2RGGA

Crystal structure of h-rasq61i-gppnhp, trigonal crystal form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
159
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oncoprotein
molecule keywords GTPase HRas
publication title Transformation Efficiency of RasQ61 Mutants Linked to Structural Features of the Switch Regions in the Presence of Raf.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 159
sequence length 166
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rggA00
5EE9A 2REBA 1HT1E 1KO5A 3LQQA 2ZAMA 2QAGC 1NKTA 4PC7A 3A4LA 1G7SA 3NHBA 2FMXA 2XTZA 3CONA 3ECCA 1CRPA 4IOLA 3SJBA 4JIMA 3SR0A 2VSXA 4R2IA 2WJYA 1QDEA 3OE7D 4NYMQ 1E2DA 2OAP1 4IDHA 4YC7A 5FTJA 2GXSA 1NN3A 2AK3A 1P2VA 3LDAA 3O8BA 4WXPA 5FTNA 3R7WA 2GESA 1UFQA 3G5UA 1KSFX 1YZUA 3L8YA 4F91B 5CLQA 2PZFA 1TU4A 2C96A 2WJHA 3IDQA 5G3ZA 2Z5FA 2HF8A 1UBFA 4DDUA 2X1VA 3U4QA 4LC1A 1QHHA 1JJVA 1YZGA 2WWIA 3U6KA 1YR7A 1VHTA 4YXWA 2ZIAA 5J4VA 3NXSA 2F1JA 4XSHA 3U61B 5FTKA 1HUQA 2D74A 4MKIA 4B2IA 2O8FA 1UEIA 3TR5A 1E9RA 5EUQB 3NBFA 2QSYA 1JXMA 5EE3A 2IF2A 2N46A 4DCVA 1KDPA 4DB2A 4OQFA 1QHSA 1HH4A 2DB3A 3O8CA 4AKEA 1TL7C 4Z8XA 3TK1A 3MFYA 1ZD1A 1KY3A 2A78A 3OE7A 4GT1A 3EWAA 4B3GA 3UANA 4ZDJA 4EUNA 1XWIA 1RRFA 1DARA 2I3BA 4Q9LA 3I61A 3C15C 4XVUA 3VX4A 1D6JA 3RSOA 4NONA 1N6LA 4B76A 4DT1B 1IXRC 2YV5A 5CITA 4GOJA 3THYB 2G83A 2GCPA 3MJHA 1ZW6A 2VHUA 1S9HA 1MRSA 3P4YA 4Q03A 4HLDA 2QT1A 5JCZA 2DBYA 1TQDA 2OCPA 1T3HA 5EXPA 3TW4A 4B73A 5CM9C 3A58B 4UKDA 4IRUB 4B43A 2CE7A 4EPXA 2WM9B 3QG1A 5KUTA 1ESNA 5DLQC 4UNPA 4Q7LA 3F0TA 4PC1A 4AG5A 1WB9A 2W6ID 4AURA 4JT4A 4KHZA 3AGQA 3ICEA 3DOEA 2VSOA 5GJBA 1W1WA 3I3SR 3SFZA 3NWJA 5IDVA 1TUIA 2EU8A 3ADCA 1UKYA 2YOGA 2ZS9A 1ZVQA 2GAAA 4WOPA 1E0AA 1DEKA 2GCOB 5CIWA 2WOOA 2P2LA 3B1ZA 2GEUA 1A4RA 1KY2A 4LGMA 3VU9B 3HYTA 1CJTC 2EFEB 1ZM4A 4LWZA 1OIXA 1LB1B 1VHLA 2A5FA 4IW3B 2VA8A 4Q9IA 4UNNA 2XNDD 1Q1BA 2QEQA 4EKDA 1ZD8A 2H57A 3K9GA 4TLDA 3GLIB 1U9IC 2CJWB 1MO4A 5LDDC 4OKSA 2IYWA 3QIAA 4D25A 1VCMA 1JNYA 1X8KA 1ZNWA 2W6IA 4QRHA 3PFIA 4R98A 4ZIRB 3BE4A 1W4AA 1OXXK 3KKPA 5HCNA 3FHTA 4NBSA 4ZCIA 5KYKA 1KI6A 2WMOB 2F1RA 4B48A 1RYHA 1XTQA 1HT2E 1HV8A 1VYVA 1G3RA 4HAWA 2CMKA 3VNUA 3MD0A 3CLVA 4TMWA 2ZI7A 4ON9A 3WP0A 4CF7A 1PZNA 2XNSA 4DSNA 4Q18A 2CHVA 2CL6X 1BOFA 1KO7A 1G8YA 1R4AA 4JZKA 1R5OA 2JIZD 4JLAA 1DAHA 3QXXA 1KI3A 4OJQA 1RC8A 5JJLA 2XNDA 1VKJA 1UKZA 1J2JA 1KNQA 1OFUX 2CLDX 1KHTA 4TL9A 4URXR 3IHWA 3F8TA 1TNDA 2XXAB 2C04A 1FPMA 3AEZA 1E9DA 1NJGA 1Q22A 4HSEA 5B58C 3GLIE 1F6BA 1IOZA 4MRRA 4C0JA 2DCUA 2YHSA 2NPFA 2H92A 4HDQB 5E7JA 5L3QB 1OYWA 2PJZA 5LD2C 1T3LA 2D62A 1OIVA 2FG5A 4PHHA 2GCNA 3VR4A 1VCOA 3ZS8A 2F6RA 4PPGA 4DLZA 1G7TA 2ORIA 4QNRA 4NTZA 4YMTA 3L2OB 2FDCA 1GL7A 2GRJA 2UZIR 2XX3A 1MO3A 4LK2A 3RHFA 3A1WA 3TSZA 5A4JA 2QBYA 4JLOA 1ZNZA 1HURA 4AYXA 3Q7QA 221PA 3SS8A 1NN1A 1YJ5A 4JS0A 3IEUA 1ZJ6A 1FQKA 4AWXA 1HE8B 4MUBA 4OI4A 2ANBA 2EWVA 4C0SA 3NIBA 4TYQA 2ZJBA 1JBKA 1JI0A 1NN5A 2A2ZA 2J87A 1A1VA 5BQ5A 2DWOA 4LPKA 4MYUA 4NCJA 2OBLA 3ZD6A 1XMSA 1W2GA 5CK5A 5L3SB 1KYIA 1CBUA 3CNLA 3W6PA 1N3BA 4Q4AA 1C1YA 5FPYA 2HT6A 421PA 2DFTA 4LBZA 2R6GA 1N0WA 1K6MA 2BIFA 3I8SA 3VKWA 3EZ6A 3GEHA 2ZI5A 1OF1A 4LYHA 4L4UA 2QE7D 1IN7A 3AF4A 3CPJB 1GSIA 3I72A 2GVDC 1N6IA 4GNKA 5FH9A 4Z8YA 4JVSB 1I2MA 1Z0AA 4AK9A 2BM1A 3PEVA 2PZGA 2JDIA 3THOA 2H1LA 2NTYC 3CRRA 1F60A 4QGAA 1GM5A 2ZRMA 4H9GA 4OYHA 3SNHA 3AGPA 4PO1A 4U02A 3CX8A 4IHQA 3RRYA 3IQWA 2B21A 2IL1A 4US0R 3K53A 2GBLC 4E09A 1WRBA 5LB4A 1RFLA 2VP6A 4OI1A 4BLTA 1W5TA 3A36A 2FH5B 4LHZA 5DSZA 2JLSA 3K0EA 5TDHA 3ZYCA 2O5VA 3ZVMA 1ZINA 2JLVA 4K8OA 1MKYA 3LLMA 3WXMA 1TQ4A 2P6NA 2OHFA 2QE7A 5C18A 4BASA 1NL3A 2KWIA 4JL6A 2XZOA 2RGDA 1FMLA 1FP6A 1OKKD 3MMPA 4NCIA 1OH5A 4XVRA 1NVVR 3T1QA 1R8QA 2O0HA 3CW2A 3K9NA 2GKSA 3LX5A 3LD9A 4Q48A 4E03A 4JYCA 4JL5A 3ND8A 3EPLA 2NGRA 2ZSEA 4B35A 3KXIA 4GMDA 3SU8A 1T91A 3LV8A 1Z06A 1FL9A 2C9CA 2ZE7A 2R6AA 4UJ5A 2VO1A 4EQ6A 2EYUA 3SZRA 2WKQA 3NEJA 3BBPA 3UWKA 2V6JA 1NG1A 4B44A 1AQYA 2EYQA 3A4NA 4JVMA 3UK6A 4IEEA 3EZ7A 4ARZB 1CP2A 1X1SA 1QVRA 1N5IA 5FOUA 4QJ3A 1QG4A 2FFHA 1FW6A 2J0QA 3Q7PA 4IVPA 2JA1A 4UXIA 4RD4A 4DLYA 1OKKA 3DZ8A 4CEJB 4H1UA 3FKQA 3CPHA 2ZITA 1RKBA 3BB1A 3VTKA 4OK5A 4URUR 1G3QA 3B8HA 4Q4JB 3UMFA 1M34E 4FMBB 3X1WA 2QAGB 2VSFA 2ECKA 4F7WA 1SZPA 1GL6A 621PA 3FYHA 3VHXA 2BC9A 4I1VA 2J41A 5B30A 2CLSA 3DHWC 1OT3A 4TL6A 3SI7A 1T0JB 5AJYA 3U44B 1H8EA 3I4LA 1VYTA 5AUQA 4Z1MD 3ZZUA 3NH6A 3TAUA 1U9IA 2QGNA 4HB3A 2EFCB 3OFND 5K8TA 3THXA 4LI0A 4QJ4A 1NKSA 4W5JA 3HU3A 3IGFA 3SHFA 2WWYA 5JWHA 1KI2A 3TLXA 4DSOA 3TGPA 3MSXA 4ACBA 1EWQA 1BKDR 2ZRFA 1KI7A 1LV7A 4C0HA 2PMKA 4JBWA 3THWB 3QJYA 4KFTA 4ZKEA 1CJVC 1Z28A 3Q9LA 5GJVC 3QKRB 4LHWA 5D3MB 3VMFA 2BKUA 1OIWA 4DVGA 2C77A 1KK3A 1XXHB 4O0MA 2CL7X 2ZXUA 1Q1EA 1GNQA 2IUTA 2VHCA 4G5OA 4NCHA 3Q3JB 2IS1A 2O8CB 2VP2A 2FSHA 3OFNA 1SVSA 4NL4H 5AUNB 5IT5A 1HE1C 4JLJA 4JVNA 3V4FA 1YZKA 1ETUA 2A5JA 4GRAA 1KSJA 3B1YA 1SKYB 3FGNA 1XDBA 4IEIA 1R0XA 2J3EA 4BEJA 4DB4A 3D6TB 2YNMA 1DAEA 2BJWA 5AWFC 4JLDA 5DYGA 4OK3A 3ZD7A 2D2FA 3HP1A 3KFVA 1NBMD 