2RGGA

Crystal structure of h-rasq61i-gppnhp, trigonal crystal form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
159
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transformation Efficiency of RasQ61 Mutants Linked to Structural Features of the Switch Regions in the Presence of Raf.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein
molecule keywords GTPase HRas
total genus 59
structure length 159
sequence length 166
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rggA00
2F9LA 5BN3A 5EP1A 3HWSA 2AWNA 1ZD9A 4NONA 4KFTA 1RYHA 1R4AA 2PJZA 4GMDA 1ZUIA 4A6PA 2HEIA 2RB4A 4KBFA 4ZIRA 3M1IA 4C2UA 1A4RA 3MUFA 2WOOA 2BBOA 2GAOA 3B60A 4AKEA 2YKGA 4OQFA 3DM5A 4OI1A 2PZFA 3IPYA 3L82B 1U8YA 1QBKC 1L4YA 2ERYA 2EYQA 3MRSA 1G8GA 1CJKC 2K5UA 1SXJB 2HDNB 2IYQA 3AV0B 3PENA 3RRMA 3LBIA 4PC2A 3MGCA 3ZVNA 3B1WA 4QJ5A 1YR7A 2ZRDA 1RVDA 4C0KA 2V1XA 1CR1A 1RIFA 4CRWB 3R9XA 1GKUB 3KUDA 2AL7A 3GD7A 1XDBA 2GVDC 2O0JA 3TBKA 4OI4A 2OO7A 1XD2A 1SXJC 3NC0C 2ZUDA 1JR3A 2CVHA 1QRAA 4CDGA 3CNNA 5L3VA 4DSOA 3UG6A 2P0EA 4LHVA 3TUZC 4BFXA 3FMOB 3U44B 1RYFA 3VR1A 1ZMXA 1NMXA 3ETLA 4BFTA 2EQBA 5BYKA 1ZJ6A 4OQXA 2R65A 2ZRGA 3DVLA 3FTQA 4QHSA 1H8EA 1TPZA 2ZYVX 2VSXA 3B1ZA 4W9MC 1HQYE 3B85A 1E1RD 4MRRA 3AF3A 1KO7A 2AXNA 4Q4AB 1EK0A 2BWJA 4M4SA 5DYGA 1E2MA 4JL8A 4FN5A 3SQWA 1VKJA 3C14C 4IFBA 2ZETA 2QORA 3GEHA 3EPHA 4GT1A 5C4GB 4FMDF 2JJ1D 4LJYA 2QNRA 2ONJA 4LC0A 4KLZA 3EC1A 4ZDKA 1OW3B 1N5JA 4B2LA 2FH5B 2CL7X 5DI9A 5KSYA 1KJZA 3EC2A 3B13B 4O25A 4A0HA 1MRNA 2ONKA 2WAYA 1YZQA 4CT5A 1G19A 2IF2A 3W90A 3MJRA 3GJ3A 5LDDC 2C98A 4PHHA 5KPJA 1NN5A 5LBIA 4A9AA 2A3RA 3BAFA 1D9ZA 2ODBA 1P60A 2ZUBA 1NVUQ 4KXFB 1GKYA 5TY0A 4B74A 4EJSA 3X2SA 1E9BA 5J40A 2QE7D 2WWFA 4QGHA 4NU0A 3KXIA 4PFSA 1W2HA 1ZBDA 2GEUA 3GQBA 2CMKA 4OJKA 2YVUA 4ZI3A 2PZGA 3D8BA 2IF0A 2N42A 4JLJA 4WOPA 3GJ0A 4N0DA 2GAAA 4TL7A 1Z5ZA 1KNQA 3QPWA 2HLDA 4LJ8A 3R7WA 4KFSA 1WXQA 1HA3A 1VMAA 2RHMA 2F7SA 2J5XA 3REGA 5LD2C 2W2TA 3ZJYA 1KI1A 5DHFA 2ODNA 4CZ2A 1IJEA 1EXMA 2W00A 3B1XA 4LYFA 4RFVA 3EA0A 2IS6A 1GL7A 1VTKA 1E2FA 4BLRA 2N1BA 1KDRA 1P7CA 3A1VA 1YHNA 4TQ9A 3M0EA 4MRNA 5J5CA 1IONA 1K5GA 3ONWA 1GIAA 1SVLA 4LV5B 5FTNA 2Y8EA 3BFVA 3FKQA 1FQKA 1Z47A 4L9WA 1KSFX 3C15C 4NTZA 3T5GA 3WMGA 4HDCA 1NMYA 2DFNA 1E0AA 3ZIAA 1WRBA 4HAWA 4AYWA 2ZSBA 4X8HA 2WHXA 1LFDB 4MH0R 5FTLA 2ZR9A 1RRFA 4IEIA 4Q4HA 4JL6A 5A5GA 1NJFA 2BOVA 4KFUA 2GA8A 1OPXA 4DCNA 1GL9B 3T1TA 2GWHA 2NO1A 1VCNA 2Z0MA 2FV8A 3NEJA 1DARA 1FOEB 2XAUA 3PV0A 4M9SA 4II7A 1R6BX 4H1UA 3O8RA 5E4FA 1R0XA 1VYUA 3R8FA 1F2TA 4K81B 4HAVA 1T4GA 4DUGD 1DAFA 2G0NA 1I4DD 3MCAA 5AUNB 1WE2A 2OFWA 3KJEA 2KE5A 3WNCA 2QBYB 1G8FA 1V5WA 2ZE6A 1Z08A 2C96A 3AVOA 3RS5A 5D3MA 3F0TA 5KUTA 4B75A 4MGIR 3W6PA 2WV9A 3PITA 4L5BA 1R8QA 2FPKA 2QN6A 2WWHA 4HUQB 1G3IA 4URYR 1XEWX 5JRJA 2XSZA 1E0JA 2F9MA 3T12A 3ZYCA 3VR6A 2FPLA 1ZD8A 2OFOA 4P3YA 4TYQA 1Q22A 3Q5DA 4Y0VA 4TT3D 4JLBA 3GP8A 1PLJA 2O52A 4M22A 1N5LA 1G8PA 2FGJA 4KLNA 2ZREA 4MQBA 4QRHA 2WKRA 1JB1A 1P9RA 2FFAA 1G6OA 4DSTA 1Q1QA 4NYJQ 1KK2A 2ZYTX 3GJXC 3VR3A 1RE0A 2GXSA 3W3AA 2F55A 4GP6A 3RHFA 2R6CA 3WYAA 2EW1A 4PAOA 1OE0A 2GCNA 1SVSA 3CR8A 3OEED 1WB9A 1E9AA 4AI6A 1X1SA 4DXAA 2OLJA 3S1AA 2BMEA 4LJ9A 3WBKA 1Z3IX 2GBLC 3SFZA 2IS1A 4FWIB 3WNDA 1I4LD 1R5BA 5AJYA 2ZEJA 2Z4RA 4WIAA 1II8B 2C9CA 5DGXA 1WQ1R 4KBGA 1NBMA 5DISB 2P6UA 4Q1FA 3DM9B 2ZRJA 5DSZA 4A2WA 3AF0A 4N3NA 1D2NA 5JWOA 4W7SA 3EIEA 5TVKA 3CRMA 2OCPA 4QJ3A 2RGBA 1CJTC 1Z0AA 3HR7A 5CYPA 2RKOA 4RSGA 3BBPA 5A0FA 5KSOA 1AS2A 1G3MA 5JBQA 1CKEA 3ZS8A 1A2BA 1DAEA 1HV8A 1JECA 1KO4A 3QPVA 2J7KA 1OH5A 2IYSA 3BS4A 1YZKA 5BXQC 4JYCA 3AQ4A 1KI6B 4NCJA 4PC1A 1FUUA 1JEEA 5FL7D 3TVDA 1PJRA 1KI7A 2IK8A 4YXWD 1DVRA 5EE0A 4DZZA 3WHLA 4G1UC 4Q47A 5JCZA 2XOKA 2Z5FA 3CRW1 1KMQA 4EPVA 5FBRB 1OHHD 3AB3A 1J90A 1WF3A 4GZLA 4DEXA 1VG0B 2OXRA 3O8CA 4WZBE 3TR5A 2ZRLA 3SJBA 1W0JA 2VHCA 2JA1A 4TLBA 5DE3A 3KKQA 1OB5A 3HYTA 3TLXA 4ASUA 1PZNA 4QBIA 5G41A 1DG3A 3NEYA 3LY5A 3WMFA 5L3SA 1E79A 1AZSC 1TEVA 2V55B 3W6NA 4EFNA 5AJVB 4TYNA 2DYKA 3ASYA 1J8YF 1W4CA 2OSBA 1X3SA 4Q7LA 1NBME 3OEHD 1JQJC 4E07A 3FFBA 2RMKA 1OHHA 2W6JD 3EASA 4HI0E 4BECA 1QHSA 1ZNYA 2VQSA 1Q1ZA 2J0QA 1T6NA 2WWYA 3WRXC 4IEEA 1SVKA 4ACBA 3DMNA 1L8QA 2FNAA 2LWIA 5JHHB 2KBFA 1I4TD 1II9A 1MABA 3B2EA 2BBTA 2L0XA 3IQWA 4MGKR 3RC3A 1Y63A 2HYIC 2F3RA 2QENA 4GP7A 3GLFA 4DLUA 1BOFA 3WYFA 1GNRA 4BFSA 1MV5A 4G5GA 4Q7MB 4DSNA 4KVAA 2C99A 5AJWA 4HDQB 4HSEA 2QMEA 4B73A 2F3TA 2GZAA 2ZAMA 1KSJA 1P72A 1TL7C 1UDWA 2IXGA 3ZGXA 2Z83A 3U60B 1GNQA 4DBLC 3I73A 1SKYB 2VO1A 2FFQA 2GCOB 3B6EA 3TUIC 4EQ6B 4NCNA 5JWRA 1ZM3A 3QF7A 5F98A 5JJIA 4NH0A 3I4LA 2B8TA 2W6ID 4LYHA 2IUUA 1NBMD 1Z6AA 2A5YB 3NBYC 2PT7A 2C2HA 5D3QA 5FH9A 1XFAA 2IYUA 3CZQA 3HPQA 4TSFA 1DS6A 2YOGA 1JI0A 5JWHA 1G8HA 4PSAA 4A2QA 5HCIA 3CH4B 3UWOA 3UG7A 1E2IA 2D74A 1UKZA 4QL3A 2FPMA 3K0AA 1ZNXA 1FP7A 5KTYA 3BERA 2OFXA 3LDAA 4I81A 4C9BA 5D3MB 1NKTA 4FWTA 1VG9B 5F9HA 5ANRB 1NIPA 4CW7A 3K9LA 1P62B 4GBMA 2C04A 2D7CA 3H84A 4EPWA 4Q4JA 4AIIA 1H8HD 3SS8A 3VHLB 1E1QA 1VG1A 4X8LA 1AQUA 1UJ2A 2LKCA 1N5IA 2JLZA 