4BL5A

Crystal structure of human gdp-l-fucose synthase with bound nadp and product gdp-l-fucose
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
314
structure length
314
Chain Sequence
SMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GDP-L-FUCOSE SYNTHASE
publication title Crystal Structure of Human Gdp-L-Fucose Synthase with Bound Nadp and Product Gdp-L-Fucose
rcsb
source organism Homo sapiens
total genus 110
structure length 314
sequence length 314
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bl5A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4bl5A02
4L73A 1GV1A 2UUPA 5EMHA 1GZ3A 4TVOA 4BNMA 2DAPA 2OP0A 3MTJA 3IIEA 4KTVE 5DBGA 1P77A 1ADBA 2PD4A 1BXZA 2OL4A 2JFHA 5GZ1A 3LF1A 1WDKA 1U3TA 4II3A 1L7DA 3S1LA 4MVJA 5JYEA 4G2NA 4XYBA 2WM3A 3TZCA 5L7WA 1RKXA 2C0CA 3KYBA 4J7UA 1P1HA 4A73A 1EUCA 4AICA 4HKTA 1WAMA 1NAIA 2VCYA 2XPCA 5JSFA 3HDHA 1YRLA 3NTQA 4NDNE 1CQIA 3EHEA 3N74A 2IZ0A 3NGXA 4QEDA 4P4NA 5ER6A 3WOHA 4DXHA 3AW9A 5HBRA 1N7GA 1E5LA 3A9WA 2VWPA 4D3DA 2WE7A 3RBZA 1NPYA 4RVFA 3GMDA 5JW6A 1PS0A 2J3HA 4ROSA 1ADFA 1TT5B 2EGHA 2PV7A 3IP1A 4EI2A 4MOWA 4AL4A 3NDRA 3I23A 4UULA 2FY8A 2B36A 2GN9A 4MVJF 2Y0DA 5TNXA 4R68A 4S3MA 3WQRA 5THKA 2VQ3A 4GMGA 3WIDA 1SC6A 2A9FA 1U8FO 5A5FA 4UVGA 4XEHA 3OQBA 4TROA 4DWVA 3ZV3A 3FI9A 3MTGA 2D59A 3H3JA 2PR2A 3DBLA 3E9MA 2Y0EA 4IXTA 2Z1MA 3F6YA 4CUZA 3PWZA 3GUYA 4CV2A 4EUHA 1Q0LA 3CPSA 5L7YA 1GDHA 4FC6A 1C1DA 2GYYA 1O94A 3AY3A 3TWOA 2WEKA 5T67A 5KTKA 4PLTA 5JXWA 5BSFA 5KIAA 4QECA 4RVGA 5I7VA 1M76A 4FFNA 2IXAA 4XYMA 2FPGA 4RZHA 1VKOA 1CEQA 3GFBA 3H5NA 5KVQA 1A4UA 3PHLA 5A5EA 4E5YA 4YT4A 2Y68A 1PJCA 4AJOA 1O95A 2E48A 4J4HA 1SZJG 3JQ7B 3T7EA 4M49A 4RO0A 4XKJA 1PJLA 1M66A 2B5VA 1O9BA 3FWNA 2GDZA 1ISJA 1J49A 1PJBA 3DHNA 4BMVA 4DREA 2X7HA 4MO2A 1E7QA 3JQFA 1LDGA 3NJ4A 2DBZA 4JROA 4NH4A 3C3XA 1JTVA 1T1SA 3WYCA 1SBYA 1EVJA 2YHUA 4WK6A 4YYZA 4DMMA 1CETA 4DA9A 4ND4A 4A03A 2CUKA 4GMFA 1ULUA 4IJUA 3VH4A 3ZWXA 5I8WA 3HN7A 1QYWA 3RUAA 1HE4A 1TLTA 4N7RA 2UYYA 3AUTA 2XXJA 4IDEA 4J0FA 1E7RA 1LDBA 5F1PA 2VRCD 4CLOB 4IM7A 4TRRA 2R00A 5A4DA 4EZBA 5ILOA 3K31A 4YWJA 2FSVA 5G0TA 4LSWA 3FBGA 4PG4A 4NJMA 5JC8A 3C8MA 4BNJA 4MPDA 1LEHA 3L07A 3NTOA 4E30A 4UREA 1MC5A 4CM1A 4D3SA 3D5QA 3DAFA 3PYXA 2NUAA 4LISA 3OF2A 4KQWA 3PFFA 4J43A 1E1KA 1P1FA 4OXKA 2BRUA 3GA0A 4BO6A 4M8SA 3OEWA 1I5RA 4XGKA 4W82A 1LUAA 1P1RA 2GUGA 3NV9A 2QYTA 1LX6A 1Z75A 3NDIA 1YS4A 1Q7CA 3VH3A 1MP0A 4EJMA 1XIVA 4FS3A 5JMWA 3I4CA 1KEVA 4MJLA 1R15A 3FTPA 4NBTA 3JQBC 4NK4A 4ZN6A 2ZTMA 1HEUA 1HKUA 2OBYA 2NLOA 3IL2A 3VVBA 3S2IA 1QMGA 2NNLD 1I24A 9LDTA 2B37A 4Q3DA 1A4IA 2Q4BA 4L4SA 3F4LA 3LT4A 5JMPA 3GEDA 4NBUA 4FOOA 4O0LA 1Q1NA 4IIUA 1AHIA 4KDFA 3JYQA 2VOEA 4ZQHA 3JTMA 4B7CA 1U2GA 4WOKA 4CLRA 1EQUA 2VHYA 1NHGA 4MVJM 2CF5A 5JAMA 2VHVA 1U2DA 4L9RA 1JLLA 2CZCA 3WYBA 5G0UA 3FD8A 3RC9A 5TS3A 2B4QA 3I9MA 2VTDA 5COQA 1XHLA 2FMUA 5IG2A 4WCFC 3D64A 3EC7A 1PJ4A 3VPGA 1WZEA 4IGFA 4RL6A 3ZNOA 2WWRA 3NGLA 1E3WB 1D1SA 2ZB7A 1XLTA 4I08A 5BSEA 1D8AA 1ZXBA 5HTOA 3IUPA 3JQAD 4CQMD 4ND3A 4TRJA 2Y99A 2ZB4A 3MEQA 1VI2A 3BZUA 3D4NA 3E5MA 4BQRA 1DRUA 1C1XB 4ZQFA 5L9AA 1U3WA 1T24A 2GN6A 3KYCA 2BHLA 4LW8A 4BO4A 3CSDA 1VKNA 5A05A 4H3VA 4FFOA 3P2OA 1ID1A 1YDEA 4D7AA 4IDAA 5ENDA 4JGBA 4QSMA 2QG4A 3O26A 4HADA 1L7EA 2EV9A 3FHLA 4ITUA 2EHDA 1B3BA 4CL8A 3GY0A 2RH4A 3RFXA 4QO8A 1ENOA 4YCAA 3NEPX 1B26A 5HWSA 1CF2O 1UZNA 1G0OA 2VWGA 4NR0A 1IUKA 1GR0A 3ZV4A 1KVTA 4J3FA 5KJ6A 2EGGA 1ARZA 3P7MA 3JD4A 4ID9A 4OH1A 2B83A 4TSKA 2Q4EA 4K28A 4YAEA 4WCFB 3WWYA 3AWDA 4KWHA 4Z9XA 2G17A 1HETA 3WGIA 2R00C 4RV9A 2HRZA 3I4FA 1JAYA 2DLDA 3KSDO 4RPKA 3GGPA 4A7PA 3RC1A 2O48X 5JY1A 2ZJ0A 5H82A 2WYUA 3S2GA 1KVQA 1KYQA 1NQOA 1GCOA 4B4UA 1QLJA 2HQ1A 4YAJA 1PGOA 1E6UA 3GRKA 3D4PA 4RPLA 1O0SA 4NFHA 4RVDA 3W8EA 3A06A 2D1YA 3GZNB 2GGSA 1HYGA 4M1QA 5A9TA 4E5MA 3AUAA 1ULSA 4ND2A 3TJRA 3BTUA 4I9NA 2YDYA 1AXEA 1ENYA 1UXIA 5F3RA 4H15A 1AGNA 4YAKA 1X7DA 1C0LA 1YL7A 2J3KA 1UP7A 3QLJA 3JQCA 2QZZA 5HS4A 3X2FA 3RCBA 1RM0A 1NFRA 3H3FA 4TMFA 2FOIA 1C0KA 1I30A 1B8PA 4RORA 2HMSA 4EUFA 3V1TC 3G3EA 1Y9EA 3DONA 2JKVA 1S7CA 1YOVA 2FWMX 3K2EA 4JBHA 3KBOA 4X54A 1VE9A 4BL5A 4WEOA 4R1NA 2F1KA 2AE2A 3WB9A 1A72A 1DC6A 1ADGA 3FNEA 1ISFA 3C1OA 3W1VA 2VHWA 2ZB3A 3IUSA 3FCOA 5FF9A 3I9NA 3WIEA 1NWHA 1NASA 2B5WA 1EQ2A 4BO0A 4TWRA 1NYTA 5JCJA 3ZCXA 4CODB 3V8BA 2VTEA 3GVPA 5FYDA 3WS7A 2O7SA 5A9SB 4OQZA 3ZU3A 4EUEA 1UZMA 1U3VA 4MVJP 2OOSA 3OIDA 4UVDA 4DGSA 3C7CB 2PZLA 2YV2A 4LVCA 2FHSA 1BVUA 2C07A 3KZVA 4WASA 4CV0A 1PWZA 1DIRA 4YACA 3M6IA 4O1MA 4N18A 3VTZA 4G81A 4BGIA 2O3RA 3INGA 4TKLA 1ZMTA 1R12A 3QA9A 3DEYX 1DXYA 2Y05A 3JQGB 3EVNA 1NVTA 3DDNA 2X9NA 1XEAA 5A03A 4M87A 9LDBA 4Q3EA 2Q49A 5JDIA 5JBIA 4PVCA 4IZHA 4JXKA 3DZGA 4OMUA 3Q3CA 4BGUA 1UP6A 2LDBA 4CM5A 3RBXA 2O3QA 3UAGA 1HSOA 2YW9A 1NBOA 3U62A 1BHSA 4GQAA 2V6MA 1P9LA 4Q3AA 5F1OA 3GDGA 1CRWG 3WGYA 2UVDA 1QYVA 4WNIA 1U7TA 1E7SA 3LZ6A 4PLGA 2Y0CA 1DBVO 2E82A 3HB5X 3BMOB 3AFMA 3H5AA 3H6KA 3UGKA 5FEUA 3PDUA 3WTCA 3ZHXA 4RLSA 1OZAA 4Q3CA 5KWEA 4DBVO 2GZ3A 3VTFA 1PSDA 3OJEA 1XELA 2A4KA 5ITWA 