2RGGA

Crystal structure of h-rasq61i-gppnhp, trigonal crystal form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
159
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transformation Efficiency of RasQ61 Mutants Linked to Structural Features of the Switch Regions in the Presence of Raf.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein
molecule keywords GTPase HRas
total genus 59
structure length 159
sequence length 166
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rggA00
3B60A 3BS4A 3SFVA 2KE5A 1XB2A 3EASA 4GP6A 2IYYA 2YV5A 1XNJA 4UNSA 4EJSB 3FOZA 1N6RA 1QHIA 3K53A 1SHKA 2PX3A 3THYB 2VBCA 5AUQA 2HCBA 2NO9A 1OXTA 4DUGD 3GQBA 3OEEA 3SJZA 2RGNA 1KAOA 5DI3A 1Q3HA 2RGDA 3I3SR 1YJ5A 4BEBA 2B92A 2IHYA 1COWA 2IYWA 2CLCX 1FQJA 3CNOA 1ETUA 3NEYA 2ZU0C 2FSHA 3THXB 3AVTA 2FU5C 4DEXA 1Y3AA 1FTNA 4DSTA 3AEZA 5FUWA 3ZZTA 1H8HD 4B71A 3IHLA 3HWSA 4UNPA 1IOZA 1ZCBA 1OB5A 5JJIA 1MO3A 5TB5A 4YDHB 2GILA 1KI9A 1YRAA 3IEUA 4Q7LA 1F3OA 2VSFA 4R7ZA 4FWIB 2REBA 2ZUDA 4TYQA 1EX6A 2PEYA 4RCZA 1WBBA 2I3BA 4DEYA 4UNRA 1KMQA 2GKSA 3OEHA 2D2EA 4HLQB 3MUFA 4GT1A 1E2FA 1XD9A 3BAFA 4PQRA 5FR1A 4I1OA 4AKHA 4HLUA 4XSHA 4C4PA 3N2EA 5DN6A 2BKUA 2QROA 1XMSA 3J81k 4DXAA 2IUUA 4DCVA 2F3RA 1DADA 3W3AA 1XXHA 3L43A 4MGKR 2WJIA 2XJ9A 3M0EA 4RSGA 5LBIA 3NHBA 1KDTA 5JHGB 5FPTA 1YE8A 3AVPA 1A82A 1G16A 1U98A 2FGJA 1NMYA 3R9XA 1T91A 3FKQA 4LI0A 4QRHA 2NO6A 1OHHA 2V1UA 2C9CA 3RS4A 5D3MB 3LAWA 1IONA 1T6NA 4GZMA 4JMPA 4PX9A 2IXEA 3WXMA 5EXPA 3WHKA 2EFEB 3PCRB 5HPYB 4LBZA 1CJMA 1T4GA 1R4AA 2OLJA 3GLGE 1NKTA 4YONB 5DH9A 3PV0A 1EFTA 2XNDD 4DSUA 2AX4A 1N6OA 2ZI5A 1KJZA 1ZNWA 4PZLA 4URUR 3QNUA 4YMWA 5JJKA 2CJWB 4DLVA 2KBEA 2F3TA 3B1XA 4IRUB 1S2MA 2D06A 2GCOA 1S9HA 1CJUC 2ZSDA 2HUPA 3KTAA 4HAXA 2BBSA 2EFGA 2DPXA 2V7QD 3QJYA 4U5XA 4DHEA 2GJ8A 3QENA 3SHFA 4Z8YA 3ZS8A 1RRPA 3EZ7A 3FKSA 4TTRA 4R9UC 1G7TA 2VP4A 4FIDA 4IVRA 2AWNA 2QPOA 4OHXA 4A2QA 3A1VA 2IWHA 3KZ1E 1GNQA 4LUCA 2XTMA 1WB9A 3JVVA 3A4MA 4B6FA 1RPZA 1UDWA 2ZSEA 1NLYA 2Z4SA 2H8KA 4JBYA 1GRRA 3W5JA 1KYIA 4KBGA 5KSPA 4M1WA 4B3XA 2P5SA 1VYTA 3FYHA 4QKQA 2V55B 1F60A 4OQNA 4QXAA 2GWHA 4MGZR 2CJWA 5FUYA 1G8HA 3RSOA 1UKYA 2VHJA 4US2R 4LBYA 1OFTA 2QORA 4FMCB 3EWAA 1W5SA 3CRW1 3EPJA 1E79D 2ODBA 3QF7A 2X1VA 2PBRA 3E5HA 1OYWA 3I4LA 1KK2A 1T8UA 3FE2A 4QGFA 3K0AA 4LHWA 3K0CA 2FJUA 4NTZA 2GCNA 2VSXA 2ZRLA 3QKRA 4H9GA 1E69A 4BZPA 1OH8A 1VCIA 5DSZA 3CPJB 4ZDKA 1HYQA 2CHGA 2JLSA 3TUZC 5C46F 1OXUA 2HF9A 3UG7A 2G0NA 1YHNA 1UEIA 2RKOA 5DISB 1BS1A 2WAXA 4Q4JA 2HF8A 4OKSA 3AQ4A 1E1QD 4JBWA 2RAPA 1V5WA 4CZ2A 3OE7A 1JXOA 3AVVA 4URWR 1OFHA 4A6XA 1JB1A 5M04A 1GITA 3LX8A 1LS1A 4C2UA 5F98A 1G4UR 1ZIPA 2ZYVX 1IBRA 2ZEJA 4Q18A 1TAGA 4BLSA 3ZYCA 4BFSA 5KU1A 1W47A 1XEWX 1N6KA 1NVWQ 1QHGA 2IS6A 1OV4A 2DFNA 3F5FA 5E7IA 4NYIR 4RZ3A 2N42A 4U7DA 1XPOA 4E22A 1C4OA 1ZBDA 2V9PA 2V6IA 2OFXA 1AA9A 3X1DA 2YOFA 2GAAA 4M21A 2AK2A 1N6PA 4TYNA 2NGRA 4DB2A 2QTHA 1JR6A 1WCV1 1FFHA 5EP4A 2W2TA 4LBVA 4DLYA 1ZJ6A 2FZ4A 2JCSA 3LH5A 2ZSAA 3OZXA 1Z5ZA 3QKSA 4Q1FA 2RGXA 4NZYA 3U44A 4GBMA 2QMHA 5KNCA 1N3BA 2QMOA 3IPYA 3ZS9A 1ZRHA 3PEYA 5F2EA 1EFCA 1GVNB 1AIPA 1AKYA 1E9DA 2AR7A 1KIMA 1QHNA 5FUVA 2F43B 3ZQJA 2MMCA 3PIRA 4MYTA 2QSZA 1GP2A 4TMVA 2N46A 1NBMA 2WWYA 1J8YF 3TQCA 1TU3A 3KB1A 4QM6A 1NN5A 1P2VA 2ZRDA 2ZVQX 1NN0A 2Q3HA 4DC9A 2QMEA 4I4LA 3KQNA 1N5IA 4CEIA 1XMVA 4KSCA 2V6JA 5D3QA 1UKZA 2QTVB 3MRSA 4PO1A 3PVSA 2ZJBA 4DJTA 4PSKA 3EIEA 4AI6A 3GLHA 2XNSA 1BMFD 4F93B 2I1VB 2C98A 1G8PA 1ZNXA 1JI0A 2EFCB 4BE7B 1CRPA 2QA5A 3EWSA 4IW3B 3AUXA 3OFND 5GVSA 2ATXA 3CF2A 4FW9A 3RAPR 4Q4LA 1KMHB 1VG9B 2ZRIA 4KLZA 1BMFA 1AGRA 5TV2A 4ASUA 3TAUA 1Z07A 1UKEA 5FOWA 2A30A 2P2LA 2W2XA 4N0EA 1RYHA 1N0WA 2G3YA 4QNRA 3ND9A 4B2PA 4V02A 2QG6A 4V0ME 3TSOA 2FSFA 4TQAA 1IXZA 3CKLA 3LBHA 2GJAA 2G83A 4C0LA 2Z6VA 1JR3E 3QIAA 1HT1E 2QAGB 1KKLA 1G9XA 2I4IA 3BB1A 1P3JA 1OFIA 3QUSA 4ZDJA 1E4VA 4Q9KA 1TL7C 1E2EA 2GXAA 1R0XA 5JSZA 3QPVA 5HTKA 3T1OA 2O0HA 3A36A 2JJ2D 1NIJA 2B8WA 5EE1A 2AD1A 2F1JA 5J4HA 1I4TD 2GHIA 2YOGA 2QNRA 4DZZA 1XD2A 5F9HA 3DMNA 2ZXUA 3MJRA 1T0JB 3BGWA 1AQUA 221PA 1G64A 1YZKA 4TLCA 4EPYA 3M1IA 3CPEA 3NHAA 5HCIA 4HUQB 1QHXA 3RANA 1TUIA 4MUAA 1P2SA 1PZNA 1TADA 4IDQA 2GJSA 3KQKA 2C9OA 5JWHA 3TR0A 1RIFA 4P0TA 2OEPA 4BUJA 1MRSA 3A4LA 2Z0MA 3S1AB 4F38A 2YC2C 2FH5B 2GCOB 1TPZA 2I1QA 3HPQA 5FBRB 2QT1A 3NBXX 2WWIA 2XXAB 2NPIA 3BXZA 5TY0A 4LK2A 5B58C 1Z6GA 1II8A 4BEJA 1TTTA 3DVLA 5TDHA 2IC5A 2RMKA 4Q00A 1ESMA 3OF5A 3BE4A 3ADDA 4OYHA 3R20A 4OHZA 1XJCA 1Z0AA 1Z0JA 1G8GA 5AJYA 3K70C 1GIAA 1U94A 5CIWA 1L4YA 3R9IA 2GEDA 4XSGA 2A5DA 5HE9A 1DOAA 4JJZA 1SVIA 1XEFA 2A5FA 1OYYA 2EW1A 2VP9A 4HAUA 2WWFA 5DYIA 3O8CA 3H4MA 4ACBA 4D6PA 4D25A 3FHOA 3LVRE 5JMTA 4LYHA 4BFXA 3Q8XB 3B5JA 1Z29A 2FG5A 4JVMA 2Q3FA 4KO8A 2RGCA 3NBFA 1TF2A 4UXIA 1H65A 5G3YA 3W6OA 5A4JA 1MH1A 2VP0A 4MGIR 1X3SA 4L9SA 3SI7A 3F3YA 1TQ2A 4HB4A 4TMWA 5CM8B 3DMDA 4URZR 4B73A 1XCPA 1E9SA 4B75A 4JYBA 2F55A 2OCYC 2FFAA 2ZAMA 1F2UA 1XRJA 4WXPA 3TKLA 1F6BA 2YOHA 1Z0DA 3IGFA 4LJ5A 4BASA 4BZQA 1KI3A 3A37A 1NG9A 4AYWA 3OAAA 1S3GA 3UWOA 3NC1C 