3V00A 2VHJA 4QKQA 2FSGA 2FPLA 5HE8A 1R6BX 3GJ5A 1CLUA 3AVPA 4Q9JA 4LHVA 3AH8A 4M1TA 2ZJAA 1Z6AA 5JEDA 4DDVA 4RSGA 4IOMA 1W44A 5TB5A 1TEXA 3K9HA 4OHZA 2K5UA 2HF9A 4I1OA 3LX8A 4Q7MB 3ADKA 3BB3A 1Q3HA 2WSSD 3OIUA 4JVLA 4QGGA 3V9PA 3K70D 3NBZC 1E6CA 3WNCA 2ZRIA 1DE0A 2PX0A 4TMXA 4FD2A 1DAMA 2G6BA 2NG1A 4URYR 4PC6A 5FPTA 3X1ZA 2HEIA 3GJ0A 3AKDA 2FGJA 5FTLA 4A2PA 2ZYTX 1IN6A 1NBMA 1Z2AA 1TADA 1E2PA 2WHXA 2ZRHA 1KNXA 1FNNA 3K9LA 4JBXA 5EQTA 1XPOA 3T35A 1ZU5A 3NBXX 2GHIA 1GAJA 2C9YA 1N6OA 4XSGA 3SJZA 3HU1A 2FFBA 4HB0A 2E87A 4DLWA 1AQUA 2IYTA 1MO5A 3GD7A 5CDFE 4M9XA 3CKLA 1G4AE 1M2OB 3GJ6A 4U5XA 2KBEA 2WSSA 1G5RA 1DTSA 1KOFA 3LLUA 4Q01A 1N5KA 2BMEA 2R65A 4BFUA 4D82A 1S2MA 2ZYVX 3KKNA 4MKHA 1ZUHA 4TQAA 1BMFD 2WBLC 3JZAA 1FNMA 2WKPA 4HAVA 3RDPA 1US8A 5JHGB 5GJWC 3R9IA 4BRUA 4OHYA 3DZDA 1M1YE 4LYJA 1RE0A 4O25A 1Z0DA 4BRWA 1P75A 1A2KC 2NZ8A 4M1KA 3RSLA 1CXZA 4A0RA 3TAHA 3CRVA 1QF9A 3DDCA 3K0FA 2QM7A 2GXQA 1W0JD 5CK4A 1KZGB 2X8AA 2GETA 4G5QA 2ZRBA 3GLGB 4IJMA 5FUXA 4Z51A 3NG1A 3LY5A 5LD2B 1P7CA 3ZJYA 1WCV1 1PLLA 4MYTA 2A5DA 1N5JA 4IVRA 4XTCS 2XJ4A 4GSYA 1XP8A 1BMFA 4WZBE 1JECA 4PHTA 4DC9A 2IEZA 4B47A 1II8A 1OJLA 2OFXA 2OLJA 1E96A 2P65A 1W47A 1E1RD 2PH1A 3ONWA 4Q5IA 1HEIA 3PUVA 3UG7A 2P6UA 2PBRA 3H4MA 3K09C 4AD8A 4DUGD 1P60A 1BO6A 4U7DA 2WVJA 1E9BA 5IRCD 2WTUA 4HATA 2I4IA 4KBFA 2ZRAA 1KSGA 4LHYA 5K8IA 1Q44A 1W0JA 3SJCA 1D2MA 2Z83A 1XZPA 3RABA 5G41A 3O8RA 1S9DA 1Q1ZA 1FFHA 3W5JA 4KCGA 1HY3A 2PT7A 1XEXA 5IF9A 3TSWA 1XD2B 4RFSA 1DOAA 2E1RA 4B2PA 5JHHB 3BERA 4ZI2A 1F2UA 1ZIPA 5B57C 1AS2A 4J0QA 4M1WA 4BLRA 3P32A 1OB2A 5JI3E 4KODA 4GFDA 5FI0B 2QQ0A 1E1RA 3QXJA 4DUGA 2ZI9A 3T1OA 2OFOA 3U7HB 3EC1A 2D4HA 3DMNA 2BBSA 5EZ5A 4GOKA 4BLPA 2NMVA 1W46A 2R6FA 4FMCF 3OEHD 4MRVA 2FJUA 4ZKDA 4R71A 3B9PA 1A5TA 3SC3A 2WJIA 5DO9A 4TLEA 2ZYUX 4WZ6A 2IYRA 2J0SA 4F92B 3MWLA 3M6AA 3TVTA 3FPAA 3CZPA 4M0LA 4PAMA 821PA 2HXYA 2ZUBA 1WBBA 5G53C 1UM8A 721PA 4V02A 1X6VA 5LPNA 4PPQA 1NBME 3REFA 5C4MA 5CB6A 3UXMA 1AGPA 3AVTA 3VHLB 1UBEA 2XOKA 4CIDA 4CW7A 2GZHA 4URVR 2BOVA 2WOJA 5JFGA 4TQUS 2OFWA 5EXSA 3I8XA 4M22A 2Q3MA 1VECA 2JJ2D 2ODBA 2IYQA 1TF7A 4A0FA 1GL9B 3AKCA 3ZQ6A 4AC9A 4AKGA 3F5FA 4ZCLA 4QBGB 4IDNA 4PFSA 4C0KA 4Q66C 4I1SA 1HTWA 1QHNA 4PXAA 1KDOA 1Q0UA 4NP6A 3L43A 1G3UA 3KQHA 1I4LD 4P32A 4LYAA 1KTVA 1GUAA 4PHFA 5HCIA 5AUOB 4DT1A 2FWRA 1Q1QA 3PENA 3E5HA 3THYA 4UNQA 1XEFA 4LJ8A 2H8KA 2HJGA 1UBGA 2AWNA 5FPSA 2JJ2A 3PVSA 4N0EA 2DHRA 5E7IA 5G3YA 3WYAA 3HR7A 5EXTA 3ADBA 3C7KA 1AZSC 1SXJC 4N1AA 2BMJA 2A30A 5CJPA 4HZUB 4X8MA 2ZM5A 2Q21A 4JKIA 3CO5A 4PO8A 1CR0A 5FR2A 4PC3A 1RW4A 4ZDKA 1TX4B 2ERYA 3DKVA 4PPNA 4A4DA 3CB4A 2J0UB 4M8NE 5FOVA 1Q12A 4GL2A 1F48A 4YXWD 3BRWD 1T8UA 3GEIA 3IHLA 5AJXA 1G8GA 2QMHA 3LWNA 4PTLA 3ZIAD 2YJTD 4QBFA 4TZ6A 4WZAE 4FMCB 3B6EA 1KJWA 2C98A 2GCOA 4LJ4A 4QBHA 1JALA 8OHMA 4MDFA 3KQKA 3ADDA 4L16A 2QNRA 3VU9A 4BFVA 4IXMA 3CH4B 1NVVQ 3FB4A 2GJ9A 4NU0A 1Z22A 2RHMA 3K0AB 1NY5A 3U3OA 3S1AA 4YDSA 2EQBA 3TR0A 3GLIA 1TMKA 2X19A 2CJWA 1KO4A 3ZQJA 1AJEA 1LVGA 1P3JA 1Z0JA 1U99A 5IHPA 2P6RA 2O8EB 2CCKA 4ZIRA 2WAYA 2JLWA 1EX7A 4XH9B 4BFSA 3M4YA 5JSZB 1B0UA 4I1UA 2DFKB 2EWWA 3DVLA 3MJRA 1W0KD 2ZJZA 3B7GA 2G9NA 3ZIAA 1E2LA 4B3DA 1BH2A 4MH0R 1YZQA 4QHYA 3CR8A 4KBGA 2AFIE 5SZIA 1GNPA 2OCBA 2DFLA 1K8RA 2QU8A 4Q1CA 2HCBA 4R7ZA 1XTSA 3N2EA 5JS7A 4TTPA 2VF7A 4K46A 5GVRA 1YE8A 4PO9A 2ZROA 1VG1A 3R9XA 1ZUNB 2VEDA 1FTNA 4G5RA 4LDJA 4V0KA 4D6PA 5K8UA 4XOIA 2XXAA 3K09A 2ZSAA 4Q21A 1W36B 2CCGA 3KXKA 4BE7B 3AVXA 4KI0A 2IUUA 1E9EA 2RAPA 1KI4A 2NO0A 5FOWA 4C7OA 1JPJA 3QKTA 4W7SA 1M7BA 1CRQA 1D2EA 5L3QA 1SHZA 2AD5A 1W0KA 2QRNA 1MOZA 3KJHA 4S2EA 2W00A 3QENA 2F9LA 4P33A 3PUZA 4MKGA 4EPRA 2ZSDA 2B7CA 1XFAA 2CL0X 2ZJYA 3PUWA 2R62A 4M9QA 2WWWA 4A8JB 3T1VA 3L0SA 1F2TA 4LY6A 4YDHB 5F9HA 3TQCA 1ELOA 3H1TA 1GRQA 4DDWA 2Q9AA 1KI9A 2JLZA 1XEWX 5DISB 5K8LA 4PPFA 1GG2A 1YZTA 4C0LA 4LV8B 2IA5A 4D0GA 2CVHA 2OCYC 2JJ8A 3QNUA 4US2R 1ZM2A 2FZ4A 2YZ2A 3RS0A 3BXZA 3PJRA 1S8FA 5H8WA 2IYUA 3TRFA 5L3SA 3DOFA 4LX0A 5JEEA 3IIKA 1GKIA 3QUSA 4MRNA 2WWGA 4TMKA 2FPMA 3K0SA 2OILA 1Q20A 2VTKA 3EZFA 1YR9A 1A2BA 3PV0A 4HAYA 1X3SA 4LRWA 1OPXA 1E0KA 2EFDB 3SN6A 3JVUA 3EIQA 5GVSA 1G5TA 3AV0B 3I32A 2FPKA 3K1JA 4OK6A 1QRAA 2ANCA 2G3YA 2QTVB 2MSDB 4JLMA 2JLYA 1YQTA 4WBSA 2IHYA 2WPDD 4LUCA 4YMWA 2RGEA 1QHYA 4OQLA 2WWFA 2CHQA 2REXB 3B78A 1MT0A 1P2UA 1ZCBA 3OESA 1KJZA 1KMQA 4P4TA 4NCKA 1E0SA 3OIYA 3K0CC 2YVUA 4HUTA 2ERXA 2A5GA 2G1JA 2B7BA 2BMDA 1MO6A 4KYUA 4X8HA 1W48A 2FFQA 2IEYA 1DAKA 4IFEA 5DNYB 3W3AA 4QJ5A 4TLAA 3VR3A 1OXTA 1II9A 1IN5A 2WV9A 1TU3A 2IS2A 4KSCA 4G3XA 2ZREA 1DO0A 4ZDIA 2BCJQ 1UDXA 2HV8A 2J7PD 3AVQA 4YMVA 5B64A 2GVZC 4UQOA 3AVWA 5FPKA 4CYMA 3KKMA 2W6JD 4ESVA 3UWOA 2WPDA 3KQLA 2VP9A 2VP5A 4HLUC 4ZDWA 1LW7A 2H18A 2PX3A 2VP4A 3AF0A 5FUVA 5AJWA 1R8SA 2RGAA 1AZTA 4DLSA 1TTTA 2WWHA 4FN5A 1PLKA 2BHRA 2I1VB 4LCBA 4F93B 1YVDA 2F1HA 2JLQA 2RGNA 1ODFA 5JI2E 3GP8A 3B1XA 1XX6A 2ZANA 2CDNA 3EG5A 1GFIA 1HYQA 4C0QC 1G9XA 4QOSA 4ARZA 2VBCA 2H16A 3UATA 3FMFA 5DHAA 4LJYA 2JDID 2XITA 3WY9A 3LBHA 3KFXA 2X2FA 2J7PA 4CEJA 4US1R 