1SO8A 1MG5A 1IYZA 4B4WA 2W2LA 1N92A 3IJPA 4E4YA 4F45A 3UCEA 3F4BA 3PHHA 1NNUA 2GPTA 4BNHA 4XWYA 3ZW9A 2O2SA 1RYEA 5FWNA 4YPOA 5CEFA 2AW5A 2H5LA 1BDMA 3GVXA 2P4QA 1GYPA 3OECA 5DT9A 1DLJA 3KSZO 4J2HA 1UR5A 3DOCA 3QWFA 4XGNA 4OOFA 3ZV5A 1D3AA 1UXKA 2I3AA 4EBFA 3QV1A 4BNLA 1PEDA 2POQX 4WECA 2NU8A 1LSJA 4DC0A 1E5QA 3IP3A 1PZEA 1WMBA 1HDRA 2VOJA 3GDOA 3SX2A 5KVVA 1UAGA 3ZWNA 4AJIA 1R37A 1YWGO 1ZJYA 3PHJA 1E77A 3LT0A 2AQKA 2TMDA 1R16A 2A35A 4BNWA 4P22A 2V6GA 4GVLA 3L4BC 1QKIA 3GHHA 1DJQA 3ASVA 1QSGA 1YJQA 1EK6A 1NPDA 1E3LA 1OI7A 3AFNA 4KTTE 3VPXA 5TJHA 2DM6A 5A02A 4MP3A 4CQMB 4YAIA 3HQ4O 4NG5A 3U4HA 3PQEA 2HAEA 4I5FA 1AXGA 2BFAA 3CEAA 4UUNA 1HE3A 3IKVA 1Q7BA 2TMGA 4CM9D 5CG1A 3WICA 2IRWA 1G1AA 1KS9A 3ZNQA 4BNFA 2V7PA 4DQVA 3AU9A 3WGHA 3H9UA 3HB4X 1G6KA 4D45A 4Q3NA 2EP5A 4NMHA 3SJUA 3QE3A 2V6FA 2X22A 3BMQB 2D2IA 2OMEA 3PLRA 2JD0A 4LMRA 1ISMA 3DO5A 4BS9A 5B4UA 3LC1O 1ZJZA 1GV0A 1I3MA 2CMDA 3O8QB 1F17A 3I5MA 4W7HA 3TDKA 5DN9A 1BW9B 3DTTA 3ULKA 3OBBA 5IN4A 5G2OA 1HE2A 1VSVA 2GLXA 3AK4A 4PLVA 4O63O 4PG5A 5IDYA 3GDFA 5L3ZA 1HZJA 1X0XA 5CEJA 2EP7A 3RSHA 4I8XA 1H2HA 3VKVA 3WYEA 3WJ7A 4PLYA 2EJWA 2ZCUA 3GGGA 3ADPA 3KM0A 4XYEA 4C7JA 3RASA 1PZGA 5CP8A 4E5NA 1TI7A 5L4LA 3D3EA 3TFOA 1BG6A 2PGJA 5BNTA 4GVXA 1GADO 3GVCA 4XRGA 1I8TA 2NQTA 1YXMA 1I3KA 4QQRA 4P4GA 4HV4A 3RWBA 1DPGA 2VRBA 4GPD1 2R6JA 3ETEA 3F1KA 1XYGA 3KYDA 5EESA 3WLEA 1T2FA 1QXSA 1PL7A 4CR8A 1A7AA 1K6JA 1A9YA 2CVZA 4YRBA 1GCUA 4ZU3A 4EEXA 5MGBA 3MJ4A 4FBGA 4FFPA 5BQFA 4K1LA 1JWAB 3FNGA 2P9CA 4FCCA 1JW9B 1N1GA 3VDRA 3VPFA 1LBEA 3CUKA 3L6DA 3E9NA 5U4QA 4L4XA 1Z73A 3E9QA 3RUHA 2JJYA 2OHXA 4L76A 2ILTA 2X9VA 4XQCA 3AUUA 1EEHA 4LSMA 3Q0EA 5CHEA 4GWGA 4PVDA 2HCTA 4JJGA 4BNGA 1OC4A 4YTEA 1A7KA 5JS6A 4OIMA 4Z6KA 2PKQP 4BNVA 4CQLB 1PS8A 4E6PA 4DVJA 1SB9A 1V9LA 1C14A 2GSDA 1A5ZA 3HDJA 1BTOA 1NAHA 1LRLA 1UXHA 1W4ZA 1BXGB 4EJ6A 4ZJUA 1PJQA 1IZ0A 1PJ3A 4PLWA 3ETGA 3GK3A 4PG7A 5IZCA 1QV6A 3PIIA 5KJEA 2W2KA 3Q2IA 4B79A 2E6UX 1LC3A 2BF7A 2HDHA 1WPQA 2YHIB 3MJEA 2VHXA 3ZWYA 5LDHA 4A0SA 1H2BA 4U8GA 1NP3A 4FGWA 3W4KA 2C20A 3EZLA 1TT7A 4K6FA 2VWHA 3C85A 1KEPA 2FR8A 4JBIA 4JBGA 4CMAA 1IL0A 3IDSA 2JL1A 4H16A 1TVEA 1E3IA 3JQ6A 3GT0A 4AJJA 1HLDA 5T8KA 1H9AA 3FN4A 3TN7A 5CFZA 3OH8A 1JVBA 5FFFA 2X58A 1P0FA 5TRTA 2HMWA 1TB4A 3S55A 1LDMA 3WR5A 3VH1A 3JD0A 4XX0A 3RIHA 4XCVA 3HFSA 4WEQA 4BNNA 4OHUA 4YT2A 1VSUA 5AVOA 3Q6IA 3AI1A 4RF5A 1I01A 3ROPA 1KC3A 4FD3A 4AG3A 4MKRA 3BHJA 3I1JA 1YKFA 1PR3A 1V35A 2NU6A 3GNTA 1K6IA 4IDCA 3L0DA 3ONFA 1AHHA 4KUGA 2NVUB 1T2EA 3WG9A 4LK3A 2X9GA 1JDJA 3CXRA 1P31A 1XWFA 1R6DA 5IAAA 1FDWA 2J5KA 5TSDA 3JYPA 3U4IA 2I99A 2ZTUA 4GSLA 1DC4A 1IOLA 1EFKA 1GZ4A 1X1TA 2I5PO 3B1KA 3AY6A 1YQGA 3JQ9C 1MX3A 2V65A 1QYXA 2O3TA 1FDSA 4ZVVA 2RIRA 4IDFA 4TVBA 1PJ2A 2O3JA 4F6LA 3ROQA 5B1YA 3IS3A 1NFFA 2JAPA 3ANLA 4WLVA 1YBMA 4NFSA 3GLQA 3R0IA 2W4QA 2Y1DA 2Y1CA 1Z7EA 5EJ2A 3X2EA 3K6JA 1ZH8A 3D5TA 5LCXA 4D0RA 1ZK4A 1JKJA 2J5QA 4KQXA 4Q3BA 5B4VA 1Y8RB 3KSUA 1W0CA 2CDBA 2QIOA 4BO7A 2WYWA 3U9LA 4CM6A 4JQCA 3D3WB 4YT5A 2YYYA 1E7MA 2V6BA 3I83A 2Y93A 3RC2A 3R3SA 4MVJG 4EGFA 1ZW1A 3RUCA 1I2ZA 2DUWA 3EVTA 3I9KA 3DBRB 2D3TA 2Y67A 3DTYA 1BWSA 2HO5A 1JVSA 3S2EA 1IZ9A 3ADOA 3DMYA 4D3FA 1MG0A 1W6UA 1Y1PA 4HP8A 4R3NA 2DFDA 1V3UA 1YGYA 2UDPA 4IJVA 5JO0A 4EJ0A 4KDEA 5TX7A 4E21A 4GLOA 3BHIA 4FR5A 5C7IO 1QR6A 3UICA 1Q2XA 4HFNA 1JA9A 3OJOA 4CMIB 2AHRA 4CL3A 3DHYA 4YBZA 1ONNA 5AXDA 2EIHA 2EW8A 3ST7A 1LU9A 4LN1A 1Y8QB 3JQ8B 4FSHA 4MINA 3TRIA 1A71A 2OZPA 4PLZA 4CMEA 4WE3A 1ZNQO 1XCBA 3DZJA 2J6IA 2Y1EA 3KV3O 4J4BA 3WGGA 1ISGA 4IY1A 4GX1A 2LDXA 4IUYA 1KC1A 3A14A 3BA1A 1U4OA 1MLDA 1LSOA 3ZNNA 5U9CA 2NTJA 1YL5A 1I0ZA 2VZ8A 4EITA 3C7AA 1F06A 4UUMA 4F6CA 3MOGA 4Z0HO 5I7SA 3U3XA 4NHEA 4NBWA 4ALLA 3QIVA 1GZ6A 2ZYDA 3UN1A 2FZEA 2HJRA 1LSSA 3TQHA 2P91A 1B0AA 1GTMA 5T8KC 1I36A 4FJ0A 1RJWA 1E3EA 4BNUA 4CLXA 5JYDA 4YJGA 2CD9A 4J9UE 3M1LA 1PL8A 2NV6A 4IBOA 3M1AA 3E8XA 1YB1A 2NWQA 3B1JA 3LC7O 1P45A 3MOIA 1MA0A 4BNKA 3GMSA 2NM0A 1R4MB 3L77A 3UF0A 2BI8A 4J90A 4AFNA 4WPGA 4CR6A 3CZMA 3RVDA 2HKIA 1LDYA 3IQDB 2FRDA 2X1HA 4I1IA 2G5CA 3K2BA 1C0IA 2AG8A 1N9GA 4OGWA 2PD3A 4IQ8A 1O5IA 3DFZA 2C59A 1GUYA 2YUTA 3HJAA 4MVJE 2A94A 4CV1A 4MIEA 3GNSA 3GH3A 5F5LA 3LDHA 1RYDA 5EL0A 1VJ1A 4NIMA 4L4RA 1ONOA 1U7HA 3RKRA 1GFSA 3JYLA 4CLDA 3EZYA 1GL3A 1E92A 3AOEA 3BMNB 3E03A 3IC5A 3QWIA 1ML3A 4MIOA 3NX4A 3ZWMA 3H9JA 4PFJA 3L4SO 4Z9YA 3B1FA 3FWZA 1QRRA 3K96A 3SXPA 2OBNA 4O6VA 2CY0A 4Q39A 4W9NA 3RUFA 2HLPA 2UV8A 1F8FA 2BGMA 4RF4A 2Q45A 1RM5A 2X6TA 3ZU5A 3BIOA 4BHTA 3RJ5A 2QYSA 2IEBA 4JN6B 4GAEA 4BVAA 2DC1A 5ILGA 3JD2A 1NWCA 3CMCO 1P3DA 2NACA 2Y1OA 3JQGA 4YVFA 4XYLA 2BELA 5G4LA 3KRTA 4B4VA 4RVUA 5TJ9A 2HMUA 4KUHA 2WTBA 1X7HA 2BFPA 2RCYA 3GQVA 1H6BA 1GAEO 1HDGO 4NI5A 3WQSB 5EERA 3GVHA 4ZD6A 1FDUA 3DR3A 2QQ5A 1HDXA 4J6FA 4OXNA 1Y7TA 3PFWO 1P0CA 3LT2A 4D46A 2I76A 3OQ6A 3TL3A 3Q9UA 2VUTA 1YJ8A 3BYZA 3BMOA 4E33A 4N5MA 1T2AA 4IQGA 3ZNPA 1V6AA 1RM4A 2UAGA 2BFMA 1XR3A 1YB5A 4M55A 1CWUA 3Q2KA 2J5RA 1HDCA 5HM8A 1UAYA 5KVCA 5T57A 1HE5A 2Z1NA 3JQFC 4Z9FA 3TFQA 4E0BA 3QQPA 4Z0TA 5G0WA 