4CQLB

Crystal structure of heterotetrameric human ketoacyl reductase complexed with nad
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
227
Chain Sequence
HHMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTRADIOL 17-BETA-DEHYDROGENASE 8
publication title Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 63
structure length 227
sequence length 239
chains with identical sequence C, F, G, J, K, N, O
ec nomenclature
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cqlB00
4FJ2A 4E3ZA 3GDOA 4CR7A 2B35A 3C7DB 4NK5A 4BOYA 1IZ9A 4EEZA 4B3JA 3AU8A 3TZKA 3QP9A 3HN7A 2E37A 3EZYA 3VZRA 4Q9NA 4WGGA 1YB1A 1SB9A 3CMMA 4KDEA 1ZK4A 2W90A 2YDYA 4U6SA 1ZK3A 4YTEA 2BFMA 4KUEA 1E3SA 1ADCA 2C2YA 4RO0A 3QW2A 1U8XX 4LSMA 4BNZA 4QECA 2WYVA 1HDXA 2X5JO 4ZQFA 4BNHA 3QLJA 3D0OA 1P31A 1LRLA 4RL6A 1DPGA 4W4TA 1PTJA 2AW5A 1P0CA 1XU9A 3PGJA 1UZLA 2DFVA 5BNIA 1BDMA 4WOJA 3LSYA 4CM6A 4Z0HO 3TN7A 1Q7BA 2AHRA 3BTVA 4J7UA 4RQTA 1DEHA 1LU9A 3PTZA 1WDMA 4IDDA 4QEDA 3RC2A 2OORA 3H9QA 3HSKA 4N7RA 1LSJA 2AE1A 2X22A 1HWYA 1RPNA 3C7CB 7ADHA 2R6JA 1TB4A 4FFMA 3E48A 3Q9UA 3RC9A 4FD3A 3L4SO 3I9KA 1LNQA 1L7EA 1B0AA 1GZ4A 2G82A 4PZDA 3LLVA 1YQGA 3UICA 3LZ6A 3BYZA 1NVGA 3JQBA 5DP2A 4P4LA 4CMGA 5KJFA 3UF0A 5CG1A 5JAIA 5COBA 1EVIA 1RM0A 1PWXA 4XYGA 1VSVA 3ZI0A 2O48X 3UOGA 2O2SA 4K6CA 1GEGA 5IFLA 2Q1WA 1CQIA 3K73O 3Q1LA 4BO4A 1JVSA 4JXKA 4L8VA 1R15A 3OBBA 2Q99A 4Z9XA 2VHZA 4DUPA 4CR6A 1XQ1A 3OA2A 1SAYA 5EL0A 4LSWA 4RGBA 4WEOA 1K3TA 1HZJA 1VL8A 3PRJA 4J1SA 1GAEO 1Z75A 3FD8A 3X2EA 4BO7A 4ITUA 1LJ8A 2V65A 3B6ZA 4MVJP 1QR6A 1Q7GA 1NP3A 4HP8A 3EYWA 3O4RA 3C8MA 3JQAA 2JCVA 3I52A 1ISGA 2F00A 1E3WA 1NWCA 2BD0A 3QVWA 5L4LA 3C1OA 3OF2A 1MV8A 2PGJA 3LYLA 3RKUA 1T2CA 3DMTA 3M2TA 2EGGA 2CF5A 3JQFA 4FC7A 1PS9A 4HXYA 1ISJA 5ADHA 3ZWCA 2GPTA 3HJAA 2I9PA 1BDBA 4JNKA 2O2YA 4O63O 4CQMB 4P8RA 3T7EA 4BKPA 1EMDA 2VWHA 4DPLA 3H65A 1IHXA 5HRUA 3V1YA 5LDGA 1ZMTA 3DOJA 1WLYA 4IDBA 4PLZA 1YB4A 2UUOA 1LXCA 4GMGA 5HS6A 2Q4BA 3DBRB 4BQPA 2DLDA 3VPFA 5CDYA 1BSVA 3ROKA 3Q2IA 4EJ0A 4D0SA 2H1SA 3ITKA 4UEJA 5A1TA 4XD2A 2DBQA 3PJGA 4WCFB 5L4SA 1EUZA 3O03A 2VHYA 1DOHA 3S8MA 3GC6A 4RORA 2BI7A 2O3JA 2PGLA 1ULSA 4GSKA 1H6AA 2VQ3A 4YRDA 1DFIA 3WIDA 2JFHA 3HQ4O 1LLQA 3K92A 1V9LA 1A9ZA 1C0KA 3R3SA 4E5PA 3WSWA 1SEPA 2G0TA 2DTEA 4J16A 2GASA 1V8BA 1UDBA 2FY8A 2WSBA 2Q46A 4WCFA 3NGXA 3K5PA 1BXGA 3W6UA 2V6BA 1QXSA 1ORRA 4D41A 4XQGA 5ENVA 1GQ2A 4I5GA 3QQPA 5ITVA 1JVBA 3OSUA 2Y1CA 4MVJM 3S2GA 5FYDA 4FPXA 1KEVA 2YHIA 4J9VA 2GF2A 1LDBA 2ZYDA 1K6XA 4RJTA 3GVCA 3RUCA 4RDIA 1MB4A 2JD2A 3R1IA 1A7AA 4HFNA 4IMRA 3WOHA 4CMIA 1LC3A 5DP1A 4CV2A 5IXYA 2CZCA 5DDIP 1PJSA 4ZHSA 3WTCA 3OJOA 3RKRA 2BMAA 4BKRA 1S6YA 3PHHA 5BSGA 3QIVA 4EJ6A 3PDUA 4DMMA 5B37A 2PLAA 3BZUA 2DU8A 4W82A 1QKIA 3QVTA 4L0QA 3WQRA 4AJHA 1IYZA 4CM7A 5JY1A 2P9EA 4C4OA 1LRKA 1SOWA 3FNEA 1LRJA 5L3ZA 4BMSA 1C0PA 1O94A 3I9JA 4IDFA 3VH3A 1C1DB 1ZH8A 3GUYA 4YEDA 4ID9A 4WUVA 3DL2A 3INRA 5AXDA 4N5NA 3QSGA 4MPDA 2IZ1A 3P2OA 2B5VA 3NGLA 1SB8A 3F1KA 3WFJA 4L4RA 2X0IA 5TJ9A 2D0IA 3IC5A 5A9TA 5BNTA 3BHJA 2D59A 5KJEA 3F3SA 1IPFA 5KKAA 1UP4A 5CDUA 2ZQZA 2VWPA 5KKCA 1O5IA 4BV9A 4YRAA 2AQKA 4FFRA 1WP4A 1CERA 5CEEA 1UAGA 4TWRA 3WR5A 3KYDB 1H0KA 3ADOA 1I8TA 4D3SA 2WD7B 4JBHA 2NACA 6ADHA 1HE2A 4YWJA 1HDYA 1AHIA 2V7PA 1NTOA 2VCYA 2X6TA 1PJCA 2ZIZA 3NDIA 3FNHA 3GVHA 2NVUA 5COAA 4UULA 3OM9A 4AVYA 2DM6A 3AI3A 2JCXA 3KBOA 5I7SA 5I7FA 1E92A 3I1JA 4MJLA 4CM9D 4QO8A 2D8AA 3A28A 4KWHA 5CAEA 1P1HA 4I5DA 3ST7A 3KEQA 1HSZA 3ZV3A 1NQAO 1ZNQO 2B4RO 1LI4A 5AXAA 4M54A 3I3OA 3RUHA 3GN2A 5KJ6A 3HG7A 4HUJA 4A0SA 2Y1FA 5U9CA 3JQ6A 2QX7A 4MVJF 2OP1A 1OI7A 2WMDA 4YAJA 5KVSA 4R16A 3RUFA 1ENZA 2OUIA 3B1JA 3PYLA 3HDJA 4IS3A 3RUIA 4CMBA 2Z1NA 1OAAA 1OBFO 1Y81A 2AG5A 5I7EA 2J3KA 2Y99A 4RQUA 3BXXA 4DRYA 1NR7A 2NTVA 5JCJD 4D79A 1RYDA 4ALLA 2CVOA 4CM8A 3I9MA 4XEHA 2ZYAA 5U1PA 3ZHXA 1DIHA 3H6KA 3EW7A 3JD0A 1GUZA 2FR1A 4RPGA 3ZWOA 3NYWA 4TROA 2VYNA 4BNTA 3P2YA 4BO5A 4HNGA 2WD8A 4F46A 3OMLA 4ZA2A 1GEEA 2GCGA 3NRCA 3I23A 4J1QA 3PYMA 3NKLA 1VSUA 4YJHA 3P19A 1P44A 3HFGA 4IJUA 4J4TA 2VNSA 4JX8A 5HWSA 1YOVB 1MGOA 5JSFA 4IJVA 2BKAA 4YDRA 5KWEA 4RF4A 5JS6A 3E9NA 1EFLA 1V3VA 3D4OA 4MIEA 3MJVA 4NU6A 4IJWA 1PL8A 2EKPA 4CM1A 3V1TC 1PZGA 3M2PA 4E5KA 1PZHA 1U2GA 1T1RA 1U4SA 2VZ8A 1U28A 3OQ6A 1NPTO 2YDXA 3GF4A 1Y8QA 3ZWPA 2ZCUA 4YACA 1ZSYA 1PJ3A 1P45A 5ITWA 1GDHA 2PH5A 3D3WB 3GMDA 4ND4A 2IZZA 4NH4A 4E5MA 4NFYA 4U5QA 4BNVA 3CE6A 3DBLB 4QFCA 3OP4A 4PG6A 4ZU3A 2I3AA 1A72A 3MWDB 1HT0A 1ONNA 1HTBA 2CY0A 3RFXA 5KJ1A 1NAIA 4LCEA 3H3JA 5ENDA 3JQ8B 1GR0A 4PG5A 1PGOA 4TZTA 1NFQA 4G5HA 3MCVA 1FMCA 1ZK1A 2I3GA 4PIVA 2NVBA 2QYSA 1VM6A 2HRBA 3JQEA 1YJ8A 4UVEA 1LC0A 1PX0A 4BV8A 5L45A 1XEAA 3BTUA 3KLMX 2JD1A 3RQSA 3BTSA 5DN9A 2AEJA 4OOFA 1I10A 2QRKA 3P5SA 2BI8A 2EP7A 3L0DA 5G4KA 1LSSA 3E03A 2DAPA 3BHMA 2JFFA 2PKRA 2VWGA 3OJ0A 3JQ8A 1A5ZA 1B3RA 1MA0A 4KP7A 3DZGA 1UAYA 1OMOA 4I5EA 1YGYA 1SBYA 4OKNA 2Q50A 4RPHA 4NJOA 1AHHA 1Y1PA 3TOXA 2Y66A 3WMWA 4RPJA 1VE9A 4FB5A 4IY1A 3AOEC 4YR9A 1WNTA 4YRBA 2C5EA 5I8ZA 3TSCA 5IAAA 4IGEA 5CPBA 1B8UA 