4P31A 3TW8B 2FGKA 2V1UA 3ZZTA 2XJ9A 2QG6A 3MWYW 3MUFA 2W6JA 3KJGA 5EP4A 1JQJC 4NPHA 4ASUD 1HQYE 2ZUCA 2IYZA 2X77A 1VCNA 2XTMA 1QZXA 3KTAB 1GTVA 4Q4JA 5FR1A 1EFUA 2QAGA 1GWNA 3CX7A 3L0IB 3SE0A 1COWD 4CEIB 1YRAA 3DEFA 2JLUA 1WMSA 3ETLA 5TV2A 1G8HA 4DLUA 4DEXA 4TL7A 3M0EA 1P72A 5J4LA 4DJTA 3B1VA 3U44A 1VMAA 1IY0A 3EA5A 3FDIA 1JAIA 4M21A 1VYUA 4S35A 1LY1A 2PCLA 2Q9CA 3MLEA 4Q4LA 3REGA 4YLGA 1GVNB 3Q5EA 1DAGA 2V3CC 3L8ZA 4D0LB 5C1BA 3QEJA 3Q85A 5ELXA 1KMHB 4ASUA 1Y3AA 4TYWA 4W9MC 1JR3A 4A0GA 3GLFB 1T3SA 2HT1A 1V5WA 2OT3B 1XTRA 1KO1A 1R2QA 2V7QA 4QHSA 5EP1A 4Q1EA 3UMRA 3LBNA 1JAHA 4BFXA 3R9WA 1FUKA 4KFUA 5EZ6B 5TXGA 5DI3A 1COWA 2FEMA 2CCJA 2ZRKA 1KZ7B 3THWA 1ZYUA 4ZPXA 3U2QA 4Q7JB 4JLVA 4G5SA 3GFPA 3QKRA 2TMKA 4I4LA 4MUAA 5D3MA 3W6OA 5B2ZA 1R10A 1XXHA 1G8PA 2QM8A 1XTKA 1LF5A 5FBVB 4TN1A 1R0YA 2O8CA 4XD7D 4DRZA 4Y0VA 4ITRC 4PQRA 1P6XA 1QG2A 2REOA 4LOAA 1T5LA 1DADA 2OUKA 3LO5A 1ZM7A 2ATXA 4QL3A 4LJ6A 3GJ7A 1VIAA 2ZE8A 3C5CA 1G7RA 1LNZA 1ZAKA 3MRSA 4B3XA 5BW8A 4DCSA 4PSKA 2Q3FA 3GLFE 2Q9BA 4HDOB 2O8BB 2OZEA 1KI8A 4MYHA 4YMUA 1H8ED 1SXJB 4PQYA 3RRNA 5JLJA 1U81A 3EARA 3TBKA 2R8RA 5AJVB 1G1MA 4JYBA 1A7JA 5CDFA 1KDRA 2BBTA 4M1YA 3CF2A 3VX3A 4MITA 1G41A 5H1YA 4CT5A 1U0HC 5CYPA 4XD7A 2QL6A 3EWSA 3OIWA 3FMPB 2GILA 4KITB 4IFBA 1AS0A 1W2HA 2R2AA 4UJ3A 1F5NA 1E2GA 2G88A 4NYJR 2RKOA 5FBLB 3H0KA 2ZQ5A 4NCNA 1NIJA 1GRRA 1I4TD 3QF7A 4C0BA 3TSOA 3W8RA 4M53A 4TLCA 1Z07A 3WHKA 4AKHA 3EPHA 3QKSB 1NMYA 4TZ0A 1OH6A 1Z0KA 4R9UC 4BLQA 2ZRLA 2IX3A 4GZMA 1D9ZA 4V0NA 4RZ2A 4GBMA 1NN0A 2OV2A 3VR1A 1U98A 4TTQA 1PUIA 4PSAA 2RHDA 2YWHA 4TL8A 3W90A 1XPUA 4HB2A 3NDBB 5CLLA 1Q21A 5FOSA 5BYKA 3TQFA 1S4QA 3I92A 2ZJOA 3KB1A 4NMMA 4BLSA 1QBKC 2DY1A 4TWZA 4AG6A 4DLXA 1VPLA 4K81B 2IYXA 4NYIR 4UNSA 3R20A 4ZV4A 2WAXA 4JJKA 1IJEA 3WYGA 1X86B 4O2LA 4TSFA 2BM0A 5AK0A 1U2RA 2O0JA 5DE3A 1S3SA 2GJSA 2IF0A 4IDOA 2Z43A 5KDLA 1OW3B 1XD8A 2OESA 3AF1A 2OAQ1 3WYFA 1AK2A 2CNWD 2ZR0A 1KJYA 3CRMA 2ZRGA 2PLFA 1OSNA 2VP0A 4I99A 2N1BA 4C2TA 3QPVA 4EJSB 4M9ZA 2NO6A 2ZYWX 3QF4B 4GDFA 3CBQA 4AKIA 3ZGXA 1E2KA 1Z29A 1ZM9A 2B92A 3TVDA 2PT5A 5JRJA 1S1MA 3GLGA 5CIQA 3HPQA 4KVGA 3KJIA 4DLRA 2FN4A 1E0JA 3FTQA 3RAPR 2DPXA 1JR3E 3BGWA 5CB8A 3CPEA 3T5GA 1NF3A 4KJZA 3ICQB 3MG9A 1PJRA 3TUIC 4B3FX 1J7KA 1EFCA 3EIEA 3CR7A 3QVVA 2IXEA 4LV5B 1AA9A 1R5BA 1W36C 5FBRB 2QMOA 4XWKA 1Z0IA 2CNWA 5BYJA 5EP3A 3H86A 1XMJA 2ODNA 2W2XA 3AF3A 3T61A 1N6PA 1U8ZA 5FUYA 1XXHE 521PA 2R6DA 2QENA 1KAGA 4BFZA 4PHGA 4BQSA 3LVQE 2GK7A 3PG5A 4KU4A 4D81A 2GAOA 2JATA 3DPUA 5E4FA 4A8JC 2FA9A 3C5HA 1XD2A 4WVFA 1SKYE 2Q6TA 4YMSA 2ORVA 1L2TA 1L4UA 1XB2A 1NNEA 4HUQB 3BAFA 3P27A 3BIFA 2GTPA 4MQBA 4D0NA 2IWRA 2GJ8A 2I1QA 1A82A 4MA4A 1Z8FA 3TMKA 2Q0HA 4B75A 2GA8A 3RWMB 1DS6A 1CULC 2WICA 5DGXA 2A5YB 3IIJA 1CU1A 2IWHA 4G0NA 2ZE5A 1T0HB 2J9RA 1FX0A 2ZI6A 3P20A 1L4YA 3AVUA 1IY1A 1E94E 1D5CA 3QVUA 4FXPA 1WP9A 4E07A 5JMTA 2GBLA 3QEOA 4NHOA 4KVAA 5HR5A 5KNBA 1SKQA 2P0EA 3E70C 4IOKA 3SQWA 1OYYA 1DG1G 1NMZA 1W7AA 5FI1B 1XTJA 2LKCA 1DELA 2VL7A 4CVNA 3LVRE 4BZQA 3AP3A 4P4UA 4ZO4A 1JB1A 1W4CA 2ZU0C 1KKMA 4LJ5A 3BH6A 1KO8A 2A9KA 1S0UA 4G01B 3UMSA 3PITA 2O8DB 4FCTA 3ZVLA 2ZSFA 3VKHA 1I2DA 4G1UC 1CJUC 4ZCMA 5JCPA 2LKDA 4B71A 2FEOA 1U8AA 4A2QA 4A15A 1CR4A 2IK8A 1GRNA 3TKLA 4F38A 1W4RA 3C4JA 1CR2A 2H17A 3GMTA 3OEED 5KPJA 2JEOA 1P61B 3DM5A 2CXXA 4RD3A 5J40A 5SZKB 5BN5A 3RYTC 2IHBA 3GQBA 2B6HA 2YYZA 3DM9B 5KSZA 3WBJA 1E1QD 1G17A 2ZUDA 4RD0A 2ORWA 5KU1A 3SYKA 1DPFA 1DAIA 2YC4C 4LJ7A 1E4VA 3V4RA 1J8YF 1JEEA 2PLRA 1N0VC 1JQLB 2PZEA 3NHAA 3TNFA 4Q02A 1WBDA 5KDDA 2VH5R 3NVAA 3UKDA 1V43A 1E2QA 3EX7C 3WP1B 4PC2A 5AR1A 4HI0E 2QGZA 2YOFA 1T6NA 1E2IA 3CF0A 3FFAA 3GLGE 3U7FB 3QBTA 3MAAC 4OQNA 3OEEA 4A0HA 3B60A 1IM2A 4HZUA 1CS4C 3WNDA 4MGZR 2NPIA 3FOZA 1P9WA 2NO1A 2J5XA 4O3MA 1E1QA 2FOLA 2XOKD 4RCYA 2FZLA 3GJXC 2Z4SA 2GEDA 4P4SB 3ZDQA 4ACAA 2IYYA 3A37A 1G20E 2OEPA 2FFAA 1N6NA 4QBIA 3AVYA 5HPYB 4LYFA 5KSOA 4Q19A 1SVWA 1C9KA 1I4DD 1NRJB 3KDSE 3VR5A 3K0AA 4PQFA 1ZD9A 3GLHB 4Q4HB 2QMUA 3I62A 1TF5A 1QHIA 2NOAA 3NKVA 3NTUA 1NVUQ 4DBLC 3WRYC 2FX3A 4GP6A 3RRZA 3X2SA 4A82A 2ZI4A 4RFVA 5L3VA 1XD9A 2O8EA 3TIFA 1OFHA 2D2EA 3U3MA 2ZVQX 1W5SA 4OQXA 5JSZA 1YZNA 3FHOA 3U6BA 1C4OA 1XJQA 1G8FA 2MSCB 4TYYA 4N0DA 4KXFB 4R2HA 1KK1A 4B6EA 3D7MA 3H84A 1IN4A 2BMFA 3DKPA 3IKJA 2GNOA 1XJ0A 4L15A 2GXUA 3KXLA 3LW7A 4II7A 3SYLA 4DCUA 4BGDA 1EXMA 4OHXA 2MSEB 4XIGS 1CKEA 1NI3A 2AHOA 3FFBA 4B33A 1E79D 4DIEA 2OBNA 3IUYA 1U8YA 5C46F 4CDGA 3NBYC 4A36A 2F9MA 3L0OA 3W3ZB 2OSBA 3GJ8A 2F3RA 3GLHE 1MRNA 2ZJ2A 2PEYA 1SVKA 3HYRA 5FOTA 1FZQA 2J45A 2F43B 1YR6A 3I5XA 1G18A 1X8JA 3EW9A 1PVOA 4TYNA 2IT1A 3FHCB 1K5GA 1YHNA 2QMEA 2GXAA 4RKEA 4YQFA 3SYNA 2NO7A 1XTIA 1M7HA 5DN6D 2ZRPA 1SGWA 1RJ9B 3TE6A 4JLBA 2FV8A 4DDTA 3RS2A 4JT2A 4MGKR 3EIHA 4LC0A 1VCIA 4A8JA 2ONKA 4PAQA 4LHXA 1UBCA 2BWJA 4MKFA 2ZEJA 4HYYA 1YKSA 1E79A 1YZLA 2HCJB 3KUCA 4DIDA 4C9BA 4XTRA 2VHQA 1MABB 2BKEA 1G16A 1J70A 2KB0A 2GF9A 5JRZA 3IQXA 5EJEA 5FBQB 1SULA 1NY6A 3IILA 2V54A 4PSVA 5DIFA 1E9SA 5J4YA 3D31A 1KGDA 2IYVA 2DFNA 1T4GA 2QTFA 2ZTSA 4RZ3A 2J59A 