3RKUA 6LDHA 3VPSA 3FTNA 4RJTA 2ZK7A 3JYNA 4IPTA 5DOVA 1WMAA 3A4VA 4ONEA 1I2CA 1W73A 4CLEA 1WXDA 4ZQEA 3WXBA 4DIFA 4GX0A 4E2YA 4TKMA 4NNJA 3DBLB 3ENKA 5AXBA 4II2A 3VZSA 2IXBA 4INAA 3QHAA 1BDBA 1ZK0A 4AJPA 3TZ6A 4PLPA 4E2WA 3I9JA 3K92A 1C1DB 3KTDA 4GKBA 3DAGA 1ZK3A 3DBHA 3F5QA 4E5KA 1Y6JA 2C2XA 2I66A 2EW2A 3E18A 5A9RA 4LVUA 3ZU4A 5F21A 4XJTA 2YZ7A 2NADA 1PX0A 2NVWA 2UUOA 3HZZA 4IJWA 2DBVO 1K2WA 1EVYA 3MWDB 3SC6A 2G76A 4Y67A 3GR6A 3FRJA 3P19A 4O59O 2Q99A 4BO1A 3GC6A 2GNAA 2O7QA 3ORFA 1E7YA 2C5EA 5GMOA 4HBGA 5JCJD 4U6SA 1T25A 2WD8A 1DDOA 3RUIA 4KMSA 1A27A 3QWHA 4CQMA 3JQAA 3PGXA 2G0TA 2AQ8A 1T1RA 3TZKA 3V1UA 3GN1A 1ADCA 2IYOA 4IGEA 4YJHA 5JNLA 3E5RA 3GG2A 5G0VA 5I9NA 1YO6A 2P9GA 1EVZA 1NM5A 2D8AA 2VZ0A 2GN4A 3O9ZA 1NTOA 2VNSA 1V8BA 4TZKA 3NAQA 3UVEA 3WFJA 5GZ3A 4YB8A 5ENVA 3ONDA 4YQYA 1LQUA 1XQ1A 1FJHA 1SPXA 4J4TA 4NK5A 4F46A 5IDQA 3W6UA 2AXQA 1VL6A 4NZ9A 4W9NC 4BO9A 1BW9A 2ZJ1A 2HK8A 4J1TA 3QW2A 4DLBA 5BT9A 4FQ8A 4GH5A 4FPXA 4IDBA 4NJMB 2NU7A 4NJOA 5J23A 4D43A 2DTXA 2PKQO 4ZQGA 3EDMA 4FW8A 2PA3A 3CTMA 5DP2A 2IE0A 2OP1A 1DLIA 2C5AA 2CVOA 4CM8A 1MC4A 3E48A 1O6ZA 4J9VA 3O4RA 4BO5A 3LSYA 2Q2VA 2EKQA 3PEFA 1HYHA 3KLMX 6ADHA 3JSAA 1YE3A 1IHYA 4YJFA 4I9HA 4U0KA 1QLHA 4FJ1A 1H6CA 3DWFA 4HY3A 1KEWA 2CDAA 4ZGWA 3C7DB 1DRVA 2VYVA 1B16A 3C24A 3INTA 5DCWA 1MGOA 4Y6PA 2J8ZA 5FI3A 1SNYA 3VVCA 3PJEA 1FDTA 3G1UA 3CINA 1MV8A 1WZIA 4FFMA 3OETA 1EBFA 3T4EA 3DOJA 3QRWA 3NJ8A 3H65A 3TL2A 1J0XO 2Y1GA 4YJDA 4J16A 3JCZA 2WD7A 3QWAA 1D4FA 5H83A 1Z45A 4OL9A 4HFMA 1WWKA 2Q46A 3GVIA 3MJVA 4HFJA 4JLWA 4RPJA 4RGBA 4S1VA 1TA4A 2NVBA 3QVOA 4XIJA 4J0EA 1JQBA 4DRYA 1P44A 3B6ZA 3NKLA 4M54A 2NU9A 1GYQA 4KOAA 2GCGA 3Q1LA 3PDJA 5BNFA 1NX6A 2QRLA 1ENZA 3WMWA 4YDRA 2Q1TA 1L1FA 3RFTA 1PZHA 2GERA 3KXDA 4Z3DA 1BXGA 3LQFA 4D42A 4BQPA 3ICPA 1MB4A 2Z95A 4B7XA 5COAA 2C7VA 3WGZA 1SOWA 4A26A 2FR0A 1XGKA 1ENPA 2PD6A 4CV3A 3EMKA 2X0IA 3KHUA 4DPKA 1O89A 1ZIDA 2H1SA 3KETA 5DNAA 4ALKA 3OJFA 4ND5A 3K9QO 2P4HX 2PZMA 3EY4A 1ZEJA 3KOUA 2VN8A 1WNTA 1GQ2A 3BHMA 4DYVA 4TRMA 5T64A 4A10A 3WNVA 2ZATA 2QZ9A 3F1LA 3GNQA 4R3WA 5GZ6A 2AA3A 4RPHA 4CM4A 5MDHA 4CUKA 3U5TA 1N1EA 1SCUA 2JCVA 3WSVA 4A27A 1M6WA 2OUIA 1Y81A 2RHCA 2C2YA 2HU2A 5JFOA 3VHRA 3BTVA 4MDHA 5K6AA 1BGVA 3KB6A 3VAZA 5I7FA 3LVFO 1DEHA 1AN9A 3V1YA 5IXYA 1OFGA 2YQ4A 3RD5A 3F5SA 3OIFA 5JCXA 2CVQA 5K9ZA 3IAHA 4D79A 4GGOA 4ESOA 1N8KA 1DRWA 1HDZA 3L6EA 3WWZA 1DO8A 2ZB8A 2DKNA 3TSCA 3OFSA 3ROMA 4E32A 1CYDA 4BKUA 3ONEA 1DAOA 3G17A 2J3JA 1CQJA 1KVSA 4IDDA 3GPIA 1QV7A 4DYDA 4BGEA 2C82A 5CDYA 1LRJA 1HZZA 1DIAA 2QX7A 1U5CA 4GBJA 1D7OA 3K8ZA 1ONPA 3H9EO 3U4CA 1PJSA 1ZZEA 3EUWA 1DSSG 5COBA 3F9IA 2OFPA 2DTEA 1HWYA 1WVGA 1GUZA 4J1NA 1UDCA 2YQ5A 1VRWA 2RBEA 4B3IA 1HT0A 1YH3A 3GF4A 4C7KA 3WQQA 3HHPA 1TT5A 4CMKA 4CUJA 1I33A 2CNBA 4BKRA 4YEDA 3D1LA 4OM8A 2H63A 4BKPA 1UP4A 1F0YA 2DBQA 2ZQYA 1YB4A 3QVTA 3W8DA 5KCZA 4OKIA 2HK7A 2D5CA 3VKUA 2EWMA 5H81A 1CERA 1NR1A 1YOVB 2JHGA 4J1SA 2PLAA 5JDIC 3PRJA 2ZQZA 4PRKA 5JLAA 7ADHA 2BH9A 1JU9A 2O3UA 3MCVA 4AJ2A 3PLNA 1XSEA 1H94A 3ZU2A 3ZHBA 1EUDA 1YBAA 4AJNA 2VYND 3WLFA 3JV7A 3PJDA 1H0KA 2CSUA 3HDQA 5KKCA 1OBFO 2NTNA 3K73O 3ROKA 4XDZA 2PH3A 2X0NA 3E82A 1YL6A 4L0QA 3LK7A 4YR9A 3EYWA 4M86A 4RDHA 4WOJA 4UEKA 4ALJA 3FR8A 4ALIA 1KETA 5EQDA 1XA0A 5IF3A 4FC7A 3T4XA 4A2CA 4BB5A 1O8CA 3H2SA 5CPFA 4XJSA 4BMNA 2HSDA 4Z0PA 1P1KA 3JQ7A 5EINA 4BGVA 2OO5A 1IPEA 3RQSA 2DPHA 8ADHA 4GKVA 3EGOA 1R0LA 2Y1FA 1RM3A 1YQDA 3NTRA 2X86A 4JIGA 4R5MA 1OAAA 2PTGA 1UDBA 4DLAA 4JX8A 2JD1A 1U3UA 2I9PA 1AE1A 1EE2A 4IMRA 3IJRA 3ZN2A 4B3JA 5L53A 3I52A 4B4OA 1VL8A 4TRNA 3UH1A 1BRMA 3ENNA 4BO2A 2B4RO 3ZWPA 2Q1WA 3ANMA 4UVHA 5KJCA 2D0IA 5DBFA 1U8XX 2O4UX 3EAGA 3V2GA 1VJTA 4D41A 3DMTA 3QJ5A 3TZQA 3B70A 5CDGA 2AE1A 3ZHYA 3BMCB 4PZEA 4WNCA 2WSBA 1F14A 3ZW8A 1ZSYA 4B3HA 4LCEA 1LLDA 4LCJA 4R1TA 4ZQBA 1IPFA 5A06A 4LRTB 1HDYA 4CLOA 4CPDA 2AEMA 3W4JA 1MFPA 2X23A 4YXFA 4PZDA 3QWBA 4R9SA 4NBVA 1BSVA 2Q2QA 4MVJD 4DL9A 2I67A 4IDGA 3QVSA 1H9BA 4HXYA 1VLLA 3NT5A 3M2TA 1M6HA 4EDFA 5LDGA 2HJSA 4FB5A 3AJRA 1R0SA 1NVGA 4BNXA 3LYLA 1FDVA 3ZI0A 3AU8A 5EQFA 1EE9A 3H8VA 3OICA 4UUOA 1ISHA 1ZK2A 2AEFA 3NUGA 3ZWCA 1Q0HA 2OORA 3KO8A 1KIFA 2YFHA 1SMKA 2BLLA 4E13A 4WLEA 4CMJA 3PZBA 2GD1O 4R01A 1R4NB 5KKAA 2X5JO 4HNGA 3I9OA 1SAYA 3D4OA 3WSWA 3UCFA 3K5PA 5T5QA 3RUDA 1EFLA 1FMCA 5CDSA 1WDMA 4RVHA 3QY9A 5A3VA 4F3YA 4WLFA 3KEQA 1OOEA 1N7HA 4JNKA 2E37A 2JCXA 5EPOA 4G5HA 5KVSA 4OJNA 2EKLA 4PG8A 3N58A 3PK0A 4PIVA 2HMTA 3R3JA 3DXFA 2YDXA 3F3SA 1NHWA 2P68A 4IXWA 2DPGA 5HS6A 4JJFA 4KUEA 1T2DA 3V5NA 4BNIA 3GEMA 4J7XA 3MJCA 3ZV6A 2D4AA 4XQEA 1LQTA 3MWEB 2ZTLA 5IFLA 2WDZA 4DPMA 1GQYA 2CDCA 2PY6A 3JD1A 4GSKA 4R1UA 4XQ9A 3UUWA 1M67A 1SEVA 3DZBA 3A28A 3PQDA 3LU1A 2RAFA 3RJ9A 3UOGA 2EEZA 3JYOA 4E5PA 2I3GA 2E4AA 5AXAA 4OKNA 3GUCA 3FPLA 4FIZA 3RAJA 3WJAA 1F8GA 1VM6A 4HWKA 3UW3A 1E3WA 4N5LA 4YAGA 1A9ZA 5GY7A 5ER9A 5CPBA 4MKZA 4TQGA 3ZZNA 3NYWA 4GI2A 3U4DA 5JPIA 2CFCA 3JQBA 1E6EA 1PWXA 4FDAA 3PWSA 3VH2A 3RROA 1M75A 4YA6A 4DTIA 1DHRA 3FR7A 4KWIA 1VC2A 1C1XA 1Z7BA 3K30A 4UEOA 3DZHA 4XDYA 3ASUA 1DFHA 3DOOA 