JQAB 1NHWA 1CRWG 2ZCVA 3DZHA 5JDIC 2O23A 3W1VA 3RU7A 1P1KA 1ULSA 3OFSA 4DLBA 1UJMA 3GHYA 1F0YA 3ZGYA 4NBWA 1MLDA 2IZZA 2NVBA 4CM6A 5GZ1A 3HN7A 4W82A 4XGNA 1GZ3A 3S2FA 4A10A 4FGWA 2NV6A 4FDAA 4MKRA 4GKBA 2GF2A 3GN1A 2DBZA 5FYDA 1MV8A 3AM4A 3OH8A 4EJMA 5ILGA 4IIUA 3H6KA 3BMQA 1E0DA 1EE9A 3UVEA 5EMHA 4ESOA 1KEUA 3PIIA 2EW2A 1E77A 4LSMA 4QX6A 3CXRA 3PHHA 1JKFA 3G3EA 2Y1CA 4LMPA 4YJHB 1YB1A 2WE7A 4CLOB 2GASA 3T7EA 3FBGA 5H82A 3RCBA 2LDBA 1ULUA 5HTOA 3TOXA 4BNIA 4QUKA 3JYNA 3GPIA 4B3JA 1PJQA 3GHHA 2AE2A 4FOOA 4L4SA 3MTJA 4KP7A 2W2LD 4B7UA 4NH4A 2HK8A 4IMPA 4CQLB 1PL8A 3PDUA 4GX1A 2EXXA 4E32A 2B37A 1U2GA 1MC4A 1GZ4A 4IXWA 4Z9XA 5G0VA 2QZZA 1TT7A 1DIRA 1RM3A 5JMPA 2RIRA 2RH4A 4EEXA 4DYVA 1I2CA 3D4PA 3EK2A 1PJ3A 1X15A 4GGOA 4PG8A 3NV9A 1IE3A 3K96A 1ZSYA 3ITDA 4PGFA 1X1EA 1ZJYA 4DC0A 4IMRA 5IFLA 5DP2A 3PYLA 1U3UA 4I9HA 5EERA 2C7GA 5I9LA 2ET6A 2Q1WA 2J5KA 3JQBA 4N54A 1QV7A 3I23A 4K9DA 1IL0A 2DUUA 1ID1A 1I10A 3RUHA 1EBFA 5IDYA 3IUPA 5KJ1A 1O94A 3ZWOA 4E5KA 1DLIA 3L4BC 3JQ8A 4YAJA 3AY6A 3K9QO 4AJ1A 1XIVA 3NYWA 5F21A 1ZKMA 4J0EA 2HCTA 2PKQP 4YR9A 4OHUA 4DXHA 3GEDA 3G1UA 3H8VA 2VYNA 4HNHA 1BRMA 1PJ2A 1G0OA 4Q3CA 1V0JA 2RCYA 4CMKA 4WCFB 3IKTA 5BSFA 3EVNA 3BIOA 2C54A 4ZQFA 1A7KA 5JDCC 4R54A 2HJSA 4AJ4A 3U4CA 3RWBA 3AOEC 2NVUB 1A71A 2DBVO 4ZHSA 2ZB3A 1KY4A 3VC7A 3GAFA 3GVCA 1KVUA 1HZZA 5HS4A 5JYEA 2QX7A 2Q45A 3ZHZA 3OJEA 4OQYA 5L7TA 2O3TA 4Y98A 1SOVA 4Z0TA 3ZH2A 2BLLA 5BR7A 5DBFA 1UZMA 4E6PA 1AGNA 3NDRA 4R3WA 4BNYA 3MEQA 2JCXA 1Z74A 2D5CA 1R15A 3WWYA 2OP0A 4ZN6A 2NLOA 4GLLA 1U3VA 2OHXA 1NX6A 1TT5B 4HADA 5EPOA 1R0SA 2VOJA 3LQFA 2IDZA 2JJYA 4FPXA 3TZCA 4DMMA 5T57A 2AEFA 3WJAA 3WXBA 2PGDA 3NTQA 4PG5A 3KB6A 2NU8A 2Y68A 1EFLA 3H9UA 4GMFA 1QG6A 4CUZA 5T5QA 1ENZA 4HXYA 4OAQA 3GR6A 4ZRMA 3VPSA 1DRUA 4XX0A 2IYPA 3PI7A 5DF1A 3B6ZA 5BSHA 2EG9A 4BO0A 2EEZA 3EZLA 1B0AA 4M86A 3F4BA 1WLYA 2EGHA 2Y0DA 2QRJA 3RI3A 4J1TA 4MO2A 3JD3A 5BT9A 4XRRA 5IXYA 4KQWA 1XR3A 1DRWA 2OXIA 5F5LA 1DHRA 2GPTA 3DOOA 2ZATA 2CNBA 3SLKA 1FJHA 4RF5A 5A03A 2CUKA 2VYND 2DT5A 2IEBA 3X2FA 3U0BA 4JX8A 2WMDA 1L7DA 1DC5A 5T6BA 3IAHA 5IN4A 1UDAA 1UDCA 3PQEA 4AJIA 3DTTA 4HY3A 2GR9A 4CM8A 2A92A 3VPHA 4E5MA 2IYOA 2B4RO 2YQ5A 3UH1A 1EDOA 4B3IA 2A94A 3W8DA 1HEUA 2Y0EA 1VJ0A 3H9GA 4IQ8A 2RHRA 4Z0PA 4CV2A 4PG7A 2JD2A 4BNHA 5JCJA 1ORRA 1ZEMA 2VUTA 3IP1A 3VTFA 1UDBA 2FWMX 1OI7A 2EKPA 3BMCB 1RYEA 2C29D 3RJ9A 3A28A 2VCYA 1YRLA 3AI2A 4Y67A 4B8ZA 4MKZA 3WGYA 5A5FA 2W2KA 3P2YA 3QW2A 3ON5A 3S2IA 1SB8A 1LLQA 1V6AA 3JQFA 4OH1A 4Y6PA 5FFFA 3LK7A 2ZIZA 1P45A 1JKIA 3JD2A 3ONDA 4IY1A 1R66A 5EL0A 4DGSA 1T2FA 1LRJA 1Z82A 4FIZA 3AY3A 3CE6A 5JAMA 1XKQA 1BVUA 2A4KA 3KEOA 4LW8A 3GMDA 2HMVA 1HSOA 2I99A 3I6QA 3W4JA 4RL6A 3ZWNA 4WLEA 2C20A 1LSJA 3WQRA 3F46A 4FS3A 2GYYA 4QO8A 3DR3A 1C0IA 4LRSB 4BO6A 1LQUA 2DVMA 4UVGA 2YDXA 1C0KA 1IHYA 4CV3A 4HUJA 1F17A 3DEYX 4BKQA 1FDTA 1XGKA 1AHIA 2BFOA 4CUJA 3TZKA 1LNQA 3D4OA 2EP5A 4ZVVA 2R00C 5KIAA 5IN5A 4B3HA 1QSGA 4CR7A 2DTDA 3SXPA 3LC2O 4NBTA 1K89A 1QP8A 4DQVA 2EW8A 4WLOA 3IS3A 2VN8A 3DFZA 4L9RA 4ZJUA 4XGKA 1HT0A 2ZK7A 1L1FA 2C7VA 3LT2A 4DL9A 1T4BA 1H0KA 2BI8A 4BKRA 1NASA 5EINA 1HDCA 3V1YA 3C7DB 1CEQA 4BQPA 5EQFA 3MTGA 4KOAA 1UUFA 4FN4A 4M87A 3TOZA 3H65A 3L0DA 1DFGA 3OP4A 3AM3A 5ENDA 5JCJD 6ADHA 1RYDA 3PJDA 4RCVA 3DTYA 3Q1LA 2AQ8A 1X0XA 1T4DA 3I9OA 4RPLA 1NWCA 4U8GA 4OXNA 3C3XA 2EP7A 1Q0QA 4FFOA 4OMUA 5G0TA 3GNSA 2R2GA 1QYDA 4D79A 3QLJA 4CLDA 1MGOA 4J0FA 4PLWA 1E1LA 1QKIA 