3MWKA 4Q00A 2BV3A 4URZR 2JLXA 2OM2A 1OFTA 5DN6A 2MMCA 3P4XA 4GZLA 2BCGY 4NH0A 1H8HD 2QQEA 2R9VA 3AP1A 3IO3A 1NLFA 3X1XA 4B2LA 2PEZA 4CZ2A 4C3ZA 2B8WA 2LCFA 2JJ1A 2A3RA 3VNVA 2C2HA 1SVLA 4A6PA 3QXHA 1ZUIA 3L0PA 4Q9HA 4JSTA 4DWJA 3Q8XB 4LV6A 4TQ9A 2RGGA 3SDZA 1U0JA 2YC2C 1CR1A 3WHLA 4EIWA 1XF9A 1UPTA 4D4KA 1NG9A 4ESHA 2C78A 1OXSC 1D9XA 2UVQA 1J90A 1T8TA 2G1KA 4PAOA 2Q3HA 3JZMA 2FNAA 2DWQA 5L8VA 4V03A 3C14C 4MYCA 4KV9A 1IONA 3FKSA 1H8HA 4OL0A 2CHGA 2FSFA 4FIDA 2ZAOA 4NYJQ 4IKEA 5JJIA 1N2CE 4KYIB 1E2JA 3BOSA 4ILEA 4EJSC 2PL3A 1AS3A 1QHXA 3K8YA 3DL0A 4C4PA 4HAXA 1D8TA 3A1TA 3MWJA 1RZ3A 4BZXA 3WNBA 1G4UR 1XJCA 4BPBA 3O47A 5KDOA 5EUMA 1CF4A 1XZQA 2KE5A 3N70A 2W83A 4EFNA 6Q21A 3WMFA 3TJZA 1S1CA 1U90A 2AFHE 1ZU4A 4ERNA 1QVAA 4N3NA 3O8DA 1Z3IX 3B82A 1QHGA 4FWTA 3KUDA 1E2NA 3WBKA 3TUZC 4EFLA 4B74A 2HYIC 3ZS9A 2ZRNA 5FFMA 5E3HA 2RGXA 4D2IA 4RKFA 4D4MA 4NYIQ 2G77B 1EFHA 1SVOA 2QPOA 3ASYA 4B34A 5JBQA 4QGFA 5FUWA 1MH1A 3IO5A 4EPVA 4MRPA 5ANRB 1E2FA 4HEJA 2BVNA 5KNCA 3BK7A 2PJRA 1SVMA 2VF8A 3N2IA 2QROA 2VIIA 3VR2A 4AY2A 3KTAA 1FOEB 2YWEA 1YU9A 4PZYA 3SQXA 4CEHB 1N0UA 4EDHA 2D7DA 4CEIA 2GJAA 1EFTA 1NSTA 2CK3D 3NC0C 2V9PA 1KSHA 3HU2A 2FF7A 2ZVPX 4HLCA 4QHTA 1HQCA 1GKYA 1BYUA 4JL8A 3SBEA 1LTQA 3RANA 4B32A 3T12A 3F3YA 1XRJA 1LS1A 2Z6VA 1U0LA 2V1XA 1IJFA 3SFVA 3BD9A 3UG6A 2CBZA 4M1OA 3IEVA 4AYTA 2ODEA 1W49A 3TUJC 1J99A 4ABYA 3NDPA 3B85A 2WJJA 3LXRA 4PR0A 2AN9A 1KMHA 3GLFA 2XEXA 4FINA 4O2RA 2C5LA 3S1AB 4FWIB 1Z6TA 3FMOB 2XZPA 4L9WA 2IC5A 2JAQA 3ASZA 4NE2A 2QN6A 2ZU6A 4OI2A 3R7WB 3PUXA 4MRSA 3X1YA 1IXZA 1PLJA 3U4QB 4GMXA 1RYFA 1JEDA 1SXJD 2CK3A 1QHHB 3JVVA 1G7CA 3LRPA 2BBOA 1M8PA 4X8LA 1FP7A 1VG9B 2ASEA 1KK0A 3X1DA 2HLDD 3LBIA 3HJNA 4IXNA 2O8FB 1E69A 3OZXA 4KO8A 3VQTA 3QPWA 5EP2A 3D3QA 4I81A 4EAQA 1GZSA 4QM7A 5A0FA 4WIAA 2WJGA 1M74A 3AVOA 3AKEA 2EFGA 4TT3D 5UKDA 4Q1AA 3L82B 1M6NA 3AM1A 1Z6XA 1JXOA 3QPUA 3W9YA 1CTQA 1DG3A 2YOHA 5SZJA 3LH5A 5HZKA 2C03A 3AUXA 2ZETA 2AL7A 2O8BA 1NLZA 4DLTA 3CRQA 1AM4D 1DAFA 4IDQA 3HR8A 1WQ1R 2YWGA 1LS6A 4PZLA 1SXJA 2WIBA 4JJZA 3IBGA 3BFXA 2UZ3A 3A1SA 4C7OB 3PXGA 1DBSA 2XGJA 3T06B 1T9HA 2WKRA 3U3KA 3PEWA 4D26A 1BYIA 2HLDA 1UKEA 1M7GA 1XBTA 2JGNA 1EGAA 1JR3D 3I5YA 4MDEA 3AUYA 4RZXA 4DZZA 2V7QD 121PA 4TT3A 4UXHA 2VYFA 3BJIC 4BUJA 1ZBDA 5L3RA 3EZ9A 1F2TB 3C41J 5F2EA 2W0MA 1XMIA 3GCGA 2VPPA 3N5CA 1BS1A 2JIZA 3TH5A 3CNNA 3C16C 2ZR7A 4KLNA 1Z63A 2ATVA 1WE2A 4RD1A 1E98A 2G0NA 3QKSA 3U3RA 3EZ2A 2IBMA 1E9FA 1N5LA 2J0VA 3B9QA 5HE9A 1PUJA 3ZH9B 1E99A 4FMDF 2UKDA 3LW8A 1ZNXA 1ONBA 3B2EA 3EPJA 1OXVA 3RRMA 3CRW1 3CZQA 4LJ9A 4DCTA 4LBYA 3CWZA 1ZRHA 2AXPA 3GFOA 3UPUA 4KFRA 4EFMA 1XCGB 5BWMA 2J1LA 1LFDB 3GJ3A 5J47A 2VRWA 4QGHA 5KNDA 2RGBA 3EAQA 4Q1BA 5BXQC 5D3QA 4JLKA 2QPTA 4A6XA 1TEVA 2KSQA 4XWOA 2CLCX 5E95A 4AI6A 1ANKA 1WDTA 1AGRA 2F1IA 2XB4A 3IBYA 1Z08A 1GKUB 3H2YA 3IIMA 4KSBA 2H5EA 5J5CA 5HTKA 3U5ZB 1RPZA 2Z4RA 3QOFA 4F4JA 5JZVA 2QP3A 2HJVA 2R44A 3QG5A 2F55A 1KI6B 3K70C 4JKYA 1KI1A 2ONJA 5CM8B 2OXRA 1Z6GA 3ND9A 2EW1A 4EJSA 2BBWA 1ZC4A 3QF4A 3R8CA 1XEWY 1L8QA 3B1WA 4RJLA 4DKXA 2J7KA 1N6KA 5F98A 1VDZA 1Z6YA 3BWDD 2Y8EA 1UF9A 1K5DA 1EWRA 2AXNA 3CIOA 3LXXA 4B3CA 5J4HA 5KHOC 1G64A 3KB2A 3SOPA 1GOTA 1CIPA 4OBEA 1RRPA 4HLQB 4F4IA 1E32A 4U00A 1E9CA 2ZJ8A 2XB2A 5M04A 1P9NA 2QT0A 4Q1FA 4DCNA 5CJ2A 4W5WA 1G291 2QRZA 4URWR 2BJVA 4OI0A 1P62B 1ESMA 4NYMR 1J8MF 1TPZA 3ZVNA 2H7VA 3RVBA 2NQ2C 3A8TA 3P1JA 5FPHA 2YWFA 3CWQA 1B23P 1NSFA 5BN4A 2YINC 2V6IA 3B5JA 3BFKA 4M2LA 1NP6A 4UXJA 2WSMA 1W4BA 1ZCAA 1IXSB 1H65A 3Q72A 1VG0B 4H1VA 1EX6A 2ZS7A 4RD2A 1R5NA 1S3GA 2P5SA 2IS6A 4D4LA 2NZJA 1VG8A 5KPDA 2QBYB 4TSFD 1JR6A 2OE2A 4L8GA 1IAQA 2J46A 4GP7A 2P3SA 3U3JA 4F4CA 3CNOA 4HUQA 3GFTA 1IBRA 2OXCA 4NDZA 1JPNA 2DR3A 4FMDB 1EFRD 2L0XA 2IXGA 2OLKA 5JWRA 1T5IA 5DH9A 1SXJE 4BEBA 1UKVY 2D06A 1P2TA 3VAAA 3J81k 4Q4AB 1G6HA 2FU5C 3SJAA 4GOXA 1TQ2A 2NO9A 1KAOA 2BEKA 2QA5A 3K0CA 5GADl 1KDTA 4A9AA 4HDCA 1WXQA 3A1UA 2PMDA 1Z0FA 2BEJA 3AQ4A 1P9RA 2X2EA 2QPAA 3W34A 3DMDA 4TYPA 2B8TA 3PUYA 3LNCA 4AIIA 4Q9KA 2CE2X 1X8LA 1TF2A 4DLVA 5TMPA 3RS3A 2O52A 3RS7A 2MMGA 5EXXA 4M1SA 1OH8A 2ZRCA 1Z47A 5FTMA 4XWAA 1FUUA 1G21E 4C30A 1ZIOA 1EFRA 2C8VA 4LJAA 5DHFA 2QUZA 1E4YA 1EG7A 2O8DA 3QE0A 1IY2A 3C8UA 4HLUA 3KQUA 1FMJA 4A2WA 5DI3B 4EPWA 3Q5DA 3RLFA 1OFIA 4JLPA 4L9SA 4D80A 3QSYA 1Y63A 3IPXA 2AKYA 2EFHB 3QBVA 1WA5A 4QXAA 4DEYA 4MGIR 3CUEF 4DSTA 2RGCA 1IN8A 2ZRJA 1UADA 4Z1MA 3T34A 3PCRB 5EE1A 4IDPA 4V0LA 2DYKA 2AR7A 4BWYA 4Z54A 3HDTA 2WIAA 4M9SA 4DXAA 2OBMA 2QORA 4A92A 2OO7A 3EXAA 4RVCA 5DYIA 2GK6A 4FCVA 3VR6A 4EQ6B 4FW9A 2AX4A 1XCMA 3W5IA 1D2NA 3ZLJA 4HAZA 1MV5A 4NKRA 3T1TA 5F9FA 3CM0A 3T5DA 1AKYA 1VTKA 4HB4A 4IOJA 2JCSA 4QG7A 4RZUA 3WMEA 4OQMA 1N25A 5FOXA 3SHWA 4JLNA 1Q57A 2DWPA 1NIPA 1RRGA 5A5GA 4TTRA 1KIMA 4WW0A 3WRXC 2P5TB 3WMGA 1KK2A 1G19A 3DO6A 3IPYA 3PEYA 3KZ1E 2PCJA 4AYWA 2GZDA 1R0ZA 2JASA 1CJKC 5H70A 2ODWA 2RB4A 4JSYA 1NMXA 1YR8A 4P4SA 4GPTA 4B6FA 2XTNA 1RVDA 3I73A 2AKAB 4CRWB 3HWSA 3A1VA 3FE2A 4BECA 4PZZA 1E2MA 2VHTA 1GIAA 2SHKA 3BS4A 1DVRA 5KO2A 3GPLA 1XCPA 2AWOA 3UIEA 3B13B 2XSZD 