2RGGA

Crystal structure of h-rasq61i-gppnhp, trigonal crystal form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
159
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Transformation Efficiency of RasQ61 Mutants Linked to Structural Features of the Switch Regions in the Presence of Raf.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein
total genus 59
structure length 159
sequence length 166
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rggA00
2GDJA 4X8LA 2FSGA 4PHFA 2ZM5A 3HP1A 5F2EA 3RNLA 3CO5A 1KI2A 3IEUA 1M74A 4O2LA 2CL7X 4BFYA 4C4PA 1ZNXA 3FDIA 5K8UA 3QEOA 2FSIA 1VPLA 4EQ6A 1BMFD 1FPMA 2Q3FA 1ZUIA 1N5IA 2J1LA 1Z06A 2EYQA 2JAQA 3QNUA 1VIAA 4E03A 2JJ1D 4RSGA 4A0FA 2OZEA 2GEUA 4DCNA 1E2JA 4IDNA 4KLZA 2WJIA 1NBMA 2YWGA 3P27A 3ZVMA 5G3YA 5EXXA 4GPTA 4IDPA 1E99A 1DO2A 2PZEA 4EJSB 1RPZA 1NVVR 2BMEA 2GJ8A 1OH5A 5GJVC 2JDIA 4XIGS 3L8YA 2WPDA 2FMXA 3BJIC 3CM0A 4DCSA 2AWNA 3NTUA 3VR6A 3CWZA 221PA 4H1VA 1FQKA 4FWTA 3FKSD 1E2GA 2DFTA 4FXPA 1T5IA 5BN4A 4HI0E 1UAAA 3EZ7A 1ZM7A 3P1JA 1QHXA 4LYFA 2XX3A 1G17A 1NJGA 3I72A 3EPJA 2V8OA 4B76A 4TYWA 4GBMA 2DWOA 4GP6A 4PQYA 2QG6A 4M4SA 4MRSA 4LC1A 3GEIA 1MRSA 1NVXQ 3CUEF 3M1IA 2XZPA 3QENA 3VHLB 3A1SA 2FJUA 3DEFA 4KU4A 2FFQA 4NYMQ 1GIAA 1SVMA 2QORA 1NMYA 1DAFA 3KKMA 2DYKA 2FZLA 2GTPA 1J7KA 1OXTA 4I4LA 1Q21A 2ZU0C 3BC1A 1Q0UA 4K8OA 5EP2A 1Z22A 2JASA 4B35A 2VF8A 3SQXA 1XD9A 1P75A 2ZQ5A 2H5EA 2ZE5A 3OHMA 2ZVPX 1O87A 1J8YF 4II7A 1TF5A 3RABA 1NSTA 4I81A 2CLSA 1KIMA 1HYQA 2E87A 2RGNC 2AWOA 2ZUCA 4HSEA 2GCPA 4KYUA 5TV2A 2C99A 2NO9A 3VX3A 5BQ5A 3T5GA 4TTPA 4Q4HA 2QBYB 3LAWA 2JLRA 1ZVQA 2IW3A 3SNHA 3Q5DA 4QGGA 3EWAA 4RD0A 4KSBA 2Z0MA 5DE3A 2H16A 1IXZA 4K81B 5IDVA 2QNRA 4NYJQ 4KLNA 2A5GA 2W2TA 5H70A 1EFTA 4IRUB 3B13B 4NMMA 2WSSD 4BQSA 1U0HC 5DI3A 2YVUA 2J87A 2ERXA 3C8UA 4RY2A 5G40A 2F3RA 1OE0A 3SYLA 1FX0B 1H65A 1KMHA 1TQ4A 2J45A 3B5JA 4G5RA 2C9OA 1VYTA 4QGFA 3DHWC 2DFLA 3WNDA 1IAQA 2D2FA 3IEVA 2V7QA 1P73A 2XTNA 3E70C 2REXB 4LRWA 2DFNA 4LBWA 4WW0A 5F9FA 3GLFA 1S0UA 2VSFA 3NH9A 3IGFA 4YMVA 2FFBA 5BN3A 2EFEB 1G21E 3DPUA 1CBUA 4RFVA 3DZ8A 2IWHA 4P4SA 4ZKDA 2PBRA 1EG7A 1WF3A 4DT1A 3ZVRA 3U44B 2DR3A 5KPDA 3RC8A 4WXRA 2R44A 2BCJQ 4JLAA 2GEVA 3Q3JB 4L15A 1P72A 3T34A 4D4LA 3IIKA 4BGDA 3WYFA 2OEPA 1XMJA 1GNRA 1H8HA 1XF9A 1M8PA 3DMDA 4ZDJA 4X8HA 3AVWA 1EFHA 2GAOA 1UBEA 3TUJC 2EFHB 5FR1A 2A7QA 3RYTC 3ZQJA 2XGJA 4X8MA 3T61A 1VCIA 1SVOA 4NYIQ 1SHKA 1ZD8A 1XDBA 1RYFA 3ASYA 1SVLA 2XXAA 3CNNA 3FMIA 2IYRA 3KZ1E 5L3QB 4MYTA 1YZLA 4RD6A 3GJ7A 1TEXA 2P6NA 1KNQA 2PEZA 3VKWA 1WXQA 2A78A 3RRNA 2ZVQX 1AS0A 1UKYA 4ARZA 4OHWA 4TLDA 4WVFA 1W4AA 1G5RA 1ZU5A 2IYZA 4DWJA 2C77A 4TYQA 3SQWA 3C5CA 5FBRB 3VNVA 2MMCA 5D3QA 1KDRA 3KXKA 1YRBA 3B1WA 2PLRA 1JQLB 4RD4A 1AN0A 1QVAA 1KOFA 2GVZC 4M9XA 3PEYA 4IDOA 2D2EA 4NCNA 3QSYA 3Q5EA 3FFAA 4FI3C 5EZ6B 1Z83A 4ON9A 4EUNA 4YMUA 1GNQA 1ZM3A 5JCZA 1IXSB 2B8WA 3QXJA 4EPTA 2DCUA 2FPKA 3AF4A 1T9HA 3QE0A 1YR6A 2FX3A 3P26A 1WA5A 2FN4A 4EPRA 3ZDQA 2QPAA 1SXJC 3OESA 1DE0A 3ICEA 3HU3A 1Z07A 2O0HA 3AF0A 3KKPA 3U7HB 1G5TA 3UMSA 2FSHA 4AIIA 2OLKA 1K5GA 3BERA 5ANRB 1HE8B 1N2CE 3R8CA 3EPLA 2AHOA 1ZINA 1CF4A 3CH5A 5HCIA 1G8YA 2VP0A 2REBA 3B1YA 1M6NA 1II0A 4JLJA 4WA7A 4GNKA 2ZYTX 1M7HA 4XD7D 2NZJA 4CT4B 1ZNYA 2WIAA 3JVVA 4A8JB 2HT6A 4V0KA 3K0CC 3QKTA 1XZQA 4KI0A 4MDFA 2FU5C 3IPXA 3PUVA 2ZRFA 4QBFA 4B6FA 3QY0A 3TSOA 4QM7A 3W5IA 4TLBA 1LF0A 2VIIA 2IHBA 4A6PA 1F2UA 4HLQB 4LPSA 3DVLA 3CB4A 1YRAA 3S1AB 1CR1A 1L4YA 2QU8A 4C0LA 3KTAA 4LYHA 1N3BA 1U81A 1ZCBA 5DO9A 2DWQA 3TR5A 4TZ6A 1ZBDA 2ZI3A 4QNRA 4DUGA 1KZGB 1M7GA 5KO2A 1BS1A 3A8TA 4YXWD 1JJVA 2RHMA 1Z0FA 2HDNB 3RRMA 2Z5FA 3NKVA 2LKDA 1ZAKA 3QKRB 1X1RA 5FOUA 2HF9A 3FMOB 2VHQA 1WQ1R 3AGPA 4QG7A 4KJZA 1CJMA 4D4MA 1ZIPA 4DLSA 1JECA 2F9LA 2DBYA 3RSLA 3PIRA 3IBYA 3IILA 3SR0A 4DSNA 5FH9A 3U61B 1R5OA 3EC2A 3C7KA 2JIZA 2F6RA 1JR6A 1E3MA 1XEXA 2ZPTX 3FHTA 2ODNA 4LDJA 4XH9B 2ZRDA 2ATVA 2C9YA 5HR5A 4W5HA 1V5WA 5JFGA 3THXB 3RWMB 1ZUNB 3HDTA 3P32A 3TK1A 2WMNB 1N0VC 1G3MA 2W6JD 2QT0A 1MOZA 3VR4A 4JLDA 2YINC 3HU1A 3K09A 3REFA 2NOAA 2WIBA 3GJ4A 3ZS9A 1HQCA 2FA9A 2VSXA 2ZYUX 1SXJE 1VG9B 3P20A 1KI9A 2IUUA 1P3JA 5EP4A 1D5CA 2J0QA 4B34A 4Y0AA 4Q4AA 3CZQA 1BH2A 3FYHA 1KSJA 1N5JA 1UPTA 3ZIAD 5B64A 2NQ2C 2Q3HA 4AWXA 2YOHA 2FH5B 2F1JA 2V6IA 2N46A 1KJYA 1FQJA 2F7SA 4RVCA 2OBLA 4V0NA 4LJ5A 1IN5A 1FMLA 1NNEA 3T35A 1FP7A 4BASA 1YR7A 1QG2A 4TQUS 4IFEA 4MA4A 2XOKA 1DBSA 4IXNA 5EXPA 4BUJA 4OBEA 1N5LA 4AKEA 2HJGA 3WXMA 2VYFA 1R0YA 1W0JD 2W00A 1SXJB 2ZYWX 3A1TA 5FBLB 3J81k 3ZZTA 1XTJA 4JVMA 5EUMA 3HJNA 2QMEA 2O8FB 2QRNA 3NC1C 4LJYA 4LHWA 1PZNA 1HURA 5EQTA 5F9HA 1E79D 4BZPA 1MKYA 1XRJA 2ZITA 1XD2B 4JSYA 1VTKA 4URXR 4DB2A 2HCBA 5GJWC 4Y0VA 3NEYA 1BOFA 4Q1BA 1KNXA 1S1MA 4HB4A 5EE0A 4HB0A 2IYWA 5K8TA 2ZAMA 1HEIA 1IY1A 1SGWA 3QG5A 1NF3A 1QHHB 4HZUB 1J70A 1E9SA 3OFND 2NPFA 1GKIA 4IHQA 4V0MA 2C03A 3A4LA 4POAA 3CPJB 3KKQA 4B3XA 1R2QA 1MABA 5JS7A 3TLXA 1SXJD 2Q0HA 5JS8A 2OE2A 4H1UA 5FUVA 3HPRA 4CEIA 1R7RA 2WWFA 3KQUA 3IBGA 3HYTA 5DN6A 1ZD1A 721PA 2IS6A 1IY0A 4TYPA 4TYYA 1G18A 4LWZA 