4M0LA 1G5TA 1G3RA 2QROA 3WXMA 4RD2A 1E1QD 2IEYA 1TF7A 2O5VA 2IEZA 1DPFA 2W58A 1RFLA 1ZAKA 4I1VA 1Y3AA 2HT6A 2B8WA 2YWEA 1P2UA 1DG1G 3RNLA 2OV2A 1JQLB 2J41A 1KHTA 3CNLA 3SDZA 4A0FA 1XCMA 1SKQA 2WJYA 3ICQB 1KJWA 4CYMA 4CEJB 4ARZA 3VKHA 2W0SA 4IXNA 1IY0A 4GPTA 2F43B 5HKKA 4PZZA 1NIJA 2JIZA 2R8RA 4FCVA 2FDCA 1L4UA 2ZPTX 4H1VA 4PZLA 4K8OA 4M1KA 4PO1A 4DIDA 1P9NA 4PSKA 1HQCA 4ESHA 2G6BA 4M1WA 3FOZA 3TVTA 4C0BA 2ZSEA 4DLVA 3OE7D 1TQ2A 2CE2X 3BWDD 3DO6A 3ADCA 1S9DA 4CEIB 2ZANA 4QHYA 1IN7A 4TMKA 1GILA 2XTZA 4XJXA 1UAAA 3SEAA 1AA9A 1FL9A 3C5HA 1IN5A 3HU1A 2HCBA 5J47A 1TAGA 1XTSA 3UATA 2V6JA 2J0UA 4RKFA 3MSXA 2ZRMA 3FHTA 5BYJA 2HXSA 1MRSA 5FOTA 3AKEA 4QOSA 3KL4A 1OFHA 3O8BA 4DDVA 1P61B 3AVTA 4F93B 1MT0A 4BUJA 4DCVA 2B7CA 2XSZD 3BK7A 3I3SR 4NPHA 1XNJA 4HB3A 4M9ZA 3CF0A 2GZHA 1K5DA 1ZYUA 3EZ7A 5FBQB 5IDVA 2Q6TA 1X8LA 4L8GA 1N0VC 4URXR 2ZR0A 3VQTA 3T34A 1CIPA 2BC9A 2YNMA 3SYNA 1HUQA 2CVFA 1QZXA 4ZV4A 2W6JA 2W2XA 3U61B 5IK2A 4Q7JB 4BFYA 2W83A 2WPDA 1OFIA 4B3XA 3IDQA 2PX3A 4QG7A 1OV4A 3KQNA 2GXQA 4IHQA 2JLVA 4NCHA 5DI3A 2GJSA 2BKEA 2QAGA 4M1SA 2W6IA 2A2ZA 3X1XA 5FOXA 4S2EA 5JMTA 1W4RA 4AKHA 5IT5A 5AUPB 2WJVA 3EZFA 1BH2A 2JGNA 3BB3A 5GJCA 3C8UA 3FDIA 3GJ6A 2REXB 3A37A 4BFWA 3K70C 3ZLJA 1E4YA 2VHQA 621PA 3THYA 2WIBA 1J7KA 4P4SB 2IYLD 2P5TB 3NH9A 4PHTA 2WSMA 4V0ME 3OZXA 4HLDA 4OHWA 4Q1EA 3AUYA 4U5XA 2XZOA 4HLUC 5HPYB 1J2JA 1ZVQA 4TLAA 2R44A 4ARZB 5LD2B 5EXXA 2CCJA 3DKVA 4GL2A 2AD1A 2J7PA 1EFHA 3PUVA 3RAPR 4EPTA 3A4NA 3R7WB 1XZPA 4QNMA 4WAUA 4XD7D 1E2QA 3FMIA 5SZKB 4PC3A 2BMFA 4LGMA 1SHKA 3NBZC 3RLFA 1ZM7A 2Z43A 2OBNA 1LW7A 1S8FA 1M2OB 3SU8A 3GPLA 4A82A 1Z06A 2PCLA 1E69A 2JLWA 4DWJA 4DDWA 1QHHB 3SI7A 2DFLA 3NTUA 3SJCA 3HJNA 2IBMA 2Q3MA 2ZRIA 2KB0A 2WWGA 1T3HA 5CK4A 2FA9A 1NG1A 5KDLA 4FMCF 4A1FA 3GCGA 1RJ9B 1E6CA 2AKAB 1XJ0A 3CPJB 4D81A 3T1OA 4DB4A 1XTJA 4NYMR 4AURA 5L3SB 4LV8B 2XZPA 4Q4HB 4Q1DA 1IBRA 4QGGA 4R98A 3NH6A 5FR1A 2IS2A 3UMFA 3VX4A 4LHXA 2WBLC 2QTFA 3WHKA 1GOTA 3K53A 5AK0A 5DHAA 3LW8A 3ZZTA 3CX7A 4MYUA 3P32A 1ZIOA 2JLUA 3RS4A 3JVUA 1K8RA 4YXWA 1M74A 1F60A 3X1WA 3KKMA 2QMHA 4FMDB 4HAXA 4MGYR 2VPPA 2VHUA 4C2TA 2F1RA 4Q1AA 5BW8A 4DLRA 5BWMA 2GILA 4I1SA 5EZ6B 1W44A 3A4MA 4B76A 2ZI3A 4HAYA 5K8IA 4PPQA 5J4VA 4ZPXA 4HB4A 3MLEA 1DAIA 1JAIA 3RANA 4JZKA 4HUQA 2QQEA 3T1VA 2WPDD 5FOUA 1FTNA 3ZVLA 3PVSA 3I5YA 2J59A 3C16C 2EWWA 4LK2A 1R0YA 3WP1B 2UKDA 4A8JA 1R10A 4CGZA 1VPLA 1XEXA 3D6TB 4L4UA 1ZUHA 2GJ9A 2NZJA 2ZE5A 4DCTA 5J4YA 5DI3B 3QKSB 2OCYC 1G4UR 4PR0A 1Z6YA 3RYTC 1M7GA 1KO8A 3LBNA 1YZTA 2I3BA 4FD2A 5DLQC 3OEEA 1C1YA 4HAZA 5FPYA 1DO0A 1GL6A 2G9NA 2DWOA 4WVFA 2H57A 4F7WA 2J0VA 1DAGA 1FMJA 1QG4A 2DHRA 4OHYA 2ZS9A 4OI2A 4AD8A 5JJKA 3B8HA 3KFXA 3B1VA 2DWPA 2GJKA 3MMPA 2IWHA 2F1JA 1UM8A 2HYDA 4YC7A 3R8CA 4MKIA 3EIHA 4I99A 1D6JA 4TT3A 4BLOA 2BBSA 3VX3A 1TUIA 2ZYWX 2OE2A 3CUEF 4CF7A 4EJSC 2WTUA 4LWZA 4QGAA 1E9EA 5DYIA 2RH5A 5CIQA 2QT1A 5KU1A 2Q21A 2YC2C 4QBFA 4UQOA 2KJQA 4Z54A 4KFRA 2VHJA 1E9DA 3RSOA 2D3WA 2ZJOA 3NC1C 1LNZA 5FFMA 4PXAA 2PLRA 5CDFE 2IXEA 5JEDA 4TYYA 3THXA 4Q48A 2E1RA 3NXSA 1ZM4A 5SZIA 4LI0A 1UEJA 4A4DA 4BLSA 4URVR 1E98A 3T35A 2AX4A 5E95A 4V0KA 4HZUB 2ZYUX 2IYWA 2ZE7A 1TF5A 2Q9AA 3I61A 1B23P 2BBWA 4QJ4A 1JALA 2OLKA 3CF6R 1ODFA 1V43A 3Q5EA 5FL3A 2IS4A 1HT1E 3SN6A 5B2ZA 4C7OB 4TYPA 5KNDA 4P33A 1UBFA 2FJUA 3QPUA 4B32A 2VP2A 3PUXA 721PA 3L8ZA 4LUCA 2ZVQX 3ZD6A 2B6HA 5GJWC 2EYUA 1ZD1A 4JLOA 1K6MA 2BJWA 5JCPA 2BDTA 3IHWA 1EWRA 4WW0A 1CR0A 2GXUA 3AUXA 4QHTA 4G01B 1X86B 2ORVA 2B92A 2HF9A 4XH9B 2WVJA 1E4VA 1GG2A 1W4BA 4TWZA 5FI1B 5H1YA 4NKRA 2D2EA 1OB2A 2HF8A 3OAAA 3GLFE 1KDOA 1RRGA 2GDJA 4OYHA 1NNEA 4P32A 4BRWA 5CM8B 1T8TA 4I4LA 1LF0A 3BJIC 4PO8A 3AP1A 4RZUA 4PQRA 3C41J 4DDTA 2GXAA 4ILEA 2ORIA 4C0LA 5KDDA 1G3QA 3QOFA 5LB2A 1W1WA 2GHIA 2JIZD 4TTPA 1Z6XA 2H16A 2ZSDA 3TQCA 2A78A 1LTQA 4MUBA 4OQLA 4FMBB 3AKCA 1RW4A 4JVNA 3AM1A 1ZM9A 5EXPA 2A7QA 2IYZA 5E3HA 1OF1A 1FFHA 4IDNA 2QMOA 4EUNA 3W5JA 3TNFA 4KYIB 1KJYA 4BEBA 5TXGA 3N70A 4NMMA 3GLFB 1IM2A 4LZZA 1E79D 2ECKA 2VH5R 1Q44A 1E2PA 3K70D 3EWAA 1N6OA 2NO7A 1R7RA 1NSFA 1MABB 1VIYA 2YOHA 4V0LA 4KVGA 1T3SA 3L0SA 5BQ5A 1YE8A 3EPLA 4AYXA 1YRAA 4Q66C 4C4PA 1J70A 4EPXA 2KSQA 4G3XA 1DELA 2FSIA 4ACAA 3AKDA 4M2LA 3QY0A 3P20A 2O0HA 2ZI4A 3Q9LA 3CW2A 3F5FA 4CEHB 2QY9A 1LB1B 5ELXA 2JEOA 1CRPA 3VHXA 1XMJA 3THYB 4GRAA 2I4IA 1XPRA 2YWFA 4FW9A 2ZRAA 4HZUA 3H4MA 2NQ2C 4LDJA 4NP6A 3W8RA 2HT1A 1F2UB 4HLQB 2G1KA 5DO9A 4RJLA 1KTVA 4W5HA 3LBHA 4TMTA 1Z0KA 3W5IA 1AM4D 4O3MA 1QG2A 1E9FA 3QQ5A 2WJGA 3CIOA 2WOJA 4BZPA 1Z0FA 2RCNA 2ODWA 3IO3A 3RSLA 1VCMA 3K1JA 1Z2CA 4DLTA 4EFLA 4JBWA 5FBVB 2CJWB 2G77B 5EP4A 5M04A 1L2TA 1S3GA 2JLQA 4LHZA 4BEJA 5LPNA 2GZDA 1W2GA 2QEQA 4G5RA 5SZHB 3W8NA 4CVNA 3I72A 2IW3A 2VF8A 4I1OA 1PUJA 4JLNA 3PFIA 4OQNA 3LO5A 2QQ0A 3U3MA 3EPJA 4FXPA 1UKVY 3MWJA 5GVSA 2QT0A 3RWMB 2P67A 1Z2AA 3WYGA 4DKXA 4A36A 3ND8A 1ZC3A 1N6NA 3AVWA 3TGPA 1U0JA 1TUEA 3ZVRA 4CT4B 2H8KA 1N6HA 3T5DA 4CIDA 1E2DA 4RD6A 1XPOA 4KI0A 2QAJA 5TMPA 3TR0A 2GF9A 3K0EA 4H9GA 2ZSAA 1Z8FA 3CR7A 4WA7A 3HP1A 1RKBA 5EE1A 1KKLA 3FE2A 2UZ3A 1MO5A 1ESNA 