2PKCA

Crystal structure of calcium-free proteinase k at 1.5 angstroms resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(serine proteinase)
molecule keywords PROTEINASE K
publication title Crystal structure of calcium-free proteinase K at 1.5-A resolution.
pubmed rcsb
source organism Engyodontium album
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 1993-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2pkcA00
2V8BA 1SIUA 4WOCA 1SUCA 2ZRQA 2WWTA 2SICE 4ZOQI 1XF1A 3H42B 1TO2E 5AVJA 2TECE 1C9MA 1SN7A 1Y3FE 1TM4E 1P7WA 1EGQA 1WSDA 1NLUA 3F7OA 1PTKA 3I37X 3DE6X 1KE1A 5JMOA 4HX2A 3VTAA 3BGOS 5ARBA 2W2OA 3DW1X 1C9NA 1NDUA 2XRMA 1KDVA 1DBIA 1SVNA 1SBNE 1Y3DE 1WMDA 1PEKE 4BWGA 4H6WA 4NMXB 2Z57A 1C3LA 1BH6A 3AJ8A 1BE6A 1GTJ1 1ZVKA 5JXJA 3QFHA 2SBTA 1C9JA 1YJBA 1V5IA 1HT3A 1KDZA 1TO1E 1VSBA 1S02A 1CSEE 3T41A 2DP4E 4B5LA 2W2PA 3DVSX 1UBNA 1TMGE 3VV3A 3VHQA 3EE6A 2W2QA 3ZXXA 1AQNA 3I30X 1TM1E 3DE1X 4M1ZA 1YJAA 2Z58A 2X8JB 2GKOA 4KB5A 3DWEX 3BPSA 2IXTA 1KDYA 5FAXA 3AJ9A 3DE7X 3SQOA 2B6NA 5AVKA 1Y4DE 1A2QA 4ZARA 1SCBA 2ID8A 3UNXA 4H6XA 4LVNA 1P7VA 2Z30A 3I34X 3GT3A 2PMWB 1SIBE 4JP8A 1GNSA 4CFZA 1SBTA 1SH7A 3WIUA 1AK9A 5JXIA 2E1PA 2G4VA 1SCDA 1IC6A 3DVQX 4I0WB 1ZVJA 1SUAA 2ZWOA 3LPCA 1Y4AE 1R6VA 5ARDA 2ID4A 3WIVA 3F7MA 3SICE 1MEEA 2DQKA 1SIOA 4OMDA 3QTLA 5B1DA 4C3UA 3DVRX 3CNQS 3Q40A 1JEAA 1ST3A 3EDYA 2QTWB 1LW6E 1Y48E 1P8JA 3DE3X 3QMPA 1SUEA 1TK2A 3DE0X 3TI9A 1T1IA 4OV6B 1SCJA 2W2NA 1THMA 2X8JA 3A3NA 3DW3X 5JXHA 1YU6A 1OYOA 1TM3E 1S2NA 2ST1A 1SELA 3AFGA 2Z2YA 1BFKA 2XTJA 4DJ5X 4MZDA 2HPZA 5ARCA 3WQBA 1GA1A 3GT4A 2WV7A 2WUVA 3LXUX 3LPDA 1Y3CE 2PKCA 3TI7A 1BJRE 2PWBA 5K7SA 2PYZA 1SUPA 3PTLA 1AV7A 5SICE 4YN3A 3VSBA 1YJCA 1GTL1 1PJ8A 4WOBA 2PRKA 1BFUA 4AKTA 3D43A 4FONA 1AU9A 1Y1KE 1GA4A 2Z56A 1GCIA 1GT91 3GCWA 5I9SA 3P5BA 1ST2A 5B1EA 1TM7E 1R0RE 3DYBA 3F49S 5AQEA 1SBIA 4CG0A 5FBZA 3CO0S 1AVTA 1PFGA 4C3VA 1SCAA 1T1GA 1EA7A 3ZXYA 4LVOA 1SCNE 3LPAA 1WVMA 1R64A 3BX1A 3TECE 3DE4X 1BE8A 4KPGA 5JXGA 5AMXA 4DWWA 1SPBS 3D9QX 3VYVA 3I2YX 1SBCA 5FFNA 3GCXA 1V6CA 4NE7A 1WMEA 1Y33E 3OSZA 3HJRA 1TECE 4H6VA 4Z2AA 3A3OA 1DUIA 2PWAA 4KG7A 1OYVA 1SBHA 2SECE 3Q5GA 1GNVA 3DE5X 2W2MA 1Q5PA 2WUWE 1KE2A 1CNMA 1GTG1 3L1KA 2HD4A 2Z2XA 3VV2A 1AH2A 3PRKE 3WHIA 4CFYA 1OT5A 2SNIE 4AKSA 1S01A 4DZTA 1Y3BE 4RYDA 1IAVA 1Y9ZA 2DUJA 3DDZX 1GA6A 5CW1A 4J94A 3A3PA 1WMFA 1SUBA 1T1EA 1MPTA 1NDQA 2PQ2A 3EIFA 4NE9A 2Z2ZA 4HVLA 2ZWPA 2IY9A 1SUDA 1AF4A 4GI3A 2P4EA 4OMCA 1TM5E 3DE2X 1Y34E 4K8RB
chains in the Genus database with same CATH superfamily
1TZBA 1UQRA 3IV9A 3TZLA 3DMNA 1B14A 4BO8A 2F1IA 2B34A 4D4HA 5HK9A 2A58A 2MR6A 2JFZA 2OECA 3VR4A 1II0A 1SKBA 5JNLA 2JFBA 3E22A 3RHTA 4KV9A 3VR6A 3ZU4A 2IUEA 1ZNZA 2B7BA 2PBZA 4W7SA 1SK9A 2IYVA 3IP8A 3WZLA 2KLBA 1FSZA 1RQ7A 2IC5A 4IEFB 2PFKA 10MHA 1QB8A 2XNDD 3HWX1 3T4UA 5ALOA 1VJ0A 4OUKX 1M2JA 3HCDA 1XDDA 2NNWB 2QQFA 4PLGA 3SBDA 3OTWA 4EQZA 3HKDA 1CDEA 2XXAA 1K6XA 4MS3B 1CJKC 3F7OA 2EL9A 1UIMA 1ZN7A 4BMZA 1YKFA 3MBKA 3KXLA 3D8HA 2R6HA 1AF7A 1NWHA 1TAQA 4NYJQ 4L0QA 5FV7A 4AJ9A 2FGJA 1QG0A 1TNDA 5I9IA 2MSLA 1FL9A 4MVJF 2F1RA 1E5DA 2R0QC 2D2XA 2V1XA 3PRHA 1AMUA 1ODCA 4NZOA 1MDFA 5TQVA 5TQ2A 4O0MA 2CD7A 4GC5A 2X0DA 4I9FA 2I3ZA 1HSZA 2OV3A 2QZZA 3BWXA 4OQYA 5ARBA 2ESRA 5JSZA 5K2OA 1BVYF 2IWRA 4QA9A 1G59A 1U5AA 2LNDA 3CR8A 3CSSA 2WA2A 1JFFA 4LNHA 4OL9A 1YIDA 3UMMA 4RTSA 3I5XA 4PSCA 3C41J 1U8YA 3DW1X 4IH1A 2VK8A 1Y7HA 3VU0A 4CCWA 1N9GA 3DH0A 3NORA 4UTOA 1SXJB 2MWMA 2JLVA 4NPHA 1KNQA 3TTXA 4A2WA 2BZGA 3HA2A 1VL2A 2WBLC 5JZVA 1BCSA 2GWHA 3MELA 4IILA 2L18A 1EI9A 3RAEC 4G0UA 4ALKA 1M75A 4ZZ0A 2CD9A 3V4FA 4A8JA 3QPAA 1YI0A 2IYXA 2W58A 1L8QA 1AQ6A 3GXOA 3WJ2A 1QVRA 3PDIA 1ZP6A 4YQEA 3IQIX 4C7BA 3LLMA 4ZP1A 3PHHA 1UJNA 4LOJA 3O7MA 1TJ5A 1RWKA 3BFJA 3SFTA 2VTBA 4QTZA 3MCTA 2DHRA 3CZ5A 3Q2IA 1ZD4A 1YDGA 2DTEA 3FPEA 4OHPA 1Q12A 1A98A 2VIIA 3I76A 2W8BA 3AVOA 4C2UA 3PFHA 4C08A 2Q6TA 3M8KA 4RMIA 5C5CA 4FYXA 3JAMA 3KUXA 1ECJA 2GJSA 4GW3A 3E58A 4KQ1A 4OHMA 1SM4A 1UXGA 5JSQA 1SKAA 5B4UA 4PSVA 4M1YA 3EC7A 2SBTA 3AILA 3IR5A 4R1UA 3VKWA 3TIIA 3V4LA 4OHOA 1FFXB 4OQFA 2QX9A 1YJBA 1R88A 2IQ5A 1VIYA 2WLTA 3AWIA 3QVMA 3MOSA 4J91A 4QBTA 1KGDA 4O4IA 4RF2A 3EDQA 1JLLA 1Z4JA 1HT3A 2YWXA 4HPXB 5G53C 3E6AA 1KDZA 2II6A 3GUYA 2I29A 5CA0B 1NKSA 1YFLA 4QUIA 3L07A 4LC9A 4C0AC 1GT6A 1RADA 4FFBA 4W4TA 1XTQA 4QU8A 5KJEA 3ZWKA 2IRWA 2ZI7A 4Z0NA 4B6EA 2WT8A 3F7TA 3TQIA 5F3DA 3GMIA 3R23A 2IZ1A 3AR7A 1C1XB 3LWZA 1JG3A 2OG1A 2VXBA 3HCPA 4M7PA 5AR1A 2JCGA 2JBHA 1VCNA 2QPAA 3DUFB 3N3AC 4FR5A 2JGDA 4YONB 1JJIA 1LVHA 4B8WA 3JQCA 4UM7A 1FP1D 4HLCA 3TXXA 2VCHA 1G17A 1IDOA 2JHPA 3N87A 2EFGA 4QULA 1MTOA 3COWA 3D6AA 3QV2A 4DKXA 4N0QA 1TM1E 2ZIWB 4MUJA 4RADA 2M6RA 3FDXA 2Z58A 2YFQA 4J7AA 4UDXX 3BSWA 2FYTA 5I7UA 2OFWA 1GXSB 4XWGA 4C4OA 2J3LA 3V8EA 1GL3A 5JAPA 1NFRA 4NYMQ 3ITNA 4GQAA 5EZYA 3EIHA 1SGWA 2GUGA 3H11A 1YS6A 4J76A 1JHDA 5CVDA 1AKVA 1FFDA 2Q0SA 3FH0A 4N3CA 1R74A 1MO3A 1SUFA 4MROA 1AKMA 1F2UB 1U3VA 2VDOB 3EQ9A 3MMSA 3SC3A 1H9CA 1Q17A 1RPJA 2ALJA 4E14A 1ZGGA 1FRQA 2VP9A 