2HXSA 4C0AC 3CF6R 1R7RA 5FBWB 1VIYA 3ZZ0A 2JLRA 3FVQA 4Q4HA 3GLHA 3LAWA 4GI7A 3AP2A 3MGCA 5AUPB 4OHWA 3MCAA 5TY0A 1P2SA 3RWOA 5KTYA 4DHEA 3THXB 3NC1C 2HUPA 1XMVA 2RCNA 3QXSA 2C9OA 1XPRA 1E2HA 5KSPA 2VLIA 3GJ4A 3D8BA 1RIFA 4HAUA 1CEEA 5LBIA 3QKUA 4L5BA 4V0MA 1OH7A 1PV4A 3A4MA 3RS5A 4QC2A 1OV4A 4YONB 1GITA 4X8OA 1ZNYA 2W2TA 1EESA 4BFWA 4B3BA 4EPYA 2ZRDA 2W0SA 1Z2CA 1BIFA 1ZP6A 3OF5A 1SQ5A 4FI3C 3BC1A 3VFDA 1FTSA 2GZAA 2E9SA 1IQPA 1AN0A 4LPSA 3E1SA 2VQSA 4W5HA 2XSZA 4BZPA 1O3YA 1G6OA 4TLBA 1CJMA 4D4JA 3R8FA 2ZJ5A 4BLOA 3KQNA 3SBDA 4P3YA 1LF0A 1Z5ZA 2HDNB 1G3IA 4IVQA 4Q7KA 4RY2A 5HKKD 1E3MA 1GILA 3FWYA 4V0OA 3PEUA 5EE5B 3BORA 2V4ZA 3W6NA 4KAXA 2ZSBA 1R0WA 1IHUA 1Q3TA 2F43A 5BN3A 2WZQA 1G3MA 2IXFA 3AKYA 1NLYA 2GJKA 1MR3F 2IW3A 2GEVA 1S96A 1II0A 3QQ5A 3RC8A 2V55B 4G5GA 1AKEA 4KLZA 4RCZA 1E2EA 3G82C 1F3OA 1RJ9A 2CEAA 2EVWX 4FCWA 4P0TA 2IS4A 4DSUA 5IK2D 5J4KA 1ZM3A 4JMPA 2OCAA 1Z83A 2D7CA 3BH7A 4A1FA 4KFSA 3EASA 2C95A 5KSYA 1G5PA 2F3TA 2V8OA 1MABA 5HKKA 1DO2A 1TAGA 3LFUA 2IYSA 3LA6A 2YKGA 4M4SA 2CVFA 2J0UA 4BFTA 3OIVA 3SEAA 2LWIA 1TQ6A 2F7SA 4BFYA 2W58A 4M1MA 4TMZA 1GNRA 4WA7A 2HYDA 3AVVA 3CX6A 2ZPTX 3BB4A 3KKQA 3KL4A 1UAAA 3VKGA 1YRBA 5JJKA 1ZC3A 4QM6A 2GDJA 4CGZA 2WWXA 4EPTA 3KX2A 5GJCA 3QXCA 5DI9A 1AIPA 1UDWA 1OE0A 3PR1A 4LZZA 2KI5A 5IK2A 2FE4A 3W8NA 5JS8A 2QAJA 2FSIA 2GF0A 2A7QA 5FL3A 3U7EB 2IUSA 2QI9C 2ZE6A 1W36D 3ZVRA 1FX0B 1KKLA 3K70B 2N42A 4UNRA 3BH0A 2G0TA 1E9AA 3CH5A 3NH9A 4WAUA 1OHHD 2BDTA 1U94A 3EPKA 3PQCA 3GEEA 3EC2A 3PIRA 3AB3A 3P26A 4POAA 5E7MA 5EE0A 2ZS8A 3QI2A 3QY0A 1US8B 1N6RA 1OXUA 2D3WA 2KJQA 3I1FA 3T15A 4QFMA 4HZIA 3OAAD 1NVWQ 1O87A 2ZR9A 4LSGA 2C99A 1UEJA 3K0FB 3RS4A 1P5ZB 2P67A 2QP9X 3BFVA 1FQJA 3OEHA 3A6PC 2O0KA 5C4GB 4JBYA 1EK0A 4LBVA 4E5UA 2XAUA 5FL7D 5JWOA 4ZI3A 2R6CA 1JJ7A 2OG2A 1XU4A 2QSZA 3M1IA 3OHMA 4LBWA 5TVKA 5F3WB 4V0ME 3KJEA 4C2UA 1OHHA 4RD6A 5TARA 4PX9A 5SZHB 3EA0A 1GDDA 1II8B 2WJVA 4WXRA 4XVQA 1P73A 2WMNB 3NEYA 5KOYA 4NZYA 4OJKA 4MGYR 5C2JB 4OHVA 1N6HA 5P21A 5CYOA 3LQRA 1X1RA 1P4SA 4TMVA 3KKOA 1OLOA 5LB2A 2QTHA 2JJ1D 3OAAA 5H68A 3FMIA 5JECA 2NIPA 3AF2A 4E22A 1SHKA 4Q47A 3HPRA 4PANA 1HA3A 2GWHA 3E2IA 5HZHA 1NJFA 3U7GA 1TUEA 2ZI3A 2RGNC 2W2VA 1SVIA 5G40A 1RRCA 5FL7A 4QNMA 2AK2A 2QP4A 1XEXB 2XZLA 4XJXA 1GP2A 4RFSB 1F2UB 3G0HA 1UJ2A 1OB5A 3RC3A 4Y0AA 3RNLA 1XNJA 4CEHA 2QZ4A 3U60B 2Z0MA 4TMTA 1L7VC 3FKSD 2AD1A 5AJZA 1NVXQ 4Q1DA 2RH5A 4CT4B 1WF3A 2RMKA 2IYLD 2KBFA 1ZMXA 2QY9A
chains in the Genus database with same CATH superfamily
5EE9A 1YA6A 1KO5A 2VUSA 2IEDA 3L6UA 3JAWA 1YRYE 4XWGA 5E4YA 1V3VA 1YMQA 4PGAA 2A9VA 1NKTA 4PC7A 3ZHVA 1CYDA 3AOGA 3ECCA 2SCUB 2JGFA 2DHQA 4IGIA 4PFQA 2R8PA 2Z30A 3E27A 3L79A 3OO0A 1QDEA 4YC7A 5FTJA 4WBNB 3A3OA 3W2TA 4MUMA 1I1QB 2GESA 1UFQA 4PCAA 3KXPA 2Y0PA 3ZPXA 4JP1A 1ZIXA 4P3XA 2QGFA 4QLAA 1EFVB 3IDQA 4JZYA 1RRKA 4LC1A 2I6QA 2R86A 1QIJA 2IUFA 2ZZKA 3BBLA 3ETJA 3FOBA 1C30A 2FDXA 3IP8A 4O6VA 1ECJA 4OU4A 1XDGA 3WLNA 2WWIA 1XEAA 3R3XA 2WYVA 1YR7A 3N3AC 2ZIAA 1VGQA 1DKRA 1GG5A 1C9EA 3NXSA 4FSHA 4XSHA 1PX0A 4K6OA 1HUQA 4JBLA 4MKIA 5LZ8A 3WYBA 5ES4B 5JBIA 2R00C 4BWFB 3TR5A 1E9RA 4CM5A 3URKA 3CG0A 3NBFA 5I3CA 2AXEA 3ZX5A 4DCVA 2EV9A 1KDPA 4DB2A 3FA2A 1HH4A 4JI0B 2FLWA 4AKEA 2WT4A 3AY6A 3FW1A 3CLTC 1TU0A 4OO3A 3AI7A 2PM8A 4GT1A 3EWAA 1U1FA 3L0DA 1HNZB 3RIHA 1SQGA 5DM4A 1RRFA 2FW7A 4W6QA 2BEUA 2XKJE 4C08A 1NVKA 4EUHA 2IZOA 3LY7A 4E4YA 4NONA 4B76A 1TA9A 2WF8A 1PDWA 3UM9A 1E5TA 2YV5A 3AETA 1I7PA 1FJXA 3EG9A 2G83A 3Q7SA 2O05A 3VI3B 3E1KA 5F1PA 4HLDA 4PBRA 4HXGA 1PW7A 3KELA 4L5JA 1SU7A 2HC9A 3IV7A 3GCDA 3IQZA 3PDIB 2DBYA 2YJZA 2NU8B 4AN4A 3LKBA 4D46A 1M83A 5DVZA 4B73A 3EEIA 3A58B 3AUUA 5L6LB 3OU6A 3LS2A 3PUIA 3IOCA 4BQOA 5KUTA 2BFFB 4QPNA 3ABRB 2KX7A 3BWMA 4UNPA 1NPTO 4Q7LA 3EVBA 2Z6QA 4DMGA 3F0TA 4B3SB 1SCQA 3SMQA 3D0QA 4Z0NA 3UH1A 3OQ1A 4FE3A 2W6ID 3DBLB 4B82A 3ZHUA 4HV4A 4KHZA 2V7UA 1WB9A 1T0UA 3ICEA 3O1JC 4MYDA 5TGDA 1VZ3A 3BZBA 3DOEA 4B7ZA 1W1WA 1N1MA 1UPXA 2VAPA 4IJ6A 4L4ZA 4L8WB 5A3VA 3H2KA 4DDHA 3NWJA 3F7NA 5AIBA 4OSEA 3RFCA 2BD0A 2CMFA 3ADOA 3ZDYB 2YOGA 3O3MB 4C2AA 4EGAA 2IBTA 3S2ZA 4WGGA 2W6CX 5HFAA 5CJJA 4HRAA 3A31A 3RC1A 3RH0A 2W6QA 2QV0A 2P2LA 2GEUA 1A4RA 1DRWA 1ZM4A 4LWZA 3KOUA 4CLRA 2NU7A 2A5FA 4IW3B 4Q9IA 3N74A 4ZXPA 4B8WA 2H4YA 2G5PA 3JR3A 1CUSA 3R6WA 2XNDD 3PU6A 3ZWCA 3K9GA 1FSGA 3LECA 4JB3A 1C1XB 1SA0A 4TTSA 4I5FA 1KC3A 3BMQB 3DMFA 1Z5VA 1V3QE 4D25A 3CEJA 1VCMA 1JNYA 2W6IA 2OGZA 3SIPA 4EBFA 4ECAA 1CQIA 3V8VA 3KAJA 1TA4A 3FHTA 4BXOB 2Z5LA 1MTOA 3CH6A 4E6EA 3TLJA 1DFHA 4L50A 3WBBA 2WMOB 5EHQA 2ZWVA 1XTQA 1VQ1A 2G7MC 3JQFA 3OA2A 5F3DA 5ADWA 1CUFA 3BXEA 3VBEA 4ARBA 4S1WA 1ZDMA 3BWVA 4C4XA 1PBNA 2HMSA 4HAWA 5D01A 5IP5A 4INJA 2UZ1A 2ZIVB 3V1NA 2DR2A 4QOFA 1L7DA 1YR3A 1T13A 3G1UA 4G63A 4ZVUA 1PGNA 3Q3IA 4Q18A 2UUBB 4J0DA 1KO7A 2C5SA 1WABA 1Y3HA 4JZKA 5C4IA 3R5JA 5K20A 2DX7A 3BDIA 5CFPA 5ALWA 4BX0A 4OJQA 5E3IA 5JJLA 2L17A 2XNDA 3HVIA 2VFAA 1FU4A 2SBTA 2FW0A 3LOQA 4TL9A 1U8TA 3HA5A 4URXR 2VK2A 3F8TA 4CM8B 5IAOA 4UARA 1TNDA 3PTAA 2PNJA 4RTQA 1GEEA 1RMQA 1PZGA 2QVYX 1LI7A 1Q22A 