1IY2A 3V9PA 2WSSD 1GRRA 4M9QA 2EFEB 5JZVA 5KO2A 3QXSA 2C9YA 1P5ZB 1N2CE 3QENA 1T9HA 4RCZA 4JSYA 4ESVA 1CS4C 3RABA 2XEXA 2CBZA 1T91A 5EXSA 4B2PA 1TF2A 4BLQA 1GNPA 2FE4A 1VECA 1KI2A 4GSYA 5E7JA 1KO5A 3M6AA 3EZ9A 2BEKA 3AH8A 1GSIA 2VP0A 4CEIA 4U02A 3U7GA 2IYRA 4LBYA 3PR1A 2Q0HA 3EIQA 2V6IA 3RS0A 1N3BA 1IY1A 2ZI7A 2LCFA 2ZS7A 4UXHA 2DB3A 3I1FA 2UVQA 1P3JA 2WSSA 2PH1A 1CJMA 3K09C 5H68A 1Z22A 2ZROA 1S2MA 3V4FA 3GLGA 1TQDA 4D4LA 4UNRA 5KPDA 3RS7A 1G7RA 4R2HA 4V02A 3LLMA 2YV5A 1XCPA 5FTMA 4B2IA 2VEDA 4PTLA 5CLLA 3C4JA 1Z0DA 1AQYA 1N0WA 4US0R 4W5JA 5TDHA 2QGNA 1GITA 1G64A 1NL3A 2VA8A 1XD9A 4P31A 1YR9A 2ZRKA 4LJ6A 4QFMA 4S35A 5L3QB 1NVWQ 3AVQA 3NHAA 4U00A 2CJWA 1KK0A 1XEFA 1LVGA 1TQ6A 3LV8A 4D25A 2BCGY 3KKNA 3N5CA 1HT2E 1SVIA 5FUWA 5B30A 3QUSA 1KK1A 4YMVA 2OBMA 3OFNA 4PANA 2CNWD 1WA5A 4PSVA 5B64A 5JECA 2PEYA 1QHGA 4M8NE 3NBXX 4MDEA 5CM9C 3W9YA 1Z07A 4WXRA 4AG5A 1F2UA 3Q7PA 4TYWA 6Q21A 4BWYA 2NOAA 4QGFA 4URZR 3DHWC 1E2NA 1E94E 2NG1A 1W36D 3FB4A 3VR4A 4ABYA 1T8UA 3GLIB 4TMXA 1G4AE 2OAQ1 4ZKEA 4Q7KA 4F4CA 5L3RA 1KGDA 3CWQA 4JLAA 3CZPA 2W2VA 3BH6A 5CK5A 4JJZA 3VNVA 2BEJA 3BH7A 3P26A 4B43A 4B3FX 1R5OA 1E2HA 2VTKA 4LJ5A 4Q9HA 421PA 2PEZA 2J7PD 4TZ0A 3KQLA 4O2LA 5CDFA 5CB6A 3NHBA 1CEEA 1H65A 2A9KA 1W36C 2QRZA 2PLFA 3NDPA 2RGCA 1DAMA 4F4IA 1G7SA 4MRSA 1OKKD 3SR0A 5HE8A 2YZ2A 1UBGA 1HEIA 1UBEA 2YYZA 4C0HA 5A4JA 2GEDA 3LRPA 4Q4JB 3B1YA 2GKSA 1UADA 2H18A 2HJVA 4AYTA 1OXSC 1UKEA 3LQQA 2CLDX 1E9CA 3T06B 1UEIA 5JI3E 4ZCLA 1FZQA 4LPKA 4RY2A 1U81A 3P4XA 4GDFA 2BKUA 1TU4A 4Q02A 3P27A 3B7GA 1ZRHA 2NZ8A 2QZ4A 3O47A 3KUCA 1NVVQ 1TEXA 1ZM2A 2CK3D 2O8CB 1WCV1 1CR4A 3FGNA 2QTVB 4LPSA 3LXXA 2OAP1 1KDPA 2RGDA 3QKUA 3L43A 2BVNA 3IEVA 2DR3A 5FI0B 2G83A 4XTRA 2AHOA 1QHIA 4DLYA 4ZCMA 1NY6A 2ZIAA 1CJUC 2HCJB 3GEIA 4DCUA 2JJ1A 3I32A 3KTAB 2R6AA 2BMDA 4MYHA 4POAA 1W49A 2GETA 2ANCA 4JVSB 4NCIA 1E9RA 2JATA 2WWWA 3DOFA 1RPZA 2XXAB 1GAJA 1NRJB 1TMKA 2CK3A 3LW7A 4MUAA 3SJZA 3LVRE 2WICA 1T0JB 3TSZA 1SVMA 3TQFA 4IW3B 4C0AC 2IA5A 4LJ4A 1OT3A 2QRNA 2NIPA 1ONBA 2FSGA 2GK7A 4MYTA 3H0KA 4WZAE 2V4ZA 4GOKA 1VYTA 4JJKA 2V7QA 3CLVA 2OZEA 4BASA 2ZRFA 2D06A 3TMKA 1GUAA 2GJAA 2ZRPA 2GRJA 4G5SA 3AVVA 4TTQA 2XJ9A 1WP9A 2ZAOA 1SHZA 1M7BA 4ITRC 1VHTA 4LRWA 4RCYA 5KOYA 1CBUA 2NO6A 4RD1A 2VSFA 4D6PA 2YINC 121PA 4OHVA 1XTRA 4JVLA 2PZEA 3QXHA 5HKKD 1ZCAA 5FPKA 5AJXA 4Z8YA 2V8OA 2WJIA 5E7MA 1X8JA 4NL4H 3GLGB 4HATA 1AZTA 1SXJE 2GBLA 2FZLA 4FI3C 1S4QA 4OJQA 4UJ5A 4EKDA 4EIWA 1AGRA 4A15A 1P9WA 1OLOA 3AVPA 4BRUA 1NLYA 3Q72A 4HLCA 4BQSA 1TU3A 4BGDA 4YDSA 2ZQ5A 3KKOA 3ADDA 4Y0AA 3W3ZB 4MKGA 3QVUA 4XSHA 4MDFA 2OEPA 5FTKA 3ICEA 4D2IA 4FMCB 2NPFA 2C5LA 2VP5A 2D7DA 1CTQA 1U8ZA 1JPJA 4OBEA 1NJGA 2VLIA 1I2MA 1QHNA 3AF1A 1ZNZA 2QAGC 2VP9A 3CPEA 3MJHA 2IYYA 1COWD 4RD3A 1SULA 5FPHA 5UKDA 2FMXA 1JJ7A 4AC9A 2C77A 2XB4A 3QG5A 3PUWA 2F1HA 3OFND 4NBSA 4F4JA 4YMUA 4TMVA 1JNYA 4F92B 3LH5A 4NYIR 5AR1A 2FEOA 3TIFA 2R6FA 3GFPA 3X1DA 1XTQA 2MSEB 3PIRA 5HZKA 3RVBA 3IIKA 1OH8A 1IJFA 2ZJ5A 4M1MA 1SXJD 2RGNA 3K0AB 4XSGA 4Q5IA 2FSHA 1GKIA 5KSZA 3BXZA 3EXAA 1CULC 4ON9A 1AIPA 1IN4A 1G8YA 1ZUNB 4V0MA 2ZVPX 4AY2A 2XXAA 4HYYA 4QNRA 1EFRA 3K0FB 4UNNA 5G3YA 2E87A 2WJJA 4F38A 2J1LA 3A6PC 1YQTA 3DMDA 1YZGA 5FOSA 3IUYA 3QSYA 4MKFA 2ATXA 4X8MA 2OILA 2P2LA 3IEUA 1W48A 3K9HA 3TKLA 1JEDA 1NMZA 1ZNWA 2O8BA 2REOA 4JS0A 3WBJA 3EPKA 4YLGA 4DLXA 4A92A 4D26A 5JSZB 2CHGA 4KCGA 3SYLA 2RGAA 3U3KA 2MSCB 2OT3B 4KHZA 4BPBA 4DRZA 1KK3A 221PA 3CH5A 1Q57A 3MG9A 2QL6A 2REBA 4M1YA 3RRZA 1CF4A 3FKSA 4X8OA 2OBLA 4Z8XA 1FPMA 4HEJA 1DAKA 4OQMA 1R0ZA 2R6GA 3FYHA 1GFIA 2G1JA 1JAHA 5IRCD 2O0KA 1N6IA 2JLSA 3QXCA 4JYBA 1F3OA 1SVWA 2EFCB 2XNDD 4EQ6A 5JJLA 1SXJA 4KYUA 1P6XA 4JT2A 3VTKA 1NG9A 3Q8XB 3AGQA 4QC2A 3I5XA 3CPHA 3PQCA 3SOPA 5FUXA 5FPTA 4IOKA 1OFTA 2XX3A 2ZTSA 3TSOA 4IDPA 5P21A 1P2VA 1DADA 4KV9A 3AEZA 2NPIA 4B6FA 1IXRC 2MSDB 5G3ZA 5JEEA 4TL6A 3OIUA 1Z0JA 1GRNA 3GFTA 1O87A 2W0MA 2WIAA 2CLSA 3THXB 5AJZA 1QVAA 3SQXA 4AKIA 2R9VA 1KI3A 3FMPB 2AK2A 3E5HA 4DUGA 1KNXA 1QHHA 4GZMA 1W47A 3MWLA 1CRQA 3PEVA 8OHMA 1F6BA 1ZINA 4IDOA 1C4OA 4DVGA 4D0NA 1F2TB 1ZU5A 2CL6X 2ZRHA 4IJMA 3KKPA 3IO5A 3TW8B 4BZQA 1OSNA 4WZ6A 1WMSA 3UIEA 2O8EA 4XOIA 1YR8A 2FN4A 3KQUA 4UNQA 4A8JC 2EFHB 2KI5A 4YQFA 1KI6A 2GNOA 3NIBA 1KSHA 4PAMA 3EARA 2O8FB 2FOLA 5B58C 4TLCA 1G41A 3T15A 3U5ZB 3KJGA 3K0SA 4J0QA 1BO6A 5DIFA 1G9XA 1TTTA 3BRWD 2HXYA 3HU2A 1ZP6A 1E99A 4TN1A 4DLWA 1IQPA 3VKGA 1VDZA 3LX8A 1Q0UA 3UKDA 5BN4A 1HE1C 2GCOA 5TV2A 4E03A 1IOZA 4URUR 3QKRA 3QJYA 4JMPA 2OHFA 5JRZA 2VBCA 3B78A 1XB2A 3BFXA 4PHFA 2JCSA 1E3MA 4YMWA 3TE6A 4JLKA 4Q1CA 3U6KA 2JLXA 2F43A 3KJIA 3K9NA 4V0NA 2IL1A 4QKQA 3SFVA 1N5KA 1D2EA 3QBVA 2MMGA 2H5EA 2ZITA 1D9XA 3IPXA 1GZSA 5TB5A 1E96A 1R5NA 4ZDIA 1LV7A 3R9WA 4KJZA 2FFHA 1S1MA 2EFDB 3PUZA 1U98A 3CRVA 3CWZA 3F8TA 2C03A 4N0EA 4KSCA 3RDPA 1KSGA 3S1AB 5JI2E 2DPXA 3CM0A 2XITA 1U94A 4BLPA 3AF4A 4KO8A 3IILA 3WNBA 2GK6A 3JZMA 4NYIQ 4EFMA 3X1YA 1DEKA 2HLDD 2FZ4A 3JVVA 5EE5B 2J3EA 4OL0A 1XEWY 1OYWA 4A8JB 2AR7A 1FW6A 3HDTA 1ZIPA 1HY3A 1OXVA 3DOEA 2XJ4A 3KTAA 3L0OA 3SHWA 2FSFA 5JS8A 