1RW4A 3ZLJA 4WXPA 5EP3A 4EPVA 1OKKA 3OEEA 1QG4A 1P5ZB 2J0UA 1NKSA 1R4AA 1US8A 4M9QA 4AI6A 4OQXA 3VR2A 2Q6TA 3FOZA 4FW9A 1WMSA 3U2QA 3T1TA 4PPFA 2X77A 1NY6A 3O8CA 5JSZA 1HTWA 3U3JA 4HATA 2A5DA 2J7PD 3GLGE 3CRQA 2Q9BA 3L0SA 2QM7A 3PFIA 4M1KA 4AC9A 1OH7A 3AB3A 3RLFA 5JEDA 3AKDA 3D8BA 4HB3A 2J9RA 5JRZA 2PJZA 1UBCA 4OHXA 5JHHB 3BE4A 4TL7A 1G16A 2JCSA 3LVRE 2K5UA 1Z08A 3OEHD 1DAKA 4O25A 4NL4H 3DDCA 5LB2A 4MGYR 1NVVQ 2GESA 2CBZA 2NGRA 4MKIA 3A58B 2A9KA 2CCGA 1KI6B 4QJ4A 2CCJA 2VHJA 4IOKA 2XB2A 2BDTA 2R6GA 1QRAA 2MSEB 1UKEA 4B48A 4PPNA 4URYR 4PC7A 3UK6A 2D7CA 2GXSA 3QF4B 4JLMA 1SVSA 1CEEA 1OH6A 3NC0C 1Q3TA 2GRJA 4OHVA 4LK2A 4CZ2A 1ZD9A 3GLGB 1XPRA 3TAUA 3MWJA 1T8UA 3PCRB 3LLMA 4S2EA 1P6XA 2ZSDA 4OI2A 2CHGA 3BIFA 5FI1B 4MDEA 2VF7A 5J4LA 3SBEA 5JJKA 4PFSA 2HF8A 2R6AA 1S1CA 1GAJA 4JVSB 1OHHA 4KCGA 4PZZA 1UF9A 3HR8A 3K1JA 2WKRA 4E5UA 1KI4A 4Q9JA 1J8MF 2BKEA 2GJKA 1OYWA 3WBJA 4JVNA 1YHNA 3GEEA 2JATA 2R2AA 4NTZA 4R98A 2PL3A 1NVWQ 4GMDA 1DAEA 3FHCB 4NPHA 2HLDD 1W49A 3L0IB 4LGMA 3KXIA 1T0HB 3C15C 3X1DA 4DLZA 2X2FA 5TXGA 2A5YB 1GKYA 1CRPA 5FOSA 1S3SA 4UKDA 2PCLA 2AL7A 4C7OA 2IK8A 1AQYA 1CLUA 3QJYA 2ZR9A 2XAUA 5LD2B 4RJLA 3QVUA 4MQBA 4XSGA 3ZD6A 4C0BA 5B2ZA 4G5SA 1XXHA 2EW1A 4FMDB 3Q7PA 4KVAA 3LFUA 4B3DA 5SZKB 1NL3A 4Q7LA 3VHXA 5KSOA 2AD1A 2V6JA 2ZRBA 1ZW6A 3RC3A 1U8AA 2RGEA 2FSFA 1Z29A 1KO5A 1B23P 4JVLA 1F6BA 1M1YE 3A1WA 3RANA 4Q00A 4TL8A 4HB2A 3A1UA 1JAIA 3NIBA 1JXOA 4BFZA 1WBBA 4ZCIA 5HZKA 4FCWA 4XWAA 4X8OA 3X1YA 4JT2A 3CWQA 3DKPA 8OHMA 4Q7MB 4PO9A 1KK2A 3U4QB 3D7MA 2NG1A 4DLTA 3WP1B 4XVQA 2VLIA 4RFSB 2G88A 5FOWA 5HE9A 4BLOA 5HKKD 5J40A 3RRZA 4M0LA 2O8BB 4ESVA 1DADA 1XB2A 1N6LA 4EPXA 1MO5A 5FI0B 2CK3A 3TRFA 2ZR0A 4PANA 1NN5A 4YQFA 1EX6A 2J46A 121PA 3GJXC 4DEYA 3U3OA 5FR2A 4OI1A 3AH8A 5L3SB 4O0MA 1E94E 1EXMA 2GBLC 1G41A 5E95A 5FUYA 3BH7A 4XWKA 2OBMA 5HCNA 4F38A 1U9IA 3LWNA 521PA 1C4OA 4JL8A 3LXRA 2ASEA 1ODFA 1RZ3A 4BEBA 2EWWA 1E96A 3SJZA 2CHQA 4P0TA 2WWIA 2KB0A 5DYIA 3TVDA 3WNCA 4QRHA 4AYWA 4A9AA 1VCOA 2BKUA 4ITRC 3TR0A 3UWKA 2J5XA 1F2TB 2O8DA 2J0VA 3SJAA 4PHGA 4HZIA 2ZS8A 1CS4C 3Q8XB 2GKSA 3L82B 4W9MC 4EIWA 4NCJA 1OXSC 2P5SA 1CR2A 2IS2A 1EESA 2P6UA 4PX9A 4C2TA 3K0EA 1NN3A 2W0SA 5KU1A 2L0XA 4QHTA 1S4QA 2G0NA 3QXCA 1SZPA 4RZ2A 1I2DA 2A2ZA 1E2IA 2GJSA 3VQTA 2ZI4A 5FTJA 2VHCA 4MKHA 4TMTA 5FUWA 5JJIA 2D3WA 4KAXA 1MO3A 4I1SA 4QJ5A 2WJGA 3AKYA 2F55A 1II8B 2PT5A 1G6HA 3KB2A 4N0DA 1W4RA 1O3YA 4BWYA 3DM9B 2ZRKA 5JBQA 2NO7A 2IWRA 3L0PA 3K8YA 2I4IA 1QHGA 5BYJA 3GLHE 1NJFA 5E7MA 4B3FX 1W2HA 5KNDA 3O8RA 1KHTA 1NP6A 4FMCB 1G7SA 1NBME 3CLVA 4NZYA 2AFHE 3BRWD 3CPEA 5HTKA 5AUNB 1UDXA 1GITA 2WBLC 1YE8A 1BMFA 1E2KA 3JZAA 5HZHA 1M34E 1W46A 4DLXA 2YOGA 3BK7A 4EQ6B 5JZVA 1SKYE 2C2HA 4CDGA 4ZIRA 2JJ1A 3HYRA 3WMGA 2XSZD 1CTQA 3D6TB 5IK2D 1GZSA 1PLKA 2W6IA 2XB4A 3IQXA 2ZEJA 3R9IA 1WBDA 3W6OA 1IJEA 2G83A 3GLHB 5CM8B 1GRQA 1Z0AA 3CR7A 3K0AB 5K8IA 1OH8A 2P5TB 4UXHA 1JBKA 4PSKA 2IL1A 1EFRA 5B30A 1Z47A 1R8QA 1Q57A 1UBFA 5FTMA 1W4CA 2REOA 4TT3A 1WRBA 4QL3A 5JI2E 3E2IA 4RCZA 1JALA 1CR4A 3LBNA 2H1LA 1QHNA 4LJ8A 1IBRA 1GSIA 1MT0A 3UMFA 1JPNA 2B8TA 2LCFA 4A2QA 2ZRHA 4GRAA 4G1UC 4MRVA 1SKYB 2IXGA 3PEVA 3A6PC 2ONKA 1ZP6A 5E3HA 5FTLA 2O0KA 4IVPA 5FTNA 1QHIA 3EPHA 2H57A 3LBIA 2P67A 3QXXA 4M2LA 1CU1A 4JL5A 3ZJYA 3KKNA 4YDSA 3JVUA 4R71A 3B1XA 4PC2A 2YV5A 3NBZC 1DELA 1Z0KA 2BBTA 2D7DA 5SZJA 3MD0A 2VH5R 2KI5A 2GBLA 4MRNA 1NBMD 1G3IA 2YC4C 1W44A 3C5HA 3CRW1 5EE5B 1JR3A 1W47A 1TX4B 3TH5A 4LPKA 2VTKA 3DO6A 4NKRA 2JDID 2WPDD 5CDFE 1PJRA 1WP9A 4M1TA 1GWNA 2WM9B 3OIUA 2PX0A 1E1QA 3KJEA 2NIPA 4TTQA 4HUQA 2UZ3A 2ZI9A 3M6AA 3DZDA 3R20A 2CEAA 4M1MA 2AXNA 2OFOA 2X19A 4DLVA 3GLFE 4B75A 1I4DD 1LY1A 1W4BA 2E9SA 4BFTA 2WSSA 1NMZA 2IXFA 4PSVA 4CVNA 2IC5A 2HEIA 4D82A 3MGCA 1Z6GA 2JEOA 4CGZA 4PXAA 1KK3A 3E5HA 4HLUA 3EA5A 4WOPA 1OV4A 2BC9A 1KDPA 1OSNA 1ZNWA 1COWA 1YQTA 2PT7A 3TNFA 3EX7C 4N0EA 2QM8A 1GG2A 1N5KA 5AJXA 2R62A 4UQOA 4OQFA 2IBMA 2C5LA 2EFGA 3IO5A 1U2RA 3I73A 4KFTA 4G5OA 4ASUA 2BOVA 4TLCA 4KVGA 4ZI2A 3TGPA 4LJ7A 2OM2A 2QBYA 3SOPA 3GFTA 4TYNA 2IUSA 4XJXA 4B3GA 3RWOA 1LNZA 2NO6A 1I4LD 1TNDA 1W0KA 1OLOA 5CITA 3H84A 2R6FA 4KODA 4DT1B 1D8TA 3KQHA 1SULA 3QPVA 1MRNA 2QP3A 1VG1A 3AGQA 2WWHA 4RCYA 4AD8A 3C14C 4ZDWA 2WMOB 1XFAA 4D0LB 2CNWA 3X1XA 5G53C 1ZUHA 5CM9C 2DPXA 4IEEA 3GLIE 2NO0A 3TUIC 3KJHA 2BM0A 1LFDB 2ZRPA 5DISB 4A4DA 2JLQA 1CJTC 4MGKR 3LXXA 3H0KA 4OYHA 2FWRA 2PMDA 1T3HA 2ZI5A 2PCJA 5CLLA 4Z8YA 1S9DA 2ANBA 3QQ5A 3EWSA 1A7JA 2V7QD 4CRWB 1Q20A 2XXAB 1GL9B 4JS0A 4B71A 1LF5A 3TQCA 5FBQB 3ND9A 1WB9A 1KZ7B 2FGKA 2P6RA 3K09C 1D2EA 4HAWA 3U44A 3B8HA 4UXJA 3LX8A 2BJVA 4B74A 1XJCA 4ARZB 3CNLA 4JLPA 4U00A 1E32A 1LW7A 2HV8A 5LBIA 3LRPA 5EE9A 3GLIB 1OIVA 3WY9A 2PJRA 4PHTA 4DHEA 3TBKA 2IT1A 3QXHA 1T5LA 3FHOA 1F48A 1DARA 3B60A 1H8HD 1YU9A 4FCTA 4LC0A 2P0EA 4B3BA 2ONJA 1IJFA 2FOLA 4D0GA 1E0KA 1II9A 2X8AA 1WDTA 2GVDC 2OG2A 1Z5ZA 3AF1A 4AG6A 3CF0A 1DAIA 3LW7A 5L3RA 1NY5A 2GZHA 2GK7A 4Q21A 4WZAE 1E2PA 5IT5A 4F91B 2AK3A 4DLUA 4LV8B 4QKQA 4F93B 1IXRC 1RC8A 2NMVA 2ZRJA 1N6OA 4O2RA 4N1AA 3RDPA 1G3RA 2WWXA 4TWZA 