3FBTA 4IIVA 4GWKA 4BNZA 5BSHA 3L9WA 4K6CA 2SCUA 2Q1SA 2WYVA 2GO1A 3G1TA 4J1QA 4OYRA 5AOVA 4I5GA 3H2ZA 1KY5A 4P8RA 2ZTVA 1FK8A 4HX5A 4LMPA 5JO9A 1PQUA 4DBZA 3I3OA 4I5DA 1Y5RA 1YONA 1DHTA 1TXGA 3DMTC 4EEZA 1PGPA 2QHXA 4BIIA 2EXXA 1QYCA 3GPDG 3OA2A 5L4SA 2JFFA 2JHFA 4Y8VA 2XOXA 1IB6A 4U5QA 4IZIA 3H7AA 3O38A 4WCFA 2XXBA 5IZCC 3CZRA 5IJZA 2BI7A 5EN4A 1GEGA 5JDCA 5DOZA 1K89A 3OSUA 5B37A 4DIOA 4E2ZA 2AEJA 4R4JA 1GUFA 3KYDB 3KLPX 3DFUA 2ET6A 4GGPA 1B15A 4N5NA 2B35A 3VZQA 1LJ8A 3Q11A 3WTBA 1JKFA 1EK5A 2PGDA 1LDNA 1GPDG 1OC2A 4JJIA 1K5HA 3GZNA 4RPGA 3DB2A 1E0DA 4WLUA 2J3IA 1X1EA 5TLSA 2RHRA 4XD2A 1EBUA 3RBVA 3KVOA 4GX5A 1LLCA 1Q0QA 2O3SA 4Q9NA 4QT0A 3E6AA 4WLNA 4OQYA 2GASA 2VUSA 3KUXA 2R2GA 3BAZA 2NTVA 3INRA 4PGFA 4J49A 3KEOA 3ICCA 8LDHA 1AUPA 4XIYA 4I9UA 5I9MA 4R9RA 2Q3EA 3I6IA 4MIYA 5C5IA 5L7TA 3UXYA 2C29D 4XB2A 4FOSA 2HK9A 1KVRA 1VL0A 5G4KB 4R16A 5ICSA 1UXJA 1Y9AA 1B3RA 4I5EA 3G49A 3GN2A 1LLUA 2W2KB 3GGOA 4FFRA 4YRDA 1PJTA 4E3ZA 1MFZA 3WGQA 5I7EA 1MUUA 4U0JA 2QW8A 4CLHA 1T2CA 3ZHZA 1PL6A 5TF4A 1I3LA 1WP4A 4WUVA 1ZK1A 3CH6A 5ES3A 1DIBA 5A9SA 2EG9A 1B7GO 1B14A 1HDOA 2AG5A 2DU8A 1C0PA 3COSA 2BKAA 3OA0A 3AM4A 1F12A 1PGNA 3NT4A 3ZWBA 2CF6A 5B4TA 5C7LO 5L45A 1H93A 3JD3A 2ZYGA 5HRUA 5TQVA 2HMVA 1GD1O 4BV9A 4J91A 1SB8A 2JFGA 4PCVA 3SLKA 4XA8A 4GL4A 5IDWA 1N5DA 4IINA 3DAPA 3LF2A 3ZWOA 3BXXA 4R69A 1PGJA 3BTSA 4BKOA 3FNFA 4BMSA 1U4SA 1NR7A 3SLGA 2PK3A 3DHEA 2VRCA 3P5SA 4PLCA 5KNLA 5G0SA 3WBFA 1B8UA 1ZVMA 4AVYA 1IE3A 1MXFA 2DT5A 4L75A 1E1LA 1J4AA 3T7CA 4DPLA 5DZSA 2Q2WA 1B2LA 4MP8A 3N7UA 2FPIA 3SC4A 3HNPA 4E31A 2ZIZA 3U49A 3NT2A 5DBIA 3EK2A 3C1TA 5KJFA 1J5PA 4UVIA 4C4OA 4CMEC 1E3JA 2FP4A 4XZ3A 2IZZA 1X15A 1JAXA 1ZBQA 2E49A 3VZPA 1GYRA 2QRKA 1VJ0A 4Y6RA 3CIFA 3H9QA 3PZRA 5CDUA 4EYEA 5JDCC 5AQ1A 4UUPA 5JAQA 4W4TA 1IHXA 3GOHA 4WJZA 5THQA 4OAQA 2FPPA 3STHA 3G0OA 1H6AA 3M2PA 3VZRA 3TOXA 2ZYAA 4AJEA 2W98A 4ZRMA 1LNQA 1KOLA 4PLFA 3MJTA 1H5QA 4BB6A 2YJZA 4QFCA 2X4GA 1E3SA 1XQ6A 3A1NA 1P1JA 3QVWA 1DC3A 4IS3A 4NFYA 5U1PA 5TIIA 2EERA 1Z74A 2X0JA 4BOYA 4JP3A 5DP1A 2GZ2A 4OSPA 3OP4A 4FFLA 4RQTA 5K0ZA 3H9GA 3GG9A 3RU7A 2HRBA 4OSOA 1NQTA 3QVXA 4JK3A 4UVEA 4ALMA 2IDZA 3GZ4A 5DF1A 1PTJA 3IMFA 4ZA2A 2PZKA 4BV8A 1U9JA 2PH5A 4FJ2A 5EIOA 2YFQA 2ZCVA 4K26A 5JE8A 4DUPA 4E12A 3RC7A 1IY8A 2O50A 1P74A 1Z82A 4O5OA 2VT3A 4MVJI 4B7UA 4J7CA 2YV3A 3HADA 3SJ7A 4UEJA 4R1SA 1QORA 1T4BA 2P2SA 3PVZA 4R51A 1V0JA 1WDLA 4HNHA 2G1UA 1P1IA 1W8DA 4WLOA 1XDWA 1DAPA 1YQXA 3GRPA 4N54A 4QTZA 4R54A 3ZWWA 3AM3A 1PR9A 1QYDA 1EUZA 1HRDA 1P33A 1PU2A 4AJHA 1TEHA 3AOEC 3MJSA 3BMQA 4QXMA 5F5NA 1EZ4A 3FNHA 3OQ1A 2B69A 2VYVD 3HDYA 1QG6A 3UHAA 3O8QA 4YJGB 2VNAA 3WFIA 5C3MA 4JCOA 5FI5A 3SEFA 1GPJA 1NVMB 3GFGA 1X13A 2F00A 2AQHA 4QX6A 2NSDA 4XYGA 4MKXA 1DB3A 1V3VA 4P38A 4Y6SA 4AJ1A 1X14A 1UJMA 4WGGA 4XR9A 7MDHA 1BVRA 1BMDA 3HG7A 4CMBA 4CMHA 1N2SA 3L4BA 4IS2A 4KP7A 4DMLA 5B12A 2Y66A 3PWKA 1I2BA 1U1IA 2WMDA 4QFDA 4D0SA 1N9GB 1X0VA 2B0JA 3PHGA 2GF2A 4Z3KA 4A5OA 3RI3A 1ZMOA 4OOEA 5TT1A 1JWBB 1CDOA 5JAZA 3PIDA 3V2HA 1T26A 1G0NA 3O03A 1V3TA 1HXHA 3HWRA 2BFOA 2IEDA 4B8ZA 2W2LD 1ZKMA 4GX2A 4BO8A 5L40A 1CJCA 4XB1A 1JN0A 4MP6A 4DLLA 3WGOA 3DZKA 3VC7A 4CJXA 2X8LA 5TC4A 3OM9A 3LT1A 3I6QA 4BNYA 4XGIA 1E7WA 3GHYA 5DULA 4CM7A 5F1KA 5A3JA 3PI7A 4MVJH 5C37A 5L4NA 4HFRA 1DJNA 3DQPA 3JQEA 4CLRB 1ZCJA 2HUNA 4W6ZA 3GEGA 5DCYA 1XU7A 1LSUA 2X0RA 1K3TA 1EMDA 4OXYA 4RZIA 4G65A 1YVEI 3ITKA 1HL3A 1YDWA 1Z6ZA 4XR4A 3VDQA 1KBZA 1I32A 2WE8A 3LC2O 3PJGA 3IOYA 4RQUA 4RCVA 5CG2A 3QSGA 5AYVA 4U6QA 4U7WA 4EW6A 1K6XA 4CR7A 4J2OA 4CQLA 1EDZA 2VHZA 4ZICA 3TPCA 3BMCA 3DZFA 4IJKA 1FF9A 1WLYA 5BSGA 4UAGA 3WNQA 3TZHA 4BKQA 3TOZA 1NQ5A 5IN5A 5JAIA 3ZWAA 1ZXLA 1DOHA 5KOIA 4NQZA 5I8ZA 3F46A 1UZLA 2P5YA 5KJ1A 2QRJA 5CDTA 4BUCA 4NU5A 4RF3A 4ZHSA 2VZ9A 1GU7A 2YHIA 4PRLA 2PFGA 1UDAA 3HUDA 4XQGA 3BTOA 3KYCB 4PG6A 4M89A 1NPTO 3AI2A 3S8MA 3D0OA 4LRSB 5CAEA 4E2XA 3FPCA 1HLPA 4FN4A 1JKIA 3D7LA 1PQWA 1UXGA 3I9LA 1M2WA 3Q9NA 3ANNA 2C7GA 1Y5MA 4W7IA 1ZSVA 2X5KO 1PZFA 1ZUD1 4RF2A 2H6EA 1EDOA 5DCUA 2PZJA 2BGLA 2NQ8A 3CKYA 3PYMA 1R4NA 4R5HA 3HE3A 1LXCA 3U09A 4CMCA 1NXQA 3RU9A 2PGLA 1K0UA 1VPDA 4QUKA 4L74A 3L9XA 3OMLA 3DBHB 3PP8A 1LLQA 4PLHA 3PXXA 1NQAO 2BGKA 4ILKA 2DBRA 1XU9A 4CMGA 4D44A 3AI3A 1SEPA 4PN3A 3AUSA 5HA5A 1E6WA 2A92A 1KVUA 2D5AA 2P9EA 4DC1A 3TNLA 3PYLA 3ZWVA 5TT0A 2JD2A 2NVUA 3PQFA 1KEUA 3ON5A 3ZGYA 2IYPA 1X7GA 2FR1A 3OJLA 3WMXA 3PTZA 1RPNA 2C54A 2XF8A 2DFVA 3ETDA 3GAFA 3LLSA 2VT2A 1B8VA 4AJ4A 1RWBA 5L51A 2AMFA 3JQAB 5JC1A 2FN7A 3DC2A 4FGSA 4IQ0A 2WJPA 2W8ZA 1LRKA 3FF4A 2GRAA 3LLVA 4IMPA 4YJHB 5C7OO 3B20A 1UUFA 2BMAA 3S2FA 4BO3A 1H6DA 1BXKA 2DQ4A 3W8FA 1T4DA 3AM5A 1OMOA 3W4IA 3UCXA 3H5RA 4Y98A 2FSSA 3C1AA 1Y8RA 3EW7A 4NPCA 1KERA 1QP8A 2P5UA 1XG5A 1ZFNA 3D3WA 1ZSNA 1R66A 2B4TO 4JP2A 1NFQA 4NBRA 1FXSA 2W90A 3CMMA 1D1TA 3FSRA 4XRRA 3WBBA 3TF5A 4YT8A 3ITDA 1LDEA 1HYEA 2EJVA 3SBOA 3DZIA 1I10A 3DBRA 2GN8A 4P4LA 1DC5A 1DIGA 1LC0A 2H9IA 3F47A 4W99A 1ORRA 2AQIA 5L95A 3NDJA 3UFXA 2YY7A 1C3VA 4RVSA 4NU6A 4LGVA 2X5OA 4CM8B 5ITVA 3WX0A 1PIWA 2JAHA 3OHSX 4CMIA 5ADHA 1KY4A 