4JKYA 2ZRAA 3EX7C 2GK6A 1MT0A 3T5GA 1IN5A 3WP1B 3KJGA 1YVDA 3GEIA 3NC0C 4LYJA 4Q5IA 2JLZA 1QF9A 3GCGA 4EPWA 4NKRA 3TUJC 3IQXA 5KPDA 4RZXA 3FHCB 4JYCA 1TEXA 4KYUA 3LNCA 2J7PD 1M7HA 4IJMA 4W5JA 1YR6A 2ASEA 2ONJA 3NWJA 1QDEA 2ZREA 3SU8A 3QKTA 1KI6B 1HURA 4CEJA 2A9KA 1GZSA 1N0VC 2RGEA 3PUXA 4BLQA 2OLKA 4JLMA 1Z3IX 2D3WA 1XU4A 1RRFA 2G6BA 1Q1BA 4P4UA 1QHSA 3SFZA 2XAUA 4BFZA 1N6NA 1BO6A 1N25A 3V9PA 4PC7A 5HZHA 2HLDA 2DCUA 2MSDB 2QE7D 2ZVPX 3FMFA 5DLQC 3VR2A 3B82A 1CR1A 1MO6A 1ZD9A 2BEKA 1XZQA 3BERA 4PAMA 2KWIA 4GOJA 4M9XA 1XPUA 1MO4A 5JWOA 3QEJA 1A1VA 1K6MA 3D3QA 2OILA 2ZRCA 1OB2A 4G3XA 4GL2A 4P3YA 2IS4A 5EP1A 821PA 1E32A 4GOXA 1N5LA 4PZZA 4LHYA 2HDNB 3RC8A 3VX3A 5EE3A 3FHTA 2EQBA 5J4YA 4KAXA 5KOYA 2VF8A 2ZI4A 1XXHE 2A78A 1E2HA 3L8YA 5FTNA 3ZIAA 4F92B 2NOAA 3MGCA 3LLUA 2F1RA 3MAAC 4HZUB 4H1UA 1KSHA 3EC1A 2C2HA 1Y63A 2HCJB 3RS0A 2BJWA 2J59A 3QXHA 3DO6A 2CEAA 5C1BA 2IBMA 4ZDWA 1ZD1A 2PLRA 4E5UA 1CR2A 3T15A 1PUIA 2YWEA 4O0MA 4IDPA 2ORWA 3GLFA 1HV8A 5DHAA 3GLIE 1NY6A 3PR1A 3V4RA 4L8GA 1LV7A 4A9AA 3ADCA 3LW7A 2W0SA 2FV8A 1E1RD 2P3SA 2R65A 3SJCA 4B3GA 3ZZUA 1RW4A 2B6HA 1G3UA 4IFEA 1G1MA 5TXGA 2CL7X 1YR9A 2RH5A 3GJ8A 2X8AA 4ARZB 4B34A 4P4SB 5FH9A 2V4ZA 1Z83A 4WAUA 3U5ZB 3D8BA 1RZ3A 2N1BA 1II8B 2QAGA 1GAJA 4OQLA 3WNDA 5KDDA 5JZVA 1UBFA 2XXAA 4KFTA 3IIMA 3TVDA 4C7OA 1DAFA 4RY2A 1JAIA 1YZQA 2FNAA 4DSOA 4A0GA 4MKGA 4JL5A 4AC9A 4HB2A 1KTVA 3Q7PA 2WOJA 2HYIC 3EA5A 3AP2A 3V4FA 2QP3A 1ZU5A 2R62A 4DDVA 2R9VA 1IM2A 2DR3A 2GK7A 2HJVA 3AP3A 5FTKA 1E2PA 1N5JA 1SGWA 4MRVA 1U0HC 1UADA 3VR6A 1P4SA 3ZZ0A 1QZXA 1I2MA 4Q7JB 3LXXA 3CB4A 1R5OA 2JJ1D 2NIPA 3CPHA 3SJBA 1ZVQA 3CRQA 4W5WA 2IF2A 3QOFA 1NNEA 1FP6A 2ZROA 3UKDA 4Q4JB 5K8UA 5EE0A 3D7MA 4JL6A 3WMEA 4PAQA 3X1XA 1NLZA 3TJZA 5AUNB 2QGNA 4Q9LA 1MO5A 4DLZA 1WE2A 5JCPA 3LX5A 3U2QA 4B48A 1QHHB 1E9CA 1JECA 4N3NA 4RFSA 1WP9A 2H92A 4ZKDA 1M8PA 1SXJB 4US1R 2ERYA 3QXXA 3WMGA 3NIBA 1A7JA 2IA5A 3T1TA 1IHUA 1SKQA 2O8FA 2VA8A 3P4XA 4KFRA 4P32A 4PXAA 3UMRA 4IOMA 1E2KA 5EUQB 4TTQA 1ONBA 4I1SA 1XD8A 1ZUHA 2ZI9A 3U3MA 1W0KD 1UBCA 3GJ3A 3L0OA 1X6VA 4PC6A 4LY6A 4K46A 1RKBA 1KOFA 2CE7A 4QOSA 4Q4AB 2NMVA 3IEVA 2GBLA 4B6EA 1VG0B 3W6NA 2O5VA 5E3HA 1CEEA 4PO9A 2WV9A 4ABYA 1V43A 5TMPA 1ZW6A 3NTUA 2ATVA 2EWVA 2GXSA 4MKIA 5ANRB 4HEJA 4BLPA 4M4SA 2CHQA 2QQEA 3LQRA 4IXMA 4YLGA 2BBTA 4JL8A 3UG6A 1VKJA 2VHQA 1R5BA 4KLNA 2WSSA 1VTKA 3L0IB 3CRVA 1WMSA 3I73A 2GJ9A 2ZIAA 3VU9B 1LTQA 3BWDD 1NMXA 2PJRA 4PHFA 1T8TA 1NI3A 5BYKA 2PX0A 3IQWA 1E9BA 5JSZB 1XJQA 4FCWA 4C0JA 4AIIA 1KI4A 3DOFA 3WRXC 1E1RA 5CB6A 4BPBA 4Q66C 2AFHE 2PZEA 1G18A 5KSOA 4EPVA 3C16C 5CJ2A 3U60B 3DEFA 3OE7D 2ZI3A 2ZJ2A 1HUQA 5FTJA 4MRRA 3BH7A 1W1WA 2PL3A 3C15C 1S8FA 2YJTD 5J4VA 1X8JA 4A0FA 2GXQA 2RGBA 3K0AB 2F1HA 4BLRA 4BFWA 4PTLA 5KYKA 4EFNA 2R2AA 2FMXA 4PSAA 1NN3A 4YXWA 3SR0A 2XGJA 4BFUA 1XEWY 1XTSA 3NDPA 5GJBA 1HTWA 3O8BA 1J99A 5CDFA 2YINC 5SZIA 2OM2A 3HU3A 5LD2B 3K0FB 1S1CA 2GF0A 2OT3B 1RRCA 3RABA 2YHSA 4CVNA 3EG5A 1FW6A 2WJVA 5HKKD 3CRRA 2DHRA 4HB3A 3Q72A 2P6UA 2WKRA 3T12A 4BZXA 3QVVA 1GG2A 2D7CA 3H0KA 5EXTA 2H5EA 5FPYA 4Q48A 2A5JA 4B35A 3RC3A 4WXRA 2IXFA 3CX6A 1W2GA 4JBXA 2WTUA 2GAOA 2QI9C 4B43A 4TL6A 3DKPA 3ZH9B 3CNNA 4A1FA 4BFTA 4XWKA 2O52A 1P2UA 1OE0A 3K9GA 3RWOA 2QT0A 5FBVB 3K9LA 2NZ8A 5J47A 3GJ5A 2QPTA 3MWKA 4NHOA 3SYNA 5E4FA 1DAHA 4BGDA 2WOOA 2Z4RA 1SZPA 1Z2AA 1J2JA 2QL6A 1GKIA 3KTAB 1FZQA 2H17A 1Z0IA 4HAYA 2D4HA 2OSBA 4DKXA 1KNXA 4Q7MB 2JATA 4JLJA 4F7WA 1E2QA 4WZBE 2HXYA 1U2RA 2ZS9A 3P20A 4DDWA 5JBQA 4WIAA 3THYA 4RVCA 1U8ZA 1KO1A 2IYTA 4HDOB 3A6PC 1FMJA 4II7A 4AY2A 2OESA 4WA7A 4FMBB 4OI0A 4IVQA 4AYTA 1XCMA 2WWHA 3TRFA 3ZGXA 1FOEB 3EA0A 3THOA 4Q4AA 1E9FA 4MYUA 1US8A 2WJYA 3PENA 3ASZA 5H8WA 4RD4A 3U7HB 4HSEA 1FNMA 3REGA 3FVQA 3PUZA 2P6RA 3B1YA 1WXQA 3FMOB 5IK2D 3CZQA 1U81A 3VQTA 1KY2A 1OHHD 3BB4A 5JFGA 3Q85A 5E7JA 3TW4A 5JI2E 1DG3A 1G20E 2Q21A 4RKEA 1Z28A 1KHTA 1OW3B 3KUCA 2O0JA 3U7EB 4V0OA 4Q9HA 3DOEA 4HI0E 4JLOA 3EZ6A 5EE9A 5B30A 4QNMA 2NO0A 5HKKA 3TLXA 2CCKA 3SHWA 2BIFA 2CVHA 4XWAA 1X8LA 4KFSA 2AD5A 2HV8A 4LZZA 2Z43A 4M1OA 4EPTA 1U99A 3KL4A 1UEJA 4DCTA 1JR3D 2AKAB 4PSVA 2V1XA 4IOLA 3ND8A 3RVBA 5C4MA 4IVPA 1NLFA 2IX3A 3B1ZA 1ZUIA 1SXJE 4EAQA 1Z6YA 1KO4A 2SHKA 2BCJQ 1LW7A 2WWXA 3B8HA 1W46A 1EK0A 2ZR9A 5CITA 1U9IC 1AZSC 1GOTA 3RHFA 2IW3A 4Z54A 3I92A 1Q3TA 5L3VA 3I8SA 2GZDA 3BFXA 3ZJYA 3A8TA 4MUBA 3SEAA 1SQ5A 1W5TA 2J41A 2OXRA 1VCOA 4LGMA 2RGNC 3Q5DA 3AVYA 3WNCA 4RD3A 1E2MA 2BVNA 1E98A 1BKDR 1HE8B 4KHZA 4ZCMA 4NMMA 4JVNA 3AV0B 1R0YA 4JVSB 4KBFA 4TMTA 3QXJA 5G3ZA 3A1TA 2QMUA 1Q22A 4Q47A 2FEMA 1UAAA 3CBQA 1CBUA 3HYTA 3CWZA 5J4KA 5L3SB 2G1KA 1W0JA 3GFOA 1P62B 2XTZA 4Q1CA 4D82A 2C95A 1E99A 2B21A 1M7BA 5JS7A 1J70A 3UIEA 3H84A 2P65A 2IUSA 4N0DA 2V8OA 5JS8A 4UXJA 5JLJA 3OAAD 3QVUA 4A82A 3H2YA 2Q9BA 5TARA 3KB2A 1ZNZA 1NF3A 2GTPA 2OO7A 3U3RA 4LJ9A 3SYLA 3VHLB 2G77B 5GADl 3U6BA 3U3KA 2WPDA 4PQFA 1YRBA 5FBQB 1ZM3A 1AS3A 2BMEA 4JLVA 4TSFA 4E07A 2IYVA 2OG2A 2QM7A 4TMZA 2KSQA 5KHOC 3UPUA 2C9YA 3GLHE 2GF9A 3VNUA 1OSNA 3GJ6A 4GNKA 4LPKA 3TVTA 1I4LD 4B2IA 1W4AA 4TLDA 3UMSA 1KI1A 2CK3D 