1E98A 1P62B 2ZYVX 1A2KC 2XNDD 3I8XA 2CMKA 3VNUA 1KDOA 1ESNA 1YZNA 1G291 3BD9A 2YHSA 1JB1A 1E2LA 1UEJA 1G4AE 5GJBA 5GVSA 1GNPA 1AS2A 1UKZA 4GOXA 1XBTA 5M04A 2XZOA 4KHZA 1KJWA 2O8CB 1E9BA 1XWIA 4Q47A 3U5ZB 3SE0A 4LYAA 4R9UC 2GA8A 4IJMA 3W34A 4C0QC 1XZPA 4KFRA 2ZROA 4OJQA 1BKDR 1QZXA 2XJ9A 2D62A 1LV7A 2FPLA 1F2UB 1NLFA 1XMSA 4NP6A 1OXVA 1XCPA 3HR7A 5FL7D 3LA6A 4RKFA 5F3WB 4ZCMA 1HT1E 2XTZA 1W2GA 5H8WA 5DHAA 5CYOA 1R0ZA 4IDHA 1D9XA 3M4YA 1CXZA 2F1IA 3OE7D 4S35A 4KV9A 1TPZA 2FFAA 1CKEA 3QKUA 4CIDA 1G6OA 1KDTA 1QDEA 1R0XA 4A8JA 1XTQA 2SHKA 1RRGA 1TQ6A 1RRCA 3DMNA 5CJPA 1GILA 3BGWA 3PENA 1U0LA 3SU8A 3W6PA 2GCOA 1P9WA 4NHOA 1ZJ6A 1N0WA 4DCVA 2GF0A 3VKGA 4TMWA 1P61B 4JT4A 1U8ZA 2GZAA 4M22A 4D26A 3H86A 5TMPA 2QRZA 3AP3A 1G19A 3I3SR 3FKQA 5CIQA 3S1AA 1UJ2A 2FG5A 5KNCA 4Q7JB 1E2EA 1FOEB 2ZXUA 4WIAA 2B7CA 1FNNA 4B73A 2ZE7A 1OFTA 2W6JA 4Q4JB 2WZQA 3C41J 3NWJA 5CJ2A 3D3QA 2DB3A 2QAJA 3Q85A 1OFHA 1Q12A 4M53A 2FDCA 2OUKA 4DUGD 5E7IA 1Q1QA 1YZTA 4WZBE 4DVGA 2H92A 2E1RA 2IYQA 4DDUA 5KPJA 3THWB 4LBZA 4W7SA 1K8RA 1VHLA 1KJZA 4HDOB 4U02A 3ZZUA 5JWRA 4BFSA 2ZUBA 4R2HA 1D2MA 1W36C 2AXPA 2WWYA 3BB1A 1Z6YA 1E4YA 4OQLA 4QGAA 4Q4AB 2JLYA 1SHZA 2ZRCA 3EZFA 3G0HA 2QA5A 2JGNA 4FWIB 3AVTA 3W3ZB 4PR0A 3P4YA 2CHVA 2ANCA 1I4TD 4M1WA 3A4NA 1GVNB 3KJGA 5CK5A 2PMKA 3REGA 4UJ3A 4A36A 4AY2A 4XVRA 2JIZD 4DDTA 4DC9A 1QBKC 2B6HA 2F9MA 4YLGA 1E9CA 3OAAA 3THXA 3L43A 3GJ3A 3K0FB 2IEYA 3ZVNA 3GJ8A 3KUDA 1GDDA 1GUAA 4IVRA 4JJKA 3QKSA 4AG5A 3TE6A 4JZKA 3UMRA 2ORVA 2OAQ1 4I1VA 4IOLA 1SQ5A 4UNPA 3UIEA 4V0ME 1E1RA 4M9SA 1TU4A 2MSDB 1KO8A 3AF3A 3AKCA 3NBXX 4B43A 3CBQA 4ERNA 4Q1DA 1BYUA 4TN1A 3WHKA 2ZE8A 4CEHA 5J5CA 3B1VA 4B6EA 3ND8A 3AVOA 4G5QA 1UEIA 2VA8A 4C3ZA 3CF6R 4V03A 3T15A 3EXAA 4ESHA 2OHFA 1OB5A 3MJRA 3AF2A 2F1HA 5FPTA 3EIQA 4FMBB 2YOFA 3EASA 5FBWB 4RD2A 4F92B 4L5BA 4PAMA 2NZ8A 2BMJA 1KAGA 1R6BX 2GF9A 5DYGA 3WMFA 4TMXA 1ZM4A 2GAAA 2CLCX 3DL0A 4CT5A 2X1VA 2VPPA 4OKSA 5JMTA 5L3VA 3THYA 4YMWA 2XOKD 2ZSEA 4DKXA 2BM1A 2HXYA 2O8FA 3AP2A 4C0JA 3KXLA 1X1SA 3NHAA 5P21A 3H1TA 3PEWA 2WTUA 2TMKA 3K70C 4PHHA 2D74A 5IHPA 1S3GA 3KQNA 1PVOA 2HT1A 4OK5A 1T4GA 2A3RA 3SC3A 5J4KA 2AKAB 4LX0A 2A30A 3NBYC 3SFVA 4LUCA 3NXSA 5TDHA 2ZJAA 4WZ6A 2UVQA 3LW8A 1EFCA 5DGXA 3AUYA 3AVXA 1US8B 3SDZA 4CEJA 5TARA 2ORIA 1QHHA 2WAYA 3BORA 5LDDC 3EG5A 2JLXA 5ELXA 1OXUA 4LJ4A 2J0SA 4IVQA 4AKHA 1SKQA 1NLYA 1P2VA 5GJCA 1AZTA 4RZ3A 5KSPA 1KGDA 4FCVA 2JLSA 1IONA 3AKEA 3KB1A 2YJTD 4MRRA 3T5DA 1FTSA 3JZMA 1U9IC 2ZJ8A 4BPBA 3MCAA 1IOZA 2WICA 3ONWA 2N42A 1GL6A 1BYIA 1U99A 2J7KA 2ZE6A 3QF7A 4PO8A 1S8FA 4B47A 1ZNZA 4KXFB 1EFUA 3PG5A 1RRFA 5DN6D 1C1YA 2VBCA 3SHWA 1D6JA 4IKEA 3IPYA 3THOA 3VKHA 1KAOA 1OKKD 3RS7A 3OEED 4Q19A 2WJJA 2YYZA 5BN5A 5E7JA 2RGAA 1N25A 1W36B 3OIYA 3RS4A 2DWPA 4EKDA 4D81A 1OT3A 2ZRAA 2OFWA 5JWOA 1YZKA 4MYCA 4GMXA 4US2R 1KKMA 4Q9LA 4L9WA 4HUTA 5CIWA 3IKJA 2RGBA 2QY9A 4F4JA 3QPWA 4U5XA 3U60B 4BLQA 2Z43A 1X6VA 2D4HA 1A1VA 2OCBA 3DM5A 4P4UA 3BH6A 2FF7A 1Y63A 2WWGA 4A92A 1DO0A 5EP1A 2OLJA 2ZSAA 3PEUA 2HYDA 4LHVA 4XVUA 1XU4A 2VSOA 1HY3A 4PQFA 5A4JA 1AM4D 1I2MA 2QPTA 2ZIAA 3AVPA 3CRVA 3TW8B 3AVVA 2ZJOA 3GJ6A 3HWSA 4MITA 3PQCA 4QBGB 3RS5A 1KI8A 4PO1A 4Q18A 5A5GA 1U0JA 4DIEA 2P65A 3NH6A 3QF4A 1JPJA 2HYIC 3KFXA 4Q7KA 1RFLA 4LOAA 3KFVA 4GP7A 2KSQA 2QGNA 5A0FA 3UXMA 1NVUQ 3IQWA 1W36D 5H68A 4YC7A 2C98A 3I62A 1VDZA 1OFIA 5FTKA 2JJ2D 1VYUA 1KI3A 1Z8FA 4C7OB 2CJWB 4P32A 4DDWA 621PA 4DXAA 5EJEA 3U3MA 3B1ZA 1Z0DA 3BAFA 1LB1B 3O8DA 3B2EA 5C1BA 2GCNA 4IOJA 1RIFA 3CH4B 1KI1A 1OHHD 3LQQA 1G3QA 4Z1MA 5LB4A 1EK0A 2ZI6A 1DAMA 2VRWA 1DAGA 2ATXA 2QAGC 4Q66C 1E0AA 1JI0A 5EUQB 5KYKA 4KYIB 4LJ6A 4PTLA 3ETLA 1AGPA 1RJ9A 2OESA 3CRRA 4TQAA 5FL3A 4WBSA 1NN0A 4TMKA 2JLUA 2AN9A 3GD7A 1E9EA 2BBWA 1XCMA 2VQSA 4Q5IA 3UPUA 3K70B 3ADBA 1G8PA 2QEQA 1J90A 4URUR 3B9PA 1KSFX 2Y8EA 5DI9A 3CNOA 3MWKA 4DSOA 4A82A 2RB4A 3MMPA 4C2UA 3AQ4A 2IEZA 4LYJA 4YONB 3MUFA 4QHYA 1ANKA 1E2QA 3PVSA 1TAGA 1E2NA 2QSYA 3B6EA 3QXSA 3T06B 4EPWA 2JA1A 1W5TA 1VG0B 3AVQA 1HH4A 821PA 3R8FA 2UZIR 1X8KA 1YVDA 2W83A 2CVFA 4PZLA 3R9WA 4U7DA 4EJSC 1QHYA 1E2FA 1H8ED 3KKOA 3WYAA 3X1WA 1G8GA 4GT1A 5BW8A 5HPYB 4UJ5A 5CLQA 3I32A 3K70D 1VG8A 2YC2C 3CF2A 2QMUA 4RFSA 3QOFA 2QQEA 4GSYA 1GM5A 1P2TA 1QHSA 1RE0A 2OT3B 4D2IA 5D3MA 1OFUX 4GOJA 3SJCA 4LY6A 4IFBA 2O8DB 3RS0A 3FWYA 4OI0A 4PZYA 4KFSA 4BECA 1ETUA 5AJVB 5UKDA 3U3KA 4GDFA 1X3SA 3R7WB 4TMZA 5JWHA 4BFXA 2F43B 2WJVA 5FFMA 4Q1EA 4DSUA 3A1VA 5L3SA 2CK3D 2OFXA 1OIWA 1UDWA 5DLQC 4EAQA 2FPMA 2H18A 4Q1AA 4EDHA 1N6RA 4YDHB 1A5TA 2QE7D 1QF9A 3RS3A 1Z3IX 1FUUA 2KBEA 2ZUDA 1PLLA 3GJ5A 1XNJA 4HAZA 3VU9A 3A36A 3V4RA 5EXSA 4HLUC 4PAOA 3KJIA 2QPOA 3VTKA 3NBFA 3QVVA 4JLOA 2V1UA 5JI3E 1YZQA 5AUQA 3F8TA 4FD2A 2O8EB 1KK0A 1VHTA 3I8SA 3K53A 2ZTSA 3TSWA 2FEMA 1F2TA 4A0GA 2RCNA 4GZLA 4HAYA 1NRJB 3WP0A 3X2SA 4OHYA 1N6IA 2PX3A 3QIAA 3K9GA 4TSFD 5AJWA 1XTKA 5EE3A 4FMDF 2GILA 2P2LA 1Z2CA 3GMTA 4L16A 2Q9AA 2QGZA 3GFOA 4QJ3A 3AUXA 4HAVA 5KSYA 3L8ZA 4LHXA 4JJZA 4JBWA 2AD5A 2J59A 1G8HA 2IYTA 4TTRA 3W90A 4D0NA 4CF7A 3IHWA 3FMPB 5C4GB 2QN6A 3PITA 4HLCA 5KDLA 