2PKCA

Crystal structure of calcium-free proteinase k at 1.5 angstroms resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE K
molecule tags Hydrolase(serine proteinase)
source organism Engyodontium album
publication title Crystal structure of calcium-free proteinase K at 1.5-A resolution.
pubmed rcsb
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 1993-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2pkcA00
2HPZA 1SIBE 3LPAA 1SBTA 1TM3E 3H42B 3LPDA 4KB5A 1WMDA 1BFKA 1YJBA 1SBNE 2W2MA 3ZXXA 4OV6B 3WIVA 1NDQA 3DE3X 2GKOA 5K7SA 3OSZA 1SCBA 1Y3BE 1TM4E 2PWAA 4ZOQI 2SBTA 2ST1A 1AQNA 3GT4A 1SBCA 2ZRQA 2ID8A 1PJ8A 1SPBS 1Y34E 3TI9A 1OT5A 1AU9A 3SICE 2IY9A 4FONA 1Y3DE 2DP4E 2PWBA 3TI7A 1WVMA 2XRMA 2W2PA 1KDVA 1GCIA 3VTAA 4OMDA 2SECE 2Z30A 1TM1E 2Z57A 2WWTA 4KPGA 3DE7X 5CW1A 4C3UA 1GTG1 2Z2XA 2PMWB 2WV7A 2XTJA 1BE8A 3AJ9A 3D9QX 3DE6X 3F7OA 3GT3A 4H6XA 4MZDA 1KDYA 1R6VA 1SCJA 4CG0A 1SVNA 5JMOA 3VHQA 4B5LA 1GNSA 3L1KA 3CNQS 3QMPA 1GNVA 1TO2E 3Q5GA 2WUVA 3VV2A 3DWEX 3ZXYA 1T1IA 3TECE 2X8JB 1JEAA 1SCAA 2Z56A 2PKCA 3DE5X 4C3VA 4HVLA 3VSBA 3QTLA 1P7VA 5FFNA 4KG7A 4NE7A 1WMEA 2SNIE 3EIFA 1DBIA 1SUPA 5JXHA 1ZVKA 2PYZA 1T1GA 4NE9A 3I34X 1S02A 1S01A 4H6VA 1VSBA 1SUBA 1TMGE 2HD4A 5SICE 3WIUA 1AH2A 3F49S 3A3PA 3VV3A 3A3NA 3BGOS 3PRKE 1BE6A 1SIUA 1WMFA 4BWGA 5AVKA 1NDUA 2G4VA 1CNMA 4LVNA 2PQ2A 1S2NA 1DUIA 1P8JA 3Q40A 4RYDA 3CO0S 1KDZA 4CFZA 1P7WA 1ST2A 3DDZX 2TECE 3DE0X 1SBIA 1R0RE 5AQEA 1A2QA 1R64A 2V8BA 3D43A 1Y4DE 5ARBA 4OMCA 1GA4A 1BH6A 3PTLA 3GCXA 2DQKA 4I0WB 4CFYA 1SUCA 2Z2YA 1TK2A 3DW3X 5AMXA 3AJ8A 3UNXA 2X8JA 1MPTA 4H6WA 1AV7A 4WOBA 3WQBA 1Y3FE 1EA7A 1ST3A 2SICE 2Z2ZA 4LVOA 1SN7A 1T1EA 2WUWE 1KE1A 4HX2A 1GTL1 1V6CA 2W2NA 1Y4AE 5JXGA 5ARCA 3DE4X 1BFUA 1SELA 1UBNA 4DWWA 1GT91 3I2YX 1SUEA 1OYOA 1YU6A 2ZWOA 2B6NA 3AFGA 3LPCA 4YN3A 4AKSA 1SUAA 2ZWPA 5JXIA 1SH7A 3QFHA 4AKTA 1Y33E 3DVQX 1IC6A 2P4EA 1SUDA 1SCNE 1C9MA 2E1PA 3GCWA 4WOCA 1TM5E 2QTWB 1KE2A 1Y1KE 3DE1X 5ARDA 3DVSX 3WHIA 1Y48E 1C9NA 1OYVA 1V5IA 1EGQA 4Z2AA 2W2QA 3DVRX 1IAVA 1YJCA 1MEEA 3T41A 1Y9ZA 1BJRE 1WSDA 1AK9A 1YJAA 3DE2X 4DJ5X 5B1EA 4GI3A 1XF1A 1ZVJA 1C9JA 3DW1X 1C3LA 3EE6A 1Y3CE 3HJRA 5FAXA 1THMA 1PEKE 2ID4A 1AVTA 1GTJ1 1Q5PA 2W2OA 1PTKA 1SIOA 2PRKA 3EDYA 2DUJA 3DYBA 1GA1A 1TECE 3BX1A 3F7MA 3LXUX 3P5BA 1CSEE 4NMXB 5FBZA 3SQOA 1TM7E 5I9SA 2IXTA 4DZTA 5AVJA 5B1DA 4J94A 3BPSA 2Z58A 4M1ZA 1SBHA 5JXJA 3I37X 3I30X 1AF4A 1NLUA 4K8RB 3A3OA 4ZARA 4JP8A 1PFGA 1TO1E 1LW6E 1SCDA 1GA6A 3VYVA 1HT3A
chains in the Genus database with same CATH superfamily
1ZZEA 3HB9A 2NMVA 4RA9A 4ARVA 3GRUA 1FRNA 3KP1A 2PY6A 4Q18A 2YN4A 3RI3A 3RGWS 4CHGA 1REQB 2PTHA 4ITRC 3EWAA 2HV9A 4XLZA 1CJTC 1WY7A 2BM8A 3A4YA 4ZU3A 5LMNB 3MCVA 5C4IA 4EHKA 2Y1XA 2C2KA 3CM0A 4IIJB 1GG8A 1G8JA 1AIPA 1ZNYA 3MVEA 4MWOA 1QLWA 1EVQA 1XCPA 1V4NA 1ZW1A 2DH5A 2VHJA 4JQYA 3FNFA 4CRWB 1H2AS 5K8TA 3T1YB 3O4RA 2JLWA 5J2TB 2P90A 3I8OA 3KT8A 1NOIA 1KDVA 3DGFC 2AOXA 3ZCXA 3CR7A 3Q0IA 4JT4A 3T4PA 4CR6A 1X13A 2VRNA 3REFA 4GYJA 1RWQA 3K32A 3PVZA 5AHRA 5JISA 1YDEA 3KSMA 1L8OA 4IYRA 5CX1B 1QTRA 3PTZA 3JW8A 4LTMA 3W8DA 3SF8B 3OQPA 3ANNA 4C0XA 3ASVA 5B36A 2XA1A 4PNPA 5ELMA 3ET5A 4CKZA 1GAJA 3DFUA 3RIGA 4RY9A 4Z1MD 4FBMA 2BKEA 2VRBA 1FNMA 1OVGA 3KFXA 3SZOA 1WDWB 1YQXA 3OFND 4EZEA 1JFFA 2CNBA 2EJTA 4RU1A 2PSHA 2TMDA 1BA3A 1GKLA 1NPDA 3C8DA 3LY7A 3UICA 5A5VA 5H0IA 1H3EA 1RU3A 1JQKA 1BE6A 1KHHA 3K9QO 3ODGA 4ZVVA 1EM8A 5GY7A 4D0LB 5I4BA 2Z3WA 3AWDA 1ZRNA 3H6KA 3KFLA 3AVYA 4KHZA 5EPOA 5L6MB 2Z98A 1O57A 2NYVA 3H9BA 3GNQA 1JAYA 1KFKB 1LQTA 2AX3A 4FOLA 3VZBA 3UHOA 4AT1A 5HPYB 3R7WB 4TUYB 1Y4DE 4CKCA 3REGA 1PDVA 3SYKA 2QV0A 3WRXA 5AM2A 4MO2A 1FXWA 2VJQA 1Q0PA 3WLNA 4BVAA 2H7YA 1DDIA 2JJYA 4JBYA 2QOEA 2H3EA 1L3IA 2H16A 2J9ZB 2WFAA 5K3AA 3FI9A 4OI0A 4ZO8A 3M6IA 3GL9A 1ACLA 4PZDA 4F3CA 4MUGA 2VCEA 4G5XA 3P4YA 4JC0A 1AURA 2ZT7A 3I2IA 3GP5A 1C0IA 2GR9A 2QSZA 3ELUA 4AQYB 2QQFA 2ZB7A 2MWMA 2YWFA 2DLNA 1TF7A 3T95A 1T3LA 3T5AA 4FFDA 1B26A 1K8QA 1OZ0A 2D13A 5AOBA 4RETA 5L3SB 4HGQA 2JKYA 2QTWB 3M9XA 4OU4A 3AVPA 1ESMA 2NU8B 5AUPB 5BXQC 4XDZA 4JCOA 2QMYA 8ADHA 5J4VA 4Z2AA 5K6TA 1NT2A 1PKEA 3X1KA 2H9YA 4S0ZA 1P91A 2C5EA 4N0PA 2BJVA 3BKXA 3AVTA 1QK4A 3GA5A 3WGHA 4DRYA 3C3BA 5CJJA 2F62A 2C20A 1BJTA 4Z99A 2ZG6A 3IEVA 4J2OA 1VHQA 4TZKA 3VH1A 1HE2A 2Y66A 3G0CA 3FDIA 2C4MA 2QSYA 4R9RA 5I7AA 1WULS 3GLQA 2ZYTX 4MXDA 3LQQA 5BT8A 4KQHA 1EDZA 1UMDA 3F6RA 4NG4A 5LB4A 1VPTA 2KYRA 1Z3CA 4ITUA 5F52A 5CVEA 3O0DA 3IVCA 4NYMQ 3UW1A 3OUTA 5L53A 3ZDBA 4YMGA 2H08A 2VWQA 