1Q74A 1A2QA 3M4JA 4DA8A 1BDMA 1Y3IA 2PLWA 1ZK1A 1EM8A 4DSNA 3HFSA 1S4QA 2XECA 3K32A 5K0TA 2H11A 3P52A 2QAIA 4JEHA 2OBFA 5LMNB 1ADYA 4Z4EA 1XNQB 3HKBA 2Y4OA 1TADA 1SIWA 3ILSA 3IBCA 3Q5DA 4LY3A 3NIBA 5H16A 2VJYA 3OCXA 3ZZ1A 5BVHB 2QVLA 3GLFE 1HMYA 1GPUA 5I7WA 3PCTA 1O77A 4GXQA 1JQAA 5EG5A 2OLKA 4C2TA 4LDPA 1XZFA 2R8EA 1JDUA 2VSXA 4EYKA 3T38A 1I4DD 4OB6A 3D8UA 3WKAA 1TFUA 4GHWA 4C0BA 4HNRA 2EZ8A 2V98A 1QGUB 1X2BA 4JK3A 1NMQA 2P77A 1YQEA 3OP1A 2JBWA 2JGKA 4XPZA 4E2ZA 3ICQB 4XPIB 1BX0A 1QNFA 3UKOA 3WGGA 5B37A 2A1TR 4CW7A 2Y68A 3Q3CA 4I3GA 4OH1A 1U7XA 4OKNA 1DCTA 2G8NA 2I1WA 1QG2A 4JROA 3MJCA 1SCDA 3KWFA 3PZRA 4EKDA 5J59A 4KIFA 2C07A 5JC8A 5KNBH 2AN1A 2YXBA 1HR0B 1NSFA 1J8FA 3A6LA 3OQJA 3ZQ4A 2YN4A 4J0FA 5AJYA 4I7EA 1Z4LA 3ZCSA 1FMCA 1UAGA 3UH1A 5FORA 2ID4A 4ASUD 3A05A 2OV6A 4LGCA 2WKWA 1AKRA 3LRXA 1JIQA 2HBZA 1TJ3A 2NAPA 3QVOA 2DFVA 2PKRA 3CU5A 3RNOA 2GBGA 1W1WA 3KXPA 4BCDA 2GJ9A 2AR7A 4D4GA 2HJSA 4JBWA 3RIYA 3AV3A 2IT1A 3IO5A 3JYLA 4UHDA 1NA5A 2D7CA 2LKCA 2GBFA 4YAWA 2ZBGA 3H17A 3I9LA 3RWOA 4MKGA 4NAHA 3WBKA 2JRLA 2BRUA 4HDMB 4R9UC 3X1JA 3OQIA 3ME5A 3SEFA 1H5QA 2ZJ8A 5KC8A 2C4MA 3AG6A 4GGOA 5CVUA 1ZAKA 1W4BA 2X42A 1UFVA 5A6SA 3IKJA 3QFRA 3HVKA 4NCJA 4XUGB 3OTQA 3VPXA 4OIFA 2F3PA 4AQ7A 3D3KA 4X6XA 1LW6E 1Q15A 4TVKA 4FFLA 4RXTA 1T10A 5IVDA 3TTVA 5TGZA 4BNGA 1WF3A 4IGKA 4Q7LA 2D5AA 1V37A 5F7ZA 3PHJA 4NV0A 1AQLA 1ZZGA 2VWHA 3F6RA 3QLUA 4HAUA 4KN9S 5CPFA 3T9DA 2ZZNA 1NXQA 1LC3A 1LFAA 5A06A 5J2UA 1IZ0A 2CUZA 4KVFA 2Z9CA 3OU7A 2OXCA 3E1KA 5SZHB 5LYJA 3DMHA 1AXGA 4JNKA 3TI9A 4UEKA 5JH7F 3ZXIA 2IK8A 5EHQA 1A7AA 2WF5A 3BH0A 1GZSA 2NZ2A 3PI7A 3MWDB 5BNWA 5ICMA 3F8SA 621PA 3H1EA 1GZ5A 5DNVA 3KJHA 5K3DA 4L02A 1CY6A 1TM3E 4JSRA 3ZD7A 2QA5A 1SNYA 3BJRA 5LCXA 3W78A 3OOYA 3I5YA 4JLAA 4PIPA 1UMCB 2ST1A 1U1IA 4IDDA 4FTWA 1ZHFA 4MB6A 3D7KA 2MSKA 5ESWA 3QNUA 2HEGA 3PT9A 2QF7A 1QHSA 1H8ED 3DV0B 4L72A 2A6PA 1Q1BA 2YQZA 3AJEA 1RAAA 2AL7A 1O95A 1XA4A 2BL4A 2WILA 1NDHA 3NWPA 1GVNB 4KH0A 4TN1A 1L1FA 5KWVA 4D9BA 2F3RA 4LW8A 1RKQA 4MRSA 1GQ2A 4Y0AA 4CI0B 1GLVA 3IDAA 4BLUA 5FPYA 4ARAA 1AHNA 1MCZA 2X15A 1ZNYA 1ABEA 5EJ4A 1M1UA 2NU7A 4F4JA 3AEUB 3FCUB 3NWJA 1MX5A 3HCNA 1FRNA 4HT3B 4XYBA 1YL5A 3OT1B 1LSJA 3D5EA 3R4CA 1PFYA 4CUKA 4RVSA 2WWYA 4OLAA 2W6JA 1ILWA 2AOUA 3VHLB 2WNIA 4QYIB 3QPVA 1LEHA 1NI5A 1QH8B 2EBWA 2I2WA 2JVIA 1DOAA 3LX4A 1PJ8A 3Q3JB 1PS0A 3AF3A 4MVXA 4PAOA 2I87A 3AF0A 5JE8A 2R84A 4NONA 4L9SA 1SCQA 2FP4A 2PS0A 2Q45A 3S2GA 3SYRA 1GTSA 1QU2A 2Y99A 2YUIA 1YKSA 5KJ1A 5A4MS 2BUBA 2HJWA 5FP0A 5I5GA 3U7GA 3TAHA 1J0EA 3W5JA 3CUEF 4BNVA 3R7WB 2O1WA 2NVWA 2YFYA 3QVVA 4HDOB 4KTVE 2CHFA 4R8MA 3RDPA 1Z68A 1NBMA 4CQMD 5GADl 2H52A 3ZXSA 4LPSA 1BCRA 3BMQA 4Q6WA 5EHIA 5I7AA 1ELOA 2ZPAA 3ENQA 4QYTA 3F49S 3VKGA 2NZYA 3S1AA 3ZWYA 1X1CA 1RKXA 2V0NA 4RELA 1YZFA 5KYXB 2VHZA 3IILA 2YRWA 1T4GA 3PFKA 4P4NA 1R4AA 5DULA 4RY9A 4LOHA 2AS0A 2HFKA 4KI0A 1NUTA 2FG7C 3K9NA 5F64A 5AUQA 3T4EA 4BIIA 3W5BA 3ID6C 1TUBA 4OHBA 3JZDA 2XZTA 3FPCA 3TIGA 2ZUWA 5IH3A 2ZI6A 2DSTA 3P9YA 1GEEA 4JJ4A 5JTUA 1XALA 4IO0A 1XZPA 4JI5B 4ESHA 2UXDB 1EIWA 4Y6LA 3VC1A 5A0TA 4L95C 1MT0A 3O26A 4TQAA 4A2PA 4CL8A 3CZQA 1YBVA 2Y1XA 1F17A 1CEXA 4TMTA 3WLTA 1E2QA 4BECA 1L5OA 2CJXA 3NHYA 1E59A 2I3BA 4Q18A 4TLLB 4QPCA 4BATA 1JGTA 4D9NA 3GRVA 4KQGA 4L8YA 1KQGA 2X77A 1E7SA 1WPXA 1IEXA 1HE8B 3H2BA 2VA8A 1VLVA 3DZBA 4NYIR 2PGNA 4EUNA 2P0AA 2F3UA 2AF3C 5TF0A 1O9BA 2KW5A 1XR3A 3B89A 4WCFA 3H9EO 2XUDA 1L8OA 4N0DA 2Q6LA 3G9TA 2QBYB 3M1YA 1NIPA 2E21A 2WJWA 5FFNA 3T3OA 4JLOA 1GN9A 1RWBA 1N6KA 4GM1A 2H85A 2RAVA 3WAJA 2H4XA 4F4IA 2F59A 4MULA 1C14A 1X14A 3SKYA 2PLRA 1J0XO 1N5MA 4IXDA 4DUGA 3M7IA 1TXGA 2E6KA 1VP9A 4AJPA 4QFDA 1KI4A 3U7QB 4FX2A 4MLZA 2VOEA 4MVJP 1XAHA 5K05A 3WJ1A 3PXBA 5E9QA 5K2MA 4O4LF 3UV6A 4DTCA 1XZIA 4CMBA 2GJAA 2OO3A 2QRNA 1CY8A 1HKHA 1N5LA 2ZVPX 3KT0A 4GL4A 4D8YA 1GUZA 1F4VA 1NASA 5JPCA 5CGQB 1SVKA 3WMGA 1D4AA 4KG7A 1Z6GA 4V3BA 1KY2A 3EPRA 2ZYWX 1XHLA 3EXG2 3PXXA 4I3FA 5ALVA 1LQTA 1M2WA 1KYIA 4UOZA 1XBTA 3SC2A 1YULA 2MYUA 1CR1A 4IUYA 3I01A 3PSAA 1APBA 3LRTA 5LIPA 1S2MA 4R1MA 3FOCA 5C9ZA 2AFIB 2QRPA 1GPAA 3L82B 1L3CA 3RV3A 4BBPA 1KC3A 1E69A 2QEQA 4FDUA 4OQZA 4BV9A 4UD2A 4M8SA 3HFRA 2DLNA 3AUAA 2R4QA 2E5LB 3SYTA 3ZBQA 2JEOA 5THKA 2GM3A 2HCTA 4OHXA 2PU7A 2VQ6A 3JV7A 2BFBA 1ULBA 1IXZA 3B7WA 1H65A 1Z06A 3O4GA 1DT3A 3IIKA 5E3HA 5KSYA 3KKPA 5KUTA 2V0GA 3ZDDA 3AU8A 1EVLA 4MW4A 1KI1A 1WV1A 1NJ2A 2ZUUA 4GOJA 4XJSA 2HZBA 5DP1A 1E1RA 3OJEA 1OSNA 1JHUA 2SNIE 2Y66A 2RHOA 4PNZA 4DDVA 5CFOA 1MOPA 1NOIA 2FF5A 3CNHA 3WLPA 1AKTA 2TMGA 4O2BB 4XA8A 4MHSA 5THQA 1H6DA 1YS7A 5CT9A 4DSTA 4WZBB 1VLHA 5JD6A 3M9WA 4EG1A 1GA6A 4HNGA 4QTTB 4PRLA 1UDCA 2WSYB 5T4BA 4NMHA 4GOLD 2FUG1 3I42A 2OUKA 1E3QA 1VI6A 2VSYA 2YOHA 3R5KA 2FKAA 3B85A 4HGPA 1HV8A 3NZEA 3LXRA 1W75A 2G1JA 2XOKA 2YXLA 3PQ2A 2NO4A 3WRVA 4M3NA 1S96A 2IY9A 4R8LA 3VYUB 1U2GA 3IEVA 3S0JA 3UYKA 1VB3A 1VCOA 2EFDB 4Z9FA 4G5SA 4HDKA 4PCLA 2Q4DA 1CR2A 2O54A 1OH8A 1H9BA 3WGTA 1HL3A 1G3MA 4UMVA 2ZJ3A 5K3FA 4CODB 4E15A 3AYZB 1XZDA 3T1QA 4QBFA 1XCJA 5ADWA 1GGEA 3VX3A 4DADA 3V7YA 