2JLZA 2RGDA 4M21A 1EX7A 2MMGA 3N2EA 2RMKA 1OB2A 3MLEA 1OW3B 3BXZA 1LTQA 3GCGA 4TL9A 3ZZ0A 4NCKA 2QAGA 4I99A 3ZVLA 3FKSA 2R6CA 3KL4A 5B58C 3CONA 2ZJZA 2A5JA 1KSGA 3W5JA 2ZS9A 1JR3E 3EA0A 1P7CA 4TLAA 3T1QA 1Q22A 3QG1A 1GFIA 3FTQA 5E4FA 2OAP1 2QUZA 2Q3MA 3B7GA 3UANA 4B3CA 5L8VA 3GLHA 2BIFA 1E0SA 3HU2A 4QFMA 3Q72A 3T1OA 5DNYB 4DB4A 1P2SA 2I3BA 3AV0B 3K0AA 4IEIA 2W6ID 3I5XA 1PUIA 2WOJA 3DOFA 2VP4A 1IN6A 3MFYA 2YWEA 3PR1A 4HYYA 3GEHA 1HV8A 3N5CA 3ADCA 1E9DA 2QL6A 4D4KA 1EFRD 4EJSA 1T3LA 5EXTA 4TT3D 1XJ0A 3TMKA 3FMFA 3X1ZA 5BWMA 1N6PA 3ICQB 1KY3A 4C9BA 5JJLA 3LLUA 3U6KA 1L2TA 1AIPA 2CCKA 3EW9A 4A0RA 2MSCB 2B21A 5KHOC 1NI3A 2N1BA 3CKLA 1MO6A 1MO4A 4HUQB 2QT1A 4BLRA 2VO1A 2OSBA 2WOOA 3PUWA 4LCBA 4Q4HB 5LPNA 1LVGA 2O0JA 2QTFA 1VCNA 2IS4A 1TQDA 2Z4SA 3CX6A 4LI0A 2EFDB 4RZXA 1R0WA 3O8BA 3PXGA 3F0TA 2OXRA 3MG9A 4JLBA 5FOVA 1HUQA 2DY1A 1S9HA 4FMCF 3PUZA 2V4ZA 3N70A 5EE1A 4B44A 2HUPA 4G3XA 1JR3D 5DI3B 1R5NA 3WRYC 2EFCB 2BVNA 4V0LA 3OIVA 1HE1C 5JCPA 3EZ2A 1XTRA 1G3UA 1KMHB 1ZC3A 1G4UR 3G82C 2G1KA 4US1R 1EGAA 1TADA 2J3EA 4QBIA 4AYTA 1UKVY 1JXMA 4RD3A 1ELOA 1CJUC 1M2OB 1RYHA 1E1QD 2BWJA 4TL6A 5TVKA 3GLFB 1WCV1 3K9HA 1YZGA 4ZI3A 2CL6X 4JIMA 1DTSA 4KBGA 4A8JC 1YZUA 2ERYA 4P4SB 2FGJA 1KO4A 3LDAA 5FOXA 3KQLA 3PUXA 2WWWA 3W8RA 4DDVA 1AKEA 1WE2A 3SBDA 1E2MA 5CDFA 2FE4A 2IYVA 4D6PA 5IF9A 4HLDA 3GFPA 4BRUA 1JQJC 2VP2A 1FL9A 3N2IA 3W6NA 1G8FA 1GKUB 4WAUA 5FPKA 1TEVA 2WSMA 2IYLD 2DHRA 3PV0A 1TL7C 3P4XA 1FX0A 2A5FA 4GOKA 1DS6A 4Z8XA 3UG6A 1COWD 3VFDA 1JAHA 2AFIE 4MKFA 1FFHA 1OJLA 1L4UA 2OCYC 3QBVA 3WYGA 3AVUA 2H8KA 3W8NA 1NMXA 1UADA 1CR0A 4ASUD 1X8JA 4EFNA 1VECA 4RD1A 2R65A 2FEOA 4M9ZA 3UWOA 2GETA 3LD9A 2ODBA 3I92A 1G64A 1W0KD 1N6NA 2EU8A 3IIMA 4A2PA 2EVWX 3BS4A 2GXAA 3FPAA 4DCUA 2AKYA 1CJVC 2ZETA 3CW2A 3H4MA 4DBLC 2AX4A 1AK2A 4A2WA 4QXAA 1XP8A 4Q9IA 1BO6A 2VP6A 1MR3F 2V55B 4M1YA 1A2BA 2CNWD 2QENA 2C78A 3D31A 5AR1A 5TB5A 3SN6A 4ACAA 5K8LA 1TU3A 4A1FA 3BFVA 4AYXA 1NKTA 4KO8A 1FMJA 2C9CA 1E4VA 3VR5A 1SVIA 3LO5A 4OQMA 3OZXA 4M1OA 4Q9HA 1LS1A 1VKJA 1ZMXA 2G9NA 4F4IA 1TUIA 3TW4A 4PPQA 2XNDA 2PEYA 1L7VC 4ZCLA 5KSZA 1G1MA 5L3QA 3I61A 1W7AA 2R9VA 4ZV4A 4HDQB 2Q21A 1JEDA 1RKBA 5H1YA 3K9NA 4DRZA 1KY2A 4HAUA 3GLIA 4GL2A 4DLWA 3BB4A 2B7BA 2GZDA 1KSHA 2NTYC 1S2MA 3Q7QA 4R7ZA 4D80A 1FTNA 1M7BA 3EARA 3M0EA 4NBSA 1GOTA 3TJZA 5J4HA 1TTTA 4MUBA 3C16C 1IQPA 2FZ4A 4XD7A 1CRQA 4BFUA 1F5NA 2HCJB 1IHUA 3F5FA 2KJQA 1AS3A 2W0MA 4D25A 4NU0A 1XPOA 4FIDA 3DKVA 2EWVA 3K0SA 5FPSA 5CB8A 1CP2A 2VL7A 4IW3B 2OILA 5G3ZA 4ZDIA 2O52A 4OK6A 4V0OA 5FL7A 4NONA 2XJ4A 1NG1A 3B82A 4C0HA 5KOYA 3KX2A 4MUAA 3CRMA 3EZ6A 3UG7A 3WRXC 3NVAA 4AURA 3UATA 3ZGXA 1Z0IA 1JNYA 6Q21A 3OE7A 5DIFA 3A4MA 2WJYA 1F3OA 4PC3A 4O3MA 5AJYA 5IRCD 3EZ9A 2RGNA 1HA3A 4YXWA 3SFZA 3V9PA 3MRSA 3FGNA 2ZRIA 1J2JA 3KTAB 4LBVA 3SYKA 4UNNA 4CW7A 1E0JA 3QBTA 4B32A 3IIJA 3EAQA 4NH0A 3ZYCA 2O8CA 4RKEA 4BZXA 1TUEA 4HAXA 3W9YA 3GPLA 2QROA 3ZS8A 1IY2A 2HXSA 4G0NA 5FOTA 3TUZC 2XTMA 2R6DA 1HQYE 2BJWA 2GCOB 2IXEA 2BMDA 2ECKA 1N6HA 2ZJYA 4MKGA 3SS8A 4YMTA 5DH9A 1GRNA 2FNAA 4IXMA 1Z63A 4BEJA 2VHUA 4AKIA 5B57C 2RAPA 4XTRA 3WHLA 3ZD7A 1TF7A 4JKIA 4BLTA 3IHLA 3G5UA 4Q48A 1XEXB 2CXXA 2Z6VA 2Z83A 2QQ0A 4KITB 4BLSA 5AK0A 1E9RA 1U8YA 1IM2A 4K46A 3RRYA 1Q44A 2V3CC 2ZRLA 4ACBA 2F3TA 2HJVA 1MH1A 2RGCA 3BWDD 3W3AA 4W5WA 3QKRA 2PZFA 2ZS7A 1GTVA 5FUXA 1N0UA 2BV3A 2LWIA 3TSZA 3ZIAA 1K5DA 1X8LA 4E07A 4OI4A 4OK3A 4LHYA 3BBPA 3U7FB 1NSFA 4NYMR 2QP9X 2QTVB 1T6NA 1TF2A 3OIWA 2VP5A 5C46F 1XEFA 2GNOA 4XOIA 2BMFA 4Q4JA 1EWQA 2ZREA 4DSTA 2WV9A 4M8NE 2WHXA 4PC6A 3K9LA 1W0JA 3U3RA 2ZJ2A 3QKSB 1SVKA 5BXQC 1FP6A 3IDQA 3THWA 1NIJA 1Y3AA 1OYYA 3H2YA 4NCIA 4G01B 3SYNA 4L4UA 4W5JA 1E9AA 2G3YA 4OHZA 2BBOA 1ZYUA 4LZZA 1AKYA 1B0UA 1D9ZA 4Q02A 1T8TA 3I4LA 4MRPA 5KUTA 4P4TA 1G5PA 5EZ5A 4GI7A 4JBXA 1E79A 2X2EA 3T1VA 3WBKA 4CEHB 1AA9A 1U90A 2C8VA 4DEXA 1E2DA 1XEWX 4XWOA 2R8RA 4TMVA 3CIOA 1W5SA 4NYJR 2QSZA 4A0HA 1DEKA 1MV5A 5FPHA 2OCAA 4BE7B 1C9KA 1U98A 1XX6A 3ADDA 4MH0R 3K0FA 1FZQA 3SJBA 5AUOB 2ZRMA 5CYPA 3OFNA 5KNBA 4PSAA 3KDSE 5JECA 5TY0A 3OAAD 3GP8A 4EPYA 2ZR7A 1YR8A 5AUPB 4C0SA 4TQ9A 3THYB 4QM6A 4KFUA 1DG1G 1R10A 1SXJA 1PUJA 4ZKEA 4L8GA 2I1QA 2BBSA 3RHFA 5AJZA 2GHIA 1VIYA 2Z4RA 2V1XA 1VYVA 1NIPA 4MGIR 1AGRA 4JLKA 1MABB 1DPFA 4LBYA 2KE5A 2KBFA 4FN5A 2QTHA 1E1RD 1ZM2A 3TVTA 1X86B 4FINA 1KKLA 1DOAA 4CEIB 3MWYW 1S96A 2IUTA 4LJ9A 3T12A 5LD2C 1KYIA 2PZGA 2BCGY 2IA5A 2LKCA 4HDCA 4QC2A 1XD2A 5FPYA 3RVBA 3MJHA 2GEDA 4P33A 1P2UA 2RGXA 2W58A 4QGHA 4DLYA 1T3SA 5HE8A 4CEJB 4PPGA 3VR3A 2JJ8A 2J0UB 2BEJA 4P3YA 1ONBA 3K0CA 3EIHA 4N3NA 2ZRGA 2W2XA 4QHSA 4KSCA 2V54A 4MGZR 4HZUA 2CVHA 2OCPA 3VX4A 3V4FA 4JMPA 3UKDA 4A6XA 2J7PA 2H7VA 1GP2A 1UM8A 2DFKB 1XCGB 3ADKA 4CYMA 1RVDA 5SZIA 5JSZB 1FW6A 1FNMA 4UXIA 1Q1BA 4NYIR 3PJRA 3B9QA 1R8SA 2ZSBA 1IN4A 2QMOA 5DHFA 4C0KA 2NO1A 2Q9CA 4OQNA 1ZRHA 3OEHA 4MYHA 4V02A 4Q01A 1Z2AA 1NLZA 3LBHA 1ZCAA 2C04A 4BRWA 1L8QA 4Z51A 1OXXK 5JLJA 2EYUA 3U7EB 1DVRA 3EIEA 3TAHA 1G7TA 1Q1EA 4UNSA 3DOEA 2VP9A 3V00A 1A4RA 4BZQA 2OBNA 2ORWA 3BB3A 2RHDA 4Q03A 2XZLA 2J41A 3A37A 