1GAWA 2F8MA 3P2OA 5FOUA 4DLTA 3LQ4A 4XYEA 3RT9A 2B4AA 3T0IA 4FFBB 1YI1A 5DNAA 4D9MA 1LKZA 5D3QA 3N2EA 2XE6A 3A6FA 1VE5A 3MLEA 2I8LA 1MDBA 2I7VA 3GFGA 3L4BA 3R24A 5EP3A 4E0BA 4AMZA 1RYHA 3LOUA 1VMIA 3OQBA 3ES9A 3WZMA 1YR6A 1XMJA 3I01A 2VHWA 4E70A 4EATA 3E2IA 3NKLA 4WA8A 3R76A 1EVZA 1DTWA 1N9GB 2L18A 1M2HA 4G9EA 2LZ0A 4IILA 3VHLB 3VBEA 1AQNA 1SUWA 1JZTA 5DIZA 1EZZA 1YZFA 2BR4A 4MUFA 4A4DA 2NVUA 2XCOA 4TLEA 4QM7A 1M0SA 1O6ZA 2IYWA 1GZ3A 2ZKLA 3FF1A 2VBIA 4H31A 1I3KA 4BKPA 4G1CA 1P29A 2PO5A 1QR2A 2ZJ7A 2X7HA 4N65A 2RHRA 4DVJA 1O5OA 1R6XA 1MB2A 1VJ1A 1S6YA 3ITNA 4OFBA 4DIEA 1EIWA 5AJUA 1H1LA 3GEHA 3EC2A 3MRVA 2NPFA 3DOEA 2WUVA 1JAZA 2QYHA 2V0CA 4OYRA 4HFNA 4GS5A 3QU4A 3T5TA 2PKCA 4JLWA 5LQDA 1XVUA 1OD6A 1T43A 3I6IA 2D1SA 4P5PA 4DCCA 3EGXA 1GYQA 1N36B 1G2IA 3AHIA 1EFUA 3FWPA 4HDNA 1YQUA 3RWBA 2Q1TA 1PV2A 1V7CA 4WY5A 3DUFB 1G2QA 3H9JA 1C7FA 2IYUA 3C7DB 1TAUA 5HK8A 3HJCA 1SFRA 1NFRA 4BFWA 2CVPA 2NN3C 2W42A 1OAAA 1UOQA 3DZGA 1RHJA 3TOXA 1K2WA 1QE3A 4PR3A 3QBVA 4YUZA 2M1XA 4RW0A 3HYRA 1P5JA 2CXQA 5ALPA 2EBWA 3ZWXA 1UMDB 4LCJA 3CF2A 4FLEA 5LDDC 2DZDA 3DMHA 1B3RA 1YVPA 2O8VA 4LECA 2V7VA 2XCQA 4MNTA 4PTZA 5DBIA 1UC9A 2RONA 5F64A 1JW9B 1YIDA 5EC8A 3OKPA 3VX3A 5LYYA 3W4IA 5CFRA 1C30A 1MRNA 2AEMA 1X1BA 1HOXA 4G85A 4HDQB 3VM6A 1QHYA 4EFDA 1NMZA 3KXPA 1YR7A 1PEDA 4L4ZA 4Q82A 2ZI4A 4A8JC 2QLFA 3MTJA 1SUDA 3GR6A 3O2SB 3IKLA 4R84A 4JI5B 2C57A 2I8CA 4K86A 2R8RA 2FP3A 2CFOA 3E9QA 5HMLA 3RVMA 1VCMA 2OV4A 2ZB8A 2LD4A 5DLYA 4E5DA 2CLCX 3L01A 1WHSB 1YDWA 1DIBA 1Y3AA 3C1AA 1KBQA 1FVHA 3AU9A 5SY9A 4TS4A 3CVUA 1VL0A 3E9EA 4IX9A 3L49A 4IQ4A 3EDYA 2G0TA 2ZAGA 1YASA 4J6EA 4LQCA 3H5RA 1D8TA 3BX1A 2HHCA 3KDSE 4QDTA 4QPCA 2W48A 1JFSA 1U8XX 2ECKA 3KLOA 1NLYA 1PLKA 1KP2A 4OM8A 3O38A 3UMYA 3JQAD 1KORA 4G5YA 3HKCB 3N5KA 1DQNA 2YHUA 3W5AA 1QF6A 1JR6A 1T9GR 5K0EA 2V0GA 2IJGX 5H3HA 4V0QA 4BEJA 4BJ6A 1U0TA 1G1MA 4RPIA 2JLUA 4R6XA 1P8AA 3S2SA 1WMDA 5FBVB 1G5IA 2V9CA 3O8CA 3NETA 1K6MA 3NTOA 1KXZA 3VOTA 1V8ZA 2RI6A 4WERA 5KYNA 4ZZ2A 1DAPA 1KFJB 1V4BA 4OXXA 1NXTA 2FPIA 3ZNPA 1W6RA 4Z5XA 1R8XA 4GXTA 4RK1A 2FW7A 1NVXQ 3WICA 2GZAA 1C7QA 1CUDA 4TXHA 2QQEA 3AESA 2XXJA 3W7BA 5KU7A 1M0WA 1GV0A 3OQVA 5DE3A 1UR5A 2R6GA 1N3LA 1SKQA 4M37A 3PQ3A 4RTNA 4R7TA 4WKGA 2B69A 4PWZA 1GRQA 1Y7TA 2HA5A 5A5GA 2B61A 1QVWA 1VL2A 4HVCA 4C21A 2PH5A 2LWIA 3FZYA 3D3KA 4F06A 5IXYA 2WV7A 1CIVA 1F6WA 5MN4A 3KFVA 4F93B 2JJ1D 4HLUA 3QV2A 3A26A 3QSGA 1T2EA 2IYNA 4OGKA 4AO7A 1AK1A 4MVJF 3AJDA 3TECE 3TOVA 4Z1OA 3EY4A 1UBMS 4HGZA 5KJ6A 3CNHA 1T0BA 3IVRA 4XQCA 4OLBA 5FNVF 4N5IX 3DZFA 4XSHA 3TCNA 1CR0A 2R9VA 1TEXA 2QT0A 4UNNA 3W0LB 1Y1QA 3VR5A 2Q9UA 3BK7A 3A1TA 3L8DA 3L05A 2WILA 3OMXA 4ALKA 5J2TA 3PRKE 2X40A 4KV9A 3RSSA 1G63A 1J56A 1M34B 4AKEA 3HO1A 1Q6ZA 4R5HA 2HLPA 4MVJM 1T8YA 3QV1A 4CKEB 1SZDA 4D5EA 5I7RA 1KO4A 2JANA 3M3DA 2IPLA 1VE9A 1IEWA 1DBWA 3O95A 3QPUA 2IGBA 4V39A 1NSTA 1MDFA 1QM5A 3R6GA 4J0EA 4PLHA 2CYAA 2VF7A 1JEDA 2HDNB 2WAAA 3K70C 4QBGB 4XIFA 4Q16A 1PGQA 4YC7A 2GZRA 4XGNA 3MWGA 3PHIA 3RS9A 3E5RA 2N3ZA 5F33A 3S2IA 4ND6A 5ECYA 1R15A 2NO6A 4LN1A 5CBPB 1USKA 4J0CA 3ND6A 5DH9A 1KVSA 4YHBA 3AGQA 3A3YA 4DEXA 1E9FA 1MO3A 1UOEA 2WSSD 3WK5A 4LKOA 2A59A 4OAQA 4I9GA 3CR3C 3KOOA 4BMVA 2AW3A 2ZE6A 1G9XA 2TYSB 2KLHA 2NT3A 1C9NA 3HUUA 3BJEA 3THXA 1EGQA 1P2GA 4MPDA 3TIVA 3TLKA 5B4UA 3PPXA 3CKLA 3U4HA 1IB0A 3D0KA 3WI7A 4I2VA 4DAEA 3I2GA 3OURA 3HY4A 2C82A 5C8ZA 1GTJ1 1Q5PA 1QH1B 1QGUA 1E0AA 2VWPA 4G1FA 4MQFA 5DLEA 1E79A 1NN5A 2CK3D 1CQXA 1E9AA 1YKGA 1VYUA 4BMPB 4RC9A 3FFTA 2CBXA 4J94A 1PEYA 2OCPA 3TSAA 1NVUQ 4FS3A 5AKKA 1AUOA 4BV3A 2DJIA 4BKOA 3SHVA 1HZZA 4JI3B 4M1KA 1G0OA 3R0QA 1QIKA 3B6IA 4RIHA 3O4VA 5ALMA 3GELA 1XQ6A 1JEYB 3W2HA 1ZK3A 2GCGA 3VSCA 3WB1A 5JBNA 2CVHA 1P4RA 5FO0A 4OJQA 4TWJA 3LRXA 3ONFA 5K0NA 4EUEA 4W1RA 5CFOA 2IT1A 4F5ZA 1PRYA 1OLXA 1L4YA 1TU3A 3RF7A 3RUFA 2P9JA 4A8HA 3IP8A 1YB5A 3H1PA 4IXTA 2RGAA 3O8NA 3FPLA 1WHTB 2WJ4A 4MS4A 1W1WA 2E3JA 2EJBA 1SPBS 2QVBA 2VUSA 1WCV1 4TSKA 1TUBB 1NBHA 3GJQA 3IR7A 4QYSA 4TWIA 5K8UA 1M1UA 4GL2A 3V4FA 3IAM6 5LBUA 4N0MA 1EX9A 1TF2A 1IN7A 3ZLTA 2C0QA 4N39A 4D6XA 1AA9A 3OQIA 3W9YA 1XVAA 1KIFA 1UANA 4GPZA 1XZ8A 3FAZA 1OA0A 2O3QA 2QMZA 3LC7O 1ZRMA 5DW0A 4D4JA 4Y0NA 4DQKA 2GJ9A 4CQLA 2UYCA 2PMBA 4Y6OA 2XA2A 3VYWA 1N6NA 5K8VA 4I8DA 3N7UA 1VMDA 1MAUA 2ADFA 4L3WA 2PUFA 3Q7IA 1FFGA 3AFIA 5TMDA 3RK4A 521PA 5IYZA 5K05A 1Y7LA 5DNEA 3MT8A 2H2WA 4RL4A 5GGXA 4UCXA 1GL7A 2AN1A 1OC4A 4WT7A 3KQOA 3KJXA 4HAYA 4AZVA 1A9PA 1TMGE 3L92A 2ZXUA 2P5YA 2QB5A 2RSLA 4TQUS 1FQKA 2IELA 4KPFC 