1HT1E 1Z2EA 3CJQA 4XYMA 1C4KA 3NOQA 1PJAA 4KYTA 1X7WB 5IW8A 1CDDA 1V47A 3ASYA 3JWGA 4BE7B 2GTHA 4QUBA 1HH4A 1ZGAA 5CITA 1UPTA 2FFHA 5CLIA 3CUYA 4U9UA 5ECYA 4IRXA 4HEJA 1AHIA 2PAFA 4HDCA 4HLDA 1HDEA 3CQ9A 4MA0A 2HLDA 3ZWAA 3HZRA 3WE7A 1U5BA 2V7UA 3RS5A 4D3FA 5BWLA 5AVJA 1LBEA 2FN8A 3OKPA 5JVDF 1Y3FE 3QFTA 4UEJA 5JMPA 4BJ1A 1P7WA 1EGQA 2AF4C 3AW8A 3G89A 4DLUA 1FYWA 1O03A 3RC2A 1A95A 1EUQA 1E6MA 3NYWA 1ZIDA 3O3MB 2RONA 4QGAA 4LHXA 1JQ5A 1BSVA 5B1YA 3CG4A 4P3KA 1DQSA 4PZ9A 2PNJA 5LMUB 1BGWA 3IJRA 3P94A 3IULA 4MLDA 5FLXA 2GBLC 2A5GA 2P5TB 3TN7A 3VR2A 5INTA 1EXDA 2P6NA 2QHXA 3COYA 4TMVA 4HX2A 5GZ6A 3UJHA 4AI6A 2F67A 4KPFC 2X0JA 3H2KA 3RVDA 2FPXA 4GT1A 4D9EA 5HIAA 2R9VA 1NP3A 3LDHA 4U2DA 3UHFA 5JIBA 1AMNA 2C8VA 1C1HA 2GDZA 4C2BA 5ITZB 5FUMA 3DB1A 4RK5A 1X0XA 2CNWA 1QIDA 4FYJA 3LZDA 4UVIA 3CT4A 1WDLA 4ZEMA 4GEGA 1M2KA 4JUAA 4BE4A 1V8PA 3A04A 3O31A 3LUPA 3CVXA 3H6KA 2JC3A 4E1BA 2Z8YA 3C70A 4OU5A 3FVVA 3OQPA 4JI0B 1RBMA 1TW3A 1NLYA 3K2QA 3L46A 1ZUHA 1YRAA 3GQBA 1YS4A 1T0HB 2Z95A 1J97A 3S40A 4PG8A 1QUFA 1OAKA 4C7KA 1JL3A 2J9ZB 2ZDHA 4WFIA 5P21A 2UXCB 4ZKEA 4QQFA 1IDN1 4V0SA 4V39A 4HQKA 5ADUS 3QQPA 3NVMB 3P9PA 1JPNA 1T3ZA 3K8YA 4JT4A 1QRUA 5CH5A 4QTYA 4YT2A 1MC8A 5I5EA 3HZOA 4ZYZA 5IDWA 3E9YA 2WFMA 3ZGNA 3A2MA 1ZM9A 3JVVA 4WDQA 1AB6A 3ZY3A 4BAUA 4BS9A 3D4LA 7GPBA 1JQJC 1L4EA 3ENKA 4HN2A 4QYSA 4UMDA 5HMMA 1FOEB 4NOLA 4NKRA 4WN9B 1KR2A 5FKJA 1Z17A 1KI6B 1H6BA 4M89A 1CUFA 2CNBA 4ZTZB 1LVUA 3H1FA 2VT7A 1AS2A 5LU8A 4HHEA 4KR2A 5IZ4A 1PSWA 4ND6A 1NW4A 1I32A 2XVXA 1DJQA 4LRTB 4M99A 3W9YA 1RJDA 1UKEA 3OPYB 1DAEA 1DXYA 2WJ4A 3GFRA 3WL6A 2FPOA 4I5EA 4BX2A 4YBRA 5EKSA 3DOOA 4DEVA 4YRLA 2IHNA 1V1RA 1M1XB 3WRWA 5JMWA 1TYCA 2XHEA 5HPYB 1ZK0A 2ZRPA 5JFOA 4NBNA 5HF6A 1LDNA 1A8UA 3H1GA 3QXCA 1PL7A 1NC1A 4M9RA 1ZOSA 3U44A 1E9AA 2YWCA 1Z6AA 4FI3F 3HB1A 4OFWA 3LUJA 2A94A 2JFUA 4RGBA 5EJ2A 1LSOA 4ZO7A 1FQKA 3E53A 2CHEA 2JFPA 2JGAA 1RXEA 3IR6A 4YO7A 1U9IA 1RWVA 4JH0A 1JDBC 3DLAA 1DWQA 3IRUA 3TJMA 2W2PA 1S5PA 4BFCA 4D57A 3BQ9A 1F7UA 3M83A 1WIWA 1Z37A 3OZRA 3CV3A 1YC2A 3TVYA 2H1RA 4IHAA 1PV4A 2QAGA 5EN4A 3K70D 2GXSA 3KZNA 2PM8A 4E88A 1HWYA 1WQ1R 1PWHA 1H0SA 1W4CA 3UOAB 3WADA 2EP5A 1OZ0A 1JG6A 2V5UA 3V7UA 4P1ZA 4EFMA 3PQEA 4TZ0A 2JZOA 3L6OO 4DQLA 3ZNPA 1AQNA 4YUZA 3DMGA 3JWIA 4R9NA 1G2IA 1QK3A 5E4TA 3GRYA 1YJAA 2VJLA 3G9QA 3P0IA 4YTEA 1X7XA 2HDHA 5GOZA 1VCHA 2O3SA 3UHAA 4D0LB 5ITVA 4PLFA 1JDSA 3JRNA 3OEEA 2IHTA 5BV1A 5TMDA 5KSPA 3NIWA 1TF5A 1W4AA 3TG2A 1K0UA 4G4JA 3ZIDA 5L95A 5FWDA 4X61A 2JD1A 1A9RA 4BLPA 1XTSA 1TA0A 2ASEA 3BL6A 2OO5A 1PSZA 2D8MA 2UZ1A 2ECKA 2IEZA 2WIBA 3DEIA 4QNMA 4YQFA 3BTOA 5SZKB 1AZWA 2B0CA 4GMKA 1GGJA 5FAXA 2E87A 2QP9X 5H83A 3HCBA 1NPTO 5D7BA 2GKGA 3EIWA 3GF4A 2QJTA 4DNOA 3PFNA 4M1KA 5JAOA 3EVAA 3N0VA 2CJPA 4O5AA 1GRQA 4R1NA 1K6MA 4DANA 2JLZA 3KCNA 2MT9A 1EHCA 2VDJA 5C7OO 4CR7A 1FP6A 5FWXB 3OF5A 1FNNA 4ZVQA 3U49A 1DARA 1VIMA 4Y1GA 2JA2A 4LNUB 1UKZA 3I34X 4BVLA 2ZUCA 4GICA 3NBZC 1JSXA 1Y8QB 4KQ9A 5DBOA 1Z35A 3MWEA 5IJ9A 3KR1A 1B74A 4QFMA 2JA1A 1NW7A 2Q50A 3KLOA 2VAVA 1KO4A 2R47A 4WL0A 5LC1A 4RBNA 4BMYA 4AZ3A 1EEXB 8AT1A 4GBED 2E5WA 1NXTA 2ZXUA 3Q8WA 3LY8A 4XR9A 3HCEA 3CJTA 3TZQA 5BSTA 1JQEA 3PYXA 4NZYA 5GJWC 3SPXA 4AYWA 2QE7D 1FW6A 2EX0A 5HUHA 2WW8A 1AK9A 1WM1A 2FWJA 5J5CA 3RG8A 1W35A 4WNIA 1RT9A 5TQ0A 1Q7GA 4HQNA 5CBPB 5EIAA 2FW0A 1XZ8A 2O0HA 2QL6A 5EJ7A 1GYQA 3DBLA 4F0JA 4P83A 1ISSA 4UM9D 4IDGA 4KP7A 3AEYA 3Q3IA 1E2IA 1KVSA 4URYR 3QPCA 3KQUA 4Q1EA 3DGEC 3OMWA 4QHSA 1XAIA 1QXSA 5B3LA 1DIAA 3WIDA 5ANRB 4QG3A 5F1KA 4ZOLF 1RPAA 2GO1A 2PZBA 1L4HA 3CIFA 1NRXA 1KIAA 3DSRA 4ZRMA 5M04A 2AMLA 1QF7A 3HZHA 5H3CA 3GW8A 4RMNA 3QTLA 4HAWA 5DYYA 1VMDA 3DQZA 5JALA 3MFYA 4MICA 5IJXA 4GOMD 5JY1A 1VL6A 1DZIA 2RGXA 1HFWA 3BK7A 4RF3A 1DC6A 1WE2A 2P6UA 1Z5PA 2MR5A 2V6JA 2HRBA 5CFZA 5FNVB 3ROEA 4MW0A 1E62A 5AI4A 3BZBA 3CNNA 3N2KB 3CLTD 4KGXA 5EIWA 4EI8A 4RZ2A 5GV8A 3REFA 5A6VA 1SHJA 3GLVA 4NMLA 4F97A 5J4YA 3EDYA 1L7BA 3GDFA 4C0QC 5C32A 1LV7A 4GD3Q 4CVNA 1SU4A 1RLOA 3LVRE 3NHJA 1TAGA 2COUA 4OQ4A 2O07A 5TJ9A 3W77A 3NHUA 1NF9A 2XDAA 3IB6A 4CMHA 2VZ0A 3GDHA 1HQYE 1XSEA 5C5EA 4X1IB 2W6OA 1DG9A 3EWIA 3K72B 2FCAA 2BF7A 1PDOA 4OYYA 1QAQA 1VJRA 4E4RA 4I4LA 3TEMA 2VHVA 1KH3A 2OR3A 2P9CA 1CS0B 3AERB 4V2UA 3DVAA 1XMQB 2R79A 2IS6A 3IFSA 1XEWY 4KQXA 4UFPA 5K3OA 1XLWA 2C4WA 3LBYA 3FA2A 3H5NA 2X7XA 3OT4A 3QVSA 5LU9A 3QLJA 4H7DA 1H85A 3N8NA 3K09A 1EPUA 3UHOA 4ZYTA 4R7ZA 3VM6A 3WV4A 5LYYA 2E2WA 3PX3A 5KNDD 1M1YA 4MO2A 1A04A 4NJEA 3GUCA 5LP1A 3N8DA 5G4LA 3RUEA 3X1ZA 4MGKR 5K8VA 1OREA 3JARA 4TTPA 1DU4A 1ZXBA 4TYPA 1KXZA 1FMTA 2G17A 1XA0A 5GIPE 1PJLA 2HZ7A 3AI1A 4G07A 4QFBA 3UT6A 3V2UA 4QUAA 3OQBA 1RYYA 1VA5A 3OPXA 1U7HA 3O8DA 1U9CA 5BNFA 4JJ8A 5KQPA 3G8AA 4XSHA 3OTOB 3DFKA 1X1QA 1HLFA 2OSVA 1SUWA 5ALZA 4JI2B 5LXTA 5EVCA 4FW9A 2V3VA 1GAWA 1V1MB 3F4KA 4URUR 3DAHA 3FVWA 3OWXA 4C29A 1SUPA 3AR3A 3DLTA 3HVJA 5LD2C 1FF9A 2AMFA 5KJCA 4K9RA 3WO0A 1JI3A 4I19A 4YN3A 1PDWA 5IHXA 2G76A 2RH4A 2YYAA 3LA6A 2HLNA 4JODA 4X1YA 5E7MA 1Z6ZA 5KS2A 2HQOA 4GL2A 4G56A 3SYKA 1P0FA 3UANA 1ECCA 