3NHBA 3LNCA 2YKGA 3ZH9B 5F98A 2VHTA 3HPQA 2B92A 4JYCA 5BYKA 4Z54A 3MWLA 1KO7A 2IYSA 3U6BA 1R5BA 2CDNA 2PLFA 421PA 3BH0A 4XTCS 3QPUA 4JLVA 5C2JB 4QBHA 4B2LA 1IN8A 2GXQA 3TKLA 2XITA 4ABYA 2D06A 4H9GA 1YKSA 1SVWA 3LV8A 3L2OB 3WNBA 2PH1A 1TQ2A 3NG1A 2RKOA 4ZDKA 3ASZA 2YZ2A 3FB4A 1KI6A 1XXHE 4A15A 1XTSA 3QI2A 4F4CA 2OO7A 3CZPA 2HLDA 4DZZA 3TIFA 5SZHB 2CE2X 2ZANA 3IUYA 4E09A 3KUCA 3EC1A 2YWHA 3MSXA 2JJ2A 4US0R 2AR7A 4LJAA 3B78A 4YMSA 3ZQ6A 4OL0A 4I1OA 1TMKA 3GLGA 1P60A 4PQRA 1YR9A 2I1VB 3SZRA 1Z6AA 1U94A 3O47A 5G41A 3AVYA 1P9NA 5AWFC 2KWIA 1ZU4A 1OIXA 1Z6TA 4TLEA 1KK1A 3I5YA 3LQRA 3E1SA 3CX8A 1GL7A 5C18A 4D4JA 1P9RA 2C95A 1XXHB 2CL0X 5KDDA 1NG9A 3QUSA 1FUKA 4GZMA 1DG3A 2FV8A 1DAHA 4P31A 2ZAOA 4GFDA 4L9SA 1RJ9B 1V43A 2IX3A 2G77B 5KTYA 4DIDA 2UKDA 4C0AC 4B33A 3GJ0A 2GJAA 1Z28A 1JEEA 4BFWA 3SEAA 1E9FA 3QEJA 4Q4LA 1KI7A 4C30A 3NDPA 4JYBA 2H17A 1UFQA 1HT2E 4ZO4A 5HKKA 2CJWA 4DLRA 3VMFA 4QNMA 1T0JB 1KMQA 1IN7A 3CPHA 5JHGB 1JJ7A 3SI7A 1VCMA 2IF0A 1OPXA 5J4YA 1PLJA 1A82A 2G6BA 4AKGA 1XPUA 4JL6A 5C4MA 2XEXA 2BHRA 2WKPA 5GVRA 1H8EA 4Z1MD 3B85A 4XSHA 3AM1A 3TQFA 5DSZA 1RRPA 3Q9LA 3RS2A 2F1RA 2O5VA 4QOSA 1EWRA 1G7RA 4PAQA 4JKYA 1W48A 3RSOA 2QZ4A 4E22A 2GWHA 2GK6A 4IOMA 5KDOA 4URZR 4LV6A 1KTVA 1E69A 4NCHA 4R2IA 4HEJA 3WMEA 2ZSFA 1K6MA 2G0TA 2GXUA 2VEDA 2IHYA 3U4QA 1P4SA 1Q3HA 1AZSC 5D3MB 4Q1CA 4URVR 1PV4A 3PUYA 3KQKA 2OV2A 2O8BA 3CR8A 2AK2A 3CX7A 3FE2A 3VR1A 3F3YA 4EFMA 1J99A 1XJQA 2ZJ5A 1YJ5A 2ZU6A 3GQBA 4B2PA 4F7WA 2QE7A 3AEZA 3LH5A 4J0QA 2BEKA 1BIFA 2RH5A 5FBVB 2IF2A 3BFXA 3LY5A 4BLPA 4ZPXA 2IYXA 2ZI7A 2OXCA 2YNMA 2ZRNA 3VU9B 1E2HA 3BOSA 3RAPR 1OF1A 1GRRA 1W1WA 4UNQA 1CJKC 1XD8A 2JLWA 3C4JA 1ZC4A 4JLNA 1T91A 3IO3A 4AK9A 2XNSA 3I1FA 1CIPA 1KO1A 5GADl 1ZM9A 4TSFA 1AJEA 4BFVA 4RZUA 1LS6A 2GJ9A 1AQUA 4TZ0A 4LV5B 4URWR 3R7WA 1NN1A 3OF5A 2WKQA 3ECCA 3SHFA 2QMHA 2QP4A 4ILEA 2F43A 3EPKA 1G20E 4PC1A 2YWFA 4DCTA 2W2VA 1D2NA 2RGGA 1E6CA 2ODEA 1QVRA 2QI9C 4IDQA 4MYUA 4JSTA 2IYYA 2WJHA 4EFLA 1XTIA 5J47A 3NDBB 2CE7A 4M1SA 3NEJA 5CK4A 1G9XA 3AP1A 2G1JA 4UNRA 2P3SA 3LVQE 4I1UA 2XSZA 4Q9KA 5IK2A 3LX5A 3U7GA 3R9XA 1UBGA 3BFKA 4JBYA 1Q1ZA 1VMAA 3L0OA 5JRJA 1II8A 5J4VA 1G7CA 1ESMA 2O8EA 3FVQA 2NPIA 3MAAC 4ZIRB 4NE2A 1F60A 2JLVA 5JEEA 3VAAA 2CLDX 4G5GA 2C96A 4B2IA 2IYUA 4NDZA 2V9PA 2WVJA 1CULC 2FFHA 2QAGB 1N6KA 2EQBA 2ZJBA 5CB6A 4OJKA 1XEWY 4KBFA 3FFBA 4LHZA 4DJTA 2ODWA 1XMVA 4LSGA 1Z0JA 1Z6XA 2WAXA 4Q1FA 2IS1A 1ZIOA 1XMIA
chains in the Genus database with same CATH superfamily
1WDKA 1NVGA 2GDJA 3AXTA 4AJEA 5KNDD 3T4XA 4UD2A 3PXCX 1KAQA 3IVRA 4LE2A 5DXAA 3D3JA 4DIKA 3Q7EA 1EWTA 1QYVA 2RB5A 3KJQA 1U0GA 4MYDA 4C4PA 3FDIA 3KEMA 3D1LA 5JD6A 3BE5A 3CY6A 1WB5A 3M2PA 3OLYA 3RYHA 1VPLA 4U63A 2WJWA 3EISA 1BMFD 4LJSA 2XF2A 1M67A 2BCEA 3TQQA 2Q5OA 1XT6A 4HWOA 2J1LA 3TF5A 4NRDA 2EYQA 2LNDA 2RH9B 4URHA 2JAQA 3NHUA 1JJBA 5E2BA 3ZC3A 3UTCA 4QPJC 1PJSA 3RAEC 2BW0A 1NQWA 2C4MA 3JASB 4LISA 1WG8A 2VK8A 3ZK7A 5ITWA 4G89A 1IK4A 3WL8A 1Z4LA 2H2DA 2YWGA 2O2SA 3L8DA 5CB0A 3NGLA 5EXXA 4GPTA 5G3YA 5EC8A 1EQAA 1NVVR 2BMEA 2QTGA 5K3AA 4G5HA 5GJVC 4IV0A 2XEDA 3L8YA 4XIGS 4DCSA 2IDJA 1PZHA 1ZN8A 4FFLA 4EGAA 221PA 2FN9A 1PFQA 4Z9FA 3I34X 2HBRA 1FXWF 3CCFA 3BK1A 5HG0A 4EHAA 2WNHA 2XNHA 3BF7A 3OZRA 3WRWA 2ISSD 1SKAA 4GS5A 2YBDA 1KWKA 1KQGA 2XRMA 5F51A 4Q3EA 2FFJA 1QX4A 4PNZA 1DQRA 4LYFA 1OWOA 3O38A 5AHXA 3EEBA 2PGDA 4EUSA 1ST2A 2J32A 4TYWA 4GBMA 1MAVA 4GP6A 1NAIA 4J0DA 3TTXA 3E9ZA 3JY6A 3CZAA 4M4SA 4MRSA 4AY6A 3EXHA 4OH1A 3AUFA 1NVXQ 3RQIA 5LKRA 3NHYA 2AFRA 4L7QA 3DL4A 2YHAA 3A1SA 3DL7A 2OXFA 2XCIA 3DEFA 4KU4A 1V6SA 3U1VA 4CN9A 5A6SA 4MVJH 5DGHA 1O6BA 4JOBA 1LPOA 4HEQA 2XBUA 3KKMA 1R0SA 3G0CA 5AVTA 3A1FA 2FZLA 1VKZA 4WVLA 4CLRB 4XM1A 2WK1A 3WDSA 3WYEA 4YRSA 2GTPA 1OXTA 3O82A 3QBDA 5E6RA 1Q0UA 1MN6A 2FPGB 4B35A 1OY1A 1XD9A 2H5EA 1LA2A 2XA9A 3OHMA 1ODSA 2BY4A 2OKGA 4K1XA 1O87A 1RHJA 4P08A 4PNHA 3RABA 2V7XA 4GI3A 3ZDBA 1C30B 4AF8A 4QYMA 1EZZA 4C4YA 3V4ZA 2UVDA 1FF9A 4RF3A 1UODA 3OU6A 3U4HA 4DWOA 2IE0A 1RLOA 3C8HA 1B26A 3GAFA 1Y3CE 3O31A 4E15A 3LAWA 3E4CA 5A4AA 4MJXA 4P58A 1SCBA 2CXHA 3CW9A 3SNHA 3S8EA 3JZDA 3Q5DA 4LZAA 1JG4A 1EGHA 1VHQA 9ATCA 2YFYA 1IXZA 4D9CA 3WGYA 4PFQA 4F5EA 2QNRA 3K9CA 4KLNA 2A5GA 2W2TA 4FGJA 2GEFA 4CM8A 3UENA 2ZAGA 1EFTA 1IZ7A 2EGUA 2XYVA 3B13B 1U0HC 2J30A 3LM8A 3ID6C 3P2MA 3Q12A 2J87A 3C8UA 5FHQA 2F3RA 5KJ6A 4E5NA 1O0BA 1H65A 1MUUA 3K72B 1E62A 2C9OA 2WTXA 4JLSA 5G0WA 3FDJA 1W8IA 4ZCPA 2B35A 2JHGA 1OC4A 3S68A 3AZOA 3E70C 1P73A 3IUEA 1IZ8A 5CEFA 4LRWA 4XDHA 3SXJA 5BNZA 3HVJA 3GLFA 2PX5A 3AHDA 5COQA 1S0UA 4X97A 4CLOA 1WDLA 4EL5A 3FWPA 1KIFA 3INTA 1DXOA 2NYAA 2P9GA 3U16A 1G2PA 1UAGA 1JKJA 3D1JA 3I2IA 3TLYA 4DT1A 3RFUA 4EG6A 4YN3A 1WZ2A 1P7ZA 3VXKA 2V8BA 4G23A 1UP6A 4BN0A 2YHUA 4CV0A 1I3NA 5JV5A 1NOKA 3AHJA 2Y6UA 4JI3B 2PUHA 1X15A 2WR8A 4D4LA 3Q8MA 3R7LA 4NJOA 3D6JA 4OBWA 4TOIA 1I2ZA 1XF9A 1M8PA 1OFUA 2RHOA 2VDJA 3FETA 4CF6A 4FQ8A 4TV9B 4ZDJA 4X8HA 3RFTA 3B6MA 2GR9A 4V3CA 1CUAA 1EFHA 5ICMA 4D9HA 2Q3CA 4U2EA 4EUFA 1QIKA 4BB0A 2A7QA 1TM7E 2O3UA 3B48A 4TYMA 1WEKA 2GERA 4UMDA 