3WGTA 5BR7A 5IXSA 1CIVA 4CM9A 4H7PA 1J6UA 3JQ9A 1ISIA 1GQQA 1PS9A 3L6OO 1Y8QA 3JQ8A 3CE6A 3U0BA 2ZKLA 4YJFB 3JQDA 2XAAA 5JY6A 2Q1UA 5BNIA 2RH8A 3AY7A 2IODA 5I9LA 1LTHR 4Y9DA 1ZO8A 1U5AA 3H4VA 4AJKA 2GR9A 3RUEA 4ALNA 4PZCA 5TGDA 2PNFA 4QO7A 4TZTA 5A1TA 3VPHA 4WKGA 3G79A 3GAZA 2JCYA 2IZ1A 1HF3A 3V2UA 2OGUA 2Q50A 1S6YA 3OJ0A 3OIGA 2WD7B 1I3NA 3UKOA 3R6DA 3PGJA 1PQPA 4URFA 3HSKA 5IZ4A 1E1NA 3AOGA 1HTBA 2O23A 5K6AC 5CEEA 2I65A 3DBVO 1PGQA 3VOSA 2VWQA 4DIBA 2DUUA 4RLHA 2VUUA 2BD0A 1R4MA 4HUJA 5IDXA 4R41A 2VYNA 2O2YA 4AJLA 5AXCA 3W6ZA 4KZPA 3MZ0A 4ZRNA 5A04A 1IULA 1DIHA 1SOVA 2PKRA 3IKTA 4OO3A 4WCDA 5G4KA 4YRAA 2GZ1A 3R1IA 1E1MA 1WW8A 2DTDA 2O4CA 4B8WA 3HN2A 1ZEMA 2PWZA 2G82A 3RFVA 1EVIA 3HFGA 1GEEA 4BNTA 1LA2A 1XKQA 1MXHA 2EF1A 3ABIA 4DQXA 2I6TA 5ICMA 3SVTA 1DFGA 1GY8A 5T6BA 1HSZA 3DL2A 4CM3A 3ZDFA 4RDIA 1YBVA 4YQZA 3P2YA 4GLLA 5LC1A 3QP9A 1LI4A 4CM4B 3PPIA 2DVMA 2FZWA 1U28A 3ZH2A 3BMNA 2Z5LA 1Q7GA 4L8VA 1R0KA 4ND1A 1DFIA 2YV1A 3PJFA 3OEYA 4K9DA 5DDIP 3NRCA 2EKPA 3WDSA 3E1KA 2OXIA 3PHIA 4DQUA 1UH5A
chains in the Genus database with same CATH superfamily
4MV8A 1U9IC 2AT1A 4G8CA 3OE7A 1NW3A 1Q14A 3OLQA 5ALXA 2QI9C 2WU1A 3IVCA 1GZ3A 2NYAA 4TVOA 3EXAA 4I7EA 5EMHA 1EG2A 2OP0A 4BNMA 4F56A 5LMCA 1GTRA 1KDPA 3IIEA 4RTSA 4KTVE 4F5ZA 1GFZA 4LZZA 2X41A 1KTVA 2G4VA 2PD4A 1BXZA 4HWPA 1KR2A 2DHQA 1ECPA 1X9HA 2I6FA 3F5MA 3PQ3A 3T9FA 1MTOA 2D1TA 1L7DA 1M2EA 4MVJA 3KU1A 1CY4A 3BC1A 4NTZA 1HEIA 3S1LA 5L7WA 2C0CA 3KYBA 3IDZA 3ZOKA 3ZZMA 1M5UA 3L04A 1WY7A 3KCNA 3WYNA 1NAIA 2ZIVB 3I6BA 1VLJA 1A69A 3TD9A 1JHQA 3KWLA 3TLGB 1X1SA 3VU0A 1N8TA 1CQIA 3MG9A 3NGXA 3WOHA 5B36A 3W5DA 4RD4A 4P4NA 3AW9A 1N7GA 1P7ZA 2FP3A 4Y30A 5JYBA 1Y4AE 4QODA 4D3DA 1F4LA 1CUVA 1T1IA 1NPYA 3IIJA 3EVZA 2VHTA 1KR5A 1CC1S 1TPYA 1TU0A 2KLBA 3FLAA 3PFIA 4MR8B 4OIFA 5JW6A 1CUFA 3BFVA 5FNVA 1TT5B 4ZEOA 2E3JA 4BJ5A 4G6ZA 2PUCA 5JSKA 2WSSA 4DLWA 4EI2A 4MOWA 2N42A 1BU5A 3FCEA 2FY8A 3DKRA 2GN9A 2XMPA 3KHSA 3KQNA 3IP9A 1QTQA 1ZJJA 3B1YA 3VDMA 2VQ3A 1N0HA 3D6TB 1SC6A 2A9FA 3VX4A 5A5FA 3HGTA 3NKVA 2IYUA 4XEHA 1DQSA 3OQBA 1DAHA 5HOEA 1P6XA 3ZV3A 1NOKA 2EF0A 2EFGA 3GPCA 2OV6A 3KD2A 2D59A 3H3JA 3K1AB 2PR2A 4ARIA 2F48A 2IVZA 3VNQA 1W8IA 3PWZA 3ZE6A 4M7OA 4AB1A 1K1EA 1Q0LA 1RMQA 1V5IA 4L5YA 4OA8A 1RXEA 3GH1A 3M4XA 4W8HA 5CB4A 1Y9JA 2GYYA 1JNXX 3ROXA 2RARA 3H2KA 1B76A 2XGJA 3BRSA 4CIXA 2OCXA 4MZXA 3WLLA 5BSFA 1W93A 2BGWA 1A1VA 1S9DA 1JVNA 3CVYA 4WD3A 2I34A 3VOAA 4CEIA 1VKOA 1X7WB 3VTAA 1CEQA 2ZE5A 1UDWA 4Q4JA 1DX9A 4K3UA 4A0HA 4GRAA 1F6DA 1MAUA 1J8YF 2DXIA 1Z47A 3DGEC 5JTTA 5A5EA 3VR3A 2YVUA 3I58A 4G0XA 1L7VC 1O95A 3M70A 2Q5QA 3D6HA 4FGKA 3FNRA 4RO0A 1UQTA 2HXGA 2YJGA 1J49A 4BMVA 3DHNA 1MABB 2VTBB 3KG2A 4FMBB 2XWQA 3DEAA 4ARZA 4MCHA 3JQFA 1LDGA 4QSHA 1RLUA 5B7GA 3AEQA 4JROA 4CIYA 1WCV1 3C3XA 4QG3A 2MHCA 3LHIA 1NMEA 4X64B 2EFDB 1C9NA 1SBYA 1EVJA 4R2IA 5GJBA 3IMEA 4WK6A 5I3ZA 1Z7YA 4LWPA 3NHWA 4DMMA 2PH1A 5J4HA 4DA9A 1UDXA 3HBNA 4JI5B 1SCQA 4IIXA 2ASEA 2DUJA 4IJUA 3VH4A 4A0RA 5IVPA 5CBKA 5I8WA 5DWVA 3T06B 2WYHA 4RK1A 1U28C 3RUAA 4F7DA 1VP3A 1QS0A 4F12A 2HUPA 4OB6A 1F0NA 2TS1A 2KSQA 5IVIA 2PKXA 3ANTA 4J0FA 1LDBA 5F1PA 4F21A 4IM7A 2F3UA 4L4ZA 5A4DA 4KJXA 5ILOA 1HMPA 1N6NA 1Y33E 2A5FA 3K31A 2FSVA 2HO4A 2DPMA 3KR0A 1PT5A 4LSWA 2EC5A 1CDEA 5G0TA 2JI8A 4PG4A 4NJMA 5BRJA 2FN3A 3X1DA 3SM9A 1G3RA 3UPTA 5JC8A 4AROA 2FDCA 1PD1A 5CH8A 1GRRA 5FORA 4D3SA 4OQPA 3DV0A 3A58B 4LISA 3R7SA 3DS8A 1E1KA 1FFBA 3H5TA 2XXAA 2E7ZA 2F7SA 3DE4X 2CD7A 4PW0A 3M4NA 5B3JA 4EIWA 1N2GA 4DCJA 4G1FA 1EG7A 1FXUA 1B00A 2V7BA 2W6NA 1M34E 5HF8A 1JDNA 1WD5A 1LX6A 1U80A 3NDIA 1KZ4A 1YS4A 2AKAB 2NPIA 2R6DA 4WZAA 4EY7A 1PFUA 4G86A 1MP0A 5FKJA 2DFKB 5JMWA 1RT9A 3LZDA 1K0FA 2ZR9A 4QD3A 1M6VA 3FTPA 4QGAA 1FVHA 4XX0B 5IMBA 5TS2A 5JZSA 1AY0A 3MB8A 1PVOA 4ZCRA 1HEUA 3GJ3A 4Z4FA 4MO9A 3VVBA 1G5HA 4HWSA 3S2IA 4L6CA 1QMGA 3G02A 4OV6B 2XNKA 4KI7A 3MTDA 4RKFA 1BFDA 2WFAA 2YN4A 2GJ8A 2Q4BA 4L50A 3GEDA 1ZD3A 2X8AA 4XLLA 4FZRA 1J2EA 3G9TA 1JJAA 1RHMA 1DIOB 1SXIA 1SVKA 2RGAA 3CLKA 3GBSA 3A6ZA 3LUJA 1WMFA 4X85A 5F2OA 1I4WA 1BN7A 1IN6A 4NSNA 4RFSA 5TMEA 4MVJM 1NHGA 5CLLA 4X6YA 2IY8A 2CF5A 2I6QA 4KYUA 3P32A 1ZVVA 5JQGA 2X2OA 4REQB 2WZDA 2CLFB 3D4IA 1BS2A 3FD8A 4EA7A 4FYIA 1T1GA 3T3EA 1RWKA 2P6PA 4GKAA 4ZZ3A 2O1EA 2JFZA 3PDIB 3OZWA 5LKRA 5IG2A 1V5GA 1F9EA 2ASVA 3D64A 3EC7A 1XRNA 2B6NA 2Z43A 3FPAA 2K4MA 1DTWA 3LECA 3WMGA 5CA1B 3RTCA 1ILWA 2XTMA 2Q8QA 3A6KA 2QTAA 3IAS1 4MGYR 2I4NA 1D1SA 3RODA 2R68A 4L57A 5JLJA 1Y3BE 2PA0A 2ZB7A 4WN3A 4YRSA 5EJ9A 1XMXA 1QO0D 4LMAA 3VR6A 5KVAA 1O9HA 1GNRA 3PFKA 1D8AA 2QD2A 2CJWA 1SCNE 2Y2VA 3IUPA 2NZXA 3R2JA 1CK4A 4CQMD 5HTOA 3TIIA 2ZB4A 1Q3TA 1USIA 4N0MA 3LHKA 4Z8YA 3ZY4A 4KHZA 2P2DA 1VLQA 3AMVA 4BMCA 4CF7A 4XPZA 3EEYA 3HR4A 1CE8A 1DRUA 4XVRA 1BVYF 3K16A 3ZVMA 4MUHA 1P7WA 3CRVA 4ED9A 2A9RA 3S99A 4TT8A 4KFRA 2EX0A 4QJ5A 4H3VA 4D7AA 3OZAA 3TBKA 5ENDA 4WNAB 4JGBA 4JBLA 1TK2A 2QG4A 3PQ5A 3AESB 1CJUC 1JR3E 1M1YA 1CNFA 4QQNA 1DEKA 4ITUA 2BISA 2EHDA 2OVBA 2VF4X 3GY0A 3D1VA 3A2MA 1GLGA 3D0QA 3MW8A 4QXPA 3RFXA 3S2UA 5BVGB 1ENOA 3NEPX 1B26A 1UJ6A 