1OIXA 2A7QA 2A3RA 1IY1A 4RFSB 4J0QA 1EFHA 1MRNA 2ODNA 2YYZA 2LKDA 5FPSA 1MV5A 1RVDA 2J1LA 2PH1A 3CONA 4PQYA 2PZFA 4HAZA 3K9HA 4B47A 2IXGA 2YVUA 3PG5A 2R6CA 3QPUA 4GP7A 1WDTA 4H1VA 3VHXA 4MDEA 4HZUA 2ZTSA 2DFTA 3K0CC 1IAQA 5FOVA 1NJGA 5FFMA 3KXLA 4HYYA 1A2BA 3SZRA 2ZRNA 1OIWA 2HXSA 1Z22A 1KAGA 3TH5A 4I81A 2J0UA 2ODEA 3LXRA 4OK3A 1R0ZA 1GL7A 3LFUA 2IYSA 1JQJC 3R7WB 3T34A 4Q9IA 2J87A 4KV9A 2O0KA 4LJ4A 4OHWA 2O8CA 4EQ6A 3WYFA 1JNYA 1P6XA 3GJXC 5B57C 1GNRA 1S4QA 2Q6TA 4G0NA 4L16A 5SZKB 1J7KA 2ZS7A 4KYIB 1FX0A 4M9ZA 1E0SA 1EFUA 5FR2A 1E4YA 2OCBA 3WNBA 4P4SA 4MITA 3EW9A 1DE0A 4TLAA 4DLRA 2O8BA 4OBEA 1AGPA 2P67A 3B1WA 4LJYA 2OFWA 5SZHB 2VQSA 1KI2A 3BORA 1XD2B 4Z8XA 1OF1A 4QGAA 3QI2A 2VO1A 3L2OB 3BC1A 4S2EA 1Q1ZA 2NG1A 2YWGA 3TW8B 3DPUA 4OHVA 3JVUA 4A0HA 2GJKA 2AWOA 3AF4A 3PQCA 3Q3JB 1T0HB 2GA8A 5C4GB 1CXZA 3ZDQA 4C0BA 4DT1B 1BIFA 121PA 2ERXA 2H16A 2J45A 1ESNA 2Q3MA 4TQUS 5JEEA 3IILA 4TZ6A 4Q19A 4A4DA 1W48A 4G5RA 1VG8A 2AN9A 2OFOA 1ZNYA 4M1TA 3WHLA 2ZAOA 1GL9B 1UM8A 4N1AA 3FPAA 5EZ6B 2ZM5A 4D0NA 4LYAA 1T9HA 4XD7D 1LY1A 2CCGA 4IKEA 2QGZA 4LOAA 1ZIOA 4P33A 3DDCA 4HZIA 1OH6A 4LJ8A 3HR7A 5FTMA 4DIEA 4RD2A 4XVQA 3V00A 1N2CE 2CL0X 2J7KA 3WBKA 2VEDA 2WJGA 4HB0A 2WPDD 2WJHA 1PJRA 2WWGA 3F0TA 4DLUA 3O47A 4FI3C 4ACAA 2REXB 4EPRA 1JQLB 3KKMA 4TMXA 4D0GA 3SDZA 2RB4A 4Q21A 1G7RA 1XTQA 2GZHA 2ZJYA 1CTQA 1JBKA 3TK1A 4AWXA 4B3CA 3NXSA 2ZR7A 3NH9A 4G1UC 5C18A 4JIMA 4WZAE 2BMFA 1I2DA 1NVVQ 3SYKA 5CLLA 4P31A 2ZJAA 4B3FX 1SVOA 1PVOA 3PEUA 1D6JA 3LLMA 1NBMD 2GVDC 5TVKA 3X2SA 2GRJA 1CS4C 1G7SA 3B1VA 1GL6A 4KVGA 3CUEF 1KK3A 3CH4B 2UVQA 2XTNA 4TSFD 3THWA 4EJSC 1G6OA 2OXCA 1EESA 2W58A 4HLUC 1AQYA 1UBEA 2GEVA 2Q0HA 2DFKB 2TMKA 2QN6A 1TQDA 2H57A 3DM5A 2IYUA 1YR8A 2VTKA 4YMTA 1KSFX 1US8B 3MJHA 4NCIA 4U02A 3WP0A 2LWIA 3A1WA 2NO7A 1TUEA 3AKYA 4HAWA 4Q01A 2O8CB 3ETLA 2HJGA 1NKSA 4JKIA 1G291 2IS2A 2ZRPA 4DDTA 1YU9A 3VR3A 4A8JB 1XEXA 5BWMA 3SQXA 1TEVA 1PUJA 5K8LA 2QP4A 4MRSA 2FDCA 4NPHA 4DIDA 3B13B 4QG7A 1R8SA 2CVFA 1DG1G 3CNLA 4QC2A 3VKGA 1A5TA 2ZE5A 2J0UB 4BQSA 3N2IA 4G5SA 3QF4B 5IT5A 1SVWA 4TMKA 1RRGA 1OPXA 2GESA 2KI5A 1KSGA 3EC2A 3I72A 2EVWX 5EUMA 4ZKEA 4AKIA 1S96A 3ADBA 4DCNA 2PMKA 1DVRA 4JSTA 2O8EA 1Z47A 2EYUA 4JT4A 4NYMQ 1NSTA 1RYFA 3C5HA 1E3MA 3RRYA 5A5GA 4NCNA 2C78A 2P0EA 3A58B 3P1JA 4ZI2A 3MMPA 1E2GA 1DELA 1IN4A 2ZETA 4S35A 1EG7A 4QGHA 4US0R 2G88A 3LD9A 1GFIA 3AVUA 1OLOA 4RJLA 3SC3A 2GETA 1KSJA 3BIFA 1CR0A 3LBNA 4OK6A 2R6AA 4Q1AA 1R0WA 4PC3A 3KQLA 4OI4A 4KFUA 3UANA 4MRNA 1KDOA 1IN7A 2AL7A 4JLAA 4Q03A 1DEKA 2FE4A 1KI8A 2AFIE 1DS6A 2P6NA 1F48A 1KI7A 3R8FA 5FL3A 1AS2A 3D31A 3LO5A 4DRZA 4BRWA 1C9KA 1MOZA 3FDIA 4EKDA 2PCLA 2EYQA 3FFBA 4TYPA 5BN4A 4K8OA 2JA1A 3BRWD 3VMFA 3RS3A 4GFDA 1T3SA 4RZUA 4F4CA 1TU4A 4CEIB 5LB4A 1IN8A 2WM9B 1XTRA 2ZITA 1W4RA 4C0QC 2KB0A 2J9RA 1M34E 5L3SA 4C30A 3THWB 4TZ0A 1GUAA 1L8QA 1TF5A 1WQ1R 1YQTA 2EWWA 2QU8A 4JVLA 3FTQA 3KUDA 4GOKA 4M22A 3AVQA 3OESA 3BBPA 1S0UA 1CJVC 1KK0A 5EZ5A 4OQFA 4MDFA 3N70A 1CRQA 3MLEA 2XJ4A 3U7GA 1AN0A 3L8ZA 2IK8A 4IOJA 1EGAA 4Z51A 3IO5A 1VYVA 1H8HA 1YKSA 4LV5B 4O2RA 3QG5A 2AKYA 4PO8A 4RKFA 3O8RA 3BFKA 4KU4A 2G9NA 3GPLA 4XWOA 2XZPA 4Q9JA 1U0JA 1EFRD 2H1LA 4NH0A 1GNPA 1DTSA 1NVXQ 4EQ6B 3NVAA 4ITRC 1RE0A 1X8KA 2GNOA 2CK3A 4LRWA 1M7GA 3TUIC 1KO7A 1NN1A 4OK5A 1LVGA 4D80A 5FBWB 2IS1A 4TN1A 4Y0VA 4URVR 2IYRA 5HZKA 3K70D 3NG1A 5LD2C 3BB3A 2QSYA 3FFAA 4TLBA 4XTRA 4GZLA 5JCZA 5L3RA 1AJEA 5BQ5A 2O8FB 1N6IA 3HJNA 1D2EA 4IOKA 4FD2A 4EFMA 4BLOA 2GZAA 2QUZA 1UBGA 3KFXA 3GFPA 1ZD8A 1XTJA 4OQMA 1E94E 4PPFA 1H8ED 2H18A 3KJHA 4DT1A 2WHXA 1FL9A 4GRAA 4Y0AA 3SE0A 3TSWA 1Z6TA 3B6EA 3DZDA 1HH4A 2BBOA 2C5LA 2QPAA 1T5IA 3QQ5A 4LJAA 1VIAA 3KKNA 3T35A 4P4TA 4RD1A 3LQQA 4V0KA 4M0LA 3K09A 1ZCAA 1ZMXA 3BH0A 3NBZC 3NH6A 2ANBA 2JAQA 4GMXA 4NYMR 4RD0A 1G41A 3AH8A 3QPWA 4XJXA 5KSYA 1R10A 1HE1C 5IF9A 4ZIRA 3W3ZB 3L0PA 2GXUA 3TBKA 4AK9A 4A92A 1G8YA 1QG2A 3D6TB 3B2EA 4FMDF 2BCGY 3T06B 1H8EA 2WJJA 3X1ZA 1QVRA 2IUTA 2CDNA 1D8TA 4TYWA 1E9EA 1NVVR 1O3YA 2J0VA 2Y8EA 5AUPB 3B9QA 3T5DA 3SS8A 1XDBA 1SVKA 2CBZA 2G0TA 4FCVA 3G82C 4CIDA 1OKKA 3C4JA 4LYFA 4ESHA 2FF7A 3GLIB 4YC7A 3K09C 2WIAA 4GSYA 3WYGA 4KITB 4EIWA 3CF0A 3GMTA 5CYPA 4ARZA 3CR8A 3CLVA 5GVRA 5ELXA 3PJRA 2VIIA 5HCNA 1HT2E 1SVSA 1X1SA 1G3QA 2W6JD 3RS2A 1YZGA 1NG1A 1G19A 4EUNA 4CEHA 2D74A 2XEXA 1VYUA 3RS7A 4C0HA 4HLCA 2BHRA 2VF7A 1LNZA 1U9IA 5AJZA 3QEOA 3C41J 1XXHB 4F91B 3W6PA 3E2IA 3RRNA 2L0XA 3L82B 5IDVA 3PEVA 1MABB 4IDHA 2JASA 4ESVA 2DBYA 2ZRFA 2Q9CA 3I32A 4G5QA 3SQWA 1GTVA 1MKYA 2C8VA 2W6ID 2ZUCA 2CL6X 4X8MA 4BRUA 1M74A 2ZYTX 2OAQ1 4Z1MA 5P21A 3RNLA 4LX0A 4AD8A 1CLUA 3T1QA 2YWFA 3KJIA 1UKVY 1ZM7A 3K0FA 5EXXA 4BECA 1A2KC 2FPLA 3UATA 3CZPA 1GILA 4KVAA 3SN6A 3A4NA 3H1TA 2W2VA 1B23P 1HA3A 4BFVA 5EQTA 2FX3A 2IYLD 1R7RA 1QHYA 1SXJC 2CLDX 3MFYA 1W0JD 2AHOA 5E95A 3LA6A 2IHBA 2PEZA 5BN3A 1GRQA 2LKCA 3BH6A 1E0AA 1EXMA 4DCUA 3IBGA 2VP6A 4UJ5A 3EPLA 1KJYA 3CH5A 2DWOA 3Q9LA 2OV2A 3I1FA 3LVQE 4E03A 1XCGB 2NTYC 4YMUA 3GP8A 1KO5A 4LPSA 3VR5A 1GWNA 3B9PA 4MGYR 2CHVA 2AXPA 5EXSA 4Z1MD 4C9BA 3P4YA 5G53C 1G21E 