2PKQP 2VA8A 2IPOA 4MULA 2YQ5A 2JGAA 5KSOA 3LXXA 2IL1A 3PP8A 4KGXA 1GEGA 4O2BB 2EEZA 4TXLA 1YO6A 3F4LA 1YC5A 1TTQB 4WZZA 3DO8A 1OFVA 5JW6A 1UDWA 3STXA 1S8FA 4LI3X 2ZPUA 3GNTA 1N9KA 4KKVA 4WOPA 2PS0A 4Y2TA 3NCTA 2P67A 3KPUA 2PH3A 5AH0A 3FMGA 4QXPA 1VMAA 2I6UA 2KI5A 3NZEA 3PUYA 5CYPA 3ZTTA 1IBRA 4AROA 1X80A 4ZWNA 1NRJB 4QJBA 4GOND 1O8CA 2R6JA 4HMPA 2X1MA 5MGBA 1W0KD 3AOEA 3NU1A 5B1YA 2P3SA 1ESCA 5HG0A 2PK3A 3G8DA 1PJ2A 3IO5A 3SZGA 1BA2A 1Q11A 1T0JB 4YROA 3GVXA 2TRSB 2V1UA 4NFYA 2H5IA 2R1VB 1NWHA 2I55A 3E27A 2HADA 5E7JA 4AY5A 4G0VA 3I12A 1TLFA 3BXPA 2XD9A 2FUNB 3I5YA 4G5SA 3LA8A 2NW6A 3QPDA 3VMFA 4B6PA 3GG9A 4C6TA 2XBMA 1WW2A 4UOQA 1JIIA 1HEUA 4FQ8A 2R47A 1DKPA 3RK1A 1WUJS 3RLIA 3DP9A 2COUA 2Q1XA 3NC0C 1PZHA 1HH4A 2K2QB 3E0QA 3FFAA 3GGSA 3D54D 3KOXA 1AE1A 4RDXA 4KR6A 4FW8A 4FZRA 4TV8A 5AXAA 2HN9A 3PIDA 1UAGA 5F7JA 3SIPA 1T8TA 4HUJA 1Q16A 1AKMA 1ORHA 2LE0A 3D7LA 4G5GA 1K7YA 3THOA 4OYYA 5IDWA 1DXOA 2ONZA 5B6JA 1IZZA 3B20A 3LPDA 1OFHA 4IUCS 2UZ0A 2AG1A 4MI1A 3L0SA 4OEHA 3W9SA 4QOHA 2X86A 5CFPA 2XCLA 4G2TA 2R7MA 4I5DA 1L7EA 4DWOA 3JD3A 1D0VA 1NR5A 3HKEA 4MYCA 4QU8A 5T6BA 1JXQA 1JHPA 3U62A 2ECPA 4MMXB 2C7PA 2VP9A 1SBCA 4HB0A 4JNKA 4ZICA 5JZOA 4C07A 4UPDA 3H5LA 5EMJA 2Q8PA 1FFAA 2VG8A 4XPIA 5FTLA 1DKOA 3ZDDA 3HN7A 2YRXA 4O2AA 1B0UA 1TA0A 1XFAA 5I4KA 1BN6A 3PU6A 3SBEA 2EJWA 3KKEA 3W5HA 4F4CA 1LFAA 5FYDA 3K0AA 3D59A 1U2DC 5HF5A 5KX5B 1SD5A 2ZIEA 4HP8A 5F1KA 4LV6A 1CC1S 4JB0A 1M83A 4MKFA 4P84A 2R4TA 3A0UA 1G16A 3B3QA 5HZGA 1ACMA 2EOAA 1O6GA 3QFFA 1I6MA 1UK7A 2I91A 1LPAB 4PLWA 3T4UA 4EELA 3LECA 2ZUCA 4D46A 1JEEA 4L0MA 1M54A 3ABRB 5ALNA 1Y8CA 4JN6B 1HQKA 3QBJA 1Q0SA 4LC0A 4Y6LA 3O4IA 3IQWA 1ODKA 2VYNA 1QZ3A 4GQAA 4XJTA 4GYWA 1YCHA 1M2OA 2A9OA 3MCWA 4QVGA 3TD6A 1Z8DA 5HILA 3CLKA 4JLJA 3D6MA 5JAOA 5ELXA 3D8HA 1RBQA 2IX9A 2J31A 4FT2A 4L50A 5KWVA 5FUWA 3TSOA 4Z4IA 2P2NA 3OT1A 4RPGA 4B3HA 1SXPA 1ACJA 4RS3A 4WOBA 4QRHA 4A6XA 1UQTA 1ST3A 5BYAA 3ETHA 2CV2A 1EINA 3B9RA 5AJVB 3O3OB 5F1YA 4ZEOA 3W6ZA 1YRLA 4I55B 4D98A 4EJ0A 5FBWB 1MT3A 2E4YA 3L7JA 1D6JA 1J6UA 3D5QA 2DE0X 3MAAC 3UY4A 4CKWA 1PQWA 1SKYB 1SXJD 4ZAZA 5DHPA 4DIKA 3NHMA 1E6EA 1WIWA 3HWWA 5I01A 2X58A 1SHUX 2QJFA 5K01A 2PFSA 4EYEA 1G0NA 4BWVA 1GQQA 1CK4A 3EOAI 2FZEA 3NG1A 4ZAYA 2Y1CA 3VKFA 4BIIA 3PJRA 4D0GA 5MDHA 3DBIA 2W2QA 4KO4S 4B46A 2HMVA 2Q2NA 3BH6A 1MTOA 4EGAA 3LA6A 1W85A 3PITA 3CRW1 1N7IA 1XF1A 4BB0A 4JGGA 5K4AA 3T5BA 1W49A 1B0AA 2FZ4A 2RAUA 2DETA 5CM2Z 1R3DA 3T06B 1F8YA 3WWPA 2HK8A 4ZAGA 1DB3A 1NJGA 1XQWA 2Y0CA 1IVYA 3P5BA 5JSZB 1UXJA 1WKVA 1AA6A 5A1TA 1ZOSA 2AD1A 3F5QA 4FUQA 4HH0A 3WGNA 5DW3A 5C1PA 1DSSG 2BSQA 4NZOA 2PZKA 3EZFA 3ORHA 3PX7A 1VYVA 1W47A 3SLKA 2ACVA 3BAZA 3KYIB 4MPRA 5A5FA 2FRVA 4YQFA 5I9BA 1I7QB 3PKIA 4MDEA 2GRUA 4O0MA 1DWQA 3SQDA 3NHWA 4HATA 3VAYA 2JGMA 4X60A 5FEUA 3R3ZA 5F1PA 4ZC1A 3C8ZA 4I8XA 5E6UB 3D7MA 4IH1A 1A8PA 4MQ4A 2HIAA 3I4FA 3JS5A 4GOMD 4XLLA 4OH1A 3K2BA 3W5IA 3ZPXA 2PZLA 2YV2A 1YZVA 2WG2A 4U02A 3IEPA 4EI7A 3LCJA 5FPTA 3QTBA 5J5VA 4V2UA 5DYNA 4EPXA 4P6VF 4HDAA 2RHTA 2W6ZA 4QPDA 4DLBA 4QT4A 1LW7A 4I9HA 4UKDA 3SNKA 2CLMB 4YJFA 3ZCUA 1GCIA 2IEAA 1CP2A 1NKVA 1MT0A 2HRZA 3UVEA 1XRSB 1ZRHA 2GPJA 4MYSA 4QD3A 4KH0A 3TE6A 4FKZA 1LV7A 4JOCA 3HJNA 4TLLB 1T5SA 3DDWA 3JV7A 4CKCB 4YGYA 1LPSA 1C4XA 1RDFA 3ZC3A 1KAGA 3A3KA 3PDIA 3KTAA 2I65A 3DOJA 3SGLA 2QEQA 3CX8A 3PYMA 4ZZ0A 1UBOS 2BFCB 1E3SA 3QW2A 1NSYA 1GPNA 1U7HA 2AL7A 1XMIA 2R2AA 1HYGA 4HRVA 6ABPA 2ISSD 4QECA 5K4GA 3EB9A 2HJSA 1JFTA 4AUNA 3DVLA 5K1ZA 2KSQA 3ROPA 3A3NA 4JVMA 4ZU1X 4I66A 3ET4A 4OB8A 4UW9A 1E1CA 1MORA 5CLGA 4LVNA 3T7IA 3RIYA 2BM9A 1MQSA 2Q1YA 3K8YA 4FFSA 3CTPA 1THTA 1U04A 4OMFG 2JEZA 2X5NA 4TMZA 5DJ5A 5KDLA 4LYEA 2ZU6A 3AJRA 3K1JA 2QM0A 2A2ZA 1K4YA 4DJEC 1VQ1A 2FZKA 1SQFA 4IRXA 4HQLA 3NUQA 2H1RA 5M7EA 4B3MB 3PNBA 4YT8A 3H65A 1F20A 2AXQA 3CUTA 3A4TA 5JTTA 4XFJA 4NEQA 2UZAA 3N28A 1GNTA 3A04A 2WTNA 1IHUA 2BCEA 2WWHA 4B09A 5HGXA 3R5XA 2ATIA 5F5NA 1K97A 2RMKA 2YHAA 3GEMA 3FPCA 1NJ2A 2G5CA 1WG8A 2OHGA 2V54A 1CQWA 5D6OA 3SIRA 4BFCA 4UUNA 1YUMA 2G1UA 4X64B 3ZY5A 3I3SR 1AG9A 1E6WA 4ALIA 4OKIA 3VXKA 2QTGA 3WLFA 4GO1A 4DLWA 4YAJA 4GX0A 1V5IA 3C15C 3EC7A 1XMOB 3T7DA 4EWLA 1S1CA 4KNYA 1MQAA 4RVUA 2PKEA 3VU0A 4F12A 2WKQA 2KLBA 1WNTA 3DS8A 1CY2A 3SNHA 3OWXA 4CM6A 3ZDAA 2ZSKA 3MJEA 1QYIA 3MTGA 3OF5A 1QQ7A 4FXPA 1FXSA 2Q5EA 2P65A 1W46A 1IQUA 1BMFD 1KPGA 1XZQA 3GFOA 4I5IA 2QYSA 2ZUWA 2OK8A 4X20A 5HE8A 2VDVE 2ZB2A 4NXMB 1C30B 3TLYA 2XRYA 2Z58A 1N1GA 5BV0A 4E13A 2UUAB 1H2FA 1YDMA 1YAJA 1KF0A 4LXGA 1DBQA 1V2HE 1WCIB 3IBTA 