1GVNB 1G1MA 1KMHA 2EWVA 3K8YA 4LJAA 3QF4A 3VFDA 2AFIE 1JXMA 3U7HB 4B3BA 1NI3A 1E2GA 1GWNA 1E32A 2NGRA 4R71A 2QI9C 3IBYA 1G5RA 4FCTA 1BMFA 2IUTA 4LC1A 2X19A 2YHSA 1G18A 2QP9X 3KZ1E 1RJ9A 4HZIA 3K09A 2IWRA 3ZIAD 5KYKA 1AS0A 3DL0A 3WMEA 1W46A 4L16A 4LBZA 3RRNA 3CO5A 2ZU0C 3FVQA 3Q85A 5EXTA 1AJEA 2VP4A 2O8EB 1DBSA 2WWXA 4Q9KA 3ZS9A 2A5JA 2AK3A 3SE0A 4ERNA 2CEAA 3AVUA 521PA 4KAXA 4TMZA 3QI2A 4I1UA 3ZD7A 1LY1A 4B3GA 1SGWA 1BKDR 1KI9A 2AXPA 5KNBA 2I1VB 1UDXA 1EGAA 3AP3A 2WKPA 5DH9A 1XD8A 3K0FA 1KAOA 4PHGA 1EX6A 5CIWA 3LLUA 1IN6A 3U4QB 4ZKDA 2PT5A 1W5TA 2J45A 1XMVA 4Q21A 3T61A 1E2LA 1UF9A 2A5GA 4D82A 4DCSA 1OJLA 3OIVA 3NBFA 4QBGB 3WP0A 5F9FA 5EP2A 4A0RA 2O8BB 4JLPA 1ELOA 1YVDA 5CJ2A 4N1AA 2QE7A 2ZSFA 5F3WB 2GJ8A 3D31A 3DDCA 5J4KA 2VF7A 2BCJQ 2YWHA 1BYUA 4A6XA 2LKDA 3TRFA 1S9HA 2WAXA 4DT1A 1XRJA 1FQJA 4NE2A 1SQ5A 1H8HA 2GF0A 2ZS8A 3KXKA 3ZZ0A 4BLTA 3AVXA 4FCWA 4B71A 4WBSA 4E22A 2A5FA 3LXRA 4MRVA 5K8UA 2JDIA 5FBLB 1XP8A 3K9GA 4LYJA 4P0TA 1XMIA 2ZR7A 3FKSD 3THOA 2ZRBA 4P4UA 4PPFA 2FEMA 2PX0A 3UMSA 1W0KD 3K0CC 3SHFA 2IX3A 1U99A 2PJRA 2QU8A 3KJHA 4M9XA 3EA5A 4QM7A 2KBEA 4RVCA 3V00A 4A0GA 1F5NA 1YZLA 2ODEA 4AKGA 1XBTA 2QP3A 4UKDA 1BYIA 5FR2A 1I2DA 4GOJA 4P4TA 3ZQJA 1T3LA 1FUKA 2QPTA 3DPUA 2GEVA 4D4MA 1G20E 3BORA 5H70A 3EAQA 3FFAA 3IHLA 2ZXUA 2Q9BA 1HTWA 4JSTA 5KNCA 1IXZA 5JFGA 3QKTA 2RHDA 5HTKA 1DAHA 3KXLA 1EFRD 4Q9JA 4B3CA 1AS3A 1A7JA 1RC8A 4YDHB 3ND9A 3LWNA 1W0KA 2JLYA 1HYQA 2OG2A 2XOKD 4JT4A 4IOMA 1AKEA 1MO4A 3H1TA 2IHBA 4ASUD 1NLZA 5GJVC 3GLGE 1G3UA 2G3YA 3MFYA 5LB4A 2ZJ2A 2AN9A 4K46A 3U3OA 4XIGS 1MO3A 1G7TA 1U9IA 4Q4LA 4Z1MA 3N2IA 3ADBA 2RGEA 1KI4A 4V0OA 5FUVA 2ZU6A 2BM0A 2GVZC 4MITA 1T5LA 3BOSA 1M34E 2QP4A 4Q03A 4MKHA 3KQKA 2IUSA 5FOWA 1XTIA 3A1SA 2V9PA 1II0A 2E9SA 3CNOA 1ANKA 3SNHA 4TZ6A 4A2PA 1DOAA 3FMFA 4LSGA 4B6EA 4Q9IA 2A30A 3D7MA 2QAGB 1H8ED 1OXXK 1U0LA 2QA5A 3QKSA 3I8XA 1NLFA 4PPNA 2DCUA 4M21A 4YMSA 3PEWA 3MD0A 4OK6A 1AGPA 3SJAA 3ZH9B 5FUYA 1XXHE 2OUKA 3LX5A 4KSBA 1BS1A 5JS7A 1FNNA 2F1IA 3P1JA 4PAQA 5HR5A 1TQ4A 3IBGA 3NWJA 1R2QA 4LHWA 4EPYA 3L2OB 1IAQA 2Q3FA 3BB4A 2XTNA 3LD9A 4ZI2A 4HDOB 3L8YA 4EPRA 1KY2A 4Q9LA 1LF5A 2EVWX 2IYXA 4IKEA 1JXOA 3ZVMA 2JDID 4V03A 1II8A 5J4HA 1DE0A 4ZCIA 5EE9A 1N6RA 4OI0A 1U0HC 5CB8A 3QF4B 4RFSB 2WKQA 2IXFA 4LOAA 2V54A 2ATVA 4HB0A 5KHOC 3CX8A 4IOJA 3SBEA 3G82C 3H86A 4LV6A 4OHXA 2ASEA 4C3ZA 1L7VC 2P65A 2EU8A 2J46A 3BFKA 1W5SA 3BGWA 1GP2A 3DZDA 3H2YA 3IGFA 3EWSA 2CXXA 4RD0A 1MOZA 3NVAA 2A5DA 3A58B 2DFTA 3MWYW 1AN0A 2FG5A 3I92A 2TMKA 3HR8A 1G17A 1S0UA 2VYFA 1RRCA 3GLHE 3U6BA 3GLHB 3PJRA 4UJ3A 2OCAA 3O8DA 1XCGB 1CLUA 4RZ2A 5FTJA 1OXUA 5TARA 2FFBA 4HB2A 1A5TA 4PC6A 2ANBA 5JLJA 4XWAA 3DZ8A 2DFKB 3K0CA 3U4QA 1NY5A 4W5WA 5GADl 1Q3TA 1E1RA 3KX2A 4GFDA 1FTSA 4OK3A 3FHCB 2QG6A 4DC9A 2R62A 4C30A 3VU9A 2X1VA 4D80A 3LFUA 2ZI6A 2XNSA 1XWIA 1W36B 4NYMQ 1E2JA 1Q1EA 2WMNB 3OAAD 4E09A 2PMDA 2OESA 1BIFA 2CCGA 1US8A 4TTRA 1U8AA 2I1QA 3E70C 3BC1A 3BB1A 1DO2A 3U2QA 2C9OA 2ZJYA 2XGJA 1KOFA 4L9SA 2QSYA 3A1UA 2P6RA 3GJ8A 1D2MA 2JJ2A 3OHMA 2B21A 1COWA 1QHXA 1P2TA 3ZQ6A 5DN6D 1G291 1PV4A 5C46F 1OIXA 2RAPA 5E7IA 4B33A 3C7KA 1VYVA 3FWYA 1ETUA 4TLEA 4B35A 3D3QA 4AK9A 4ZDWA 1QHYA 2IYTA 5DN6A 3GLIA 2OCBA 3NDBB 1XXHB 3GEEA 2BHRA 4IOLA 1XU4A 4Q01A 1T0HB 2PBRA 4FIDA 2ZJZA 1G7CA 2QUZA 3TUJC 1KI8A 1GTVA 1UFQA 3CX6A 3EG5A 3HYRA 1G6HA 4BFUA 3THWA 2Z4SA 3PEYA 1NVXQ 1D5CA 2ORWA 3UXMA 3PXGA 3U7FB 1JPNA 1M1YE 2EFGA 2DBYA 2QGZA 4B47A 1XX6A 5GJBA 2R2AA 1IN8A 1VHLA 1X1RA 1Z83A 2CHVA 2ZI9A 4DLZA 2XB2A 3EW9A 2VL7A 1UBCA 1WDTA 4LBWA 5BN5A 4KU4A 5CLQA 2SHKA 4GNKA 3OE7A 3GFOA 3AVYA 1G16A 4D4KA 2BM1A 1YZUA 2ZI5A 3WY9A 4YMTA 4PZYA 1RRPA 3RWOA 1OYYA 1NP6A 1YJ5A 1Z29A 2ZJ8A 1VCIA 3Q3JB 1T5IA 1HE8B 2VHTA 2F6RA 2NO0A 4R9UC 3EZ2A 5AUQA 1KAGA 3QIAA 4RD4A 2B7BA 4RZXA 2NTYC 3SYKA 3GJ4A 1MO6A 4R7ZA 3BH0A 2ZJAA 1VCOA 3LAWA 1ZC4A 2ZM5A 4QXAA 1CR2A 2WM9B 4DEYA 4DDUA 5L3QA 2X2EA 1W4AA 4RZ3A 3WRYC 1HH4A 3SC3A 5AUOB 4URWR 3P4YA 3RC8A 2XTMA 3V4RA 2P6NA 2X77A 5C18A 1Q3HA 2AFHE 2CCKA 3N2EA 2G88A 5JSZA 4QM6A 5CYOA 3C5CA 1P4SA 5KSPA 4DSUA 2D2FA 1US8B 5IK2D 3I62A 5B57C 1W0JD 3B9QA 3IIMA 4MRPA 1NVVR 2QPOA 3CBQA 4LX0A 1XJQA 4UNSA 3QEJA 4RFSA 4EDHA 4IVRA 5DNYB 4M53A 4KITB 5EP3A 5HCNA 3ECCA 3B82A 3LQRA 4FINA 2VSOA 4HUTA 1B0UA 1XTKA 2QTHA 2BIFA 5IF9A 4DIEA 3NKVA 1FX0A 3OIYA 1EFTA 3B9PA 4JKIA 1FNMA 4HLUA 2XNDA 3GJ7A 3I8SA 4L15A 4BZXA 2WJHA 1VIAA 2YOFA 4JKYA 4M1OA 1YR6A 1OIWA 2ZRNA 3GJ5A 1PLKA 2PMKA 4G5QA 4TQUS 1W7AA 1O3YA 2QBYA 1XJCA 3TW4A 4GI7A 4D0GA 4OKSA 2RGNC 1YU9A 2Q3HA 3VKWA 1U2RA 1WBDA 1IHUA 2D4HA 4ZIRB 2H1LA 1E2EA 1RZ3A 2WMOB 3LNCA 5GVRA 2GESA 1QDEA 2RGGA 3PG5A 5FPSA 1XF9A 4P4SA 1ESMA 4G0NA 3JZAA 3HPRA 4Q1BA 4D4JA 4G5OA 2X2FA 3ZDQA 1KZ7B 2R6DA 1HURA 2NO9A 3AP2A 1QVRA 4BFZA 5HZHA 2OM2A 2Z6VA 1KO1A 3L0PA 1NN1A 1NN3A 2JAQA 1E0KA 3QE0A 2C78A 5EQTA 2AKYA 4IVQA 4UXJA 3U3JA 3VMFA 1FMLA 2C8VA 4M1TA 2ZRCA 1CJVC 1JR3D 3T1QA 1OH7A 2QM7A 4TL9A 4B34A 1KY3A 1N6LA 1KKMA 3BE4A 4JBYA 1XD2B 3B5JA 3ZZUA 1AK2A 1PVOA 1SVOA 3GLIE 1GDDA 1NF3A 2HJGA 4MYCA 1NKSA 2JJ8A 3E1SA 2FU5C 3TK1A 1YRBA 4JL5A 