1NQTA 1T29A 5DFAA 1S3FA 1F6BA 1EK5A 2QRLA 4AZSA 1VI6A 2NPFA 4DIOA 2H92A 1Z62A 3FLEA 5E7JA 1OYWA 4DM7A 4ZOLB 1T3LA 2D62A 1EQ2A 1OIVA 4YFYA 2P4EA 3DTVB 4PHHA 4XDGA 2GCNA 3Q0EA 3CZ9A 4GF5A 4PPGA 1G7TA 3EVDA 4R1LA 2FOIA 2ORIA 3ZKWA 5KNDD 4KIUA 5JANA 4I4NA 2O2IA 2GRJA 2XX3A 1AKQA 2IV3A 3SEZA 3F73A 3TSZA 5BQFA 2NAFA 2Q7XA 1J06A 1EHYA 2FN9A 2P27A 2XVMA 3RYHB 5B7QA 2R7LA 1EHIA 1TC2A 3KCNA 1MEEA 1MOPA 3B3GA 5A9SB 1SBCA 3ZY3A 3WIBA 1MQSA 4M55A 1PQ4A 1IEWA 1PG5A 3O38A 1CPYA 4C87A 3TEJA 5K1ZA 3C8MA 3GZJA 4P98A 2H1HA 2CDCA 1B1CA 3NIBA 4XQEA 5JS2A 5MN4A 5GIOE 3KAPA 2V0CA 5D00A 3ZNQA 3PJDA 3BCUA 1P29A 5C52B 4U4AA 3MMNA 3PE3A 1U80A 4OOFA 5JXGA 4HJRA 5TJ9A 1Z68A 3E0XA 3ZNOA 2OCLA 1QMGA 3BK2A 4I6JA 1CBUA 2VZLA 2WG0A 4G5HA 4GLBA 1T25A 3G5MA 5CMLA 5C32A 3BA1A 421PA 1JMKC 1NHWA 4AIRA 4HQRA 2L19A 1K6MA 2BIFA 1ZXLA 3EZ6A 1H2WA 3GEHA 3Q87B 4KUEA 1OF1A 4OGKA 3ROFA 1JG7A 3SIRA 3R3SA 1WXDA 1IN7A 2W22A 1FFSA 3CPJB 1KAQA 2LDBA 2PGAA 5ECGC 4NPAA 4Z8YA 3DLPX 4PTZA 3ZH2A 4CIAA 1OAKA 3GLUA 1ISIA 2Q5IA 3PEVA 5BQOA 2H1LA 3CRRA 1CRWG 5CM2Z 8GPBA 4H9GA 3OLYA 1HLDA 2VJYA 4UBMA 4UOQA 4BKMA 4U02A 5DHUA 3PLAE 4UAGA 4Y2SA 1X3LA 2B21A 2RKBA 2XCIA 4LIPD 4KQCA 3WYCA 3OWXA 4OLAA 3OU2A 4US0R 3PNKA 4H59A 2GBLC 4P5DA 4BYMA 1SPXA 3O91A 1RYYA 2H7YA 5LB4A 2R6HA 5K0GA 5KYGA 1K7SN 1DAOA 4J76A 3ORYA 1IJKA 4BLTA 3A32A 3R7DA 4BX2A 3H2ZA 1C1DA 3K0EA 3ZYCA 3IBFA 5DB4A 2EJBA 3RT9A 1QFXA 2PBFA 2XUPA 5EZSA 4JP3A 1UKAA 4QTXA 5IKOA 1RR6A 2EKBA 3RKUA 1SCAA 1AMUA 1NL3A 1JIIA 2OV8A 1OKKD 1XZ8A 1ZI9A 3IJ5A 4NCIA 3AL2A 3LBFA 1NVVR 3ZXXA 1NJ5A 5KQRA 2GKSA 1UFKA 3LD9A 3LX5A 5TEWA 3ZU2A 5L4NA 4X62B 1DUVG 1WSDA 3JTMA 4JL5A 1U5AA 2BSAA 2CL5A 4QT4A 1PUXA 1QJ4A 2G67A 4B35A 4U2DA 2C0CA 4L5YA 1T91A 1Z17A 2OD7A 3OU7A 4TZKA 3GYBA 2C9CA 5CVVA 4UJ5A 5D3ZA 1DCMA 1H23A 2R6AA 5ITVA 4AQ7A 3N2KA 4EQ6A 2EYUA 2YRFA 1IYZA 3SEQA 2WKQA 2V8BA 3SZRA 5REQA 1KAEA 1MXFA 2FCRA 2V6JA 3UWKA 3WTBA 4REMA 4C2BA 1AQYA 3ST7A 5HIAA 1WPRA 1USGA 4L0MA 4HDMB 1CP2A 1QHEA 4FHZA 2AMLA 1W88A 2PXAA 1WM1A 4QJ3A 2EKDA 4WFQA 4CKZA 4YLYA 3HB9A 2UVPA 4PAGA 2PHZA 2JA1A 2GFQA 3CVOA 3ZWWA 4C3UA 3PK0A 3HXQA 4CM6A 2ZR8A 4S2UA 1OKKA 3K31A 2WUGA 3WZLA 3LPCA 4H1UA 1VKNA 3AOEC 3CPHA 4BNHA 1XG5A 2QRJA 4ZGWA 4OP3A 4MV1A 4RS3A 6ADHA 5DNUA 1Y5LA 2VDWA 2P5YA 2XBUA 4RKRA 3BB1A 4P58A 3DVSX 1TYEB 5EZYA 2NSJA 4JR0A 5DLYA 2BI7A 4JOCA 3RPEA 3UMFA 5H5JA 3UNXA 1LBIA 2Y05A 1RWPA 3HXPA 4O2AA 4HQFA 1K7EB 4CF4A 2DCMA 2VSFA 4F7WA 5E6SB 3U09A 1KWGA 3H9BA 1GPDG 1SZPA 4WV3A 1MVOA 3FYHA 2FQXA 4LZLA 1M1YA 3AR3A 2CLSA 4DZRA 2LZ0A 4N0MA 5LA6F 2CV2A 3EH1A 3SI7A 3I9JA 2CVOA 1O97D 4YY3B 4Z1MD 2P9JA 5AUQA 4WWHA 3EMKA 3R7LA 1WV0A 2WWTA 1P44A 3GUHA 3NH6A 2CMHA 2JRLA 3LHKA 4H35A 5K8TA 4UPEA 4LI0A 4DCMA 1JPUA 1VRCA 1ZUD1 3C6XA 4QULA 5C3MA 3C7CB 3SHFA 2WWYA 1XNHA 5DWQA 3H75A 3IQHX 5JWHA 1GVHA 3TLXA 4L4RA 1PR3A 3DWGA 3JWPA 2RD2A 5AICA 3PCXA 1NJ1A 2AG8A 3GA5A 1DJMA 1EWQA 1BKDR 4OFWA 4MW1A 3RROA 4C0HA 4H6VA 4OXXA 3H97A 1SBYA 5TC4A 3ONDA 4EW2A 2JJMA 4K6MA 2A67A 3QJYA 1YWGO 1CJVC 4TS9A 3TD6A 4FUTA 2J09A 2GK4A 2VTEA 2PUCA 2XUJA 1OIWA 2C77A 4O0MA 4LXYA 3DEAA 3QFCA 1X7GA 4JQOA 4DWOA 4ZVVA 4NCHA 1GNQA 3O4FA 4G5OA 4PN3A 3Q3JB 3RBXA 4TKUB 1JMYA 2FKNA 1YS4A 1BHO1 4EGCB 1UPBA 4GP9A 3BQMB 3VSAA 2HGZA 2I2DA 4FQ7A 4AJ1A 3R5XA 2HBRA 4F5WA 4JVNA 6AT1A 3L4JA 1YZKA 3Q3GE 5AI0A 4FQ5A 2A5JA 1SCBA 3AHJA 1KSJA 1NX9A 1RM4A 2VUTA 1ZK3A 3FPSA 5TT0A 5C8XA 3BX1A 3ENNA 1T8SA 4O4JB 5K0LA 1B6RA 2XMDA 2FZWA 2B7LA 4MO9A 3ZXIA 1PNTA 1U7TA 2IOYA 1J09A 5DYGA 1YVUA 3KFVA 5J9FA 1W34A 3N8DA 4U8GA 2VKTA 3ZDXB 1KQ3A 2FSGA 3D43A 1FFXB 4IIXA 4AICA 4E14A 2FPLA 2II6A 1PJQA 1R6BX 3GJ5A 2FY8A 3KVNA 3WYEA 3NBQA 3NM4A 4W1SA 1P2FA 1WXWA 2DRIA 3TDNA 1A5ZA 4YRBA 3K1AB 10MHA 4DDVA 1FEZA 2QQGA 3UJ7A 1Q50A 5EERA 5TB5A 3OC6A 3U7JA 2XA9A 4OHZA 2K5UA 1IVSA 3NHSA 2HF9A 4X1KA 1W0CA 2MIIA 3OM0A 1TIKA 5AHKA 3KQMA 3LX8A 1EAYA 4Q7MB 4IZ6A 4R1OA 3K70D 5BRNA 2RIPA 2AJDA 4DLBA 5ALQA 3WNCA 3MILA 3VNQA 1PNRA 4MB2A 3X1MA 4J7UA 3ZV4A 2DKFA 5ITZB 2NG1A 4HBZA 4PC6A 4WLOA 3X1ZA 4MMYB 5MFPA 5FTLA 2AOTB 3BWEA 1AXGA 1MMFB 1Z2AA 4X1YA 3WJ2A 3L02A 4IJWA 1PHPA 4ZZ2A 1CCWA 2WHXA 5HJ5A 2DEUA 1FNNA 1ULAA 4JBXA 4N3BA 3RSCA 5JCOC 1P0MA 5DWVA 4LECA 4CKCA 1BQ3A 1ZU5A 1SWVA 2YXEA 4BQRA 3NBXX 2NSYA 1W581 2C9YA 3IAM1 4JP5A 1D1PA 1PD1A 3DOOA 4NNJA 3ZN2A 3HO1A 4OLJA 4IGAA 1IZ8A 1VSQA 1V3UA 4MQFB 1QGDA 4OJMX 3CZMA 4IUBS 1QU2A 5K3FA 3CBGA 1G4AE 1QIKA 3CKLA 3EA4A 3MC1A 2QJFA 3D9QX 1FE8A 1T9CA 1ZK4A 2Y0EA 3GJZA 3LQFA 3PPXA 1KOFA 3T7JA 2CUNA 3I39X 4A5OA 2H7XA 4LAFA 2ZYVX 3DULA 3KKNA 4KQJA 5EMKA 1NVAA 3LHIA 1OWNA 1V8BA 2WBLC 2C7VA 2J0EA 2Y1OA 3SX4A 4KL8S 4G0OA 2WKPA 4F3TA 3CZAA 1V45E 4HAVA 3F49S 2FCAA 2RC5A 3X0DA 2J3JA 5AK6A 3R9IA 2RHLA 5ADUS 3DBRA 3DHEA 1XHFA 3OZFA 4V39A 2SECE 4LFAB 4J91A 1A2KC 3I6ZA 1H0KA 4A0RA 1C3OB 3CRVA 4IRXA 1KERA 1KYZA 4IJQA 5I3ZA 1W0JD 2X9NA 4CGYA 4HQ0A 4X5OA 1KZGB 4IDAA 9LDTA 2QDKA 5A71A 1TYAE 4BZWA 1EB8A 4MTLA 5FUXA 1GADO 3IMFA 4L2IA 2JI7A 2WIFA 1VE1A 4AJ9A 5JYEA 5LD2B 1WCV1 1N2HA 3E9NA 1LDGA 3E82A 3ELDA 2CV0A 1F6WA 3D3WB 1WDKA 1KFJB 5FOQA 3KZXA 4Y67A 