4CQLB

Crystal structure of heterotetrameric human ketoacyl reductase complexed with nad
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
227
Chain Sequence
HHMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords ESTRADIOL 17-BETA-DEHYDROGENASE 8
total genus 63
structure length 227
sequence length 239
chains with identical sequence C, F, G, J, K, N, O
ec nomenclature
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cqlB00
1VJ1A 1I30A 4BGVA 2GN6A 3GVCA 5L53A 2NTJA 2FPIA 2NADA 3KLPX 3CE6A 3BTVA 2DT5A 4WE3A 4Y6RA 3W8FA 5C7LO 3GF4A 2R00C 1U8XX 4MVJE 3WFIA 3OIFA 3JYOA 2DUUA 3AUUA 4EUHA 2D5AA 4MINA 3B1KA 3NV9A 3OA0A 1GUYA 3MJSA 3PYLA 4PG8A 5TRTA 5C37A 3WBFA 1P9LA 1NTOA 2XPCA 4NJOA 1DOHA 3H65A 2FY8A 4I5DA 1NASA 3GRKA 1HZZA 2DUWA 1CJCA 4PCVA 1C0IA 3JQGA 5C3MA 4BMNA 3HB5X 1DHTA 4IIUA 5AYVA 3N74A 4MIEA 1ZFNA 3WQQA 4DXHA 1I3MA 3VH2A 3ONDA 3Q0EA 2Y68A 5G0UA 1E1MA 1FK8A 4E3ZA 3Q9UA 3NT5A 2DM6A 4BNWA 1MFZA 4BOYA 4QUKA 4J90A 5BQFA 5KOIA 4WOJA 3JD1A 4ZD6A 3JV7A 4K26A 1EE9A 3LSYA 1BTOA 4CL3A 6ADHA 2J6IA 4D46A 5EINA 1B8UA 1BDMA 3GHYA 1PGJA 2AQKA 1NWCA 2CF5A 5K6AC 3MEQA 4O6VA 5TJ9A 4JQCA 1PZFA 1ADCA 1O8CA 1A27A 1R37A 5A3VA 4ALMA 4C7KA 1IZ9A 5IDYA 1KVQA 2HKIA 3V2HA 2O3QA 4AJ1A 3UXYA 5CDYA 4UAGA 4PLYA 3PDUA 2X23A 3GGOA 1QRRA 5CEEA 1ONPA 3RUDA 3OJ0A 5IXSA 2ZB7A 2QRKA 3DC2A 4J4TA 5TF4A 1IUKA 3JQGB 3ZWXA 3DO5A 1R6DA 2GERA 4XR9A 2D3TA 3FNHA 2NWQA 2JL1A 1PU2A 3GVPA 4BO2A 1JN0A 1I2CA 5G4KA 4BQPA 3BMOA 4E13A 4TROA 4I5GA 4YAEA 2QYTA 1QP8A 2BD0A 4IJKA 4G2NA 4KTTE 1HYEA 2DKNA 3LT1A 4RVDA 4J49A 5FFFA 1HE2A 3NDJA 3OECA 1H94A 3ST7A 1WW8A 3BMNA 3OHSX 4A7PA 4YRAA 4CLRB 1V3VA 4WCFB 2O50A 4RPHA 4XIJA 1ZKMA 1U5AA 1VC2A 2E48A 1P44A 1F12A 3WTBA 1IZ0A 1L1FA 1A71A 1DBVO 3CINA 4A0SA 4BNHA 1Q7BA 1UP7A 3WSWA 4O5OA 2J3JA 3GMDA 4RL6A 3GDGA 4O0LA 4CV1A 5HRUA 2WEKA 4EEZA 4Y9DA 1T2CA 2OBNA 1JWBB 4H16A 3RSHA 3WMXA 1FMCA 3ZW8A 1WXDA 1IL0A 3QA9A 1YBAA 3DZGA 1ZMOA 5ILGA 3GG9A 4FFMA 3DZKA 1XHLA 4PG6A 4D41A 1O0SA 1L7DA 3MZ0A 4RO0A 1NVTA 1UP4A 4MVJF 4Z0PA 4R69A 3DAGA 3DZBA 4IXTA 2G82A 1ZK3A 3S1LA 2I5PO 3LLVA 4W6ZA 4J2OA 3GDFA 3QVOA 3VHRA 3BZUA 4WASA 1KY4A 4YBZA 1T1RA 4FCCA 4FQ8A 2CD9A 3DONA 4JBIA 4YT4A 4ONEA 4L75A 4ZRMA 2BMAA 1XU7A 4PG4A 1V3UA 1LDGA 3OQBA 1E1LA 3ZNQA 4AJHA 4DTIA 2C7VA 1RM3A 3F9IA 4K28A 3MTGA 3TZ6A 4XB1A 2YYYA 1VE9A 1I3NA 3QVSA 4WCDA 2OP1A 1QYVA 1VLLA 3VPXA 4CMGA 2ZTLA 2Y66A 3JSAA 1DJQA 3KSDO 2JFFA 2NVBA 2GCGA 3B20A 4H7PA 4UVIA 4W9NC 3C7AA 1UDBA 4OXKA 3CUKA 2OZPA 3RBXA 4XYMA 1DC3A 2Y1FA 1AHIA 1LRJA 1FJHA 4YAKA 2ZTMA 3WDSA 4MKZA 4D3SA 3AOEC 3G1UA 2LDBA 2EW2A 2ZYAA 4ZVVA 4U6SA 3W8DA 5IFLA 1E3WA 4CMIB 1KVRA 3W1VA 3GY0A 1X15A 3I1JA 2QQ5A 1PJQA 3BMQA 5IDWA 4KDFA 1I01A 3DTTA 2P68A 1XIVA 3RUIA 3AUSA 3I9NA 2PH5A 3C1TA 1R0SA 3CXRA 4PZDA 4XGNA 1FDTA 3TFOA 4PIVA 4F6CA 1L7EA 3TQHA 3KM0A 3GN2A 1ENZA 3GMSA 5C7OO 4L8VA 4EUFA 1SB8A 3H7AA 3PYXA 4G5HA 4TZKA 1YB1A 2YQ5A 4M54A 2GN9A 1U3TA 4N5NA 4KQXA 1E5LA 1PGNA 4GLOA 4RPKA 3FNGA 1MG5A 4CLEA 2X86A 4P4LA 1PQWA 5DOVA 2OUIA 4A10A 3E5MA 4WNCA 4B79A 5KVVA 2VTEA 5H82A 4Z9XA 5GZ3A 1PWZA 1ID1A 4YJDA 1RM5A 3DZIA 1V3TA 3WOHA 5A9SB 2Z95A 4LCEA 5TSDA 3EUWA 4QECA 2F00A 1LLCA 2NNLD 4FB5A 1RPNA 5ENVA 3U49A 5KJCA 3VVCA 3WSVA 4HNGA 3TFQA 4EEXA 1B15A 5CDGA 1YDWA 1PIWA 4FJ0A 5KNLA 2PGLA 5A9TA 4LSWA 3GLQA 3WWZA 2NSDA 4IDEA 3IKVA 4XYEA 4CM3A 3SEFA 4IDCA 4O59O 4M49A 3V2GA 1XWFA 2YHIB 4DIBA 2UAGA 3PTZA 5JSFA 4GX0A 1Y5RA 3ZCXA 4GWGA 1M6WA 3EZYA 3RU9A 3D5QA 1X13A 4J16A 3WGHA 2BGLA 3KYDA 4JXKA 1HE5A 2G76A 2YFQA 4WKGA 2D1YA 3RUCA 4AJKA 1HDGO 2DBZA 3PQEA 3RKRA 1YBVA 3RC1A 2VN8A 1BDBA 4P38A 1FDUA 4BB5A 3U3XA 3KBOA 4RZHA 1U1IA 4RVFA 4LN1A 3A1NA 3JQAB 3WQSB 4IDDA 3AW9A 4ZQGA 2VOEA 4CV3A 3HUDA 1O6ZA 3WGYA 1SMKA 1E1NA 3WJAA 4NFHA 1KC1A 1HYGA 3OQ1A 5CPFA 3H4VA 4J4BA 1LC0A 1Z73A 3DB2A 2WSBA 3TPCA 3HDYA 5LDHA 5ILOA 4Y8VA 1YQXA 1QYXA 4C7JA 4GPD1 3PZBA 4U5QA 2AQ8A 4N5LA 1SEVA 2AW5A 3LLSA 3H8VA 4JLWA 1E6WA 1VSVA 4LGVA 1M76A 4A26A 4EJMA 2HDHA 3KETA 3L4BC 4MIOA 3BMOB 4BV9A 5K0ZA 4GL4A 2VWPA 5K6AA 2O7SA 4B7CA 1QV7A 1AHHA 4UUMA 1Q0HA 3KEQA 3O03A 4CMCA 1C1XB 1SAYA 4FFRA 2OO5A 1F06A 1ENPA 2GNAA 3G1TA 4E12A 1NQ5A 1J4AA 2X1HA 1ZBQA 5JAMA 2EKLA 4DQUA 4I9HA 3FBTA 1ENYA 3KHUA 4WCFA 1HL3A 3GZNA 1YL7A 5I9LA 4TRRA 4BNZA 4R1NA 1HDRA 1GTMA 1OI7A 2X0RA 2NTNA 1Z82A 3IIEA 1MP0A 3KYBA 1U7HA 1QYDA 2H5LA 3RUAA 1EDZA 1PJTA 3PP8A 4IDBA 1KETA 2WYVA 3JYNA 1E3IA 1DIBA 2IXAA 5FWNA 3D4OA 2VYVD 5DP1A 3WJ7A 4U6QA 4B7XA 1D4FA 1UXIA 4ZQHA 1BXZA 1OC2A 2Y93A 4HY3A 3TL2A 3ZU4A 3AUAA 2BHLA 1EUDA 2AG8A 2GF2A 4NG5A 1V8BA 3JQFC 4BL5A 1UJMA 4PLGA 3HNPA 4R1UA 4CQLA 3NJ8A 4M55A 4IGFA 3JYLA 3CMCO 1N7GA 4K6FA 4OJNA 5DZSA 2NVUA 3ZWAA 3DAFA 2DU8A 1PX0A 4CV2A 1HWYA 1V0JA 4AG3A 1C0KA 3W6ZA 1SPXA 3BTSA 4U8GA 3NDIA 1NAIA 1ZCJA 5EJ2A 2OMEA 3VKUA 3DHEA 3TNLA 2RBEA 1MV8A 3GUCA 4L9RA 4DPKA 1PL7A 4PN3A 1V6AA 1SCUA 1NXQA 3ADPA 3NTRA 5ER6A 3M1LA 1OMOA 2UYYA 3SXPA 3ANMA 3RD5A 1Y8RB 4XGKA 1ADGA 2X9GA 3ITDA 4XQ9A 3ROQA 4ND3A 4GMGA 2FMUA 3ZWMA 3UCFA 1NAHA 2UUOA 3GPDG 4R4JA 4ALIA 2Z5LA 3P7MA 4U7WA 5MGBA 3UVEA 