4IDNA 1OKKD 2V7QA 1DO0A 4B33A 3SOPA 5AJWA 1CR4A 3OIYA 3HDTA 3P27A 4NYIQ 3C8UA 4FXPA 4OJKA 4PZYA 5GJCA 1M1YE 1XTIA 3DHWC 4LHVA 5EP3A 3HU1A 2DYKA 5DHFA 1Z6XA 4A8JA 2ANCA 2YNMA 1Z8FA 4LHZA 8OHMA 1IXSB 2WVJA 4PFSA 2WSMA 1D2NA 2QRZA 1F5NA 1CF4A 3EPKA 1XFAA 2IF0A 3Q5EA 4D26A 1VCMA 2YZ2A 2AK3A 4PPQA 4GMDA 2JLRA 2QZ4A 5KDOA 5DYGA 4JSYA 2Z83A 4ZIRB 1K8RA 4D4KA 5KDLA 2OCAA 3K70B 3PUYA 5H70A 5K8TA 4XH9B 4D2IA 3K0SA 4LBWA 2PT5A 3OIUA 5A0FA 2QBYB 2IYXA 1RFLA 1SKYE 4ZI3A 2XX3A 3O8DA 5DGXA 1E0KA 2J0SA 3B85A 3OIVA 3LRPA 4TTPA 2QE7A 2ZYUX 3NEJA 3N5CA 2FFQA 4GPTA 5KO2A 1SVLA 3ECCA 4WW0A 5CK5A 3VKWA 1Z6AA 3KXIA 2F1IA 3AGPA 1G5RA 2FSIA 1TNDA 4AKEA 5L3QA 2XITA 1FUUA 3X1YA 2QBYA 2O8DB 1P60A 1Z0FA 2ZJOA 3CIOA 2QEQA 1XBTA 3HU2A 3TNFA 2ZE8A 2O8BB 3CM0A 1CJKC 3S1AA 2IEZA 4LV8B 1WRBA 5LPNA 1QG4A 4QBGB 1IY2A 1PLLA 1ANKA 5HR5A 1GM5A 5DNYB 3FB4A 4KXFB 4NCJA 5DO9A 1X1RA 2OZEA 421PA 1KY3A 2VHCA 3AGQA 3ZD7A 4QFMA 4B2LA 4UNQA 4B44A 2OCPA 3W34A 3LY5A 1S9DA 2A2ZA 3K1JA 4WOPA 3OEED 3KFVA 3CF6R 3GFTA 1E79A 2BEJA 4NP6A 4R71A 3MG9A 4PHGA 2A5GA 4M9QA 3VFDA 4QBHA 4ILEA 1NJFA 1OIVA 1WF3A 2IYZA 2JJ1A 5L3QB 2AXNA 4QJ4A 3FKSD 4GDFA 2WZQA 4M8NE 4PC1A 2ZQ5A 4RD6A 1P9RA 2E1RA 1DAKA 1UF9A 5K8IA 5JJLA 4Q4HB 1RJ9A 3U4QB 2XB2A 1EFRA 1JEEA 4M1KA 5FOTA 1T3HA 3QKRB 4IEEA 1FX0B 2J3EA 1P2TA 3ZVMA 1PV4A 1M6NA 4LJ7A 1TMKA 1AS0A 3MCAA 3KQUA 1G7CA 3QXSA 5IRCD 2BC9A 4ZCIA 4CF7A 2JJ8A 1R6BX 2GEUA 1D9ZA 1QRAA 4M53A 3ZVNA 4DDUA 1C1YA 1SKYB 3UK6A 2FOLA 3HPRA 1E2DA 2YC4C 4DBLC 4F4JA 3ICEA 3PUWA 4WVFA 1MABA 4ZCLA 3IIKA 2D62A 3QXCA 1Q1QA 1OT3A 4ERNA 4IFBA 5LDDC 2JLYA 2MSEB 1KK1A 5JWRA 2ZSBA 4X8OA 4YMVA 1VHLA 3WMFA 4UKDA 1KDPA 4C0SA 1RJ9B 2WIBA 3AP1A 3U4QA 1JXMA 4WZ6A 1I4DD 4NE2A 2VRWA 1FPMA 2O8EB 1JPNA 4Q1EA 3IDQA 3UWKA 2ZR0A 4ON9A 1YR7A 4CRWB 1IN6A 1F2TB 4JT2A 3AVXA 1SHZA 1Z06A 2F7SA 3JZAA 5BW8A 5AJVB 3U44B 2DWQA 5CK4A 2X2FA 721PA 4W9MC 2QAJA 3VNVA 3FMIA 4V03A 4YXWD 5AUOB 4I99A 4B3BA 1P73A 1GKUB 5JI3E 1WBDA 1YZLA 2DWPA 3AKDA 5BXQC 2ORIA 2BM0A 2E87A 2ZRGA 1W49A 2FZLA 2FSGA 1XX6A 2BMJA 2QY9A 3LV8A 4W5HA 2IT1A 2FPMA 4HDQB 2CNWD 4W7SA 5J4LA 2FEOA 3ZVRA 1ZP6A 3AB3A 4A6PA 1Q20A 3K0EA 2EFHB 2D2FA 2H7VA 2HYDA 4L5BA 5F3WB 4IXNA 3I62A 3ZIAD 2EU8A 2F9MA 3E1SA 1KMHA 2ZRHA 4M1MA 1LF0A 1UPTA 4PPGA 2ZRMA 4JLNA 3WY9A 4TWZA 2WAYA 4LV6A 1CIPA 5LB2A 3RRZA 2FGKA 2QRNA 2R6GA 3P32A 4EJSA 2FPKA 1J90A 1LF5A 1ZU4A 3PXGA 1TQ6A 2FWRA 5EE5B 3C7KA 5HE8A 5CDFE 5FPKA 5FTLA 3RYTC 4Q1BA 2ZPTX 2ZE6A 3ONWA 4ZO4A 3LDAA 3QY0A 4XD7A 1UFQA 3K9NA 1VDZA 1KNQA 1JALA 4JLKA 3KKOA 4PANA 1EX7A 1K5GA 1AKEA 1N6HA 1KZGB 3W8RA 2ZRKA 2ZRBA 1Q57A 4CT5A 4A36A 1FTSA 2ZSFA 2Z5FA 4JLPA 1G5PA 2QAGC 3OIWA 1XP8A 2EFDB 2XNDA 4O25A 4UNNA 1XWIA 1GRNA 3REFA 1K5DA 1VMAA 3MWLA 2ZYWX 5AR1A 4B3DA 5JEDA 1DBSA 4A15A 4QJ5A 2C99A 2GVZC 1KDRA 2BMDA 4O2LA 4BLTA 5CB8A 3NKVA 3RLFA 1FQKA 1DAMA 2XOKD 2CLSA 2QM8A 3UXMA 4QJ3A 3M4YA 1XEXB 4EFLA 2OE2A 1VECA 2JGNA 2ZS8A 1VCNA 2J46A 2DY1A 3GLGA 1ZM9A 1NRJB 3PITA 2XZOA 1U8AA 4MA4A 3IKJA 4MYCA 3B78A 2F9LA 4KODA 3GLFE 2HT1A 1T5LA 1OXSC 2ZJ5A 4OL0A 1NY5A 1E96A 3ASYA 2JLUA 4HUQA 1XPRA 1YZUA 2BOVA 2ZU6A 1A4RA 5DN6D 1Z08A 3GEEA 3T1VA 4CEJB 1CU1A 5L8VA 1L4UA 1LB1B 3SNHA 3H86A 3VU9A 1ZUNB 3Q7QA 2WBLC 1M2OB 2KJQA 2W0MA 3G0HA 3IHWA 4OJQA 4QHTA 1XMIA 1OH7A 3MWYW 4CT4B 2LCFA 2UZIR 1HQYE 4L9WA 2WSSD 3A1SA 2IWRA 4HATA 5KNBA 2DFLA 4V0NA 5FPHA 4B74A 3ICQB 3GJ7A 3FGNA 4NCKA 3GLGB 1ZAKA 1W36C 1YZNA 3EZ2A 1EWRA 3BD9A 2VL7A 5FOSA 2CXXA 2GBLC 4DLXA 2VSOA 2FFHA 4MH0R 4TT3A 4DLWA 5FOXA 3MD0A 1XTKA 3CX8A 3KX2A 4D0LB 4JLBA 3FWYA 3ZD6A 4DUGA 3TR5A 5CIQA 1S3SA 4D81A 2VH5R 5DIFA 2XSZA 1F2UB 1R2QA 5AK0A 6Q21A 1ZC4A 3FMPB 1G8FA 3C5CA 4XIGS 2WWWA 3OEHD 2B7CA 2QTFA 3DZ8A 1W44A 4KCGA 3OHMA 4ZDIA 1XMJA 4M1YA 3BOSA 2FFBA 2O8DA 4AYXA 2WMNB 1KZ7B 1LFDB 3I8XA 4Q1DA 2J7PA 1KJWA 1E1QA 1YZTA 4IDOA 3R9WA 1P7CA 2V54A 3W9YA 2J0QA 2F6RA 1P9WA 3BK7A 1QHHA 521PA 4K81B 2B8TA 3I61A 3R8CA 4D4JA 1HQCA 1Q44A 1CJTC 4HLDA 1SXJA 3CO5A 2ZANA 1OXVA 5BN5A 5SZJA 5DI9A 5KUTA 1W36B 4AKGA 2PMDA 3MSXA 3HYRA 4U00A 4LWZA 1D2MA 3AF0A 1KI6A 3QBVA 4FINA 4PPNA 2X77A 3SJAA 1AK2A 2JDIA 1KKMA 4FN5A 3GLIA 1GSIA 2BJVA 1FP7A 1L7VC 1N0UA 5E7MA 2OBLA 2UKDA 2PCJA 3VTKA 1WA5A 2YWHA 5C2JB 2C77A 2MSCB 4G5GA 3GJ4A 2PZGA 1FUKA 4MKFA 2QQ0A 3AVOA 1JAHA 5B2ZA 4A8JC 4O3MA 2PJZA 4V0LA 1SXJD 3AVWA 3IO3A 4CDGA 2WKQA 2ZUBA 5BYJA 3TMKA 1JJ7A 5EJEA 2UZ3A 2ZI6A 3KKPA 3KXKA 4OQXA 4LHXA 1L2TA 3CRMA 4C7OB 1GKYA 1VIYA 5H68A 3WYAA 2BV3A 2E9SA 4ASUD 5DI3B 1G5TA 2OBNA 3SBDA 2RGGA 3CX7A 1CP2A 5FL7A 2OBMA 5KPJA 1U8YA 1NL3A 1NP6A 5G41A 5KNDA 5KTYA 2JDID 2WMOB 4JLDA 4AG5A 1JPJA 2V3CC 4PHTA 1U0LA 3CR7A 2XB4A 1XJ0A 2BM1A 4I1VA 1F2TA 4NYJR 4FMDB 4DWJA 5G40A 2QENA 2WKPA 4MQBA 4JS0A 3HR8A 3MWJA 4OI2A 1BOFA 4LC1A 4FWTA 3EIHA 4DLTA 2WICA 1II0A 1DARA 1NBME 1HY3A 2CNWA 2JEOA 4NONA 4XTCS 3GLFB 3QE0A 4DB4A 2ZJZA 3GD7A 2JLXA 1EWQA 3F8TA 3WRYC 4C0AC 4CGZA 4R2IA 2OHFA 5EP2A 3TSZA 1E9AA 3VR1A 1G3MA 1S1MA 3M6AA 3AKCA 2JIZA 3NBYC 4A2PA 2IL1A 1ZM4A 3CW2A 5AJXA 3KDSE 3HP1A 2IEYA 2ECKA 3IPXA 2R6FA 5FI1B 3LBIA 3ZVLA 2XZLA 3AF1A 2RGAA 2NPFA 4TL9A 3AF2A 