1RRFA 1UP6A 3FETA 4C4SA 4ZDIA 5A9SA 2FWIA 1D2CA 3MT7A 1KMHA 2QTVB 2CLCX 3A9WA 2Q7DA 1DFGA 2Q5JA 2IUTA 2UYYA 4LQCA 4ETIA 1Z8FA 1ZR2A 3H2IA 4P0QB 1GT91 3K0EA 3T1VA 2XD4A 4BMXA 1N5IA 1I24A 1OTHA 1NF3A 1Q57A 5FOXA 5JBIA 4WKGA 1PWYE 1M1NB 4J7XA 4AW9A 3LD9A 1E3LA 1F6DA 2APJA 3U3DA 4E6PA 1JWLA 4BQRA 4UHFA 2BFNA 4LE2A 1W5SA 3ADDA 1T9CA 5F1YA 2F8SA 3AEKB 3TMKA 1V4BA 1VG9B 2CLMB 1T6ZA 3R0VA 4GPIB 4J9VA 4L4RA 5BR4A 4ZV7A 3OX3A 1HQCA 5T41A 2FNAA 3ZUPA 4RQUA 4UW9A 5H0IA 4J1QA 3KQTA 3ZYCA 4DWJA 1C7ZA 1K6EA 3QUBA 3AVTA 3UAWA 2CMDA 1NG1A 1SCNE 1M6EX 4J9UE 4II3A 2R8ZA 4A5SA 5KX5A 1JMVA 2B3DA 2J0UB 2DTDA 3S2SA 1ISGA 1OA0A 1FU4A 4EGFA 5A04A 3CX3A 4Q3LA 4NS4A 4RK1A 3QYAA 4WJZA 2A4KA 5EJFA 1O94D 4X97A 1C30A 1Q19A 2IPLA 1GO2A 1PRYA 2LBPA 1CQIB 2R7KA 3CRQA 1EFPB 2VP6A 5HIKA 4AS3A 4J6FA 3X1MA 2GPYA 3O0TA 4FFPA 3G1WA 4MUGA 4KNYA 4EUEA 3D3WB 4KWIA 3NW9A 4NYJR 1FRZA 3MHTA 2OP0A 2PZEA 4KR7A 3ERCA 3AI2A 3TFQA 2C59A 3WYFA 5IKMA 4M0PA 1SKYB 1SXPA 4ZO8A 5BRJA 2NX2A 4UCXA 1U9ZA 2R1ZA 4OD0A 5BOSA 3FUUA 1E4YA 3BBLA 3TRFA 3TGLA 1BX1A 2ZB4A 3TQOA 1DDGA 2J5KA 4MB2A 3PDCA 1WPQA 3TVDA 2JANA 1X9IA 1XMJA 1V6AA 2PS3A 2J45A 3LQKA 3I8OA 3LV8A 3RYFA 1ISHA 2MINA 3HB7A 3DT9A 4YUAA 1U8ZA 3I4CA 3IP5A 3VMFA 2ISQA 4PX9A 4H4EA 3IDQA 3QW2A 3KUDA 4KO4S 4LJSA 4F9EA 5H70A 1P5RA 2PFGA 1D7AA 2QX4A 1ZK4A 3VRHA 3HBMA 2BFEB 2XI4A 1XVUA 3P97A 4OBBA 3TGPA 2XDQB 3H04A 2H8GA 3GL9A 1GRRA 4Q01A 2A33A 3R6TA 2QP4A 4TQUS 4MAAA 1KSJA 3UT5B 2PZFA 3AEQB 1CUBA 2VC2B 4C89A 2VJPA 1SBHA 5K8LA 3TX2A 2PK3A 2OGTA 4PX5A 1FU8A 3I5MA 4EA7A 1JPVA 4Q12A 3W3AD 3AQIA 4BP8A 1DQYA 4L4ZA 1HYBA 3UJ9A 1DEKA 5T6BA 4DLYA 3ICEA 1OH5A 4D80A 3LUDA 2Q3HA 4MRMA 1DO2A 2GZDA 1UPBA 3F9RA 3G1UA 2H9IA 1U4NA 2QY9A 3L8HA 4JJZA 4IL5A 1LLUA 3AF6A 1M3SA 3D7SA 2C7RA 4MW2A 1YQGA 2GJ4A 4CZ2A 2X1VA 3TEFA 3ZLVA 2ZJAA 4HTFA 2CXPA 3DAOA 1USWA 2H48A 1RM3A 3F4LA 3HDVA 4UHJA 2XEXA 4P3PA 1I5EA 1XHEA 2YINC 5IVKA 2Z1MA 2QTGA 1JSRA 2WF8A 2RB5A 4RJIA 1UKBA 4BC0A 1MRSA 1JIVA 3EXIB 3X3HA 3DTVB 4BU0A 1MJHA 4ZMBA 3QKTA 2HV8A 4UJ3A 4Y2HA 1MBZA 2HADA 4MPRA 4UEQA 2QUAA 1A9QA 4MUEA 3M6IA 4F86A 2XTAA 1C29B 2X8LA 1GAEO 1BWRA 3WDLA 4F5DA 4A10A 1BQ4A 1G0NA 2J0EA 3NHWA 5DSZA 1H1LA 2VAMA 4YEDA 1L5HA 2V7VA 4RYDA 521PA 1KTIA 1YTUA 1H69A 3ENVA 1KORA 1Z0ZA 2BW0A 1ZGJA 4UMFA 3I23A 3R5JA 4ZQEA 5F1PA 1GPH1 1NNEA 5JNVA 1UK8A 2DC1A 4XB1A 1BA3A 1TVMA 2I62A 4M9CA 3FF4A 3PFWO 4M1MA 2ZW9A 3SEZA 3OFKA 5AVTA 2CW5A 5AQ1A 2FMHA 4EPYA 1E2GA 2CK3D 2R6FA 1A5TA 3D7MA 3E1GA 4E2FA 1DJPA 3E35A 1O5TA 3KG2A 1I4LD 2EQAA 4XTCS 2GS9A 3K9QO 1A2KC 1UBUS 3VYTB 5C4MA 1OZHA 3R9XB 4UVHA 5DLQC 1I2AA 2F48A 4JP2A 2P27A 4B6RA 3HK2A 1RXUA 4IIJA 2ZCJA 1JRLA 3GUHA 1NFQA 1PAUA 3IA7A 3LF1A 4EW1A 1LX7A 4MV3A 4N6GA 3ITEA 1RNLA 1JPUA 3HUUA 4I4CA 4NYMR 1PD1A 1EYZA 3OU2A 3U4AA 3WKDA 4ME6A 3LPNA 5PNTA 1EFUA 2C92A 3EUWA 3L8EA 1YUBA 4KUGA 3A1EA 1G8GA 4WCDA 3I1IA 5E3JA 1YZ3A 2QV0A 4WBXC 4NAVA 2HGSA 2ZRQA 4R81A 4LRSB 2IYEA 4JJ6A 4N0PA 3FMVA 4A16A 4DQKA 4RIGA 5A1JA 3CY6A 3U7FB 4IS3A 4OGGA 4EITA 2D7DA 4D26A 1T8PA 1XF1A 3RK1A 3U7RA 1ODJA 5U4XA 3PXAA 2RE8A 3E9ZA 2JLBA 1PZGA 1JA1A 3L1VA 3W2FA 1JWBB 2Z43A 3G5MA 3OE5A 5MF6A 3SVZA 1FBTA 1DHRA 1P4HA 4HPJB 4ZI7B 3LC1O 1VQ1A 1J2UA 2OVFA 1RJFA 3KSDO 1OFVA 5FADA 3N2NA 3SX4A 3IAM1 3KSBC 1QO9A 4DUZB 3V6MA 5DFAA 4HNHA 1VPWA 4OMUA 1YCGA 1ADFA 1Y6ZA 2JIMA 2P9ZA 2R751 1LDGA 3AUYA 3FCAA 1QLWA 3OPVA 4RMGA 1CZRA 2A57A 3KL2A 1ID8A 5ER6A 1DKPA 4YJKA 3U7JA 2BUCA 3PNMA 1ZH8A 3H5IA 1KIMA 1Z8HA 4E6EA 2N47A 3LO5A 5CD1A 4P38A 3WHPA 3UHJA 1OQAA 4WCFB 4NMWA 2IP1A 2GCGA 2JCSA 4NLLA 4C7JA 1T35A 1YB1A 2QRUA 4R6WA 4TX1A 1YOVA 4TLCA 1TCUA 2EJUA 3WJAA 1C7QA 1ZD3A 4EELA 1W73A 4J4BA 1XD9A 2WVGA 4RIEA 2QJFA 3IBTA 3OO0A 4P82A 3FWPA 5ALLA 5DMXA 3GNQA 4P7KA 2XGJA 4FCTA 4IVPA 3VR0A 4ZK6A 1QLJA 3ZBUA 2J48A 3DCNA 5KYGA 3UPUA 1P9OA 1YWGO 1N2ZA 2IZ6A 3AY0A 3CRNA 3DDCA 2O3JA 4K6HA 4R40A 5B1HA 2Q5OA 1XZKA 1XRSB 3HPQA 3ZLTA 4DUYB 3X1XA 2IYQA 2WLSA 2Z3VA 5A5FA 1JIIA 3JYNA 4OJKA 4H6WA 4ZAXA 5SYMA 4DLBA 3LFTA 4BKQA 1U02A 4LJLA 5FPKA 3G0GA 3DOUA 1JF8A 1RWNA 1L4FA 1Z74A 4FFDA 1NQUA 3W04A 5JO9A 3ZWCA 5HKKD 2RHWA 1BJTA 4ZPXA 3TSZA 3FMIA 1OFUA 2GSDA 3LJKA 3DO5A 1YE8A 5KTMA 1OKKA 4NCKA 1UBOS 4US1R 1DC3A 2EJCA 1E79A 1TUIA 4N18A 4CQJA 1GCGA 1E3MA 2IKSA 4X95A 1UEXC 2W7TA 5BSWA 3LDFA 4LOKA 5ECWA 3IV7A 2ZSAA 1MORA 3W6NA 3I62A 4DGQA 1XJCA 3BT7A 2C8JA 3RRMA 3B20A 5EPOA 4F9FA 1TUGA 2J3IA 5DSXA 2ZUEA 1J0BA 4C4YA 1EINA 2QR2A 2R86A 2Z5LA 4LMBA 3G8YA 5I4CA 3JXEA 2NO6A 3NTOA 4L8VA 5DCLA 3RARA 1QRRA 3L8FA 1LTQA 1OX5A 4AK9A 2PZGA 3AHGA 1JB1A 4M21A 4MR9B 1EVQA 3EXEB 3GH1A 4WX2B 2WY2D 3AONB 4N49A 4WUVA 2OGUA 3M5WA 2J7KA 5EXXA 5JAMA 2B35A 2CMKA 4Z7QB 4QT0A 4QHTA 3C6XA 3VHQA 1K68A 2O0JA 2OHVA 3K0FA 4FILA 4NTZA 4MQEB 5DN9A 1FY2A 3V4ZA 1I2CA 5DU2A 5L3VA 4Q7EA 4DW8A 1ZA1A 2X2FA 3T3DA 3VPFA 5EWJA 4BO7A 5EQFA 2V1UA 3DDSA 1EP9A 3KB1A 5KYYA 1R5JA 4YECA 3O8QA 4ZVPA 2A59A 1TKCA 2EZUA 4HNTA 1J23A 1WSBA 5D3MA 4YC7A 3SIPA 1P0QA 3P9KA 4EBBA 2ZANA 4JLMA 4KV7A 3PNOA 4MS3A 2Z83A 3KAJA 1WAMA 4X1OA 4ANFA 4XGIA 4B85A 2COEA 3OZUA 1M8GA 3DXFA 3BREA 3VR6D 