5ILGA 3LC2O 4B8ZA 1KC1A 2I99A 6LDHA 2RHCA 3EMKA 1DRWA 4FGWA 4YCAA 5CP8A 1NFRA 3CZMA 2BFPA 2EG9A 2J8ZA 3I4CA 5DBIA 5KVQA 4E32A 2Y1EA 4Q3EA 3WWYA 3TJRA 1CJCA 4MIOA 4Z3KA 2Q3EA 1TXGA 4ESOA 3VVBA 4UUOA 4BO2A 3MZ0A 3DFZA 3D3EA 5A5FA 4OSPA 1YDWA 4IPTA 2DVMA 3ZZNA 3TZQA 3VDRA 2YV3A 3PEFA 2O7QA 4IXTA 2B0JA 3QVSA 4UUMA 4FJ1A 3OEYA 1KYQA 3AI1A 1H5QA 2BHLA 1E3JA 3B70A 1FDVA 3PIDA 1E7RA 3WTBA 2HSDA 4BMVA 4IBOA 1U5AA 5DBFA 5T64A 2C54A 1NX6A 2H9IA 2IEBA 5JCXA 2DPGA 3TWOA 1K5HA 4WJZA 1SCUA 4OSOA 5K0ZA 1O95A 3GNQA 1NASA 3PJEA 8LDHA 3GDGA 3OEWA 1B8VA 5FF9A 3KM0A 2YFHA 5F3RA 1T24A 1GFSA 3KOUA 4B4OA 4E2ZA 5CEFA 1GU7A 5EQDA 1UXIA 4E2YA 2OMEA 4AICA 1R4NB 3HADA 2Y93A 4E30A 1GUYA 3ONDA 2HQ1A 1C1XA 1B3BA 4B4VA 3ROMA 1Z45A 3OETA 3G0OA 4YJFA 3MJSA 5JBIA 2NNLD 3G1TA 4ZICA 4OIMA 4O5OA 1CDOA 1GZ6A 2O3TA 5G0TA 1IL0A 4GGOA 1DAOA 3DMTC 3L77A 2PV7A 2NSDA 1Y8RB 2PH3A 3OICA 4I5FA 3GQVA 4YQYA 2XXBA 5MGBA 4DIOA 4EITA 2HJRA 4JJGA 2OBYA 1I2BA 3AY6A 3DHEA 4YXFA 3CINA 3INTA 4R1TA 4A27A 2O23A 1YE3A 4PLTA 4TMFA 4A03A 3EDMA 4DLBA 4DYVA 4CLRA 4FFOA 4AJ4A 2Y68A 2BGLA 1MXFA 3KLPX 3JQGA 2ZJ0A 2HMVA 4NK4A 4W7HA 5G0VA 4ZRNA 4FR5A 4A2CA 4XIYA 1BW9A 3U49A 5IN5A 1E7WA 2Z95A 2Z1MA 4QT0A 4IINA 2ZYGA 1X1TA 3AWDA 4Z9FA 3RC7A 1GCUA 2X7HA 1Q1NA 4DQUA 2CDCA 4RV9A 3SX2A 2C0CA 4WECA 3PQFA 3TFQA 3BMQA 3TZCA 4BNXA 2EV9A 4J1NA 4DXHA 1GYQA 1NPYA 5ES3A 2BGKA 1GUFA 2RIRA 3GOHA 3I4FA 4XYMA 4Q3NA 5L9AA 3E8XA 3DZBA 4RLHA 5IG2A 2B69A 4I9NA 3Q6IA 4WCFC 5TC4A 1ADFA 1ZO8A 2HK7A 4B7XA 3NJ8A 5A02A 2RH8A 4EEXA 3VVCA 3ZWMA 4CV0A 1EBFA 4ALJA 4MKZA 3PDJA 3NT4A 3KSUA 4L9RA 3ROPA 4MVJE 3RFVA 1ENPA 3AM3A 1TVEA 1NWHA 3JD2A 2OBNA 4CJXA 4UREA 4XB2A 1MC5A 1UDCA 5F5LA 3WGQA 4F6LA 3PXXA 1R4MB 3DMYA 4E2XA 2CMDA 3ZNQA 2HO5A 5JC1A 3H5NA 4R54A 4BO6A 1I0ZA 4B4UA 3TZ6A 1ZSNA 4N5LA 3WFIA 1PQWA 1RYEA 2OHXA 2OO5A 4Q3CA 5ILOA 2VYVA 1GPDG 1HETA 3AJRA 4H15A 3GVXA 3MOIA 2Y67A 4BO8A 1PS0A 1IHYA 1V35A 2AMFA 4KQXA 4MINA 1Y7TA 4DYDA 1T26A 2D1YA 4NBVA 2QYTA 3AK4A 3KZVA 1M75A 2UAGA 3JQDA 4RVFA 4CR8A 2X9GA 4YVFA 3IDSA 4CMEC 2CVQA 5K6AA 4MKRA 2JCYA 2G76A 3KXDA 3ZNPA 3K6JA 3ZW8A 1G1AA 5CEJA 4Z0PA 1PGPA 4AJOA 1DBVO 2ZTLA 3GK3A 1MG0A 2YY7A 3D1LA 4I08A 5CDTA 4TRJA 2JKVA 3GRPA 1EK5A 3ONEA 3GR6A 3KEOA 2EXXA 2BRUA 4FSHA 4D0RA 4D43A 1LQTA 1O0SA 2EJVA 5EQFA 1R12A 4O59O 2VN8A 1XSEA 4B4WA 2X1HA 1EVJA 3VDQA 3TFOA 3C7AA 4Z3DA 4WLUA 2CUKA 3UXYA 2NVWA 3MJCA 1P77A 3H2SA 1M2WA 3WMXA 2FSSA 3GLQA 3WLEA 5B12A 4DIBA 1HE3A 3WJAA 1WMBA 3WGTA 1P1JA 3PJFA 3AU9A 1QSGA 3EHEA 3OIGA 4ND3A 3BTOA 1LDMA 2HKIA 2O3SA 2OZPA 4WE3A 3JYPA 3L6OO 3ADPA 3L9XA 4RZIA 4QTZA 2HJSA 3U9LA 1VJTA 3UVEA 4AJEA 1KEWA 1DJNA 1DC5A 1S7CA 4CMKA 3CIFA 3GN1A 5EJ2A 2FPGA 2D5AA 3L9WA 1HE5A 1SC6A 3AOEA 4H3VA 5KNLA 4A7PA 4BUCA 1I3MA 2OP0A 1AE1A 2Y0EA 3E6AA 4DMLA 3EUWA 5GY7A 3LT2A 4ZJUA 4WPGA 2R00A 3AUTA 3VC7A 2EWMA 4DLLA 4NMHA 4WOKA 5BSHA 3FN4A 2FRDA 4BNKA 3FWNA 2YHUA 3ZWNA 2AQ8A 2G17A 5B4TA 1I2CA 3PWKA 2PGDA 1YBMA 4I1IA 3JYQA 3WXBA 4YT4A 3GNSA 2HRZA 3FR7A 4GL4A 4AJKA 5TRTA 4PLYA 3P7MA 2H5LA 4YJGB 4E5NA 3SLKA 3G49A 3VHRA 2YYYA 4JCOA 4R3NA 5I9MA 1DC6A 1J5PA 1TEHA 1GYPA 1JWAB 2BGMA 3WLFA 5IN4A 3L6DA 2QW8A 1LDGA 4HV4A 5LDHA 1I2ZA 3BMOB 3WNVA 2Q45A 1MX3A 1R16A 2NU6A 5C3MA 1W8DA 1P0FA 2G5CA 4BMNA 3PHLA 5TT1A 4WK6A 3HZZA 5A03A 1B26A 3V2HA 3ZV5A 2ZTMA 4D42A 4CODB 3BIOA 3PHIA 4M86A 4YJGA 3OJFA 3NT5A 3WGGA 2AEMA 2LDXA 4ZVVA 4F3YA 1YKFA 1HDCA 3DTYA 2VYND 2O3RA 3ZHYA 1M6HA 1WMAA 1Z7BA 2NUAA 3GGGA 1HSOA 5COQA 2Y0CA 3M1LA 1B8PA 1EE9A 4Q39A 3VTZA 2I5PO 5JDCC 1I33A 3LF1A 4R68A 2WDZA 4O6VA 2HMSA 2XXJA 5JAQA 2BLLA 2A94A 3SEFA 4GBJA 4XB1A 4FC6A 3RC1A 2WM3A 3UGKA 1F06A 1D1SA 4PG7A 1N7GA 3D4NA 3QWHA 2QZ9A 4KUGA 2IDZA 1IE3A 3AFNA 3I83A 2DUWA 3ZGYA 3TF5A 2E82A 1SOVA 2PZKA 1QMGA 4I8XA 5LC1A 2FHSA 4OJNA 4IZHA 2VHVA 1NFFA 3PYXA 4EI2A 3GZNB 2EEZA 2P4HX 5HM8A 3CXRA 4HWKA 1DAPA 2PD6A 1A4IA 4A5OA 4BO9A 1WXDA 1C0IA 2Q49A 4CQMA 2HDHA 1LDEA 2GUGA 4GH5A 1CRWG 1C0LA 3DBHB 3W4KA 1F8FA 3OIDA 4FFLA 4OOEA 5ICMA 2D4AA 2B36A 4INAA 5AQ1A 3MTGA 5IDWA 2FPIA 3GPIA 3NTRA 3E18A 3ANLA 4OXYA 3UN1A 2AQHA 2D2IA 2C5AA 1H6BA 2YQ4A 2X0NA 4AJJA 3AUAA 3DBRA 3GHYA 4Y6RA 3RUAA 3UCFA 3H5AA 1QYXA 1VKOA 3AUSA 4PLWA 4UEOA 4BKOA 4IZIA 2IEDA 2GZ1A 4BQRA 1ADGA 1KY5A 4L4XA 3FHLA 2ZB4A 4II2A 4BL5A 1X1EA 4LRTB 3VPSA 5T8KA 1HLDA 1GQYA 4UVGA 1NYTA 1QYCA 1XG5A 1LX6A 3RU9A 4DIFA 2NTNA 3GZ4A 3D7LA 5TS3A 2OGUA 3A9WA 5H83A 2IXAA 3ZN2A 4DA9A 3E5MA 4NFSA 2JJYA 3VPHA 3WIEA 3LC7O 2B5WA 1NAHA 1Y9EA 3I6QA 2PD3A 2F1KA 2X8LA 2CD9A 2GD1O 2GZ3A 1GZ3A 4S1VA 2VWQA 1ISIA 2YQ5A 5CDSA 3PWZA 3MJ4A 4Y67A 3HDHA 4R41A 2Z5LA 3EVNA 1GD1O 2VRBA 3LU1A 4J0EA 3ZU3A 4FBGA 5FI5A 1KBZA 3T7CA 1UH5A 2GN6A 4E33A 4MVJI 3FNGA 1PIWA 1W73A 4JQCA 4MVJD 4P4NA 2IYPA 4AJLA 3BAZA 1R0KA 4BO3A 3LF2A 3DB2A 1E5LA 4N54A 4J1TA 5FFFA 4BB5A 4CMEA 4ZQBA 3WG9A 4E13A 1UJMA 3C24A 4OQZA 4YT8A 1LDNA 2PD4A 2EW2A 1QLJA 5I7VA 1UXJA 2J3HA 1GADO 3FCOA 1E1KA 2X58A 1WVGA 2E6UX 3PQDA 4GQAA 3MWEB 5C5IA 1O6ZA 3WJ7A 3H9JA 1C1DA 4R9SA 4BGIA 4NBUA 4QXMA 3TL2A 3GG2A 3KRTA 3WNQA 1Y5RA 3C85A 4U8GA 1BMDA 1HL3A 1YWGO 1LLDA 1BTOA 4RVGA 