3PFWO 4NNJA 3K2BA 3JD0A 5KKAA 4BNUA 1NYTA 1CJCA 2GRAA 1AXGA 1I8TA 3WSWA 1HRDA 4ZQHA 2NSDA 4XYGA 3EMKA 3WFIA 4BO5A 1U1IA 3CH6A 1DDOA 3V2UA 2PH5A 5FWNA 2O7SA 1SMKA 2WJPA 2UDPA 3E6AA 3LC7O 5KJCA 1NQOA 4J49A 1LDMA 1YBMA 4RQUA 3LDHA 5IXSA 3V1TC 3WLFA 4OKNA 5IDWA 4BMSA 3VVBA 4XB1A 4CLRA 2G82A 2A35A 3PLRA 4MDHA 5DDIP 4L4XA 4BGVA 5IDQA 5F1KA 1M6HA 2ZTMA 3GC6A 5IG2A 2VYVA 2QHXA 1HL3A 3EY4A 2I76A 2I3GA 1CQIA 3K6JA 4RO0A 1PTJA 3B1JA 4ALNA 2VT2A 4E21A 5JE8A 2GERA 1WDLA 2J8ZA 5K6AA 3TZHA 1PR3A 5COQA 2BFMA 4BHTA 4QQRA 4OM8A 3LF1A 4EGFA 4B4WA 1YDEA 4P8RA 1IPFA 5C5IA 1EMDA 1LUAA 5A3JA 4NI5A 4NPCA 4Q3NA 4DMLA 2X0JA 1VL0A 4OXKA 4A03A 1EVJA 4RVSA 4CMCA 1R37A 5FEUA 5IAAA 1ZEJA 2O3RA 5TJHA 3NRCA 3N7UA 4Q9NA 3S2GA 4DYDA 3G1TA 1JWAB 4D44A 3PEFA 4PN3A 1M2WA 1I5RA 3UCXA 3WG9A 4UVDA 2FZWA 3A1NA 3HDHA 1JW9B 3ZNPA 1KYQA 1I3KA 4ROSA 1QYWA 2HJRA 3GEMA 5I8WA 3ZI0A 3WGOA 2YW9A 5BQFA 1XCBA 4U6QA 4HFMA 4XYBA 1N92A 4YT8A 3KO8A 1DSSG 3JD4A 4XJSA 1G6KA 4YJDA 1GFSA 2RAFA 4YT4A 2UV8A 2X4GA 1FDVA 1Z45A 4PLTA 3U4IA 5IZCC 3TDKA 4E0BA 4R01A 1EK6A 3GFBA 3UW3A 3GEGA 5ITWA 3F4LA 4NJMB 1YQGA 2WTBA 4OQZA 4YJGA 2LDXA 1DEHA 4ZQBA 1WXDA 3TFOA 4CR8A 3AK4A 1LU9A 2X5JO 2VRCD 1LLUA 4CL8A 1NQ5A 1ZVMA 2G0TA 2JKVA 3OM9A 4CMAA 4O5OA 2Y1DA 3D0OA 4R5MA 3RUDA 3VTZA 3KEQA 3D1LA 4NDNE 1I24A 5AXBA 1FXSA 3MJCA 2VTDA 1GPDG 4NZ9A 5CFZA 1ZMOA 4E2WA 3GGGA 1I33A 4II2A 1WWKA 1PQPA 1NFQA 4NJOA 1GUYA 2W98A 2D3TA 2FHSA 1UAGA 4MOWA 4UVIA 1P77A 4IQ0A 9LDBA 2CDAA 3MJ4A 4J1NA 1HE4A 3PWSA 4H3VA 3MOIA 3H5NA 2NADA 4DPMA 1PGPA 3MWDB 2QRKA 3Q2KA 5IJZA 1HLPA 4BB6A 1P1JA 2GUGA 1C0PA 1H2BA 2OBNA 2JAHA 4QXMA 3DZGA 3UF0A 5L95A 1IB6A 2Y1OA 3M2PA 1C0LA 3UOGA 5THKA 1Y6JA 2HMSA 4CMEA 4MPDA 3GH3A 4J91A 1I3MA 2G1UA 3SEFA 3RUCA 4GSLA 3EAGA 4PCVA 4ZU3A 1GADO 3EW7A 3JQ6A 1YWGO 1GQYA 4MINA 5FI3A 2E49A 3OETA 1DFIA 4PLGA 4EITA 3O8QA 3SLGA 1ZMTA 3H2ZA 3KYDB 4FQ8A 4IZIA 1ONNA 4RVGA 2OMEA 3DL2A 3HHPA 3QVXA 4R41A 3U49A 2Q2WA 2VZ9A 2FSVA 3OIFA 1QXSA 2FY8A 3I52A 4MVJE 5I9NA 4TQGA 5A06A 1JVBA 1SEVA 4N5LA 3DBHB 3WYCA 5BSGA 2AHRA 3R1IA 5L3ZA 1HDRA 2VUUA 4NR0A 3LVFO 4ID9A 5C3MA 4BV8A 4RDHA 4CQMA 4DTIA 5L45A 1OC4A 1EVYA 4E12A 3OEWA 1E3EA 1YGYA 1ML3A 2QW8A 4BS9A 3NDIA 4LRTB 5T67A 1YONA 2ZB7A 1AN9A 3WBFA 1KY5A 1F12A 1K3TA 3WMXA 2VT3A 2PD4A 2WEKA 3OJLA 2E37A 4BL5A 1N9GA 3ZNQA 3LT0A 3NKLA 4OOFA 5H81A 1B8VA 4IGFA 3HN2A 4IJVA 5KVVA 1D1SA 5JO9A 4RVHA 1U28A 4KDEA 1T1RA 1I2BA 3D3WB 1Z73A 5I8ZA 4ONEA 4FFRA 5JBIA 4W7IA 3DAPA 1O89A 5K0ZA 4YQYA 3AJRA 3V8BA 1JTVA 1P1RA 1KEPA 5TX7A 3UICA 3BTUA 1KEWA 3JQDA 3OQBA 3X2EA 1PIWA 4XJTA 1VC2A 4WEQA 7ADHA 1CETA 1R16A 5KWEA 2Y05A 1XG5A 3AFMA 3WICA 4KWHA 1WZEA 1ZK0A 3OA0A 1LRLA 1SBYA 3ENNA 3PK0A 3PTZA 4BGUA 1EZ4A 4E2ZA 1J4AA 3WGQA 4MIOA 2ZTVA 2P4QA 1H6DA 2O7QA 5EESA 4LVUA 3RUIA 3TFQA 4N5MA 1GUFA 3RIHA 1YOVB 1GTMA 1N8KA 3QVOA 5KVCA 4XCVA 1GD1O 3O9ZA 2IZ0A 2RHCA 1HDXA 3GG9A 5DCWA 4CMIB 3MOGA 5DCYA 3ENKA 4PLFA 3UGKA 2QRLA 4OSOA 3KSDO 5I9MA 3DOJA 1SB9A 2H5LA 3NAQA 1UXHA 2FPIA 3DWFA 4IDEA 4C7JA 4N7RA 2X22A 5F3RA 4IJUA 5JCXA 2Q3EA 1KOLA 3R6DA 3HUDA 3WIEA 4CQMD 3H2SA 1WAMA 2Q49A 5JFOA 5JAIA 1FDWA 3EGOA 4FR5A 4YACA 3VZPA 1NVGA 4JIGA 4BO1A 2B0JA 4HP8A 1GYPA 2C59A 3DFUA 1Q2XA 3MJVA 4F6CA 1Q1NA 4W6ZA 2D1YA 3BA1A 4E5YA 1BW9B 3HFGA 3A9WA 3I83A 5ADHA 1UP6A 3RFVA 3JQCA 3QWBA 5ER6A 3GK3A 4D3SA 5CP8A 3C8MA 3PWKA 4HKTA 4Q3AA 1E6WA 3Q11A 3HDQA 2YJZA 3DZKA 5IF3A 4L4RA 3WTCA 4D0RA 4Q3DA 4XIJA 3BMOB 3WFJA 1PJBA 2G17A 3FSRA 