3WB9A 1EVYA 3PJEA 5KCZA 1T1SA 1P45A 5EIOA 3E9MA 3WLEA 2PH3A 4TQGA 5A05A 3NEPX 1JAXA 2WJPA 4WEOA 4DIFA 4DQVA 2UUPA 2CVZA 2DQ4A 2VNSA 5U4QA 3TOZA 4RJTA 3R3SA 1GEGA 5COBA 5BSGA 5JMWA 1OBFO 5JMPA 1LDNA 5JE8A 1R15A 4NH4A 4PLVA 2Y1OA 4M89A 2IYOA 1LLDA 4XZ3A 4CV0A 3VZQA 4D44A 1H6CA 3T4EA 1Y5MA 3PLNA 1ZNQO 4FOSA 4P4NA 3WWYA 3G17A 3TZCA 1BGVA 5EMHA 2D4AA 5A4DA 1H9AA 1PSDA 1ZZEA 1ZJYA 1KS9A 3I9JA 3HWRA 4PZCA 2ZKLA 1Q2XA 1EUZA 2HMSA 1DFHA 4DRYA 3AJRA 3VPSA 3QHAA 3ZW9A 2Y99A 3DXFA 3PFFA 4GX5A 1EK5A 3LU1A 4N18A 2BGKA 3DBLB 4R3WA 3VTZA 4J1TA 1K3TA 1ZSNA 1LEHA 1I2BA 4JX8A 4KUHA 1U3VA 5ES3A 4UVGA 4PLHA 4HV4A 2O7QA 1K89A 5JDIA 3I9KA 3PFWO 2B36A 4NFYA 4CQMD 2B35A 3MJCA 3ZV5A 3E6AA 1PGOA 3F47A 4FC6A 4ITUA 2YHUA 1CERA 4DYVA 1X0VA 2SCUA 3IC5A 5DOZA 3L4BA 3K30A 1I8TA 2H9IA 4CMIA 4UVDA 4RV9A 3ZWPA 3KSUA 1PZHA 2Y1CA 4A2CA 2EKPA 2WDZA 3DDNA 4J2HA 3ANLA 2YZ7A 4HADA 4HFRA 1CQJA 3AI3A 1YDEA 4NQZA 4RVGA 4ROSA 1N8KA 1Y9EA 4YJHA 1E6EA 3E5RA 2PZJA 2NU9A 2JKVA 3V5NA 1Z45A 2VTDA 4CM6A 2ZTUA 2VQ3A 1DC4A 4MOWA 1U28A 2Q4BA 1SC6A 2FRDA 4FC7A 1ISJA 3RROA 3DOJA 1N7HA 3I9MA 4CLDA 3VVBA 4Z3DA 4OM8A 3BTOA 5JNLA 2VRBA 4YYZA 5F1PA 5A9SA 1TEHA 1MLDA 3L6DA 3I52A 3OICA 2FZEA 2VUSA 1XG5A 3MJ4A 4XJSA 3WNVA 5JXWA 1WAMA 3JD0A 1CF2O 2AQIA 2JFHA 2NACA 5KJ6A 1FF9A 3H9UA 3O38A 2BGMA 3Q1LA 4CLXA 3WIEA 2DLDA 4XGIA 4XKJA 3K31A 3C1AA 3DMTC 2IEBA 1GQ2A 1VSUA 3NDRA 4K1LA 5L40A 1XQ6A 4W7HA 2DBQA 2IRWA 2UVDA 2IXBA 3E03A 3FF4A 3ROKA 1P0FA 1ZEMA 2Q99A 1GPJA 4WLUA 1TT5A 4Z0HO 4HBGA 2WE8A 4OL9A 3GNQA 1VRWA 1H9BA 4BNNA 4DLAA 1YQGA 1E7RA 5L4SA 4UEOA 3BAZA 1P1IA 4QTZA 1KVTA 4RPJA 5ER9A 1EVZA 1UH5A 3SBOA 4ILKA 1JKFA 4FOOA 1NQAO 5JC1A 3MJEA 3R3JA 3KYCB 1CEQA 1LLQA 2EIHA 3QJ5A 2QX7A 1V9LA 4NBUA 3U4DA 4GGOA 2HU2A 1N9GB 4J9VA 1ULUA 4R5HA 5IG2A 4DYDA 1D8AA 3RC7A 4AVYA 4BKRA 2OL4A 3E18A 3GEDA 5DCUA 2OBYA 4PZEA 4M1QA 4L73A 5BSFA 5F1OA 4BNLA 2B37A 2VUTA 2DFDA 4DVJA 5I7FA 1T4DA 3PGJA 3ZI0A 1IHYA 1GV1A 4HWKA 3ZV6A 3JQBA 1QYWA 1YO6A 4YJFB 4BIIA 5IF3A 5JS6A 1UR5A 3I6QA 5DULA 4H3VA 4JNKA 2ET6A 3JQBC 3R1IA 2XXJA 4J6FA 2QHXA 4AJ2A 3H9GA 3H2SA 2BI7A 3P2YA 2A94A 5DP2A 1ULSA 3AOGA 4DQXA 1BHSA 1YXMA 5A06A 1N92A 2HJSA 2IZZA 4OQZA 4CMEC 4DL9A 1A7AA 2P4HX 4BGEA 3PEFA 3OETA 5KKCA 3M6IA 1YB4A 4OHUA 4KWHA 1R0LA 4YWJA 5T5QA 1YKFA 3WBBA 2W90A 4I9NA 4NPCA 3I9LA 3FR7A 2VHZA 2RCYA 3BTUA 4YT2A 1BSVA 3ETDA 3RUEA 4HUJA 1YJ8A 1XQ1A 3RQSA 1VKOA 1H0KA 1E7WA 3I9OA 4K9DA 4WLFA 5CDTA 1ML3A 2X4GA 2J8ZA 4RLHA 5KTKA 5JO0A 4FFNA 4I08A 1HE4A 4D7AA 1XGKA 1FDWA 4KUEA 5AVOA 4B3IA 1H6DA 1PJ3A 2YFHA 4JIGA 4RDHA 2I6TA 3AM5A 4BO6A 5EPOA 4Q39A 3CEAA 5GY7A 1SBYA 1XA0A 1NBOA 1H2BA 1PJSA 1PL8A 2E49A 1WMBA 4WNIA 3VDQA 2DPGA 3RUHA 5EESA 1OC4A 5TGDA 3V1UA 1G0OA 4KZPA 3IJPA 1X1TA 2QIOA 3F1LA 4PVCA 4D0SA 5IZCA 3KVOA 4RPLA 1KBZA 3PHIA 3H5AA 5JC8A 3TWOA 4NBTA 4IDGA 4UULA 5L45A 3R6DA 2G17A 2VOJA 2ZYDA 4WEQA 1E5QA 3GT0A 3K8ZA 4MJLA 4QFDA 5G0VA 4CQMA 1DIHA 1BVRA 2GZ2A 1JLLA 4CMEA 2RIRA 1WLYA 3FTNA 2R2GA 4W7IA 3ZZNA 3U09A 2VHYA 3CSDA 1NPYA 4ND1A 3RC9A 3UAGA 2YW9A 4B8ZA 1B8VA 4RDIA 4XD2A 3DR3A 4GLLA 2EEZA 4CUKA 5A1TA 1R0KA 2Q1UA 4OMUA 1CETA 3O9ZA 5B4UA 2YHIA 2PZKA 1J49A 2X0IA 3LYLA 1DFIA 2B4TO 2A35A 1GCUA 4YAJA 1R12A 4WLOA 4FD3A 4AJOA 2HLPA 1VM6A 4ZJUA 3F6YA 1LBEA 5BT9A 1GL3A 4E21A 2YV1A 3INRA 1D7OA 1AE1A 3RIHA 4CQLB 1M75A 4YAGA 3E9NA 1PZEA 4GKVA 1DIAA 4LRTB 3IUPA 9LDTA 5KVCA 1E3SA 1MB4A 3CIFA 4AJ4A 1HSOA 4XQEA 1NQTA 3U5TA 1DIRA 1C0PA 2O23A 4EITA 1A4UA 2ZJ1A 3RJ5A 4NNJA 3UUWA 2BRUA 3JQFA 2X6TA 3D3WB 4WLNA 1DB3A 2NVWA 1A4IA 2VT2A 5T8KC 4YT8A 1WDLA 2X5KO 3GUYA 3I3OA 3GQVA 5DBIA 5TLSA 4JJFA 2O3TA 3P19A 2EP7A 4PLTA 3Q3CA 2HMWA 3BYZA 5L7WA 1NHGA 3PVZA 3EYWA 3DAPA 2AG5A 4LK3A 4IDAA 2PKQP 2WWRA 2VT3A 2V6MA 2DC1A 2TMGA 5LC1A 1SB9A 4MKRA 3WYEA 3WYBA 3JQAA 3RAJA 5KIAA 2HJRA 4YCAA 4GAEA 2BFOA 1YGYA 3JQ9A 1BXKA 3C24A 4OO3A 4IXWA 1VKNA 3PGXA 1TXGA 4JN6B 1HDYA 2HK8A 4PRLA 4E5MA 4FFOA 2B4RO 1LUAA 2XOXA 2JCVA 3FN4A 4AJIA 1XKQA 2P9GA 1PGPA 3KYDB 1ZSVA 2VNAA 2Q2QA 2X9VA 3KTDA 4NR0A 1IB6A 3ROPA 3K73O 3MCVA 5F3RA 4O1MA 4RVUA 2C5EA 2QRLA 1LSSA 3JQDA 4W9NA 2D0IA 2C0CA 2W2LD 4MVJD 1DJNA 3QP9A 2NLOA 4BNMA 1IY8A 2OGUA 2Q2WA 3JQCA 4Q3AA 4YACA 4CM1A 2Q4EA 2FPGA 4TKMA 3CMMA 2Q50A 1JQBA 3UHAA 3U0BA 1BXGA 3A14A 4EGFA 2O4CA 1B14A 1Y8QA 2VYND 3O8QA 3PWZA 3SC6A 4AICA 4ALLA 1NR7A 3RBVA 1YONA 5CPBA 3VKVA 3A4VA 1PQPA 1ONNA 2RH8A 3GNTA 1U3WA 4ND2A 5AXBA 5JY1A 3QV1A 2P9EA 5G2OA 4INAA 5U1PA 3SLKA 2FZWA 1YE3A 2PD4A 2CDCA 3KLMX 4K6CA 4WUVA 2O4UX 3ITKA 1C3VA 1UXJA 3WGGA 4ALJA 1T2EA 1U7TA 2GZ1A 4RQUA 3QE3A 2ZB3A 3GFGA 3E82A 4DLBA 5CDSA 1VL0A 2PWZA 1AXGA 3JD2A 4II3A 3T4XA 5KWEA 4IJVA 2DBRA 3W4JA 5T57A 4CLOA 2QW8A 1K6JA 3AWDA 1DRVA 5L4LA 4WLVA 4GQAA 2Y05A 1ZK1A 1GY8A 3FR8A 4BNJA 3PI7A 4FJ2A 1I0ZA 2PLAA 2V65A 3ORFA 2AEFA 1VJTA 2O3RA 4GKBA 3L07A 4F45A 4XDYA 4IM7A 1E7QA 4IGEA 4KWIA 3B70A 3MJVA 2PD3A 1YH3A 2PNFA 1LA2A 4HFNA 1TLTA 3OBBA 4ALKA 3BHJA 4QT0A 1ISHA 3EMKA 1HDXA 4JJGA 4J1QA 3FD8A 1M2WA 2G5CA 1GD1O 3AM3A 5ENDA 1PL6A 3RWBA 2GYYA 5A02A 3DZJA 7ADHA 4YJGA 2QYSA 3C7DB 3QRWA 4EJ0A 1QMGA 1J6UA 2V6GA 