4UVGA 4YJGA 3PNKA 3EY9A 1E2UA 4OAOA 2ZT6A 3BMCA 4MGZR 2O8DB 3ESCA 4M0MA 3K31A 3RAGA 1K6EA 4HG2A 1M2EA 3PYXA 4OI1A 3KJZA 2QD1A 2J08A 3MMXA 4MV8A 5CM8B 5BY2A 2BFOA 2W0MA 3E22B 3VR4A 3QEOA 2QK4A 3LSYA 4LDNA 2G80A 3T7EA 4C4AA 3THWA 3AMVA 2H1LA 4CTJA 1YJQA 2W83A 2J5QA 2QUAA 1GJRA 3GMTA 3H4MA 3P0EA 1CY4A 5F78A 3OIDA 3U1BA 4X90A 4HZIA 4KR9A 1PJ8A 3C6YA 3I6BA 3INGA 3W9UA 1WL8A 1AZTA 5JHHB 4J1TC 4X00A 3CV3A 2ZSFA 3GXOA 2IHJA 4EYGA 1KEVA 2H1WA 2JAHA 3BL6A 3ZZ1A 3SJ7A 3MILA 4UNQA 4UUBA 2FKNA 5KWJA 1GQFA 4HFJA 1RAAA 2XHZA 1CJBA 2FSSA 4Q93A 3WB0A 2O5CA 5TXGA 1THZA 5BVGA 2F3QA 3U4GA 1AGXA 4JBGA 1DPGA 1APBA 3EARA 3F74A 1GTRA 2I6XA 1RAIA 5K8LA 2FE4A 2GN2A 2VP0A 1FP1D 2A5DA 3AH8A 2GCPA 4HZUA 1M8KA 3DOHA 4ZEWA 4CQMB 1S0UA 3F90A 3ZJ5A 3IL2A 2AR9A 4TMXA 1XR3A 2JAXA 5DVZA 2JFNA 2OGWA 1EFPA 1F2VA 4M8IA 4US1R 1QQTA 2Q0XA 4BIMA 4DL9A 2QR2A 2FCAA 2QSJA 2QUBA 4H0CA 3KU4A 3GAFA 4D3XA 1EDDA 4LJAA 2H17A 4INJA 3Q8KA 2HHHB 3GOQA 5JCPA 2R7NA 1R1DA 4CL0A 1O8BA 4MPTA 3CZ9A 3FNQA 5BYBA 4TLMB 4ZI2A 3H86A 4N48A 3IYLW 2FGJA 1NN0A 2PUCA 4E5KA 4JXZA 5KSPA 1PI3A 2OXEA 1UH5A 4C4XA 3BE5A 4NL4H 1WDLA 1TEZA 2GI4A 3D7KA 1QCCA 3B13B 1Z6ZA 4AP9A 3RBXA 3LTEA 4ZVMA 1VBNA 3IJEB 5BXYA 1YQDA 1XZEA 5JSZA 1CZLA 2EJVA 3F3SA 4H7EA 2EJUA 1JPUA 4MWTA 4E5SA 1T8UA 5CYFA 4KO1S 5DGDA 2E21A 4LK3A 1P5ZB 2PKQO 3HXMA 5I5GA 5JMPA 3AM5A 3ZIDA 1ZY2A 2CNOA 1SCNE 2AOTB 5DEOA 4NULA 3VHXA 3W6UA 3LL7A 1DAOA 2A4KA 4MP6A 2EL7A 1U02A 2JFZA 1I7PA 4QU9A 4PQRA 2FQYA 2QN1A 5E3IA 4B6GA 1ZP6A 1DUSA 4MS3A 4A10A 4LDZA 4TRNA 1OZGA 1N3IA 3DE2X 3DV9A 2FK8A 3MMPA 3IERA 5H70A 3AB8A 2OLJA 2QW8A 4M76B 3ASUA 4NE2A 1VP3A 4PG4A 4FSXA 4ZOBA 5EEGA 4IMPA 4RZSA 1EZ1A 2BMWA 5K0ZA 3L0ZA 3G02A 5AK0A 5BW4A 2OCYC 5DN6A 4EKIA 1V9CA 2VQ3A 3E7FA 2R5WA 4MVJG 3NM6B 2WTAA 4KQ2A 3S2FA 4C05A 4QJ4A 1OH8A 2C98A 2K2WA 2W71A 1OTYA 2IYSA 4Q9IA 5E9QA 4NAHA 3JCZA 4YGXB 3WKBA 3L40A 4AJJA 3I9NA 4E4YA 2QTVA 1Z6AA 3ADBA 3QU2A 1HDEA 1WUHS 1YZTA 2JAOA 1GN9A 4Z53A 4ARZA 2XKAA 4TMFA 5BURA 1H3NA 2I6GA 5FLEX 3BGDA 1DEHA 3UJPA 3KVNA 1UPTA 2WP8J 4TN5A 3SBXA 1XZHA 1XDBA 3CN9A 5C34B 1HDYA 4EDFA 5BQFA 2YWBA 1XD2B 3K6RA 4IQGA 3MTDA 3U44B 4UD2A 2JVJA 2R62A 1YT5A 3E1KA 3H5OA 2QTTA 3OP1A 5AK4A 5ALSA 1A5ZA 2PLWA 2X8LA 1TO6A 2Y05A 1TTHA 4TN1A 1WR8A 1LF0A 2BFDA 1U9IC 1Z33A 4J9VA 1F51E 4NEHB 2DHDA 1IVNA 2FZ5A 1BQ4A 2I7XA 5TT1A 3REQB 2OCGA 4MVJI 4XYGA 1XQXA 3ZOKA 2C4TA 3ZGZA 4YRLA 1KTVA 3GZNA 3RUDA 3CMCO 5E9AA 3T9DA 4DM3A 1CUHA 2YWXA 4LQ4A 2A0XA 2NUAB 2GVDC 3FDZA 4H6XA 3BZWA 3CRQA 2CKDA 4ZOCA 4D8YA 3H8JA 1IZYA 3WGQA 1ZVMA 2ZRAA 3BYZA 2HCRA 3N9IA 3T3DA 4N03A 5L3QA 3EG9B 5JV5A 2YIJA 3G59A 1NVDA 1XNGA 2WK1A 1QORA 2XMQA 3EVNA 3BC1A 3F46A 3KSUA 4YPFA 5TY0A 2XF8A 1SUBA 4LWOA 3IRVA 3N2GB 2I7TA 4IINA 1T0UA 2CZQA 4J7UA 2I54A 1UXGA 4N49A 1DFIA 3ZQJA 1JXMA 3AHFA 4I1IA 5KYYA 2XY4A 1MZPA 2BGJA 1A7KA 2QUHA 3IUYA 4QELA 1MLDA 2BZGA 3ILHA 3OKFA 2Y77A 4IDNA 4OHCA 1U4NA 4W7IA 3RK0A 3SEZA 4EECA 1SQGA 1CUXA 1LTHR 1YK1A 1GLNA 2KW5A 2PT7A 2XOEA 3WLQA 4F9EA 2IKSA 4EIWA 1VTKA 5HR5A 4I36A 4MCHA 4E08A 5BW5A 3I6ZA 5C53B 2X2OA 2GHQA 4RM2A 2F4VB 3OIFA 4X1KA 1FMTA 1UDAA 3SY8A 1XZNA 2QPLA 4KFUA 1GSAA 1OU0A 2W6OA 1JLLB 3SDBA 2QJRA 2I76A 1ZMTA 3U37A 3WGTA 2O4UX 2I2AA 4J0HA 1AGRA 3TIFA 3MD0A 5IULC 1NTOA 3AOGA 4KMOA 5BSGA 1OIXA 2QZPA 1FQOA 1SH7A 5G40A 3ZDFA 1NU6A 5CNMA 1RAEA 3R6TA 1RXIA 4YCDA 5AIAA 3UJCA 5JUWA 5LDHA 4X6XA 1FTGA 5K3FA 1DT3A 4XYLA 4EO7A 2MMCA 4RAQA 4JWKA 4UQPA 3SOZA 4MIEA 3WAKA 1UM8A 5JFOA 3IAS1 4EX6A 1SRRA 4IVRA 2I62A 4JDUA 2LDBA 3ZDRA 4LXHA 1RACA 1FMFA 1M6VB 1SR8A 5FAXA 4FDMA 4AJNA 4C5BA 1PEKE 1TQDA 3BBPA 2Q4EA 3W3AA 4IG4A 5FL7D 4JSYA 4O4HB 1Y9EA 2ZI9A 5CVCA 4TRRA 1W4BA 2JBWA 3EK2A 3IP3A 4RJ2A 4M0PA 2HFKA 2IYZA 1CETA 1MH9A 2Y67A 3QJ5A 3K2IA 3OPMA 3L79A 2TMGA 1HKUA 3MHPA 2NWQA 3QUAA 3OOHA 4NQRA 2O5VA 4OP2A 4WXRA 1BCRB 1KYQA 3ECAA 1S5PA 2J4FA 3MWJA 3O2JA 1F06A 1DLIA 3UAWA 3W2TA 2BSXA 2HCJB 2QTCA 3PCTA 2ZCUA 4FZVA 1KQGA 4XA8A 4GUAA 1KRWA 2GD2A 3ZXXA 3QK7A 4NC9A 3DZ8A 3G6WA 4RYLA 4WWHA 2HSWA 4FMPA 1PO7A 5DGTA 4P5EA 4L2IA 3WTCA 3JQ7B 2BGRA 2IYTA 1VZ3A 2OCAA 3CLSC 3L0DA 3PZRA 3TJRA 3S2ZA 2V7XA 1LDYA 3CHYA 5EGSA 1GGHA 1GTZA 2V4UA 4FHDA 3U7QB 4XZ3A 5E2BA 3TXYA 3U48A 3JQ9A 4EFKA 3V33A 5TS3A 1BDIA 1DV2A 4I4TB 1KI6A 1T0HB 5KQRA 3FB1A 3GLHE 2HCFA 1UBCA 2J0EA 3R7AA 4D8TA 4EUFA 4OPMA 3EXIA 5BV7A 1VKJA 5TGDA 2H4WA 1JEYA 3I8XA 2H2FA 1SCJA 1V3QE 3RU3A 2C9MA 1T9DA 3NBFA 1X38A 1NYQA 2KS6A 4HXYA 1R6DA 3ZHYA 2CMGA 4C7BA 4A15A 2G07A 4WEOA 4IQ8A 4G5RA 1KK0A 4AI6A 2ZPAA 3QTLA 1JG6A 1JDJA 4U5QA 5AUOB 