1N7HA 4DL9A 1B2LA 2AA3A 4IGFA 1LDYA 3DAPA 1XYGA 5G4LA 1O89A 4E2WA 3H7AA 3NEPX 3ROQA 4DBVO 1MP0A 1W6UA 3IMFA 4EUEA 3GRKA 4BB6A 1ZKMA 3NDJA 2ZB8A 2EF1A 4R3WA 4F6CA 5IDQA 3MOGA 4HFMA 1KVSA 3DOCA 1A27A 4XR9A 1RM5A 5JNLA 2FSVA 2IZ0A 3C1AA 5B4UA 4NQZA 4EYEA 2VOJA 1JKIA 3M1AA 5CG2A 3O8QB 3ABIA 4KMSA 4B3HA 2EP5A 1X15A 3VKUA 3KYDA 4OXKA 1N2SA 4JJIA 3GY0A 4CM4B 2WD7A 3ZNNA 3UUWA 4BNJA 1O9BA 4NG5A 1LBEA 1I3KA 1G6KA 2WJPA 1B16A 5F1KA 5F5NA 2Y1OA 1D8AA 5JPIA 2I76A 3G3EA 5A05A 4LK3A 1E7MA 3V1UA 1GTMA 1QV6A 2QG4A 4XRGA 4PG4A 1LSOA 3A4VA 3LLSA 3W1VA 3WSVA 4BNFA 1F12A 1ZW1A 1I32A 3H9UA 2O50A 2B4TO 4J9UE 4XKJA 4CM4A 2GN9A 1X7DA 4GX1A 3OFSA 1CETA 1B14A 1H94A 1U2DA 2I6TA 3TDKA 4BNGA 5GZ1A 1E3EA 3PZRA 4CUKA 2X9NA 1EE2A 1XIVA 3BMCB 4XWYA 5H81A 2HUNA 4BO0A 1DHTA 1HDOA 1H9BA 5TT0A 1AGNA 4LCJA 3I9OA 2JAPA 1PL7A 2P9CA 2DTXA 2GDZA 3IL2A 3UAGA 3WGZA 1YQDA 1U3UA 5EPOA 3V2UA 4NNJA 1VJ0A 1CQJA 3ZWWA 1ZXBA 2VUUA 3H2ZA 4XJSA 5TGDA 4K28A 2GNAA 3G79A 4EUHA 3KV3O 3RUEA 5K6AC 1JLLA 2PZJA 1HZZA 5A3VA 3TOZA 4NBWA 5KVVA 4XQ9A 1DHRA 2GERA 4LMPA 1E1LA 2XAAA 3QE3A 1N8KA 1YOVA 3JQ9C 4PLVA 1AXEA 4ZQHA 4PZCA 4WEQA 5DOVA 2Q1SA 1Q0QA 3BMNB 3ZDFA 1RJWA 2O3UA 5JO0A 3JSAA 4XRRA 1ONOA 1E7YA 4CUJA 1YL5A 4HADA 4OQYA 1SMKA 1PJQA 3WYEA 2ZTUA 1UP6A 2NLOA 1OOEA 2DQ4A 2YV1A 5HBRA 1FDSA 1LTHR 2D3TA 2VYVD 4W99A 3LQFA 5AXCA 1G0OA 5JDCA 4J91A 4WCDA 5GZ3A 3ETEA 3GEDA 1YL7A 1Z82A 4CV3A 4Y6PA 4P22A 5G2OA 4OHUA 1A71A 1QG6A 3D3WA 4YT2A 3V5NA 1RKXA 3FNFA 5L40A 1HEUA 4HKTA 3ZHBA 3DBLA 3ZWYA 2RBEA 2X0RA 4DVJA 2X9VA 2OXIA 4U0KA 4ROSA 3MJTA 3KYCB 3Q9NA 3N7UA 1PWZA 3LK7A 1U3VA 3LT4A 4GPD1 3INGA 3DBVO 1VL0A 3DONA 5B1YA 1GV0A 1YJQA 3HWRA 2R2GA 3DZJA 2Q4EA 1R37A 1K89A 4LMRA 3CEAA 4JJFA 3F47A 3VKVA 3PK0A 4NZ9A 4XGIA 4YQZA 4CMHA 1ZUD1 3GT0A 3O9ZA 1BGVA 2Q1UA 4W9NA 5CDGA 1U8FO 2GN4A 2NADA 3F4LA 4KUHA 2XPCA 1XHLA 2BFAA 2R00C 3LC1O 4L75A 3RWBA 3DHYA 5A04A 1H93A 1ARZA 4B7UA 1Q7CA 3K30A 3MEQA 1EQUA 4MVJA 5TQVA 1I3LA 3GDFA 3H9GA 2ET6A 3VPXA 4QO7A 2WE7A 1F0YA 1WDLA 2FZWA 3CTMA 4UAGA 5CPFA 3C3XA 2AQIA 2PR2A 3ULKA 2WE8A 3S2FA 3VH1A 4D45A 2CNBA 1I3NA 3U4HA 5CHEA 1A4UA 3GAZA 4DLAA 5JC8A 2QZZA 3KETA 1CYDA 2VT3A 4CLEA 4XJTA 3E82A 3Q0EA 3RROA 2IRWA 3VAZA 2J5RA 5IJZA 2DKNA 1JDJA 1NHGA 3ANNA 4YPOA 1ONPA 1E7SA 4NJMB 4Q3AA 5G0UA 3W8DA 4UVDA 2VHXA 1C14A 1J6UA 1DIAA 3GHHA 2EHDA 3QWBA 1P74A 5G0SA 2P5UA 4E12A 1GCOA 3E9MA 4XYEA 4CLDA 4FN4A 1JA9A 2BF7A 3VOSA 4EGFA 3UCXA 3FWZA 4FFPA 3KHUA 3AM5A 1E3IA 3GUCA 1HLPA 4GAEA 4DWVA 5A9RA 3N74A 4KTVE 1R4NA 4NJMA 1DC3A 1HYEA 1Y5MA 4Y9DA 3DAFA 4IDAA 3FI9A 3DAGA 3U4CA 5KOIA 2UYYA 3KTDA 1KOLA 2PKQP 4GGPA 5H82A 1I30A 4MO2A 5F1PA 5BT9A 2DBZA 2ZB3A 1Y8RA 1E7QA 3SBOA 4RVSA 4N18A 4YJDA 1HF3A 5TNXA 4TQGA 1R6DA 3ZCXA 3PLRA 1N5DA 4GVXA 2I65A 1WW8A 1PJLA 1XKQA 3EY4A 1T2AA 5LCXA 1XCBA 3K31A 2DT5A 2NWQA 2OL4A 4LRSB 1ULUA 4I9HA 1YXMA 1JAYA 1HDGO 1NPDA 3WGHA 2ZK7A 1W0CA 1B15A 2X86A 5EESA 1ZSVA 2CFCA 1GYRA 3KVOA 3DZFA 3ENNA 4ALKA 1I01A 1T1SA 1D1TA 4OMUA 2RCYA 4TSKA 1TT5B 3H4VA 4K1LA 1OC4A 3JTMA 5JLAA 2W98A 2J3IA 4ND2A 5A3JA 4DQXA 4PN3A 5L7WA 4I9UA 3QWIA 1EUDA 4GMFA 4TVBA 3W8FA 1BHSA 3B1KA 3PQEA 4J7XA 1DXYA 1J0XO 1U5CA 3IUPA 4R1NA 3AY3A 4WLFA 2Q1TA 5T8KC 1NQTA 4A10A 1Q0LA 1WZEA 1NBOA 4BGVA 2P4QA 1PQUA 1PZFA 2W2KB 1K0UA 2RH4A 3GGOA 4TRNA 3I9NA 3DEYX 1LLUA 4CQMD 3DTTA 5KJCA 1KVTA 1KVRA 1PR3A 2CSUA 2OFPA 1Y6JA 5C7OO 2HMWA 3L4BA 4MDHA 3T4EA 3UCEA 3U0BA 1PJTA 4PRLA 4CLOB 1E6WA 1HKUA 1T25A 4GX5A 1F14A 2JHGA 1H2HA 1EZ4A 3DXFA 4XZ3A 4CQLB 4URFA 3LVFO 5JAMA 4FS3A 4OM8A 5C7IO 1KEPA 1HRDA 5BNFA 1KVUA 3S2IA 1ENOA 3ZNOA 4AJIA 2HLPA 5TIIA 1GPJA 5DULA 4CV1A 1DIRA 4J2OA 2GYYA 4J4BA 1TLTA 3C1TA 3ON5A 2CDBA 4CM5A 3DO5A 3DWFA 1ZVMA 2DUUA 1G0NA 1MFZA 3PI7A 1P3DA 2EKLA 1R4MA 3K8ZA 2EERA 3TRIA 4BO1A 2NU8A 4BVAA 1H6DA 3AFMA 2BFOA 3EC7A 1ENYA 4XYLA 3Q11A 4YA6A 2VZ0A 1IY8A 4B79A 1ZJZA 3EVTA 3U3XA 4QQRA 1F8GA 3HUDA 1XR3A 1DSSG 3JQ9A 1JKJA 3DFUA 2QHXA 3N58A 4YAEA 2C59A 4IDEA 4N5MA 5F1OA 4ALNA 1AXGA 1KIFA 5JDIC 3JQ7B 1Z7EA 5KCZA 5B4VA 1QYVA 4JP2A 1UDAA 3PHGA 4HX5A 5L7YA 5T6BA 4OXNA 4JN6B 3I9LA 4L74A 1UR5A 2VZ9A 1XLTA 3CMCO 3ZWVA 9LDBA 5JYDA 3VZPA 1YRLA 4HFRA 4AL4A 5MDHA 3RAJA 2X23A 4PG8A 4XX0A 3RBVA 1SPXA 3IS3A 4HFJA 2X5OA 2DBRA 1LLCA 1E0DA 3D5TA 1PL6A 3ETGA 2CF6A 3FBTA 3RCBA 1E77A 4ZD6A 3HFSA 4CLXA 1AUPA 4DC1A 5IZ4A 4CL3A 5BQFA 5JXWA 1DFGA 1QV7A 4M87A 4NFHA 1JQBA 1ADBA 1TI7A 3FPCA 1DJQA 1IZ0A 3U5TA 4K26A 1L7DA 4K9DA 3ZV4A 1MUUA 3F4BA 4FFNA 4E0BA 1M67A 3KB6A 2X4GA 1RWBA 3WB9A 1EVZA 3DHNA 1PU2A 1ZFNA 4GI2A 3OQ1A 2Q2VA 2B83A 1XDWA 1YONA 2X5KO 1UXKA 3RFTA 4ALIA 1W4ZA 4OGWA 3F5SA 3WBFA 1D7OA 3SVTA 3IJPA 4UUNA 4GKBA 3LT1A 2YW9A 1K2WA 3JD3A 2E4AA 5G0WA 3GPDG 4MIYA 1AN9A 2FP4A 4MP8A 1UXGA 1XELA 2UV8A 3E9QA 4WNIA 3R0IA 1U7HA 3ZW9A 2EKQA 3U62A 1V3UA 3CKYA 2WTBA 3OH8A 2HMTA 3UHAA 3FTNA 4B3IA 2W4QA 3O38A 4IMPA 4UVHA 4MVJH 4FGSA 3GMSA 4YAGA 4ZN6A 1NVMB 5JO9A 3ENKA 4JBIA 3HDYA 3ITDA 4P4GA 1HYHA 4H7PA 4UVIA 3WGIA 1IB6A 1P1RA 2ILTA 2UVDA 3FSRA 2ZQYA 1PEDA 4F45A 5BSFA 4WKGA 4S3MA 4QX6A 3A1NA 1ISFA 3ZU2A 1UZNA 1V0JA 4AJ1A 1P1IA 4LISA 3CZRA 