3RC2A 2C29D 4NJMB 4DLLA 2PY6A 4DPMA 1UDAA 4II2A 3CZRA 2EGGA 1LDYA 1AN9A 1NQOA 4CM9D 2FR1A 1ZIDA 3LC7O 1C1DA 4Q3NA 5CP8A 2AE1A 4GSKA 2FR0A 4TMFA 1ZMTA 3AM4A 4HKTA 4IS3A 5IDXA 4YEDA 4NK5A 2I66A 2WD7A 2C54A 4B7UA 3OFSA 4GI2A 3WGIA 4LCJA 4FR5A 3DMTA 1DFGA 8ADHA 4KDEA 4DBZA 5ADHA 2I3GA 3QLJA 4RCVA 2Y0CA 3U4IA 2YDXA 3UGKA 2VZ9A 3QWHA 3D0OA 3HZZA 4TVBA 3STHA 2EF1A 3KUXA 1EMDA 3IMFA 2O2YA 2OFPA 1HLDA 3OM9A 3G79A 3K96A 4L4RA 5CG2A 4LRSB 3EGOA 4RF3A 2YJZA 1JA9A 2HMVA 1OOEA 1B8PA 1YL5A 2X5JO 3E9QA 1DPGA 4CM5A 1NP3A 3F4BA 1JU9A 4UUOA 3HDQA 1BVUA 2PZMA 5GZ1A 4IQ8A 3LQFA 2GN4A 1LJ8A 3GOHA 1QR6A 4E0BA 4NU5A 1TVEA 1N1EA 3FPLA 4DGSA 4E6PA 4IDFA 1MGOA 2GDZA 3UOGA 1MXFA 4E30A 3GNSA 5TNXA 4AJPA 4BO3A 1ADBA 4CM4B 4JP3A 3FTPA 3KO8A 3JQEA 1H93A 3U4CA 4FGSA 5COQA 3RU7A 4UVHA 3DBRB 1ZEJA 3L4SO 4DIOA 3G3EA 4KP7A 5G4LA 2EKQA 2BF7A 4R54A 4Q3EA 1Z74A 4ZGWA 2EWMA 3UN1A 1B0AA 1QV6A 4Y67A 2XAAA 4Z9YA 2GZ3A 3TDKA 1K6XA 1FDVA 1NVGA 3ADOA 2VHVA 3D64A 4E32A 4XYLA 5LCXA 4Y6PA 1HTBA 1UXHA 2HSDA 1JKJA 1BW9B 1T24A 3AY6A 1O9BA 2PKRA 2OXIA 1LC3A 2DTXA 3SJUA 3TZKA 3JQAD 1U9JA 1H5QA 5FF9A 1KEUA 1PZGA 1ZO8A 3EHEA 2OHXA 3QVTA 3CZMA 1RM0A 2IYPA 4IBOA 3WFJA 3AU9A 5I8WA 3IKTA 4R41A 3VH4A 4HFMA 4WK6A 5AXAA 5JO9A 4CR6A 2H6EA 1ISMA 1Z75A 3BMQB 1EVIA 4R16A 5JLAA 1S6YA 3QY9A 4I8XA 4EDFA 1JKIA 4XQGA 3SC4A 1FDSA 1KEVA 1WZEA 2FSSA 1K2WA 3GR6A 4CMAA 4P22A 1N5DA 2C7GA 3IP1A 4NJMA 6LDHA 2ZB4A 2W2LA 1NFQA 2QG4A 3EDMA 5B37A 1IOLA 3NT2A 3GZ4A 5HTOA 1LRKA 4O63O 2I65A 1HT0A 3W8EA 1O95A 1C14A 4KMSA 1U2DA 3ABIA 3WX0A 4B3HA 3C8MA 3ZWOA 2CF6A 5FI5A 1B26A 1OZAA 1PR3A 3QWBA 1MC5A 3LF2A 4BKQA 3PIIA 5COAA 3PJGA 2CSUA 2A92A 3JQ8A 4DREA 1Z7EA 3LT4A 1HDZA 4RF4A 2B0JA 5IDQA 3S2FA 4ZN6A 3I4CA 3AUTA 3KB6A 5IJZA 4JBGA 4FJ1A 1E7MA 3CH6A 3PQFA 4LISA 1NFRA 4L4XA 3HDHA 4GX2A 4RF5A 3OEWA 5AOVA 4EZBA 5IN4A 1PJ4A 4AJNA 2JD2A 2JHGA 1TI7A 3GZNB 4GGPA 1P3DA 3IDSA 4F6LA 3L6EA 5JAQA 1XDWA 3KV3O 1K6IA 3IOYA 4BO4A 3PQDA 4NMHA 5EN4A 1P31A 3JQ9C 1S7CA 1KEPA 1EFLA 3PHHA 1EK6A 3PWSA 5I9MA 4WGGA 2C5AA 3QQPA 1NFFA 2ZCUA 4PGFA 4HP8A 5ITWA 5L7TA 1BWSA 2EERA 5G0TA 2RAFA 1LQUA 5I7SA 3HFGA 4FSHA 4DBVO 2P2SA 2CFCA 3LC1O 5L9AA 3INTA 1LDMA 2DFVA 3VH1A 4EI2A 1SO8A 2EJVA 1WPQA 4BO8A 2ZTVA 3NGXA 1KEWA 4BNKA 1GU7A 1XU9A 3IP3A 1ZXBA 4S1VA 3ZV3A 2GRAA 4DC0A 4CLOB 5DBFA 1DAOA 1P74A 3OA2A 4E2YA 4CLRA 4FS3A 1X7GA 3GVHA 1Q0QA 3HN7A 4I5FA 4OXYA 5CFZA 4PG7A 4D43A 1R16A 2GO1A 1B3RA 1G1AA 3LZ6A 3O4RA 3JYPA 4RVHA 2JCXA 4TSKA 2Z1MA 4YJHB 3QIVA 2X8LA 5I9NA 2CZCA 3KSZO 4DPLA 4BVAA 4CPDA 2VYVA 5DDIP 3PJDA 3ZWCA 4OIMA 5I7EA 1QG6A 3VH3A 4XR4A 4U0KA 4RPGA 3ZGYA 1BMDA 2P9CA 3QVXA 5EERA 4W82A 4ND4A 4PLPA 1WNTA 4IIVA 3E48A 2W98A 1A72A 3Q9NA 2I76A 3PPIA 5DT9A 3TSCA 3ZHYA 4J3FA 1NM5A 3RJ9A 4BMSA 1GEEA 1E3LA 1ZH8A 4CM8A 4OYRA 1XYGA 3M1AA 3ZNOA 3TOXA 5DBGA 3DWFA 4UREA 1I3LA 4I1IA 4J7XA 1XR3A 2HMTA 1AUPA 4YRDA 5KKAA 2EXXA 4EUEA 1ZK4A 1E7YA 4BS9A 2AHRA 4MVJM 4CR8A 3HG7A 4AJEA 8LDHA 3PK0A 3V2UA 4Z9FA 4IINA 3OJOA 1T2DA 3GVIA 3U9LA 3ULKA 2Y1DA 1R4NB 1V35A 5A5EA 3KEOA 1Y7TA 2BKAA 5CG1A 1Q0LA 3NGLA 1W73A 4YB8A 1WZIA 5EQDA 1B2LA 1U5CA 4PFJA 2WTBA 4TZTA 1GZ3A 1X0XA 3F4LA 3P5SA 3ZWBA 1M67A 1AGNA 2ZB8A 2RHCA 4BO0A 1X7DA 3PIDA 3DBVO 2IZ1A 2Q1WA 2IODA 2ZJ0A 1LDBA 5THKA 3DBHB 2HO5A 4A73A 1IE3A 1ZVMA 3GGPA 5KVQA 1LX6A 4TRNA 3GG2A 2X9NA 4MIYA 5TX7A 2RH4A 3NTOA 2P4QA 5TC4A 4BO7A 1W6UA 4YR9A 4GX1A 1T2FA 4G81A 1PS8A 3FSRA 4CMKA 3FPCA 2ILTA 1TT5B 4FBGA 3RFXA 1PGQA 2Q1SA 1LSOA 4DMMA 1ADFA 2DBVO 2DVMA 1ZUD1 3C3XA 3UF0A 1RM4A 1C0LA 2O48X 1R4MB 1VL6A 1XCBA 1E77A 1WWKA 2BFAA 2O3UA 2HMUA 4I5EA 4NI5A 5TT1A 2X7HA 1EUCA 2V6BA 2AEMA 3NTQA 3N58A 5AXDA 3X2EA 5KJEA 3MTJA 4OSOA 2I9PA 1Y81A 4FGWA 1J0XO 1OFGA 1SNYA 2Q3EA 2VYNA 4XEHA 3IL2A 4OH1A 3BMCA 3QWAA 3B6ZA 3T7EA 4AJJA 4B4UA 4E5KA 4WJZA 2Y1GA 1W8DA 4NIMA 2CNBA 4DC1A 5L95A 2XF8A 4L0QA 1I5RA 4YTEA 1MC4A 2J3HA 3HN2A 3D4NA 1E0DA 5J23A 3KRTA 3F5QA 1HEUA 1HKUA 3D1LA 3A9WA 2W4QA 4YJGB 2PK3A 1U3UA 1JW9B 4CL8A 3DL2A 5EQFA 4FFPA 4GMFA 1GDHA 3V8BA 2EJWA 2WYWA 1A9ZA 1HDOA 1HRDA 1M66A 2GUGA 2J5QA 2FP4A 3BMCB 1PJLA 4XWYA 2J3KA 1DHRA 2CMDA 4Y98A 3NKLA 5BNTA 5ICMA 5TJHA 4E5NA 2D8AA 5F5NA 3W4KA 1Q1NA 3LDHA 2JCYA 5ICSA 1HF3A 2G1UA 1G6KA 4YXFA 4ZQEA 2AXQA 4GSLA 5JAIA 2BFMA 2Y67A 4R51A 5L7YA 4CUJA 2C20A 3DHNA 1B7GO 4AFNA 5KJ1A 1KY5A 3WGZA 1O89A 1FXSA 2JD1A 3FWNA 2Q45A 4EYEA 3D5TA 2PR2A 5L4NA 3TJRA 2HK9A 1Z7BA 1HE3A 1ZK2A 2GN8A 2VHXA 1HXHA 3OJEA 4BNGA 2WYUA 3AFMA 3SX2A 1O5IA 1TA4A 2B5VA 5BSEA 3S2GA 1XLTA 2HRBA 1U4SA 2Z1NA 3S2IA 2PFGA 3L77A 4CM8B 3CPSA 3BMNB 2BH9A 5JDCA 2BFPA 2BLLA 2PTGA 5A3JA 3D7LA 4XRGA 2FSVA 3Q2KA 1I3KA 5C5IA 1ORRA 3INGA 2W2KA 3DHYA 3M2TA 4YQYA 3HJAA 4ZHSA 2QZZA 4B3JA 3COSA 1DAPA 1ZXLA 4HFJA 5THQA 1RKXA 1NX6A 4XX0A 2XXBA 4J0FA 4XA8A 1LNQA 3ZWYA 5BNIA 3LVFO 2PA3A 5T8KA 1UAYA 1PR9A 4PRKA 3WXBA 5IZ4A 4MVJH 2BI8A 4RZIA 1ONOA 2FHSA 4CMJA 3WS7A 4NBWA 4BNXA 1G0NA 4KTVE 5F1KA 1R4NA 4BGUA 5TQVA 4A27A 3K2EA 1Q7CA 5CAEA 3PHJA 3G49A 1QKIA 2NTVA 1JVSA 5JW6A 3Q2IA 2I99A 4YVFA 3IAHA 1PJ2A 3BA1A 3UCXA 3DOOA 4AJLA 5FI3A 2D59A 4N54A 1E92A 3GRPA 1DXYA 