5KAPA 1P6UA 3BDVA 3WMFA 1E1KA 3AEYA 2EFYA 1PNRA 2VJYA 3UFXB 2ZJ3A 4GXRA 1A7AA 3QWHA 1EK1A 4N6OA 4WK4B 5DI9A 3I9OA 1V71A 3GJ5A 3CLRC 2X41A 2PBZA 4MRSA 3PDUA 3DBRB 4KXQA 4QYWA 1KETA 5C46F 2O1SA 1Y9DA 1NIJA 3DHVA 1ZVQA 3GARA 4XEHA 1LDEA 3P5SA 3Q40A 2YWRA 4I3HA 4PHFA 4XUCA 1XI2A 5KMGB 1YIOA 3DLCA 3IPYA 4HL6A 4JLUA 4WJZA 2GAIA 3W1WA 4DIBA 1W6UA 1W76A 2F9FA 2YOFA 4K6HA 2XDYA 2NVOA 1GADO 4DPMA 4YQYA 1Z0ZA 3E3OA 2FMUA 4G0YA 3USES 1GSOA 3V55A 4NCAA 2X0KA 4JSTA 3UTCA 1JECA 2AQHA 1X1RA 3CUKA 4WLEA 2FWRA 5TQ2A 2YV1A 4WI1A 3OFSA 4QBHA 2WHXA 3TR0A 2ZRMA 4M0KA 3ZWQA 2IHNA 4GVPA 2EKLA 3TUIC 2BZSA 4UE3S 1IBMB 3EUAA 3S2UA 3BB3A 4V0MA 4D4HA 5A4MS 2V45A 4AUKA 1WXEA 3N8GA 2FUCA 3MOSA 4A03A 4BAUA 1KMCA 4TYMA 1C1DA 3ZE7A 1TRHA 2ZB4A 4M1OA 1L4KA 1DRVA 1XLTA 1ADJA 1YBMA 3F5SA 3PL1A 2SCUA 3HN2A 1OWPA 5FULA 1NWCA 5IANA 1XB2A 3K1ZA 5AKLA 3RC7A 3G8CA 3KV1A 1AQUA 2YFHA 4UBNA 2CMHA 4OMUA 2VT6A 3UMRA 1KERA 2PZMA 1W0JA 3A28A 3A4NA 4KH1A 5KIAA 1WLSA 1UXIA 2R8PA 3QVSA 4OUDA 1JAHA 4JI0B 4P1ZA 1R8JA 1LS1A 4JI2B 5FOTA 2XB2A 1NXXA 4C7VA 3JQ8B 3BQ9A 4F3YA 2HU2A 1SU4A 1RCFA 3EVDA 3SVZA 2I9PA 1WB5A 4L5JA 1IJFA 2JFVA 1B41A 3BMQA 2N9UA 4Z3DA 3HVUA 4DA6A 3CW9A 3GVHA 3GLFE 3GHYA 2C5AA 2ZIVB 2WHPB 5KYVA 4CM4B 2ORED 4ENVA 2AOVA 5L3QB 2IK8A 3EG5A 1JQJC 3Q2KA 1CS4C 1OI3A 4DGSA 5BUCA 3OCYA 3PUJA 4LNAA 2ESRA 4NH4A 1N6RA 5KJEA 2HAEA 2P5SA 3W4KA 3TOCA 3DBVO 3RHSA 3CZ5A 3E4DA 4CL2A 5L95A 5LL6P 2ANCA 2B5WA 1ZHFA 4JITA 3DD1A 3CT6A 5KYKA 2HLDA 5DRTA 3G8YA 1I9GA 1DJPA 2JBAA 2WFLA 2Z57A 3WJ2A 3I4CA 1C7EA 3LCVB 4KRXA 4WNCA 3EHDA 4C87A 3CG4A 4D56A 1CUAA 2EU8A 3QY0A 4ROSA 5LQMA 1G38A 5BSTA 4D2IA 1NKSA 2C1XA 1Z63A 1DRKA 2HA7A 4Y2RA 1G17A 2J85A 4UMDA 4M83A 4MR7A 4YCBA 5EJ4A 3KNZA 2H18A 3EEBA 3ICPA 2BH2A 2PZJA 5T7BA 3EIWA 4GL4A 3PLRA 1PZEA 3B7PA 3P27A 5GPBA 4REQB 2XSZA 3WQSB 4QJ3A 3BFPA 1GU0A 3HVIA 3OP4A 3IHWA 4M60A 2HTEA 1P3DA 4LOIA 1PD0A 3CLUC 3TQHA 2QJTA 3TZQA 2P8JA 5ERXA 1CZKA 4FFVA 3N0VA 2REQA 2R7KA 1HI9A 3AFNA 3KTOA 5A6VA 2JC3A 1BC5A 2X6QA 3GT7A 1ZH6A 5BNTA 1ECFA 5CRIA 3DH0A 1Y6QA 3I39X 1EK5A 3BERA 3RVRA 1VG0B 5ESXA 1T5HX 1NZDA 2WG1A 1GZDA 3DO5A 3OOEA 3UCEA 3QJGA 4NYIQ 2JI7A 4IO1A 5GV8A 5JNWA 2QG6A 1CUVA 1I2DA 3DOUA 4UULA 4WXYB 1E66A 1ZIPA 5EZSA 2L17A 2QENA 1K9SA 1Z4LA 1ATIA 1RYZA 2JCYA 5JXGA 2ZR8A 4DT1B 1HOTA 2Z8XA 1G66A 2IZ7A 2R8XA 3BHMA 2B2NA 2ZAMA 3FI0A 3T94A 4HQ6A 4HAWA 1Z47A 1M75A 4JC5A 4DE5A 3PD7A 4YRZA 1M6YA 2WKRA 2J3JA 5THXA 5BUSA 5BSHA 3SSAA 4AG5A 3UMSA 2RI0A 1C7ZA 1P4JA 4AAYA 2J0SA 4HDCA 2O8EB 2BN4A 1XTJA 4RABA 1E6KA 3TUZC 1F48A 3OTHA 3CNOA 4ETWA 2HJRA 2JI6A 4KDEA 2X0RA 1Q7BA 3Q8XB 4ETIA 5B1EA 4Y2HA 3BD7A 2ZDHA 1Q0TA 4F91B 3GJRA 5BWOA 5ITVA 1K0UA 3U80A 5DBOA 1JDUA 3AEUB 2DUMA 4QBKA 4U2BA 4Q12A 3VTFA 5ITSA 1S8AA 5CIQA 1MFZA 1YZNA 1LBTA 3SK0A 1N5MA 3GRAA 4ARBA 2Q29A 2G8NA 4ZRMA 2VTEA 3HI4A 1Q92A 4QNMA 4KKXB 4QPJC 3MIIA 1ND6A 3OZTA 2P6UA 4KDRA 2VDNB 1JTVA 3IV9A 1VKRA 2HF7A 2OC9A 4BNJA 3WWYA 3GLSA 4C01A 4E15A 4LF7B 1GA6A 3AF6A 1E7QA 4LK2A 3WHKA 2NP7A 2WYWA 2QDKA 2XE4A 1V41E 2OSVA 4XGRA 2P30A 2I3GA 4RVNA 3K8ZA 4NBKA 1IUNA 1TQ8A 3QFSA 4U9HS 1QRTA 3VZSA 4QRDA 1VXRA 1CEEA 5E1DA 4E33A 3AJEA 5EXTA 5EYPA 2ST1A 2XA9A 4BNNA 1Z4JA 2ZDQA 4J0GA 2FX3A 2C3MA 3S81A 3NVAA 3KZMA 4QPZA 4FYKA 1J24A 3EOBI 4UNSA 3KUCA 3LYLA 3OAAD 4JWTA 4JL8A 1KDRA 1HLFA 1G4AE 1O6FA 3C5VA 1XCOA 3FHJA 4J6FA 4N0DA 1QFJA 4V0OA 5AKZA 3MNFA 3PEYA 2ZW9A 3PSHA 4RLFA 2DUWA 2C07A 2B4TO 3DE6X 5EWLB 3WO0A 3RYHB 2YICA 5E6RB 3V2GA 3DQQA 3ND9A 4G26A 2J3QA 1ZDMA 4QG7A 5COQA 1QB8A 1XU7A 3KV3O 4AM8A 4UTPA 4BRWA 2ZZKA 3LDHA 5KTOA 5HRUA 1II8B 1JWAB 1G5HA 4AUMA 1D4OA 1UZLA 3RIMA 1A5TA 3NJRA 5HQTA 2NZXA 3PF9A 1XJQA 1BNCA 2VXOA 1UBLS 2PSSA 5CVTA 3OCUA 1V16A 4BFXA 5F4BA 3VO1A 2QLJA 3A3PA 1SAYA 1B8OA 3F7NA 3I28A 3TCKA 3N53A 2RHJA 3ZQ6A 4JJZA 1T5OA 5SZKB 2VDKB 4KP7A 2EZTA 4KGDA 3OEEA 5JCXA 1K88A 4QOIA 4R83A 3B5IA 5ALYA 4GZ6A 1AY0A 4V03A 2YCLA 1QO0D 3PQDA 1RZUA 2O0JA 5DCUA 2QRNA 2NVUB 3H9EO 3WLEA 4I50F 1E2LA 5CA0A 3R8FA 3HZOA 2HBRA 2NVBA 4JEUA 5AVXA 4W1PA 4W9NC 3KSRA 3L7MA 3MJHA 5A05A 3FHTA 3K0FA 5K09A 1BVUA 2CXOA 4MVYA 1CIJA 1J0DA 4PW0A 3OTIA 3PHJA 4HNAB 4MKZA 3SG0A 4BGEA 4BFZA 1I32A 1W4LA 2D1FA 4Z0HO 5KOJB 1P9WA 3NTXA 5BW8A 3I72A 1FS4A 1BH2A 1E6MA 1X2EA 2ZUSA 1V7QA 1RXVA 3UOGA 5GAJA 1MVNA 4CT0A 3L4BC 3VVCA 4FBLA 4G01B 4HYQA 4CV3A 4I08A 3OMWA 3WSTA 4X1IA 1VLHA 1H2BA 3TGLA 4QOFA 3KUXA 1NUTA 1ZM3A 2V7TA 3HFRA 3IUSA 4PINA 1C5KA 1FP4B 1L7PA 2PUVA 3ABOB 5EKXA 3D2AA 3UT5B 1O08A 3DFKA 5BN5A 2NO5A 3GJ4A 3D8BA 4FIZA 3VOBA 4MLCA 3SS9X 4JV5B 5GZ1A 