3V7FA 1WCIB 4WZBE 3DAOA 5A4IS 1DXQA 1JECA 4OX9B 1PJBA 3ZZNA 2XVYA 2JFYA 2XMGA 4CWAA 1II8A 4A2CA 2VH1A 2OLJA 3Q3VA 1E1RD 3LF1A 1AQNA 3UG7A 4DUGD 3HI6A 4QJBA 5KVCA 1QLJA 4LNUB 3TAXA 2VH2A 4JXJA 5D5PA 3QX3A 1G20B 4TXNA 5IRCD 3TLMA 2VDMB 1JQEA 5LUAA 2WTUA 2I4IA 5I8ZA 4KBFA 5FKJA 1Y3BE 3VO9A 3Q1KA 2WZDA 2IPNA 1W0JA 1Q1AA 3TZLA 1NW7A 1D2MA 2Z83A 2HQBA 3OCCA 2HA4A 4CMJA 1Q1ZA 1NM5C 2WEKA 1FFHA 1PR2A 2AH5A 3N75A 4M99A 4J0EA 4XQ9A 1HY3A 4XYLA 2H5IA 1XEXA 3G85A 5B1HA 3S7ZA 1WHSA 3TSWA 1M6YA 4F6RB 1ZL0A 4ZI2A 3FIJA 4BJHB 1SUFA 1X1QA 1ZIPA 5B57C 4JI4B 1OB2A 5JI3E 5EPEA 4DA0A 4GFDA 4DA8A 3HN6A 2E4WA 4JK3A 1WETA 2M1ZA 1E1RA 3IH5A 3L7CA 4DUGA 2Y3IA 2FPOA 3T1OA 2GBIA 1DBWA 1MT3A 3W5HA 5J58A 4H7FA 4YWJA 3PI6A 2FFRA 2R1VB 4A16A 1MP0A 1W5BA 4AULA 2AFIA 1FQWA 3LT4A 5SY6A 2DTDA 1P17A 1TYDE 1W46A 3MJ4A 4DQLA 4ZKDA 4R71A 3CH7A 1X77A 3ULKA 3X2EA 1WUYA 1JZTA 3NRBA 1K6JA 3NAGA 2XMCA 3OQVA 4TLEA 2PKWA 3MTIA 3WOHA 1GSHA 2IYRA 4IIBA 2SCUA 1WU7A 4QXPA 4F92B 5K6RA 1D0SA 2AQ8A 1B0ZA 5D5QA 2C3OA 4NAHA 3FPAA 1IEXA 1THGA 3GEBA 1Y98A 4WBNA 1IUPA 1DKMA 3K8QA 2LR0A 1Q14A 1ZHFA 2ZUBA 2AN4A 3R0QA 2BDEA 3SYRA 5G53C 2Q3BA 1YTLA 3HCFA 4P9NA 1B42A 2DXIA 1EFVA 1NBME 4HH4A 4LF7B 1SCKA 1IY8A 1TM3E 1K2WA 4HG2A 4R2LA 1UBEA 4UNIA 2AX3A 4ZQHA 3H8SA 5C8VA 4QLBA 2GZHA 5BO5A 2BOVA 2WOJA 5JFGA 5E0OA 3KUXA 2AZXA 4X85A 5CHEA 5FBHA 2Q3MA 3KQSA 4TXJA 5ARCA 1EK1A 4QOEA 2PXHA 2IYQA 4ZQGA 1CE8B 2X5OA 5DX1A 3QH4A 1W30A 1ZH4A 2ENUA 3I76A 1P6QA 4A0FA 1GL9B 3UJ3X 2JA2A 4P2BA 1HF3A 1H69A 2HO5A 2QYHA 4WASA 4ZCLA 4QBGB 4HX9A 4CMEC 4C0KA 3EY4A 4L74A 2HPAA 1HTWA 1QHNA 3GI1A 4MV8A 1KJJA 4YIKA 4XYBA 3TVYA 4EO7A 4OQPA 4OJTA 1V2GA 2PWBA 2C9ZA 1K4MA 4Q4DA 3VO2A 1I4LD 3HP4A 4M7OA 5HCIA 4IDDA 3E5MA 4HN9A 3U80A 1YGPA 3LDFA 2I5PO 4DNPA 1Q1QA 1M1UA 2CHEA 5JZMA 3PENA 1OC2A 4BMSA 3R75A 2C57A 3MK31 4JA0A 1ZH8A 2GZRA 2H8KA 1JHRA 1UODA 4FZJA 3EGXB 2AWNA 4H7PA 4LXTA 2M2IA 2IPMA 3PDIA 4N0EA 2NU8A 1JHVA 5CDYA 5B2FA 4WD3A 4YH1A 4XX0B 4DIBA 2Q46A 3DE0X 3HEMA 2JVIA 3EXIB 5GONB 3HR7A 5EXTA 1LH0A 3WYAA 1TAHA 4OM7A 1WUHS 3T0IA 2BMJA 2BFFA 4FJ0A 5CJPA 3KNZA 5GOZA 2O7NA 2PA3A 5EPOA 2VQ3A 4X8MA 2FKAA 2PPLA 3HGTA 4OEHA 4JKIA 3EJWA 3VAYA 4PO8A 3BIJA 3C6KA 3EGEA 5FR2A 1NRWA 3EN0A 1TMOA 2IEBA 4PC3A 5G0UA 3TQOA 2ERYA 3DKVA 4ZDKA 1H0HA 1WSAA 1ORVA 4GVLA 5T4BA 5E2IA 5A7FA 4LF4B 3AHHA 1FP1D 5COQA 2F8SA 1Z8NA 2VJLA 4XWYA 2NU9B 3UN1A 4GL2A 3H2IA 4ARCA 1JDNA 2FN3A 3WIDA 3NEPX 3L8MA 5J2TF 4PS1A 5KTRA 2XCSB 4AROA 2RI1A 4NK5A 3PPVA 4WZAE 3B6EA 3G0DA 4G8BA 3D8HA 3EF0A 3KPUA 4DF3A 8OHMA 4IQ8A 5GTDA 2EKZA 3L8CA 4BFVA 5AW5A 3GFRA 1Z22A 1JKXA 2AXQA 2EIHA 2ZWOA 8ATCA 2HWUA 1PWYE 4YDSA 1G66A 3COZA 1IB0A 4M7PA 3ZCQA 4R9SA 3UB2A 2VNKA 3TR0A 4ES6A 2GA9A 4K40A 3UCXA 4RMJA 1TMKA 2X19A 1UWLA 1C1XA 1T15A 3A1CA 3U0VA 3BMQA 3GROA 2LNDA 4GYWA 4WA8A 4Z9FA 1Z0JA 5L95A 2P6RA 4BL5A 1GZ4A 4ZT6A 4U7FA 1AKMA 3COJA 1VYHA 4BXOA 2J3QA 1EX7A 3I5MA 3M4YA 2NAPA 5A5FA 4WKGA 4I1UA 4ZQEA 3FYUB 4MHSA 1M8FA 2WG2A 3HADA 1W0KD 3B7GA 1T8YA 4QDUA 5ECDA 2Z6AA 3DTVD 3DUWA 4KREA 4YRGA 4MV5A 4C4TA 1AN9A 2LXNA 2FQ1A 4QHYA 4KBGA 4W4TA 1GRVA 3C8HA 5SZIA 3CN7A 1GNPA 1GPBA 2QY6A 5HHTA 4C5BA 4RPHA 4KRXA 1KDZA 1JFTA 1C4XA 2PWZA 2GF2A 4I3HA 4MCHA 4N5LA 4UVGA 4EARA 4I4TB 5EJ9A 1MDFA 2ZROA 4L02A 2W6ZA 2LGJA 1ZUNB 3EZGA 3ZU5A 3GWZA 3CZ4A 2DE0X 3ZBTA 5BSUA 3MBKA 4EGFA 7MHTA 1U0GA 1NWHA 4R69A 5CIYA 2QXUA 4CM8A 1RAHA 1Y3CE 4D6PA 3K09A 5K8UA 1L7MA 2I76A 3UUEA 3L40A 2ID9A 3KT6A 4KI0A 4UD6A 1RI3A 1CUVA 1YD7A 3M6MD 2NO0A 3RIYA 3L0CA 1U2DC 1L3IA 1RABA 3S7TA 5BV8A 2RARA 4HGZA 3FPEA 4ZOLA 4V38A 1W0KA 4J3FA 1ATZA 3WK6A 3DTVA 3OIFA 3AEXA 3RI3A 3UTCA 1S4MA 4GKJB 3AEYA 1VLMA 4IIJB 4JLWA 4MKGA 3M6XA 4KKXB 2F17A 2B7CA 1XFAA 3LCJA 1GSOA 1TW3A 2GLTA 2ZJYA 3HCRA 3OZWA 4M9QA 4P3KA 5CLFA 3L0SA 2NVWA 2EP8A 5CD9A 1C3EA 4WESB 5A4AA 3TQCA 2WZBA 1IFXA 3RYHA 4ZODA 3C74A 1F2DA 1LXCA 1NVGA 3IAS1 3GRZA 4UPVA 5A9SA 4Z4IA 4G0PA 4C7XA 3QEAZ 2IW1A 3DVRX 3O3CA 3V7UA 3ZWQA 4BCDA 1T2VA 2FEKA 3OD1A 2FMTA 4J6EA 5EIWA 1GG2A 3OI7A 4CIBA 3ABOB 4LV8B 4ITVA 1J20A 1LK5A 4O4IF 1QPGA 1TW2A 2GJ4A 4PBSA 1N0HA 2R60A 2YZ2A 4FR2A 1G98A 3BXZA 4GM4A 3RSFA 4IV5A 1T2AA 4KR3A 3N28A 5H8WA 1O4VA 2CWWA 4JUAA 2PY6A 3JQPA 2XRYA 4MRNA 4Y3UA 3HCDA 4YQYA 1CUCA 3USCS 4TMKA 2FPMA 3KZKA 1Q20A 3R0JA 4HH0A 2UYGA 3PV0A 2AUNA 1X3SA 4LRWA 3KOWA 1VDMA 3NHMA 1E0KA 2EFDB 4YUWA 3JVUA 3GX1A 3ZWBA 1G55A 3DEJA 5LOVB 1EJ6A 3TZBA 3K1JA 3HFGA 4R3WA 2QXYA 3ZWPA 4JLMA 2G3YA 4YJ3F 1AV6A 4HX5A 4LUCA 4M89A 2O6LA 3B78A 2REXB 4DKJA 2AZDA 2R8YA 5DNVA 1I6MA 4HMPA 3DDUA 3KYCB 1N2SA 1ZCBA 2NZUG 3PGLA 1KJZA 4P4TA 2PFKA 3K0CC 4HUTA 2ERXA 3ZR4B 3VR4D 5AH0A 5AJHA 1YE3A 3HJFA 1DC3A 3P2KA 4KTVE 4CMHA 4CUZA 1E7MA 3LKZA 4YRDA 1EFAA 4B7AA 5ALOA 1I7DA 1O0SA 1WQ3A 4UULA 1H4TA 1QR2A 1TLFA 3KDAA 4TLAA 4F8JA 2J5RA 3QLTA 5F12A 1CS0B 1II9A 1WW2A 1IN5A 2QKYA 4BTVA 5K7SA 1TU3A 2ZB7A 4LOHA 4EG6A 2IS2A 1T2FA 1EK2A 1NBWB 4D0RA 4FEGA 4KSCA 2CXUA 4ZDIA 2C82A 1UDXA 2HV8A 5FJJA 1V35A 2VATA 4J6FA 3WLTA 4CYMA 1O77A 3KKMA 5T6MA 1T24A 4DQUA 2ST1A 2VP9A 4KQHA 1FMTA 4RF4A 2I2AA 4X00A 2WU1A 3AF0A 1IE3A 3QQPA 