2QL5A 4ISBA 4M0LA 5HWSA 1RWNA 3AEKA 3SXJA 4IIJB 1GR0A 2VBIA 4KO1S 3RNOA 1KVTA 3RU2A 3ZD6A 1GTJ1 1ARZA 2FMHA 4ID9A 3I6YA 3BJRA 4K28A 3RF7A 3P9YA 5IM5A 1KJ8A 5FAKA 4ARBA 4H6PA 1HETA 3WGIA 2R00C 3ER6A 3RC3A 2BSXA 4M8KA 2BDEA 2IJGX 2ZT8A 2SKEA 3O8NA 3HXOA 1XZNA 4A7PA 1GN8A 3BMXA 3HMKA 4NWIA 4HVAA 5H82A 2KI5A 2WYUA 3LFTA 3S2GA 5J4LA 4H1UA 4LQLA 2A0KA 1KYQA 4B4UA 4DLPA 4F3CA 2ZBEA 5AR1A 4UMFA 3W34A 4M8IA 1PGOA 1Z0ZA 3ZX5A 5ALOA 2LD4A 4ZGGA 1T8WA 3F5DA 4IDPA 1FFCA 4EG0A 1FIUA 4NFHA 1RBMA 4RVDA 4DW8A 3W8EA 3A06A 1U8CB 3AEXA 1K2VN 2X77A 4NENB 5AW1A 4GKJB 2ZJ7A 5FTWA 1KAMA 1ULHA 4M1QA 4NBLA 5A9TA 4E5MA 4TZ6A 3L8MA 3K70C 4Y1RB 1RLMA 1RADA 1ULSA 1QKKA 1H2EA 1RP7A 4ND2A 4AW9A 2OBLA 2ZWOA 2OC9A 3OEHA 4B81A 4D92A 5JR3A 1AXEA 1AGPA 3WXMA 5GIPE 4H15A 1XMSA 5DRYA 1Y8CA 3HJNA 2Q28A 1C0LA 1U7PA 4AWAA 3GLGE 3EMBA 1KI4A 3O2QB 1UP7A 2XY4A 2PKYX 3ZLBA 1P62B 2O0LA 3K9FC 4AP6A 3NOQA 4DNFA 1Q1QA 3MLEA 4HL6A 1TVKB 4ON9A 4A9AA 4PWZA 1NFRA 5CHYA 3KFLA 3LKBA 2W6ID 2FDRA 1OV6A 3HDGA 2FOIA 5BSVA 2ANBA 1D09A 2HMSA 2V8BA 4EUFA 3V1TC 5JADA 2JKVA 5BMVA 5LZ2A 1XAIA 1LW7A 1YOVA 5A71A 2FWMX 3K2EA 3N2IA 1YQQA 2J1LA 2PRJA 5EKXA 4X54A 3SHFA 4R1NA 3CJQA 4NAVA 5EWJA 4MUKA 4B2YA 2N47A 1A72A 2HIAA 3E9ZA 3WB9A 1DC6A 1ADGA 3EXG2 4MB2A 4C7MA 1ISFA 4BVEA 5DHFA 1Z3IX 5LP6F 2B5WA 2GBGA 4WXPA 3RADC 4N82A 4LV8B 1JDPA 2ZUSA 1TEXA 3V34A 4ZFNA 2VTEA 3N5CA 3WRWA 3GVPA 5FYDA 2O7SA 4GE0A 4IRUB 4OLFA 4RENA 1RDFA 4PX2A 5JALA 2PSFA 3FBWA 1Z4OA 2PX4A 3AF3A 4LFAB 5I48A 3OKPA 4OI0A 3DDWA 5CB8A 1E3DA 1E2UA 4QUIA 1XMIA 2I87A 5FWXA 3U56A 4DRZA 2ZIUB 4KXWA 1M0TA 1XAJA 2R8RA 4R8VA 1NMXA 1W46A 4HEA1 5DM0A 5EZQA 2QYHA 4QDKA 4RMGA 4WACA 1FUUA 5KSPA 2FHSA 4BEWA 3HJUA 3AERB 4GVPA 2WQ6A 3FOEC 3B48A 1UC9A 4WASA 1L5WA 3B1VA 4JKIA 1MPTA 1TCVA 1AKVA 2ZUWA 4KIJA 4LZPA 4YACA 4O1MA 5P21A 4I1OA 5IPFA 3P9ZA 1NQVA 3N8NA 5CH3A 4B09A 1G38A 2MYPA 3PA6A 4AY2A 1ZISA 3CISA 3EVAA 2L18A 4M0DA 5NULA 3ZGVA 2DG2A 3QBJA 3H2JA 3AQ4A 3PXEA 3DCNA 1VYHA 1BIFA 3AJEA 3AL2A 3DDNA 2X9NA 3FMFA 1XEAA 4JDPA 3BGVA 4JMPA 1Z12A 3F6EX 2PWBA 3JASB 4IVPA 4M7WA 5DM60 1Y6GA 2DOKA 2QD5A 1TEZA 4MCJA 2B7BA 1E2PA 1E2NA 3OUUA 4FLMA 1AX9A 4JXKA 3DZGA 1ZM7A 3Q3CA 4NZOA 5BVHB 1UP6A 2LDBA 4CM5A 1UIRA 5EIBD 4KLCA 3QEMB 2AX4A 3CA8A 4EA6A 1P9LA 4EG1A 5F1OA 2ZJZA 5B7QA 2C4VA 4TTIA 1PTJC 1NATA 2CXUA 2UVDA 1REQB 3Q8WA 4ZALA 4IEIA 1E7SA 1UMKA 2Y0CA 3NB0A 5BOVA 3JATA 2W2TA 4NG4A 4QFMA 4PBSA 4EW1A 5FEUA 3ZHXA 3S27A 4NXMB 2P2CA 3KOXA 5KWEA 2O05A 1FLNA 1X38A 4G67A 3RWMB 1F8UA 3KWJA 421PA 4DBVO 521PA 5ITWA 1SO8A 2X2FA 1BROA 3A4IA 4MTCA 3I92A 4RKWA 3BJMA 1IK6A 4KKXB 2EKDA 4RC9A 3PHHA 3LCVB 1T35A 4BV2A 2WA1A 1Z6GA 4L5AA 4YPOA 1XFAA 2VR1A 2H5LA 3GVXA 3IBFA 3VKFA 1ORHA 5DT9A 2X3UA 5BXYA 1DLJA 4J2HA 1B8NA 1M2HA 2FMFA 2QJFA 3UMYA 4R2KA 1UR5A 1XXLA 2O2XA 2PHZA 1QDEA 3DOCA 3JTEA 4JL8A 1CIJA 3QWFA 1M5TA 4NNOA 1QKJA 4OOFA 2P2ZA 3CVWA 1TM3E 3PXUA 2Q2OA 1D3AA 2C9CA 4R31A 4EBFA 3VDXA 3T1QA 1QR2A 3LLUA 3ZBTA 2FRVA 2HLHA 4WECA 3RSLA 4DM4A 1L5QA 5K4AA 1TADA 4YRFA 1LSJA 3N86A 1JIXA 1E5QA 1MJGA 4EQZA 3VMFA 3B3AA 2DB3A 1RSZA 2WU3A 1YASA 3RKSA 5KVVA 2P0YA 4LJ6A 1UAGA 2DJIA 4QOEA 3ZWNA 1IQRA 2I0FA 2H1FA 2AVNA 1R37A 1LX7A 2F3QA 1ZJYA 3PB3A 3PHJA 2OFWA 2JLVA 3FYTA 3L0SA 3H11B 1R16A 4AAYA 2QAGC 2BHNA 2PS3A 4BNWA 4F84A 3ZY5A 2I1VB 3K9HA 5HDBB 5HZKA 3ECCA 3H04A 4M99A 3CG0A 3UXEA 1DJQA 1EK6A 3R9KA 2ZI4A 3AFNA 5EQJB 3VPXA 4OL0A 4HYEA 3THWB 2DM6A 2AW3A 4DMRA 2RHGB 3D8UA 5H02A 4HAXA 4MP3A 4CQMB 4NG5A 3U4HA 3OHMA 2H7XA 1W49A 2YXPX 3CEAA 5FWAA 2DKFA 2WTEA 4NZZA 5DLDA 3NATA 4R7GA 4A8JC 2AR7A 3V6LA 3GDHA 3T34A 2F3TA 2JKZA 3GB9A 4MPJA 3FDZB 4IEEA 5D51S 2GJ9A 5IHPA 1VIDA 3SY8A 3WGHA 3PC3A 3K9CA 1O6FA 1XDSA 2JLXA 4WKPA 3ICOA 1GGNA 4Q7MB 2EP5A 4HVCA 3N9IA 4GOJA 1T5TA 4O4JA 4LMRA 4UHFA 1ISMA 1PUIA 4BS9A 5TMDA 4EKGA 4E15A 3H1AA 2CXNA 3OFVA 1AKMA 1EGAA 1ZM9A 1I3MA 3ET4A 5BPFA 1J70A 1V9CA 2WWGA 3O94A 2D54A 3ODPA 1OXUA 2VP5A 1A2OA 1L5MA 4ES6A 1LBTA 1NI3A 1RZUA 4AKTA 1ZQ9A 4HYQA 5G2OA 1UK7A 1CYEA 3EDCA 3ZL9A 3KFVA 1RS0A 1SIUA 5IDYA 3GDFA 4U2FA 3HXQA 1CNMA 3A0UA 1UBMS 1BDIA 2RB5A 1IY2A 2AVDA 2AZ4A 2XA1A 4Z8XA 4FX2A 3GMIA 5J59A 4RHUA 8ABPA 4JIMA 3ORHA 1YE8A 1DVRA 1H8HD 1H2HA 2PUHA 3A25A 4DG5A 3M5CA 1FVXA 2XE8A 1F7UA 1KFCB 5EE1A 4LGCA 2Z2ZA 4BEBA 5JSZB 1ZGZA 3DE2X 4XYEA 2FF5A 2IYYA 3RASA 3WLMA 1OLXB 4IFEA 2PGJA 5BSRA 1U7OA 3GA5A 3TMKA 3TG8A 3GVCA 2GM9A 4Z0NA 3OY7A 1C8KA 1T36A 1RRGA 1WHTA 3R4CA 3IIMA 4ZHQF 3DMGA 4J29A 2COKA 2CNLA 2H8KA 3N59A 4QQRA 2PMFA 4MW2A 3WWEA 4P08A 3UV7A 1P4AA 2CXPA 3FMVA 1DPGA 2VRBA 2FH5B 2VTKA 3ETEA 4CDMA 5EESA 4WXYB 3H75A 2R8PA 1DXHA 2RONA 3L8CA 1SBTA 4KXQA 4ZAYA 5F77A 2VAPA 5FJIA 4AZWA 4YRBA 3UK0A 2BGNA 1CT9A 2J6CA 1Z34A 5ALWA 4BE4A 5JXGA 3PEYA 4A8PA 1NQWA 5JZVA 3MJ4A 3M3PA 3FLMA 4FBGA 1EQAA 4LBYA 4P82A 5DASA 4B0PA 4Q4LA 5KWJA 2BCGY 3FNGA 2YY5A 1KK3A 3BERA 4FCCA 1W4RA 3B9BA 3VPFA 3L0CA 3E9NA 4X93A 5U4QA 1OU4A 2OXFA 5FBLB 4Q7LA 3RYHB 4X3OA 3E9QA 2A3RA 4N8EA 3RUHA 4ZMRA 1PJ8A 4JFAA 4EI7A 4L76A 1SCJA 4DCUA 2OQRA 2ILTA 4RSMA 4CL0A 2EZUA 1CZHA 4IF6A 4U6NA 5CHEA 1RBQA 5EYPB 3QITA 5K5EA 5KYKA 