1TVCA 2IYVA 2QRPA 4PFSA 5CH3A 1UZUA 5K51A 4ARUA 1ZN2A 3KOYA 3TB6A 1DQPA 3GPLA 1SIOA 4DUYB 4MKIA 4JQZA 1FB5A 3CH6A 5ALLA 3B1WA 4GICA 5DNDA 1JVNA 1P0PA 3EVGA 3Q5EA 1W29A 1ZJ4A 5I9SA 5TPZD 2LCQA 2VHTA 1DX4A 2LCFA 5EIAA 1DXYA 2JFHA 1MO6A 5JALA 4AYWA 3O9ZA 5COAA 4KR3A 2OPBA 3O92A 1C9YA 1KHTA 5M29A 4DNFA 3KBBA 4GG1A 2O8EA 3RTGA 3NTQA 3M0EA 3RU9A 1QB7A 2I3AA 3GVCA 2RDMA 1U99A 1RQLA 3R0VA 3TMAA 3ESDA 4Q1EA 5JH7A 4BFTA 2DECA 2HWUA 4RHYA 1KZ4A 2O0MA 1BD4A 4BNIA 4P58A 1X70A 1NY6A 1ZCAA 2AG6A 3F1KA 3L9XA 5E4TA 3TQSA 4C0LA 5CA1F 6YASA 4KRFA 4GM1A 1UKCA 4D43A 2J09A 4QXMA 4OIMA 4PR0A 1BXZA 1RVV1 3U39A 2ZIXB 2WWWA 4KVGA 4HPWA 3TI7A 1WVMA 1FMLA 2W2PA 5ITZA 3N2NA 1BS1A 1OBOA 2OQ2A 3Q7RA 5ALGA 3WL5A 5LNK1 1UBGA 2HA3A 1UBUS 2JHFA 3C4QA 2BWJA 2HJVA 2QE7D 2X42A 1ZD4A 4JXJA 2F64A 1M67A 2VDUE 4XRGA 2Q45A 1TQHA 3MJ4A 3R5JA 1JSZA 3LDGA 4UE6A 2O2CA 1J1ZA 2X8JB 4MWGA 3E22A 3K5IA 1TU4A 5DN9A 4BNZA 2NYAA 1WPGA 3UANA 1MC1A 3UMBA 3I0MA 3WRYA 1C0KA 4YDHB 3QQPA 4IUYA 5ETJA 1YZYA 3DPUA 4K7JA 4MRNA 1IRXA 4OX9Y 1OA1A 1T36B 2O54A 3AFOA 4QVKA 1J2UA 1QKKA 3HWRA 4IV0A 4OHRA 4A0RA 2Q27A 5HXAA 1NRIA 5HE9A 4IIYA 2JGFA 1U5AA 1P1CA 3NWEA 3ZCVA 4X92A 1I01A 4HTFA 2H85A 4TTQA 4PRKA 3TVDA 1V37A 3A1NA 1Y1TA 1O97C 1KQPA 3D43A 5ECGC 4P32A 4LHEA 3ZDQA 4EBBA 3AP3A 1G41A 1F7UA 1SVLA 1TYBE 2YFQA 3JAKB 3M6LA 2XNSA 3NBQA 3OBIA 4WBNB 4BVGA 5LFAA 5GZ3A 1U11A 4P4SB 3VR1A 4TZ6A 4L02A 3LVFO 4R2XA 4LGYA 1Z36A 1NM5C 5H1YA 3H84A 4EK9A 4Z4FA 3H11B 4MS1B 4BE9A 4WESA 4A2QA 2H57A 2GZSA 1QHHA 1ZVVA 1QAMA 3EGDA 3I2YX 3PDIB 5TQVA 2V7QD 3CJQA 2PXCA 3AQIA 1NRXA 5AUQA 1RJ9B 3RASA 3TDKA 5FOWA 4BTEA 2JL1A 3OZ7A 1RS0A 2VNIA 4DMLA 4G1EB 3RVNA 3NEYA 1A1SA 2ZXFA 3MB8A 5E6UA 4Z4QA 1VKOA 2GAAA 2O0LA 1YBHA 2JI8A 2ZBGA 2XNKA 1DAFA 2JFYA 3O75A 3NH9A 2Q1SA 4JHXA 4C1NA 2RGDA 1XRQA 1WV1A 5EJ7A 2XWQA 1SU7A 3UK0A 1BJRE 2YCBA 1B4DA 2WM8A 4MA4A 2QRMA 4HDKB 1CY7A 2PLAA 3CT4A 5J58A 1SVOA 1W48A 4ABYA 3O3MB 4TYQA 4YJHB 3G13A 1TCUA 2JI9A 3E5NA 1Z9BA 1RZRA 3ZVKA 2QYOA 2EP5A 2Y3IA 4FCCA 3PFHA 5CHEA 1N2JA 3IBCA 4JBXA 1L7OA 2VSQA 3LLVA 3OZVA 4U7TB 4HDMB 2YWDA 4OF4A 3TX2A 3MS7A 5LQNA 4FSDA 1HT3A 2E85A 1UBFA 4Q00A 1IOZA 2OVBA 4QAQA 3UT5A 2G9QA 3CZ4A 4KYIB 4RPJA 3VYSB 5C9ZA 4WA7A 1PGPA 1SBNE 4IZ6A 4QWWA 3KE9A 2BCGY 1CJSA 1P3Y1 1DC5A 2W6JA 3O4JA 3HEBA 3O8BA 4PHHA 3P9QA 5FNZA 5ULLA 3D3WA 4B6SA 4I46A 5DM60 4DC1A 3HFSA 1HE5A 2E4UA 2GKSA 3PJGA 1WCXA 2WOOA 2EFCB 2RHDA 3DL0A 3L6RA 2ANBA 3MRTA 1FU8A 1NQWA 3NLLA 4BB9A 5IKEA 2HH9A 3HQ4O 2QVGA 4LKRA 1DBSA 1ZN7A 3LH5A 1SQ6A 2Q9BA 1GAQA 1Z0FA 3R2JA 3K35A 2MT9A 2VK8A 3AY3A 2PQ6A 4JLAA 3TLBA 4Q9LA 3Q87B 4BVLA 3FGNA 3DBLA 1GNLA 2H8KA 3GLKA 1U90A 3PWZA 1S3IA 4M8NE 4EG4A 2I66A 3QVVA 2AI2A 3ZH2A 1LPOA 2RHMA 2Q2OA 3DKRA 5K99A 1LNZA 3DPIA 1SZCA 1YACA 2RIPA 4I55A 3O74A 3S5UA 2FEAA 2NQTA 2QD4A 4GLOA 1NJ8A 5A4AA 1NMQA 1VE7A 2Q7XA 3ZHVA 3D3NA 4ROTA 4DDTA 4JI1B 5IZCC 3FPHA 1T0IA 1X7ZA 3RFCA 4HXEB 1Z07A 2IDZA 3GLFB 3X1XA 4R5MA 2Z4TA 3I1JA 4MV9A 4F2GA 5ECWA 5A4IS 5DTEA 1W36B 1ZMBA 2APJA 1J7KA 2BVNA 3OM1A 4JBIA 3WZLA 4DDHA 3WR5A 3C3EA 1NV9A 3RVQA 1UP7A 2CB9A 1D5CA 3IQEA 2JGRA 3B3JA 4WXPA 4RZXA 2XTNA 1Z0UA 4YI5A 4DHWA 4YAUA 3FLEA 3OECA 4Q3CA 5T3UA 4BUZA 4DR5B 2OLEA 3ESYA 4MYRA 1JKJB 2HXSA 4F04A 4DR2B 3I64A 1ZBDA 3WLTA 2F3RA 1R12A 2I7CA 1BW9A 1DQZA 3TLAA 4E22A 5EJGA 5C4MA 3BH0A 4JKIA 2E37A 3S2YA 3T5CA 4FGWA 3DE4X 3M6XA 1KZ6A 2YWJA 1XEWX 4IO0A 1UBNA 4E2WA 5KTKA 1C2TA 1M66A 2VRCA 5COBA 3PR1A 5BV2P 4Y1GA 2JHPA 5LKRA 1VI2A 3LQFA 2V7UA 4DCSA 1NNEA 4JI7B 3LZ6A 2B8TA 1DRUA 2PAAA 5BMVA 4POOA 5CA1B 1KAMA 2J5KA 2OB2A 4U2FA 4CI9A 1N6HA 2NYRA 4ZIRB 4GGOA 5LOVA 4BJHB 1KH3A 1T3TA 5EFOA 5U4XA 4QDUA 8ABPA 3PC4A 5LP6A 1CF4A 4RHUA 2CL5A 1UBEA 4PC1A 1KS9A 3IO3A 2SHKA 3WOHA 4BKUA 2FLVA 2XRZA 3COSA 4QHYA 2PUGA 3HVHA 3AUAA 4EVQA 4BX2A 5DCLA 1GZ4A 2GS9A 2D2FA 3K2QA 4FR5A 3ENVA 4UTZA 3DYBA 4KPEC 3TD2A 3AI1A 2R1ZA 5B7GA 5K6AA 1EIZA 3FY4A 3NHPA 3CX4A 2V98A 3DM9B 5H3LA 3F8SA 3IUBA 1SMKA 3EXFA 3PQ5A 4BX9A 4EG1A 1QBKC 2Z6VA 3DULA 2EW8A 4MGYR 5K0GA 4X62B 2B98A 1C4KA 1IXSB 4L08A 4MSUA 3DVAA 3T8YA 3MINA 4O3FA 4F71A 4EQ6B 4O4JF 3W8RA 2HPZA 1PWXA 4TKVA 4OHOA 1J39A 2EXXA 4MLPA 3FPKA 2RAVA 3EUWA 1Q20A 1LNQA 4AP5A 1NW8A 4WVFA 2QX4A 4NAUA 1M6VA 4G8CA 2KX7A 5DB4A 4Q7MB 2JJ2A 3V9AA 3OE7D 4G0PA 2RGEA 4AMVA 1H05A 3PS9A 4HWSA 1SIWA 2VF8A 4YXWD 4KW7A 3ZHCA 4RXMA 2A3NA 4KQ6A 1EP2B 1K3FA 2BZ0A 3H2KA 4R2LA 1Z17A 5TQ0B 1U7PA 3TRDA 5LWHA 3F5DA 4ND1A 5AM0A 3J81k 2X3UA 1W94A 1OLUB 5L4NA 2C77A 2HPHA 4WCFB 2I29A 3PXXA 4C0KA 4Q19A 1W30A 1MX3A 3JVDA 3FYCA 