1T26A 4JCOA 1J5PA 3RASA 2YDYA 3HE3A 4ZQBA 3OIGA 1F17A 3TRIA 4Q9NA 1LI4A 1CQIA 3K2BA 4Q3BA 4DUPA 2JD0A 4RORA 2YV3A 2X58A 3EZLA 3Q6IA 1LXCA 3FI9A 3QWFA 4EJ6A 3DZFA 3PWKA 5JDIC 2WE7A 3GHHA 4PLCA 3DZHA 3OMLA 3GC6A 1SOWA 4WECA 2V7PA 4XQCA 1R4MA 3A28A 3I83A 3L9XA 2F1KA 3GVXA 2POQX 4UUPA 3HSKA 3JQ7A 4NU6A 3AK4A 4D3DA 2ZIZA 2YUTA 2UDPA 2NM0A 3I23A 2OP0A 2J3IA 4YQZA 2GR9A 3ZHXA 3UH1A 3SLGA 2VRCD 2JHFA 1MXHA 1EBFA 1UDCA 2AMFA 4TVOA 1GUFA 1N1GA 3D4PA 3MWEB 3PHLA 1R66A 2O3JA 5H81A 3D3WA 2E6UX 1LQTA 2WMDA 1W0CA 1MFPA 4WOKA 1YBMA 3KXDA 5JYEA 1YL6A 2AA3A 4MVJG 1PWXA 3AI2A 1QYCA 2EGHA 1YOVA 3AY7A 1HDCA 1PJBA 1GZ4A 4J1NA 4MVJI 2RHRA 2Q2VA 4BMVA 5JDCC 2DTEA 1CDOA 5IN5A 1D1SA 3KOUA 3ZU3A 3ONEA 2FPPA 2X22A 2GSDA 4WCFC 1P0CA 1RJWA 3ZHZA 2X0JA 3I5MA 4XIYA 3VAZA 4F3YA 2WD8A 4R9RA 1LU9A 3S2EA 5DF1A 1XEAA 1UUFA 2W2KB 4BQRA 3OEYA 3DBRA 3HHPA 1WMAA 3BXXA 3L9WA 1A9YA 2GASA 3OP4A 3ONFA 4RVSA 4QX6A 3H5NA 4PLZA 3UW3A 4IPTA 5JFOA 1XSEA 4J0EA 4IZIA 4KQWA 3WLFA 3WIDA 1H6AA 4P8RA 1P77A 4NHEA 4Z0TA 2QZ9A 1C1DB 4FIZA 3ICPA 3A06A 4MDHA 4BNFA 2A4KA 3WYCA 4GH5A 2AEJA 2NU6A 5LDGA 4YRBA 1JWAB 5K9ZA 4A03A 3GPIA 1U4OA 4ND5A 1T25A 5EL0A 5I7VA 3EVNA 3RFVA 1EVJA 1EEHA 3BHIA 2B69A 2C59A 2NV6A 1YWGO 4RQTA 2VZ8A 4KUGA 3MOGA 4FPXA 3SVTA 1GCOA 1HLPA 3FBGA 3NJ4A 2O3SA 4BNIA 3E8XA 1K0UA 2GPTA 4BNTA 2E82A 1IULA 3GAZA 1KIFA 4Y6SA 1F14A 1GAEO 4UUNA 5TIIA 4BO5A 2WM3A 3HB4X 4S3MA 4MVJA 4PG5A 2JAHA 1T2AA 2PGJA 3U62A 1LTHR 3UCEA 5HM8A 4IUYA 1EQUA 4E2ZA 5JCXA 1QORA 4QO8A 5IZCC 3ICCA 3R0IA 4Z6KA 1GUZA 4RGBA 2C82A 3OJFA 4IQGA 1GADO 1KVSA 2FN7A 3VTFA 5AXCA 3ASUA 3F5SA 3GAFA 1ISGA 3DFZA 1EZ4A 2FR8A 5T64A 1LLUA 5TS3A 3ROMA 3F46A 2Q1TA 3TZQA 2W8ZA 1YVEI 3IJRA 3VPGA 4BKUA 4XCVA 3PDJA 4LVUA 1AXEA 1WDMA 2ZQYA 3O26A 4NBRA 2P91A 5G0WA 3MWDB 1UZNA 4R5MA 5CHEA 4GBJA 1PQUA 1YS4A 3I4FA 4JK3A 1E3EA 9LDBA 4LVCA 4TRJA 5C7IO 1YRLA 5A9RA 3TF5A 3PXXA 4YPOA 2D2IA 4G65A 1LSJA 3C7CB 3GA0A 5JCJD 2VWHA 3MJTA 4D79A 4H15A 5HA5A 5T6BA 4A5OA 2VUUA 2Y1EA 3HADA 1Y6JA 1P1FA 7MDHA 2PD6A 4IY1A 4J7CA 3K6JA 4IS2A 3U4HA 3RFTA 3DMYA 1QLJA 1SEPA 2EP5A 1ARZA 1IYZA 3AI1A 1I24A 1MX3A 3WG9A 4IJUA 3JQ8B 4PLWA 3WQRA 5A5FA 5BSHA 1KC3A 1VJ0A 5G0SA 3K92A 2GGSA 4N5MA 4XRRA 3ENKA 1TT7A 3CTMA 4IJWA 1X1EA 1QLHA 1KVUA 4QQRA 2X0NA 3GDOA 4P4GA 4D45A 1X7HA 2YV2A 2O2SA 1I2ZA 1JTVA 2HK7A 3LF1A 3DEYX 3WTCA 1ZSYA 4E31A 2ZYGA 2VZ0A 4GWKA 1KYQA 3AFNA 4FDAA 1KERA 4HNHA 3FCOA 4CJXA 1UZMA 5IAAA 2QRJA 1U8FO 1KOLA 4HX5A 1SOVA 4MKXA 4I9UA 1GQYA 3C1OA 5B4TA 3WR5A 3JCZA 4OKIA 1WP4A 2IEDA 3F3SA 3DFUA 5CEFA 4Q3CA 5A04A 2ZCVA 1PS0A 1Q7GA 4JBHA 1VI2A 3PHGA 4NBVA 3WNQA 4DWVA 4TKLA 1Y9AA 5JAZA 1MUUA 4CMBA 3L0DA 4YT5A 1GYQA 5I8ZA 4B4WA 5B12A 2VWQA 2HCTA 1JDJA 1E1KA 4M86A 1EQ2A 1NR1A 1XELA 1MG0A 3JYQA 5IXYA 1Y8RA 3EVTA 2VRCA 2IE0A 4BNVA 2CUKA 4CQMB 3LT2A 4IQ0A 3VDRA 1YOVB 3ZNNA 4AL4A 3L6OO 4MP3A 4J91A 4OXNA 3LC2O 2V6FA 4JGBA 1DRUA 1RWBA 1YQDA 5HBRA 4BHTA 4L76A 1PTJA 4R1TA 3O8QB 4E5YA 3HFSA 2GD1O 3AU8A 3NUGA 2WD7B 2UV8A 3EY4A 1CWUA 1DLJA 1H2HA 1A7KA 4EBFA 4BKPA 4WPGA 1E3JA 4DA9A 3ZHBA 3UFXA 4D3FA 3WGQA 1N2SA 3OSUA 4BGIA 1U2GA 3BHMA 1VPDA 3PRJA 1ENOA 4BNYA 3BIOA 4KOAA 1GYRA 1WVGA 5AQ1A 5B4VA 3RI3A 3FWZA 2D5CA 5A03A 1EBUA 5L3ZA 2ZK7A 4XB2A 2VWGA 1UXKA 2R00A 4LSMA 3NYWA 5HS6A 4TWRA 4LW8A 2H63A 2GLXA 3DOCA 2NU8A 4GVXA 4R3NA 1JAYA 3V1TC 4F46A 3PLRA 3EAGA 3ZWWA 1A5ZA 3F1KA 1UXGA 4R1SA 3ZV4A 2G0TA 4FFLA 3PJFA 4ZICA 1VL8A 1F0YA 5JCJA 3ZWNA 4NK4A 1EFKA 1NPDA 5FEUA 1D3AA 1ZW1A 5MDHA 3ANNA 3LK7A 1I36A 4MP8A 5TT0A 1GYPA 1P1JA 4L74A 4L4SA 3VPHA 4GVLA 2E4AA 5HS4A 1E3WB 4FW8A 5F21A 1QSGA 2VCYA 1ZK0A 3JD4A 1PEDA 1NNUA 1RYDA 2YQ4A 3PZRA 4JP2A 1DSSG 3I6IA 3DBHA 4Q3DA 1ISFA 2HRZA 5ITVA 1YB5A 4XYBA 2PZLA 2ZATA 2E37A 4W4TA 4E2WA 5CEJA 4CM7A 2Q46A 1P1KA 3WGTA 3ON5A 3H6KA 2CDBA 2PGDA 3H5RA 1F8GA 3C85A 4ZA2A 5DN9A 4MVJP 2Y0EA 3H9QA 1RYEA 4PVDA 1P1RA 2YY7A 4M87A 5JPIA 4BO1A 1GV0A 4OSPA 4RF2A 1TB4A 4OKNA 3JTMA 3ZNPA 3QSGA 2JFGA 2NQ8A 3B1FA 3DTYA 1LRLA 2X5OA 3OH8A 3IUSA 4XYGA 3EC7A 1Z6ZA 3OIDA 1DEHA 1UAGA 1X14A 3H9EO 3VOSA 1HETA 2HQ1A 4OGWA 3FNFA 2OOSA 2I67A 4HXYA 3JQ7B 4M8SA 5KJFA 5GMOA 3X2FA 4MPDA 1PJCA 4CMHA 1DO8A 1NVMB 3GEGA 4NDNE 3TL3A 4R9SA 4DMLA 1GR0A 1I10A 2NQTA 2P5UA 4UEKA 1YJQA 4ESOA 1E6UA 3QWIA 3VZSA 2AQHA 3VZRA 3B1JA 3GH3A 3NT4A 1IPEA 5JYDA 4E4YA 1I32A 2TMDA 1DRWA 2DTDA 1CRWG 5H83A 3CKYA 1EDOA 3K5PA 3OF2A 4OOEA 2NVUB 2B83A 4B4VA 5BR7A 1BXGB 1IHXA 3VPFA 2DPHA 2I3AA 2OORA 1NWHA 1Y1PA 4ZRNA 4BNUA 4D0RA 4QEDA 1K5HA 5F5LA 2LDXA 5JBIA 1GZ6A 1GQQA 4E33A 3D3EA 3AY3A 4NZ9A 2IZ0A 4R68A 5U9CA 3TZHA 1CYDA 4IMRA 1OAAA 2J5RA 1UP6A 3W4IA 3KZVA 1LSUA 4XJTA 4J1SA 1W4ZA 3ETEA 4MP6A 3FNEA 3DQPA 5GZ6A 4ZU3A 3JQ6A 4YAIA 4CM9A 4UEJA 1DIGA 4E2XA 1BG6A 4FN4A 3RUFA 4WLEA 2BELA 2VHWA 3VZPA 1B16A 1GFSA 3ZN2A 1DLIA 1GPDG 5KVSA 3Q11A 3HDJA 1P1HA 1PS9A 4IMPA 4Z3KA 4CODB 4BUCA 1WDKA 1HZJA 4J9UE 3ENNA 1HSZA 3G0OA 2C2XA 2C2YA 3K9QO 3LT0A 3QVWA 4EW6A 4OAQA 3KYCA 3WMWA 4ALNA 3GFBA 2FWMX 1O94A 2NU7A 3ZDFA 2HUNA 2FOIA 3S8MA 4J7UA 4C4OA 2A9FA 5BNFA 2CVOA 4QXMA 3GN1A 5B1YA 4X54A 4NFSA 3TN7A 2ZQZA 2CVQA 1NYTA 