1JXQA 2HK8A 2O4UX 4ABYA 4EENA 5EESA 2FJ0A 4JL5A 3C1TA 1GKYA 1XMXA 4MWSA 3THXB 2BR5A 4YXWA 4UBKA 2QZJA 2JGLA 3BEOA 3GAAA 5DE3A 3OPQA 1YA6A 1P77A 1KEZA 1MMFB 1UANA 4JWKA 1KOJA 4NBWA 1C3OA 4O1MA 5H9WA 3LX6A 3A4IA 4OYHA 3K20A 1IEWA 3UMSA 2CV1A 1D2NA 1E7QA 4LJ9A 4GX2A 2FR1A 2WHXA 1HXHA 4P9NA 1Z4NA 3RE1A 2YJZA 1IBSA 2XBLA 3G17A 3C1AA 1II8B 2AJCA 2G80A 2ZIFA 3ODGA 3QKSB 2JHFA 5JD3A 2C57A 3V8NA 1SXJA 1PFQA 4K6MA 4FUQA 4RA9A 4KLNA 1JPJA 1A9XB 1QQ6A 1Y0BA 1PJZA 1Z7GA 2H51A 2VHWA 4NAUA 3UAZA 4ZCSA 4AZTA 5KTPA 1KHTA 1U11A 4W6ZA 1VI5A 2OGWA 2QLMA 3FWNA 1PYOA 3I5AA 1HEUA 2W2KB 3FDFA 1Q2XA 1YK0A 2FR8C 3IBGA 4RTKA 1DBVO 3ZD9A 3AKCA 5BWBA 1KI7A 3RFCA 5G1OA 3ZVMA 1LK7A 4CR6A 2HWWA 4DXAA 3L6RA 4CMCA 2FG6C 1WUIS 2LVBA 1RP1A 2C4TA 4NG5A 3QKUA 1XMPA 3O73A 4YUVA 4ZT7A 1EVIA 4DDWA 3CB2A 3SJZA 2A84A 2D1TA 4DS3A 4XVCA 1ZONA 2FFQA 3L04A 4KPUB 3M5DA 1Z6QA 4QEKA 2OLJA 2FQXA 4I4TB 4E94A 1Z36A 4YMTA 1E92A 3DHEA 1WQ4A 1OH7A 4LRWA 1FTWA 5JZMA 3GP3A 2QLJA 1LRLA 1J06A 1U2PA 2IX9A 1SIOA 2WNHA 4JR0A 4UPDA 4WXEA 5KWIA 1NZDA 4BEBA 3I1FA 2ORYA 2O2GA 2IUUA 1D8AA 2DRIA 2HT6A 3JYPA 5ADHA 4S1NA 1BVRA 5AK6A 4D6PA 1J99A 1PJQA 1CUDA 2JK1A 1VKJA 3DOCA 4ZCTA 1YGPA 3TFWA 3D4NA 3O95A 5AM2A 1CJTC 1QGED 3QA9A 4BDSA 4N12A 4YVFA 2WU3A 3F0TA 1EUYA 4IFIA 4EF6A 3PGJA 4ZEOA 2AHRA 2ZTMA 3BXOA 2G07A 2A9VA 2VP4A 1WHSB 5JROA 1PQWA 5DTQA 3U0BA 3ROPA 2OBNA 1USUA 1IBCA 2OFOA 3CBQA 3GFQA 1GZ3A 3L1UA 3LXXA 3UUWA 4DARA 2HSWA 3A9VA 1OFUX 1WZIA 3FHLA 3IXMA 5HEKA 1G8AA 1EVYA 3VJKA 1Q1AA 2IH2A 4TVSA 3M6MD 2C29D 3P9CA 3ZEAA 4JT2A 3HU1A 2Q9UA 4AKIA 4DY4A 2AG0A 2ZTSA 2YC4C 1HZZA 4HYYA 4ZANA 4C7XA 4NRDA 3U3OA 1ZBDA 4L5BA 3HKCB 3BFVA 3NTVA 5EJEA 3INYA 1EBBA 5IC6A 1XTIA 1NRJB 1UINA 2BFDA 4IYRA 3ZN2A 3KYJB 4Q02A 3KSAC 2FU5C 4EK9A 4EIWA 5A9TA 3KLMX 4Y0VA 3RRYA 1FSSA 4DLSA 4AB1A 5I6DA 3QFCA 3O90A 3UB2A 2QN1A 1CEYA 3PL5A 1W46A 1GTRA 4RQTA 4I3HA 3AY7A 5AJZA 3DLHA 3HUTA 4MZDA 3ONDA 5ALGA 1JQDA 2WUDA 1E6UA 3NHSA 4KGZA 1A4IA 4LI3X 4TYQA 4UE6A 3NEPX 3BF7A 1R15A 3GGDA 2BP7B 4ZVKA 3BK1A 3O03A 1RRVA 2WHEA 1DEHA 4H3SA 2IFTA 3QEKA 4DCUA 4EFNA 2FMIA 3OIYA 4Q16A 4BKUA 2IV2X 2QTHA 3T7AA 3RUFA 3PEYA 1HDYA 3GK3A 3SS8A 4WT7A 4UEOA 2POQX 2ONYA 1G6KA 3NEAA 4IXMA 4M0DA 3O8OB 2P7IA 2CFIA 4CL2A 2H5EA 2R66A 4M37A 4PYMA 3URKA 1U7DA 3A6KA 4WBNB 2H0AA 1X8KA 2IPOA 3PTLA 4G5FA 2BI8A 4NCAA 2JJ2A 3QRWA 2WJZB 5IKPA 1U2TA 4HATA 4F3YA 2OD2A 5B6JA 3QP9A 2M6LA 1Z34A 1EQAA 3VR5D 3KZ1E 1CZLA 1V2HE 2ZWAA 2XUQA 2C2HA 1L4LA 3CR7A 1IIBA 3QU2A 1Y1LA 2PUWA 3IUPA 2WJGA 3PEEA 4N0MA 4UHHA 1KEVA 1KVTA 5IZCC 1VE7A 3AKYA 3LCUA 3W8FA 4TSRA 5CA0F 1C4OA 1PTJC 3T7SA 4WMLA 1DDIA 3V4OA 3G2MA 1ESZA 4QDKA 2DBZA 1H5NA 3CSDA 4JITA 4QUJA 3Q41A 4UXHA 4XRGA 3DT8A 1E1QA 1BRTA 1KARA 1QFJA 3GJ5A 2TS1A 5KYWA 3GLFB 3WZMA 3DYBA 3ZNQA 2WSLA 3ECSA 2IDJA 4MUBA 2AYXA 5B3AA 3UKDA 3DBRA 1DB3A 1FVOA 5B53A 3U6BA 1ACLA 1Q1EA 2AJBA 3E7XA 5LLSA 3RREA 4LZWA 2XRZA 5G0TA 3RVKA 2H2WA 2V97A 2FZ5A 3DT6A 3KOYA 1LDMA 4OHZA 4DLLA 3NAZA 5BN4A 5MGBA 3T5TA 1V4NA 3IMKA 2PGOA 3PXCX 1L5KA 4XIGS 2INGX 2XH8A 1LF0A 1TD1A 3L4KA 3U9LA 3GD7A 3ZWOA 1SULA 4O1IA 2FPIB 2JD2A 2R1VB 1JA9A 2ZDQA 4F04A 2PUFA 1P4JA 4O4JB 5HMLA 1T1JA 1F8FA 1Y7LA 1PNOA 4LTMA 2FPWA 5J1TB 2HHAA 4QUDA 6ADHA 4NESA 3W2EA 5A4KA 4F6LA 1WUYA 5AXBA 3AOEA 5UKDA 1X1SA 4GYJA 3R7AA 2QMHA 4IR7A 3ZYZA 2P2ZA 4JI6B 3WA7A 2L0XA 1ZC4A 2VK4A 1ND5A 3I8XA 2WWRA 5IBRA 5EXTA 3SF8A 1RYEA 2QG4A 4GUAA 2Q1SA 3UK0A 1NN3A 2ZIXB 2VS1A 5FOTA 4B46A 3NX4A 3ET5A 4CM1A 3UMYA 4KZPA 4P53A 5B7GA 4YY3B 1U7TA 5M2QA 4W1SA 4ZI3A 1SR8A 5K0LA 4Q9JA 2AEFA 1HYHA 2VKQA 4UUOA 4CFSA 4TWRA 2BDUA 2Q3MA 2WU0A 3PB3A 3A0UA 3Q72A 4PZYA 1UJBA 4Y2XA 1NBME 4J0JA 2R25B 2K7FA 4BVKA 1YNOA 4DILA 4Y2SA 5KB3A 2IXBA 4QRDA 2VJNA 1ZU4A 4QXRA 1N5DA 2P9YA 3EUFA 3FFAA 2H1IA 4AQYB 1PCXA 3A6GA 5JWHA 1V48A 1XB2A 3L6CA 4PSUA 1NUHA 1OASA 1J1IA 2V54A 1J2RA 2ODWA 4IQGA 1QONA 1G8MA 2CLLB 2XVYA 3G9XA 2YVLA 3ZDZB 1ZQ9A 4BWVA 3PITA 5HKLA 2ZUTA 2C2YA 3K0BA 5CCXA 5BQXA 3MYRA 3ZI7A 1TIBA 1O96B 3L7CA 4TXMA 3TW8A 5DIZA 1ZH6A 1PGOA 5HZKA 3GFSA 1N2SA 3I3SR 2GNAA 2Y1FA 1M6WA 3DULA 3U56A 4JIMA 4UUNA 2NVUA 3SSNA 1JHAA 2P40A 4IHJF 1Y5RA 4L9AA 2DT5A 4KFRA 1XTPA 5D7NA 4D3ZA 2OCPA 3FUTA 4HXGA 3SG0A 5IDQA 1SU7A 2D0OB 4WXHA 2CF6A 1RBQA 3AR2A 2FP3A 3DF9A 1ZHHA 4NBLA 4MUFA 3I72A 3R0JA 4Z8YA 1YA8A 2XNJA 4UHEA 1ODLA 4QT4A 2ZRHA 2FX3A 1LZKA 5IM4A 3C3WA 4U7FA 1U2ZA 4YXFA 2A67A 4GYWA 5A2GA 4A23A 1ISRA 2GCIA 2WUWE 3BH7A 1MW9X 4JVOA 3GZNA 4MKRA 5CM9C 3RKUA 3VYWA 1S6YA 3SWWA 2YZNA 2C1XA 2Q1YA 1G2QA 1YB4A 3JASB 3O4IA 2XUFA 4GWKA 2X1MA 2R00A 4KSCA 5J2TF 1H23A 3S44A 2RGBA 2R8RA 3TS1A 1SBZA 2FPPB 3KT8A 1L4BA 2X2PA 1P0MA 5FIUA 1W4RA 1AH2A 4B6QA 2L17A 1ZESA 3LC7O 3MLEA 4LHEA 4Y6RA 4ZK2A 3SI7A 4QYMA 2AH5A 2RKBA 1QDEA 1YHYA 4TWIA 5E38A 3ADBA 2HV9A 1UADA 2OOKA 4DEYA 2BGMA 2GFHA 4PTYA 5HSGA 1PQ4A 3FYTA 3SQXA 3ZHTA 1AV6A 1ZMOA 4EEXA 4BTEA 3G2LA 1RM0A 2DUJA 4BN0A 4BV8A 3M0EA 1AD2A 1KC1A 3RM3A 1QLHA 1R7RA 1NURA 4I50F 4ILKA 2RI1A 3ELBA 4G0NA 3B5IA 4ENWA 2H1WA 3VPBA 2PUDA 4L3OA 4BP1A 2Q49A 3JD4A 4Y2UA 3EEQA 2E7ZA 3BWVA 2IOFK 4LZJA 4PXSA 3U9TA 