3QPAA 2IBTA 1MZVA 1H8EA 1UMCB 1XL0A 1ZPDA 3RCBA 3NV9A 3DWEX 1UKAA 1UMBA 1JHYA 1YUNA 3Q98A 4YJ3F 3AG5A 2IBMA 4MINA 2WIJA 3IQHX 1QOPB 1E4VA 1F0PA 1L8QA 4X7MA 3CPEA 3RSHA 4DB4A 3N8KA 3M1IA 5KCMA 1INLA 1EVKA 1VKHA 4TKZA 4TROA 2P35A 2VIIA 4YP9A 3WNCA 3I6MA 2ACWA 3MPOA 5JY1A 1YRBA 2EWVA 2YY7A 4S05A 1V8PA 2HMTA 5DNVA 1Q22A 4FMCF 4IGEA 1XZKA 4NFLA 3M6FA 3K4PA 3A1EA 3MJDA 4ESEA 3R7LA 1OBFO 3QXCA 3P2IA 2AXPA 4CM8B 3K70D 3WOVA 1H4QA 3AR3A 4OQDA 3NUGA 1ZN9A 3OIGA 3AIIA 4K81B 5FH9A 1F4LA 3GUUA 3M2PA 2JIRA 4BFSA 1ODCA 1U1DA 1LTQA 1QQ6A 2JIZD 1K7XB 4DMMA 2ADMA 2FJ0A 4TV8B 1G20A 3CY6A 3URKA 4CIDA 4TXMA 4ZRNA 2IPXA 2VDWB 4LOHA 1R6BX 1QDEA 3HGTA 2YBDA 1DP4A 1B6SA 2BHSA 2BTQB 2CXXA 4DRXA 1D5WA 4EFLA 4EENA 4CBVA 5DT9A 3FHOA 1V47A 2C1EA 3I76A 1C8BA 1P62B 1QRAA 4EO4A 2C3YA 1XZIA 1I3MA 5JSYA 3TWOA 3D6VA 1E2MA 5JWRA 1QIFA 4MWDA 5LUBA 2HIMA 4HBZA 3S7ZA 5BUZA 3QXJA 4X94A 2QRHA 3WJ7A 1CB0A 1RYMA 1DC4A 2B8NA 3NM5A 3DVRX 5SY4A 3CG0A 4MQEB 2ZRHA 1H6BA 2I2WA 5C3UA 3UA3A 2Y0DA 5FWDA 2QAGA 2H06A 2J1LA 1IXYA 2FPRA 4DOMA 1EU1A 3BB4A 3EIEA 3AB7A 3GZNB 4CM8A 2Q3HA 2X0FA 2CE7A 4DPKA 1G60A 2F1RA 3MT7A 3C43A 3SHQA 4H59A 3IMFA 3ZVLA 5F7XA 2D2VA 1QK3A 3KLMX 2N1MA 2P2ZA 2BJWA 2C9YA 3HCPA 4KRYA 4H17A 5D00A 4LXIA 2HLNA 5SY6A 3ZHBA 3GFVA 4EVIA 1I7SB 2F7SA 5DZSA 4GOKA 2V4MA 3WA6A 2A57A 2JBHA 3DM5A 4XX1A 2PX2A 4R54A 4L73A 1UP4A 2HQRA 3TGWA 2V3CC 1ECCA 1X39A 2OCKA 3F97A 5DO9A 4B48A 2HR1A 3JVEA 2ZROA 1Y4SA 3ROTA 2EV9A 2F1OA 1FSFA 3AILA 1YOVA 3DE3X 3KWFA 5JSUA 3UJ6A 3IAS6 1MAVA 1Y5RA 1T6BY 3D0QA 2OB1A 4XLTA 3MSCA 4AU1A 2IYFA 5HFJA 4EZBA 3IQXA 1MO4A 1FL9A 2CHQA 3DL7A 2V3VA 1P9OA 1JPJA 4CNBA 1Z6YA 2HB6A 4LE0A 3H2ZA 4MP8A 2ORIA 3OE4A 4OHKA 5JRJA 4RTLA 4OLJA 5JJKA 2AFHA 5BSRA 4UDOA 3TDNA 2JA1A 2CBZA 1EX6A 2HHJA 5I48A 1T4BA 4WOJA 1WCYA 2X1HA 3U3DA 2OBBA 1TYEB 3QPVA 1JALA 3MJCA 4ND8B 3KT6A 5IWAB 3CNQS 3U3OA 3IDFA 1YGYA 5K20A 1ZKDA 2YMPA 3NDIA 5FP0A 1LK7A 3RVLA 2Z56A 3H0EA 3SJAA 1LBIA 3ZZMA 3N8HA 4CI0B 1ZGCA 4HVLA 1K6JA 4GI1A 2JG3A 3OLVA 2JLQA 3R9KA 4V1CA 2SNIE 3O1HB 4AKIA 1R9JA 1VBKA 2H1CA 3CLRD 3RO7A 2V5UA 3TL2A 5BO5A 3B85A 2NVWA 3OFJA 5J4HA 4HHEA 3S40A 2WU0A 1I24A 1Q44A 3W5DA 2NIPA 1SOUA 3AKZA 2D7CA 3OZEA 5CA1A 2PMEA 4BVKA 2BMEA 5FI1B 3MJTA 3BXZA 5ANRB 3DDZX 1GDDA 4ZVOA 1KI8A 4W5HA 3BGIA 1I3NA 1NL3A 1XDUA 3P0FA 3EPRA 3GFQA 2VNAA 4KE7A 3ZQKA 1PJLA 1DOAA 4GWGA 4QOJA 5DXAA 1AF7A 1GIAA 5FWYA 4IGAA 4IDOA 5EE3A 4BAZA 3SKYA 4PLGA 3SXUB 1BGVA 4U2DA 4MAMA 1A9ZA 5JU6A 2G88A 4MKXA 4NFSA 1W52X 2AHRA 3FYUA 4MIYA 3S7TA 1I2AA 1ZNWA 3EEIA 4PS1A 3ZIAD 4LS3A 4NZPA 4TVOA 1AJEA 1R88A 3OM0A 3NBKA 4KMRA 1YGPA 4N5MA 3CLSD 4IXNA 2NAFA 4AKTA 5JNVA 3CCFA 1IC6A 4RGYA 5EFZA 4BQFA 5BPHA 2R66A 1F8GA 2E1PA 5FOQA 3DZJA 3AR7A 2OHFA 5AJZA 4KV7A 3CEJA 3H16A 4IL5A 2VYCA 4R69A 4JB3A 4WL0A 5I45A 3T1NA 3W6NA 1T6ZA 3UH1A 5AIBA 2E18A 3EDCA 4TL8A 5ALUA 3JQ6A 3V2IA 4LV5B 3DW1X 4BV2A 1GPUA 4AIRA 3N75A 2VXBA 1XPRA 1Y7IA 2AD5A 3ADDA 1G21B 4LF4B 1NUPA 1WUYA 2GNPA 4IIVA 3N5CA 4DZTA 5GV7A 1H66A 5MF6A 1W36C 1EK2A 4XUEA 4Q9NA 1RXUA 4D97A 3JVUA 1PBTA 2GVNA 3JALA 1PT5A 2I6FA 1QC5B 4UM5A 4OVKA 3NOQA 1VJRA 1PT8A 1OF1A 4IHJF 4NENB 4B71A 3LXMA 1HE1C 5JJCA 1V0JA 2NUAA 1AXEA 3O84A 2VHXA 4LMBA 5CURA 3WGGA 4F2PA 1QG0A 5DLQC 1RZRD 1TUGA 3KUKA 2B7LA 1BN7A 1YHZA 3A9CA 5LYJB 4KC0A 4YJ2A 2QPTA 3JQFA 4RVFA 2IXGA 3O9VA 2Q4OA 3DT9A 1FSSA 2HRDA 3M6UA 3EBPA 3SX2A 2Y1OA 4FGKA 2QROA 4BQNA 1M34A 3ADOA 1HY3A 2G72A 3KTFA 3DFIA 5D87A 4HN4B 2PVCA 3ZGOA 3KYJB 4ZHQA 1EVYA 4DV4B 1EFVB 4EY7A 4F60A 3D8UA 5HX7A 2HA0A 5CGQB 2XQJA 1U2GC 1UQUA 2F8LA 1K9VF 4XPZA 1I0ZA 2DP4E 5BOVA 3H2SA 1QPBA 2I4LA 2OAEA 2AEJA 1Z6GA 3PNVA 2C4WA 1PR4A 1SPXA 1GAEO 2J8ZA 3JARA 4Q4HB 4F97A 3GHHA 3RM3A 1P2UA 4BTVA 1GN8A 4E31A 821PA 4B8YA 2WIAA 1AB6A 1TOAA 4XGQA 1BCRA 5JMOA 1ZC4A 2OILA 4DMCA 3CUEF 3JVIA 5I8PA 5G0SA 1LPNA 5DSTA 3LYHA 5A2GA 1S9HA 3KHKA 2OXTA 3W8EA 5F73A 4RF3A 4RCZA 2H59A 1KKLA 3GUCA 1BWRA 4LAFA 3DC2A 4DLKA 5JYDA 1QANA 1GHTA 3G5AA 2CFCA 1I2CA 3AJAA 2PVPA 2YOGA 3EN0A 4JASB 4X1OA 2AYZA 2VSXA 2FW0A 1RXCA 3L4JA 2PT5A 2WU8A 1E7SA 2DFTA 2RBGA 3TKYA 4CJXA 4ZHQF 2QHXA 3AONB 3RTEA 2FPGA 2QUIA 4TXJA 1MOSA 3FHLA 5FTJA 1G2OA 2QR5A 4N3CA 4IQ0A 3LWNA 5C52B 2XKBA 2F8TA 1CYEA 3WDSA 3QUBA 2EEPA 4AXXA 5C1OA 4KQIA 1ZM2A 2FOLA 4I0WB 4OP3A 3K8QA 5EE9A 1L5YA 2EKZA 1E7MA 3GJ7A 1A95A 1QRDA 2KQUA 3DNMA 3QG1A 1CVRA 1LS6A 2FYTA 4LMAA 5FTNA 1XG5A 3AXTA 4WEQA 2ZBDA 2YHBA 1ZCJA 2Q21A 3SE7A 3DCYA 2ZIGA 3DF7A 3ISVA 2O8DA 3QE0A 3SEQA 4B9AA 2ZWOA 5DRYA 3AV3A 3QXXA 4OD0A 4AIIA 4DQUA 3ZJVA 4RKRA 2A5YB 3LKBA 