4INOA 3NT4A 2ATCA 4C7KA 3IL2A 2VK8A 1AZTA 1TTTA 2QL9A 1KAMA 4W8GA 1PLKA 1TKCA 3L1HA 3KYBA 4C05A 3PNLA 3KTOA 2I1VB 1PGQA 2ECOA 4MWGA 5GMOA 2F1HA 2JLQA 3U4CA 5JI2E 2Y0CA 2G9QA 3HBJA 1J6UA 1GFIA 3HJHA 3CZCA 4HDMA 2ORYA 1FS5A 4JYZA 3MWDB 3ASUA 1YJCA 4EITA 1O6CA 4BY9E 3WIVA 4IJUA 4PLCA 2PGNA 3Q3EA 2EDAA 2WUDA 3IV9A 1E8DA 2JJYA 4N4AA 3KFXA 1WVMA 2X2FA 4GPEA 1A8HA 1X9HA 1V96A 1Y34E 2BRUA 2ISSD 2JZNA 1T5OA 3AW9A 3IUJA 4FZ3A 1DKUA 1CG6A 4P31A 4US1R 3AI2A 3DB1A 3U62A 3O4VA 5JZ9A 3AQIA 4FFNA 4MARA 2JAPA 1HQYE 1OROA 3D1JA 1EQAA 1NR1A 2IYZA 1XQWA 1FRZA 2WMDA 1TK2A 1YJXA 1VI5A 1ZG3A 1VL1A 1QZXA 2QSJA 4Z0PA 4E31A 1TUGA 3QVXA 4GNRA 1IHYA 4ND4A 1G38A 4JBNA 4LZPA 3DZIA 2JEZA 1Q0TA 3CX7A 2HSZA 3I2KA 4WCVA 2Z8XA 1PDVA 1VLVA 5E6SA 5HIIA 4CEIB 1WMSA 1LC3A 4J16A 5H0IA 3ETLA 1BTOA 1PL7A 3ZV5A 1DUSA 1HYBA 1T5HX 1T4CB 1CRZA 3BVPA 4MVJE 5AI5A 4J2OA 3M0EA 1DTWB 2CFRA 3GLVA 4MB6A 1JAXA 5TSDA 3ZW8A 1YGYA 3B1VA 1VMAA 1FJHA 1XMPA 4XA8A 3Q2KA 4J1SA 1ZEMA 2QRQA 4LE1A 3EGDB 3MLEA 4J8PA 4WCFC 2JW5A 1EGMB 4UU1A 2DUNA 2XQJA 3CUWA 1NVTA 4RTLA 4RY9A 5IDWA 1ZESA 5AM5A 1D4FA 4YO7A 1YH3A 1A50B 1JR3A 1AK9A 5KQGA 2A35A 1T3SA 1TJYA 1IHOA 2HHHB 1E6WA 4E5DA 2OT3B 1KO1A 3JQQA 2V7QA 4HL6A 1XZGA 1CZRA 1J8FA 3NT5A 4V2IA 2J4DA 3IKTA 2CWDA 5CXSA 2J3DA 3VJKA 2DBZA 4CIYA 1R15A 2I78A 1KZ7B 2IYPA 1EP1B 1MX3A 3GFPA 1T0BA 1WB4A 3I12A 3QX7A 4MUAA 5EIFA 3I6MA 3I09A 4UE3S 5D86A 5KYUB 3IIEA 1ECLA 2PQ6A 3L7IA 3PXDA 5LU9A 1P2BA 5FBVB 2ZJ4A 3WGOA 2VPIA 4YRPA 4XM0A 4TKUA 4TRJA 4Y0VA 1T6BY 3G2MA 1XLWA 3STYA 4DRZA 1XLUA 4II2A 1FSSA 2ZOSA 1P6XA 4E5PA 2O6HA 4INZA 2OUKA 2QG4A 2YJ5A 3LCVB 2OC4A 4KPUB 3DOUA 2IHTA 2XDAA 3GARA 3GJ7A 3AB7A 3KVRA 4O4JA 5IJXA 1QUFA 1XFDA 2ZE8A 3K32A 4HWRA 1G7RA 3A9VA 2I91A 1VLHA 1OX6A 1YA8A 2VJAA 3JQRA 2CY0A 2FMKA 4R1UA 4BNTA 4DCSA 1E1DA 1NI5A 2O8BB 1QRUA 1FFXA 4KGZA 4C4YA 1H8ED 4GR9A 3GRCA 2EBHX 2GN4A 4MYRA 1HDZA 3RRNA 5KQMA 3EARA 2WRZA 1ODLA 2WSIA 4WHMA 5AJVB 3K1AA 2ICAA 3IAAA 3C4VA 5CDFA 4GLJA 4M1YA 2VSYA 3CF2A 3K8ZA 1TZKA 1QYXA 5ENDA 1G41A 2GYVA 2OV3A 2V7BA 3R24A 3L8DA 1P7VA 2DU8A 1SG0A 4PAWA 1CUWA 4RLHA 4RSHA 3EWSA 5CYPA 4U9HS 1JHMA 1YUNA 2ZYSA 2P69A 2R2AA 1Z0SA 4LEIA 4UJ3A 1J22A 2GFIA 4M49A 4LMBA 3SVLA 2RKOA 2XKBA 4XUGB 3ZY5A 1VXOA 5AVVA 4GKKB 5AM4A 3N0VA 5G1NA 1JH9A 3S70A 5ITZA 3QF7A 4OGWA 4C0BA 4BX8A 3W8RA 5EIHA 2Q3LA 3FCXA 1Z07A 3H9GA 4GYJA 2AOTA 4J0HA 4AKHA 1XI2A 1XYGA 1GV0A 5IHXA 2G8LA 5FHQA 3UZUA 2IX3A 1LA2A 5EXDA 4MA0A 2ZSKA 3UOWA 4RZ2A 1JEYB 1MJGA 4BC1A 3KT3A 3BREA 2HZ7A 4BRZA 1JDUA 2RHDA 3C6ZA 5ERYA 2A4KA 3P5SA 2C4HA 4HB2A 5JG7A 2P1DA 3TQRA 3ZHBA 1Q21A 4EG5A 3GH3A 5FOSA 4ZEMA 5BYKA 1B8OA 3ERCA 4J07A 1S4QA 4MQFA 3IEMA 2ZJOA 3ZZ1A 1RAFA 3IVCA 1IUKA 2QTNA 4GEKA 5KWVA 3Q8KA 2IYOA 1PJCA 4FYKA 1XZHA 2ONZA 2GAIA 4UNSA 3GIDA 1EI9A 1TGYA 5C0OE 4KQMA 1WB5A 2V6MA 3AFHA 5KTOA 2BONA 1AXRA 4CV3A 4F2HA 2WAXA 4M76B 5AVXA 1RXEA 1M76A 2GN2A 4TSFA 4R31A 1TZJA 5AK0A 1C50A 1JT9A 1S3SA 2IF0A 4IDOA 4BWGA 2FX5A 2VHEA 4B09A 4BNIA 2FE1A 1XD8A 2GTHA 1GNLA 3IP3A 4FW8A 2NP6A 1N5DA 1KJYA 2B0CA 3CC8A 2Z5GA 2ZRGA 4E1VA 5DTQA 1D2CA 1TQ8A 1W87A 1C3OA 4PG7A 3QPVA 1T2EA 2VHXA 1V4BA 2NO6A 3LWBA 4EL0A 4ENRA 3D6MA 4G67A 2YV1A 3OE4A 4GOLD 2XUDA 1JG3A 2UUAB 1RACA 3P2JA 2A0YA 2I33A 2XRFA 5HDQA 4ZQIA 2VWQA 1J5XA 3HXTA 3NIWA 3PRKE 4TVBA 3W9UA 3D3WA 1TE2A 3PFNA 5AVQA 1KMCA 1T2NA 1WCIA 2ADFA 4BMNA 5TMBA 4AJOA 1G8MA 4KJZA 3HN7A 4MQLA 3B3FA 4B3FX 3AV3A 1J7KA 3EIEA 5AHOA 3B52X 2JH8A 1DINA 3QVVA 3C87A 2IXEA 5TRTA 1Z4QA 3CQ9A 1W36C 2J8ZA 1B93A 2OOKA 4RQTA 1RQ7A 1BN7A 2V7PA 1H2YA 2ZVJA 1JN0A 4HAIA 1MX9A 3G9TA 4LNUA 3PNMA 1G20A 1ZJZA 4OTZA 4WK0B 5BYJA 4DCGA 1ZR2A 3PGMA 3FUCA 4PCLA 4ZI5A 3T61A 3C70A 1UPUA 4ZOEA 5HQTA 3LGXA 4M6WB 4PPYA 4W63A 2QTGA 4E15A 1JJBA 3JV7A 5F4BA 1EDBA 3G7SA 1AZWA 2GK7A 4K3UA 4ZEVA 1HNXB 3DWFA 5KNDH 4ZAXA 2ZPAA 5KNBD 2AMFA 2JATA 3DPUA 1J23A 2HK6A 5IAGA 4UEJA 5BPHA 1P9LA 4F6RA 1E3EA 1Q0HA 1H2EA 2ZJFA 3KPJA 2H51A 3ZW9A 2G9VA 4LDQA 1GHTA 3ITNA 4JFAA 4YCCA 4BV8A 1O94D 5HQJA 3TPCA 3AUTA 3CN9A 3OETA 3DE6X 4MW4A 4QU9A 1EP2B 2QHXA 3JATB 4RK6A 3TOSA 2IWRA 2I1QA 2BGKA 5K51A 4M8LA 1AO3A 4N6GA 3TMKA 2P2ZA 4IRMA 2D2IA 5AW6A 1TJNA 2GA8A 1DS6A 4M1QA 2R1VA 2WF6A 3D6VA 1FZTA 4MQ4A 5WRFA 1DQYA 1DT5A 1FTGA 3KTFA 4D44A 2IWHA 4ZYTA 4N0QA 1WG8A 2HTEA 3IP5A 3P20A 1FX0A 3QU2A 2A7XA 1IY1A 3VU1A 3T5TA 2B5OA 2XIJA 1V5EA 5AKHA 3EEBA 2IHVA 4G0WA 3WL5A 3ETCA 1H0RA 1N7GA 1FDUA 3FGZA 4JBGA 1ODCA 4URFA 5KNBA 1FFCA 2P0EA 2ZT7A 3DMHA 3VC2A 4BQQA 1MXHA 4MRMB 1B4DA 1DBIA 4P5EA 1T8WA 5D1NA 1NMZA 2ZVDA 4Q24A 2H1WA 1QCYA 1XTJA 2EDCA 2H8GA 2IYNA 1O94A 1B2LA 2X8BA 2VZ8A 4LDPA 3LVRE 3E5NA 3F6YA 3K9CA 1C0PA 3FPKA 4P4UA 3ZIUA 4BZQA 3WL7A 1QRRA 3FVRA 1YNOA 4PNZA 5U4XA 1C8LA 4G01B 5AKIA 3T3PB 3GNSA 1Z0UA 1N77A 2EJWA 4Y9SA 3PITA 2YJNA 4LFCB 4O4LF 3ZVLA 5KREA 3ZNPA 4AJ2A 2PSJA 3OSUA 5DEOA 2WTEA 1M2HA 5ALSA 2K87A 5B1EA 4JIGA 3UT5B 3VKFA 4KC0A 1EFLA 4B71A 1CE8A 2NZVG 3DPSA 1U5BB 3IJEB 3TKLA 3FCCA 3K5WA 1BKYA 2TECE 3GMTA 1I1NA 3OEED 4MW5A 4NECA 3JAMA 2CLLB 5DZSA 3QU4A 3BMNB 3P9CA 3VPFA 3RVKA 2CFCA 1VIMA 3RR2A 2B6HA 5FA6A 1BZYA 1ZO8A 4ZJYA