3JV7A 3CUKA 4BHTA 1DIBA 5JMPA 4BNUA 2J5KA 4XQCA 4PLPA 2IYOA 5IXSA 3UW3A 3DDNA 1X0XA 5TSDA 4II3A 1DRVA 4Z6KA 5A4DA 2VUSA 5T67A 1T2EA 4D3DA 3DZHA 1KETA 3JQAB 2Y05A 4CL8A 3BMOA 5FWNA 3V8BA 1E3WB 3NTQA 2A92A 4DPKA 4WNCA 2HAEA 2G1UA 1IPEA 2W2LA 4MVJG 4CPDA 2GN8A 3GVPA 1R66A 4D7AA 2A9FA 2LDBA 3NJ4A 3WGYA 5C7LO 1MG5A 3GNTA 4ONEA 4E31A 5CFZA 3CH6A 4LGVA 1H2BA 3EAGA 1IULA 3RSHA 1KC3A 3B1FA 5FI3A 1T2DA 5AYVA 3JYOA 1YS4A 3S55A 4EW6A 4M1QA 3WYCA 3PJDA 3QWFA 4J6FA 2IE0A 4YBZA 5IZCC 1PGJA 2HMUA 3G1UA 4IIVA 3SC4A 2O7SA 1Z73A 3W6ZA 1A9YA 2X0JA 5C37A 1Y9AA 3NDRA 4FDAA 4AJPA 1GL3A 3ONFA 2H6EA 4WLEA 2YUTA 4R01A 1NXQA 1CF2O 3HNPA 3WWZA 1K6IA 4GX2A 3R3JA 3CSDA 3GGPA 4HBGA 5TF4A 3E5RA 4U6QA 4CMAA 4U0JA 3RBXA 2BH9A 4NDNE 4TZKA 3D5QA 1J49A 5DT9A 2O4CA 1BG6A 4IXWA 2DBVO 1YDEA 1PSDA 4W9NC 1BVUA 5TJHA 1NR1A 3ZU5A 5GZ6A 1KERA 3GZNA 1F17A 3D64A 3ICCA 4TVOA 3RASA 2GLXA 2XOXA 2C2XA 1NM5A 2Y1GA 1FDTA 3PHJA 3F1LA 2WEKA 2VTEA 2AG8A 2VTDA 2EW8A 1XGKA 3AOGA 1U1IA 4E6PA 3DBHA 2AXQA 2A35A 2PK3A 4DBZA 1BXGB 1FXSA 3KYBA 3IKVA 4NPCA 4RPKA 5EMHA 1V6AA 1ZEJA 2HK8A 4L76A 5DF1A 4EBFA 4OYRA 2W8ZA 3EK2A 1LA2A 5IDYA 2C7GA 2IODA 1VLLA 3VZSA 2YHIB 3K2BA 4CLHA 1UXHA 1X13A 2FWMX 3PVZA 2PZLA 1FK8A 1CIVA 4GSLA 1Z6ZA 4IUYA 4WLNA 4YYZA 5EN4A 4DPMA 1GV1A 2J5QA 4BNYA 3DZIA 4FIZA 4CMIB 4IM7A 1XA0A 4GWKA 2XF8A 2Q2QA 2P68A 2P5YA 1Q2XA 3FBGA 5A9SB 4J3FA 2PY6A 4OAQA 4OH1A 4PVCA 2OOSA 5THQA 2BELA 2NQTA 1LEHA 2RAFA 4HNHA 1C3VA 3HE3A 3H8VA 5KVCA 4BS9A 4XQEA 5L53A 2ZATA 3L6EA 4GLOA 4WASA 3GFBA 1YVEI 1JAXA 4E4YA 4E5YA 4ND1A 4YAKA 1D4FA 5U4QA 1NQ5A 1YBVA 1JW9B 2HCTA 3OA0A 3QHAA 1OFGA 3FPLA 4KQWA 3SXPA 5A9SA 2ZJ1A 2JFGA 2TMDA 3U4DA 3S1LA 3SJ7A 2PWZA 4CM3A 5JFOA 3L07A 3RBZA 5A06A 1J4AA 3JCZA 3HN2A 4XR4A 1GY8A 1P1FA 5GMOA 2SCUA 4RPLA 3I5MA 3X2FA 1E6UA 2VRCA 4RDHA 4AJ2A 1EQ2A 1I36A 4J0FA 4PLCA 4IQ8A 3IIEA 5JE8A 3WBBA 3WYBA 3WICA 1ZXLA 1HDRA 1XWFA 5JDIA 1U9JA 1VC2A 3ZV6A 2DFDA 1WDKA 1YL6A 4CMCA 5TX7A 3FF4A 3D4PA 3PPIA 1TT7A 4D3FA 2B4QA 5AVOA 4G81A 1JU9A 3K2EA 3RI3A 1VL6A 1FDUA 3KO8A 3WDSA 2NVUB 5IF3A 4JBGA 2J6IA 3ANMA 5DCYA 3EZLA 4PGFA 4RF2A 3ZWAA 1QRRA 4PLGA 1P9LA 4NBRA 3NV9A 1MFPA 3RJ9A 4J90A 4JLWA 2VOEA 1EUCA 4XCVA 2C20A 4RF5A 3G17A 2FN7A 3AY7A 3K9QO 4RLSA 4DGSA 1I24A 4JK3A 1ZBQA 4RVUA 4R1SA 4TRMA 4Y6SA 5DZSA 4BIIA 1BWSA 3RD5A 4B7CA 5AXBA 3EGOA 1T4BA 3A06A 1ZJYA 4P38A 4FOSA 1MXHA 1SNYA 4XYBA 1H9AA 2WWRA 3WQQA 2V6MA 3O8QA 3WQSB 4KTTE 1N1GA 3VH4A 3VPGA 4CM8B 4PFJA 2NU9A 2O3QA 1ID1A 4IQGA 4NU5A 1D3AA 2VHWA 3RU7A 2ZB7A 3L4BC 5ER9A 4HY3A 1FJHA 2V6FA 3R6DA 4QUKA 2WYUA 3UH1A 4R4JA 4QSMA 1JKFA 4LVUA 4JGBA 3KUXA 1WAMA 1E6EA 4NI5A 1T2FA 1YH3A 3ASUA 4FQ8A 5L51A 2I67A 4YJHB 3QV1A 4R51A 4NHEA 1R0SA 1SO8A 1GQQA 1NQOA 1DC4A 1PJ4A 1ZMOA 4E21A 2EIHA 1M66A 2ZTVA 4LW8A 1U4OA 1JTVA 4C7JA 1DIGA 2VUTA 1DRUA 1LSUA 4YB8A 2FOIA 3PWSA 4FJ0A 2I66A 4RVHA 2NU7A 2ZCVA 1X7HA 3BMCA 1Q0HA 3RIHA 1U7TA 5FEUA 2GRAA 4RZHA 3ZU4A 1DFHA 1ZIDA 3ETDA 2Y0DA 2NV6A 2YJZA 3B20A 3ZHZA 2FPPA 4XGKA 3RUDA 5JAZA 2UDPA 3F9IA 4YAIA 2GZ2A 3V2GA 3T4XA 5K9ZA 1Y8QB 3SLGA 8ADHA 2FR0A 5AOVA 4JROA 2E48A 4BNLA 3DOOA 3PP8A 3MTJA 3TZHA 2FR8A 4OL9A 3PZBA 2EGHA 3IOYA 2CDAA 1XU7A 3U4IA 1KEUA 4M55A 2UUPA 2NM0A 4M49A 4ZGWA 3FR8A 3GG9A 4ZRMA 1ZK2A 3M6IA 3OJLA 1E1NA 1LUAA 3STHA 1TA4A 3BMNA 1IUKA 3IP3A 5IZCA 2GR9A 4XIJA 1V3TA 1FF9A 4NBTA 2JD0A 4AJNA 5T5QA 4DTIA 5THKA 3NUGA 4Y8VA 4YT5A 5G4KB 3KSDO 4PCVA 1E3LA 4Y98A 3TL3A 3WX0A 2HU2A 1SZJG 4XGNA 5ICSA 3NAQA 1YBAA 1WZIA 2ZKLA 3GEMA 3WGOA 4DREA 4KZPA 5DBGA 3CPSA 1X14A 1XQ6A 1N9GB 4J2HA 3OECA 4W6ZA 2GGSA 4H16A 4IQ0A 3PFFA 4JIGA 2O4UX 4Z9YA 3K96A 2C29D 2NQ8A 3GVIA 3W4IA 4D46A 3GEGA 2DTDA 3AUUA 3KYCA 1KVQA 3QY9A 1U3WA 3UKOA 4EZBA 4EJMA 4CUZA 3QJ5A 4RVDA 5DCWA 3A14A 5I9NA 1YB5A 2JAHA 3NX4A 4R1UA 1N9GA 4ZQEA 1EVYA 2GO1A 2PZMA 4MP6A 3QWAA 1JN0A 1ZZEA 4G2NA 4GKVA 1QORA 3F5QA 4IS2A 2TMGA 3W4JA 3Q3CA 3ZH2A 1ISHA 4R69A 3SC6A 4Z0TA 1ZCJA 1VKNA 1BXKA 1U3TA 3W8EA 4MKXA 4CMJA 4FOOA 4BGUA 3IUSA 1M6WA 5HTOA 3H3FA 4XDYA 1MC4A 1VPDA 5HA5A 1E5QA 1H6CA 2D5CA 1P1KA 2JL1A 3GH3A 3I6IA 5JW6A 4BNIA 3DC2A 5J23A 5JY6A 1M76A 4JP3A 4GWGA 4NR0A 4XDZA 3OHSX 3JQBC 3LDHA 3ICPA 3OIFA 1PS8A 5ER6A 2NTJA 4J4HA 1C1XB 4A26A 3QA9A 3HHPA 2VNAA 1L1FA 2Y1DA 1R0LA 4G65A 4YJFB 1PQPA 4ZQGA 1SEVA 1BRMA 1DLIA 4J49A 4BKUA 1QLHA 3BHIA 2PNFA 4KWIA 5EINA 1HXHA 3PGXA 1DO8A 1CEQA 3NT2A 4B8WA 3E1KA 4IDCA 4PLFA 4Q3DA 4QFDA 4UUPA 3VTFA 4M89A 4BNWA 3HB5X 2Q2WA 4EDFA 3NTOA 3WS7A 2E49A 1HDZA 1QYDA 2J3JA 3OQBA 2B37A 7MDHA 3PLNA 1FDWA 1QP8A 1T4DA 4CLRB 4O0LA 5A5EA 3Q2KA 4BNMA 5KTKA 1LQUA 4J43A 3U09A 2FZEA 1I5RA 3JQGB 3GA0A 5DCUA 2YV2A 2A4KA 1ZEMA 3JQFC 1EBUA 4KOAA 4CM9A 5I8WA 3H5RA 3RJ5A 4GX0A 2HK9A 5I9LA 1BW9B 2V6GA 1ML3A 1EFKA 3JYNA 1A7KA 4O1MA 3F46A 1PGNA 5EERA 1B7GO 3H9EO 2PTGA 1EK6A 3HB4X 4NIMA 4PRKA 4WLVA 2W2LD 5TLSA 4PVDA 2H63A 1YO6A 2AE2A 4R5MA 4LVCA 4R9RA 3HDQA 1JWBB 4L73A 3BMQB 4MP3A 1VJ1A 5IDXA 1RM4A 4ND5A 4PZEA 4U7WA 2GSDA 1NNUA 1UP7A 2PKQO 2YFQA 3JQAD 3QVOA 5JCJA 1BVRA 1P33A 3IJRA 3QVXA 2P9GA 1WPQA 3ZWXA 3ZWBA 3JD1A 1IOLA 4K6FA 3AI2A 3GFGA 2IXBA 5HS4A 3BA1A 3IP1A 