2DAPA 4J43A 1T4BA 2B4QA 1BRMA 4LMPA 3QW2A 5CDUA 3FRJA 1E7SA 4LMRA 4QFCA 3WGOA 3H9JA 1DDOA 1NHWA 1ZJZA 3GGGA 3NX4A 4YDRA 4ID9A 4YJFA 3WICA 3ZH2A 5G4KB 2R6JA 4BB6A 4OQYA 4TRMA 3T7CA 3FHLA 1ISIA 1F8FA 1Y8QB 1B3BA 3HQ4O 3AOEA 5JY6A 1QXSA 3UKOA 4CLHA 1MA0A 3MOIA 2J5KA 4MO2A 2Q49A 1IPFA 4XDZA 5T67A 1SZJG 1LDEA 4BKOA 4YA6A 3VC7A 3GEMA 1N9GA 2B5WA 4W99A 1DC6A 4B4OA 4E5PA 1D1TA 3M2PA 4QSMA 1H6BA 3NRCA 4IZHA 3V1YA 4N7RA 3RKUA 4URFA 1JVBA 4D42A 2Y0DA 2CDAA 2CY0A 3P2OA 5DNAA 4BV8A 3ETGA 4CM4A 5L51A 2NUAA 4UVEA 5DCYA 3OJLA 3E1KA 3EW7A 2PV7A 1UZLA 2AE2A 4R01A 3W6UA 1HYHA 4OOFA 1DC5A 4ZQFA 1C1XA 3H3JA 3DBLA 3PYMA 1CIVA 4PLFA 1NPTO 1I33A 2IDZA 3S55A 4CR7A 3H3FA 3ZWVA 3ZU2A 3SJ7A 3UICA 2EW8A 3IQDB 2P5YA 1P33A 3EK2A 1EE2A 3RVDA 5HWSA 5DCWA 2JJYA 2PKQO 1BW9A 1M6HA 4U0JA 3H2ZA 4B8WA 2HAEA 5FYDA 4CUZA 2EHDA 3ASVA 3GK3A 2EV9A 4QO7A 3RBZA 3JD3A 2JAPA 2H1SA 2C07A 4J4HA 4RLSA 4JROA 3N7UA 4JJIA 3RCBA 3ZU5A 2EG9A 3OQ6A 3NAQA 3IS3A 4BO9A
chains in the Genus database with same CATH superfamily
4P5DA 1IQUA 2ONYA 4NG4A 2XR1A 3IOEA 4PGAA 4TS4A 4BGVA 3GVCA 4M7OA 1V47A 3ZX4A 1A3CA 1KI8A 5L53A 2OO7A 3U4QA 3GO4A 2NADA 3IGFA 3A37A 3CE6A 1PV4A 4WE3A 1OYVA 2C1ZA 4XSVA 4Y6RA 1AUXA 1UMDA 3I45A 5BV8A 5C7LO 4GPAA 3JYOA 2DUUA 4NNOA 4UBMA 4UMEA 3ZIAA 1ZJJA 2D5AA 3TTTA 4D3ZA 1GUYA 1N2EA 3PYLA 3ADKA 2A7XA 2WFZA 4IVNA 1EP1B 3DMPA 2ZG6A 1AHNA 1N9ZA 4O4JB 4NJOA 2E21A 2ISSD 4W1SA 2QY6A 3H2KA 1PNVA 2FY8A 3H65A 3ZBTA 3HBFA 4RTLA 2IHNA 2P1DA 2DUWA 1EJ6A 1TIBA 4RH0A 4EO9A 4IIYA 3N8KA 4XVHA 3IEUA 4DXAA 3AM1A 3GYGA 1H2AS 4Y2UA 2JVKA 4PO3X 3G8AA 3SIXA 4Y2VA 5JH7F 2Z6UA 2C3YA 4NBKA 5IYZF 2XCRB 3WQQA 5AUNB 1I5OA 1YULA 1I3MA 1BOFA 2EZ9A 2QRZA 3SR0A 1OX4B 3OEED 2Y68A 3ESXA 3ONDA 1LPSA 2C4VA 1WXHA 3Q0EA 1SG6A 1FK8A 2CHUA 2W2OA 3BX1A 3OIUA 2V59A 4NKRA 5LMNB 1VG0B 5BWNA 5JS7A 3E22A 3DFFA 1ZD9A 2WQZA 4MGKR 1N6LA 6ADHA 2GYVA 2VZEA 3VZCA 3L46A 4TTSA 5E3HA 4AP9A 5CFMA 4D46A 3BJEA 1B8UA 2XW6A 3ZE0B 1BDMA 4DV7B 2JLWA 2VK8A 4HF7A 2FX5A 1G5RA 4FOTA 5D3MA 3HRHA 4O6VA 1EAMA 1NQVA 2EAUA 1T36B 4M38A 4LRYA 2I2BA 1VPEA 2HJWA 1KWKA 2GDJA 4QLBA 2HKIA 3F8WA 4AJ1A 1SCQA 4Y1GA 5CDYA 1G3QA 4OBXA 3OZVA 4V0ME 4PLYA 4BUJA 5LL6P 1USVA 4C7VA 3GGOA 3P4UA 1E2MA 4XIIA 4D9BA 1A04A 1M6VA 1QIHA 3HJGA 4QARA 2A9PA 4QYIB 5CEEA 3AHCA 1T6ZA 3GFOA 4LXXA 1ONPA 4GEGA 1VOTA 1SPBS 5IXSA 5FWAA 2QRKA 4ZDWA 3SEAA 2BKLA 1EESA 4EG5A 2XCQA 3DO5A 2GERA 4XR9A 2D3TA 2GF0A 5JQGF 4KNWA 2IE8A 3IERA 1VB5A 4QYMA 4BO2A 1JN0A 2H0QA 5EYPB 5G4KA 3ZKWB 4B5LA 4C4AA 3ZJUA 4ZTUB 3CKLA 3HP7A 4I5GA 4E13A 2D0PB 3BZWA 2QYTA 1DV2A 4IDPA 3PL1A 1HC7A 5LBUA 2AXEA 5IASA 4NU0A 1HYEA 4JLBA 3R4CA 3L05A 5CM2Z 1TCBA 1OKKA 3T3IA 2AVNA 3OECA 5B6IA 2PUAA 3BMNA 4CF7A 5AJVB 4A7PA 4YRAA 2JAWA 2OKCA 3IQHX 4N5DA 4MV7A 2C96A 4CLRB 2FJ0A 2CHEA 4KMRA 2HSJA 4URYR 1YT5A 4KI0A 4XW2A 3HU5A 4MHSA 1VC2A 2OHVA 4BCCA 3G2IA 4L7VA 3B3AA 4MEBA 1P44A 4QPPA 3MC1A 4A23A 3VR2D 2ODNA 4OI4A 5KQMA 1DBVO 1GVNB 1SVMA 2CK3D 3KKPA 3R76A 3WSTA 2OGZA 1ZH0A 3Q5GA 4L51A 5KNBH 3H9CA 1CKEA 5IP5A 4ENRA 3AFIA 3UMFA 2J3JA 3GMDA 4RL6A 3V4OA 5HRUA 3PEVA 2QT9A 3VSEA 3ZBPA 4L8GA 2OBNA 4H16A 1M34A 3G2LA 3R3XA 3KFXA 4WERA 2G9QA 2YCBA 1TJPB 2ZRPA 4BLWA 1YBAA 1AK1A 1EGQA 2BW0A 2WFLA 3IUBA 3QUCA 4LE2A 3EC2A 2X8WA 3GG9A 4FFMA 2PRIA 3R6WA 4MWCA 4PG6A 1WQ1R 3AG5A 1FDRA 5TF0A 1YQ9A 1JMYA 1Z8HA 1NVTA 2AFRA 2YJ3A 3GPCA 4RMGA 5KYUB 1RHUA 3K2QA 4ZZIA 1QO7A 6NULA 1WU8A 2BM8A 2H3HA 3KKNA 4IXTA 3ZCVA 1SVNA 2GBLC 4J03A 3CUYA 1NE2A 4IKOA 5E1BA 1NXSA 3VHRA 3EQ8A 1CK4A 3MT9A 4BLRA 1QG4A 1P19A 2PSFA 3GLFB 4PTLA 3DONA 4JBIA 5IJ9A 3KQWA 1XDUA 3HYCA 1UC8A 1S1CA 4ONEA 1OBVA 4Z49A 4EY5A 5K8TA 3VYTB 1N32B 1TMGE 5AKEA 5ALIA 2PDAA 4ZRMA 4BLPA 1XU7A 5AW7A 3R4VA 3UMYA 1TJ3A 1V95A 1SOMA 2CNWA 5KHAA 4IQFA 1MW8X 1FLAA 2GPAA 4U9IS 4KX3A 1PT8A 3F9IA 1O6BA 4MB0A 4K28A 4DCPA 3KKMA 5JD5A 2RHOA 3DH0A 5JD3A 4ARZB 5JQGA 5EMNA 1IEVA 1LBQA 2YS6A 1DJQA 3KSDO 1A8PA 2GLUA 1TKAA 4WZAB 4JI6B 1Z5ZA 1KTIA 2EFDB 2VJPA 3HCWA 4H7PA 1S2DA 2ZYRA 3R7WA 1U9IC 1ZI6A 2ZSJA 1JE0A 1Z2EA 3Q4GA 3QU9A 4YJ2A 5ETJA 3F6BX 2PX5A 3A58B 1MJGA 3CUKA 2QYOA 1CQXA 1AHIA 4AIRA 2BEJA 1FJHA 2AR9A 4B7ZA 4QYXA 2IF2A 2ZTMA 2QRUA 4MKZA 4Z4CA 1B6RA 3G1UA 3BWCA 1GGVA 4FEAA 2P4SA 5B3JA 2HWKA 3D02A 3I0MA 2FQ1A 1KVRA 3KYJB 1QZ3A 2CMHA 2C5HA 4KXMA 4XWOA 4K7JA 3I1JA 1ZM7A 5HF8A 1H5UA 2C0QA 3DJYA 3IHTA 5DXAA 3AUSA 2J07A 5BPHA 2JJMA 3HS3A 4WY2A 4M2LA 4PZDA 1R0SA 2LVBA 2WUGA 3PD1A 1PR1A 4OHXA 2JJ1A 4Q7KA 4R1PA 4PIVA 1DEAA 4F6CA 1I4LD 2BDEA 1L7EA 2PSDA 3C3YA 5I01A 4LYYA 4OLFA 1CR2A 5C7OO 5H9WA 3WI7A 5B1EA 4OYLA 2Y9PB 5I4CA 2C97A 4RMHA 1OZGA 4ZCMA 1M8GA 2GFIA 4M54A 1E0JA 1E1QD 2GN9A 2ZJYA 1U3TA 2YN0A 2ZRKA 2EFYA 4L72A 4I46A 3B3FA 1MG5A 1T35A 2X86A 3LUPA 6YASA 2AUNA 1N5OX 3M3HA 2GEKA 3UXHA 4C89A 1D0SA 1PQWA 2EZTA 2PMWB 3K32A 3F2VA 1R4AA 4B79A 3OLVA 2VTEA 2PR7A 4YP6A 4Z9XA 4ARZA 5GZ3A 5EZ6B 1ID1A 2OORC 1RM5A 3K0HA 1V3TA 4IJQA 4C4SA 3B6EA 3BT7A 1WUYA 3DYBA 4QECA 2NNLD 1LLCA 1C9MA 4IV5A 4ENQA 5KOYA 3NMUF 4DV1B 3FFWA 3H8WA 4NZOA 3JARB 3VVCA 3C2QA 2OBBA 2ZVPX 2YXNA 3HXOA 4TN5A 3TFQA 4PNZA 1W35A 