3ZQJA 2GKOA 2REQA 3NTXA 4KRXA 5CCDA 3IUPA 2QLLA 4K9NA 1JA1A 2ZFUA 1ZD8A 2QRLA 1JA9A 1RYFA 3ASYA 4N76A 3CPSA 4NWIA 3Q9SA 1L4HA 4MB0A 2EAUA 2YS6A 4H0NA 3PPYA 2VXOA 2B4KA 3E7XA 1X38A 1P2DA 4ZFNA 3BIOA 4GWKA 2R5NA 3GJ7A 4RD6A 1KNQA 3E18A 3QJGA 1NF8A 3RRNA 5KX5A 5ESXA 3L7MA 4OHWA 2WHYA 3DFIA 1BX0A 1W4AA 1WY7A 2BGRA 4CIXA 4DWJA 4N7RA 4EW3A 2P9TA 2Q5JA 5KYXA 4L22A 5FBRB 3E22A 3SOZA 1Z4NA 1XFDA 3LYLA 5BSRA 3SKVA 1ES9A 3V8RA 3B1WA 2ACEA 2PLRA 1USIA 2JZCA 3HDHA 2Z8YA 3QVKA 1OA0A 4J1QA 3ISTA 4FFRA 4KK4A 2OXTA 3GCXA 3FVWA 1NJ1A 2GVZC 3QNMA 4M9XA 4QDZA 4V3BA 4IDOA 4UMEA 3S28A 3NHLA 2VQEB 1SWWA 1QYRA 2B8WA 2C2WA 3HB4X 4RSHA 2FN8A 1LQ2A 3K8QA 5BQ3A 4FQ7A 1T9HA 1WHTA 3EBLA 2IGBA 1FP4B 3AJAA 3I2FA 4KV7A 5CT4A 3BPSA 4YP7A 5B3LA 1VKHA 1O9HA 3WGGA 5IDWA 2GN9A 1Q95A 2POQX 1B8VA 1TT5B 1ZXBA 1KZ1A 4YI3A 3TZLA 1SXJC 2CYBA 3ZDQA 1DFIA 4C2BA 1A7UA 2CXQA 2J3DA 3KBOA 4MI1A 4E46A 3ICEA 1Z07A 1Q3KA 4TSKA 2PKYX 3AF0A 4UNIA 4PZPA 3ZV5A 4TGLA 2ZYHA 3JARB 4AIIA 4YBZA 1U3DA 3F6CA 3BERA 5ANRB 1SPBS 1SR8A 3KLBA 5M5BA 2OORA 4LF5B 1MMFB 2WFZA 3R8CA 4Z7QB 5C8VA 5CVJA 4DG5A 3A3PA 1H5QA 3EPLA 3O7MA 2QYSA 3DR3A 1BA3A 1T5HX 4LMRA 4P81A 3AEQB 5IKOA 3CH5A 3U4AA 1CF4A 1T9ZA 3L40A 5HCIA 4BN4A 4BBJA 3S2ZA 4W5TA 3DBRA 1L8LA 3L0ZA 3BTOA 3N75A 4JLJA 3LOQA 4WA7A 4YDRA 1M7HA 1KL7A 1PDOA 2NZJA 1PIWA 1QH1B 2WIAA 4E12A 4DTCA 4V0KA 3ZY4A 1CIVA 1PEDA 4CBVA 2FU5C 2G9RA 1D0SA 2XTJA 4JQCA 2JNWA 4QBFA 4B6FA 1S2OA 1DTWA 3KQYA 3QY0A 3W5IA 1PS8A 4B82A 2OHOA 3ANYB 3B12A 4EYKA 2XD4A 2XECA 4E1BA 3DQQA 1O96A 3JQQA 3LCUA 4I4CA 3UGTA 1W9HA 3G0BA 4IJWA 4A6PA 3CVVA 4DA4A 4PZCA 1JWAB 1DNPA 2G0AA 1C3JA 4LPSA 4NZOA 3ZU4A 5LU9A 2J5QA 2PRYA 1YRAA 4OSEA 1LRKA 2G1AA 2R7AA 2XNCA 3KEQA 2RK6A 3BDAA 4LYHA 1UJ5A 4NABA 4RIEA 4C0LA 5IJ0A 4PY2A 3WX0A 3TXXA 3TR5A 5KX5F 1TO1E 1ZBDA 1Y8QB 5J2TA 1FFBA 3AETA 5KO2A 3PHBE 1BS1A 4YXWD 1PEYA 1NJSA 4TKLA 3WYNA 1RMYA 1Z0FA 2ZIGA 3ZHYA 2EP7A 3UMYA 2PKQP 2Z5FA 4N12A 4MP8A 1E1KA 2BGGA 1WVIA 2HBYA 1ZAKA 4GGMX 4INOA 3DWIA 5HS4A 1VA4A 3H1AA 4EYQA 1VFNA 2FZGA 4HWKA 4LXIA 5CTJA 2VHQA 2PH5A 2R47A 2WUDA 3IE0A 5AVJA 5KDOA 1NXTA 2FQXA 3H05A 3O8OA 2FQ1A 4D4MA 4N41A 1TAUA 1HFEL 4IWXA 1JECA 3ZNNA 2F9LA 2YWRA 2BTQB 2DBYA 4QOJA 5IDXA 4BXOA 3IBYA 1VSQA 3A05A 4YJFA 5E1BA 3U61B 1R5OA 1YQXA 3BHJA 1B0AA 2F6RA 3G0DA 5C81A 1H9BA 3H83A 1JR6A 1XEXA 2ZPTX 2EL7A 1JZSA 1UOEA 5CGZA 4CTJA 3C8ZA 1YZHA 2MYTA 1SM4A 4R3NA 2NTEA 1L5WA 3GVXA 5JFGA 3RWMB 1Z0SA 5KNCD 3R5TA 3MQ2A 1ID8A 3P32A 3TK1A 4RVDA 5ALPA 2ORYA 1DBQA 1N0VC 1PT6A 2W6JD 2ZSHA 2ZSIA 3CKKA 1AKNA 2QT0A 5ARBA 5LCXA 1Q50A 1RSZA 1WMFA 2IEBA 2GO1A 5HK8A 4PN3A 1A9XB 2AZMA 3GJ4A 4OJNA 3ZS9A 1MPTA 5ABPA 1MOPA 1DQSA 1KI9A 3EULA 4N82A 4FQ5A 5EP4A 3W3AD 3NBMA 2G80A 2OCXA 2VDPB 3UJ3X 1NQOA 4B34A 4DSAA 4YWHA 3BMCB 5E1MA 1UPTA 5CD9A 3KVNA 4NJMB 3ZIAD 3UGKA 2H9YA 4AWXA 3ZEAA 2QXTA 5ADHA 4D8XA 4QTTB 3G2QA 4Q05A 7GPBA 2VC2B 5H3HA 1QX3A 1YVRA 5JAPA 3EGIA 2F7SA 4RVCA 4L78A 1CJSA 1L7PA 3PUIA 1JLLB 5KVSA 3W2TA 2Z5LA 2ID7A 4L85A 4Q34A 2NUBA 4YMHA 1GTL1 1YR7A 4ZRNA 5REQB 4EW1A 4IFEA 4MA4A 3F3KA 1DBSA 3DZIA 3E9YA 4IXNA 4K9SA 4U2GA 4BUJA 1AQNA 2IY8A 2RHCA 2QYHA 4ETWA 1QCYA 5AIAA 5J2TF 2Q3DA 4OVKA 1H5UA 1SXJB 3WXMA 1XTJA 2Y05A 5EIHA 1PJAA 1EXNA 2OCDA 4UZSA 4EG7A 3O21A 5A02A 5EUMA 3HJNA 5BVGB 2NU7B 2C0CA 5C3MA 4EHJA 4H1WA 3ZDFA 4LHWA 3ACBA 1MRZA 2DBZA 3E9DA 2D1TA 4FYIA 4BOYA 3BMOA 1IMOA 1HURA 4ZVLA 2MTBA 4FB5A 1ZH4A 3MEQA 4F5YA 4BZPA 1J97A 4JSYA 3EXFB 1RKXA 3MWEB 3VGPA 5CAEB 5GJWC 4XDZA 4KQXA 5AVZA 1BOFA 1N2SA 5P8WA 4C06A 3QYAA 4Q1BA 3WIVA 2CFOA 2HAEA 3VDQA 1B14A 2OHIA 3L7BA 5K8TA 1SGWA 1WB6A 5HFAA 5BWNA 1Y3BE 3OHPA 1RCUA 2Q27A 3QELB 1GYPA 2HWUA 5FWXB 1GUBA 3A31A 3FOFC 1H1TA 2NPFA 3QMMA 1GTSA 1QOPB 2A67A 2NZYA 3HEAA 2XT0A 1R6UA 1UBJS 3BIXA 4POAA 3SC6A 1ABFA 1QE3A 4OPMA 4B3XA 1WMDA 2O3SA 3EODA 2Q0HA 1K7FB 5HA5A 3FGOA 2FK7A 1KYVA 3EFBA 1NHWA 4E7PA 3DEYX 1Z3CA 5CFOA 4C04A 1TI7A 1EX1A 3ILVA 2ISQA 2ZJFA 3WYDA 2AG5A 2IS6A 2FP4B 1SCDA 1VKRA 4TYYA 4B80A 4LWZA 2QVZX 1J07A 3JQAD 1OKKA 4FYWA 4LOLA 4MA5A 2PVSA 3OEEA 2C84A 4LOJA 1LI7A 1W34A 1W4LA 4F96A 1C2TA 3K31A 4AI6A 2PD6A 3HHPA 4OQXA 4W1QA 3DLBA 1UANA 3JATA 4Q3NA 4P93A 4YRGA 2BUBA 1QO7A 1NR1A 3LX6A 1OBOA 4PPFA 3C7AA 1NYLA 3EMKA 3GCDA 3ONFA 5AICA 2A14A 4QREA 3F96A 2A5DA 2A88A 1K3UB 2FHPA 4LTMA 4ZVPA 2YNMC 2EHDA 3L0SA 3TS1A 1FBNA 1JHVA 1CD5A 4AC9A 3RLFA 3HXOA 4JUDX 1K0FA 4FHCA 2YY7A 1GU1A 1ISIA 4GICA 1E9VA 4DR5B 3BJRA 5DP1A 1NC1A 1YDEA 3ODPA 2R6ZA 2PZJA 1XDDA 1PU2A 4ND2A 2BGNA 3DDCA 4R83A 3H4TA 5JSHA 3L6OO 3I8OA 1Z6QA 2WHEA 4OG2A 1G38A 5K0BA 2R8XA 1JG3A 3O03A 3ORQA 4GH5A 5TEWA 5FT9A 4F56A 2HH9A 3KSMA 4GR4A 1UBSB 1JE0A 2D7CA 2CXRA 2JBAB 3QH4A 4JLMA 2PMEA 1YVEI 2VOJA 2FW8A 4DB2A 1XPRA 3T5TA 3B3QA 2EDCA 4FXOA 4LK2A 4C4RA 4CZ2A 4XX0B 3TAUA 1UMKA 3MWJA 3TCNA 3RO7A 2IZ0A 3UK7A 3KSRA 3EZYA 1P6XA 4WK6A 2O3RA 1F1BA 2A0FA 2CHGA 3LKVA 3L5OA 2VF7A 1QMGA 1L7MA 4FZRA 1ORWA 4RF4A 2HF8A 5JJKA 2XVMA 1GAJA 1ZGCA 2VT3A 3AW8A 4JVSB 4N0PA 1U8XX 3IBFA 4HOYA 1XROA 1XZLA 2P1ZA 2WP8J 3N3BC 3Q3EA 2FCAA 1WJGA 2H65A 2N75A 3HKEB 1NVDA 3K1ZA 5EIBC 3S40A 1J25A 