5CM9C 4GI7A 1G4AE 4RCYA 4OI1A 3U6KA 1ZC3A 4V0MA 3L0SA 4WBSA 1X86B 5KSZA 1OFUX 1GDDA 4QM7A 1G17A 2VYFA 5JECA 2YKGA 2CMKA 3GJ0A 2CCJA 3EAQA 2C03A 4TL7A 4MKHA 2ONKA 5CLQA 1DAEA 5B64A 3VKHA 1D5CA 1DO2A 1ZINA 3W8NA 1E2IA 4B32A 4A2WA 3ZQ6A 2OAP1 3TQFA 1JEDA 3E70C 2JLWA 1JJVA 4JJKA 3DL0A 3TGPA 2C96A 5IK2A 2R44A 4MRPA 5GJWC 4CEHB 4QL3A 1JR3A 3KQHA 3W5IA 1IY0A 4M9SA 1DAIA 2ZI7A 2CE2X 3OFNA 1E2LA 2FN4A 2QP9X 4CYMA 1PLKA 1XF9A 5AWFC 4DVGA 1W0KA 1FMLA 2FA9A 3I5XA 3QG1A 3VAAA 2NQ2C 3U3OA 1AZTA 1B0UA 2OUKA 5JRJA 3BJIC 1Q21A 3QKSB 4ZPXA 1UJ2A 2ZE7A 3AM1A 2HLDD 3RSLA 1FNNA 2IYQA 4YQFA 1N5KA 4Q7KA 5FUXA 4YDSA 2K5UA 1XZPA 3PUVA 4M1SA 5JRZA 5F9FA 3EARA 4LC0A 4EPXA 1VG1A 3P26A 4QGGA 2NZJA 1PLJA 3R7WA 2X19A 4R2HA 3QKUA 4RZ2A 1TQ4A 4NU0A 4EDHA 1E6CA 4L15A 3K8YA 4TQ9A 4KSBA 5DE3A 2P5TB 4TL8A 3AKEA 3AF3A 2JLQA 3QBTA 1Q12A 1IXRC 2ODWA 5CJPA 1QBKC 2GCPA 3WBJA 1W4CA 5J5CA 3LW8A 1G3RA 1T3LA 4OHYA 1D9XA 3EZ9A 3X1WA 1SULA 1OJLA 1AM4D 1IQPA 3G5UA 3KJEA 3KKQA 1LS6A 1BH2A 4TT3D 3UMFA 3TAHA 5FI0B 1Q1EA 5J40A 4C0KA 4D4LA 3NDBB 4M2LA 1QVAA 3EIQA 1RC8A 4XVUA 2MMGA 3ZLJA 1CKEA 1KGDA 4F4IA 4Q4HA 4UQOA 2BDTA 2G1JA 4QHYA 3C14C 2Q9AA 4ZV4A 2D7DA 1ELOA 3T61A 3I5YA 1R5NA 4DSNA 4LSGA 5GJVC 2A5YB 1HEIA 3AUYA 3IIJA 4FCTA 2NO1A 2RHMA 1ZYUA 4RFVA 3GEHA 4URYR 2W00A 1NMZA 4IHQA 5FBLB 4XVRA 1MR3F 4FMCF 3IUYA 5JHHB 4AURA 2ORVA 3DM9B 3EXAA 2X2EA 3U3JA 4TYYA 3QF4A 4KI0A 4NDZA 3CWQA 2RCNA 3B7GA 5H1YA 1E2NA 2J5XA 4R98A 1NVUQ 2R6DA 3JZMA 4DLSA 4DCSA 2VP2A 3BFVA 1U90A 4PAOA 5CYOA 4LCBA 1W4BA 4C2TA 1P72A 1P5ZB 3U7FB 2VHUA 4NL4H 3SBEA 1IJEA 2PLFA 1NSFA 1ZM2A 2HT6A 3EZFA 4E09A 3THXA 1Z63A 2VLIA 2C04A 1OH5A 4PR0A 1G6HA 1VPLA 4HUTA 4A0RA 3W90A 1J8MF 1P9NA 2JJ2A 5IHPA 2XSZD 1KO8A 4D4MA 4L4UA 5FL7D 3PEWA 4HAVA 2GDJA 2ZJ8A 4QBIA 1TX4B 1G3IA 4UXHA 1R8QA 2ZRJA 1O87A 4POAA 1SVMA 2JIZD 4KJZA 1BYIA 1BYUA 2HEIA 1TF7A 3LWNA 3TE6A 3U61B 4C3ZA 4BWYA 3RWMB 2R8RA 4PC2A 1E9RA 4XOIA 1N6LA 3RS5A 3DKVA 4G5OA 4YMSA 1UDXA 2VPPA 2DB3A 1COWD 3IBYA 2VHTA 1IJFA 2PT7A 4JZKA 3PFIA 3RRMA 4LJ6A 4NCHA 4LDJA 3RDPA 4Q02A 1OXXK 4X8LA 2JLVA 2RHDA 1Q0UA 3QSYA 1P61B 1DPFA 3GLHB 4G01B 4PHHA 3EPHA 1CULC 5FOUA 2BWJA 1DAGA 4BFYA 4URXR 2W6IA 1Z0KA 4NYJQ 5D3MA 2BKEA 1W2HA 1E2JA 1VHTA 4QHSA 4UJ3A 3VR4A 1E0JA 1ODFA 2W83A 4MYHA 1P75A 4IEIA 2B7BA 621PA 1W36D 3ADKA 4X8HA 4CW7A 2VP5A 4NBSA 3A1UA 2KBFA 4B76A 2REOA 3TIFA 1NIPA 1II9A 1Z2CA 4TLEA 2BBWA 4HDCA 4AG6A 2F43A 4I1UA 2XOKA 2W6JA 5UKDA 1W7AA 4QBFA 3VX4A
chains in the Genus database with same CATH superfamily
3GGDA 3FOBA 2C3PA 3SFVA 1Z88A 1LA2A 1L5WA 3Q3HA 2IYYA 2YV5A 3VR5H 4DJDC 4H7IA 4UNSA 1L5HB 4LW8A 4N40A 1YB2A 3G79A 4JXKA 1AF7A 1H66A 4AMYA 2FW0A 1PZEA 3K53A 3Q7RA 3BF7A 4FSHA 3RFFA 2PX3A 3G6WA 3MT8A 5F12A 2HCBA 1RWQA 3SKYA 2ESRA 4PAWA 2Y1GA 2POCA 1IATA 2H00A 1GFZA 2QW0X 3OEEA 4J1TC 2ID7A 1HDGO 1Z4KA 3KOMA 2RGDA 4QTXA 3DG9A 2MIIA 2AJDA 1YJ5A 1FZTA 2MINB 2XNCA 3MUNA 2Y0CA 4HD8A 4HWTA 2A9QA 3HR4A 3ZIUA 3THXB 3AVTA 2H2WA 2GSWA 1O97C 3TXYA 2PZAA 1DX6A 2PH7A 3GPBA 3AEZA 3EUAA 1BWQA 4MGHA 2GTIA 3ZNOA 1H8HD 4DJ5X 4N5DA 1OX4B 4UNPA 1RPTA 3A4YA 3B6IA 1ZQ9A 2C31A 3PFGA 3T5TA 4CV2A 2XVMA 3DHVA 3JAKA 3JS5A 5JCJA 2WHPB 4RJTA 1U1CA 4Q7LA 4D9HA 4N9QA 3U56A 4TV9A 1J4AA 4RCZA 2OV3A 1VBFA 5EGSA 4ALKA 4QUKA 2GB4A 5BNIA 5KMGB 4MQUA 3RUPA 1ZD3A 4Y2QA 1EG2A 2FVXA 3MUFA 4GT1A 3DAOA 3K8ZA 3BAFA 5FR1A 1NW6A 4J90A 3RC2A 4UE3S 4GAEA 4XSHA 2NU7A 1V0JA 4MPTA 5DWQA 4C4PA 4ZMBA 1HDXA 2BKUA 2PGDA 3I1YA 3NT4A 5IJXA 1IYZA 3SKXA 4C5BA 1FFEA 4EELA 4ENPA 3J81k 2E5LB 3K3PA 1L6RA 2QYSA 4KXWA 1FK8A 3V8VA 1A96A 2ACVA 2VQDA 4MGKR 1HE5A 2FWJA 3GP3A 1CJBA 1QO0A 3CURA 3WDMA 2HRDA 5JHGB 3FNFA 3IEMA 2FGJA 3H9CA 4QO7A 3RYHA 1XA4A 4OYRA 5DXJA 4XYBA 3ANSA 5F21A 4CR6A 3IT2A 1RZVA 4QRHA 2NO6A 5CMLA 1V47A 2XOEA 3A6GA 4ITUA 4X92A 4U8GA 4LJSA 3RS4A 4EHHA 3I5MA 5D3MB 2ZW9A 1T6NA 3LAWA 4GZMA 1VE7A 1RXSA 2HLNA 3HADA 3JALA 3WGNA 4AXBA 1LPOA 5E9WA 1HE3A 1GU1A 4LF9B 4ZI7F 2VLBA 1CJMA 2Q3LA 3ZWCA 1R4AA 2OLJA 3OZRA 4TZKA 1M2EA 1JAYA 3FOWA 1QMGA 3MGBA 1WMAA 5KJEA 1EFTA 2ZIWB 4D41A 2YH2A 3CUYA 4FSXA 2NNLD 2R4QA 4N48A 1P18A 2GYVA 2OYCA 5JXHA 2D06A 1U7OA 1S9HA 4GD3Q 1IK4A 1BHSA 1CJUC 3SOZA 2ZSDA 5KBYA 2A4MA 4FKMA 3C3CA 1BC5A 1XZNA 1QGUA 2BFDA 3ULKA 1N4DA 2V7QD 2HREA 2YBDA 1MJGM 3AEXA 4G0YA 1ZUWA 3SHFA 3ZS8A 3QUBA 4YAWA 4LRSB 5JDCA 3FKSA 2X8JA 3H8VA 1XZHA 1AGYA 1MEJA 2JGIA 3KAJA 1HYBA 1EM8A 4ZGBA 5BNZA 3TLCA 3DZJA 3PFFA 1SBHA 4QEDA 1JKXA 2VDMB 3T6KA 4KLCA 3KZ1E 3RBVA 2IWHA 3MZ0A 1GNQA 4XARA 2AOUA 1TC2A 3JVVA 4M9UA 3FSRA 1V1JA 1UDWA 1YVRA 1NLYA 2VH2A 2Z4SA 2H8KA 3ANXA 2YJ5A 3BF8A 3OQVA 2CYCA 4KBGA 1AKRA 2NVBA 5BWNA 2ZZNA 1DBRA 4KWHA 2NYUA 2V45A 5HGJA 2P5SA 1VYTA 3QPBA 4I9HA 3SYMA 3UAXA 3W9BA 3FF1A 4MZDA 5BWBA 2V55B 1YRWA 4FQ8A 4KO2S 4WXYB 3COWA 4MK4A 1CC1S 4ZARA 5JD6A 2WB2A 3ZWMA 2HBRA 2MSLA 4BLVA 4V0SA 3LBAA 4MGZR 2CJWA 3TZQA 5FUYA 1HTBA 1N0HA 3RSOA 4BN4A 4BNTA 1NXSA 3CHYA 5HHTA 5DP1A 3RUDA 5IAKA 2VPTA 3QLVA 1OFTA 1U7HA 5IUJC 1V2HE 1CQPA 1CY8A 3EPJA 1ZOPA 4LOKA 2YS7A 3UV6A 3QF7A 5C3UA 4BQPA 2XRFA 2PBRA 3D4IA 1EUQA 3I4LA 4MKZA 4RA6A 1KK2A 2J3LA 