4HWKA 4K28A 4Z3DA 1C1XB 3KM0A 4UREA 2WD7B 1QV6A 3HZZA 5FI5A 3V2GA 2BI7A 3DZBA 3L77A 4J7XA 2JAPA 1H6CA 1JN0A 1X7GA 1JLLA 5G2OA 1UXGA 4RLSA 3F5SA 4AJJA 4PLZA 2Y0CA 4M89A 4YJHA 1MXFA 4CLOA 1DIBA 5TLSA 1CYDA 3ONEA 4I5DA 1DOHA 1V9LA 3AUUA 4GX5A 5HM8A 2GZ1A 3UHAA 3A06A 3M6IA 2YYYA 3SJUA 2AQKA 1UP4A 1E7WA 2PK3A 1U7HA 4IDAA 1GEEA 4PFJA 4CQLA 2Z1MA 4AICA 4LN1A 2Y99A 2BH9A 1LDYA 4MP8A 5TT1A 3E18A 1TI7A 1Y9EA 1ZJZA 4R9RA 1PR9A 5DOZA 4CL3A 5JDIA 3Q6IA 1NXQA 4IJKA 1A4UA 4BNJA 4ZICA 4M49A 1R0KA 4IJWA 3PRJA 2FPPA 3GMSA 3IIEA 1QLJA 3ETDA 1ADGA 3OA2A 1MA0A 1ZIDA 4BNNA 1ZK2A 1FDUA 3H9EO 3JQBC 3JQGB 3MZ0A 4JJFA 4YPOA 3T4XA 1IY8A 3K2EA 3D7LA 1HDOA 3ITKA 1A9ZA 1NPTO 3ADOA 3PLNA 3S8MA 2P9GA 3JQAD 4U6SA 5G4KB 2NNLD 1ZK1A 1E7RA 3VKVA 3VH1A 4J4BA 1ZNQO 2WYWA 4FBGA 1ISJA 4PG6A 2F00A 1YJ8A 2B83A 1B8UA 5EIOA 1E3SA 3I4CA 2IRWA 4J43A 4JP3A 2OP1A 3FHLA 3DO5A 4BQRA 1CWUA 4OJNA 4FSHA 4ALIA 5B37A 2FRDA 2ILTA 4UEJA 4BVAA 1TA4A 2I65A 3GG2A 1YQDA 1ZSVA 1IHXA 1LLCA 4CM9A 3W4IA 4I08A 1MG5A 3VPFA 3GFGA 4WCFA 5CDUA 3OEYA 4E13A 1T2DA 3NJ4A 4IINA 4J6FA 4PRLA 1EVIA 5G0WA 1ZUD1 2EF1A 4UUPA 3OSUA 1W4ZA 2VHZA 1H6BA 3FNHA 1M66A 3E5MA 2ZYAA 1V35A 2NVUA 3E9MA 1U8FO 2C0CA 1HXHA 3SC6A 3HJAA 1P33A 4O6VA 4JP2A 2FN7A 2BF7A 2NU7A 1ZO8A 2H63A 1NQAO 2JHGA 4OXYA 4XD2A 3K5PA 1GAEO 2NWQA 2W8ZA 4XYMA 4H16A 1MUUA 4FFNA 1NVMB 4G65A 4JBGA 3WSVA 4YRAA 1H9AA 5KJ6A 1U2DA 4EBFA 2D2IA 2PTGA 5L4LA 1TT5A 4W99A 3RFTA 2O4CA
chains in the Genus database with same CATH superfamily
1FNMA 1KK1A 1SIOA 2ORIA 3A1TA 3CKKA 5A9RA 3N05A 3U4HA 4MK4A 2YC2C 1E1MA 3HG7A 1F8GA 3P9SA 4WGFA 4UBMA 1LBIA 5H1YA 4CEHB 1O77A 2XYPA 4NYIQ 4Z4EA 2IS4A 3NTLA 3RRYA 4DSZA 2IX3A 4OK6A 4BGIA 1HLGA 1NAIA 1GARA 2WJWA 4C0BA 4CFZA 1Y1RA 2GF0A 4ZIRB 3CLUD 5KHOC 4ZV4A 3IKMB 3FB1A 3VDNB 4EDFA 1D2HA 3HXLA 1CZRA 2JCYA 4XKJA 1CJUC 5D3MA 3VNQA 4WFIA 2QYTA 3R7LA 1VGQA 2FH5B 4JBNA 4MAFA 3N2GA 4YC7A 4RUKA 4D9NA 2MU1A 4IGEA 4A8JB 3A25A 1U1EA 5G3YA 5BQ5A 3KHKA 1VDMA 1E3IA 2YHSA 3A7DA 3AOGA 3F5QA 3FMGA 1HC7A 1SKUA 2QL6A 3KRTA 3NTRA 1UJBA 1O94D 1TCUA 1MAHA 3P32A 1K7FB 4ZJZA 5JY1A 3KQQA 5BN5A 1ZGHA 4OQFA 4NHEA 1YRBA 3THSA 4K86A 1QK3A 3PDWA 3STWA 1QE5A 4IILA 5JXGA 3QM1A 1ODFA 1EFAA 4K2HA 3WHPA 6NULA 4JV5B 1DBIA 4ZCMA 3IUSA 1K8ZB 2C31A 3VOBA 2VJBA 4ARBA 1GR1A 4RLFA 2XB9A 2Q1XA 5BNFA 1VG0B 1Z4MA 3FF4A 4FFVA 1QH8A 4GHWA 5JUWA 4G41A 2OC9A 4OU4A 1UOEA 3ZWBA 4B80A 1JLMA 4R6WA 1I7LA 4URFA 4MKFA 3RAPR 5LYYA 2O1WA 3F3YA 2ZVPX 3MF4A 2ZJ6A 4LE0A 5E9QA 1XA4A 2XYRA 1BEEA 2RBEA 3SVZA 3HNRA 3QVWA 3MINA 1F06A 2P4HX 2ZROA 1B3BA 1F8FA 2VHQA 3N74A 4RC9A 3SS7X 5CB6A 5JPCA 3ZJTA 3BD8A 3ZBPA 4EJSC 2GI4A 3GCXA 4KC0A 3SP1A 3PUYA 4K9SA 5FWXB 1AGXA 4LKOA 1PV4A 4EATA 1T8RA 3EMVA 1XB2A 3A4LA 5E7IA 4GMHA 4Q4AB 1PQUA 4QSHA 3X1KA 4IIFA 2IU3A 5TY0A 2ERYA 2IYSA 2Z5LA 3BWDD 2PKYX 3G82C 2P40A 2JFUA 2NAPA 3BAZA 4UU8A 3AHDA 3CJQA 4RDIA 2EAUA 3O2QB 2ZCUA 3QFRA 2QQ5A 4ND1A 3C6ZA 3CZMA 1NW6A 3VU0A 1XXHE 4Y3UA 3QV1A 3P2OA 1RC1A 1LRKA 2XHEA 3SZLA 3WP0A 2R2AA 2H29A 3K94A 4P4UA 2XKAA 2J9FB 5LXTA 1DG3A 5CK4A 3W5JA 3HACA 4ZYYA 2FLKA 5DM2A 2PH3A 1AQLA 3BRSA 2B1QA 3N0WA 2J3KA 4LBZA 4MRPA 4QYIB 3K0BA 4K9PA 1O9HA 4YASA 1MJGM 2VDNB 5KJFA 3NR2A 1K7YA 4GT1A 1RLOA 1MO5A 2I6XA 4JA0A 5BSMA 3IUNA 1XDWA 5DNDA 3H1EA 1INLA 3TQHA 1ZGGA 1JVSA 1PJAA 2QDXA 2ZBVA 4ENQA 2DH5A 1WKCA 4ER3A 4PSUA 5CA0A 3RS0A 4KO2S 1MCZA 2PS9A 2IEZA 2Q4EA 1GZUA 1L1QA 2GWRA 1DOAA 2QRHA 3MN1A 4IW3B 3W6OA 1DJQA 1EDEA 1C1DB 1PEDA 