1RFLA 4DQKA 1QIHA 4YTEA 3IEKA 2YRFA 2FCRA 1A7KA 1S3GA 3JARA 1JX6A 1GZSA 1VE7A 3QKRA 4GP6A 4JYBA 4Z6KA 5F9FA 2W4IA 4DVJA 2O8BB 1W9MA 1A5ZA 1W85B 1BTOA 2J30A 5DI3B 4EL5A 1LRLA 3EDQA 4JB2A 1BXGB 5DGDA 2CT8A 2C4KA 2P4SA 2ZSAA 2X0DA 4ZI7A 4S05A 4JLJA 1P9WA 2ZXUA 1M2VB 1DP4A 4HAUA 4Z4QA 4HNAB 5KJEA 2WAXA 1WTCA 2HN9A 3C7KA 3VO1A 4EK9A 2P2YA 2Z98A 2YHIB 3F49S 4KE9A 1ZN7A 3ZWYA 4XUDA 3C4JA 2ATCA 2QMUA 2C2ZA 3U3ZA 1IXYA 4EX7A 3AIKA 1QH8A 1W5BA 3CWQA 3FPJA 1P5FA 3EZLA 4NULA 3FVWA 5ENZA 2ZRAA 3JWIA 4JBGA 1V16B 1JDBC 3IDSA 1W4BA 1I6KA 2XUDA 4RSGA 4O08A 3VYRB 1U3GA 3MT0A 2Q7XA 4OXRA 3ZI4A 4KH1A 3VISA 3TTVA 4ZPJA 4P4UA 3AVWA 1D2AA 3NTVA 4AJJA 3CF0A 3AF0A 4Y7DA 3GFQA 3P20A 3FN4A 5KYNA 3KAKA 3OH8A 2C3YA 4FCWA 2PL9A 4N3GA 5FOVA 3SP1A 2EWWA 1NUUA 3DO6A 1U8UA 2R3SA 1OIVA 5EIHA 4W1QA 3PEEA 4JUFA 3S55A 3WR5A 1Z06A 3IBYA 3JD0A 4WRRA 4XCVA 3UGTA 1RXSA 3QI7A 2H08A 3MTIA 4Y2RA 1CR0A 1RBYA 1YB7A 1ZGAA 1N7JA 5CB6A 2HREA 1F9AA 4J94A 4RF5A 5FJJA 3DCJA 4EUKA 3TAUA 1UZAA 1INLA 4FD3A 4AG3A 1XOIA 1YKFA 1PR3A 1QVWA 4TMYA 1KDVA 3BQNB 3NV7A 1KZ7B 3DF9A 1PR2A 4HN2A 4OB7A 1Z5ZA 2AN4A 2WUVA 2ZT5A 2O54A 1MHTA 2PRSA 1T2EA 1M2JA 2B2NA 3CXRA 4JVLA 4JZYA 4N6GA 3IMKA 1U2PA 3GJRA 3TI9A 5JBQA 3C6QA 3ZGOA 1EFKA 1GZ4A 4RAQA 2A6PA 2G8LA 2I5PO 3JQ9C 4RL6A 4V0OA 2V65A 5IBRA 1EB9A 2O3TA 1V5WA 1WB5A 4ZVVA 4IDFA 2FG6C 3MRTA 4UFPA 1PJ2A 1M6NA 1F2TB 4D3YA 1RHQA 4EW2A 3IS3A 4ZV7A 1QK5A 3PLAE 4XGQA 2PQ2A 1C9EA 3HYCA 4URWR 1OJLA 2MSLA 3GLQA 3UH0A 2CB9A 2QRMA 2C8JA 2W4QA 3VVLA 2CDNA 3K6JA 4QZVA 3D5TA 3N3AC 3AKDA 1JKJA 1Y8RB 3GBVA 5K0FA 3I8OA 1H2AS 5AKXA 1V1RA 3CCFA 2GZAA 2YYYA 4WFIA 4G41A 2Y93A 1RYFA 3JAWB 2WI8A 2MTBA 5BUSA 2I2FA 2ZTHA 3COWA 3RUCA 1OFVA 5FA6A 1I2ZA 2DUWA 3VR2D 3IVAA 4MRVA 4BN4A 2D3TA 2Y67A 1C2TA 1R7RA 3AGQA 4IQFA 1SC4A 2WR8A 1JVSA 3PXBA 3S2EA 4NPAA 1OGYA 1RMTA 5KOYA 2PZEA 4HP8A 3M9WA 5JO0A 3F7OA 1L4YA 3ZWQA 1FUKA 2JCSA 4KDEA 4DQUA 4A8HA 3EEIA 4E21A 4Z4HA 1XNHA 2EQ5A 3BHIA 1J23A 1FFXA 2HHCA 2AEEA 3GDWA 3LX4A 3LTNC 2GEKA 4B46A 2FOLA 3QVKA 4UMDA 4CMIB 5JXHA 2HT6A 1OAOA 2ACWA 1IWOA 3LPLA 2PIAA 5AXDA 3L4JA 3ST7A 4BQFA 1LU9A 4LN1A 4Y2UA 5MN6A 2NNWB 4Y2HA 1F5NA 3RS9A 2OZPA 2YHAA 4PLZA 1IJEA 1YB2A 4E2FA 1RW4A 3MILA 3T3PB 1ZHHA 1U0HC 5KHAA 2CVHA 5CTJA 3W3AH 5IASA 1XCBA 1GPKA 1QAMA 2I3BA 2QQFA 4DXDA 2EG5A 2JC3A 1YFJA 2PRIA 2CUTA 1KC1A 2HIMA 5I5GA 2B7LA 1Z4KA 4UOQA 5EKTA 1YL5A 1I0ZA 2EDAA 1PYOA 3C7AA 4TWJA 5JCOC 3X1XA 4H7DA 1PKEA 4D9IA 4PE5B 2JLZA 4F6CA 2VF7A 2FR8C 3PC7A 2JANA 10MHA 4MW0A 3SVZA 4IOJA 1GZ6A 4IJQA 5F3DA 1B4DA 1YRBA 1KYTA 2XUZA 1TIKA 3O4VA 1CLUA 2CNDA 1C7RA 2P91A 1B0AA 1GTMA 3IAXA 2H8GA 4WL0A 5F51A 2P41A 2HY7A 4HT3B 3IERA 1C2YA 1JJVA 2XECA 2WT9A 3T1YB 1NLMA 1MJFA 1PL8A 1ZH6A 4Q4DA 5KTRA 2IYQA 5LQJA 4DB4A 3ZLAA 5CW1A 3HZOA 2RMKA 2F62A 3B1JA 5A2GA 1T5SA 1MA0A 3VR5H 4AYTA 3L77A 3S7ZA 2BI8A 1QRSA 3Q0TA 4DA4A 1E2BA 5F52A 2Y1LA 3ESXA 2J9ZB 1JIJA 3FMIA 4EGJA 5C53B 3H2YA 3IQDB 3AKZA 4TOIA 1T9KA 1SU6A 1J20A 1KDRA 1RAIA 1C0IA 1UJBA 4JR0A 4TTRA 3TIFA 2IUEA 1WQ1R 1EWTA 4I4TA 1O5IA 3NCHA 1GUYA 2M6SA 3FKQA 3L1IA 4MVJE 4CV1A 4YXWD 3O0TA 4NMLA 1ULZA 3GYBA 1GDTA 3SOPA 3D2CA 4RD0A 4WXMA 5A0TA 1XDUA 4QXAA 2V59A 2XYVA 3JZIA 1U31A 3DAYA 4IDNA 1TDJA 1E9DA 4MAFA 3R7FA 1WW3A 2VHQA 2QN1A 2XIQA 5BUCA 1T3GA 3SJBA 4WERA 1RYNA 5CW2A 3NJRA 1V6SA 4QLBA 3RKRA 3UPUA 2QSZA 3MGCA 3PSHA 1MIOA 3EZYA 3F6CA 1Q92A 5ADVA 1E92A 1SCBA 2ZPAA 3R3WA 2IYZA 4C08A 4WJLA 3BMNB 3LBYA 1GL6A 1ML3A 2HX1A 1O8BA 1ULAA 3NX4A 1O0BA 1BCRB 1W88A 4YJ3B 4K5QA 3FWZA 3K96A 3HUEA 4KZKA 2C61A 4GU5A 5CX1A 1X8LA 1A96A 4B3GA 4Q39A 5KDLA 2IPXA 4D9GA 3EPKA 2Y0BA 4KGVA 2W48A 3QXGA 2JB9A 1Z38A 1F8FA 2BGMA 2I2BA 4HNSA 4L8GA 4RF4A 2AYXA 2X6TA 4X1IA 3WDKA 4C01A 5FBRB 3EGVA 2AR9A 2BUCA 3LG2A 4HH0A 4KK3A 2QYSA 4QYTA 3RJ5A 1UBHS 4FU0A 5KYWB 1S3FA 2QAIA 5ILGA 3NM4A 1YTLA 1P3DA 2H2HA 3CMCO 3JQGA 3KUUA 3MAJA 2H4XA 3OOEA 5DFAA 3RH0A 3PWTA 4FK8A 1Q3HA 1WHSA 4RVUA 2R4TA 1MO5A 1Y34E 2E1RA 3C87A 2AG0A 2DUMA 3LRPA 5DN6A 4BEJA 5B1EA 5ICGA 4G26A 3EDYA 2JEYA 1L7MA 4OLBA 2ZRJA 2RCYA 3C3MA 1JFTA 1HQYE 4NI5A 2EFCB 4TMXA 1J0DA 1HMYA 4A92A 2QQ5A 1HDXA 3NHBA 4JT8A 4PYQA 1WBJB 4GPTA 1NNEA 3PFWO 3LT2A 3OQ6A 2FA9A 2PWYA 3GRAA 2FGKA 1J42A 3QKSA 2ZVPX 1P17A 3CU5A 2Z4TA 1UMCB 1YJ8A 3BGSA 3NBZC 3L18A 3WK6A 1TLLA 1V6AA 1RM4A 3HACA 5LL6P 1XR3A 1NY6A 4HK4A 4O2AF 4Z99A 1O77A 1ZD8A 1QBKC 1HDCA 1NSTA 4Q3KA 3UHOA 4DT1A 3TFQA 1HE5A 4QGHA 2VDUE 3QQPA 1R8SA 3HK2A 1XCLA 2ZR0A 4YMGA 1E2JA 3DCYA 1DCKA 3FTNA 3KJXA 2AF3C 4RJTA 1EP3B 4FGLA 1QRTA 4LF9B 1GRQA 3PD0A 5DOVA 2R6GA 4PCUA 3RE1A 4XVCA 3A3YA 3WLJA 1SUFA 4AK9A 7YASA 2J5BA 1RI4A 1WXDA 4DIFA 4E2YA 1TYEB 4QRHA 1Z6YA 4UNPA 3CX8A 1XTIA 2WP0A 4ODIA 4QXRA 5D00A 4I3HA 4EG3A 4RDXA 2IXBA 1BDBA 1XZBA 2IP2A 4QQKA 3GJ5A 4EUNA 4WXHA 5TEVA 4UHCA 2CEKA 1LVHA 3K92A 4JY7A 1M7HA 1QGDA 3DAGA 1M1XB 1ZK3A 3KKPA 4Y2VA 4ENSA 4E09A 4E5KA 1Y6JA 1TZKA 2I66A 2HPHA 2JK1A 2OZKA 2P40A 3BSFA 3E18A 3IOBA 3P9SA 4L4UA 5A9RA 5KOJB 2XQKA 2OFOA 2PZGA 2R7KA 4KI0A 3ZU4A 5LIRA 3AVVA 2PZFA 2YZ7A 2NADA 3KKLA 5DNEA 2XX3A 1UAAA 3QU5A 2P8SA 1H69A 1K2WA 4BCDA 1EVYA 2RDMA 4ZCTA 