3IQDB 4FW8A 1HYGA 1VRWA 5BSEA 9LDTA 2FMUA 3VZQA 4M8SA 3LT0A 3COSA 1UUFA 1TT5A 3FRJA 1CWUA 3QRWA 4AFNA 4BKQA 4RCVA 2QRLA 4A73A 3ASVA 3OJEA 4IJKA 5JMWA 5JYEA 4X54A 3TQHA 1PJ2A 3VH2A 5T57A 2C07A 4FCCA 4DC0A 2QIOA 4UEKA 3SJUA 2DC1A 3GAFA 3O26A 4L4SA 2W2KA 1DB3A 1RM3A 1WWKA 4RF3A 1OZAA 2QQ5A 4GVLA 4XA8A 3TPCA 3JQCA 3TNLA 1X7GA 1N1EA 4OO3A 3JD4A 5L4NA 1PR9A 3FTPA 4GLLA 4OKIA 4ILKA 1EDOA 3AM4A 4LN1A 4CLOA 1PJBA 3DR3A 1NHWA 5DNAA 1EEHA 3PFWO 1Z74A 2P2SA 2PA3A 4CQLA 4PLHA 4ALMA 4MOWA 5DOZA 1MLDA 3PIIA 3JYLA 4W7IA 4TKMA 3IKTA 2C82A 2POQX 3S2EA 1HE4A 4WLOA 4Q3BA 2C7VA 2CVZA 2JHFA 3DZKA 3ORFA 3KSZO 5F21A 5L95A 2AEFA 1OC2A 4DQVA 1PZEA 5EIOA 4TKLA 4AG3A 1DLJA 5L7TA 2RHRA 1EDZA 2EJWA 2PFGA 4IIUA 3AW9A 1VI2A 2VT2A 4TRRA 4J7CA 2QRJA 3DQPA 4IDGA 4BNNA 1K6JA 3RVDA 1E1MA 3UFXA 2P91A 3IAHA 1NVTA 5BR7A 3MJEA 1DDOA 1KS9A 4KDFA 1PGQA 1N92A 4BGEA 3JQ7A 1UZMA 4R5HA 1YQXA 4EUFA 4D44A 3F6YA 1BXZA 1QYWA 1KY4A 1O8CA 1X0VA 2VRCD 1ZK0A 1ISMA 2WYWA 4C7KA 2DPHA 2YZ7A 5KIAA
chains in the Genus database with same CATH superfamily
1KZ7B 4IF4A 4LTMA 3LQKA 4CR7A 3LNTA 1ODFA 3QQ5A 3R6GA 1QUEA 1BJTA 3TNFA 3FOEC 4EEZA 4YJKA 3NUZA 2RHDA 4R98A 5KYNA 1EZ1A 4P36A 3PE6A 3AP1A 4Q9NA 1ZL0A 2ZI6A 2W90A 4J6EA 4RQAA 1A9QA 5FADA 4KMOA 4C04A 2BJWA 4CCAA 4ZYVA 2BFMA 4TYPA 4RA9A 2OSVA 5C8XA 1ADCA 5FBLB 2DETA 1WY7A 2C2YA 3I2FA 4OGLA 3QNMA 1HDXA 1UZAA 4W8OA 5FA5A 2IF2A 4BNHA 1JFTA 2WHPB 1P31A 2X3UA 3CJQA 5LQKA 1IMJA 1IOVA 1Z6XA 4LIPD 3UV7A 4YRFA 4DA0A 1GGVA 1UZLA 1BDMA 4WOJA 1EFVB 4M46A 3DZDA 4Z0HO 2YY6A 4FUTA 1Q7BA 3D8NA 5JSYA 3VHLB 1V7CA 1LU9A 4L9SA 3Q40A 1T9AA 4Q02A 4TXJA 2OVFA 3RABA 5HM6A 3SFVA 1DKNA 2PGIA 1KJ8A 1KARA 2ORYA 4N7RA 1U8TA 2AE1A 2HLNA 4EG7A 2QLMA 2R6JA 5DLDA 2MT9A 2NU6B 3RC9A 4FD3A 4EF6A 1MB0A 3ZGVA 5D84A 1YBFA 4F3KA 1NJ1A 2WIDA 3CUVA 3QI7A 3NDPA 1IWOA 3MMXA 1KAEA 4ZAGA 4DV7B 4K88A 1LPNA 1M2OA 1CY8A 5AM5A 2QA5A 5LJLA 5KJFA 2NX2A 5CG1A 2QT1A 5COBA 5ECWA 1PWXA 2E1RA 2ZWIA 3I04M 4Q7LA 3UOGA 4K6CA 5BP7A 1K4YA 1SY7A 1GU1A 1ZY2A 4BO4A 5DXJA 1MPXA 1JVSA 1KPGA 4L8VA 3QKUA 2NUAB 4C14A 5K20A 1VCHA 1FJGB 2VHZA 2OZKA 4HX2A 3RR2A 4CR6A 3LYUA 1XQ1A 2OG2A 5LXTF 1NN5A 1SAYA 2NIPA 3FPGA 4MRSA 1YVPA 4ZI2A 4QJ3A 3O4GA 4RGBA 4U00A 4YECA 4HOYA 1U28C 1KO5A 1DBQA 1G5FA 1HZJA 1VL8A 3PRJA 4JJ8A 1KMMA 1GAEO 4J1SA 2JDIA 1EH5A 1WTCA 1YTUA 2WRZA 3NOOA 1ZN2A 4TTTS 3WLSA 5KTPA 1QR6A 3PVCA 1Q7GA 2IIVA 4MA4A 1YRYE 3O4RA 3C8MA 4TV8A 5JNRA 1LB1B 3JQAA 4N39A 2ACWA 4D57A 3FB1A 3PC2A 2O8NA 2F00A 3OMWA 2FZLA 3QVWA 1GKIA 1THGA 1U02A 3P45A 1BA2A 2A33A 2EU8A 3SYMA 3U3MA 2FSGA 1MQSA 2IHZA 3GLVA 1RI4A 1DP4A 4C3UA 3ADBA 2PX5A 4LGYA 3VR4H 1EK2A 3DPSA 3SQNA 3EFBA 4FN5A 1ZRNA 4C1BA 1C7JA 5BN3A 4RD1A 1AK2A 1C9KA 3HJRA 4PC3A 4HXYA 4H60A 1ISJA 1AQUA 5ADHA 3ZWCA 3HJAA 3LUCA 2JJ2D 3R41A 4ZVTA 2DPMA 2ID4A 3HJHA 3HLKA 1TD9A 5U4XA 1XZDA 3LL7A 5BQ3A 1PNVA 3LAWA 2UYCA 2Y92A 5FB3A 4R1PA 1RTTA 2OK7A 3I4LA 2VDLB 1YJ5A 1LK7A 3RW9A 1IHXA 5HRUA 1U1CA 5A4IS 4NXNB 1KO8A 5CXQA 1WLYA 5C5DA 1CE8A 3LPMA 3PGMA 4ETNA 3OQOA 5HS6A 2HBYA 2Q4BA 1Q95A 3EXFB 1SN7A 3NIGB 4QHSA 5HFNA 4D96A 2EAUA 2JCBA 3EG9A 2PX0A 1W5FA 3KSBC 4TS1A 4C0JA 3GD5A 4H2DA 3S70A 4LHWA 4EJ0A 1L5RA 2H1SA 1NP7A 3BM5A 4RTLA 3DLPX 4XD2A 4PZAA 5A1TA 1XRJA 1DAFA 1EUZA 2ZAGA 1ITZA 1Y9ZA 4RORA 4MS4A 2O3JA 3M82A 1EG7A 3AV3A 2IC5A 1IN4A 1GVNB 2PIDA 1NUQA 1VIYA 4G4JA 4YRDA 2VQ3A 5FHRA 2PS9A 1PV4A 3MMNA 1CBUA 2QAGA 3HXLA 2XE6A 3L0OA 1YSCA 3F98A 4QYTA 1L8OA 1QYIA 1VZ3A 5GWXA 1J5EB 1V9LA 1A9ZA 1C0KA 1X1QA 1XJQA 2RI6A 2V97A 2X2FA 5GONF 3SPXA 4E5PA 1N33B 1CQXA 2OCAA 2IUTA 2G0TA 3NLLA 4INZA 1UDBA 3KDPA 3RYHA 1MQ9A 3ENWA 3UY4A 1VYUA 1OU0A 1W1WA 5CNJA 4MQ5A 2Q46A 5NULA 3CBGA 3UWKA 2QORA 3TECE 2R11A 1VPWA 1BXGA 3MMPA 2J3QA 1BOOA 1CIPA 3FDXA 3O8OB 1QXSA 4CHTA 2CBZA 1NVVR 2WFLB 3JSXA 4URHA 4F2GA 1C81A 3IAS6 1Z12A 2FZGA 5BYAA 2ZEJA 2HT1A 3HVUA 1JVBA 3IAS1 3S2GA 5I6DA 2FXIA 3VHXB 3H04A 3E35A 1KEVA 3BL6A 3SKYA 3W5JA 3PUYA 3SDSA 2BUCA 2FEKA 2XQGA 4FTWA 2XXAA 2GF2A 2WKRA 3QF4A 2ZYDA 4DDUA 3ABRB 1ACLA 3E7DA 3CA8A 3H8WA 4OD0A 4RTJA 1L7QA 1IVSA 2EHJA 2ORWA 2B61A 1A7AA 1CRZA 2G9UA 3R1IA 1ZW6A 3EEYA 1G3MA 2I3BA 1HORA 4J03A 3OO1A 2VLBA 4OK6A 4PHGA 2ZE7A 3L49A 3WTCA 3KELA 3A1EA 4ON9A 1S0UA 5DMHA 3K8QA 1AMOA 3IERA 4YCLA 3X0DA 2I03A 4DMMA 3QLVC 2PLAA 3U3DA 5JASA 4IP0A 2OCGA 4AMUA 2DU8A 2L2QA 3WQRA 4H0CA 4LJ5A 1IYZA 2EYUA 3D31A 2HJGA 2C7QA 2BFEA 1E0AA 4MKIA 1IU9A 1S9DA 1OT3A 2PRIA 1NKTA 1SOWA 2H2DA 4ADSG 3JAKB 3PDIB 5FTNA 2B7CA 5L3ZA 3THOA 4IDFA 2V45A 3AIMA 4DUGA 1XN4A 3GYGA 3LFUA 4WUVA 3L6RA 3ZDZB 1M1YE 4H35A 5FPPA 2ZIUB 1O1YA 4URXR 4KQMA 4MITA 3QSGA 16PKA 1DE0A 4MPDA 3P2OA 1EFHA 3P0IA 3NM4A 5IKOA 3AX6A 3NV7A 3LK6A 3S40A 1RXYA 4D1YA 1W35A 5LXTA 2IYAA 1COZA 3GJSA 4H7HA 5E7JA 3EWSA 2II6A 3EQ8A 1SD1A 1TUEA 5A3RA 5C7YA 3MBIA 4ZZ3A 3SHWA 2D59A 4GOKA 2ZTSA 1P4AA 3D3NA 3E3LA 2G1AA 4PZLA 3W7AA 4Z0NA 3P96A 4K9PA 3N0XA 4J75A 2IJGX 2VAMA 1WHTB 5DSTA 1XTRA 3IX7A 4U63A 3STYA 1QRSA 2GCOB 2GHRA 1QQ6A 2QDXA 2JRCA 1VB3A 1OFVA 5EIAA 3OURA 4MVYA 4JD5A 2DWOA 1WP4A 1G6HA 5FBKA 4IRXA 3RSZA 1TCCA 4B45A 2QE7D 3AMVA 4JENA 4TWRA 