5CDGA 3S29A 4FJ0A 5LOVB 2AYXA 4L27A 5A9TA 2QX6A 4P54A 4RZ3A 4F96A 4MJ3A 3SEFA 4M49A 2WABA 3LYHA 1U2RA 1ZI9A 2UAGA 3CUWA 3H1GA 5JBQA 2GJKA 5JSFA 2MWMA 4BDSA 5KYUA 3QTBA 4JQYA 1M6WA 3UJ3X 4F6RB 3ZEIA 3NNNA 4P81A 4YROA 4JUBA 2JNWA 4DEXA 3BGSA 1MNAA 1Y80A 2DETA 1E32A 5CB4B 5JYBA 1CZRA 2WP0A 4RL4A 2QL9A 2HDWA 5IH7A 5ED4A 1E8MA 1KZ6A 2D1YA 3FF1A 3O2NA 4PXSA 5HQTA 3QLVC 2DBZA 1JH9A 1JYSA 4CCYA 2SKCA 3AF0A 3RC1A 2VN8A 1M6VB 3TPFA 2BMFA 4CIXA 2XA2A 4S04A 3V3TA 4X6XA 4RZHA 3VC2A 1IAVA 4F91B 5L6LB 1VHQA 4PICA 4JJAA 3A1NA 4WXPA 5F33A 1P6UA 1CY7A 1F1JA 4GXTA 1TCVA 4MJXA 3MLEA 3NETA 4R2LA 4C29A 4DV2B 1Y37A 3ACDA 1VLQA 3GARA 4MS4B 2IPNA 3TLBA 5CPFA 4V2IA 3H4VA 1P2SA 1LC0A 2WB4A 4GO1A 5ENZA 3GXOA 2Q7XA 2WSBA 4QHTA 3ZK8A 3O1JC 3PR2B 3TPCA 3DP7A 4I4NA 4LRWA 3F6CA 4NONA 3D31A 4Y8VA 2OHIA 3AJDA 4I14A 3SICE 3S7ZA 2P2GA 3DE0X 3WYFA 2G4VA 5REQB 5IKEA 4HNSA 1TZMA 4XM2A 1U0BB 4O4IF 4X62B 4DIDA 3FOCA 3LLSA 3QFFA 3H8VA 1DEOA 2F43A 2HDHA 3MRSA 1CTQA 4IV8A 3SKXA 3BMOB 4BV9A 4RKEA 3I04M 1KOGA 2XDYA 1RAGA 3CYFA 1GRCA 2MT9A 2Q28A 2HA7A 2VWPA 3EXIA 5JNTA 1EUCB 3AVUA 4IDHA 2J0EA 2WAXA 3DEAA 3G68A 1ZRSA 2PWYA 1Q0HA 3JWJA 4QGBA 3O03A 2EVWX 3QIAA 4ABTA 2PT6A 1TMYA 2ZRJA 2Y9MB 3G0IA 4PS1A 1F06A 3OOEA 2XD4A 1WPGA 2WU0A 4PZ9A 3TD2A 2VPPA 2WJ6A 4KREA 5FBVB 4ESHA 2OVBA 3EVFA 3AEZA 4O2AA 4DQUA 2AFVA 5IARA 3T3DA 4HB2A 2IU3A 2B21A 3FBTA 4WCFA 3HU2A 3G89A 2SECE 4ZCQA 4A8HA 3FLAA 4MW4A 1FZTA 3QOXA 2X0RA 1Z82A 3OTIA 5DV9A 2IBTA 3I09A 1MP0A 4MS3B 4FP9A 4ZI7A 2ATCA 2H5LA 4IMIB 1GQFA 5K6TA 5LIRA 2QGZA 1EDZA 1TDJA 3EUEA 1JQDA 1W4CA 3DD1A 4FWBA 4LJ5A 4UXJA 2WYVA 4CF4A 2QLBA 4EQ6B 5DWDA 3KQQA 5SY6A 3U2QA 1W2WB 5AUPB 3RVPA 3IVRA 2VYVD 2QS9A 4XD7A 4CT5A 1VSBA 4RMJA 1K7SN 1D4FA 2V4MA 3MBKA 1OC2A 4ZQHA 5BOSA 4GI5A 2CEAA 5AW1A 4LWPA 2Y93A 2BVNA 2F43B 3MRTA 4K9OA 4IL5A 5B1IA 3M6AA 3SS9X 5DO9A 1ECBA 2IYNA 3ZU4A 5LWQA 4Z4GA 5B1SA 4BXOA 1EUDA 4K9QA 3IDOA 5JASA 3G59A 3O7MA 4IXMA 2GF2A 2P3OA 4RGQA 2VF2A 4X95A 4QU0A 4NG5A 1V8BA 2GXUA 4O8ZA 4H7IA 2IA5A 2X42A 1EFPB 3TCKA 3U7QB 3DC7A 1GPBA 4PLGA 3HNPA 4FBMA 3NJ8A 4H7FA 4R6XA 2KB0A 4XH9B 5FL7D 4CHTA 1MJ5A 3H7IA 4FI3C 4CEIA 1BKDR 1X38A 1XVIA 2QP9X 4LE0A 4M7PA 4LJKA 4Q37A 4AN4A 2ZBFA 1CNEA 4D97A 3R9XB 1ORIA 4JXXA 1QHHB 5DZSA 2NVUA 2IH5A 4YCJA 4WD3A 1ZD3A 4CV2A 4EPYA 2WSLA 4AG3A 1IG0A 4I55A 3BTSA 4ZQIA 3NDIA 4EG6A 3CF6R 2HYDA 4EGQA 4EB0A 5HDQA 3VKUA 2NX2A 3TNLA 1ZZGA 1P2UA 1MV8A 4CIWA 4PN3A 3M7IA 1PL7A 5HXAA 5MN6A 3ADPA 1BFUA 3CO5A 4EKIA 1L4NA 3AVXA 3SZOA 1F4VA 4DR1B 1DG9A 1QKKA 3RD5A 3DTVB 3H5VA 3L0BA 1SXJC 5I9TA 1TZKA 1FXWF 4P93A 1Y63A 3HKDB 1BS1A 3QKSA 3RYHA 1CRPA 4E5SA 5J5VA 2XQJA 4ND3A 2WHYA 2FMUA 4YLEA 1NAHA 4NP6A 2GCPA 1QBKC 4YI3A 1UMKA 3K1AA 2VR1A 3PNMA 1Y82A 1EVYA 2ZBGA 1KJNA 3PJEA 1T1SA 1P45A 4FR2A 4XM1A 3T3GA 3BRQA 3AR8A 1KO4A 2RHBA 3LTNC 2H7VA 3CO0S 1A9TA 4D9HA 1RABA 3RM3A 3CN7A 4MARA 1YB6A 1JAXA 4DIFA 2Q4OA 1JHRA 2UUPA 3KPUA 2VNSA 4I1VA 3TOZA 2GRJA 4DLRA 4RJTA 3T5AA 1N25A 3AEUA 3I92A 3N3AC 2I22A 5C18A 4CEIB 2ZSUA 5JMPA 2HTEA 3TLAA 3IP7A 5FHRA 1R15A 4UNPA 1DS6A 2SNIE 4EA8A 1GDTA 2Y1OA 5HZMA 2FX3A 1UBLS 3ETNA 1YRHA 4M89A 4MO9A 3DV0A 3WP0A 2VDPB 4ENVA 3GUZA 5EQTA 3FVQA 3LKZA 3CEHA 3IVCA 4BX2A 5UKDA 4D44A 4YRKA 4FM9A 3T4EA 3PLNA 2FV8A 3S44A 5T4HA 5LQKA 1I6MA 3NC4A 1XLVA 3H1PA 1W4AA 2ZYUX 3EZXA 4PZCA 3I2IA 2NW6A 2HADA 3HWRA 4HDOB 4ZODA 1OY1A 2UYHA 1EUZA 1V26A 2SHKA 4PYQA 1I7PA 1S3IA 1I1NA 2JGRA 2WW8A 1XP5A 1IWOA 3G7SA 2XKBA 4G4JA 4K8OA 4AK9A 2ZJFA 2Y99A 1MIOA 2M6SA 3PFFA 3DEHA 5EZQA 1YAHA 1GPLA 2BGKA 3H1BA 1BCSB 3RHZA 2AKYA 1Z2DA 1I2BA 2IUSA 2PKXA 2PBFA 5DHPA 5DYYA 4EVSA 5I48A 5TDHA 2HQBA 4JEUA 1DQPA 3BE5A 2GEUA 5IM4A 4JB3A 3TVDA 1M0SA 4HV4A 2O7QA 3WNDA 2KW5A 1YA6A 3PFWO 4U2CA 4CQMD 1UOEA 2YY6A 3E6AA 3FMVA 3HLTA 4ITUA 2FNAA 3GNLA 1Z08A 2MIIA 3DHWC 2YHUA 2AR7A 1OPRA 4HJXA 3WB2A 1SBNE 1YI1A 3ZE1B 3BH0A 1AUQA 1I8TA 3DEKA 4CMIA 5DHRA 2Y0BA 3D0RA 3KSUA 3NYIA 3ZWPA 1E9EA 1OB2A 1NW8A 3ITNA 3OCZA 3T52A 4Q47A 5DM2A 1ZC3A 2Y1CA 3LGXA 3LPAA 2EKPA 3PKJA 2Y27A 2G5TA 4UPVA 3LWNA 2IZOA 4X7RA 1ESMA 1EZZA 2M32A 3ZDYB 5HF5A 4C6TA 5G41A 4GMHA 3G7NA 2YZ7A 3NVAA 4HADA 4RHTA 4D0GA 4Z7JA 1Q1BA 3EGXB 3BFVA 3EIQA 1L5OA 1BXRB 2QRNA 3ML1A 4MMXB 3EEBA 4JJ4A 5LLDA 1U9ZA 2WICA 2H08A 1X9IA 3FH0A 3Q6MA 4BFVA 1J0AA 2Z3ZA 3FWYA 2ECPA 2FW6A 1NW4A 2VQ3A 1K6MA 2JH9A 4CN8A 2OK8A 2FEMA 1Z34A 4BKMA 4RY2A 4B5KA 2FRDA 1ISJA 4M88A 3DOJA 3AV3A 4HNAB 5JXGA 2VSFA 4JKIA 4X65B 3VVBA 3U1BA 4Z3DA 4II7A 1V2HE 4BMZA 4V39A 1TZ2A 2JPDA 5A9SA 3U4GA 1W1IA 1TEHA 2AOUA 5FLXA 3LUHA 1YK1A 3EGIA 3PXUA 2RGBA 3GLSA 1WAMA 5K3BA 2C9CA 1QHFA 2AQIA 3MSXA 4HWOA 3TAXA 2VDUE 3E84A 4CU2A 3FKJA 5FX2A 4FMDB 1P4AA 2OV2A 3B85A 1XZDA 3K31A 1R0WA 4LC9A 3Q7RA 2YHAA 3JVVA 4UATA 4WN9B 5G1PA 4EAAA 4K1LA 5FR2A 1UK9A 2VDOB 2VNJA 3N8HA 2UVDA 2IXBA 3ACCA 4GFDA 3FF4A 3P9IA 1ZEMA 4C7OA 3A1FA 4DG5A 1QH8B 2QGNA 3EFHA 2OFFA 2Q99A 1JRLA 1OFVA 1GPJA 1PWHA 3RRBA 1TT5A 4W5NA 4HBGA 1DTEA 2VHQA 3JRXA 2BCJQ 3GDWA 1TRHA 2L17A 5KREA 4IWXA 2BYTA 2VNIA 1XBTA 4FGLA 4JBLA 3ICEA 3SJBA 2H17A 4TV9B 1ADJA 3K94A 5JMOA 1KVTA 3E23A 3ZD7A 