3TKYA 1GVHA 2H0QA 3SC6A 1V39A 1ETUA 1PE0A 3FRJA 3VBEA 4JKYA 5FA8A 1O58A 3VSAA 4O59O 1RLIA 3DVSX 2C04A 1G4AE 3BICA 4ARAA 2W2NA 4EO7A 4ZRDA 5JCJD 1RACA 1T25A 3V00A 5F7OA 4LY0A 4KWTA 1KK1A 3QWHA 1N57A 4OXXA 5A3SA 4YJ2B 1E69A 3RJZA 1TKRA 3C0KA 5K8TA 4IGEA 5DSXA 5JNLA 4S04A 1YZYA 4LDRA 4TMKA 1MOSA 5L3SA 1KO1A 2VPZA 4YLYA 3QEKA 4WZAE 2R6ZA 2XTNA 3E2PA 1F48A 1F8YA 4F72A 3NVKI 2VZ0A 4G5SA 3QMPA 5LM3A 2O2IA 1NW8A 2YJTD 3GZTB 1VLHA 4QVKA 4WBNF 1G18A 4W6QA 1V8BA 3DDCA 3NAQA 4GBGA 3UVEA 3WFJA 5KS2A 3T0FA 5JI3E 2ZRPA 1HGXA 4HD8A 4O8CA 2PE5A 2RGNC 1LQUA 2YINC 1RLJA 1SPXA 3K05A 4QEKA 4ZYVA 4F46A 5IDQA 3K72B 1VL6A 5I6DA 4P7KA 4C30A 4KQCA 2YWBA 2XUGA 3R6GA 5ERXA 4DLSA 4OFZA 4J1TA 1PYGA 5K0GA 4HB2A 4ZO4A 2AHOA 4FPXA 2ZDHA 3IDFA 4C87A 1UBJS 3MRXA 1U2DC 5EE9A 1R8XA 2DTXA 5FBZA 5AI0A 3TVDA 2PKQO 4ZQGA 1JILA 1NBHA 3RIEA 1V7PC 3STYA 1E96A 2I7DA 2OP1A 3RU3A 2CVOA 4CM8A 1O96A 4R40A 2QOEA 2HJHA 5EJ8A 2NZ8A 4GM0A 1F51E 2FCAA 4G56A 3T3HA 4BO5A 2Q2VA 3BIJA 3HPRA 4DQXA 1I1HA 3VHXB 5FLXA 5AJWA 3KLMX 1NT4A 3JSAA 4AZ0A 1IBCA 2N1MA 2V7QA 3F98A 3WLRA 1IHYA 5CXXA 2ZBFA 4O3MA 2ZBUA 3PQ8A 2G07A 4ZGWA 1KY2A 2CCJA 5FIUA 2BFDA 2CDAA 4R8KA 3WC4A 2GM5A 2KBFA 3PUVA 1DRVA 2WVHA 3C24A 2ONKA 4GZLA 3DAOA 1XL1A 1SVMA 1MAVA 1VG0B 3O8CA 2J33A 1SNYA 1QHNA 3VVCA 5B6IA 2OO3A 3OZBA 1G60A 1KHHA 1FDTA 3ND7A 2E5LB 3C3PA 5C8DA 3VO2A 4R2HA 2WTAA 4ZT2A 4FFMA 3A6JA 2JAUA 2JFVA 5IJ9B 3DOJA 4L9AA 3AYZB 2GLTA 4HTAA 1XDZA 4YCSA 1EZZA 1M1YE 3GJ4A 4MR7A 2HDOA 4LI3X 1WWKA 1XZDA 3NWPA 2I4TA 4XX1A 4KG7A 3T1OA 3OZUA 1L7PA 1P0IA 4M53A 1KZ6A 2OHOA 4LXQA 5KWSA 1ZJ5A 3Q3GE 5IC4A 2JARA 2WT4A 4MW7A 5B57C 1P44A 4IGAA 1P7YA 2GCGA 3PUWA 3Q1LA 1WVMA 3CX6A 3MCWA 5HF6A 1M72A 2SICE 4X63A 3JQRA 3EN0A 1P81A 1QVAA 1NI5A 3WMWA 5KQPA 3T4UA 1WKBA 4HNRA 3HCDA 4UCFA 1NYRA 1WM1A 4NY1A 4Z3DA 1GVNB 3LW8A 3ZJ5A 5A5VA 5HRAA 4AULA 2CV1A 1D2HA 1G16A 3NI2A 3Q8MA 2VS1A 3MHTA 2X6QA 1RHKA 2JIDA 4UUAA 4JGIA 1ENPA 3T5TA 4CV3A 3EMKA 4P1ZA 2PUWA 2X0IA 3KHUA 4DPKA 4FE4A 3ZDCA 3QUTA 3G23A 4ALKA 2DPLA 3OOWA 4ND5A 4EQ6B 3PNVA 5J2UA 1M5RA 3CEMA 5IYZA 2P4HX 2GTPA 3QBEA 1ZEJA 4ZI5A 3NONA 1EWYA 5A5DA 3R3UA 5LP6C 4A10A 3WNVA 3KS9A 2ZTSA 221PA 4DABA 4OATA 4CUKA 4N4AA 3DWEX 1THZA 4IDOA 1LY1A 4M60A 4ER6A 3I3SR 3PEVA 3C3KA 1GZ7A 3P0JA 3HABA 3QVLA 1MV5A 2RH5A 3WZLA 4DLZA 2Q07A 2HA2A 4RM3A 3BTVA 4I3FA 1Z15A 1ZM2A 4Y9UA 1VCHA 5K6AA 1Z6XA 3H05A 3PNLA 3C5HA 1Q77A 5M04A 4JT9A 4BATA 5BWLA 5ITSA 2HYIC 3DBOB 1E1QA 1G5TA 2WAOA 3G9ZA 3KIPA 1OFGA 2YQ4A 2CJYA 3K09A 4LEIA 4L72A 4QU8A 3RD5A 1JLMA 4PPQA 1SG0A 1RP1A 3A1TA 1EFUA 1I0IA 2AN3A 3ZV7A 1A2QA 4R8LA 4F1JA 1K4YA 5K9ZA 1DTEA 1FSGA 2WIGA 3EFEA 4C4YA 1N8KA 1UWLA 2GMWA 4F1WA 1JH9A 1G291 1HDZA 5DYTA 4IJ5A 3RTBA 1I2AA 5YASA 5E0OA 1IN5A 2YOFA 3CUSA 2JRLA 3R3ZA 3IUJA 4P80A 2PUFA 1VKHA 2FWBA 2J3JA 1IXRC 2RGYA 3T5CA 4ACAA 1KVSA 4ECAA 5JECA 2QJTA 4DGQA 1QV7A 2ZJBA 4LWZA 2EZTA 3GLKA 3OD1A 1CG6A 1D2MA 3OTHA 4GNKA 4ID3A 4O0MA 3TLGA 5B5SA 5ITZB 4LPSA 1V8ZA 1AK2A 1NN0A 1DIAA 3U26A 2QX7A 3P2EA 3T9EA 1MZVA 1KTIA 3A27A 3U4CA 4CETA 1NXOA 3EUWA 5G40A 3LYUA 5IANA 5LP6B 2PXHA 2M98A 2XUPA 3QFFA 2OK7A 1UDCA 2A9VA 2VXBA 1VRWA 1ZL2A 3HY4A 4MR8A 4UHBA 4S24A 1HT0A 1ZH4A 1Q0SA 3I01A 3ONWA 4AP9A 1DG3A 5E1BA 1NULA 3HHPA 1GKUB 1TT5A 2CNBA 3H5OA 2V4ZA 1RPJA 1M2FA 2IHBA 1N3BA 4N7MA 4OM8A 2AI2A 3A1SA 3BRWA 4BKPA 3UKJA 1MNAA 2RHTA 1YB4A 1WUYA 3FH0A 3L79A 4G97A 3TB6A 3UY4A 2HK7A 1GNSA 2D5CA 1GL7A 2FEWB 3K4HA 4AF8A 2EWMA 4MULA 1CERA 4ZOCA 2OM6A 1U9IA 2QTTA 3KR2A 4G8JA 1E4OA 5FEMA 3M3DA 5E38A 4N5HX 5HDQA 4D3XA 4X92A 5JDIC 5JWRA 7ADHA 5BR8B 3W6PA 2AIRA 3MCVA 3FJYA 3K1AA 4AJ2A 4PN7A 4D26A 3N6VA 3FZEA 3K35A 4AO6A 3ZGNA 4TQUS 3CURA 5E6UB 4B71A 4TTPA 3FYCA 4A2QA 4IO0A 1UM8A 2QL6A 3RVLA 4DA0A 3K73O 1NBAA 4XDZA 3E82A 1FP1D 2GK4A 4PZ9A 1DAFA 1J21A 3LK7A 3UO8B 2Q27A 4YR9A 4BLSA 4BGDA 3U4QB 4WOJA 1RWPA 4ALJA 4HWGA 1X7WA 3LPMA 1BYIA 5JBNA 1FP2A 1TGYA 5KNDH 3U40A 1EVQA 2VDNB 2ZSHA 4ASUD 3T4XA 2AMLA 4MI9A 2ZI6A 3WB0A 1R1DA 1O8CA 2BE9A 3DBIA 3H2SA 1J5XA 3TQOA 4XJSA 2HSDA 4HJXA 4LHZA 2NZYA 1IPEA 1OLOA 2I2AA 2W70A 3ER8A 3SFZA 2JHAA 1MABA 3LW7A 4B80A 2VTBA 4JIGA 4EF6A 4DLAA 5TPZA 3W2TA 1E9VA 1OZ0A 4PCAA 1DJLA 2ATEA 2ZAIA 1Z5GA 1CR6A 1AE1A 1EE2A 1QQ5A 1L0BA 1RI1A 2VYCA 2XEXA 3B3JA 3C6BA 1GFIA 4UZEA 3ZN2A 3G2QA 1VL8A 3TS1A 5L53A 4F8JA 2XRFA 1SHZA 1W52X 5HZGA 4BO2A 2B4RO 4BVHA 1DV2A 5FL7D 3SKYA 4H77A 4JI8B 2J0QA 5K3FB 1RQLA 3EAGA 4L9WA 3GLFB 1PL0A 1VJTA 3IKMB 5C35A 2AE1A 1NN5A 1DINA 3BMCB 2ZIXB 4PZEA 1YUMA 4R98A 3ZVNA 3RIXA 2Q4OA 4NZMA 4WT7A 4B3HA 2ACKA 2G28A 4IILA 4R1TA 5AI8A 3G0IA 3MMZA 4NZYA 5HJ2A 2QMHA 1NP7A 3BKWA 2G3YA 3LUAA 3QY0A 2AEMA 3W4JA 3AWIA 4YXFA 3WL6A 1UCFA 4PZDA 1I4OA 3G9UA 2DGDA 2YYAA 1BSVA 3G0CA 4B35A 4D1YA 5JIBA 3LPAA 4MW9A 2ZT6A 3EBOA 1QTIA 3KQLA 2PUDA 2ISSD 5HX7A 2QLTA 4IIGA 4OPMA 2X8BA 3NT5A 2Q5FA 3Q72A 4AS2A 4EDFA 1YC5A 3TLEA 3R8CA 3AEYA 5C5CA 4FNOA 1FDVA 2EOAA 1E0AA 3B8EA 3PRKE 1KFJB 4UUOA 1ZK2A 1JBEA 1I4LD 3ZWCA 1QV9A 1Q0HA 3OZGA 3MOSA 1KIFA 2YFHA 1SVLA 4WHMA 4LJRA 1QC5B 4IH9A 4WLEA 4D99A 4E13A 4OFWA 4X7BA 2GD1O 4R01A 1R4NB 3NXKA 2UXDB 2Y27A 1OFHA