4CM9D 2DG2A 3T54A 4BKMA 2BKEA 1FMCA 4RTMA 3V1UA 4JVNA 2QZ9A 3ES9A 2FQYA 3EXG2 1WW3A 2C2GA 4RVOA 4KXMA 4UDOA 3WWZA 3ZCXA 3BZBA 2PL3A 3PNYA 5IH7A 2O54A 4DW8A 3RYIA 1R3DA 4GMDA 1DAEA 3FHCB 4DDHA 2P3QA 4OQDA 1U5CA 1SBHA 4ID3A 1T0HB 2P5UA 5TXGA 2W2KA 1ISHA 4G6ZA 4CT0A 1LK7A 4OLAA 1S3SA 5AK6A 4Z6KA 2AL7A 4NULA 1NM5C 2AQKA 4BQNA 1K27A 3IDZA 4W7IA 4XB6B 1S5PA 2M6RA 4S1VA 1C1XA 1BJRE 2YIVX 4CCYB 1YGPA 2ZDGA 3GNLA 2RJ3A 5B2ZA 4F21A 1XXHA 4EEXA 2EW1A 3RC9A 3Q7PA 4KVAA 3LFUA 4LF8B 3BT7A 4EF5A 3GJZA 1O9GA 4BDTA 2Q5IA 5SZKB 4Q7LA 3L1IA 2IBTA 4MAMA 3L06A 2QTCA 4XKJA 1H9CA 4HMPA 2ZRBA 2FKAA 1ZW6A 4X66B 4IBOA 2RGEA 1G59A 1KBOA 3DZBA 1B23P 2WJ6A 4JVLA 1F6BA 4LOIA 1GGHA 4Q00A 5FBZA 4RVUA 2AJDA 5I4KA 3FDFA 4J0HA 5EUCA 4WNAA 2YV3A 5HZKA 4FCWA 4XWAA 3STTA 1LTHR 4X84A 4YAEA 3DKPA 5A71A 4XZ3A 4BQFA 4XYBA 4U2CA 2L18A 4H0CA 1ORHA 4Q7QA 3U4QB 4KDEA 1TC1A 4DLKA 3DWFA 4BO3A 4XVQA 1TRHA 3BTUA 4J76A 1G6KA 2PX4A 4GM0A 3RRZA 4M0LA 2YVKA 4BU0A 4W5RA 1XVUA 3WK4A 3MCVA 4K28A 5AVUA 3ZCQA 4AY5A 1BQ3A 3QVGB 3FPGA 3IRUA 5FI0B 2XVAA 1K4MA 5EZQA 2EQ5A 5TMDA 4YQFA 1J5XA 1ZI6A 3RAFC 4LDPA 2YJ4A 2EDAA 2P4QA 5EJMA 2AI3A 3MTQA 4KJXA 4TVOA 4CTKA 4HVCA 4TZKA 1M1YB 1AQIA 1EXMA 2GBLC 2OCGA 3BULA 3GLVA 4RE6A 3HDGA 4XWKA 5K7SA 3DBHA 3CSDA 4F38A 1EK2A 5A7HA 1O58A 2LUOA 3EGVA 1RPTA 1BGWA 4JL8A 4RTLA 3LXRA 2ASEA 5HQ3A 4D97A 1B0ZA 1RZ3A 4GM1A 1QH8B 1WXDA 3BAZA 3TJMA 4BEBA 4P0TA 2G9VA 4OQPA 3ZI0A 4D99A 5JFTA 1NW7A 2I4LA 1DEOA 1PFWA 2B9VA 4P54A 1PV1A 5DYIA 3TVDA 3WDKA 4QRHA 4BL5A 2FR8A 4RLFA 2H1HA 4A9AA 4EY8A 5KTRA 4HDSB 1QHFA 2OZVA 2JHCA 1LVUA 2NUAB 4FILA 2XCLA 4PBSA 1W6RA 1OZHA 1WZUA 4E70A 4EIWA 4NCJA 4XQ9A 4Z4QA 1OXSC 3ZDCA 4HHEA 4Y2JA 2L42A 2CBGA 4PX9A 4RMNA 1PR4A 3KR9A 3JS5A 1XHFA 2W2LD 4PF1A 5F1KA 2RH4A 3ZZNA 4Y6GB 2BHLA 1RP7A 5ESRA 4EYGA 3VQTA 1E2IA 2GJSA 3TM4A 5EJFA 1LC3A 5AW8A 4TMTA 5FUWA 5JJIA 1UBRS 4EB6B 3LMKA 1L1RA 2CMHA 1E66A 2RCYA 3HYLA 2WJGA 3R9XB 4QDUA 1ECPA 1II8B 2PT5A 3UK1A 2EJVA 4N0DA 1OQAA 3DBOB 4H15A 4F6RA 1Q0SA 4WN9B 2J5KA 3EMVA 5DIZA 1E5TA 3VGJA 3WMWA 4C0KA 4S1PA 3F9RA 4R0MA 1KYQA 4E5VA 5BYJA 4HQ6A 3GLHE 2OD2A 1NJFA 1AK1A 1E8NA 5TR9A 1TTHA 3D5EA 3ZCRA 2GSWA 4MLZA 3K0BA 3K5IA 4OYLA 3WGTA 2VYNA 3FGPA 1KHTA 4FMCB 3V2HA 1KEUA 4C29A 3BRWD 2R6R1 2DQSA 3X43A 1UDXA 5FXMA 5LOVB 1YDHA 5U9CA 3WOVA 1WSAA 4DMCA 2HHHB 1HLPA 1W85B 3OSZA 1FU8A 4LY3A 4NZPA 3HJTA 1W46A 4BQPA 3KP1A 4DLXA 3ZHVA 1SKYE 4CDGA 2NT3A 2QN7A 1GCOA 4GXRA 2OD9A 3H7AA 5IK2D 2DM6A 2OP1A 1PLKA 2W6IA 4Y2XA 3FNHA 2ZEJA 3K3PA 2RKWA 3QVLA 3W6OA 1TJ4A 4XR4A 4HXGA 1MZPA 4JNCA 2P35A 2I2AA 3MRXA 4NC9A 4DAEA 1JBKA 3HRIA 1EFRA 4D3FA 1Z47A 1R8QA 5CYFA 1XJWA 2IUFA 1W4CA 2REOA 3B20A 3E1KA 3OD1A 4R1PA 4JAVC 3U9LA 3ZUGA 5HJEA 4UDNA 5BWBA 1HNXB 3ENNA 1CR4A 1YO6A 3ENKA 4J6EA 3WNVA 3VTZA 4LJ8A 1U2GA 1VMEA 5CW2A 1GCUA 1WLSA 3EY4A 5AW4A 5ISMA 2ZRHA 3G8CA 2NQ8A 1RM5A 1TECE 3ELBA 1N7HA 4AS2A 2CYCA 1H42A 1MC8A 3OX1A 1XVVA 4MRVA 2IXGA 4I19A 4IDAA 4A03A 3PEVA 3A6PC 5AK3A 2ZT6A 3TW6A 1WMBA 4H7JA 1Y9ZA 3ZWOA 2IDZA 5FTLA 1Y5MA 3ZJUA 1BXKA 2J3MA 3OBIA 3QEMB 1QHIA 3AR4A 2HNBA 2QX7A 3MUEA 2JIRA 3VSAA 4BVAA 1DBWA 2PXCA 3D4LA 4LI3X 2DFPA 3DLPX 3ABSB 3KWJA 3SC4A 1C9DB 3VZSA 4M2LA 4DWWA 4DUPA 3KKNA 4M0CA 4YDSA 3AFOA 4MMZB 3JVUA 4Q3CA 4QLOA 2VR1A 1ZS9A 2BBTA 2B94A 2CF5A 2D7DA 1G42A 3AHEA 2GPAA 2AOVA 3X1MA 5TPWA 1V11A 4QASA 4DPMA 2QVBA 2QW1A 2YC4C 1W44A 4EFDA 3FTPA 5TVGA 1JR3A 1W47A 1TJYA 2HRRA 2VTKA 4BJ6A 1RTTA 2C4WA 3VM6A 5JCXA 1JSLA 3CQ9A 3RTAA 3FTNA 1TZCA 1Y6JA 4M1TA 4XIJA 4FDVA 3RUAA 4AN4A 4DC1A 3LL4A 1QRUA 1AQJA 2PX0A 2WIDA 3KD3A 1SCUB 3C8DA 4LWOA 1B8UA 5BPFA 5I9NA 2J3KA 3LBFA 1JL3A 1PV2A 3PU6A 3PGLA 2I76A 2ZI9A 3R20A 5ALZA 3EGDB 2OUIA 2AXNA 4P5EA 3SVZA 4CKZA 2UUCB 2O20A 4DDKA 1HNZB 2EGHA 4NR0A 1T2CA 4B75A 1JHYA 1I4DD 3G9TA 2E9SA 1S2IA 2A1TS 1FB5A 4KTVE 3TTWA 2Y0BA 4AIRA 2IXFA 4CVNA 1CF9A 4EITA 2IOFK 2XY4A 3MGCA 5K0GA 1TKBA 2XT9A 4MQEA 3SK0A 3WVNA 1L7DA 2ZYRA 3ITEA 4JR2A 2D1FA 1KK3A 5IPFA 3NAGA 3MUNA 1PJ2A 4IUCS 2B4YA 3A4TA 2Z3VA 2AHRA 3U26A 1BW9A 3TNFA 5JQGB 3D6VA 1N9ZA 4N0EA 1WWKA 5AW0A 3FFWA 4GXTA 4BVEA 2R62A 3SEFA 2QD1A 5AESA 1JYEA 3RTGA 4RWEA 2R6JA 2C5LA 3IO5A 3I73A 1R27A 1NP7A 2I99A 2WPNA 3Q3GE 4G5OA 4TLCA 4NXNB 3W7BA 4EHIA 1UC5B 3KBBA 4KVGA 2H1IA 3JQPA 5EIAA 2OM2A 4DE5A 3MT7A 3PICA 3VH1A 2QBYA 1V6AA 3LUJA 3SOPA 1A9ZA 1FYEA 1Z6ZA 4ROSA 1NYTA 2Z58A 1LNZA 2V97A 2WD7A 1M2EA 5HNKA 3I1JA 1Q91A 3SXUB 2FHSA 3KQMA 5LR6A 3H84A 3WKAA 3IERA 2R6FA 4XEHA 2ZUVA 4XUGB 4BLUA 2G1PA 3NBKA 2QP3A 4AD8A 2ZR8A 3ZZ1A 2WWHA 3NETA 1ND6A 2OD7A 3G1UA 5ITSA 4EG5A 4QDJA 1RBMA 3GOQA 4L75A 1X7DA 5KZMB 2DPHA 4O4IB 3ZY6A 2FP3A 4TWRA 3QIVA 5G53C 1ZK3A 2B8EA 4MVWA 1AHNA 4FVTA 1JHMA 1QU2A 4RCVA 5CFNA 1U6KA 3KJHA 5H7XA 2ZRPA 3SX2A 2GX6A 3GT4A 1CUZA 3G2LA 1CJTC 4A4DA 1ZD5A 3AFMA 1L7EA 3QBJA 5EKXA 1NBOA 2FWRA 2PMDA 2EATA 2WUEA 5ALXA 4EGJA 3OOWA 1E2BA 5CLLA 4YQZA 5LN1A 2Q46A 2CN1A 2UXBB 5ARDA 4B71A 2P6PA 4IUYA 2O3QA 2IH2A 4IX9A 3WHPA 1W94A 2FGKA 5K3SA 3K09C 4J6FA 2H5LA 1EPUA 3B8HA 3M4NA 4H18A 4OP2A 3LX8A 3V2IA 1EEHA 3CNLA 2H31A 2AG0A 3A25A 4U00A 1E32A 2XCTB 3SIRA 1S3FA 