4DR3B 3SBOA 1L5LA 4ILKA 3EPKA 1F2VA 3SYLA 1LLQA 1OAOA 3LOQA 3NQ41 3B12A 3PT9A 3RYHB 3ZY4A 4KYVA 1V9LA 1MHTA 3HWSA 1P2BA 2W71A 5K8JB 1YRAA 4KYIB 4IDNA 1WDWB 1ULUA 4G41A 4J9VA 4MPJA 4MTLA 4PNPA 4DYDA 5CEFA 2O57A 4MYSA 4BCDA 3LQ1A 5GTDA 4XWWA 2GPYA 4BU0A 5DCUA 4BLVA 1NW9B 1L8LA 5F1OA 4MS1A 2QK4A 2VAXA 5H7XA 5LNK6 2XRZA 4ZWNA 5I7FA 2ZRHA 4DVJA 5LZ2A 2ZBQA 1YS1X 2BGWA 2B94A 1ZCFA 4QVIA 1G3IA 4YCBA 1UBMS 1YO6A 3I34X 3IV7A 1U3FA 5IF3A 2H57A 4RK6A 1NW6A 3I6QA 3OOSA 5DULA 3DMHA 1GVHA 3UTCA 4JNKA 1S8NA 3UFBA 2XXJA 3HWWA 4AJ2A 1IN7A 2QHXA 3U17A 4IFTA 1QBGA 1UJ4A 4US0R 3B6KA 4F21A 3Q8XB 3RT7A 3KEFA 1N92A 3LTEA 2WJ3A 4DADA 5A4FS 3B6JA 1PYDA 3AHEA 1A7AA 2GEBA 1T1JA 4ZOLB 1UKCA 4HYTA 4DG9A 5FBQB 3CRW1 3WLPA 4NYIR 1P91A 3M6IA 5SYNA 4LHSA 5ALSA 5H70A 1XZKA 3M1YA 3O90A 5FPKA 4UHBA 1GKLA 4KWHA 4YWJA 1EB8A 2VHTA 4B3GA 5EIWA 4M83A 1L4MA 4PONA 3Q3VA 2VHZA 2RCYA 4UTRA 5A0TA 1Q1GA 4LNHA 4ZDIA 4YT2A 1BSVA 4L22A 4HUJA 3VR1A 2XUPA 4H3HB 3PEYA 3UB4A 1H0KA 2BKEA 2J8ZA 2Y6VA 3V3KA 1R0YA 4RLHA 4EWLA 3W5HA 5AHRA 3KLOA 3HKCB 5JO0A 2W37A 5KTKA 2AK2A 4FFNA 2VSNA 2OO3A 3O8DA 1AJEA 4KGVA 2P2YA 3VSBA 2R751 2P30A 1HE4A 3CX8A 3HDTA 3R7FA 3IT3A 3U3RA 3ZK7A 4D7AA 1KMHB 4KUEA 5AVOA 3ROXA 3VU0A 2GESA 3AO0B 2VZLA 2YFHA 5AVUA 5KAMA 3A4IA 4RIIA 4KYTA 2AJTA 3RHSA 1JHYA 3EMVA 1DVRA 5EPOA 1AZSC 3IPXA 2NO4A 3CEAA 1EVLA 3EXHC 3V00A 5FWYA 4HDAA 5ESDA 1ZVVA 1MOSA 2ZPTX 5AD1A 1VIVA 5BVHB 1XA0A 1PJSA 1RJGA 2PRYA 2CNDA 4UHCA 3RB8A 1NJFA 3D7RA 3SS7X 1JQJC 1VBFA 4E03A 2DPGA 4QAQA 1ZY2A 1KFEB 2H9YA 3V1UA 4AS1A 1G0OA 3DXYA 5CLHA 1K5PA 4OY3A 2ZBVA 1X1TA 2QIOA 3F1LA 2P0EA 5IZCA 1NT4A 4NDAA 1OXBB 1KMIY 3PHIA 1B73A 1MQSA 2EL7A 1P2GA 5ESXA 5JS2A 1AURA 1JEJA 1SHTX 3FSGD 4NBTA 4DS3A 1P1CA 2XKJE 2BFEB 3K8ZA 5G0VA 1MC8A 4CQMA 2J9FB 1ECGA 4KIUA 4NAVA 1JILA 1BVRA 1HI9A 1NBHA 2IIPA 4CHGA 3C43A 3K20A 4CMEA 3FTNA 4W7IA 3VJLA 3VHLB 3ZZNA 5C1PA 5LSAA 3U09A 1RZRA 4FXPA 4ND1A 2YW9A 4PYLA 3WC4A 1B8VA 4JGGA 1ONSA 4FEEA 2AX3A 3PQ3A 2AJLI 2Z1DA 4GLLA 4LMBA 3M5CA 3WZ2A 3MPUA 4OMUA 4GS5A 2ORWA 3MMXA 3EIUA 3A3PA 3B2NA 2PZKA 4LXHA 4ZVTA 3OIWA 1FYXA 1YA4A 3W5BA 1GZUA 2HMYB 3ES9A 3ZHTA 2P11A 4NCBA 4Y0AA 1GCUA 3ELUA 1J1IA 4JU8A 5E7JA 3PTAA 4QOIA 5H02A 1QFZA 2GPSA 1VM6A 3B60A 3BMXA 3JQPA 4YCSA 1PE0A 1GL3A 4E21A 2YV1A 4ZYVA 4JS0A 4A36A 5KX5A 1AE1A 3EWIA 3W6PA 2XWBF 4CQLB 9LDTA 1GT6A 3BWYA 4GM0A 1MB4A 4AYWA 1WCWA 1MJHA 3PUZA 5AJWA 2WJJA 3OD1A 2W43A 1MRSA 4ZRDA 3THOA 3VGJA 2XMRA 3C3BA 4D99A 3U5TA 2ID9A 4GOMD 4C07A 1DIRA 2HA6A 4UBLA 3E7FA 4U3JA 3ISTA 2ES4A 2AB0A 4U2GA 3A9UA 1A4UA 2VHJA 4Q15A 5AIAA 3A0UA 5BY2A 3UUWA 1NMSA 2BPOA 2BRUA 5DHTA 3ZHRA 2ZIWB 5H8WA 4BFXA 3C1UA 4QYIA 1KI3A 1T9AA 3JQFA 4RK5A 1PFKA 3EUFA 2X6TA 1J9ZA 1X7WB 4ANFA 2O05A 2AZTA 4D5GA 5J1TB 2DF8A 1MF7A 4IIHA 3K9GA 1UT5A 2QTZA 4I8DA 1E5XA 3FGZA 7AT1A 2DGDA 3BE8A 1RI5A 2G9VA 4IUBS 3GQVA 4HJRA 3S27A 5C4IA 4JJFA 3HLKA 1UAAA 3P19A 1YFJA 2HA3A 2Y8EA 1W8IA 2JC3A 3NFYA 1UPAA 3KQKA 1A95A 1HL7A 4F4HA 1L5WA 3PVZA 3RPEA 3LBNA 1RWVA 2AG5A 3DAPA 3EOZA 3G9XA 4PQYA 5AK5A 4R0MA 4JC8A 1WSBA 5B53A 3TB4A 2VT3A 5JI2E 2TMGA 3FM9A 1E3DA 1N7JA 2C9BA 3PNLA 3WYEA 5KIAA 2FUG6 1BXKA 4OO3A 3A11A 1SHLA 3LI2A 5I6DA 4O4HF 5ULLA 1NQWA 1XU4A 4BP8A 4LS3A 3SXUA 1WHTA 2EOAA 5ALUA 4PRLA 4B6QA 3E2PA 4FCVA 1UDXA 3ZE8A 1VGVA 5JJ5A 1JLRA 1LUAA 2XOXA 4R40A 2JCVA 1C3OA 4PN7A 3IPRA 1KFJB 1E64A 2GNPA 5KHOC 4KN9S 1PGPA 5FV7A 5ALVA 1B4DA 1ZSVA 1K6EA 2X9VA 3NGMA 1IB6A 1WMFA 1WABA 5HRAA 1LJUA 4O1MA 4AKIA 2WHQA 2PMEA 3IMEA 4R83A 2GHTA 3HP4A 3LDAA 1TEXA 1RSZA 3G1WA 3JQDA 5CYOA 4HX2A 1DC7A 5CH8A 1O03A 4UTOA 3SYNA 5ALYA 2P8SA 3QP9A 3SFTA 2P8JA 4PRYA 3OURA 4ER6A 2Q2WA 1PNTA 3FPGA 4MRNA 1HT1E 1ICIA 3PNKA 3QXGA 5CTJA 2VNKA 1XVAA 3PX2A 4B6EA 4CM1A 3PA6A 2J45A 4TKMA 4QC2A 2Q50A 5I51A 3UHAA 1F0PA 2BTOA 4XSGA 5IABA 1SH7A 1W581 2JAUA 2V7UA 2VDWA 5DIZA 2O4CA 4F4FA 4QPJC 2O0LA 3KKLA 4ZI2A 3PWZA 1W6RA 4ALLA 3N2YA 1EIZA 1D6NA 3RBVA 4CWAA 3JU3A 5CPBA 1FUYB 3R5JA 1PQPA 1W94A 4FR0A 4FDMA 4E46A 2LE0A 1JDBC 1JSLA 3NBMA 5KI6A 2IHYA 3SLKA 4N3NA 1X6VA 2CDCA 4QXRA 3SQOA 3D6NB 4ZI5A 1UXJA 4ALJA 4B4DA 2GZ1A 5BR8B 3SYKA 3E82A 4DLBA 3L01A 1G16A 1QH9A 1T6YA 3BICA 2C4MA 2G8NA 3ED1A 2X19A 3KD3A 4GICA 5KWEA 4M99A 1AA6A 4GZ6A 1UFKA 1YCGA 1OBCA 2R8PA 1DDGA 1ZK1A 2XTJA 4JH0A 3FR8A 4JJEA 2C9YA 2WIBA 3CLSD 3EIHA 4KG7A 5KYWB 2P9QA 3DOEA 4W6QA 1QF6A 4C6SA 1SN7A 3R24A 2O3RA 4AMVA 2ZIXB 4F12A 4F45A 2CKDA 3COPA 4X91A 3L4EA 1E7QA 4G4SP 3FA2A 4IGEA 2PD3A 4HQRA 3AR9A 1LA2A 3E61A 4H7KA 2HA2A 3EMKA 1DE0A 1LY1A 4J1QA 4JJGA 4TUYF 3SZRA 2FFJA 3HP1A 4MV5A 3TEFA 2ECKA 1W30A 3AXSA 3DGEC 4TS1A 3H1FA 2I3ZA 3WL4A 4P98A 1I2DA 2GYYA 2I6SA 3RWBA 5A02A 2WU1A 3AJEA 1H4SA 3DZJA 1HG0A 3EODA 4YJGA 4JT4A 3MS4A 4EJ0A 4UAUA 1QMGA 3IVXA 3EVBA 4AZVA 4AKGA 2AOWA 4P34A 1K8YB 5IPFA 1XNGA 1SKYB 3FSEA 3K9BA 2PL9A 1L3IA 3AUFA 4MUJA 1AN9A 2QMHA 1XMQB 3OHMA 5E8RA 3KZXA 1QCCA 2AE1A 5ECWA 1TD9A 2FR0A 2L0XA 2ZUEA 4HKTA 3NEJA 4DWWA 2W11A 1C7RA 3DWIA 2C1EA 2I66A 5ARBA 1VHLA 1T8RA 2XDWA 2C54A 4KR9A 4GI2A 4KE6A 5JSZA 2WFAA 1ZD4A 4FR5A 1GITA 2LKCA 3A27A 1DAGA 1U0EA 1UFQA 3L49A 