1WMBA 4Y6GB 5C37A 1RPTA 5ICCA 4M8NE 1XFDA 2Q99A 1CNEA 3VO1A 1PEKE 5GZ6A 1MX5A 2H57A 2GN1A 2VHXA 4ZV7A 4CW7A 4UULA 2ZSJA 4P0QB 4M0EA 5JMOA 4MWBA 1W4LA 3KTAB 1T26A 2N0SA 3CVOA 1QE3A 4HRYA 4R1SA 4NDZA 3FLBA 2Z2ZA 3QXJA 1P3JA 1SGWA 2JAWA 1DC3A 3LWDA 2EHDA 5FNZA 5KHAA 2FZVA 4CG0A 3I0ZA 1XBTA 4EHBA 3R3JA 4A27A 4AAYA 3X1MA 5BQOA 3AVWA 4GBJA 4PPYA 3R4VA 3PQ3A 4MVJP 2APJA 2P9YA 2V7PA 3THRA 1WP9A 1IU9A 3DW1X 1S2IA 5EIXA 3ONFA 2BHRA 1KS9A 1XF1A 1T8TA 2EATA 4U39A 4C22A 1G7SA 2GXSA 4XCQA 1Y5NA 2FZEA 1O95C 4U2GA 3M83A 3SNKA 1I3NA 5K0JA 1U5BB 3B85A 3EDCA 1L3CA 4H7IA 5FIUA 3W2GA 1RI5A 1U0OC 3A11A 4MR9B 4O4IF 1Y4SA 3QU7A 3CTMA 3I0NA 1UP7A 1CUHA 1EKXA 4EKNB 3DBLB 2FG7C 3SR4A 3NBUA 2QMUA 2R00A 4X93A 4D9IA 3DOFA 3D0KA 4OIFA 5EMLA 1LBEA 4YB8A 3UJDA 3GEEA 3TEMA 4ZKEA 1C8LA 1ZD5A 2FFJA 4UHHA 1G41A 1HO3A 1EH5A 4JROA 2VWHA 4YHBA 4ZMRA 3ZK9A 5E2BA 4CEJB 2VFAA 1NNLA 5JMTA 1LPOA 1OVGA 3E9QA 1V1RA 3TAUA 2QTGA 2ZANA 4J9UE 2W00A 5BQXA 3WQSB 2YRFA 4D56A 2Q9AA 1GL9B 3VOTA 3JSAA 1RJGA 2I34A 3OKFA 4I1SA 1P4GA 3CPJB 3SZOA 3CNQS 2E48A 1XALA 5DX8A 5IC4A 3GZ4A 3B52X 3EDMA 1PX2A 1PQ4A 4WXPA 4MVJG 4L74A 1XQ9A 3ZW9A 1PTJC 4Q3LA 2Z3VA 2F1HA 3W5IA 2AEJA 1MRNA 3A3NA 1GLVA 1ZJWA 1GEGA 3OICA 3U4DA 3QBEA 3PYXA 4WESB 2PV7A 2PA0A 4BEVA 5AOVA 2EG5A 4UASA 3WIDA 2HSWA 4CUKA 3BN3A 2VDLB 1OROA 3GFTA 1RAHA 3I42A 4N49A 2J33A 4NYMQ 3RV4A 5EZSA 1DX9A 1OWMA 1YCFA 3ETLA 3FNQA 3D8RA 1XP5A 2QN2A 5BV1A 2XDQB 3DXXA 3OX3A 3JQ9A 3IFSA 4MRRA 2P4UA 3KXPA 3L4JA 2BFPA 2R8RA 3KJQA 4WN9B 5JQGA 1OW3B 2J3MA 1Y3DE 2XUAA 3IBFA 5K6TA 2O50A 2R48A 5K0LA 3KYBA 3N58A 1PJ4A 1IHPA 3O8OB 2PLNA 2PRIA 1T6YA 2PMEA 1ZJ6A 2AMLA 1YUNA 3G2IA 3DA8A 4BZWA 4BBPA 2WSIA 3MJEA 1M0TA 1I3LA 2QMQA 4LJAA 5EP2A 5F12A 3K30A 4UNNA 4BKPA 1T4CB 1SRQA 2VR1A 1XZHA 4H77A 3H9CA 5BOSA 1EWQA 1JSXA 4S2EA 1KY2A 2XQKA 1A9YA 3ZW8A 3D9QX 1TF2A 1WW8A 3GU3A 4C3VA 4IKOA 1QBKC 2QJWA 3GW8A 4QFCA 1Q0SA 4D9KA 1RQNA 4GE0A 4L50A 4IGKA 1B16A 1UBKS 1IYZA 1FRNA 1QQ6A 2QTHA 4QOIA 5EKXA 3RUAA 1GCUA 3SF0A 1JDVA 1L5SA 1T8PA 1OLOA 2Z3WA 3AQIA 4Y9RA 1SU4A 1V4VA 1Z15A 4HTFB 3T5DA 1F0NA 2RHHA 1R3DA 4IXTA 3T4UA 3TUIC 3VX3A 3FPCA 3TB4A 4JI4B 2FUCA 3I9NA 4NMHA 1SUEA 5DOVA 2BW0A 2XMPA 1N0VC 4GQIA 3CM0A 4CTKA 2C61A 2XCSB 1BDIA 2M1ZA 2OFOA 1IHOA 2I1QA 5ITVA 3VDQA 3GFOA 5CK5A 5LNK1 5KKCA 4DS3A 2AFHE 1UC4B 3Q8MA 3OJFA 1X42A 1Y3IA 2GN6A 2YMLA 3HO8A 4FC7A 3S1LA 4AJLA 3DCYA 5AVSA 3G8AA 5K09A 2O05A 3D3QA 1OYYA 5DI9A 3AWIA 3OIVA 1OIWA 2OCGA 2HLHA 1R6DA 3CX7A 3KKEA 2H18A 2CC2A 4IIHA 3RG2A 5CCBA 2HRRA 3GO4A 1U81A 4N5HX 4B9EA 4RL4A 3RKSA 5K6RA 2PT6A 3LVRE 1CZOA 3T06B 1IQRA 2PMFA 3GGJA 2WUEA 3R3WA 4L6IA 4JBHA 3KZOA 1ZRNA 2OILA 4KTVE 2CLHB 4DSAA 3AVVA 4PZDA 1NUUA 2R1TA 5G1NA 4K1LA 1ZMRA 5U4QA 3EQ9A 4RZXA 1M1YE 3ISTA 4OATA 3H5WA 1KA9H 5KEIA 4OHYA 1ID8A 2XUJA 4IWNA 2CEKA 1E2DA 4RX1A 4DIDA 2W4IA 5DLPA 1NW4A 1O4VA 3MD9A 3O8RA 3RV3A 2CBGA 3QPBA 4YRLA 2H1HA 3WGGA 1W47A 3D8SA 3HRKA 1JQEA 1AURA 4YRDA 2MINA 2ONJA 4CDRA 2YJ3A 3IULA 2MMCA 1AN0A 2BDEA 5K01A 3MQFA 2MTBA 4GMGA 2WTEA 3FRJA 3JWPA 1MG0A 4M0UA 4MVJA 4L2IA 2RHBA 2ACWA 3UXHA 2Q6OA 3UWSA 4EFNA 2XOKA 4PQYA 1Z56C 3CYFA 3QOWA 1X3LA 2RJNA 4ERNA 2QD4A 1ADJA 3DS8A 5COAA 2IE8A 4M1OA 1M1ZA 2V1UA 3DVLA 1A7JA 4QU8A 1TLFA 1XQ6A 2GLTA 2YWGA 3DTVA 1JUDA 1M8KA 2H85A 4LMRA 3SZGA 5EGSA 4IUDS 4IHAA 2ATEA 1TZCA 3ORSA 1DEKA 1XEAA 4AJNA 1EK5A 2I55A 1Q7CA 2Z5GA 3H6GA 4JL6A 2GD2A 3KYDA 4CMHA 2YMMA 3SXJA 5CFNA 2IEDA 3SSAA 2O4UX 1KEVA 5CXXA 3O47A 