3IUEA 2ZULA 2AV6A 1H0KA 3EPKA 1Q91A 3NWPA 1W48A 3SBXA 2WD7B 1FBTA 1OWOA 1TO2E 2I4OA 2W83A 2VCYA 5AI6A 2H54A 1NTOA 4HN9A 4OXRA 2ZIZA 1SVSA 3OX1A 1XALA 3GVHA 5FPTA 3RIGA 1CFJA 4UULA 1EINA 2CZQA 1BFUA 4IFBA 3GLIA 4KPUA 3S1SA 2CNNA 4GMHA 2MYUA 2OBBA 3OC6A 1GL6A 4KQJA 4LYYA 1N6IA 4MJLA 3UV3A 4CG0A 5D3KA 4P84A 5LQUA 1NNEA 3RLIA 3F2VA 5CAEA 1P62B 3KEQA 1IZ7A 4WK2B 5EAIA 1NQAO 1RZRD 3KL2A 4L5CA 2J7PA 1N36B 1DWPA 2ZYTX 3A6PC 5KJ6A 4TS9A 1T9DA 1VHQA 3AUXA 3D6JA 3WYNA 4EVIA 5K8CA 2QX7A 4LF8B 4YAJA 5KVSA 1W4CA 3OCCA 3E9DA 4QEKA 3U61B 3RUIA 3HDJA 1ZC3A 3OE7D 3ZJYA 3ZEAA 1Y81A 1X8JA 2ODNA 2J3KA 2D1FA 4W1QA 2Y99A 2A9JA 3BXXA 3OZXA 1I5OA 1K63A 3R4CA 4JR2A 1NR7A 2QNBA 5AM1A 1KYZA 3V8QA 3RG2A 3WK7A 3WLLA 3HB9A 2DG2A 2I6SA 4FZRA 4ALLA 3DYBA 3M9WA 4UDYX 1T1GA 3T94A 1Z28A 4UDNA 1FNNA 1MX1A 4HN4B 4EHIA 4F9TA 5U1PA 1XEWX 4ZOEA 2HK6A 2YWFA 3WY9A 3ZI7A 10MHA 1UBTS 1A5TA 2VTKA 2ZUDA 3DUFA 3NYWA 4JGIA 4TROA 5GONA 1UODA 3AHFA 1OH7A 3G8BA 5HKLA 2RGGA 2FOXA 2WIBA 3C8HA 4BO5A 2NYVA 4HNGA 3ESQA 4F46A 1AH2A 2GCGA 1YU9A 1BX3A 3NKLA 3PYMA 4J1QA 3TW0A 4RXTA 3VZCA 2Q3FA 2J5XA 4IQFA 2HLHA 4QUGA 4YJHA 1UJ4A 3P19A 2PRJA 3BC1A 1HQKA 4Q18A 3HVJA 4EATA 1ZZGA 1E98A 2FRXA 3HFGA 2WINI 3KKQA 4IJUA 5HWSA 1YOVB 5JSFA 3MRTA 2BKAA 5HE8A 3CLUC 4IWYA 3QVVA 3E9NA 1G5QA 4F06A 2FMKA 1V3VA 3R74A 5JCOA 5E1OA 4DA6A 1W2WB 4S1OA 1PL8A 2EKPA 4NEGA 3BXGA 5I7RA 4A36A 1CRPA 1FQKA 1JMYA 1KU6A 2MSDB 2EBFX 4JODA 2ZAYA 4JQYA 2IXGA 3B2QA 2XMCA 4YRCA 3VO9A 4ZCIA 4LOLA 4L3WA 1OFTA 4ZCLA 1MAVA 2IKQA 4IIFA 4N7JA 2FZCA 4KKXB 2ETXA 2XCQA 4LVNA 3VX4A 1ML4A 5ITWA 2C3MA 1F4VA 1KRHA 2JJQA 2I7VA 2IZZA 2W2VA 1Z0SA 4RX1A 3E22A 4U5QA 4CVNA 4E5MA 1U9IC 3B1YA 1EDEA 1SXPA 2D0PB 2QX9A 1Y98A 3CE6A 3OP4A 3E05A 4PWYA 1G64A 1L1EA 4Y2GA 3IIIA 3RVQA 1V4VA 3MWDB 2WFAA 1HT0A 4JUAA 4YO8A 5EFZA 4BCBA 1YFJA 2C1EA 2I33A 2CY0A 1Z5VA 4RA6B 4ZV7A 1VMIA 5DNDA 4BN5A 1RZUA 2PXCA 3B2NA 5KJ1A 4EVQA 1DX9A 3L6BA 3M89A 2VQDA 4G5HA 3NVAA 5D2CA 3T5CA 3USES 5CA0B 3M1IA 2I3GA 3F5MA 1R6AA 2NVBA 4AIRA 4F9EA 4YP5A 2ANCA 2A58A 4GS5A 5E7IA 1I1NA 3B38A 1TQ6A 2WD9A 2YZGA 4ZT4A 2ZUWA 4O8CA 2COKA 3RS4A 1KJJA 2XQFA 3TR0A 3QBDA 3DVLA 4E2FA 4BV8A 2H9AA 5ALJA 2DWCA 3KLMX 3VU0A 2JD1A 2V3WA 3BTSA 3JWEA 5FHQA 1MOPA 3LYAA 1MRZA 3IDQA 1YR8A 4KL8S 4C0HA 4EY7A 2GWHA 3D3KA 3H2GA 1LSSA 3E03A 1F38A 1PR0A 3BHMA 2PKRA 3H13A 5CGQB 4N6OA 2VWGA 4Y9RA 1XTUA 1B1AA 3KTAB 5ALMA 1CK4A 2QJFA 4KP7A 2YUIA 5CW1A 1BNCA 1OMOA 4WMLA 4IIDA 4Q9IA 3S2UA 2BDEA 4OKNA 1QBKC 1PR1A 1Y1PA 1F51E 1OWMA 1ND6A 3CVUA 2LNDA 1WNTA 3NYQA 1YACA 2VPQA 1WW3A 3H97A 3I1FA 1QZTA 1WOYA 4R8RA 1CIJA 4UCFA 5ILGA 1PAUA 5ALTA 2VBFA 6LDHA 3EMKA 1DRWA 2BM8A 2A0XA 1BD3A 1XLUA 2NXCA 1GM5A 1KDZA 5REQB 1N5LA 4M0FA 2XUPA 5HE9A 2KBFA 3WGJA 3VPBA 1J07A 3WL3A 3EMDA 3WWYA 4YASA 3TJRA 4GBGA 2WJIA 1TADA 1TQDA 2Q3EA 2YJ4A 4URZR 3VVBA 3RU2A 3HBMA 4KN6A 3NTVA 2BZGA 1NVDA 4BYGA 2Z1DA 3DFZA 5A5FA 2HHAA 3BBPA 4NCKA 3TZQA 2ASVA 3IODA 1SXJC 2EEPA 1T5IA 1G6OA 2B0JA 2LV8A 1YRBA 3ELBA 3HYSA 3QVSA 4FJ1A 4OA8A 2QAJA 4UUMA 3B70A 2HEIA 1SUFA 2V5VA 2WUVA 1P2TA 3P26A 2F3UA 4I8DA 3WVNA 2HSDA 2DSTA 3AKEA 3ICVA 1T8YA 2IEBA 1WA5A 5JCXA 3QOWA 2WTAA 1TE2A 4WJZA 2PU5A 5K0ZA 4P0TA 5L6MB 8LDHA 3MG9A 2IZ5A 2QMOA 4PANA 1YZGA 3OEWA 1P7CA 2V98A 3PT5A 1B8VA 1RYFA 3AGQA 3ET4A 1D09A 4DADA 2YFHA 3A1TA 1VLZA 1T24A 1SHJA 1GFSA 1YC5A 4NMMA 3RM3A 2JHCA 3SC2A 5JD5A 2WK1A 3L40A 1E9FA 1WSWA 3IV7A 5I9SA 1MKYA 5F9FA 2W2MA 4AT1A 1AO0A 4AICA 1R4NB 4ZGBA 2HHJA 2HQ1A 4ODIA 1ND5A 1Y82A 1B3BA 2H2IA 3GMTA 4W5HA 1CY4A 3FMIA 1EP3B 1OA1A 5LQNA 2QLLA 1J9EA 3G0OA 5AK3A 3H1EA 5JBIA 1G9TA 3V4PB 1XLWA 1DJLA 4O5OA 2F59A 2P7HA 5CDSA 4KK3A 3NMUF 3B36A 1UMCB 5G0TA 1GZUA 5IC6A 2ANBA 1H3NA 2FOLA 1GNTA 4NJEA 1BX0A 4TUYB 3DMTC 2JA2A 3OEED 2R68A 1OPXA 4OLHA 1E1RA 1Y8RB 2PH3A 1KJZA 3I0MA 3ME5A 3F6PA 4I5FA 4QDJA 3AHDA 2XXBA 5SYMA 3WYGA 4DIOA 4EITA 3HLTA 2OBYA 5EJ8A 5KYUB 3RC8A 3AY6A 3DHEA 2CLMB 5AHRA 4YXFA 3ROZA 3GUHA 3D2CA 2O23A 3UFBA 2PM8A 3TGLA 1YI1A 4PLTA 4AWXA 4G1BA 5FWDA 1M1XB 1IK6A 3IP8A 1VKZA 4GPZA 5CLQA 4GLFA 4CLRA 3WGVA 2NP7A 4KBGA 2ILVA 4OXIA 4AJ4A 2WJ6A 3W2EA 1KJQA 2QUAA 3JQGA 1NURA 2ZJ0A 4LJ7A 4WZ6A 5JIBA 2HMVA 5G0VA 3KXPA 2VDQB 4ZRNA 3STTA 1NBHA 1V95A 5KYUA 1SGWA 4RUKA 4V3CA 5FAXA 1BW9A 3ELYA 3RG8A 5IM4F 4D02A 1I6WA 2Z95A 4E11A 4FHCA 3X1KA 2ZYGA 1GRCA 2HTEA 4ZIRB 3IAFA 3CWCA 4Z9FA 2GN2A 2XYQA 1T9KA 1NJ8A 3W9BA 3D7NA 3EDOA 621PA 1CEYA 1JR3D 1SVLA 1Z4KA 3EULA 3SMVA 2DHEA 1RXVA 1IY1A 5ALUA 1RXSA 3S3TA 4F2WA 1HTWA 2FPWA 4NX2A 2C0CA 1W36D 4BNXA 1M0SA 4U02A 3HJGA 2ONCA 4LWOA 4TL9A 3RADC 1J56A 4RGYA 4GM0A 4DHEA 5B3LA 3OMXA 2GILA 4AO6A 5ES3A 3TRJA 2RIRA 1OWPA 3BJRA 1K5DA 3ZIUA 3K0BA 4F1KA 4FW9A 3E8XA 4YS6A 3K6SB 4RLHA 3R8FA 1XZAA 2B69A 4QUAA 3I58A 1F48A 1RKBA 3EXEA 1ZO8A 2NMVA 4B7XA 1R0WA 1CJMA 1EX9A 3L0SA 1KI4A 1WB6A 4HJXA 4HLUC 1MT3A 2RH8A 4NCNA 2XTAA 4OI2A 5AH0A 2IS2A 3TLZA 1NNLA 3ZWMA 4CV0A 1EBFA 4DDVA 2ZJOA 4MKZA 2REBA 3O21A 3GJ7A 3FPBA 4W8GA 3V4RA 1QNFA 3WIBA 3R44A 4Z99A 1USWA 1A8IA 4WZAE 1X8XA 3IJEB 4AY3A 1ZH6A 2XQKA 1N3BA 2ISQA 1ZGZA 3JD2A 4ZYYA 4ZVKA 3IIMA 1MO2A 