5IKMA 3HCPA 1TKCA 1E64A 4CJXA 4LHWA 3VDQA 3F4LA 3R5TA 1LPNA 3GZ4A 4ZCQA 2I03A 3TZHA 4RV5A 3WADA 1OH8A 3Q9NA 4MEAA 1HYQA 4QBTA 3TUZC 1M6HA 3PDHA 3RT9A 2ON6A 3ABOB 3U9SA 5C81A 5DULA 1OXUA 4X6YA 1QB8A 3MERA 1HK7A 1I9GA 2UYOA 2I71A 2WAXA 3T99A 1EU1A 2HF8A 4OKSA 1QZTA 3JD3A 1KZHA 3AQ4A 1L5GB 2RAPA 3MNFA 1JXOA 4L0MA 1NWCA 2DUJA 4QSMA 1OAOC 3AVVA 3N3BC 4A6XA 3UC5A 2UUBB 5M04A 1GITA 2OAGA 1G4UR 4MVWA 2OD2A 5KAPA 3QH4A 1IBRA 3SEQA 4W5OA 4ZT4A 4EJMA 2FWBA 3HHEA 1ZS9A 5KU1A 4S04A 2BF7A 3N1UA 5AM5A 3T8YA 1EEHA 3MMSA 2FK7A 2X9LA 4F3NA 1UPCA 3AHCA 2I62A 4PX3A 5E7IA 2I6TA 1I1HA 3RQIA 2G76A 2AQIA 2G28A 1AA9A 1BGVA 3RTCA 3X1DA 2UYHA 2IZ0A 1GAEO 3EXHA 5LZ2A 4AY5A 1N6PA 1L1QA 2XNHA 1JR6A 2QTHA 4AJNA 4DLYA 4Z9BA 4PE5B 1GLVA 1Z3CA 2JCSA 1YBMA 5LXTB 1NWHA 1A8SA 2ZSAA 3IEPA 3LH5A 3OZXA 4U7HA 4WLEA 3DCNA 3GDWA 1GEEA 3QKSA 1C9YA 1SBIA 3DWEX 4YP9A 1C7JA 5E7QA 4G86A 5HF9A 4B81A 2QMHA 4CLXA 2QMOA 2DLNA 3PEYA 3S81A 2PX8A 3GQBB 3A0RB 2J07A 3FETA 1AKYA 2IHUA 2FHSA 3BMCB 4NDAA 5HZMA 3P52A 1DFGA 1XZCA 3AKZA 1QHNA 2ECOA 2QTRA 2PWPA 2F43B 3ILSA 1V4NA 1HZJA 1NV9A 4JH0A 1T1EA 3S2EA 1NR1A 2BFNA 2NSHA 3WC4A 3PC3A 4BAGA 3UUGA 4UEOA 4G07A 1J8YF 3A2MA 3EGWA 5K6AC 1TU3A 1FU8A 4AMUA 5AVTA 3WOHA 1NN0A 2DBQA 5IBCA 1HYHA 1GPBA 1SD5A 2J9FB 4KIJA 4CEIA 3L93A 1XDZA 1ST3A 1RC1A 1XMVA 3MIZA 4ZVKA 5AVRA 2FETA 1GFSA 5D3QA 4C78A 5BURA 1IUPA 2MYUA 3CX4A 1NT4A 1E89A 1EUZA 4TV9F 4D4IA 5I9IA 4PSKA 4P93A 4F7DA 3QFRA 5GTDA 1M6EX 1I2ZA 3WJ1A 1BFKA 1BMFD 4O1IA 1OUMA 1NFFA 1UQRA 2AB0A 4C3UA 3AEKA 3MCWA 2EFCB 2VUIB 4BE7B 2B61A 2WIFA 1Z4QA 1ND5A 4G63A 4NBTA 4R9VA 4B4UA 1IOWA 1JGTA 5IF3A 3E84A 1PNQA 1WMBA 1GGMA 1CRWG 1OFVA 1OZFA 1PL7A 2ATXA 3RAPR 3WA7A 4KRYA 3PC4A 4P7FA 3TIVA 5HOEA 1Z07A 3OLQA 5FOWA 4O4LA 5CA1A 2H9IA 1C30A 2P2LA 4KWIA 2W2XA 5DYWA 4ZXFA 1VJCA 3JYHA 3DBHA 1IZZA 2PXXA 4EG4A 2Q4BA 8GPBA 4B2PA 1FDVA 3CR3C 1LK7A 3GNTA 4DG9A 3RUFA 4TVKA 1BRTA 4OFZA 4TQAA 3WIDA 3W5BA 5JNSA 1IFXA 2PSJA 2XD9A 4GGOA 2GJAA 1DRJA 2G83A 3F9IA 1OXKB 3D8TA 1RQLA 1QRRA 2VI5A 3I01M 5FYDA 1KKLA 3BB1A 4GGPA 1UMDB 3T5AA 3C7AA 5F2KA 2CLLB 3IVCA 3QUSA 4O4HA 2FFRA 4E2WA 2C4UA 2FPUA 1E2EA 1R0XA 5JSZA 3EMKA 3V8EA 3T1OA 3R7BA 3G8YA 4MAAA 2EL9A 4E2FA 2OHHA 1M1NA 1NIJA 1LDNA 1B4DA 4DADA 2TMDA 1GT6A 5BV0A 4DZZA 2GZMA 3UK1A 4BNDA 3CZ9A 3DMNA 4EVIA 2C7RA 1DDGA 3AM3A 4FGUA 3SQOA 1AQUA 4P35A 3G2KA 1XQYA 1CY7A 3OTHA 3AONB 3KVRA 1DKUA 1JEJA 3DV0B 4N7BA 1PTJA 4EPYA 4R2WA 3NHAA 1CNFA 2Q7OE 1V7PC 1OGJA 1SBQA 4MUAA 3LPMA 2I80A 4ZTZB 2CJXA 2D1SA 5JWHA 2X8BA 4WZAB 1RIFA 4F38A 3OZFA 2FH5B 1TPZA 2I1QA 2SCUB 3OQIA 3QPCA 4QUEA 2WWIA 4TLLB 2XXAB 2NPIA 2QD3A 2DUMA 2IYFA 3IQIX 3C6KA 1Z6GA 5B58C 2ZFUA 4N3BA 3AR4A 1LPMA 4NQRA 1ID1A 1XDSA 1O08A 2B35A 2G9ZA 3DVLA 3LZ6A 2IV7A 3BREA 3AEQB 3HVUA 1C29B 2WABA 4R68A 4BV9A 3W78A 3G0IA 4OYHA 4OHZA 1XJCA 1Z0AA 3K70C 5HTOA 4U7WA 1GIAA 2DSNA 2O14A 1L4YA 3R9IA 3BIXA 5HE9A 4NRDA 1L3BA 1JFFB 3Q8KA 2WG1A 1OYYA 2HTFA 4YBRA 2A57A 4ZAVA 4DRYA 3H1BA 3D1VA 2WWFA 2ETVA 3I12A 3PHCA 3KAKA 5BT9A 1QG6A 2HQRA 4UHEA 3FUUA 5ADUS 3RK4A 4UZFA 3EUFA 3K1AA 2YXNA 4O4HF 3PNQA 4BFXA 3Q8XB 4DCCA 4X54A 2I8CA 1PNRA 1Z29A 4JVMA 3DMPA 3P2JA 2QZPA 2Q3FA 4YJHB 1B2RA 2HMAA 5G3YA 4UXIA 3M49A 1NRXA 3O03A 3ZLVA 1MH1A 4MGIR 5A4JA 1IG0A 2XA2A 3SI7A 3F3YA 4HB4A 5CM8B 5TE9A 3LP8A 4URZR 4B73A 1KR5A 2F55A 3ZK9A 5CIYA 2XWJI 1ZXBA 2HRQA 3HCAA 3UWSA 1ZL0A 1LLCA 4HYTA 1Z0DA 2APJA 4BZQA 1R4ZA 3MUEA 4QECA 1XDDA 4UTRA 1NG9A 3GA5A 2O4UX 4P7KA 5ENDA 1A9ZA 4J2OA 2AI3A 4S1WA 2GARA 1F3LA 2ZRAA 1ISPA 4I4TA 1AN9A 1DTEA 1NQWA 2ZBDA 3OJFA 1MT0A 2ZR8A 4HGOA 2ZJ3A 5K1ZA 2OTCA 1U4OA 1P1RA 4JT8A 4PV7A 1K0FA 1ZFNA 2WHQA 2YICA 3AIOA 4L85A 1RRKA 2XYGA 2JJYA 3FCEA 4H18A 3WI7A 3FAZA 3GCGA 3WMXA 3FPBA 2XEDA 4DAEA 2IU6A 4NKRA 2H31A 2CZGA 3HGQA 2P0AA 3LGXA 4RZXA 4JYCA 2XNKA 5FA8A 1KZYC 3LNCA 2J7PD 3ICPA 3V2UA 4DIMA 1THMA 1Y1KE 3WAKA 2BSXA 3FZNA 1O6GA 3BBLA 4EFKA 3TPZA 4FLMA 2CLMB 2YFKA 5DHRA 2PG3A 4A8PA 3LOQA 2P2SA 2EKDA 4EA7A 1M1ZA 4TROA 1DQSA 2AMFA 4WINA 3GA0A 1K68A 4ZGGA 5A9TA 4K03A 1ZOSA 2P41A 2WZCA 2FWAA 3OCVA 2XWSA 3V34A 3PUXA 5IKPA 1GNVA 1TM1E 4K05A 1Z3IX 2V7PA 4L2IB 4L9RA 1Q1BA 4R3NA 1BO6A 4KK3A 3V9PA 4C08A 2H1IA 4K87A 4PC7A 2B4YA 3DZHA 3E7XA 4GI5A 3ANTA 3D3EA 2YFHA 3FOEC 1UJCA 1J56A 3CZ5A 3CLRC 1CR1A 1GVHA 1G2IA 1MO6A 1ZD9A 4O4JF 5EMHA 1IZ9A 2KWIA 3VOBA 2GNAA 3LVFO 2I87A 3QEJA 5JWOA 2ECQA 5ALTA 4LJKA 3WGVA 3HXMA 4GL2A 4G3XA 1N32B 1TOAA 1O95D 1SOAA 5COBA 5AK5A 5EP1A 2V4MA 3LHSA 1N5LA 4HHEA 2LDBA 2HDNB 2JAXA 4F5ZA 1PFWA 4X3CA 3WWOA 5J4YA 1FSPA 3FOFC 1PHRA 3KTDA 3ZWAA 2RGWA 2VF8A 1ZCJA 9LDBA 5KOYA 3O6VA 1IXYA 4L27A 1XXHE 4TGLA 3ZQUA 4XFJA 5FV4A 5CD1A 1YNOA 3RVNA 2GEKA 4F92B 1CVLA 2AJBA 5C1PA 3MGCA 3LLUA 1M6YA 5FUMA 2GNPA 1FBTA 4DR1B 1VRVA 4XVHA 1ST2A 3DO6A 2CEAA 5CFZA 4ZDWA 3T9EA 1T5HX 1T29A 1GTJ1 2NSDA 1PT6A 3AM5A 1BX1A 1INLA 1A98A 2RG1A 3HZZA 3JQ8B 4HRXA 5ALZA 2LCQA 1BU5A 4C43A 3GLIE 3UM9A 1NY6A 2OGWA 3PR1A 3AM4A 3V4RA 3NETA 4L8GA 1LV7A 1NP3A 1ZXXA 4OCZA 3LW7A 5AI9A 3X44A 2UXDB 2FV8A 2P3SA 1FSSA 3FCSB 1CQJA 1EI9A 1DUSA 3EDQA 1SQ6A 4Y6RA 3ZZUA 5EJ4A 3V2GA 2CL7X 