3PL1A 1EUQA 4LF4B 1YBAA 2ZJZA 2W48A 4PX2A 3S99A 5JC1A 4IS2A 4U2FA 1MAWA 2OBYA 1ZVVA 1QO9A 1JA0A 3FVTA 3PV0A 4KUGA 5FO1A 1NMXA 1GGJA 1NJFA 4QOSA 2DGDA 3ANTA 1D9ZA 1RI1A 3I9KA 3QVJA 4Q7EA 4D42A 5CH5A 2CJWB 3NORA 1DDGA 2ZSEA 2IODA 3LAWA 3Q3JB 4NFHA 5K8LA 4NPHA 2FW0A 4BV9A 4IXDA 4KQGA 1RPNA 1V95A 3COSA 1AQUA 1Z18A 3LTEA 2R5FA 3M3PA 1BU8A 4URVR 4RIEA 1PU2A 2JCBA 3F6EX 4PLPA 5KHLB 3KQHA 3PKJA 3UFXA 2ZUFA 4HLDA 2FWAA 3FUVA 1AU9A 3QELB 4DQXA 4TROA 4MKIA 5IT4A 5BSRA 1Z7GA 4HZIA 4BGEA 2WU0A 2PFGA 5IJ0A 4ARUA 4EHKA 2HGZA 4UNRA 4UTRA 1QIIA 3CA8A 4A8PA 1MRSA 721PA 2X9NA 1ZQ9A 1YOBA 1SVSA 5EXTA 1NPDA 4JS0A 1EQUA 6AT1A 3U9SA 2ANCA 3VNAA 5KYTA 1FFXA 1GL3A 5CUQA 1YC5A 2Z2XA 3WB0A 1JAZA 5C7IO 3IB6A 3CUVA 3ORHA 6REQB 3AJ8A 4GU5A 4U7JA 5FF9A 1RIIA 4US1R 4DJ5X 5JW6A 1GFIA 2HHHB 4RJ2A 3AR9A 4YQZA 3TLEA 3U7EB 3V3TA 1E7YA 1EX6A 4UMVA 4RETA 4FBLA 3D54D 1KXJA 1NP7A 3EF1A 3GZNB 1XZPA 4BNMA 1JDBB 2EFGA 1A9TA 3E23A 4MRVA 1V2HE 5KVSA 3SQWA 3EGEA 3H2KA 2XOKD 2W2QA 1QLHA 1T3GA 1UT5A 3F67A 5EP3A 1PZNA 2IOHA 1KIAA 4DA7A 5CA1B 1PBTA 4X00A 4X8LA 1H2FA 3DTVD 5ARDA 1EGAA 4ZVLA 1IM2A 4JY7A 4P4NA 2YV3A 2BM1A 4N0QA 5FPPA 3V1NA 3NHRA 1FSGA 1IPHA 1MF7A 2XDYA 2IIBA 3PHLA 1RE1A 4I5EA 4KN8A 5J4HA 4ALKA 2D1QA 4IHKA 4K8OA 4K81B 4QDKA 3UPDA 1SHUX 3QWFA 4PRKA 5ALVA 2BSQA 5A62A 2Z2YA 5LMNB 3BTOA 2PX6A 2BFBB 4H7FA 4UJ5A 3B8EA 4EA6A 4E94A 3O1IC 4LHVA 3B51X 4BOYA 1ZRSA 2EJCA 2LKDA 2ZYRA 4ZYUA 1QO0A 9ABPA 3VMMA 4Q3BA 3MXOA 4OVKA 5F78A 1BQEA 3TCXB 4IG9A 2X9GA 3B1YA 5C1OA 4OA5A 2XBLA 3JZMA 2CV0A 2O59A 1T9GR 2HWXA 1SPBS 1UANA 4UHKA 2GJSA 3DSRA 3HWX1 4TUYB 1JEQA 1KNQA 4YJ3B 1SXJC 1TCVA 5BVGB 4KZPA 1SG9A 2GN0A 1E3DA 2V96A 4C6TB 3PUIA 4JJIA 4OA8A 3WO1A 3FDFA 3HDJA 3EC7A 4AMGA 1EUDB 3GGOA 4HZUB 1Z38A 3SMQA 3FNGA 3R2JA 1RYNA 4FZ3A 4YRZA 5E4TA 3PXBA 3UOAB 1G5QA 1RMYA 4EPVA 4JGIA 3IA2A 2ONCA 4JJEA 1IRXA 2A84A 3ROFA 3OJOA 4HNGA 5FOWA 3V4OA 1KFKB 5DH9A 4MTCA 2O07A 1W8DA 4KJXA 4EI2A 1HORA 1KHTA 1AQYA 1GN8A 2QZJA 1XA0A 1GKKA 4YUYA 2QMOA 1A27A 1XZKA 4FGSA 5H8WA 3KVOA 2ONKA 2WUWE 2QORA 3AESA 4GGMX 5G3ZA 2RGNC 1A2BA 4F4HA 3NIBA 1YRAA 4LMBA 1R8SA 4KBFA 1GDHA 5HNKA 4DVGA 3IPAA 4X44A 5K3FA 1T9DA 3HJNA 3QX3A 2WTXA 3EGCA 3PHCA 1T1GA 2P5UA 1HTWA 5I4IA 4EECA 5J43A 2DETA 1H42A 1Z4JA 1ECBA 1O6CA 1P7CA 5KAMA 1RAAA 4JN6B 4DWVA 1KAMA 1B1AA 2BEWB 3FKSA 3NS7A 4KVFA 1Z35A 2R6CA 4HLCA 4P22A 4QPNA 5EHIA 2JKZA 3UB3A 2PCLA 2CXXA 4WKGA 1YL6A 3P0EA 2JHFA 1W4AA 3KYIB 1YR3A 3L05A 3MT9A 4EHLA 4I1VA 3BG5A 4FFWA 1H2RS 4ZQEA 3E3NA 3S28A 5JOQA 7MDHA 3AFGA 3BD6A 3RC1A 2OORA 1JLHA 4NE7A 3W8EA 3KVVA 4Z6KA 3CUKA 4OLAA 3D3JA 3NIGB 3WK8A 2DFKB 2F43B 5F5XA 1M7HA 2F90A 4UMEA 4LCEA 2M98A 1GZSA 2WV9A 1SC6A 3BAFA 3E48A 3REFA 5DYGA 4C2BA 3L8YA 4LC1A 4B82A 2XQJA 3O1HB 1J0XO 4P86A 3U09A 3R0ZA 3WL5A 4DRYA 1CUUA 3ZWAA 4ND8B 2H11A 3ZNNA 4EGCB 5CDFE 2KPOA 4UBJA 5KYUB 1ZRMA 1U2GC 4DWWA 1I4OA 4WFKA 4NK5A 4R0NA 3V8QA 3BILA 4IEFB 2XECA 3SHOA 5BMVB 2CCJA 4UM9B 3WIUA 2BRUA 1W49A 4F7DA 3JQGA 4DA4A 4B83A 1MFZA 1DKNA 3PICA 4GPD1 3LECA 3OQIB 5CT4A 3VU9A 5K3AA 5KOIA 3NI2A 5FRDA 1H8HA 2R7LA 3LT1A 1DAMA 3CRRA 5A0TA 1UINA 2JFNA 1S3SA 1Z06A 2J59A 3UJ7A 2HT1A 2QE6A 5IUNC 2CF5A 5F1PA 3SI7A 4FDUA 3ZS9A 3CXUA 4E1VA 5ITZA 1KEKA 4LNHA 2WWGA 4TMFA 4UBIA 3U3OA 4QHTA 4RKWA 2RE8A 2QLNA 3AI3A 3JQPA 5AHWA 4TMXA 1DQNA 4Z3OA 2WWXA 4LYHA 2REXB 4B5KA 1XMQB 2IC5A 3H11B 5LC1A 3SBEA 2GJ8A 1T5OA 4I4NA 4LV6A 3ZXUB 4YLYA 4IUCS 2EFDB 4XWKA 2GSWA 3JYQA 3Q3HA 4LA4A 4RPGA 