4EJSB 5KQGA 1UDCA 3X3HA 4M8LA 4R2WA 1VA4A 4OFBA 3C2QA 4OF4A 3DKKA 3ZHSA 2WAMA 4PNEA 4E2XA 2PFSA 1SR8A 5KPDA 3TIGA 3UTDA 4DLNA 2HWWA 1IN7A 1CJBA 1E20A 3GBVA 4B0OA 2Q21A 5HCNA 2QN9A 5TPWA 4B4UA 3WFIA 2PUGA 4M1YA 1U2EA 2OHXA 2IS6A 2DYKA 4UHEA 1U7XA 2J9FB 3WDMA 1ADJA 2RHJA 2UUCB 5M34A 4KEAA 4LYFA 3QUAA 4TM7A 3CVJA 1AQIA 3VXKA 2C88A 2IP2A 5EZQA 1V35A 1GDDA 1N6OA 2AMFA 3HCEA 4TN5A 1G8SA 1MR3F 1O94C 3DJFA 2V3VA 1WDWB 3MGAA 5LU9A 4G0VA 2BGGA 1N3LA 1FW6A 1IDOA 2HWYA 1TX4B 1W5BA 2W4IA 3K09C 4HPWA 3IDSA 4YVFA 4ARZB 4CR8A 5LOVA 2FQYA 3FPHA 4F4JA 3HMQA 4IJ5A 3KXDA 1ZJ4A 2IE8A 3G13A 2XZTA 2ZGVA 5CEJA 5LQCA 3KU1A 3BF7A 4Z0PA 1CB0A 5K2MA 1IM5A 3BL5A 5C52B 2ZTLA 2XNJA 1HRKA 3HNOA 4JITA 1RJGA 4Q4AB 4XX0B 5CVCA 3LGSA 3K70D 4I08A 1OAOA 5CMLA 3VTKA 1UQRA 4TTVA 2Q3DA 4A0FA 5CDTA 2C03A 4DWJA 4PBRA 3RTGA 4A15A 1MJGA 1Q1AA 1UM9A 1Z6QA 4EA6A 4IV8A 5BWNA 3BFVA 5EIWA 5K0EA 1Z2AA 1F2UB 3CO5A 1V16B 1LQTA 3PA8A 5B7PA 3H1BA 4KI0A 2OHJA 2OPBA 4Z7QB 1R12A 2XWQA 3CLTC 4U2KA 1XSEA 3H5IA 2X1HA 3REGA 3NCTA 1EVJA 1DXOA 3MN1A 4RCZA 3C7AA 4DV2B 4OQFA 4Z3DA 3LECA 2BWJA 1JX6A 1N75A 1GT6A 3UXYA 1FMFA 2J87A 3H2SA 5IVIA 1O94D 1ZXXA 3F7NA 3G0IA 4NCHA 3WMXA 2IEAA 1UPFA 4RD2A 1QS0B 3MFYA 4RH1A 2JBWA 3FYUC 3Q7TA 3WLEA 2GOYA 4DSZA 3U4QA 1N4AA 1HE3A 4WN9A 1WMBA 4X1YB 1XCOA 1F2UA 1PR2A 2CB9A 1IK4A 3AW8A 3PJFA 4G5XA 4RKRA 3VISA 4B47A 1J23A 3M6MD 3QE0A 3EHEA 3BTOA 1LDMA 1TTQB 2OZPA 3N28A 5FQNA 3JYPA 4XH9B 2O2JA 1XZMA 4F8YA 2V7XA 3AKDA 1VJTA 4JI5B 3UVEA 4DNPA 1D6JA 4HG2A 4OHKA 1KEWA 3SAJA 1S7CA 4ENUA 3TMYA 1DEXA 2GNOA 2BEVA 3GN1A 3L46A 2D74A 4FKMA 3OZUA 2FPGA 5IM4A 1N77A 4YWHA 5E6UB 2V03A 4AYTA 2Q6OA 2BHSA 4JUCA 1XUOA 4H3VA 2QD4A 4PSCA 4X1YA 3OOEA 5C51B 2ZXUA 1XFDA 4K2HA 4RTRA 2Y0EA 3E6AA 1NW5A 1WXIA 4ZJUA 1IEQA 2ZUUA 4N1AA 3IJ5A 3UC5A 3AUTA 3EF1A 2EWMA 2FN9A 1N0IA 3LSTA 3V6MA 1W75A 2NXWA 4NMHA 4UTXA 2QVYX 3PUKA 1Z47A 3TB4A 5JJIA 5CNMA 4GNRA 4BNKA 5JR3A 3FWNA 3OX4A 5B64A 5I47A 3GT4A 4LHVA 5K7SA 2Q07A 2MMGA 1Z0IA 2JCSA 5B4TA 3PWKA 1YBMA 3O73A 4K2AA 3JYQA 1A82A 3WXBA 3ZCUA 1DRJA 3T5PA 3FR7A 4NAHA 2QQGA 4PLYA 3Q8LA 4YUAA 4XD7D 4YCSA 3EQ9A 4MHSA 4E5NA 3SLKA 4ZMBA 4CKWB 2UZ1B 3GT7A 4JCOA 5I9MA 1I1QB 3GV0A 4KR2A 3PEYA 4CNQA 1E3DA 5IBPA 1CY2A 1OU4A 4X20A 1RWOA 1LDGA 5AJZA 3BMOB 3WNVA 2O07A 3RO7A 1P0FA 3PHLA 1VIMA 5A03A 1WEKA 2AMLA 4FZ5A 3ZV5A 4S1TA 3LWZA 1TYDE 4O3FA 1U2GC 1SKYE 2RGXA 4ZCTA 2FZ5A 3IRVA 1QF6A 3BIOA 3TAUA 1EK1A 1NLYA 1UWLA 3FFBA 3N2GB 3OJFA 2CHEA 4UAUA 1I0IA 4QNRA 1VE6A 2JGJA 1VE7A 2Z4TA 1M1YA 4HDAA 1G4UR 4NRDA 3QGMA 1M6HA 1SC9A 3BXFA 3GEHA 1BO6A 1WMAA 1JLMA 4OI4A 3WGLA 1HSOA 4FQ5A 3P20A 4M3NA 1FE8A 1NMSA 1SQ0A 3TCNA 5P8WA 3VTZA 5JAQA 4O6VA 2HMSA 3O7MA 1KEEB 1P80A 2A94A 3N2GA 3OPVA 2C94A 2OO7A 3UGQA 3N2EA 3ZLBA 4RTSA 1GQOA 1IPHA 2GARA 3MUNA 3EGDB 1T10A 1QCCA 4KR3A 1F06A 4DQKA 4MHTA 1CUJA 5JCZA 2QVXX 5JRDS 2BFDB 4KUGA 4QU5A 5E95A 1KDPA 1LF5A 3KOWA 3RIMA 4M99A 2CLSA 3T7KA 3QFHA 5LQAA 2PUBA 1P4GA 2OZLB 3AVOA 1I80A 3R7BA 3UG6A 3ZGYA 3K0AB 1M72A 1CNMA 2JLSA 2ZPTX 2FHSA 4EI2A 3CLVA 3MIZA 1NFFA 1WXQA 4IZHA 5BORA 3GJYA 2P8SA 2OQ2A 2C9ZA 3JVVA 4ZAZA 1DUIA 4A5OA 4JB8A 4BO9A 1CDDA 4B6QA 5CCXA 1C0IA 2M2IA 1J97A 3U3OA 4OHRA 3KOZA 1QE0A 1YKGA 2WAYA 3FJOA 2AZ4A 3H2YA 3IFSA 3IULA 3RS7A 1C0LA 3W4KA 5AVUA 3OIDA 4CIAA 5ICMA 3AKCA 2D4AA 4TXNA 4OX9B 4INAA 1V96A 1E0JA 1X3LA 2WF5A 2G7MC 4QPDA 4F7WA 3RWMB 5C8VA 3QI2A 2ECOA 3W1WA 2J0QA 1QTNA 1L9XA 5TY0A 3VYSB 1EB8A 1U0GA 1UOPA 1CY1A 1JILA 3PD1A 1L6RA 1LPSA 3NG1A 3PPVA 4HQ6A 2GBPA 1TAGA 4QWWA 1XCGB 1SUPA 4C08A 4F4UA 5K8TA 4KE8A 1L5VA 4UARA 3VVMA 3ZDEA 4UEOA 2XMRA 4YMHA 1RPZA 4IZIA 4BQRA 3QJYA 2C83A 3CCBA 2HWXA 2X77A 2GQ0A 1U6JA 3E9EA 3OLXA 4L4XA 4CCSA 3T3IA 3FHLA 4B17A 4YV1A 5JVDA 2WJGA 4BL5A 3AEUB 4D4LA 1X1EA 3UJHA 4C89A 1MHTA 2GM4A 2C2GA 2CHFA 1FTWA 4GOJA 5C4GB 2L0XA 2NT4A 3K4PA 4KQ1A 2WWFA 3RYCA 1CZUA 2BAGA 4Q66C 3OIVA 4Q9JA 4DIFA 2YWHA 4Y6GB 3VSAA 3V4FA 1HGXA 2F43B 3OT1B 4LHZA 2ZUTA 3D7LA 3DM9B 1BDIA 1QPZA 2FAXA 3A4TA 4AQ7A 4Q12A 2OHFA 2OFWA 4M36A 3TW8B 3K72B 3CRNA 4CKCA 4F1WA 1Z0JA 3E5MA 4M1ZA 1RE0A 2QN7A 2YXPX 3VPHA 2ZUFA 2IU3A 3LC7O 3CRVA 2PD3A 2HA3A 3F74A 3R3VA 4ER0A 5BWMA 5I7OA 5IVHA 2X8LA 3EDQA 3KHKA 1GZ3A 4J0CA 2BR4A 1ISIA 1JA1A 2COEA 2BISA 2WFMA 3MJ4A 2QENA 3ZOKA 2P30A 1NMZA 1USIA 4R41A 2Z5LA 1KI9A 3LU1A 1WXFA 1Q92A 4MYUA 4RZXA 5FI5A 5SZHB 1RRMA 2F8TA 1UH5A 4RVCA 3Q3JB 3PXAA 5IWCA 2C9DA 4IMJB 4NYJQ 5H4GA 4AJLA 4UHKA 2CL5A 5LFAA 1ZC4A 3VU1A 3LHFA 4TT8A 5DCLA 1WXHA 4LTDA 2QMEA 2PYIA 1M2EA 4JT8A 5I01A 1F9EA 5FFFA 3NORA 2WT9A 3QIAA 3T8YA 4FE7A 1FB5A 5J40A 4IEEA 2JH8A 1XJWA 1LI5A 3CEJA 1S2IA 1UCFA 3E7PA 3Q3EA 3R5SA 1Z4PX 3A2LA 3AVWA 4HGZA 2ZVDA 1O95D 1LD3A 1D04A 2KMLA 3B7WA 2EKDA 2J3HA 5I7VA 1GKKA 1Y1KE 4FNAA 1CZOA 2E6UX 1ES9A 3HB7A 3U60B 3PQDA 3CVVA 5HIAA 1OILA 4RY2A 3DVRX 3H9JA 2VI5A 4R9SA 3L02A 4XM2A 4QXMA 2I6XA 4GDMA 5EP1A 3GG2A 4BGIA 1U8ZA 4RFSA 4J0HA 1RQGA 4P9NA 4KH1A 3WNQA 3C85A 5HIMA 4FNGA 3AB3A 4BMZA 1HL3A 4RY9A 3EBOA 1LLDA 4RVGA 3C6MA 4FGLA 2PH1A 2RH5A 4IGFA 1IUOA 4QXQA 4V3BA 2AXPA 4RESA 4CG2A 1RYHA 4E2WA 1QRUA 4LZJA 4U9IS 4EZEA 