2JZCA 2C5EA 3WYNA 4TTVA 2MJLA 1X3SA 2C96A 4EKGA 2R8BA 3GUUA 2EZTA 3PC8A 2XBMA 1G20A 5DNYB 1BMFA 2R1TB 1VZ3A 2OKCA 4OIMA 3W1WA 2NMVA 4DDUA 1LPNA 4UAUA 2UZAA 2REQA 3H4TA 4HCJA 4AJJA 1VBKA 2VHJA 4IWNA 4ZV9A 5A2QA 4JC5A 4LX8A 4ZOAA 4CR8A 1M8FA 5JI3E 1SEPA 4G1FA 2RHCA 1MG0A 2WQZA 1I7NA 1XKLA 2B4KA 2BFCB 1ZSNA 3A9CA 3WB1A 4YDSA 1XTRA 1BX3A 2CFSA 4X54A 4YIKA 3OMXA 2EARA 2YWRA 2ZB3A 3ZEIA 4FDAA 4JLUA 1SUCA 4C7VA 1IJFA 3ZWQA 2LZ0A 4ZYUA 1CEEA 1WTAA 4YAGA 3I9FA 3LL4A 1TVEA 1C4XA 4RS4A 5ESXA 1F3OA 2DQSA 3WBJA 2Q4EA 2BDEA 3FFTA 1G41A 2OM6A 5ALKA 1K5HA 2OC4A 4J2OA 4XR4A 1DX6A 5LBTA 2VPZA 4N54A 3VSCA 3EWSA 5KQGA 3PLRA 2ZB7A 1YR7A 4XD2A 1AK1A 4PFKA 2JF0A 3ADKA 4B1FA 2PRJA 3VC7A 4D3YA 2QD2A 1LNQA 2SCUA 1NAHA 3EJWA 3VGPA 2DWCA 1VLQA 4IAOA 4LV8B 1W0JA 4GZ5A 4J7CA 4EPVA 3VZRA 1QRAA 2PGAA 1WP4A 4DUGD 3HYLA 3BERA 4W5OA 3FZEA 1EQUA 2B69A 2ZJ6A 4HRVA 1XX6A 2QN9A 1QS0B 4PZUA 2Q8QA 7REQA 2CZGA 2G4LA 4HX5A 2JG3A 4JEUA 2PUBA 1TKAA 4YJ2F 2BCJQ 4YRGA 1N7IA 4NZNA 1X87A 3HJAA 4UDNA 1XZLA 4HWRA 1L3IA 1WHTA 3DKPA 2P11A 2LR0A 2BHNA 2RARA 2WU1A 4NJMA 1N8KA 4M46A 4Q4LA 4EHLA 2CUKA 3S70A 4ER7A 5IF9A 4B35A 5IDVA 2BLNA 1WVGA 4N8SA 1K63A 3V7FA 4PV7A 4A0SA 1NJ8A 2QIOA 4TMKA 2XYQA 1Z38A 1Y3DE 1P62B 1WBDA 4QTUB 2P1RA 4L74A 4U0JA 1RU3A 3EYWA 4U02A 1KK1A 3KYBA 4U2BA 4ARZB 5CLFA 1G6OA 4MYSA 3HWRA 2NSHA 2JJMA 1FQOA 5AM1A 4ZDWA 5HRCA 1EK6A 5DSTA 2J32A 4HEA6 4NR0A 3VR5H 2AIRA 5DW3A 3TTSA 1SZDA 3GRKA 1K2VN 2GEBA 5DRYA 2NU8A 4CCAA 3EGCA 2HPHA 4M6WB 4R3WA 1BE6A 5LDHA 2KS6A 4A0GA 1TC1A 1E5TA 3FTFA 2ZE7A 2PZ8A 5JI2E 2VYFA 2CNKA 4FGLA 1E1RD 2W6PA 3ASVA 2Q7OE 4YALA 4LY9A 2W6NA 5JBNA 1K5PA 2ZT6A 2HIGA 3LP5A 3P2KA 2NM0A 1ECPA 5BT8A 3K2IA 3W6UA 4BNIA 3A2KA 4IIBA 2I55A 2NIPA 4ALLA 4B4WA 1COWA 2F90A 5LNK1 3G0OA 4ZQIA 3RHSA 2COKA 1VM6A 2QXTA 5JH7A 2Z2JA 2XGSA 2K87A 1A9OA 4AY4A 1T43A 4KTTE 3RTCA 1O57A 2AG6A 1TJNA 5L7TA 2WKQA 3LBHA 4GX0A 3N8IA 2E4XA 1L5SA 3U39A 5FA6A 3TM4A 2XOKD 2O2XA 3ONWA 3RT7A 3PENA 5L40A 4LYJA 1WB9A 4IV0A 4PQRA 3VUEA 1X7WA 1I0ZA 1DKNA 4EH1A 1Q50A 5HIMA 4IY1A 5EMHA 2PGIA 4I81A 1MA3A 2MYTA 1F60A 3NT2A 3E3OA 1TLLA 4Q66C 3DE1X 5DOZA 2ERXA 5DM60 1C4WA 1OIXA 1AKQA 1X3LA 1LDEA 3II6X 5CFQA 3MEQA 5KO2A 3KDPA 4NXMB 2GD0A 1HNWB 2B1QA 4NEHB 5IUKC 2GBCA 2H7CA 4JLNA 3P0JA 5ALWA 5FBLB 1Q0PA 1AG9A 3A1NA 4F84A 5I01A 2GFQA 3DZHA 3BKXA 3CSUA 3U81A 4CCYB 4WK6A 1ICIA 5HGXA 1TMYA 5DCYA 1RCUA 1QO0D 1BXGA 1KDYA 3DOHA 1QZUA 4R3UC 4QVGA 2PVPA 3AF5A 2FMXA 1YRBA 2CJYA 4I2NA 4LXUA 4GLJA 3SQOA 1QQ7A 3KXDA 5JHHB 3ZBTA 1VSQA 2UU9B 3EPPA 2WKPA 4LBZA 4NZPA 4ND5A 3D2CA 4PZCA 5BRNA 2MOKA 1VMKA 3DTTA 5FUXA 4PLHA 5J2TB 3LVFO 4EW3A 1E6CA 3HRIA 4URFA 3S8EA 5DHAA 4RTRA 2PMDA 3BBPA 2YJ5A 3TRJA 7AT1A 1SBYA 1XGKA 4R83A 3VR2D 4PR3A 3DWFA 3QE3A 4JHLA 5KDDA 5DZSA 1H0HA 4KZKA 4C21A 4HGZA 1O6CA 3L4SO 5ETJA 3VPAA 1SIBE 1OWPA 1G21E 3H1BA 3E2IA 1CUJA 2ASVA 1BEZA 3BK2A 3QHQA 1M54A 5CHEA 4GRAA 2CYBA 2QZSA 1Q92A 1VMAA 1YO6A 3H9GA 3KPWA 2XIQA 3HMQA 1CQZA 3OHSX 2AFVA 1J0CA 1S8NA 4I50B 1DI0A 1KJ8A 2EV9A 2GXQA 1MABB 2KSQA 2ZSEA 1DRWA 4HH1A 4UBNA 1TT7A 2Q3FA 4YRJA 5IWAB 1MAHA 2P90A 3OICA 5EERA 2YKGA 5JXIA 3MVEA 2GTIA 3ZHZA 3DCJA 4WN9A 2CSXA 3KTAA 4EQ6B 3WLOA 1KO1A 1LY1A 3QPBA 3ZE8A 4B4DA 2FOIA 2J87A 3I12A 1P17A 2J5BA 2Z8YM 1PR9A 2PRZA 5DCWA 3FYUC 5K6AC 2FOXA 1YJXA 1IWPB 1VYHA 3LPCA 4NWIA 1TA4A 3RAJA 1MB3A 4A0RA 1U2SA 2AQ8A 2DQ4A 3VQTA 3GX1A 2XD9A 2J9GA 5BT9A 1PK8A 2PH1A 4UVDA 2QYOA 5AW2A 5I9NA 2WD9A 3ZHUA 1KEWA 3M1AA 4IKEA 3GLHE 3KOUA 4FOPA 3C3BA 1KYQA 1PE0A 4TZTA 1IAQA 1HETA 2C1EA 4GP9A 5LQDA 3O4RA 2BKAA 1C7EA 1FX0A 2C5FA 2YZ7A 3MF4A 1CZOA 5DM4A 4G23A 4D2IA 2QUBA 4E1VA 1CUYA 1ETUA 1XNJA 2C77A 1MC5A 4BO0A 4U1RA 4E70A 1A9ZA 1PJTA 2QX6A 4G9GA 3OIGA 1VKNA 5F2NA 3KJFA 1R0KA 1DTWB 1JB9A 5IKEA 5KMGA 1ST3A 2YNMD 3GGSA 5I4IA 3N0WA 4JQYA 5COBA 4KO8A 3EGXA 1KAEA 1J20A 1T5BA 4QFCA 3IP1A 1P7YA 1A9YA 5G0SA 3A1WA 1DELA 2BCGY 1G16A 3DEZA 1AUOA 5DGIA 3FLBA 1RWWA 3ROMA 4O4LA 1BHJA 1NUPA 1RAEA 1TK2A 2H2AA 2DULA 1TYAE 3FHJA 3SAJA 2CDAA 2GCPA 3GLUA 1Z62A 2ZYGA 3KEFA 3NBQA 2GZRA 2W22A 2HA4A 2UVPB 4H31A 2HPVA 2ZAYA 5BOVA 3TRHA 4ROSA 4LDZA 2BEUB 1WBBA 3REOA 4MX8A 2CXHA 2NUAB 4H7HA 1AQJA 1W36D 4KXYA 2EJWA 4YJ2B 1SRQA 1WETA 1I0LA 4YB8A 3BWDD 1MQSA 5BSFA 5DH9A 4AZVA 5AKZA 4HUQA 5DHUA 2PL1A 3LL7A 4OGWA 1E9FA 2XSZA 2YV1A 4HEQA 3WRXC 1LDBA 3OA2A 4DCMA 4Z9AA 1V5GA 5FTMA 3TDMA 5E6RA 3SZGA 3TINA 1NL3A 1YI1A 3LH5A 5AXCA 3OKAA 3KZCA 1YVUA 1AGXA 3BDIA 1GA1A 4YCLA 4GVLA 4JI4B 1XEXB 1RYDA 4KL8S 4HD8A 4I5GA 1SK8A 4IO1A 1RMTA 4YPOA 5IBPA 3AVWA 5GVRA 4QL3A 1CX9B 2HO4A 4J8PA 3H8JA 1J1ZA 1Y3CE 3L9XA 4TUYB 3ZDXB 1BJRE 2EXXA 4FKMA 3CF4A 1E99A 1P0IA 2JGJA 4ARVA 5CVVA 1E6EA 3M82A 2HOQA 1FP4B 1OLUB 9GPBA 1P4AA 1ZNXA 4QQ8A 2J4FA 1CRLA 1SOMA 2NACA 4QDOA 1N3IA 5EIOA 3SJBA 4ALNA 1QBKC 1CZUA 1R8QA 4DA4A 2JI6A 4OF4A 3PJFA 1EDZA 4OPMA 4P0TA 3SHWA 1X1TA 3WQHA 3U19A 4OI1A 3OCCA 4RKFA 1J09A 4KKXB 2ZYHA 3MXTA 3SOZA 2FWBA 3CIOA 2EGHA 4LTNA 1C50A 3PQCA 1W0KA 3KZXA 5A7HA 2FWNA 2I6QA 5F21A 3HJFA 1GKUB 1PUIA 5C7YA 5J4HA 2IH4A 4BEVA 2M1ZA 1P2FA 2WSIA 4DA0A 1G5TA 1VG1A 1UDBA 3ZWMA 