5L8VA 2JASA 3RS3A 1CXZA 4PC7A 4XD7A 4LBVA 4Z1MD 2AWOA 1N6KA 2J9RA 1SKYE 4AG6A 2O8DA 2P5SA 1DTSA 1C9KA 4BE7B 4TQAA 2GTPA 4PX9A 1XMSA 3KFVA 2QM8A 1TX4B 3PEUA 4DLSA 3CB4A 1UPTA 4F91B 3CONA 3VR2A 5KDOA 1LS6A 3BD9A 1KMHB 3EZ6A 5JHGB 2CLCX 3SZRA 2OXCA 3THWB 1MKYA 3UWKA 4JLDA 2YWGA 2ZUCA 1KZGB 3QNUA 2H7VA 1OH6A 3OEHA 4C0SA 1P73A 4GMXA 3PUYA 821PA 4LY6A 1JR3E 3LA6A 1IXSB 2IC5A 2N46A 2QPAA 3AF2A 4OHZA 2BJVA 1M7HA 2VP6A 3FPAA 1R0WA 1CU1A 4TSFD 1E0SA 4QBHA 1EFCA 2KWIA 3G5UA 4Q00A 1G5PA 1EWQA 2JJ2D 2CE7A 4IDHA 1JR6A 2V7QD 5C1BA 4IXMA 1A1VA 1P75A 5F2EA 2IHYA 3ADKA 1CP2A 4ZDJA 2HUPA 3QG1A 2WWIA 4GOXA 4JIMA 4NHOA 4IDQA 4PQFA 5G40A 2JLRA 1MH1A 4PQYA 4TL8A 1XEXB 1Q1BA 3KB1A 2H17A 3IKJA 1EFUA 2YC4C 1NN0A 4DJTA 2MMCA 4C7OA 4JLMA 3J81k 2QMUA 4JVMA 2J87A 1S96A 2FF7A 3A36A 3A1TA 1GRQA 3QEOA 4IRUB 3TH5A 3GMTA 4DHEA 3QKRB 3VU9B 3CF2A 1JBKA 2D62A 1X8KA 3QBTA 1JJVA 3ASZA 1M6NA 5EE3A 4PO9A 1TADA 3LVQE 3KQHA 3HU3A 2CL0X 1R8SA 2WZQA 3QVVA 3VNUA 2P3SA 2GCPA 4XVUA 1U9IC 3TAHA 4NZYA 3E2IA 5K8LA 1M8PA 4O2RA 1AKYA 2ZJBA 2HV8A 5J4LA 3R9IA 4C0JA 1XZQA 3R20A 2FWRA 3CKLA 4YONB 5EZ5A 3A8TA 2PCJA 5C2JB 1Q12A 3G0HA 2ZE8A 3AGPA 1A82A 2BV3A 5CJPA 2ERXA 5K8TA 4Q19A 5EJEA 4PPGA 3OIWA 5C4MA 1QF9A 4LHYA 4MA4A 1EESA 3NG1A 3M4YA 4O0MA 3AKYA 1KYIA 1GM5A 2C95A 3KB2A 1XXHA 3TAUA 2X8AA 3VR5A 4IFEA 3SBDA 5FOVA 2G0TA 4Q4AA 4JBXA 4WXPA 5G53C 4DT1B 4C0QC 1MR3F 4AWXA 1J8MF 2AD5A 2VIIA 3F3YA 5IHPA 1N6PA 3UMRA 4EJSB 1Z6TA 1KIMA 1Z28A 2UZIR 1PLLA 3U3RA 3L0IB 2Q9CA 1FP6A 3VAAA 1BMFD 2FGKA 4HAUA 2J0SA 3TSWA 4B3DA 3BIFA 4NCKA 1EG7A 4IVPA 5AWFC 3U44A 2O8CA 1Z6GA 2CDNA 1OIVA 4TMWA 4XVRA 4US2R 2NMVA 4LCBA 5FL7A 2FX3A 5CITA 1A2KC 1OKKA 3W6OA 4R2IA 4US1R 1F48A 4JLVA 2BMJA 2V3CC 1KDTA 3A1WA 4TLDA 3K70B 1ZU4A 4UNPA 1SZPA 2PL3A 3RS2A 1Q21A 1G21E 3CRQA 4Q18A 1TNDA 4RKEA 2CNWA 2H92A 3OF5A 1Q20A 4Z51A 1N0UA 3MWKA 3REFA 3U7EB 1YKSA 2QSZA 1NSTA 4NYJR 4BFVA 2VRWA 4D0LB 3Q7QA 3DKPA 4DB2A 1ZCBA 5FBWB 4XTCS 4LYAA 4UXIA 2O8DB 4OK5A 2CHQA 1E9SA 4B48A 1EX7A 1LS1A 4EAQA 4LJ7A 1Z0IA 3X1ZA 4U7DA 3DEFA 1J99A 2IT1A 1XPUA 1D8TA 4KODA 1UKYA 3CRRA 5SZJA 1WBBA 4B44A 3MAAC 1S3SA 3UPUA 2XZLA 1S1CA 4ZO4A 3W34A 3UANA 3UK6A 3TJZA 1OFUX 1Z63A 5EUQB 4XWOA 5H8WA 2DWQA 1YZNA 5EUMA 1E2KA 2J0UB 4XWKA 1P2SA 3QXJA 2V1UA 4CEJA 4XVQA 3RRYA 1FX0B 3KDSE 4E5UA 3IQXA 2DY1A 1U90A 2RGXA 1ZW6A 2IYVA 1X6VA 3A4LA 3QXXA 3GLHA 3EX7C 3IIJA 2O8FA 1N25A 1PUIA 4CEHA 3FHOA 4MGZR 1OXTA 5HE9A 4NDZA 1VG8A 3OESA 3PCRB 2YJTD
chains in the Genus database with same CATH superfamily
1BJTA 1PD1A 4KE8A 3HWSA 2BISA 1KORA 3ZE0B 5IANA 1WV1A 4XUGB 4PLTA 4ZD6A 4GMDA 2L17A 5B1DA 5BV2P 1F8UA 3AR6A 3M1IA 3VOTA 1A4RA 2IGTA 1WVMA 3FAZA 2YYAA 2BBOA 3OZIA 4BNHA 5LU9A 3B60A 2IOHA 1YRYE 4NAHA 4OQFA 1X94A 4AKEA 3DWGA 2NUAB 4F4HA 2XMBA 2PZFA 3IPYA 3R3SA 2VYCA 1OZAA 2I1WA 3P4UA 2PWYA 2DUJA 2FPIA 4JJGA 5KHLB 3LECA 3N8KA 3D3KA 2XKJE 2D1TA 3W1EA 2M6SA 4C06A 1G8GA 4DLNA 1C4WA 1CJKC 1VRWA 1XZHA 2K5UA 2IYQA 4I0WB 3AV0B 4NARA 3IUPA 1X7WB 2GYVA 4D46A 3DSRA 3ZVNA 4MQFB 4MVJH 5HHTA 3WAKA 2V1XA 5HRCA 1EDDA 2QV7A 1AGNA 2BFEB 1SQ0A 1H2ZA 5FWXA 1EVKA 4PF1A 4XKJA 3TAHA 3TZHA 1XD2A 4RM2A 5JPCA 3PX7A 1N2BA 2XWSA 1YC5A 4QEDA 3C1AA 3N2NA 4W8OA 2IQIA 3TW8A 4WKBA 3SZUA 3KT8A 4EY7A 5L3VA 4DSOA 2JK0A 3DEYX 2P0EA 1EP3B 2YYYA 3JU3A 3AIKA 4MNTA 4RK4A 5BOVA 4YDQA 3EVTA 5JV5A 3U44B 1A4IA 4FDUA 4R54A 4IJKA 2H1VA 2PKCA 5CFLA 5J2TB 1T9GR 4BFTA 1Y5MA 3V4PB 2IEIA 1EG2A 3RBAA 3V8NA 1ZJ6A 4OQXA 3EZXA 1VXOA 2A33A 2BM8A 2ZRGA 1UAYA 1ZQ1A 1ZJ5A 3EVCA 3L77A 4MVJE 3B1ZA 2CHUA 4EKYA 3RFCA 1HQYE 5BQPA 1E2BA 2QX8A 3C1TA 3SS7X 1KO7A 3AR7A 3MTIA 4LHSA 5T4EA 3WA6A 3AC0A 3ZDXB 2LXNA 4AX4A 3JQDA 1X70A 4O6VA 5K0FA 3QE3A 1USVA 4D5EA 1UWLA 4HX2A 4YRZA 4YT4A 1VKJA 2VTBB 1J0AA 3W1VA 3SMVA 1VBMA 3MTJA 1A8IA 1F3LA 3K9FC 3IE1A 4HQLA 3EPHA 3R0ZA 2JJ1D 1W85A 2WKWA 2ZTLA 2QNRA 4E5PA 2ONJA 5LWQA 1TJNA 1W5BA 3FNQA 1EK6A 3DDOA 1B8PA 1OW3B 3O83A 5BSGA 1YBVA 3BXHA 3A32A 3EN0A 2FH5B 3PZBA 4B2LA 4BBAA 3G59A 4JC8A 1QK3A 2O50A 2YWDA 4O25A 1QRTA 3FGOA 2I2CA 1MRNA 2VPWA 3QU2A 2B2XA 3INYA 4IMRA 3VVMA 4URFA 4J16C 1G19A 3F5DA 4CT5A 1YHYA 2O7QA 3M4XA 3TD2A 2JGFA 3DLCA 4D4HA 3D5TA 2MSLA 1NF2A 4RH1A 5GV7A 5LCXA 1G2QA 4YLYA 2A3RA 4OYLA 1VOTA 1RQRA 2ZR8A 1NVUQ 2ZUBA 3QWAA 1CK4A 4KV7A 4KXFB 4X7PA 1VHWA 5CLHA 3IE2A 4AKSA 3NHSA 1Q84A 5JZBA 3AILA 4RDXA 1AH2A 4IDFA 3E4CA 1E77A 4YREA 5J40A 1TAQA 4TS3A 1Y4ZA 3B3GA 5JDIA 2PFKA 1W2HA 4GI5A 4WCFA 1VFPA 4Y2QA 5ICMA 4OJKA 1V9LA 2LGJA 3DVRX 1D4OA 3D8BA 4IRMA 4E88A 1WCYA 3HN6A 5CNKA 3KQTA 3LF1A 3G7SA 4N0DA 3PXEA 2GAAA 4TL7A 2I5PO 1NDHA 3HCPA 4RQAA 1EDOA 2FWPA 4GX2A 4MVJF 1YS7A 4IS2A 3QPWA 4OXRA 2IIVA 4RHUA 4LJ8A 4ZT6A 1FY2A 4QU5A 1WNTA 1KU0A 1ZRMA 1UQTA 3WLEA 1ZZGA 1NU6A 3KEMA 4PWYA 2RHMA 1I4OA 2JLBA 2RGYA 2WTNA 3MCWA 5IN4A 1KEEA 5AVRA 5LD2C 3TL3A 1I0ZA 2GBGA 2PQ0A 5M2QA 1HTTA 4W1QA 2W00A 3DGFC 1H2WA 4RFVA 1QYRA 1G60A 4K9NA 4CKBA 3EVZA 4RULA 3R6TA 1L5WA 5LZ5A 1SHTX 4BLRA 4ZYYA 1MQ8B 4EP1A 4TQ9A 1YHNA 5ALUA 3M0EA 2X4DA 3O6VA 2PGNA 3UENA 1JQDA 3RODA 2XDYA 3ONWA 2E1PA 5A06A 1GIAA 4LV5B 1VM6A 1U04A 2Y8EA 3WGUA 1U7HA 