2FCRA 1YR9A 2PWBA 5JXGA 4YCBA 1XIVA 1Z6ZA 1XLTA 3MWGA 3H2BA 4FE4A 2Z3WA 3D8BA 4L57A 3K16A 1II8B 5E3IA 5FP0A 3U3XA 3WNDA 3I37X 1KAQA 3I2JA 2R2GA 3IIMA 1TK3A 3TVDA 2OZLA 3ZQ4A 4P6VF 1P17A 4RY2A 1FMFA 2W2NA 1JAIA 4UBIA 3TEMA 3RQSA 1N5DA 3DTNA 2DTDA 5DP2A 4AC9A 2VYQA 1KTVA 5FT9A 5GM1A 3CINA 1RZRD 2Q3DA 1RM0A 2TMGA 2WOJA 2X0IA 4FZ3A 4JA2A 2QP3A 4DDVA 2Q4TA 2VPZA 3HJGA 4CMBA 4EA6A 2DR3A 2HJVA 3AP3A 4L3VA 3W79A 1J2TA 1SGWA 1U0HC 3F6EX 3JQ7B 2X5KO 3PD0A 5PNTA 3VR6A 3WGYA 4YXFA 3ZZ0A 2V6MA 2G1PA 4FNMA 4EW2A 1PJ8A 3CB4A 2C4HA 3B2NA 3OWXA 5I7UA 3CPHA 4MCJA 4C4SA 3V97A 3IUPA 2NW6A 4ALMA 2BFCB 3NYQA 4W5WA 2IF2A 1Z8DA 1UMCA 3QOFA 1FP6A 2ZROA 4EZEA 4HVCA 4Q4JB 1CUUA 2CMHA 3D7MA 3K8OE 3M34A 4JL6A 5EE0A 3X1XA 2K4MA 1N2CA 3I6ZA 3MINA 4IICA 3TJZA 1HFWA 4W4TA 3DGFC 4DLZA 2GCEA 3JQDA 3BZWA 5ALVA 1FYWA 3LX5A 1B8NA 1QORA 4B48A 4IAOA 3VNRA 1X19A 2VAVA 4LRXA 2H92A 1DNPA 2ERYA 3E15A 3QXXA 3ISVA 1A7JA 4KFRA 4OA8A 3CGWA 3S99A 1JHQA 5EUQB 4TTQA 2X5JO 2CY0A 1JU4A 1ETHA 2WYWA 3UUFA 4EG1A 4NENB 1R12A 1XG5A 4BWFB 3DW3X 3PDUA 3PWSA 5G02A 4Q3CA 1GQ2A 4FVTA 4HPJB 3F49S 4LY6A 3N28A 1KOFA 3EQ8A 3NC4A 4ZV7A 5K4AA 2JFNA 3HA2A 2DECA 2NMVA 4GYKA 3IEVA 3GUZA 4UHFA 1U5AA 2J3IA 4X65B 4BYMA 2O7RA 1ZZEA 1RHMA 3B9RA 3KEOA 5E3HA 2FTKE 3MTJA 1VP3A 3IMCA 2OGTA 4G9GA 1ZK4A 2WV9A 5DX1A 3QM1A 1V43A 1ZW6A 3NTUA 1ODJA 1GUBA 1O9BA 4RZQA 1GQQA 1A5ZA 4IJWA 4DV6B 3GNLA 3LQRA 4L8WB 4D3ZA 3UG6A 2BBTA 2I7XA 3OZ7A 1AGNA 5BQOA 4AAYA 5DSTA 4KLNA 3L0IB 5T64A 3O8NA 3OUZA 2GJ9A 2ZIAA 1B6RA 3DDNA 4MYSA 3RYIA 2EDCA 3VU9B 5KOHA 3GRAA 2CXPA 1NMXA 3PBKA 2X7JA 3RW9A 1XZMA 1T8TA 1NI3A 3O4HA 4UFNA 3ZHCA 1QLHA 5C34B 3GJYA 3IQWA 5JSZB 2HFJA 4R8LA 2CV2A 3X2FA 4FCWA 5HDQA 3HSYA 3JU3A 3L02A 1E1RA 2ES4A 4HY3A 1MB9A 2AFHE 2JIQA 2PZEA 3UHOA 1EM8B 3MYYA 3C16C 2R6R1 1O95A 3V42A 4RPLA 5DX8A 3RU2A 1WNFA 4QPNA 1CUSA 1VLMA 2EC5A 2ZJ2A 4LMPA 5LDHA 1R50A 2CFIA 1HUQA 2XF8A 1RQGA 4EENA 4FHGA 1F5SA 1V6SA 2PL3A 3QW2A 1JXAA 3ZHBA 1OBFO 3FUTA 4YGXB 4IUBS 4HVLA 1M6VB 3WGZA 1A3CA 4W5QA 1QS0B 4GKJB 2HSZA 3O4IA 1VHJA 4RL4A 4CKYA 2NWQA 4P53A 4YXWA 4LVOA 1IHYA 4BFUA 3RAFC 3KLPX 1XEWY 5I9MA 4DGQA 2X0KA 1YUBA 4U6NA 3OHPA 4M87A 1MENA 3JD4A 1A8QA 1S1CA 4BX0A 3O0DA 4WJZA 4XFKA 1OB5A 2FW9A 4YCNA 1YS7A 2IYPA 1DC3A 4L4SA 3EFEA 3M1LA 3FSJX 4CVNA 1FW6A 1PQWA 5HKKD 4LZNA 2DHRA 2IXTA 2R6JA 4YV1A 4PLFA 4HB3A 4QOIA 1I32A 3CLSD 3DVAB 3L0BA 3CKKA 4EOGA 1HNWB 2CMFA 3E1KA 2WUDA 4BZXA 4E22A 2XTJA 2J9FA 2PMBA 1MORA 2PYIA 5C5EA 1VMEA 1WSAA 2P2GA 2WQ7A 3AFIA 5FPYA 2OB1A 5CBPB 4B3HA 4FP9A 4J75A 3BXEA 3MVEA 4Q48A 2P9YA 4WXRA 1S3IA 4AZTA 3SHTA 2WTUA 4X64B 2RARA 4KOAA 1YDFA 3KUUA 4C7MA 4B43A 1T2NA 3DKPA 4TL6A 3O4VA 3ZH9B 5JISA 4A1FA 4CQLB 2NZ2A 4BFTA 4CCSA 3QOYA 1DCTA 4QUJA 1W8DA 1G6Q1 1Z17A 3RWOA 5B7PA 3HY3A 5DWDA 3WFIA 1VMIA 2ZUTA 2QT0A 3K9LA 2GZSA 3N53A 4R0NA 5JMPA 1JHRA 2EP5A 1O94D 1CUFA 3MWKA 4Q05A 3DEHA 4HUJA 4EG0A 4NCBA 2L42A 1Z5NA 3UT5A 4BGDA 2PUFA 2Z4RA 3KTAB 1GKIA 2Z8XA 3LY8A 3WIOA 2XQIA 4Q37A 4Z3DA 3OQHA 1GXSA 4MWCA 4Q7MB 2JATA 4F7WA 4WZBE 2Y92A 2HXYA 1U2RA 3H2JA 4QYIA 4QWMA 4BNWA 4WIAA 3THYA 1QHFA 2O2XA 4RVCA 1RBZA 1DJOA 3G7UA 2DH6A 3HM2A 4II7A 3LXMA 3B3FA 2H7YA 3PHLA 4WA7A 1RBMA 1EX9A 2WZDA 3WQQA 1M8JA 4U0KA 1Q95A 5KVQA 3TRFA 3TS1A 1FRZA 6ABPA 3BILA 5FLEX 3N75A 2RJOA 2H4JA 1NZDA 2Q2VA 3EGOA 3JARB 2Y66A 2XODA 4II3A 2WT8A 4A8TA 5H8WA 2OFPA 3MGGA 4RD4A 4ZK2A 1TM2A 3OA0A 1QJ4A 4F3TA 1TTQB 4AQDA 4P5EA 1DKMA 1M8KA 4N6OA 5HIAA 3M6FA 1R8YA 2Q8NA 3IVGA 3ZW7A 5JPIA 3D7NA 4D7AA 4NOMA 3PUZA 3RJTA 3FMOB 3GIDA 2NUTA 1M5UA 1DEXA 4OU5A 2WMDA 4LNHA 4YQZA 3CZQA 3WV5A 5M2QA 3OO1A 3WL3A 5I48A 1GSOA 3WNVA 4KQCA 1I6MA 2IYAA 3EY4A 5BSRA 4K9PA 4XGRA 3WX0A 2WA1A 4BOYA 4B7AA 5KYUB 4Q6WA 1Z28A 1LTHR 2WTXA 4DQUA 2W8BA 2HC9A 4GBJA 2O0JA 5AFSA 4V0OA 4MUHA 5LZ5A 5T57A 2J85A 2HBQA 3A14A 4UM9B 3I76A 4JLOA 1DKNA 2PH5A 3GCXA 2IKQA 1FVHA 2IUEA 4FDVA 2AQHA 1D1TA 2ZDGA 3IALA 3ZE0B 3ITNA 5KNDD 1HMYA 3SHWA 4CMEA 2CLFB 2CVHA 4JC0A 5T5QA 4IJ5A 3UA3A 2QLFA 5LOVF 1QIFA 1WQ3A 4M1OA 4XIIA 3DLBA 3WLEA 5KI6A 1UEJA 5ALEA 3U37A 4LDNA 4DCTA 2QIOA 1Q7RA 4JJ8A 4CLEA 5IYZA 1QFSA 3CE6A 1YOBA 4F1WA 3GRPA 3VV3A 3NIDB 5C4MA 5AW3A 2ZT7A 2E4XA 3IOCA 4CQJA 2P7HA 3ORHA 3B1ZA 1ZUIA 1SXJE 1X1QA 1KO4A 1FXWF 1LXCA 2BCJQ 1W46A 1EK0A 2HB6A 1GOTA 1RQRA 4HVTA 1FU7A 4J3NA 1L7MA 4HNGA 3BK1A 3R6GA 2VUUA 3ESQA 1E5TA 3NORA 2GZDA 5H16A 4AF6A 5KNBD 1IUNA 1SQ5A 3K05A 3MJCA 2OXRA 5D85A 4P3OA 1C41A 1NBIA 2TECE 3WNCA 4FNGA 2B5WA 2H1VA 3Q8MA 4F86A 2YHAA 3A2LA 4G1VA 4ZPJA 4ZCMA 1EE2A 3LUCA 4KQXA 1VDMA 4JVNA 4NMMA 3BCHA 2IDZA 2ZWIA 3FKJA 3PNPA 1NYRA 1D4AA 1WXEA 2R60A 2WVHA 1KYWA 4TS1A 2QMUA 1BW9A 1H94A 3IERA 4YO8A 2WK1A 4HDMB 4Q47A 2FJPA 1E1CA 1WUIS 3O8QB 3IPLA 4LZLA 4HG2A 3IKLA 4YDQA 3DXZA 3CWZA 4P34A 1TXGA 3O9VA 3SC6A 1G21A 5L3SB 3HB4X 2OQRA 2XTZA 2RHLA 1AQIA 3LUGA 4D82A 1PL6A 1Z2NX 2HLPA 2C95A 2JHGA 3HYSA 5EHZA 2B21A 5JS7A 3QEKA 5KJ1A 1KTIA 1JTVA 2NZYA 2W2KA 2X0JA 3H84A 2P65A 1OI7A 3EMVA 1GAXA 4DF3A 3OAAD 3QE2A 4Z4FA 4DNPA 1Z18A 1FDWA 3DSRA 3KB2A 2RHJA 1OWNA 1Q17A 1QLJA 1ULAA 1NF3A 1CUCA 4P92A 4YNBA 2OO7A 4KIGA 4LZOA 4LJ9A 