3ROZA 2ZBRA 4D8TA 3DDNA 3GD5A 3QSGA 4R71A 3HXOA 4TQ9A 5JAIA 3H9BA 1P4GA 5T8KC 1CUWA 2IPXA 1QF9A 2HA7A 1WA5A 2ZE6A 3VSAA 2P75A 1PFGA 4YACA 5H82A 4C3VA 3Q0IA 2HW8A 2ZBFA 4LHVA 5E7QA 2GAIA 3QE4A 3ZXYA 2XCUA 4UAVA 4CM8B 2F1KA 1MVLA 4N8DA 4R1TA 2EVWX 4KWCA 1NMYA 4LMRA 1YASA 4DR4B 2QGZA 3UA3A 4Z1OA 2BJVA 4E5SA 3ZHQA 1N75A 1ONOA 4J43A 3RAGA 3P0EA 3TOSA 2O2IA 5LQRA 3MRVA 1UQUA 1D03A 3OM1A 1V8ZA 4B3CA 3DC7A 4QKQA 5JJCA 4QTXA 5JVDA 4RD6A 3DXXA 5JXGA 5K5EA 1SC1A 3ER6A 2IUSA 3EW7A 4X63A 3I2KA 1A97A 1X1AA 4G8JA 1KJWA 3TSWA 2LIPA 2YVKA 3H5WA 4J1SA 3V5NA 4ARCA 1PZNA 4I1VA 2YY7A 3KNZA 1OLXB 1T0BA 1FPMA 3WMWA 1DAHA 5DW0A 2IBMA 1T5SA 2X6QA 3PD7A 3P9NA 1PT6A 2Q3EA 4JZKA 1E3DA 2K6GA 2W00A 2ES4A 2FFJA 3A9RA 1CS0A 6CHYA 3IQZA 3O1JC 2ZULA 3HN6A 2FPLA 2H17A 2OCIA 2RK6A 3ABSB 1T9AA 3GCXA 5EKDA 4CUJA 2JDIA 5TPZA 1AJEA 1TM2A 3MT8A 3HYSA 3KKMA 3Q3EA 5F5XA 4H7IA 5DF1A 4JOQA 3LYAA 1JQBA 1IMJA 1JWAB 1V4VA 2BBOA 3C3PA 3OSZA 3PUJA 3PWSA 1KFKB 4K9QA 4RPJA 3UGKA 3MN1A 3CVWA 1DKQA 1XELA 2WPDD 1QH1A 2C20A 5ERGB 3GG9A 2XWSA 5EZQA 3QX9A 2QMYA 3V8BA 4G85A 1JXMA 3BMOA 1XKTA 3EOBI 4PLYA 4XE5A 4B7XA 2CKMA 3I2JA 4AMBA 3RD5A 1JKFA 3CZCA 1YACA 3Q15C 4EW6A 4DKJA 1JEYB 1DOHA 1E18A 5TRTA 3E1SA 2ADFA 5DNEA 5JFGA 3IEMA 4P2GA 3B53X 3ZDBA 3A26A 4C7OB 3IURA 1P5HA 3LCCA 2YRXA 3BA1A 1SQ5A 1V1MA 4LDJA 4QU0A 5JRDS 2I03A 5TVGA 4DSZA 1I5RA 3G0HA 3KTDA 2R44A 4EFDA 3JR3A 1F9EA 4RLFA 2R7LA 3I3OA 4AFNA 1KEKA 3JVDA 4LYDA 5JISA 3T1HB 1P5JA 5EKXA 3SIRA 4BNTA 1CNMA 2XE7A 4KE7A 3L1KA 4YFYA 5HNKA 1I14A 3E70C 1YE5A 2C9OA 2QPTA 4RKRA 4HLUC 5L3QB 4UJ5A 1V1JA 5AJHA 2FSUA 4CLRA 4JBYA 3DEJA 4YCBA 3P9IA 3IE2A 4LF9B 1U0JA 3D8BA 1N5RA 2HDNB 3FDIA 4F56A 2NV6A 4R54A 1WXDA 4YRSA 5LQKA 4PGAA 3BVPA 1GZVA 3NVKI 5IT9A 4UU1A 5C4GB 2DZDA 4PAMA 3KVOA 3P4YA 2GK4A 1EUCB 1M1NA 3TLGA 4F2HA 5AVOA 5DN6A 4HRYA 1VPEA 1PX2A 3IAUA 3AVYA 2ZUSA 4DV0B 1KJIA 1AGRA 1ZRNA 3GAMA 1Y9ZA 4QX6A 3STHA 4DBLC 5C37A 3TMYA 2EWWA 2QRQA 4FCCA 4A27A 1CR4A 4PEVA 5TEVA 2AXQA 2E5FA 5LWQA 3ZKWA 1HRKA 3FOEC 4UNQA 3OZBA 4LXQA 4LRQA 1QCZA 4AO6A 3F1LA 5DO9A 4RY8A 3PKZA 1BIFA 3IEPA 3ZH2A 3ZKAA 2GMWA 1QH9A 4OLJA 1V39A 4UREA 5HTOA 4B73A 1ZCJA 3ETLA 1X7GA 1QC5B 3CTPA 4I9NA 1N1MA 3E3LA 4L85A 4MKIA 4UE2A 5M5BA 5J23A 3SHQA 1W88B 1Q21A 4JQCA 4ZOEA 5A05A 4BXOA 1JHYA 1PGQA 5DX8A 1AF4A 4RFVA 3EMDA 3FNQA 1EFPA 2QX8A 2HC9A 3GZ4A 3EIUA 3OJCA 4RV5A 5TS3A 4YMGA 1ZFNA 2B9VA 3THYA 2RHMA 2JCYA 4AJLA 4DEXA 1HX7A 3RK0A 1Y34E 4BRWA 3V42A 4BLQA 4KKVA 3A14A 2WOOA 3JY6A 2OT3B 4EVIA 1U80A 4Y9UA 2XLBA 3KOZA 3UA4A 3VPSA 2XYVA 3AUXA 1FPQA 2I4IA 1KIFA 3MCZA 4TT3D 4BBAA 2HJVA 5DGXA 1I4EB 5CA1B 2PSDA 4RZSA 1LBHA 2AI2A 1MFZA 2JAHA 3BCUA 3VAZA 3DQQA 1KH2A 1DEAA 2ANBA 4HAXA 1ZIOA 1EB8A 3WK4A 3OF3A 4UZEA 3EOAI 5HF5A 4DC1A 3VVMA 6Q21A 3BTVA 4TMXA 4ZCMA 4RV4A 4QPJC 1KVUA 4R31A 5DEOA 1FLDA 4DUPA 2IZ5A 5DM1A 3ZCPA 3ESDA 3SQMA 2UYHA 2PL9A 3NDRA 4BBJA 1E3WB 4KC0A 4KDEA 2NN3C 4D99A 2Z6AA 4CEJB 3EGVA 1KE1A 4FGJA 1WCIA 2O2SA 4PTZA 4W1RA 5KYVA 1QP4A 2P1DA 1Z0DA 5DTEA 3TQQA 3E23A 1ZUIA 4QXAA 4C0JA 4G1EB 3QBEA 2XYHA 3D6TB 3SE7A 2WZBA 4U7PB 4DFDA 2JLAA 1WR8A 1N9ZA 1QORA 2GBLA 1PHRA 1Y5LA 2G67A 3OY7A 3WLRA 1RBYA 2PKEA 3EAGA 3GP5A 1RPNA 2M1XA 1T0JB 4CTMA 3AKZA 2QW8A 5KKNB 2W2OA 5HOQA 2PUHA 1KEEB 1IB6A 3ORSA 2G9NA 1OR8A 4DREA 3T5AA 1FDWA 1ZUD1 2R6CA 2Z08A 3D6MA 4NCNA 3UZUA 4EY5A 4K3VA 1PT8A 4DJDC 4IVRA 3GN2A 1NZFA 1LB1B 4MKXA 4LWZA 4OP2A 5FYDA 2ZT7A 4Q4HA 4RDCA 5DI3A 1Z8NA 4UM5A 1UMBB 3QV1A 3T95A 3EXHB 3NXSA 3OPMA 4MVJG 3L7JA 5D84A 1SVNA 3GJRA 4CMIB 4N41A 4JFRA 2HU5A 2XOEA 5HFJA 2IKQA 3HCCA 1G4HA 2QRMA 1IFXA 2H16A 4FZVA 4ZOLA 2HMVA 1P9WA 4X93A 2DEUA 4I5DA 5EMLA 4M9SA 4MW5A 1N2CE 1NP7A 1TDJA 2VYVA 1N6LA 3EZ2A 1ZKMA 3HJCA 2ZRNA 4RH3A 2K2QB 4G0QA 1VJ5A 3UWMA 4KQ6A 4RFSB 4W9NC 4NMXB 5EHXA 1M8JA 3N7AA 3SN6A 2VDMB 3H16A 2OUIA 2G09A 4B2YA 3C74A 3R09A 4DV6B 1QRTA 1C3LA 3UMRA 4Y6OA 3T15A 3U4GA 1OH6A 2XMBA 5FOWA 2R6GA 1ZINA 1P1KA 3OCYA 1JX6A 3AHHA 3DEKA 4MGHA 3WGYA 5ITWA 4O4IF 2VXCA 2CFRA 3QVKA 4B45A 2XUGA 2LIVA 3COVA 3VU9B 4B3BA 4V0NA 4L6AA 4CKEA 1QFZA 1GNPA 2Y1DA 5CB4B 3BMCA 2LD4A 3PNSA 4U8GA 3O8RA 1BHQ1 3F74A 4DG9A 4N6OA 3C8ZA 3DNFA 4O2LA 2YYYA 2BGLA 3OJWA 4L5AA 1YSCA 1T3HA 1UBCA 2RI6A 1CSEE 3L84A 1AN9A 5I7FA 4MQ4A 4N3BA 2C8KA 1E60A 3WK7A 2Y76A 2QMEA 2M9MA 5EOVA 2YDYA 3SEQA 1HG0A 1WXHA 1Z39A 4PO1A 4ESEA 5HM6A 1MU0A 3ZY4A 3I6QA 3WWZA 3WGQA 1VBNA 3DMPA 3FNEA 3V55A 2H92A 3B9BA 2AG5A 5DRTA 3O47A 5L51A 3B9QA 2CNNA 5AW6A 2FXVA 2ZITA 1CZKA 3CW9A 2Q2VA 1JZSA 4LHSA 4P5PA 3ZXXA 1ZIYA 3BDAA 4D3SA 3ICVA 5AVRA 2ZYAA 4M7WA 2C61A 5CLLA 3EDMA 4QJIA 5HQ3A 2OFFA 1V11B 3ED1A 4HKTA 5U9CA 2FE4A 1ZSYA 3E7FA 2E4ZA 4LHWA 5C1IA 2X13A 3RVJA 1JJVA 4BGUA 2R65A 3AINA 2V4UA 1EJBA 4L8LA 1VRVA 5BSRA 3SXUA 4G25A 2ZG6A 3WSVA 4GC9A 5IAAA 1N6PA 3K0SA 5AW0A 2IXTA 3FN4A 3ROFA 2Q29A 3Q7IA 2XF2A 1E2HA 2WK1A 4M55A 4XUEA 4YJFA 2AMVA 5EJGA 3D59A 3CG0A 3R3YA 2VDUE 2VYNA 3IOMA 5E0OA 5IAGA 2FQYA 3WK5A 3KVVA 2WFZA 1J2TA 1ZPDA 4UMEA 2A0YA 2W42A 5JW6A 1N2XA 1EVKA 3BCSA 3N7TA 3OKCA 4LEIA 3EDCA 3IBFA 4ZXPA 2A92A 2FWMX 1GLGA 1SQSA 1TVKA 2H31A 4IDBA 