3OTQA 1BU5A 1C9EA 4KGXA 3WGGA 5TSDA 1NMYA 3B1KA 2QTMA 3ZIAA 4FSHA 2DJIA 4KXMA 4X61A 4XWTA 4RDCA 1D5WA 4HAWA 8ADHA 1M66A 1V9CA 2IU4A 4R16A 1G63A 1WUHS 4RPCA 2QZJA 5IJZA 4JL6A 3L05A 1AK9A 1IHDA 2OK7A 4XM2A 1NJFA 3BN3A 1OPXA 5TQ0A 3ZPXA 4PSCA 4KDEA 1U0OC 1U2DC 3AFGA 2OL4A 3C6QA 3VTFA 3WNVA 5GQSA 3MJSA 5BSFA 3A1NA 3NEJA 2FV8A 2OORC 3L3BA 4M9SA 5CT8A 5EESA 3RFUA 4II7A 2I22A 2HW8A 1EQ2A 4ZVTA 3GR6A 3AJRA 4H1UA 3FFWA 4GKBA 3ESDA 5E4FA 3URKA 1B76A 3ER6A 3R8FA 2D13A 1F20A 1P2BA 3G2JA 1IH8A 1F2TA 2DKNA 3C8MA 4K81B 3L4JA 5AKIA 1E3DA 2YQZA 1T4GA 2O05A 2Q7XA 4RV4A 1WE2A 1TYEB 3C8DA 1TMOA 3LOPA 1NR1A 2W6PA 1UKCA 3FGZA 2HSDA 4QOIA 4UUOA 3ANLA 4RK7A 4OHRA 4AXBA 1V5WA 2ZE6A 4BMDA 3N2KB 1KJ8A 2C96A 2QN1A 3RS5A 4ZOAA 2OY0A 1KYTA 2PVPA 1A9SA 3S0JA 3O4VA 3NUGA 4LDQA 3GY0A 4EB6B 9MHTA 5JY1A 1QGZA 1G8JA 3ESZA 1N57A 1VJ1A 4MGIR 3M1AA 3RUDA 3ZWXA 4WZAA 2PX8A 1GYPA 3JQQA 1FW8A 1I4EB 2X0JA 2PJDA 2QN6A 3M81A 4G1CA 3LHKA 1XEWX 1WW3A 1LD3A 5DSTA 5JQWA 3I39X 2ID7A 4HSGA 3RCBA 4GX5A 5U4XA 3T12A 3ZYCA 5KWEA 3IMEA 1CZOA 1AKVA 4WMLA 4TYQA 3SQDA 5KEIA 4NSNA 4EA9A 1U0EA 3Q5DA 4Y0VA 5D7NA 2WEKA 4YJ2A 2ID8A 2WYOA 3X43A 3H19A 4KLNA 3WKCA 1I6LA 3COVA 4ZPJA 4ZAWA 3RARA 3OJ0A 1QRUA 2WKRA 1CUEA 2X14A 3ZLUA 2FFAA 3NS7A 2VT3A 3AFHA 1P5JA 2BTEA 3WLLA 3TZ6A 3K6SA 3UNXA 3JQEA 3ROGA 1JDTA 4BKMA 2R6CA 1C7FA 3GEGA 5AVZA 2C0QA 1OE0A 1UOEA 3KJXA 4X84A 3OEED 1E9AA 1JHQA 1JHVA 3ELDA 1ISRA 1SD2A 3PXDA 3C43A 4RMNA 3IUNA 1N36B 3FYDA 4JJIA 4YRQA 2X86A 4Y6PA 2FKAA 3D3EA 4LE1A 3T3PB 4D5GA 1I4LD 3W9SA 5AJYA 3AUUA 3DBLB 4WIAA 4D0RA 2JK1A 1WQ1R 1NBMA 3D6AA 2P6UA 4JASB 4RNCA 3ZJ5A 4C7JA 3DM9B 5BY2A 4MR7A 4HWTA 5GY7A 2ZRJA 4NMXB 5CB4A 1WLYA 5E4JA 3NHUA 2O07A 4BVHA 1ZH4A 2PBLA 5JWOA 3F6YA 4YUZA 4CBVA 3V2GA 3IQGX 2VF2A 4PG8A 1NBAA 2OCPA 3HCCA 2HBQA 2JH8A 5F76A 4HWSA 1CJTC 3FCUB 3HR7A 4REQA 4B6PA 4RSGA 3FVRA 3MGKA 2C88A 5KSOA 2YXPX 1G3MA 1CKEA 3JQBC 5IXSA 1JECA 1MEJA 3QPVA 4FKBA 3GNLA 2QRVA 4JC5A 1UMCA 1YZKA 4JYCA 4OGGA 4XGKA 1NXQA 1Y42X 4UHFA 1JEEA 3E23A 3LOQA 3SC6A 4LI3X 5HQJA 3WADA 4YAGA 5AW0A 2IEDA 1DVRA 2R8OA 4TKVA 2QRGA 1U7TA 2PA0A 2IQ5A 3KWMA 1ZD5A 5EZYF 1GTJ1 4G1UC 4MR8A 2XOKA 4Q47A 5JCZA 3H5OA 3C98A 3FLBA 3CNQS 5DBEX 1C1DA 3SP1A 3VZQA 4UAUA 4D1YA 1SKUA 1OHHD 2HMYB 3HDGA 4DQXA 3AB3A 5AVKA 1V5EA 1XTTA 3RBZA 1UIMA 3NKLA 4X95A 1F8GA 1ZGGA 2OXRA 1E6LA 3L8FA 3O8CA 3AUFA 3H1PA 3TR5A 2BYTA 3SJBA 2VHCA 4TLBA 1C4XA 2VJBA 4GL4A 2CJXA 2FLKA 1C1XA 1LZKA 3G5TA 4MS4A 2OGWA 4ASUA 4QBIA 4DXDA 4XFDA 4EHHA 2OV4A 4KWTA 4OHBA 3E7PA 1PZHA 1KY5A 4R1QA 4TWAA 3WQSB 5C8YA 4DCJA 1L6IA 5JSQA 3HXLA 5EKTA 3H9BA 1O8BA 2GNPA 2XE8A 2R25B 1AA6A 1PR6A 1J8YF 2OSBA 4R2LA 3NWPA 3ZQUA 5IBQA 1X3SA 2W4IA 3Q3VA 3NC4A 5DFAA 2Y67A 3OEHD 1L5GB 4K1LA 3A4YA 3RT9A 2W6JD 1NF8A 2VQSA 1WO8A 3K5IA 1PR3A 1T6NA 4F3YA 4IEEA 1SVKA 1Y8CA 3FSEA 1T43A 1NNLA 3Q6MA 4QXPA 3VR3D 4D99A 3OPYI 3PDUA 3GRVA 2W4QA 3L8GA 4KQXA 4OP2A 1Q0LA 3MERA 3I9JA 1RCFA 3I05A 5ECWA 2VG8A 4C6TB 1F6WA 2L0XA 4NICA 4MGKR 1TT5A 4XWYA 3GLFA 2ZKLA 4XE5A 3LQ1A 2N9UA 1BOFA 4JJ6A 4BFSA 4G5GA 2R1VA 4N01A 4KVAA 5ALMA 1JDUA 3M4NA 3KSAC 1HWYA 1IVSA 3A2NA 2YUTA 3GBSA 4B73A 2H4ZA 2GZAA 1ONNA 4OYRA 2OVFA 1KSJA 1RPAA 4UVGA 4BC0A 3ZGXA 3AUSA 3EWIA 1RKXA 3WYCA 4DBLC 3LXMA 2IV7A 2DLNA 1U6JA 2IE0A 5DTRA 2FFQA 3EISA 2GCOB 4AJIA 1UODA 2YWBA 4EQ6B 1MC1A 3QF7A 4RIGA 5JWRA 4S05A 1N3YA 3F9RA 3BKXA 4YI3A 4LYHA 4RY0A 1NBMD 4P53A 3NBYC 1YRWA 3IUQA 3PHHA 2C7OA 5FH9A 4O02B 3HPQA 4WCFB 3NO4A 3WJ2A 2YOGA 1ZZEA 5FHRA 4LOKA 5DHTA 4MICA 5JWHA 1G8HA 4A2QA 3BD6A 3AIOA 4ETMA 3L4BC 2Q1YA 3EDMA 1NT4A 5H9VA 2PX5A 3HUFA 1HDEA 2JHFA 1L5NA 1JFRA 2LDXA 3FYUA 1X7GA 4P4LA 2JNWA 4PLFA 1M8GA 2OFXA 4Z1OA 4I81A 1RS0A 5D3MB 3SLKA 5LQAA 4L73A 4E30A 3WMWA 3EH2A 3EGWA 1KMIY 3MS4A 3PXUA 4Q12A 5ANRB 3Q0EA 4CW7A 3CZ4A 5FT9A 1CZRA 3H04A 3K9LA 4QATA 3F46A 5G1OA 4QG3A 3DE2X 2VJDA 2Y1DA 1FRVA 4A23A 2D7CA 3H84A 4DRXB 2JHPA 4U6NA 2NZVG 3KWLA 4Q4JA 2BR5A 4DREA 4MQ4A 1Y5NA 1NSYA 2DX7A 3PTAA 2C1ZA 3R0JA 1AQUA 3ZYZA 2ZG6A 3UC5A 2LKCA 5I51A 5KVSA 1TE2A 3NW9A 1N2GA 1QKIA 3KD3A 4CLOA 1AKUA 3WYDA 1GPMA 2Q62A 3OJWA 4YRIA 3LCVB 3RO7A 1QAQA 2QROA 4YEDA 2X58A 3P2YA 3WXMA 4RD2A 3LP8A 2NP7A 5F21A 1TF7A 2O5VA 5EJ9A 2IEZA 1TW3A 1Y5LA 2I2XB 4V3CA 4HCJA 5EGNA 1FDWA 2IV3A 4EO7A 1W1UA 2P2CA 3KZNA 3EVNA 3VBEA 2HT6A 1P91A 2B8WA 2YWEA 1P2UA 1Q74A 2OV2A 3RSCA 4CMGA 3GVPA 1Y6RA 3CUSA 3FTCA 4RVFA 4A0FA 3G2IA 3KOZA 3DE7X 1YI1A 3OOEA 4CYMA 2FLVA 4BNYA 4B4OA 3N28A 3BT7A 3VKHA 2IPOA 3K8QA 8OHMA 4W8HA 2PIDA 3OQIA 4KQJA 5F1YA 3UY4A 3Q6IA 4PZZA 1GG8A 2F3QA 2JIZA 3B20A 1YJ8A 4BVGA 1A9YA 3KLOA 4H1VA 4PZLA 4I66A 4ZQHA 3VI3B 1J20A 5ARBA 3Q7EA 4ESHA 1HQCA 2G6BA 3GIDA 4ENVA 2JIQA 5KCMA 5E1BA 3L8CA 2XTJA 4D0NA 1RC1A 5E1MA 1BA3A 3SZMA 1H0KA 4WBXC 3CVWA 4V0RA 1U11A 4CEIB 3KM0A 4MWOA 4AICA 5HRUA 1NJ8A 2OP0A 7ABPA 1KWKA 5F9MA 4TMKA 4LRUA 3L5OA 4CM1A 4GICA 4WZAB 3RVMA 3HU1A 3W77A 2FPGA 5EPEA 5CXUA 4UUMA 3AO0B 3DR5A 3OT1A 1SM4A 2J0UA 3SHVA 4IZ6A 1WHSB 2HXSA 4GX0A 2Q4OA 5BYJA 1ZMTA 3GJTA 4EY3A 2RAUA 4PYJA 2Z8YA 1AMOA 2OA0A 5KOJB 1K08A 2WG0A 5I48A 1I6KA 3AWIA 3AVTA 4PTZA 1DJNA 