3R75A 4D96A 5FBKA 1UWKA 4WCDA 4PW0A 3G2HA 2Z04A 4HDNB 3REQB 4PFJA 4DM7A 4KP7A 3PPWA 4J0FA 1UMDB 4PHTA 4TTIA 4DRZA 3P2JA 2PKWA 4AICA 4KGXA 3QXHA 3B36A 4HF7A 3FHOA 4M54A 1L1QA 1F48A 3B60A 3KT6A 4FGKA 2GFHA 2DZDA 3TIIA 4WEQA 2FTKE 1MIOB 2X7HA 2GN2A 2ONJA 5LZ4A 5G0SA 5H59A 3TXYA 1YACA 3HYSA 3IQGX 4AG6A 4N48A 4KUHA 5JBNA 2V7BA 4CI0B 1IVSA 1R6DA 1TVMA 4N47A 1V71A 2GK7A 3NNSA 3FUTA 4DJFC 2F8LA 4F93B 1Y34E 1UAYA 4FYMA 3RYCB 2ZRJA 1RC8A 2NMVA 3OY2A 4MUJA 5KHAA 1CDZA 2H7CA 2B1GA 3RDPA 2V58A 3BVPA 4PR3A 2ZYVX 3I8XA 4WLUA 4NEHB 1FRFS 1YZNA 4B7AA 4LA4A 1FJGB 4MHSA 4FE3A 1TQ8A 3EMBA 3QPAA 3WGMA 3D5TA 1LBQA 4KQJA 4J8PA 3R2JA 2X7JA 4CG1A 2J9XB 4BO8A 2X4IA 3OSUA 5GAJA 2N3ZA 2Z5VA 1W52X 3A70A 1IUOA 2PHZA 1AK9A 1XDSA 1Y3FE 1EGMB 4Q47A 5DYWA 3SE0A 5KQLA 1OASA 4HH0A 4PLZA 3N07A 1GPWB 2EJWA 4G81A 1T2EA 1I7PA 2WSIA 4GR5A 1FFDA 2BFDB 3EIFA 1QZXA 1GEGA 2D62A 5DNWA 4JVOA 1H1DA 1FJXA 1O97D 2BONA 2C7OA 1KQFA 4KE7A 1Z16A 1B3RA 2ZWOA 4JDPA 2PQ2A 3U39A 3AKZA 2BTEA 3ULKA 4BEWA 4YCAA 4J2OA 1JBQA 4TWIA 2D5IA 3TQRA 5JANA 5CYOA 3MW8A 4CMCA 3M4YA 4HKTA 3IEKA 1CXZA 1YUMA 3H9EO 3OE7D 4S35A 4KV9A 1DX6A 1FRQA 2PA3A 3DMGA 4QWWA 3WNZA 3OMLA 3QKUA 4ZOQI 4LDZA 4D43A 2PQMA 1N32B 5B3JA 3NR2A 4A8JA 3PT5A 4AECA 1QE5A 4D44A 3SS9X 3L6BA 3VJKA 5FUBA 1ITZA 3BGWA 1MQ9A 1PHRA 5H80A 1DTEA 4CETA 1P9WA 2E1PA 4NHOA 3S70A 1VXOA 2HB6A 1NI4A 4DCPA 1NNSA 2R79A 2X42A 4J0GA 1WXXA 2AYYA 3WA7A 2C1ZA 1P61B 1FFEA 1EWYA 2EBFX 2OCLA 1QAOA 1TMGE 4G0PA 4JT4A 4JX8A 4OQQA 3UUFA 2PGIA 3CCCA 5LQRA 2GZMA 1N2CA 1C3XA 4DR7B 1W2WB 1FNSA 2A0KA 4LX8A 1BWQA 1KVRA 3I3SR 3TTSA 4CMJA 4GW3A 3ZHSA 4ENUA 2B7CA 1FNNA 2HMYB 1GL3A 4GLFA 5LZ5A 3Q40A 3H9GA 4UUBA 7AT1A 3WLNA 2WZQA 3FWKA 3MWGA 3EQ6A 1OTXA 3NWJA 5CJ2A 5T8KA 4EATA 3Q85A 1OFHA 2I6SA 4ZXFA 1M2JA 1ULAA 2VKTA 4X20A 1XWFA 2FDCA 2VKQA 3UJ7A 1M8KA 2GD6A 3GIDA 2JCBA 4RANA 3FFXA 4WZBE 5E7IA 1H4TA 2W93A 4Q3BA 2HHLA 2X7XA 3AB7A 4LBZA 1K8RA 1VHLA 4W7SA 1KJZA 3RAGA 4ML3A 4OXKA 1SC1A 4OB8A 4UTXA 4CN8A 5FX2A 5JD3A 5JWRA 3T1YB 1W36C 4Q3DA 3BB1A 1I1OA 1I7LA 1GAQA 3E84A 4JSRA 4QGAA 1E89A 1EVZA 2VH2A 2ZRCA 1IUKA 1X3LA 3G0HA 2PZLA 5DBFA 1ZISA 2HRZA 4JQSA 4HYTA 1RACA 4TKMA 1X7WB 1F51E 5KJ1A 1Z12A 4R8RA 4U6NA 5D51S 4FONA 4PR0A 3P4YA 3UJCA 4QUHA 4V39A 4M1WA 1JT2A 4GX0A 4HFJA 2PMKA 3REGA 4A36A 4MVJA 3PFHA 2E89A 3R41A 4GKBA 3T9CA 1MJFA 1KFJB 2FUG6 1VBKA 4KYVA 3GH3A 4RVFA 1E9CA 3W4KA 4DC9A 1Z4OA 1NUSA 3GJ3A 3DEJA 2G09A 1EI9A 3H7IA 2ZWVA 2K2QB 2CNNA 2IEYA 3K0FB 3QMVA 1GUAA 4KPGA 4OJYA 4RUKA 2QTBA 5H82A 4AULA 3MB8A 3QKSA 2BGLA 1TUBB 4K2AA 2IZ5A 4FK8A 3UMRA 1LPNA 2ORVA 2OAQ1 4I1VA 1GZ6A 2KX7A 3NEAA 1SQ5A 4S05A 3UIEA 1Z5VA 4V0ME 4Y9TA 3DXYA 1NUTA 1RXUA 3PGJA 1M6WA 3RIYA 1KO8A 1XHEA 1ZHFA 3FJOA 4WUVA 1I2CA 4AJNA 5L45A 2AN1A 1HETA 3KUUA 3HWWA 1W35A 3B3JA 4G5QA 2ZCVA 2V9CA 5IEBA 2B2XA 3ND6A 4IH9A 2Z95A 3CF6R 4V03A 3NOQA 3S99A 1ZW1A 2YDYA 3EXAA 1OB5A 2OHFA 4JUCA 3O73A 4GKAA 2HHCA 2GI4A 4JJ4A 2JIOA 3KYDA 4IGAA 1BX1A 2YOFA 3EASA 4YRLA 4YJ2B 5FBWB 1J1IA 3KYBA 3NI2A 3PWZA 2NZ8A 2WWRA 1KAGA 4L5BA 1GGVA 3COYA 3DYIA 2NWQA 1M73E 1DAPA 1IEWA 3IT0A 3THYA 4BFLA 2WYVA 2XDWA 2XE7A 5K05A 2DVMA 3FB1A 4DGSA 4QQNA 1P3Y1 2O8FA 3RH0A 1FRZA 1KVQA 1JS1X 2MWMA 3KXLA 4W9NA 3WRXA 4C0JA 2RJOA 2VJQA 1QMPA 5P21A 3H1TA 5CPBA 3PEWA 1TZBA 1TPYA 4HTFB 4IJQA 1MTOA 3JQ9A 5IHPA 1S3GA 4ZP1A 1T5SA 4QELA 1WCIB 4ZOLB 2XPCA 2I9KA 1PVOA 1T4GA 2A3RA 3ORRA 3SC3A 2VT2A 1UBNA 2BR4A 3SFVA 3OQPA 4LUCA 3BCRA 4WZ6A 4P1ZA 5CNJA 3DMFA 3RSZA 5HOEA 5L53A 2Q5CA 2G76A 1FTWA 8ABPA 3T5MA 3I2HA 4NBVA 3ANNA 1H0HA 1QHHA 4W82A 5ELXA 4I1PA 3EG5A 3LKDA 2OP0A 1OXUA 4GPAA 4LJ4A 4A2CA 1QK4A 3UW1A 4E4TA 1V48A 3IEPA 1HF3A 3KIPA 2MCFA 4CHGA 5KSPA 1IZYA 3IVXA 3LWZA 3VR3D 3UFXA 1RBQA 3STUA 2RSLA 2UVPA 2BFNA 3IC5A 2ZUFA 1CQZA 2I4OA 3AKEA 3PHGA 4BVGA 1S8OA 1GGJA 4RA6B 1FTSA 1Q2UA 2QLNA 3ZE6A 5A9SB 4NE7A 3B5IA 2JC3A 1U9IC 2YVLA 3IOMA 1IOZA 2WICA 1G5IA 5T5QA 2N42A 2YZKA 4LOKA 2VJCA 3I23A 4GMGA 3WGVA 1RQ2A 5AVSA 1A4UA 3QWFA 2FZCA 4GM4A 2CD7A 3Q0EA 2XV1A 2YCLA 4MTCA 1L4GA 2NXEA 4GLOA 4PXSA 3USZA 3TSCA 5HOQA 3O0DA 2WSLA 1NVMB 1XGKA 4EG1A 1XYYA 4TVBA 1C8VB 2P3OA 2YMLA 3FF1A 1OKKD 2BFCB 2FUKA 4Z2YA 3GJSA 3OEED 3UUGA 3V7YA 3ZE2B 4LIPD 1W36B 3K2BA 5EQJB 2C7VA 2DWPA 5F21A 2FWMX 4JH0A 3P2IA 2ZRAA 2XZOA 2DCMA 1YZKA 4GOOD 3MJEA 4KQGA 1MNQA 4MMYB 1D3AA 1F4VA 1O94C 3AYXB 4UEWA 3ZW7A 1KKMA 2ZJ4A 3LFHA 1K8QA 2M1XA 4Y7CA 3FGZA 4DOMA 2B98A 1NW8A 2QY9A 4F4JA 3QPWA 4U5XA 4TKVA 2JIPA 1GPAA 3VDRA 1A77A 2DF8A 1LQTA 2OCBA 2CNBA 3DM5A 3GRCA 3H5WA 4P4UA 1UZLA 1THTA 3WB0A 3DXFA 1AMNA 1E3WA 3I12A 2N47A 2Q2QA 3ABIA 3GXBA 1JEQA 3VPDA 4XVUA 3SY8A 1UMCA 5A4JA 3NDRA 1I2MA 2DERA 2OGTA 1V39A 2XQIA 3AVVA 3DT8A 4KPEC 4QLAA 2PUTA 1U0BB 3PQCA 4MW6A 5ILQA 5D6OA 4G0VA 2Z56A 1KEZA 5A5GA 3OOJA 2P65A 3QF4A 3TRIA 3OX2A 4Q7KA 1DRKA 4U2FA 4RS3A 4GP7A 2KSQA 1XRNA 1NVUQ 3OP1A 1YTLA 4EA7A 1KU0A 1AXGA 3DP9A 1Q74A 4U0KA 2QLJA 3W5HA 2F64A 3FKJA 1FFYA 4NPCA 1ZI8A 4C7OB 1TMOA 5B7QA 4P32A 3WLAA 1X7YA 3BA6A 3DFFA 3OO1A 2PGLA 2BFPA 1Y7TA 3RSSA 5BSTA 5AKZA 4DXAA 4AZ0A 5EJEA 3B1ZA 1Z0DA 3FROA 3RT1A 2ICAA 2CHEA 3ZR4B