1EXVA 2BELA 3ELUA 1Z6AA 5SYAA 3ZLJA 3HQ4O 4P38A 2QIPA 4CR6A 4M8SA 3TI9A 5HJ2A 3X1ZA 1ZVJA 4URXR 3LGAA 2CLIB 1NYLA 1RSZA 3UIEA 5FXMA 4EYKA 1E7SA 2WWFA 3EC2A 3L07A 2AHOA 2YHAA 5MN4A 3MIZA 1MH9A 3DQPA 1I13A 3C3DA 3WYEA 2WDPA 1PUIA 2VH2A 1J56A 4J0JA 2BH2A 1EWKA 1QU3A 3GNQA 1KI6A 3Q7EA 1XU7A 5JWOA 3VR6A 3V46A 1DZIA 1JKXA 4H6WA 4KXUA 4OGWA 2YOHA 4EL5A 1U9JA 3L8CA 1X1RA 2NACA 2P69A 4Q66C 4XTCS 3NOQA 1KAHA 3L7MA 1WV0A 4WACA 2QN8A 4FFBA 4YJKA 5KMGA 4X71A 3BXXA 2V5AA 1O9BA 1QG0A 2OHVA 3IVAA 2JK1A 4BMVA 4MUXA 3ZV3A 1HKUA 1RJFA 5EWLA 5JISA 2P11A 1LNSA 8MHTA 3D5TA 4DUGA 2ZUEA 2C83A 4JB3A 3TIIA 4UEKA 1QIFA 5IJAA 4R8KA 4BFXA 4MVJH 4EB6A 2GPYA 2QPLA 2G70A 2VTEA 4V0MA 4D0GA 1ZIXA 3SIXA 1DJNA 3T5GA 4QUGA 3ZKWB 1IWPB 4MW9A 1WZIA 1WBBA 4RJTA 2O1EA 1FVXA 4ZO9A 4ZOCA 4G8JA 4R5HA 4QFBA 1CT9A 3SIPA 3SX2A 2H8KA 3RU3A 5HKLA 4PSCA 1DUIA 1TAHA 2X2OA 3GL9A 3L4BA 4I5GA 4N0PA 4S1VA 1W2WB 4UARA 2I6QA 1L7AA 4KO4S 3UUGA 5AW2A 3AF4A 3ZQ6A 4B3RB 2YINC 4YRRA 4JI7B 4YYZA 4W5JA 4FD3A 2G72A 4Z49A 2VDQB 1J2RA 1J0CA 1ONOA 1V1JA 2FW7A 2OOKA 3PR1A 2E87A 2O3UA 1MPXA 4R1LA 8LDHA 4ZCPA 2DPXA 2YNMD 3L0SA 4DBVO 3LY7A 2P3QA 1S2OA 1GSOA 3W6ZA 3DD5A 4ITUA 1JJIA 2ZT8A 1FFHA 2YY7A 1X14A 4MA0A 5DTQA 1TM5E 3VDRA 1SUCA 1OXUA 1VL8A 4PNEA 4M1QA 4OG2A 5CXUA 3LCJA 1RTKA 3DL0A 3SSOA 3ANXA 3NPMA 1JR3D 1PG0A 3BMNA 5T8KC 1Z6GA 5FYQA 4UQOA 3V1UA 4CJXA 1KAOA 1HDIA 1ZH8A 3BL6A 3IBGA 3PXXA 1BEZA 3T7CA 1O8BA 3FFXA 1F8YA 4ZEXA 4YX9A 1KC3A 1Z5PA 2H4YA 3G79A 4NC9A 2NNWB 5DB4A 2P4SA 3ZU3A 3AB3A 4BKMA 1F2TA 1WPRA 5IAJA 4EHJA 1H3FA 4JL8A 1N7JA 2IXFA 1CFJA 4RANA 1TDJA 4MUHA 4AQDA 4O2AB 4EW2A 5LJLA 1WB9A 2V6BA 4AN0A 4HVLA 2LNDA 3AY0A 3QYPA 2W8BA 2ZIXA 2N3ZA 3E35A 4ZC1A 3SIWA 5DLDA 2O6LA 4BJHB 2PJUA 5ESWA 3VR6D 1NMYA 4OP1A 4D02A 3BBLA 5HGJA 1IJFA 1I5OA 3O92A 3QGMA 3SC4A 5DYNA 5IABA 3HMKA 4DR4B 3QF4A 3UAZA 3QBDA 3DMYA 1Q95A 3L7LA 3E1KA 5ECDA 3VDMA 4BBJA 4RPCA 3F5FA 1BKYA 1CG6A 3H84A 2XCRB 1WMSA 3K72B 3U4MA 3Q7PA 3A1VA 4MUMA 2FXIA 4CMJA 2N42A 1CR4A 1HRKA 3BL5A 4DUGD 1ZH0A 1E0AA 1TM2A 1F6DA 4FFPA 4XX0B 3CKLA 1TCBA 3T5AA 1SXQA 2WR8A 5H7XA 2BGWA 4X84A 3U5TA 2NVOA 1QH1B 1T36B 3EZ9A 3AM1A 1N6RA 1VA4A 2QRUA 4J4TA 2EYQA 4NOKA 4J7UA 5AQEA 1NBWB 3OF2A 2WQZA 1ESZA 5F35A 1IBKB 2B5WA 1ZIOA 4HFJA 3ZU5A 1GXSA 4YFYA 2O2EA 3A6FA 5KTRA 1PKXA 2X8BA 4CFYA 1HT1E 2BM8A 1EX7A 2J09A 3TRFA 4F7WA 5HSGA 1ECJA 3VNRA 2ZYDA 1YR7A 3ZGOA 3VXKA 1KOJA 1OV4A 1S9HA 2QVZX 2D7DA 4RMHA 3S3TA 4FYJA 1TL7C 2BEVA 2H1IA 2RK3A 2XWQA 3KHSA 3WNBA 4CTNA 3RS2A 3KOXA 2AEEA 3ST7A 3HMQA 4TKLA 4HNUA 1NGSA 2VPYA 4WCDA 4IDDA 1MB9A 2JLAA 3KT3A 1Q0HA 4Q16A 2PX2A 3JVDA 1B15A 5T7BA 1EUCA 1PV2A 1GU7A 2V7VA 5IBQA 2AB0A 4P4TA 4PYIA 4BO7A 3AF5A 4KYVA 4BE4A 4DE5A 5JCZA 4Z53A 3GJ6A 1FFYA 3HCFA 2A9JA 1QMGA 4ID3A 3VMFA 1E1RA 3LT5A 2QG4A 5DU2A 3IYLW 4PSKA 4AJKA 5DMHA 3N0VA 4FN5A 3ZY3A 1ZGAA 3VYRB 4CMGA 3PGJA 2ZITA 4E4TA 1U7DA 3GA0A 1VHTA 5ALTA 2A7QA 4QQKA 4C7OB 4QECA 4M1YA 5LPNA 2YWEA 2VPQA 2W2KB 1HMPA 3FCOA 5I4CA 2VSFA 3HCCA 2VZEA 4JBLA 2OBFA 4ETWA 1A0OA 2WJJA 4XUDA 2F3SA 1Y3FE 2J31A 3GROA 3PNOA 4E5VA 3MFYA 3PE4A 2PWBA 2QRVA 3GVHA 5FQOA 3SE7A 3IE1A 4KITB 3U1TA 1KC1A 1F2VA 1ZMBA 1QIKA 3U17A 4LZLA 4LI3X 3FY4A 3THWA 2GM9A 2HLDA 2VPWA 3I01M 3W6UA 3FSJX 1K6XA 2Q3HA 3IELA 2YVLA 3ZWVA 1N7IA 4I4LA 1NBMA 1E1CB 2V0NA 4L8GA 2V0CA 3OZ7A 1M2NA 3LBIA 4LRWA 2A0KA 3NT5A 3VFDA 3BB4A 4UW9A 4AZSA 1UEJA 2E82A 2JEYA 2GJKA 3B5EA 2AYYA 4FEYA 3GT7A 1GU1A 2IYVA 4XVRA 1XA3A 2C4VA 2V9PA 4XWTA 