4DCVA 2B7CA 3WGYA 4R69A 3KIPA 4IHJF 5E1DA 5BMVB 1UP7A 3LK6A 1PRYA 3C3DA 2J30A 4JCCA 5BUQA 4FGLA 5JSFA 2ZAGA 1EZ4A 1N0VC 3QMPA 2E4AA 4LWPA 3HBFA 4QTZA 1HQDA 1MRZA 5F7ZA 5FWXB 1DWUA 1WP4A 3BGSA 3H5NA 3S55A 2XCSB 2CVFA 3JXEA 1QZXA 2GSWA 1BFDA 1YJAA 2B20A 4Q7JB 4WPGA 2W83A 2WPDA 4B3XA 4Y2TA 2MR6A 3IDQA 5T7BA 1OV4A 2VYQA 4IHQA 4R2XA 3OM0A 5DI3A 5C3MA 1FP2A 2BKEA 2QAGA 5C8VA 3X1XA 3MJTA 4IQ8A 4D74A 3ICCA 2DERA 4YYEA 6REQA 2HQ1A 2P7HA 2WJVA 4NMWA 5IT5A 5E3IA 3BB3A 3MC1A 5DGHA 2WG1A 4JFRA 1RCTE 3K70C 3S99A 2HDOA 2DULA 1TJPB 5DM60 5KVCA 2WABA 4R5HA 4IZHA 5IKOA 1W8IA 2X8WA 4QYSA 1R9MA 4P4SB 2IYLD 3NH9A 4CUKA 3O93A 4NOLA 4CM4A 4XIYA 2QQ5A 3VI4B 1EXNA 1ZX1A 1HETA 2JH3A 3OPMA 3PGMA 5T64A 2XECA 3H6GA 2XZOA 4D4IA 1J2JA 5HPYB 3I6MA 1JMVA 4MX8A 2DJ5A 3WK6A 4MDYA 1N9GB 3DNPA 3WLPA 3IDSA 1EP2B 2XA1A 3UT5B 5LD2B 2XLCA 2CHFA 1OC2A 3D4LA 3ZHRA 1PJTA 2AD1A 1RHRA 2J7PA 2W5UA 3PUVA 4X6UA 2OPBA 2X8LA 3ZE8A 3R7WB 1XZPA 4EPTA 3TJMA 2RI1A 3FMIA 2ZUFA 1WHTA 1L5QA 2Y93A 2YJNA 4MW9A 4CLHA 3RLFA 4QUHA 2WC1A 3DP7A 4BP1A 3FTNA 3QJ5A 3LQFA 1UXJA 5AXDA 4N7JA 4YT8A 1U65A 5F73A 2P9EA 5CVDA 5JO0A 1H9BA 4A82A 5MN4A 2JLWA 2JC3A 1GCGA 4I4TF 4JP2A 4NZPA 2O0LA 5B6PA 5IJ0B 5HUJA 5LXTA 5T4BA 1KMMA 2VTBA 2VHXA 4HQOA 1AUQA 1OGIA 3HCEA 2IBMA 4NFHA 3SJCA 2ZTMA 3E2MA 3UAZA 1IQRA 5ALVA 1K27A 1PZMA 5JNRA 1Y7PA 2NX2A 1N2EA 3PF9A 2IOFK 1PZXA 2BF7A 4G4GA 1BXKA 2Y2VA 3AUJB 3LVBA 3O8OA 3TQIA 4MV8A 2QTVA 4YP9A 1VMDA 3ZCTA 13PKA 3DT6A 1SMKA 4RF4A 1OFVA 2C7BA 3T1OA 4AURA 4LV8B 3HK2A 3PQ3A 1KRHA 5ALLA 4BDTA 1TUBB 4I5IA 1IBRA 2HNKA 2OB1A 4MCJA 3NH6A 1XP5A 4E31A 4HWGA 5BUZA 3E22B 2W98A 2ETXA 1FU7A 1UMBA 4Y6LA 1GOTA 2J3IA 1GXSA 3TRJA 2LCIA 1UK7A 4XJSA 4AQDA 4GH5A 1XKTA 3CX7A 1Z7GA 2D2VA 4HWRA 3NP7A 3FTEA 2PV0A 1P19A 2QLLA 4YRLA 3ZVKA 1M74A 2WNSA 1F60A 3OCXA 4RH0A 3X1WA 4JGBA 1MQAA 3LYAA 1IVYA 1OAAA 3EF3A 4N6NA 2Y1LA 3KYJB 2VPPA 4WZBA 3EDRA 4C2TA 5BW8A 4Q1AA 2IX9A 3B70A 2WM3A 5BWMA 1V48A 2JRCA 4I1SA 2ZAIA 1ULZA 3C1UA 2Y1FA 3SVZA 4ISBA 3KYDA 4OQYA 3O91A 3JRWA 2ZI3A 1YO6A 2GLTA 1KZ6A 3NHJA 3IDZA 3G02A 5I9LA 2AS0A 1LWOA 2XMDA 5DULA 5ILGA 2Y99A 4JZKA 1NXWA 5DHPA 3RANA 4X64B 4CIAA 4Y9RA 3QHPA 4LECA 3VHXB 4ESEA 3PFNA 1NQUA 5FOUA 1FTNA 3A6LA 1Y98A 3LYUA 3HVJA 2XYPA 2HSWA 1XRSB 2J59A 3AU8A 5JC1A 1U0FA 1QKJA 4J0FA 1SAYA 4B0PA 3E7XA 1QGUA 1R0YA 5REQA 4MHSA 4TZKA 1TO2E 4QT0A 4BATA 1RI3A 5A1TA 4E4RA 1RKVA 3D6TB 4Z3OA 1V95A 2H6EA 4UU7A 2GJ9A 3EJ6A 3NPAA 4JX9A 5AJUA 4IP0A 1DC4A 2ZE5A 5IKEA 4YK7A 3T7CA 4WTOA 3ZBPA 2OCYC 1GSOA 3RD5A 1W88A 4HJXA 2IHNA 3KZVA 5AHRA 4WL0A 2VPIA 1Z37A 1VKNA 2Z5GA 4ENTA 2FPPA 3OEEA 2O3QA 1KERA 3FF1A 1DO0A 3TQRA 2G9NA 1VJRA 4WVFA 1XLUA 1VKZA 3D3WB 3KU4A 4V2UA 3N2KA 2BGTA 3VU3A 2OSVA 4F7WA 3H8JA 1ATZA 3VO1A 1O97D 4NOKA 4AO8A 4EB6A 5IBCA 4AD8A 5NULA 3WSVA 1WCIB 3X44A 3RKSA 2CXTA 2NSDA 1RNLA 1UM8A 3EIHA 4BLOA 4OXNA 1MXFA 2BBSA 1O95C 3IOMA 4YJ3F 1TUIA 1P1RA 1AHHA 1BJKA 1G5FA 4G0XA 3TOZA 4OQDA 3VSBA 5CFNA 4M55A 4D9BA 2UYYA 3KZXA 4LWZA 2AXQA 2EKDA 3CLRC 5CIQA 2QT1A 3LHFA 4QBFA 1UBUS 4KXQA 4NNJA 2RBKA 4UQOA 5CBPB 4Z54A 2V7WA 1E9DA 3E9MA 4HH4A 4OA8A 3WYBA 4LOJA 3V4ZA 4JI7B 1YCDA 4D8UA 4F6RA 1EUZA 1JKFA 2XF8A 1W25A 2VS1A 3DCYA 1L7QA 4LI0A 3I2JA 3TNYA 4A4DA 5K2OA 4W5NA 2EHDA 3T35A 4MCHA 5E95A 4KXUA 1R4MB 4RL6A 5JSUA 9ABPA 3T3IA 4IQFA 2QT9A 3COPA 4RMHA 2IYWA 3WGNA 4O08A 5K0SA 3I61A 1O5OA 5HJEA 2BBWA 1DUVG 3SXUA 4QJ4A 4GGPA 2OLKA 2GVNA 4AXXA 1GR0A 3N6RA 4O3FA 1V43A 2CDBA 5WRFA 3DMHA 3AKZA 1OBOA 1U4OA 1ULHA 1E20A 4M46A 5KNDA 5KX5A 3H97A 4P33A 5ESDA 4KBYA 3MWDB 4B32A 1EQAA 3NP9A 4P84A 5CX1B 3R0QA 3V46A 3L8ZA 4H77A 2EGHA 4DG9A 2NQ8A 2AJBA 2B6HA 4GKVA 4CTNA 1Y9JA 4INPA 3F3SA 5CB4B 2CNKA 5AKXA 2XUQA 3PNPA 1I2BA 5JNLA 5EG5A 2VTDA 3GG9A 4E2YA 1M0SA 5IF3A 4QHTA 3LUCA 5EJFA 3SBXA 3C3YA 3D6NB 3GFRA 4YI5A 1TK9A 1V8DA 1U2GA 2B92A 3DV0B 2A14A 1GG2A 1I24A 1QIFA 2GM5A 2OZLB 4TWZA 3COZA 2D2EA 1TTQB 3G0GA 2HF8A 4NECA 4CMIA 3GLFE 3EIOA 5K20A 3N07A 3S1LA 5MFZA 1T8TA 3BTUA 1LF0A 4PO8A 3QV2A 3H11B 1FCJA 2XGMA 4G0MA 2VP3A 2Q6IA 3RASA 4BV8A 2B9EA 3GNTA 4ILEA 1B8VA 4NF2A 1ZBQA 4HDNB 3EXEB 3ER8A 1UMDA 1E8NA 1TOAA 1WKCA 2YCLA 1RWPA 2Z04A 1MHPA 2ZT7A 3F8SA 3C6YA 4J07A 1Z6XA 4TTPA 5HEKA 1KDZA 4E7PA 4F8JA 1NI5A 1D1TA 1JFVA 2WSLA 1LTQA 1PWEA 4MR7B 5AKZA 1U1DA 3QE9Y 3AM1A 3NGXA 3EHDA 4PGGA 2A7QA 1MGPA 5DB4A 4URHA 6AT1A 5K45A 5KC8A 1NE7A 2WVHA 1KJYA 4B09A 1R0KA 4NMMA 4FFSA 1FSPA 2DSNA 1E61A 4RLHA 2G1PA 1E79D 4M0UA 2O14A 4A8TA 4D41A 2VH5R 1P29A 1Q44A 3P2EA 4OGFA 1UKBA 5EJ6A 2FWMX 3K70D 2NO7A 2J08A 1VIYA 1NSFA 5CM8B 4E13A 5EFOA 1DIOB 2QLBA 1BX0A 1DNPA 2Y1GA 6PFKA 1PI3A 2I9KA 5ALJA 2MU1A 1IMJA 4JIGA 1Z5UA 2EBHX 4OFZA 4AYXA 3EPLA 3N2LA 1YRAA 1JAXA 2A9FA 4TVKA 3RHSA 2F67A 1J70A 5HS6A 4EPXA 5L51A 1Z18A 1E5QA 2J3KA 3Q3EA 5DWDA 2JAXA 2FSIA 3RAEC 1RJWA 2DQ4A 3MUNA 1PN3A 1AKNA 3Q9LA 3CW2A 4H6XA 4CEHB 2QY9A 3ON5A 3GZTB 3GHYA 1TI7A 2Y68A 2AXEA 1V9SA 1S89A 2YXLA 2VLBA 4MR8B 5ELXA 2VUTA 1XPRA 2VYND 4AQYB 1USGA 2ZRAA 1QQ7A 2NQ2C 1CQPA 2HT1A 3R5KA 5E6UB 3LPAA 2G1KA 4LXHA 4AN4A 5DO9A 5FJJA 5KYGA 1QFSA 3SZLA 3M6WA 3MN1A 1CDEA 1KQNA 3G85A 1N8SA 