8ADHA 4BFLA 3SG0A 4UW9A 3QLJA 1CQJB 1G7TA 2X4DA 1GSHA 1U7ZA 3U4IA 2YDXA 1DXQA 2VZ9A 3QWHA 1XRLA 3GJRA 3UGKA 4EJSA 3D0OA 5DX1A 2W4MA 3STWA 3OM9A 3G79A 1FXUA 4L4RA 3KXIA 2RG1A 2OZKA 4FZ5A 4J1TC 4NEHB 3DFMA 2HMVA 1D6MA 3E9QA 1T2UA 1YL5A 2X5JO 1DPGA 3I6YA 2AZXA 4AXBA 5FLEX 3HDQA 2KQUA 4XVUA 5GZ1A 1Z3IX 3TO5A 4IQ8A 3H6GA 3OUTA 2GN1A 3V8PA 4KQKA 3OLYA 4E0BA 1WUIS 3IEIA 3FPLA 4NU5A 4JVLA 1DKPA 3RF6A 3USCS 1U8EA 5BSTA 4ARSA 2FF7A 2PH7A 4IDFA 1GTSA 2GDZA 1JJ7A 1NC1A 5TNXA 3LZCA 3GL9A 4CM4B 1RQGA 3FTPA 3L18A 4CTNA 3FPHA 3UV3A 1XWWA 1DELA 4UVHA 5DYTA 1ZU5A 3OJWA 2F8SA 1WOMA 1YHZA 3EC1A 1OJLA 1O96A 4RS4A 2HU7A 1T91A 5CXXA 1A9XB 3NJRA 1Y3AA 4C78A 5JJKA 4JNCA 1TZJA 1L8AA 1Z74A 1C7JA 3VNAA 3ZTWA 4HQLA 4JD5A 3UN1A 2CV1A 1W5AA 2IEZA 4NX2A 4HDRA 1IY2A 5H16A 4XYLA 3C3DA 5AVYA 1MAUA 1UXHA 4M60A 1GRVA 1BW9B 3CW9A 3KWFA 1T24A 2X5XA 3N53A 1DQZA 2QX4A 4P7JA 3TIGA 3EASA 4RE5A 1AF4A 1O94C 3C6ZA 2O2XA 3SJUA 5DIFA 2Y3IA 4YP7A 3VOBA 5CHYA 3OKAA 3JR7A 2JGKA 3FB4A 4D5EA 1PEAA 5FF9A 2Y1LA 4NARA 3TMYA 3ZR4B 4EENA 5KYWA 2WKQA 2TSYB 1F0NA 4JQOA 4PBSA 4RQBA 1WG8A 2XEDA 1WMSA 2GWHA 2AMYA 2YJ5A 2OHXA 2OWEA 4A8JC 2B1QA 1RM0A 1NJ5A 1WW3A 2IYPA 2M6RA 2WFMA 4D3XA 4NOMA 5I8WA 1PNOA 4H1VA 1TK3A 1AKQA 4O0MA 4KXWA 3IKTA 3VH4A 4HFMA 4WK6A 4WK0B 5I9SA 1GLNA 5JO9A 3R2JA 5I7UA 1ECJA 1O87A 1QM5A 1K9VF 3KXKA 1EK2A 3UMGA 3ZJ5A 4HLDA 1EVIA 4R16A 4CF5A 4EA7A 4I8XA 2FRVA 4AO7A 1D9ZA 1J2RA 3SC4A 2R8ZA 3GR6A 4INPA 2UXCB 1Z68A 1AU9A 2J0VA 4CMAA 3H13A 4RKWA 2BEVA 2C7GA 4DLKA 6LDHA 1RBZA 3NTVA 1QHXA 2QXYA 3E9RA 5KBYA 1WZCA 3NV7A 2CFTA 4QGGA 5BQOA 3O4FA 3GV0A 2HDOA 3QV2A 3ABOB 1IOLA 3RWOA 4XD7D 3UHOA 5C80A 1YQWA 5JJLA 5DEIA 5A5VA 2QLTA 2HQSA 1C14A 5BN3B 2A88A 3ABIA 3ESRA 3C8MA 3ELDA 4HLQB 3W5SA 5FI5A 1B26A 1PR3A 2ID7A 4BKQA 5CW1A 1YUNA 1N2ZA 2CLSA 2Q5EA 3PJGA 2A92A 5HCNA 1P9NA 4P3PA 1HDZA 3V4PB 2FW7A 4ZN6A 3OQOA 3AUTA 3E9EA 2C5BA 4JBGA 4DKJA 4UTZA 1E7MA 2PJRA 3HUFA 3EDOA 2J4FA 1M8PA 3PQFA 1NFRA 1E3QA 1JP7A 4FNAA 2FSUA 1BKYA 1T4MA 1W5EA 3OEWA 5AOVA 5IAJA 4OHZA 4AJNA 3J81k 4F6LA 3L6EA 3U7QA 2HCBA 2GZMA 1HQYE 3U13A 3ZQJA 3ETCA 4Q48A 3RVLA 4CCAA 3S8EA 1CDDA 3ZDAA 4OA5A 1RE0A 3FOBA 2DP4E 1IIBA 1SK8A 1EFLA 4R8KA 2GFQA 2XGJA 2IOHA 4AIIA 3QI7A 3HI4A 4OHRA 1CHDA 5I9MA 3T7KA 5CVVA 2NXCA 5EQJB 4NCIA 2CLDX 2HC9A 1NFFA 2P90A 2ZCUA 4PGFA 3A04A 5CFOA 5HW0A 4HP8A 1SXPA 1RR6A 3NBUA 4QUGA 1K4MA 2BTQA 1RC8A 2RAFA 5I7SA 3LMKA 1USWA 4J0JA 4NENA 1SCUB 1OXVA 1PR4A 5DVZA 2DFVA 3LY8A 2BF4A 1SO8A 4D8WA 2MDTA 3HB7A 4NY1A 3NGXA 1KEWA 4YC7A 4XWKA 1E8NA 2QD3A 2Z8ZA 3RG8A 4C05A 5GVSA 1KY3A 3IP3A 1ZXBA 4K3UA 3UM9A 2FWJA 2GRAA 2GAAA 1NJSA 1ZNWA 4CLOB 4EB6A 1KO5A 3GFQA 2QQFA 1DAOA 4Y2GA 5AHWA 1Y9DA 2Q4TA 5F73A 4AF8A 2LKDA 4B0PA 4C20A 4E2YA 4CTMA 2ST1A 3U9SA 5KTPA 4CLRA 4O4LA 2EX4A 1W9MA 2C00A 3VR6D 3GVHA 1FYWA 1UKZA 1EWTA 1FNDA 1S9HA 3D6VA 3KU4A 3O0DA 3BQ9A 2G4LA 3KG2A 2HTFA 4PR0A 3THRA 3LHFA 1F4PA 2DECA 3OD5A 2PYZA 2V6JA 1R16A 5ELLA 1IWBB 1B3RA 5L3QA 2CXXA 1LW6E 1KE1A 5IDVA 2B8WA 4P3OA 2WLSA 4XCQA 1J33A 1TFRA 3BK2A 5LKAA 3GD7A 1UFRA 4TSKA 3W78A 4YJHB 3QIVA 3KJFA 1TQ8A 3O2SB 2CZCA 3KSZO 4DPLA 4BVAA 4CPDA 1FFYA 2M1XA 2GH1A 1K2VN 3ZWCA 2ZIEA 4BZQA 2WG1A 1NN3A 3VH3A 4U0KA 2FP4B 3KOOA 1I6WA 3ZGYA 5B2FA 4MZDA 5KEIA 4W82A 3TX2A 4XM0A 1EWVA 1KSJA 1V7ZA 2EATA 3DF9A 1A72A 1YR6A 4PGHA 3TSCA 2K2WA 3ZHYA 4ZO9A 2BFBB 3GZJA 3ZQ6A 4BMSA 3WLIA 2IPAB 1IONA 1ZH8A 2Z4SA 4CM8A 4ESEA 4MVCA 2H5JA 5JCPA 4JUFA 4ZJUA 1MO2A 5DBGA 2O8CA 3DWFA 4AZ3B 3SF8A 4J7XA 4RAOA 3DE1X 3AQ4A 3O93A 5IUJC 4YRDA 4YUVA 1XNHA 3WVNA 4WMLA 4ZYYA 2DCUA 1NUAA 5TQ0B 3TIIA 4CZ2A 2GS9A 2AHRA 2I4LA 4W8OA 2WM2A 1WD5A 1OX4A 1SC9A 4HUQB 1VPWA 3M9WA 2QUJA 4IINA 4MEJA 2IITA 3CCFA 4LC1A 4RA6A 5AM0A 3ULKA 4KXFB 5FBLB 4KO3S 1EAYA 3IKMB 5A5EA 2IS4A 1NRXA 4QKQA 3VGPA 2V7WA 4J76A 2BKAA 3FMGA 4Q21A 1E1RA 2JGFA 3TRFA 2H3EA 4EUKA 4YB8A 4QT4A 2WU4A 1G3UA 1JG4A 3UJBA 3CKMA 2QVYX 3O3NB 4QBFA 4TZTA 2QE6A 1NLUA 3F4LA 4MGEA 3R7WB 1THMA 2YV4A 1L3BA 4UE3S 5DLQC 1U5BB 1E2IA 5TEWA 2IYTA 2ETXA 3EARA 4XE5A 3VM6A 3IRUA 3DUFB 2HK6A 1SVIA 1X7DA 5CXQA 3ADDA 3DBVO 1VKHA 1RIFA 3OIYA 2IODA 3I1IA 4PAGA 1L5GB 2ZIVB 2ZJ0A 3NH9A 2QMUA 4I0WB 2HO5A 4A73A 1E0KA 5GP1A 2K4MA 5CLFA 2B5OA 5BUZA 2IUYA 3P9QA 1P5JA 1BZYA 2AT1A 4OXXA 1C1HA 5HTKA 1ESDA 5KQLA 1LX6A 2H2FA 2I3DA 1TADA 2XODA 4TRNA 3CVXA 4EG7A 3SVZA 2X9NA 5TX7A 3BCSA 5E1OA 2P4QA 4G84A 5TC4A 4FYWA 1SZCA 4D8XA 1DKUA 2DBYA 3JAWA 3W05A 4YR9A 7REQA 3BGWA 3G2PA 4C04A 3NYRA 4ZZ3A 4BUZA 3EQZA 4L7QA 1W88B 2O0HA 1ADFA 4HAYA 3RLIA 3IT1A 1F8YA 2O2HA 5LMUB 3FUCA 3KL2A 4OJQA 1G9TA 3ABZA 2ZTHA 5K8VA 2O48X 2ETVA 1FNCA 1M2GA 1QZXA 1XCBA 3BILA 4QASA 4RBNA 2BFAA 2ORYA 3WK8A 2B7BA 2OC4A 5LUBA 2Q4RA 4I5EA 4I7EA 2PSJA 3NBFA 3PRYA 4OREX 3S70A 4G56A 2WWYA 1EUCA 4QJ5A 2V6BA 4DCOA 4N3BA 1SUCA 2AEMA 3G0GA 1KDTA 3PVCA 5AXDA 3ESQA 1QIGA 4HN2A 4W5JA 4OSOA 2I9PA 1Y81A 2IU0A 2AMVA 3CWQA 4FGWA 3U48A 1SNYA 4XEHA 1SUPA 1YUMA 3DB1A 5BV7A 4B7AA 1G6Q1 1Y4ZA 4WJZA 3ZS9A 1DKMA 5TVKA 4YRMA 4MK4A 4V0LA 8OHMA 4DC1A 2J85A 1HFJA 2C61A 2IFTA 4KNVA 4W5OA 4RGVA 3OZGA 1G42A 2FPWA 1I5RA 3QF4A 1MC4<