8ATCA 5E7MA 3E9CA 2WBLC 2HF9A 2A5YB 2C82A 2W2TA 3TTXA 1QHFA 5T3YA 4P0PB 2P9JA 3JZIA 4AX8A 1GKYA 3QYAA 2DZDA 1D6MA 3VJKA 3QSYA 2I7DA 3FX2A 1GRRA 4K3UA 4M8LA 1NQVA 4W5RA 2PY6A 2DMRA 1LFDB 2GFQA 4ZEVA 3QUCA 3TAXA 4EPRA 1E9CA 3N9IA 3NHLA 5A4DA 3DUWA 3IPCA 4PSAA 4BQNA 1CKEA 4XZ3A 3NEPX 4HNRA 3CLRD 4NQRA 1S1MA 2PNFA 2XHZA 4R8LA 4MUGA 3K05A 1UMKA 4IX1A 4WQMA 1ZNXA 2KLBA 1O6FA 3LDAA 3H8SA 1IZ7A 4TKUB 3TS1A 1FBTA 2C4KA 1G7CA 3O2JA 1GQ2A 3GRVA 3NAGA 4TWJA 5JBQA 1ZS9A 4GLOA 4RIFA 1YDGA 4L8YA 1Q3HA 1U65A 2BGTA 2DECA 4AROA 3PENA 3TIGA 1RLUA 1O95A 1IEWA 2JJQA 4K9KA 1J8MF 2F9LA 2RGEA 2HMUA 2O8EA 1SK8A 3QWHA 4IV8A 4YP1A 4QUIA 2J4CA 5K6AC 5KTYA 1VIYA 3ND8A 3SPXA 2CD7A 3B20A 3AHIA 4NENB 1WABA 1Y34E 3D7RA 4PAMA 4RHEA 4EGAA 2CXTA 3GQBB 5EHGA 3NHBA 1RWKA 3GD5A 3H5LA 1ZZGA 1HG0A 1SBIA 1U7XA 2NTNA 3JATB 1HLDA 1SBHA 4GW3A 4IIXA 3KKPA 3BGOS 3K6SB 2H1RA 1NONA 3JYOA 1WB5A 4D4IA 3ULKA 2ORED 1I14A 4DPKA 2WG0A 1YZLA 2DBYA 2HLDD 5LIPA 3PC3A 3MT8A 4M21A 3WLKX 2J32A 1KMMA 1GPWB 4WAUA 2F8MA 2E3JA 4BFCA 1RADA 1VBKA 5B58C 4MGKR 3RYCA 2NU9B 4YRCA 4UEQA 4RULA 2Q6TA 4MVJI 5LP6C 1EM8B 3UG7A 1F0PA 3AU8A 5J58A 5F7ZA 2VT6A 4EPTA 2ZI4A 3FIJA 1Q1EA 1QFYA 3U1VA 3KPVA 2OYCA 5IJXA 4GL2A 3MFQA 4MPJA 4MYHA 5DSTA 1WIWA 4BLUA 2SKDA 2WM2A 3F8WA 4URWR 1CJTC 3U3MA 1Y6GA 2RG7A 4MYDA 4HNTA 4ENSA 4EJ6A 2DYKA 2R11A 2X5KO 2ZE5A 3QJ5A 3WGMA 2FSSA 3IQDB 5BMVF 2XI4A 4I50A 5JZ9A 2X14A 1YKFA 3BOSA 2WF9A 2K2QB 2XB6A 2A3RA 3RTGA 3FB4A 3PHBE 4ZAVA 5A9SA 1JXOA 5CURA 3UMMA 2R84A 3P94A 1UWLA 2OV4A 1GR0A 3K8OE 4M7PA 1Q0LA 1AS2A 2QV0A 4H31A 3LOUA 4XSVA 5ILQA 3RYTC 2NXJA 4KGVA 3VR6H 2R6HA 4ZI7A 5A1TA 3AFNA 1XDBA 2ZUBA 2Z43A 2DR2A 3CZQA 4FXPA 3CKYA 1S2DA 2Z4SA 3N8KA 4PV7A 2Y9PB 2IA5A 3CZRA 4O2BB 4HGNA 5EMMA 1NXTA 2VUIB 2P5TB 4I66A 1T0IA 2Q21A 4QPJC 4RKEA 2OGWA 2AI3A 1G6HA 2GUWA 3W0LB 3OCZA 3LX6A 1P2FA 4EUFA 4TSKA 3ABZA 2ADFA 1KSGA 1UBGA 2COUA 4YTEA 2WYIA 4XB2A 1YFZA 3LP5A 1YDMA 3VKUA 1XWIA 4TMYA 1R4NA 2YZNA 3EVFA 3DF7A 4PZCA 2QNRA 2B36A 1FP6A 1W52X 1ZHHA 3WNVA 1FNBA 1PL7A 4B85A 5KU1A 1K27A 1H9BA 4RE6A 5AHOA 1WW3A 1BHJA 4DLSA 4DV2B 1KFJB 4CLXA 5F3WB 3QG1A 2G80A 5D5QA 5CDGA 3KSRA 1RAIA 1YR6A 3MELA 5GGYA 4GLFA 2C2XA 4X85A 4EABA 2UXCB 2DHRA 2F7SA 4PM4A 2ZRDA 2VDRB 2V59A 3BULA 3KSBC 2P78A 5G4LA 2Q3BA 3K1ZA 4LYJA 3M2TA 2WSSA 1GGVA 1A5SB 1H65A 3R0QA 3HYTA 4YRMA 3CE9A 3S7TA 4DLWA 2D1SA 4FDTA 4JGGA 1YA4A 1R6UA 3V7NA 1CLUA 4BO4A 4X62B 1VGRA 5IH3A 1YZNA 1MC5A 3EPKA 1NJ6A 2F3QA 3BHJA 4GEKA 2RBGA 4HT3B 4RDXA 3AF6A 1FTWA 3ZW7A 1LDGA 1XRRA 2ENUA 4Q1VA 3WQBA 1DG9A 1GPAA 1Z0UA 2GZRA 2QZ9A 3ZU2A 5J4KA 1N0UA 3R0JA 3L18A 1TIBA 3V5NA 1QANA 1C9KA 3GDOA 4FT4A 1MW9X 2ZREA 3ILXA 3PCTA 4LJ4A 1N2JA 5HZHA 3O83A 3R3ZA 2JD0A 3ZNOA 5KSOA 1F7VA 1YB4A 1V8DA 2JGIA 1PUJA 3BWMA 3SCZA 2OLKA 3ECSA 4ABYA 1FIUA 4B46A 1XZCA 5BVHB 5JXIA 2ZDGA 5BP7A 2VK8A 2ZDHA 4DM4A 1P2BA 2MIIA 3EVTA 2O8DA 5GQSA 5AXCA 1PO7A 1HF3A 3P9KA 1H8ED 1EINA 2C2MA 1NDHA 2J46A 2UZAA 1MORA 4N9WA 1PLKA 2XRZA 1SN7A 4W4TA 1M6NA 2C2YA 3K0KA 5K8UA 3ZCRA 3KYCA 1THZA 2VBFA 5IHPA 5MGNA 4JBIA 2KI5A 3UV6A 5CG1A 3SX0A 1DBRA 2B6HA 1HT2E 1KBZA 1W5SA 3NV7A 1P0PA 1X1AA 3EXIA 4LGYA 5LZ7A 1G9XA 4EY8A 1RHKA 4J2OA 3TJRA 2VI5A 1JTEA 2Z5FA 4NP6A 4EF4A 1ODTC 2CXHA 1DTWA 2OKCA 2VF2A 4ALLA 3MCTA 2NSLA 1Y48E 1CDEA 1WXIA 3LP8A 1QFSA 1H5QA 2V7EA 2EKLA 3BCHA 4EHNA 1Y4AE 1EXNA 1Q6YA 1ZM7A 3K4QA 1EVZA 1C0EA 3L6RA 4PYNA 4X1IA 1FF9A 5IK2A 3C16C 4OBWA 2O3JA 2D7CA 2QBYA 4B4UA 2ZYHA 4RD1A 4D97A 