3U3RA 3UOGA 1CDZA 1LC3A 1TW2A 2G77B 3EW7A 3HNOA 2G4LA 2Q4EA 4YA6A 5IVHA 3U6BA 1GTZA 2IV2X 4ZU1X 3RFUA 3P9KA 1AS3A 5I4CA 3R3JA 2IYVA 2OG2A 4NI5A 5ENZA 1NUTA 2QZSA 3VPCA 3UMVA 1JHOA 1OSNA 2CFOA 1YJ8A 1IH8A 3RC9A 5BUCA 3MILA 2NADA 4EGFA 3KO8A 1I4LD 2RHGB 2B4RO 2PLWA 5DHQA 1B0AA 3T38A 2X7XA 1RE1A 1SH7A 3A9WA 3DEJA 1OIXA 4RFSB 4G0QA 4JCCA 3KL2A 3N7TA 4Y2VA 1EVZA 4WMLA 1XC7A 2FSVA 3P5SA 1V26A 2VUTA 2HA4A 3ZDZB 1H22A 5EWMB 2PH1A 3CONA 4IHAA 4PS0A 2PZFA 4E88A 4HAZA 4QULA 3K9HA 3MLAA 4B47A 2R6CA 1ZLXA 4UMDA 3VHXA 1ZH0A 2DFTA 1YH3A 2HQ1A 2TSYB 2VH1A 4OGWA 3KQTA 4FUTA 4NC9A 1XYGA 2E49A 1U2TA 1A2BA 1FMCA 5EESA 4YRZA 3PGJA 1ZWKA 3AR2A 4HGNA 5IT4A 2VDNB 1KAGA 1W0CA 1PW5A 1VOTA 1X70A 4D57A 3TH5A 1E77A 2A14A 1OILA 2JCYA 3GVCA 5BNFA 5BSWA 3TNJA 4Z4CA 2J0UA 1KQPA 4GVXA 1R0ZA 4IQ8A 1GL7A 3TTVA 3ZZNA 5MN4A 3QYPA 3U0BA 1AUPA 3UOAB 1JQJC 3BE6A 4WERA 2DLDA 2IEAA 4QA9A 1R4MB 4B6GA 2FRDC 4EI2A 5IH7A 2O8CA 4V2UA 1W581 4EQ6A 1UJ4A 3HBJA 1DU4A 4URHA 4YV0A 4RDXA 4IV5A 3LKDA 2B25A 4KG7A 4UHDA 3I0ZA 3CLUC 3MC1A 4HX5A 5BWOA 2QM3A 1WKBA 1BEUB 5FR2A 4X1IA 3NGXA 4E11A 1LWNA 4FGLA 3UUEA 4TLAA 1VCHA 2PTHA 2P67A 3B1WA 1NLUA 4IMRA 1BMDA 4CIAA 2MSWA 5E1MA 1JLHA 1RPNA 3FFWA 1XD2B 5CXSA 4QGAA 4MR9B 5GONB 3L2OB 1H1DA 5CJJA 1Q1ZA 4IIEA 4HDRA 3TOCA 1QYRA 4EKIA 3STXA 2JI8A 2HBYA 3PTLA 1SOUA 3JVUA 4A0HA 1T6XA 2PQMA 3D81A 3F5SA 1GQFA 3Q1KA 1T0HB 3DE6X 1PJ4A 3LLSA 1K8ZB 3QFHA 3LL4A 4MWTA 5DTIA 3T4UA 5AVOA 3ZDQA 5AJTA 5AW5A 3IEKA 1SBCA 5ALFA 3ZH2A 2J45A 4ER3A 4EY7A 2IE0A 2Q3MA 1MNQA 5HA5A 2E4UA 3O8OA 5A3RA 4M8KA 4Y18A 1W48A 4G5RA 5JATA 1PZMA 4FYJA 2WINI 2ZAGA 3A6KA 4Q39A 1UM8A 5EZ6B 1UWCA 1T9HA 4XD7D 1LY1A 4ND6A 3WL4A 3W05A 1WCIA 2QGZA 1GV1A 3K1YA 2YZ7A 3F97A 2IS6A 4P33A 1OBHA 1QP0A 2H2DA 3HR7A 2WU1A 3JQBC 4YAGA 1SC1A 3F6BX 1AD2A 3V00A 4CG1A 3WBKA 3K0KA 1AMNA 2FG7C 3DFMA 4L4YA 3G2LA 2PZBA 4DLUA 3O47A 2A7XA 3DXFA 1IPHA 4ACAA 1Z68A 4BMVA 1C0EA 3F71A 5SYAA 4EPRA 4OTZA 5AKXA 4P4NA 4TMXA 4JJIA 4WOJA 5KYNA 1O96B 1G7RA 1XTQA 3AYZB 2ZJYA 2RE8A 4LFAB 4D44A 3IJEB 2PD6A 3IA2A 3NXSA 1UINA 3F4KA 3NH9A 1TW3A 4FYVA 3SFTA 5AKLA 1WB6A 1KE2A 5K0BA 4LFBB 2VAPA 1TKAA 3L7NA 5LQCA 1NVVQ 4K9NA 3H8WA 1IWBB 1BDBA 1T4MA 4KX5A 4P31A 4YCSA 3WLHA 4AN4A 1JU3A 2BTEA 3QYJA 2A92A 5ESXA 1D6JA 1ZEJA 5TVKA 3P9RA 2XGGA 4BNKA 1CS4C 1UXIA 3WJ7A 3CUEF 3N6VA 3CH4B 1FJ2A 3INNA 4YX9A 3F1LA 2OXCA 3JARA 3N2GA 2FLKA 4YDRA 1BN6A 2B20A 3DZKA 3ND7A 5ARBA 2C5BA 5I5GA 1HDRA 2VATA 3ZJTA 1MVOA 4GLBA 2IYUA 4WZBB 5LYJB 1YR8A 2G07A 4M55A 4YMTA 5FWXB 1VJDA 4U02A 4RK4A 3WP0A 5K51A 5TX7A 5L45A 2H2HA 2JZOA 3H9UA 3I09A 3FIUA 4MX8A 4HAWA 1ZBQA 4L75A 3VBCA 2HJGA 4QODA 1AKNA 4JKIA 2X40A 2BUAA 2B5VA 2IS2A 1JSRA 4HWOA 4LQCA 2PGIA 4KO1S 3KQYA 4MV7A 1DOZA 2DPYA 2HQBA 4TRNA 2AZ4A 3UJCA 1XEXA 1NC3A 4ZOBA 5K8LA 4WJKB 4ZRDA 1RJGA 1JQKA 3JPWA 4CQMB 1Z12A 4DIDA 5JCXA 2WB4A 4UE2A 2CNNA 3PA6A 4AMBA 2EJWA 1NXWA 5ALRA 5LM3A 4IH9A 4KB5A 2JFZA 4G5SA 4X20B 2JLCA 3QF4B 1QGDA 1UT5A 2A59A 3D43A 2WUGA 1TU0A 3VNBA 3DL7A 1WPRA 3D6MA 3H5OA 1KSGA 3EC2A 1FP4B 3LYAA 1YWGO 3Q7TA 3LGAA 2DHEA 2XV1A 3JYNA 1TO6A 1I0LA 3MRVA 2YMLA 1NM5C 4PQGA 1S96A 4AKIA 1J8DA 3OQ6A 1BQ4A 3P94A 4Q3AA 3AIKA 3TOVA 3ETDA 2HPZA 2EYUA 5MHTA 3QUCA 4JT4A 1SG0A 1NSTA 1D2AA 4ZO8A 3NWEA 4NCNA 3PQ5A 5DRTA 3A58B 3MMPA 1ICEA 3PUKA 3VYUB 1DELA 4RJKA 4RLHA 1ZY2A 2ZETA 4K1LA 1EG7A 4NU8X 4UBKA 1P5JA 2CUTA 2QLBA 2G88A 2X86A 1I3OA 4MQEB 1NF2A 4V3BA 3M4ZA 1OLOA 3VDMA 3WDKA 4U7FA 3K9WA 2GETA 3WL7A 1ENPA 1TUGA 1KSJA 1P7WA 4FOTA 4OK6A 4RVGA 1R0WA 4WT7A 3A11A 4ATNA 1K0UA 2B8JA 1FDRA 1G55A 3FX2A 4Y2RA 4C29A 4F6RA 4UTVA 4HF7A 5F7JA 1U3DA 1DEKA 1RAIA 2AFIE 2DR0A 2P6NA 1UOEA 2XA9A 4JI6B 4YRSA 3QX7A 2QTBA 5BQ3A 5TSDA 3ZV5A 3D31A 3LO5A 3R3UA 4DRZA 4BRWA 1C9KA 1MOZA 1JR2A 2Q5EA 3FDIA 4NOJA 4AJIA 1XA3A 2O7QA 3EVAA 2EHJA 4ND8A 1QU3A 3FFBA 1TQ8A 1G5HA 4WY8A 1L5SA 1DLJA 3P9ZA 4WLOA 5A02A 5SY9A 2I2DA 3RODA 2O2DA 2ZVJA 4DCPA 4YI5A 4NV1A 1UQUA 3MAGA 4FR0A 1WU8A 1XVLA 3D5EA 2WM9B 2HIHA 1ADBA 4R8KA 1XTRA 1L4LA 3FDJA 4CF4A 1YFLA 4NCXA 3H87A 4MW4A 3PLNA 4HPXB 4C0QC 2Q5IA 5CXXA 2WRZA 1V3QE 4H7JA 1ZRSA 2Q1WA 1L8QA 1TF5A 2C2GA 1WQ1R 2NSLA 3DR3A 2HW8A 3KUDA 2YV2A 5J2UA 5KYXA 5CCXA 5HIKA 3HVIA 4YP6A 3OESA 1QV7A 5LKAA 2YFQA 1BXZA 3JRWA 1DKRA 2H4HA 1ECPA 3CKYA 3ZHZA 4WDQA 1AN0A 1DQYA 5BSUA 2D5CA 3L8ZA 1BROA 4A27A 1EGAA 4Z51A 3IO5A 3SSNA 1H8HA 1I51A 3C8HA 4QOEA 1QKJA 4AZWA 2PE5A 1PFKA 4HV4A 2H51A 3GY0A 4WGGA 5IEJA 2QE6A 3BFKA 4TRMA 2LP4Y 4HNHA 1VI2A 4GDMA 2HZ7A 3GPLA 3HCDA 1I94B 5DEOA 1YONA 4PZAA 1PEYA 2H1LA 1GNPA 1M54A 3PEEA 4XX0A 2DLCX 1E6UA 1B74A 2DUUA 2IY7A 1RE0A 2JZNA 2ZCUA 1X8KA 2ZYIA 3BXGA 2CK3A 4ME6A 4YH1A 5EHNA 5HF5A 2H65A 1M7GA 2H4XA 3R0VA 4NX2A 1OAAA 4P3PA 5L6LB 1XZDA 3IH5A 4Y0VA 4HNSA 5BN4B 2IYRA 3CLUD 3K70D 3NG1A 4E13A 4S0XA 4RK5A 3AJ8A 3BB3A 3E9CA 3FFXA 1CERA 3C3JA 5A71A 4YHHB 2QSYA 2AG8A 3O8LA 3K30A 1XAIA 4K88A 4TLBA 3UAZA 5JJKA 2IYEA 2P11A 3IB3A 5CCBA 4C0BA 5BQ5A 3JR7A 5K0SA 1P4HA 4BV2A 3D8HA 2Q3JA 3IUBA 4Z0PA 4DQVA 2AW5A 4TRRA 4YVFA 1XJ5A 3DCYA 3G5AA 3KWLA 3BHMA 3OD1A 1AQNA 2C20A 2COEA 4BLOA 1SK8A 1CQZA 3BD8A 3TTXA 4