2KLHA 5IHPA 2IHJA 4AKEA 1MP0A 1W6UA 3R5XA 1QP7A 2DFPA 3GRKA 3E1GA 4CDNA 3OFND 4PHFA 5FTMA 1ZKMA 3OQJA 2HA6A 2AFRA 4M1EA 5G1OA 2ZB8A 2EF1A 3A8TA 3KD3A 4IIJF 4JL8A 5E9QA 3ELWA 5IDQA 3HPQA 4CF7A 2ZRJA 3U31A 3WKDA 4AKIA 3L8GA 4L02A 1WQ4A 4A23A 2ZWVA 2ATXA 1L7VC 5CG2A 4AY2A 3CLKA 4WW0A 4D99A 4ARIA 2FI1A 3EIHA 2QXYA 1NXWA 4E6EA 4OXKA 1N2SA 3VOBA 1WZCA 3E15A 4CM4B 3ZNNA 2QJWA 4EF5A 4LDAA 1RYMA 3LPLA 2C57A 3MB8A 2WJPA 3LQ2A 4U7TB 4IHAA 2D7DA 1D8AA 2RG1A 3ENZA 1UPXA 1ZL2A 1F2TB 1FRNA 2EF0A 4X61A 3ZDQA 1W7AA 3ZD7A 2W2PA 4LK3A 1E7MA 3R7LA 1WF6A 4FHZA 3VI3B 1TEXA 2VDNB 3A4VA 2CMHA 3VR6D 4H31A 1VIDA 1Z07A 3ZJTA 3WSVA 1F12A 5I45A 1AQNA 3T1TA 3IELA 3WWCA 4DBLE 4OFWA 4J9UE 4CM4A 2C5FA 2XUJA 1MIOB 3FCCA 4I8IA 1H94A 1E2KA 2UVPA 1U2DA 1JHAA 3FLAA 2O52A 2PJUA 2AR0A 1E3EA 3PFKA 4XQ0A 3KZOA 5MFPA 4BE7B 4CUKA 2PYDA 5LZ4A 1EE2A 1XIVA 4RAQA 2H51A 2MSKA 3JWIA 2PKYX 4V0KA 4URVR 4RHEA 5A4KA 1B0PA 2HUNA 4RHFA 4FDLA 2JIMA 4L2IB 1TO1E 4NMXB 3IKJA 3SQXA 1WF3A 2P9CA 1Q17A 2Z6VA 3NVMB 1UOQA 2XDWA 2OO5C 1NR5A 2Q4OA 3AONB 4KVZA 4KNWA 4D9BA 5JAPA 5TMPA 1HFEL 3KQVA 1P5JA 2IYFA 2E3JA 2H2AA 4G3XA 1CUHA 1RAEA 2CNDA 4HH1A 4NNJA 4WHMA 3AF5A 5DHUA 1ZXBA 2QPLA 4KRFA 2GD6A 3I92A 2IY7A 2OK8A 3R0XA 2J9ZB 3UUGA 2GNAA 3I6MA 4KGXA 1QOPB 1U9CA 2RHLA 3KV3O 3CNLA 2Q2OA 3R5KA 1S2MA 1JLLA 2OAP1 3EXHC 2QW0X 4G1CA 5J2UF 1B42A 2GXAA 1J2TA 2HXSA 1F5SA 4N8EA 4AP6A 1SBQA 2BKXA 3IHTA 4HXEB 4LXHA 2V7EA 3AQIA 4NBWA 3CTPA 2QUBA 3HV0A 4LMPA 4WNAA 1W29A 4E2YA 2AFIE 1A50B 4F4CA 1N8KA 2BGJA 3PGKA 4PLVA 1AXEA 2ZJYA 4QNNA 4PCAA 4ENPA 3ZDFA 3A2NA 3JASA 1ONOA 3HXTA 4CUJA 1A9PA 1DELA 1VYVA 1K9VF 2RHTA 2A1UA 3AZOA 4AWBA 4B71A 2CJWB 3A1VA 4ZU1X 3UMMA 2D6FA 3U3RA 4PXAA 1GTJ1 3G2PA 4NATA 3S1AB 3PX3A 4KCGA 2DQ4A 3GA7A 3O75A 4OQ4A 5AXCA 1GZSA 2OXRA 5KYWB 3REFA 1XLTC 4LHSA 3RIXA 1M2NA 3C3YA 1ZGHA 3GEDA 3KKNA 4M83A 1KJWA 2OBXA 3MT8A 1GNVA 3AVQA 4O25A 4C3VA 4RSRA 4P22A 4NF2A 3LDGA 4CETA 4I1VA 3AVTA 1A71A 4IVNA 1MF7A 1UBEA 1ZUNA 4WK0B 4HKTA 3EMBA 3ZHBA 3ZWYA 5E3IA 2IXFA 2XDQA 1V4BA 2X9VA 3HA3A 4LRUA 1V37A 2VJBA 2ZUVA 4IIJB 4WY8A 5CD1A 2XHEA 5M29A 4CFSA 2WTXA 2XT9A 1CQZA 1SHKA 4AK9A 2BEKA 2P0EA 5EMKA 4ZK2A 1P7WA 3TLAA 1GV0A 2GAIA 2YOGA 3OZ7A 4K9RA 5B3AA 4BTLA 2IF0A 1AO3A 2A5JA 3QK7A 2O8FB 1K89A 3CEAA 3RYTC 3UHJA 1FX1A 2IY9A 2I8AA 5C1IA 3LBYA 5WRFA 3RKSA 3F47A 4CHGA 1Z5WA 4A0GA 4CMHA 5JI2E 2PFKA 1DTWA 4CTJA 4IIJA 2QX6A 3V80A 2O2CA 2Q1UA 4Q7EA 3PKIA 4W9NA 5CDGA 4XGQA 4K40A 2NADA 3F4LA 4W6QA 2BFAA 1MO5A 2Y2VA 3KAJA 3RTAA 3ZE0B 5A04A 2VAWA 4E7PA 1NF2A 4FONA 3WRVA 3F6BX 4DDMA 2JGLA 5KSYA 4JUIA 5AKZA 3V7UA 2JLXA 4J0JA 4KB5A 4YV0A 1MBZA 3TGPA 2O8FA 4K46A 2ZUBA 3T1OA 3B6IA 3DF9A 1I3LA 4ZO6A 3L1JA 2WILA 4HK4A 3VPXA 5HUHA 3D6VA 1F0YA 5CPFA 3F97A 1BQ4A 5B53A 1Z5UA 2QLTA 4MW5A 4R0NA 3S2FA 2P9TA 1W2HA 2DULA 2VJMB 3VH1A 3KCQA 4DR6B 1ZOOA 4KAFA 3T61A 3TR5A 3GAZA 3B9QA 5JC8A 3KETA 4ETIA 3FUVA 4RD4A 1CYDA 2IYTA 3W1EA 3ID6C 5I8PA 2FMHA 4XOUA 4DA7A 3EWIA 2FPMA 5EE9A 4LRQA 3E82A 3Q0EA 5LKAA 1NW3A 1HLFA 5FUMA 2VH5R 3RJMA 2XB2A 3P0EA 3VAZA 2JAWA 3LRXA 2I6UA 4O4IF 1NHGA 1OLSA 1UEXC 4N6GA 4R83A 4TLMB 5FBHA 4AP5A 2I4NA 1XTKA 4YI3A 3THSA 3W5UA 3X2SA 1ZGCA 1A9OA 1KH1A 2A0WA 5I5GA 2OQRA 2VPYA 2J0SA 4Q3AA 3GP5A 5CFLA 2WJWA 4LJ4A 1JDNA 5CVJA 1DU4A 4HATA 4ZOLF 1V8ZA 1C9MA 1WD7A 2CN1A 2I54A 4RJKA 4UVDA 5K0NA 4A3SA 1D2AA 4Z5XA 1I4LD 3GZTB 2XRZA 1SIOA 4OJMX 4JI7B 1SVOA 1VLVA 4GZ3A 3NEJA 2ZBPA 3OE5A 4UMDA 3SYTA 2P5UA 1EX6A 2MHCA 3PUXA 1GVHA 3TZEA 3ESBA 4CLDA 4LY3A 1T4GA 1ZWKA 1Q3TA 4ZVRA 4KSYA 1U2TA 4IKEA 1YF3A 2YY5A 2PUEA 1O03A 4P0QB 4AZ0A 1GCGA 3NHLA 4GAEA 4DWVA 4EPWA 3CH7A 3N74A 4G1FA 4Q24A 4C05A 1FS4A 2DUNA 1BU5A 1E9CA 5AI8A 4QYIA 3HCDA 5J2UA 3V7WA 2Q5JA 2QGNA 2CMGA 2VSOA 4IDAA 1CHNA 3DAGA 3TLXA 1NBMD 3U4CA 1FLVA 1YKSA 2JHPA 3JAWA 4MV7A 1CUWA 2OILA 5H82A 3H16A 2HSZA 2A1IA 1FXWF 3CR3C 2G9VA 3PIRA 3AR4A 2CXRA 2I2DA 2WSYB 2PN1A 1E7QA 3SBOA 4OPMA 1OIXA 4KQKA 1HF3A 1QGUA 4YJDA 1R6DA 2BP7B 5EUMA 5TNXA 3ZQJA 3PLRA 1N5DA 3G5TA 1JQEA 3FKJA 5K09A 3QW4B 4G1MB 2I65A 3MQFA 3NKFA 3EY4A 2OHHA 5LCXA 4M0LA 2QOEA 1NNI1 3FDZA 1RD4A 2NWQA 4UHDA 4PAWA 5E9AA 5C8DA 4XLZA 5BUSA 3RAPR 1JAYA 1X9IA 3D6HA 5EXTA 2BZ1A 3D0KA 4BZWA 5EESA 1ZSVA 4YP1A 1BH6A 2HO4A 3KVOA 2W00A 4ZHQB 4ENWA 5IWAB 4ALKA 1I01A 1T1SA 5FV7A 4OMUA 4AM8A 1T6ZA 4JYMA 4U1RA 4TSKA 1KS2A 1SZDA 4YRRA 3RB8A 1M7GA 4V0LA 2ZQ5A 2W98A 1E4OA 2J3IA 5EKUA 3WZ2A 3RAEC 3ESDA 1ZMBA 4DQXA 3CEPB 1AM4D 5EWLA 2FZVA 1JAZA 5DK4A 3FTCA 2HMYB 2V7TA 1EUDA 1U6IA 3MXOA 2J07A 4HDMA 4TVBA 4AZVA 3WL5A 3SR4A 3GMIA 2QRZA 2EJTA 1E2PA 1L8QA 2I62A 1DXYA 1J0XO 3AETB 4BFWA 3Q41A 3R76A 3P0FA 2Q1TA 4KN5A 4TLLB 3ZHCA 1JA0A 1AS3A 4PC7A 3SBEA 1Q0LA 1WZEA 4A10A 3LGXA 2JBAA 3HSYA 4WKNA 1NXSA 1NDUA 1PZFA 1YS2X 4RKFA 5AJTA 4EKNB 3Q8KA 2RH4A 3T3EA 1TRKA 3E0XA 2WHEA 3I6YA 4LXYA 4B2PA 1LY1A 2OWEA 1C50A 4C29A 3KSAC 9ABPA 3ZLVA 4C6HA 1QZ3A 2CSUA 2OFPA 4Q82A 1Y6JA 3P9CA 3Q4GA 2FKAA 3HUEA 3O8LA 1PJTA 4HPJB 1YB6A 3WE7A 3ZCQA 2MIIA 1EESA 2R87A 4MR9A 1Q1BA 2X8JB 3EVCA 1Z5PA 4PFKA 4XZ3A 5P21A 3TD6A 4HPXB 4UE6A 4G01B 2HIHA 3UK0A 1N2XA 5JAMA 4FS3A 1FLDA