3DPUA 4MRAA 2I34A 3S2YA 1WABA 3KUUA 2AHOA 4ZHQF 1RRMA 2QU7A 1NPYA 3DL2A 1R6DA 4KN5A 1R0WA 1R5NA 4FXPA 4OQDA 3KCQA 3WWPA 4DT1B 1AHPA 2J5RA 3NM6B 3F1KA 3EEOA 4P7FA 2WTBA 2RIRA 1B43A 5IVIA 1E3JA 2A5LA 4QNNA 2ZCUA 4GXNA 3GUZA 4Q4CA 2CXUA 3K1AA 4MW1A 1IN1A 3CEAA 3O1IC 4UCFA 3B2EA 3CEPB 1KZ6A 3T6KA 2PV0A 2GHQA 4YWHA 3D4OA 2C4NA 3BIJA 4YAUA 5HKBA 2AJ8A 4AS2A 1G2OA 2I99A 2OBLA 1I7QB 1RXIA 4RLSA 3UXHA 1OZFA 2FPSA 2H5IA 2PLAA 1V7CA 2JVJA 4RCYA 1XV5A 3KOXA 3ELWA 5AKYA 2GA8A 2QG6A 3NC1C 4IZOA 4EY3A 1DIRA 4FQ8A 2OYCA 5L3SB 3N0TA 1FLAA 2YHAA 2O2YA 3G3EA 3GR6A 1AO3A 1V95A 2J08A 2D1RA 3O7WA 3ENZA 3JAWA 4PRZA 2YWDA 4RD0A 2E37A 2PR7A 4ROTA 3MGGA 2G71A 1EFAA 5CCDA 1ZD9A 1K5DA 5CXSA 2YICA 2OP1A 2PKQO 4TL7A 3G5UA 4R2KA 5G0UA 3RUAA 3VAAA 1OVMA 3W6ZA 2X0KA 3FWYA 4CHGA 2JLSA 3AI7A 4RPKA 3RVOA 1BGXT 1JBEA 5KTRA 1Q22A 4OKIA 5LZ5A 2Q8NA 3DLIA 3UJ6A 4OFBA 1RYHA 1N6IA 1U8CB 2F9FA 3E9QA 2PX3A 4O5OA 4Y98A 4PBSA 4JP1A 3E22B 2ZSJA 3T3PB 3I6MA 4C3UA 4D6YA 4LFBB 2EAUA 4DCGA 2JFYA 5JSFA 3JX9A 1MGOA 2ZYSA 4RSMA 1CQJA 4XDGA 4OQLA 1Q3HA 1WV0A 3EISA 4PX3A 4XEHA 4ZTUB 2CCGA 4FFWA 2QXYA 4F72A 3KIPA 1IUPA 3KVNA 5JSKA 3RBXA 5EUBA 4QU5A 4F5EA 4PZZA 1NLFA 5BVGB 1W2GA 2BFFB 2QGFA 1SXJE 3AIOA 3I39X 4HP8A 1Z82A 1A96A 1E79D 3HKDB 4R4JA 4ZD6A 3WL7A 1M7GA 4YCNA 2YV5A 4R0VA 1U63A 2IS4A 3A4MA 1KF0A 2R1UA 2RGRA 5B6PA 4J90A 1ORWA 2M2IA 4E13A 1N36B 4BPBA 5BUZA 1ESDA 2ZIVB 2PYDA 3NHAA 1DINA 3K6JA 5BNTA 2QYSA 5K4GA 4MWZA 4W5NA 3A1FA 2JL1A 5KVQA 5TQ2B 1S0UA 2DR2A 4KE9A 5JSZB 1C3JA 5E3IA 3DE0X 1T9BA 5U1PA 3L0OA 2GZAA 4PHCA 2F1JA 3PUYA 3UWPA 4XVUA 2ZYIA 4GP6A 3B5EA 3Q7SA 4JOBA 5BR7A 4BZWA 3C0KA 4M1WA 4LRYA 4C76A 3AKEA 4MCJA 3TO5A 4BQIA 1CR6A 1N9GB 1VE1A 3OZVA 4CDGA 3HY6A 3O94A 4JGIA 4NNOA 1S2NA 3SJCA 1M5UA 1VA4A 2XMPA 3K94A 3U13A 2XCLA 2BMVA 1R16A 2VDWA 4KIGA 3D3QA 1JDTA 1BCSB 2V8OA 1E7YA 3M33A 4KE8A 5KJ6A 2PX5A 1IYZA 1OFHA 9ATCA 5JR3A 1WCXA 4RL4A 3MCAA 4NP6A 4A8JB 1R9JA 4DCCA 2HHHB 1GGFA 2PTGA 1NHWA 4FINA 4LXXA 5DTMA 3UMFA 3A7EA 3PDIB 5IAEA 3W8DA 4C5AA 1Z12A 5I9LA 2OHXA 1P7PA 1JBQA 1MXFA 3A1VA 1S9HA 3IPXA 1ZN9A 2W71A 4NEGA 5PGMA 4F5ZA 2VTBB 3AVXA 1ZMTA 1MFPA 1Z07A 3GGJA 3PDHA 2IELA 5CX4A 3W2HA 1RYFA 1F1JA 4CM9A 1II8A 3I9V1 4FWBA 2ECQA 2DQYA 2W8BB 3QIVA 3RPEA 4YXWD 2XMGA 3A1TA 4ENSA 1B1AA 3KV3O 3PL1A 4URXR 5E9JA 2GCOA 5NULA 1YC5A 3DLCA 3NBYC 3TLMA 2P4UA 4CLHA 3WL8A 4AWAA 4CIWA 1YZKA 2QMZA 2XCQA 4FX5A 5JS1A 2HA0A 3TFOA 1ZHOA 3E0QA 4CETA 1PW5A 2XBUA 4QASA 3MNFA 2VT6A 3VNSA 4U63A 3FZYA 1T5TA 4O4IB 3V97A 3EQ7A 3NQ41 1JLLB 3DOFA 1FTYA 3N7UA 3O1HB 4WGFA 4AX8A 5AVUA 1SXJD 3D4BA 2B21A 1R0XA 3KB8A 4UNPA 3QYFA 4FFBB 1VFPA 1KAMA 2GRJA 3VH2A 3CEMA 1Q3KA 3GNLA 2H2DA 3AUSA 3EFOA 4HG2A 2PUCA 2ZRGA 4OHRA 4BZPA 1U04A 5AFSA 5B1EA 5AI5A 5IK2D 1G4AE 3AEZA 1Y3HA 3AB8A 3GJYA 3IHWA 3OTIA 5CK5A 2JAOA 3OAAA 1N4DA 4MJLA 5EFOA 5FPHA 1TU4A 5HF9A 4DMKA 1XL0A 2JGDB 5JFTA 2BEWA 4DB4A 3WGIA 5KHLB 3LNCA 1SCAA 1YZHA 3ZCVA 2G25A 4R2MA 2Q3LA 3TZ6A 1EA7A 2JAQA 2QVGA 1KS2A 2C31A 3MJSA 4WN3A 1JTVA 3OD1A 1WDTA 1YDHA 3G8BA 3WLMA 2NVOA 1RHRA 2IIVA 3KLPX 3UMVA 2Y67A 1UJ2A 1C81A 3WXMA 4E5VA 3E18A 4TV9F 3GFVA 3TL3A 4ZVUA 3KSMA 2YCBA 3U2QA 3WDMA 4F6CA 4KSBA 4B2IA 3RTBA 4PSKA 4NI5A 2GILA 4B43A 3FIJA 4R8RA 5IXYA 3K6SB 3PE4A 1T8SA 5C34B 3CZMA 4E7OA 5EZYB 2I4RA 1L9KA 2F64A 3DS8A 3H11B 1K5GA 1WHSA 2PVSA 4NENA 3YASA 2ZAGA 5FEMA 2EW8A 1EX6A 1UDRA 5T7BA 2V7EA 4GZLA 3QKWA 4JKYA 2FY8A 2POCA 3C39A 3GJ8A 3E7PA 2EYUA 4DMRA 1ZUNA 3NV7A 1EM8B 3KQYA 4LDAA 4OQPA 4XQGA 1JT9A 2PXAA 1H2WA 1XK7A 3ZIAA 4L08A 4UNIA 5JQGF 3ABQB 3HDQA 3HKBB 2GPWA 4RANA 5HCUA 1J2YA 4AY6A 4BP9A 4ZHQB 2H4JA 5HUQA 2CMHA 1Y33E 3AR5A 1VRWA 1W48A 2XW6A 3O74A 1BYIA 4MA4A 4N5MA 1KY4A 3GGGA 1WXEA 2V6BA 4PW0A 4ZT3A 3EC1A 2RDMA 4HQOA 4HWKA 1XIVA 4FIDA 3DG9A 3CVVA 4BMNA 1XD2A 2NAFA 2WV9A 3PS9A 5EEHA 5JD5A 4KCGA 3C8DA 1ZICA 2BY4A 2NO1A 2PZLA 3BRWD 3QJ5A 4LVUA 1HTWA 4P8RA 4U6QA 1GCOA 4XQEA 4IWYA 4H60A 3BB3A 3RWBA 2EHDA 2QRVA 2YDXA 3DBOB 3CLSC 4XFDA 5IBQA 3NCHA 4QDUA 4QOSA 2HDWA 1L5YA 4PZ0A 1N2EA 2FLWA 3MPUA 5L4SA 4NU6A 4AECA 5CB0A 5EHGA 2GFIA 4IJMA 3H5VA 4JSTA 4R41A 2UUCB 2D74A 3IE1A 2QB5A 1FIUA 4BMVA 1UM8A 2K7ZA 1NJSA 4WLOA 3FUXA 4QICA 2IU0A 1CUIA 1PW7A 3B8HA 3T35A 1YRQA 3DEYX 3HJGA 3WGMA 3QMVA 1KRXA 1SVIA 3RTAA 1TAHA 2B61A 3I45A 4EKIA 1HFKA 3MWYW 1OI4A 5ALYA 4Q1VA 4BZQA 3IPCA 2I67A 3RSQA 4H3VA 1MJFA 1F5SA 2QVXX 4KQ2A 3FCYA 4MVJE 3NAGA 3FGPA 1AXEA 3BILA 3OLYA 2GCNA 4HAYA 2Q6OA 4KFSA 4PG4A 3JAKA 5AM3A 5JEDA 1GUFA 4KQCA 1UPFA 4TLBA 3FI9A 4TSFD 5CLGA 3DMDA 3X44A 2WJ3A 4M9QA 4A6EA 3OQIB 3ONVA 1Z75A 1MB9A 3RSLA 4AP9A 4F3NA 1D4ZA 3MOGA 4HQFA 4PIMA 4Y2PA 4H7EA 4Y9DA 4WGGA 5A6SB 5HOEA 3FHCB 4LDRA 1JDJA 2MMGA 1W44A 2PAAA 3EEYA 1T5IA 1G0OA 4AWXA 3D6UA 1IAVA 4BDTA 1G18A 4M1SA 1C0IA 4UTPA 4D81A 4LQDA 3PDWA 3RS2A 3D02A 3EZ9A 4Y2VA 1D1SA 3PXGA 4KOEC 1ZJWA 4HWPA 4YQZA 3M70A 3ZQ6A 1DXHA 5J2UB 1UKCA 4ZVVA 3RROA 2HM7A 3PYMA 2DCMA 4JYZA 3TQSA 3H1TA 3OFVA 5LYJB 1E1QD 3BIWA 2WD7A 3EIFA 4R8KA 2B4QA 2I6UA 3NBAA 3QMMA 1B93A 4PSDA 4Y67A 2WAOA 1PT5A 1VSUA 5JAUA 1QNLA 1C5KA 2QVBA 3DMTC 4JU8A 2HWYA 4OKSA