4MWSA 2JARA 3EFHA 4PO3X 4Q9JA 4ZT6A 1P17A 3V2HA 1RM4A 2RGCA 3TPCA 2C5GA 2VPXA 3HLKA 3X2SA 1E2JA 1VCMA 4WJLA 5B1EA 4C5CA 2IHJA 3TL6A 2IZOA 2PDAA 2I2FA 3QTLA 5F7JA 3W7BA 3G5TA 4RABA 3ZD9A 1WZNA 3M6FA 4FEAA 2YW2A 4JWTA 1HE3A 1GTZA 4JZKA 3CGGA 1GPH1 1V5EA 1SVLA 3W9UA 1U5AA 3ZDXB 3KP1A 3ELWA 3ZU4A 3KD3A 2YXPX 4A0HA 5EHQA 4MJLA 3U5ZB 1QGUB 5E0OA 1G60A 1NUHA 3ROGA 4NAVA 2JFQA 4OL9A 2NPIA 3THOA 4YAKA 5CX1A 1WMAA 5FADA 1F6BA 1M76A 1PR6A 3NBKA 4UU7A 4WBXC 3TM5A 2D62A 4BFVA 2CNWA 5KYYB 4JUBA 3WKAA 5HWSA 3I8SA 4M9XA 1RWPA 4LRYA 1SA0A 2PXAA 1CEYA 1X7ZB 3OX1A 1UDRA 4FFMA 4B7ZA 3PG5A 4Q48A 2JHPA 4D7AA 2J48A 4R2KA 3IL2A 3ND7A 4Q5IA 5BUZA 1OBVA 3TTVA 4TYWA 2JEOA 3O3MB 3D7KA 1WXXA 1N9GB 1SH7A 2QTVB 2R3SA 1OILA 2Y1FA 3WGVA 2OAP1 3F6YA 2JCSA 3KZ1E 1YZYA 3N2NA 3WK5A 3OTOB 1EK2A 2FWPA 3IILA 1BVYF 3TQQA 4H1UA 3MRXA 2D54A 4C89A 5T41A 2GBLC 3RROA 1IUKA 2DTXA 4A82A 4JU8A 2HUNA 1XKTA 5ERYA 1ZD8A 2BEUB 3TJMA 4M0PA 2X1LA 4G26A 1KYIA 5HBGA 3RD5A 4GOMD 3BSWA 3L6EA 2HV8A 4MB0A 4TXLA 1ABFA 1GQQA 3Q7RA 3G49A 2NU6A 3F73A 1BOOA 4EVIA 3NIDB 3R3XA 4ILEA 4MS1A 1XTRA 3KFXA 3ZZNA 4CM1A 4MQUA 4FOTA 2XOXA 4HDMA 3TLKA 4E2YA 4BWYA 3T12A 5LM3A 5IK2D 1ADBA 3BZUA 1QVWA 3FWZA 4HDSB 4WE3A 3ICOA 5CCDA 3AXTA 4DQLA 2QL7A 1HH4A 4UHBA 2BUAA 1CQJA 4AJOA 1NU8A 3PITA 4EUSA 3L5OA 621PA 3KQKA 4MGZR 5ES3A 1YQUA 3ELYA 3OWHA 1K5HA 2D7JA 2ID7A 3HU3A 4R83A 4DV4B 2H9IA 2Z8YM 4PBRA 2V7WA 4YVFA 3UXEA 3HWWA 4IMJB 2H0RA 2C2BA 1P8AA 1GT91 3B6IA 1TTPB 3LDGA 3FTPA 3GVXA 2CEAA 2G8LA 3FWPA 4JYCA 5CLHA 3P20A 1JHOA 3VC2A 4CTJA 4KQKA 4HH4A 1YRQA 4MAMA 5L95A 2CYAA 1WX1A 3P9NA 3E27A 3EYWA 5DYYA 1P73A 2BTEA 2CUNA 1P44A 2JJ1A 2I33A 4PNZA 3EZYA 3W8RA 3RFXA 4KIJA 2A58A 2CNWD 2DBRA 3CLTC 5FB3A 1O97C 3NM4A 5JALA 1C7FA 4A16A 4B3MB 2PYZA 1SXJA 4MP3A 1LSOA 2AFIA 3Q7TA 1E5VA 3ESXA 2WYVA 2V98A 3WGIA 2D1FA 2VJQA 3A04A 4H08A 4WGGA 1ZR4A 5IM4A 1E3TA 2AOUA 4FYXA 5AJYA 1K8RA 4X65B 2FMIA 3RC2A 3WLNA 3UBMA 3KR1A 2FV8A 4BNVA 4BWGA 1AC5A 3E7XA 1NSTA 4AJPA 3W3AA 2F9FA 4QUHA 2BOVA 3U9LA 2AJ8A 2HO5A 1E20A 4RPHA 3KOUA 4Y9SA 1TZJA 3KAKA 4ZRNA 4IDHA 1NLMA 4YMWA 1KH1A 2DUMA 3JQAB 5FL3A 5LQUA 1X80B 1UWKA 3EZFA 5C8DA 1CRWG 3JVIA 2UZIR 5BT8A 3DZHA 1LI5A 5KYVA 5JDIC 1E18A 3H1TA 2DWQA 3C43A 5DMXA 4PNHA 4KLZA 2RGNA 2X4DA 4YMLA 4CF6A 1FU7A 2IZZA 1UBMS 3HN7A 1YK1A 4W82A 5LWQA 4EK9A 3FHTA 3G7UA 4A10A 4FDAA 1C41A 2GCOA 1Q17A 3OPMA 4F97A 1XD2A 4GKBA 1MQSA 3GN1A 4YGYA 3RR2A 5JHGB 2H51A 4LNAA 5ILGA 1EVKA 2YQZA 1E0DA 1QKKA 5EMHA 1KTIA 4LDJA 2PR7A 1YT5A 3AYXB 4P5DA 1E77A 4ESOA 3IQWA 3ZBQA 3L0ZA 4RGYA 3FKJA 1YIOA 2NXNA 2Y1CA 3PQ6A 4MGEA 4BP1A 3FKQA 1W76A 4YMTA 2WE7A 2GASA 4MS3B 2C7QA 1ESMA 2JI4A 1OYWA 2VDMB 5DGTA 3A8TA 4JEMA 4BNIA 4QUKA 3QFFA 1N2CA 3HYCA 3NKVA 2NYVA 5FKJA 4B3JA 4C88A 5CFLA 5KAPA 1PJQA 1CVLA 4R8VA 1JNYA 1X70A 3AV0B 4FOOA 3MTJA 4L4SA 1JEYA 1YCDA 5ALMA 4NH4A 4FZ5A 2HK8A 4I8IA 1NXXA 2AOWA 4MVWA 2OR3A 3TLYA 4CQLB 4JLAA 1BYIA 1R00A 1UKAA 5BY2A 2JVIA 3OOHA 2NAFA 5AD1A 1E94E 1Q91A 1Z07A 3E9DA 1RIFA 2B37A 1E2UA 3WC4A 4ENRA 4PR0A 1U2GA 2QA5A 1BN7A 1GZ4A 1UF9A 2Y27A 1SXJD 5AKHA 5G0VA 1U0BB 4JR1A 3KQVA 1TT7A 3H16A 3LBNA 4U9UA 1ZNZA 2D8MA 2IXTA 2W22A 1QUEA 4DLZA 3PCXA 3O8LA 1PJ3A 4EA9A 1JA1A 5B3JC 3NV9A 1XROA 3GLTA 1IE3A 1ZSYA 4PGFA 4B2LA 1Q15A 4EIWA 2AZTA 3CEJA 3QQ5A 4HUQB 4IMRA 2MHCA 4DC0A 2F6RA 2VNKA 3BD9A 3D7NA 5EYPB 1LJUA 1G3IA 1GTL1 4LQ4A 3W3AD 4KI0A 2A8YA 4RIIA 4CZ2A 2Z6QA 1OA1A 1BN6A 3E05A 4B3TB 4TGLA 3ZGLA 3I23A 2QUAA 1PT9A