4L3OA 3STXA 4YAUA 4PYMA 2GEFA 3B6IA 3QQ5A 4KNWA 4ZO8A 1Z0FA 4O1HA 1M2VB 2OZPA 3PKJA 3FI9A 3K1JA 1XRMA 1Z2CA 1GRCA 2QRHA 4U8HA 1SU4A 1L7NA 3GLRA 2OC9A 3VISA 2DOKA 2CJWB 4MZXA 2G77B 1V3TA 3FCSB 2JLQA 3CVOA 3JALB 3M2TA 5GV8A 2OBXA 5FDFA 1PUXA 1Z4IA 3TTSA 1ZNQO 5LPNA 2CNLA 2HIHA 3TZLA 4KXVA 1KOLA 3MLAA 4L8VA 4M36A 1YB4A 3T3MB 1HZJA 2VF8A 1D4ZA 3OY7A 5LJLA 3U3MA 3ORSA 4GM0A 2QQ0A 4OQNA 3EPJA 2RD2A 2WHPA 3C70A 4FSDA 4G9BA 4ZZ2A 2B82A 7ADHA 1U7OA 1MN6A 1XAIA 1C81A 4NFSA 1OILA 5D8DA 3RIEA 3WYGA 4AZSA 1M2EA 1UFRA 3K9CA 4DKXA 4EBBA 5HKBA 1VHDA 5IWAB 5GPBA 1F1JA 5JW6A 2PSHA 4D97A 2AZXA 1TUEA 1X9HA 2Z2ZA 3QLEA 1N6HA 2GUGA 5FYQA 3WGHA 1JSXA 4CIDA 2IU3A 1E2DA 4DQDA 1T5SA 1QU2A 1KYZA 2KHZA 4QBTA 5C7LO 4I6JA 2I91A 3DFMA 4KI0A 3EK2A 5AO9A 4C5AA 1MJNA 4JT9A 2MTBA 3Q0TA 1JU3A 1H0RA 1YQXA 2E21A 1Z8FA 1OXMA 1E1CA 1W6UA 2D54A 3R3XA 4M9CA 3ANNA 2TECE 3D8TA 2PZJA 4M9QA 3FIJA 3KOWA 3UJAA 2WYHA 2EFEB 5JZVA 2B4RO 2NU8B 3FPGA 3PHIA 1ULAA 4FUTA 2ACVA 2P6OA 3HV2A 3QENA 2PKYX 4MW6A 4RCZA 4X3CA 2Z5VA 4D9MA 3WLMA 1OZGA 3K9WA 4G5HA 2VHYA 2XEXA 4RBNA 1ILWA 2FB9A 1R6TA 1T91A 5EXSA 4BQNA 1G8AA 5F64A 2R0QC 1GNPA 3LLCA 2AEEA 2F3SA 2H7CA 3L6UA 4V39A 3TB4A 3AETB 1KO5A 1ZRNA 2A0FA 2WFLB 2EKLA 2JFGA 3EXIB 3LLSA 3UJDA 1L6RA 1LSSA 1RWNA 2PUWA 2YRWA 4MRAA 1ISPA 3H2ZA 3F7TA 3DA8A 1P3Y1 3WWCA 1VJDA 1E1MA 1OLXB 3U7GA 3QLVA 3ZY4A 3DQPA 1DSSG 4KL8S 1E5XA 3KYDB 4TWRA 3JATB 1K9SA 3WRWA 2LCFA 2P4SA 4WLOA 3ILSA 1PHRA 3I1FA 2UVQA 4Q16A 4U7JA 1P3JA 2WSSA 1CJMA 3FUVA 4FDLA 3K09C 1TQDA 1BCRA 2OHGA 3W5BA 2GPNA 1G7RA 1V41E 3IR7A 3T9EA 3U4HA 3ZDBA 5BSMA 4RO0A 2PMBA 3TDMA 2JBAB 2ODTX 3BQNB 4IWYA 4B2IA 1SOAA 2JS7A 4YCCA 4KQGA 1H94A 4I4TA 3CS3A 4US0R 1E8MA 3KOMA 4YRAA 4G5XA 4P34A 2J3QA 3Q3CA 1JDJA 5CYFA 2DECA 2C94A 4LJ6A 4CODB 5L3QB 1X2EA 1WSAA 4P8RA 4ENQA 5H0IA 1KK0A 4V24A 4OMUA 2CDAA 3LV8A 4PZAA 2R7MA 3PT5A 4QREA 4R2JA 5EQJB 4UEWA 4D25A 1UM9B 1I8TA 3GOQA 1HT2E 2UUAB 4Q15A 5BYBA 3ONEA 5LMCA 2EZUA 3OFNA 1K8QA 2JARA 4PANA 4WXYB 1EIZA 2CUZA 3WL4A 3QMVA 2LD4A 5I9MA 5AK6A 4BEVA 3CSSA 1DEHA 2EGUA 1WA5A 2DFVA 3EFOB 4AS2A 5AW9A 2PEYA 5B64A 2GO7A 3FUTA 3W9YA 4M6WB 1Z07A 4TSKA 4WXRA 3KKKA 4X1YB 4TYWA 1RM3A 2AX3A 2P2GA 1BEUB 4K8RB 4II3A 4QGFA 3TM4A 3UJBA 1E2NA 4IIBA 3QWIA 1TEZA 2NG1A 3NLLA 2ZJFA 5KI6A 1E0DA 3VR4A 4TMXA 1WHSA 2OAQ1 2RONA 2VDPB 2AC4A 4WBNF 3L7OA 3QBEA 2CN1A 2QX9A 1J0DA 1PL6A 5KOJA 2DWUA 3CZPA 5CK5A 4EY4A 4YCMA 1LW6E 1MJHA 3R74A 5KWIA 4B43A 1CYEA 2I6GA 1P4JA 4MV1A 3F4KA 1JZQA 2DTDA 1IK6A 421PA 2PEZA 5I7SA 5IX8A 1LH0A 1CEEA 1H65A 2PSSA 3E0QA 4WQMA 4ZI7A 5EKUA 3W5HA 1RXWA 1NX9A 3NWOA 2QRZA 1VSTA 3RGWS 1W36C 4BX3A 3PHBE 4FDAA 4F4IA 1G7SA 5B4UA 5BOSA 3DTVB 3CB2A 4Z0HO 3T7JA 4CF6A 2YYZA 1QR6A 4FPXA 4X45A 5A4JA 2CLOB 1A76A 5DHSA 5LBTA 3LYLA 1TM5E 2GEDA 2IEAA 4AWAA 3CA8A 3S8EA 1BKSB 3LRPA 1O4WA 5ITZB 1HRKA 3B1YA 1Z5PA 2PV7A 3V33A 3KFLA 6REQB 1Z7YA 3LQQA 2HFJA 1E9CA 3MYRA 4D3FA 1FRZA 4N0QA 2EGGA 2NVWA 5JI3E 1TCCA 1CRZA 1YUMA 1WLSA 4JXKA 4XDHA 3P4XA 3AHEA 3NEPX 2BKUA 1MG0A 3ENNA 3VDNB 4FGZA 2X5JO 1U8EA 2QZ4A 2NZ8A 3O47A 4XA8A 3MM4A 3KUCA 1HOTA 4GVXA 3HJCA 1I30A 1FS6A 5D7BA 3PQ7A 3MWFA 1XXLA 5EJ8A 5IJ9A 3EWNA 1HPLA 1OZFA 2KLHA 2OO5A 3LXXA 1KDYA 2ONZA 5IVIA 3WLTA 4A26A 5BVHA 3EZNA 5GGYA 4F4UA 1JZSA 3H6KA 1B73A 4EFDA 4UMFA 3AW9A 3EE6A 2BY4A 3OFVA 5G0UA 5FI0B 1KL7A 2PXHA 4HEHA 4XTRA 2IHTA 4ISCA 4DLYA 1TCBA 2P9TA 1DIBA 1Q7GA 3KTAB 1LBIA 3C2QA 1UPXA 3F74A 1Z5GA 4MYHA 2GETA 4JVSB 3L18A 3ED1A 4PLVA 1OX4B 2JATA 4C5CA 5IKPA 2ETVA 1SUWA 2AUMA 3GDGA 3Q88A 3KAQA 4KN5A 4K9RA 2VHEA 5CT6A 4R3NA 1S8AA 2LVBA 5D00A 5EINA 4J0GA 4F12A 2B99A 1SURA 4JOCA 4F38A 2GRAA 2IA5A 4C0AC 3HLYA 3B6ZA 1OT3A 2QRNA 1IK4A 3BD7A 1CS0B 1U80A 1U2PA 2V4ZA 1FVHA 3Q1LA 1P6QA 4ZVSA 5JY6A 1QTRA 1ICEA 3UCEA 3U39A 5IFLA 2ZRFA 3G68A 4KGDA 1FNBA 3TMKA 4G5SA 3AVVA 4TTQA 3DBHA 1G20B 1ST2A 3D7RA 3AFOA 4O4JB 4Y2SA 2JGLA 3PNLA 2E55A 1VHTA 4RS4A 1Q19A 3IPRA 1H5UA 4L27A 4RD1A 5AP9A 1LLFA 3UFXA 4AZTA 4U7FA 2J09A 3L6RA 4B82A 2YINC 3TGLA 5K0CA 4ND4A 1TEHA 2E4XA 1JTVA 2GZ3A 3E22A 3ENVA 4OHVA 5HKKD 1E4EB 1ZLXA 2OHXA 1UMBB 1GGVA 2IOQA 1YACA 1CIVA 2YS7A 4UJ5A 4EKDA 4GS5A 3CH7A 1AGRA 4CF4A 4AY4A 2NV2B 3BE6A 1BQ4A 2V45A 3TECE 1QOQB 1OLOA 1U2SA 3CISA 1NLYA 2L42A 3AJDA 1EAYA 4YDSA 4BMCA 3KKOA 3TLYA 3ADDA 4WFQA 4XSHA 1R4NB 4MDFA 3REOA 4JYAB 3EF1A 2P77A 3GHHA 5FTKA 1SEVA 3T7KA 3KT0A 1G66A 2NPFA 2B8EA 3TTTA 2FRDC 3WL3A 2D7DA 2GASA 1NJGA 3AF1A 1QHNA 1H2EA 1RIIA 2PSEA 2VT7A 3MJHA 5UKDA 5FPHA 3UJ8A 3HZZA 3CVJA 2AZDA 4PZ0A 3ZWNA 3TGWA 4AC9A 2FQ1A 2G7ZA 1ND6A 3QG5A 1FQOA 1IC6A 1MC5A 5JANA 4Y9DA 1JPUA 3M6IA 4N3BA 3OPYB 4YMUA 2ZB2A 1AD2A 3EQ9A 3I58A 4GYJA 3SM3A 3WQRA 4XIIA 1SUFA 3IIIA 5LP6C 3QPDA 2HSZA 3SAJA 4F92B 2XNKA 1GQYA 3A0RB 3B1JA 1UPAA 5ERYA 3TIIA 3DZCA 1BAPA 4KO1S 2WQ7A 4Q9DA 3TIFA 4M0FA 1L4EA 3GFPA 3Q8LA 3X1DA 1XTQA 3ES9A 2XIJA 2IVZA 1U4NA 1WTAA 3AWDA 1SXJD 2XQJA 3K0AB 4M1MA 4Y2RA 3S2IA 1ADCA 1D7OA 2FJ0A 3KYCA 3EXAA 3NBMA 1FQWA 4ON9A 1G8YA 1EQUA 3KLBA 5CAEB 2XXAA 4HYYA 2BEWA 3FSGD 4DLLA 3PX2A 2GBIA 3ETCA 4JOBA 4NU5A 4OP3A 1JYFA 4IJWA 3AYZB 4PLWA 3A6PC 1MORA 3