1T29A 1I51A 3GUVA 5DDIP 3WKCA 1M5UA 3EPJA 10MHA 4CCYB 3L6CA 3AVXA 1T8WA 3IJRA 4FLFA 3FTNA 3TB4A 3QNMA 1E9EA 3E2MA 3FYTA 4TLCA 5IABA 1J2EA 1TUEA 1VHWA 1FTSA 3DHEA 1LVUA 3ADCA 2RE8A 1VJ5A 2Y1DA 2VF2A 1P2TA 3JAKA 3WJ1A 3R3VA 4RUKA 5E95A 1MBZA 1YS4A 3AVWA 3K16A 4JLPA 1AVTA 1A5BB 1WJGA 3MXOA 4X7RA 2FKAA 1Q7RA 4ZI7A 2IODA 2PANA 4WUVA 3NTRA 5JHGB 1ESDA 1L7VC 4MQ5A 1PWEA 4R0VA 1OYYA 1XFDA 3AW8A 2B4KA 5HRCA 3VGPA 1D2CA 1V95A 2H31A 4PSAA 4B5KA 5DSZA 2I9KA 2WPDD 3RVPA 3D1VA 4J90A 2F3PA 4OB6A 3RWOA 4RANA 1J09A 3OLYA 3B52X 2YS6A 1WSWA 3MBOA 1QO0A 3ULKA 3RVSA 1ZUD1 1Q1GA 2VL7A 3QVGB 1L5LA 4KB5A 1F5SA 3MRXA 4ZCIA 1IEQA 3IP7A 3ZE0B 2CLDX 7ADHA 2W2MA 3H1TA 3OT5A 5BNIA 2HLHA 3MQ4A 1NG1A 1BAPA 1PR3A 5IM4F 2IUUA 4DV0B 4NS4A 1QNLA 4HB3A 4RHCA 3TO5A 3KD3A 1YONA 3ONNA 4EB8A 4M9CA 2YWCA 4GD3Q 2NXEA 1J7JA 2M98A 3GY0A 1AOXA 4D0NA 3LV8A 4A0QA 2A7XA 4UZEA 4KAAA 4PZCA 4Q3NA 3M89A 4Z2YA 3INYA 5BN4B 5I9TA 1E77A 2R2GA 2ZYRA 3PGJA 4HGRA 1M1YA 2PCLA 4FE7A 4KPGA 3VJKA 8GPBA 1EAYA 2WIDA 3M70A 4DSAA 3CSSA 5JI3E 2I1WA 3PC8A 1PR1A 4KQ9A 3QF4A 3G0DA 3AEKA 1X1CA 4Y9RA 2BEUB 1G5QA 4X8OA 5EL0A 1N3YA 2FWJA 3CF4A 4M9ZA 5JH7B 1IK4A 1FIUA 3VPDA 5HM8A 3DT8A 3SSOA 2RIRA 3VOAA 1OCEA 1J9GA 1TT5A 2H0AA 1NHGA 3ZHUA 4NCIA 2P1ZA 2QXUA 1A04A 3HJTA 4YS6A 2G0NA 2FDCA 4K9PA 1RHUA 1VXOA 4RMGA 5B6PA 3WMXA 3RVOA 1W4CA 2PHZA 1CQJA 1CXZA 2E5WA 2J3KA 3MW8A 3HM2A 4G84A 2G70A 1GNPA 1B73A 4PRLA 3D0OA 2IA5A 3I2JA 2VHYA 4Q48A 3KPJA 1R2QA 1E4EB 4RKWA 4YJFB 1Z38A 2EQ5A 4BJ5A 1S2NA 4MW6A 3P2MA 2R68A 2IH5A 2O8CB 1ZCZA 2X0NA 4TVBA 3LYUA 4UXIA 4V0KA 5IAOA 1R9MA 2XZPA 4QU0A 3PEVA 3VR6D 4YUWA 2FUEA 3PJFA 4BLOA 3ER8A 4YQZA 2XB4A 2FSUA 6NULA 1DZ3A 3H3FA 1CRWG 4M8LA 1I1OA 5F2EA 1VG8A 5JLAA 3OCVA 4KRGA 1O9BA 1QZUA 3DEJA 3QVTA 1QVZA 4A0FA 4MUAA 3G2HA 4LF6B 2ZSAA 3IV6A 1UJ2A 4IZOA 4AC9A 5LYJF 2O3UA 1DELA 1PVVA 1N8NA 3VYUB 1R3UA 1P2SA 1TTTA 1GPAA 1SQSA 1K8RA 3OFKA 2GAOA 3D5TA 1SOWA 4BV9A 3PGMA 1ULZA 3TFOA 4ARIA 1XZMA 1LSSA 1FVOA 4AG3A 3KPYA 2AV6A 3FIJA 1UPAA 3G85A 4HWKA 4TYYA 3FGOA 1ZS9A 2B1QA 4A23A 1KFBB 1QIMA 3L77A 4B45A 2O3JA 1TTPB 2P7IA 3SP1A 4XX0B 3E03A 1NGSA 5LA6F 1MX9A 1EE2A 1TJ3A 4K9LA 4L8LA 4KAJA 4AJOA 3NNDA 3DLBA 1W0JD 3ICWA 1E59A 2CYBA 4EMTA 5JFGA 1GPKA 4KSBA 1KAQA 3TNYA 2O2GA 5FWYB 4LGMA 1F7VA 1IPFA 3WYGA 5FADA 4YDRA 5JBQA 3I0NA 1FJXA 2VNKA 1T35A 3DWIA 1XEXA 5KQSA 4DKJA 2O2IA 3F3YA 4EJ2A 5KPJA 4EFMA 4NU6A 3FPBA 3VPFA 2LPMA 5H5JA 1Q1QA 2CD9A 2OSBA 1NQXA 2A67A 2ZTMA 2QL5A 3RS8A 3FPFA 4DEYA 4DQVA 4EVRA 1W87A 1LBQA 3LIIA 4Z4EA 1I1HA 1Q12A 3L46A 4EARA 4ZHSA 1C4WA 2G3YA 3SJUA 4A5SA 4DB2A 3PNOA 4LJ8A 1I5EA 1U3FA 3AY0A 4LYFA 4AFNA 2AZXA 4AS3A 3K9CA 4NBLA 1Q7TA 1XQ1A 2PS1A 3T7AA 2A92A 4H7KA 1EM8B 3QITA 1E64A 1FC0A 1RXEA 3GLIE 3R9XB 2ZK7A 4NMWA 5CT4A 2IYQA 2AFHE 4GLBA 3GV0A 2J33A 1AN9A 3MFQA 4EHNA 1WETA 3NWOA 3ZH9B 5KPDA 1ZR2A 1ZH2A 2ZJ0A 4YP1A 4G37A 3GDFA 2IY9A 3E5MA 3LUCA 4FOOA 3GGDA 3K92A 4C6TB 4F38A 5B57C 4BO9A 4FWIB 1P1KA 2C2ZA 2GFQA 3IAAA 5K0JA 1P17A 2C2WA 2A9KA 1C3EA 4LJ4A 4O2BA 4TT3D 4BNWA 4EOGA 2V74B 4HPXB 4X1YA 4CMEA 2EFEB 4W4TA 4LF9B 4R9NA 5JMTA 5CDYA 2Q1UA 1YULA 2IV3A 3ZXYA 2WEKA 1RADA 1Z83A 5DTRA 4GI7A 2OQRA 2DBRA 2Y0BA 3A1SA 4NI5A 2HNAA 4AWBA 1Y7PA 2DCMA 2P9FA 3LJKA 4AYTA 4PCVA 2PA0A 4ZXPA 3PQ8A 3F3MA 3CH5A 2HW8A 4WMLA 1Q3KA 1ZSYA 2ZRNA 3CB4A 1PUIA 4KSCA 2GESA 1ZNQO 2AMLA 2R8YA 1WMFA 5JO0A 1G6HA 4NATA 1JLSA 4DIDA 1L5HA 3ZHTA 4GWKA 2SKDA 4OXNA 4ZPJA 4KBGA 4GQIA 4DPLA 1KSGA 2H1HA 1UT6A 3IJPA 1GWNA 1QCYA 3RFVA 2RGRA 1U0GA 2IOFK 1H0HA 3K5PA 4LCEA 4MQLA 1DTEA 5LNK6 4FGLA 4ANFA 1B3BA 2OY0A 3PBKA 1KJZA 2CEAA 4GF5A 1TAQA 2ZR7A 2JFBA 1KK1A 3IQZA 2XUOA 4DARA 3LTNC 4P4GA 4RVOA 4M1TA 1ORRA 2WJYA 4ZT3A 3VDRA 5C7YA 5FOSA 3KVRA 4QASA 1VIYA 4ILKA 5H4HA 4ZVKA 2OENG 1Y9AA 3LY5A 3C14C 4Q02A 4TRJA 3ZY4A 1SA0A 4YECA 3IBFA 4HR7A 4DMGA 5EJMA 3UUFA 2MMGA 1YVUA 3A2NA 4MEJA 4C7XA 1W0KA 1J2JA 5BMVF 4H15A 4QUBA 4AJ9A 6AT1A 5K3EA 1QAQA 3BMXA 3ZHSA 1P7PA 1CPYA 2WWGA 3HYCA 4O1HA 3TLCA 3CXUA 5E3HA 5EPEA 2PKRA 2VF5X 3DE1X 3OFVA 1PFVA 4Q1AA 4ZMRA 4QOSA 1CBUA 3T0FA 2QG4A 1TVMA 1ESEA 4IAOA 4U0JA 3PNMA 3TRHA 1PL8A 4LNHA 2BTEA 2F3UA 2COEA 1GG9A 1C3LA 1UC8A 4I4TA 4XJVA 5HKKD 4GKAA 4P35A 1O89A 3RG2A 4Q4HA 1G20B 5NLLA 1YS1X 1NN1A 3MF4A 1TW2A 4EY4A 4E6PA 4LOAA 3BD6A 1HEIA 1U8AA 3TRIA 5DV9A 5EIEA 2A6PA 3KTAB 1AF4A 2Z8ZA 1OX4A 3K9LA 5LWQA 3BK2A 3LXRA 1ODIA 4RTJA 4O08A 5LQJA 1A3CA 3TQCA 1N5IA 3W3ZB 4ENRA 5AW9A 3RREA 1FFSA 2OZLA 5DK6A 4IZIA 1BXGA 4M7PA 3PXDA 1QNFA 1RLUA 1BQ3A 2JGNA 1OAKA 2BISA 3CLHA 3TEJA 1A9YA 5KWIA 1HZZC 1MAAA 1PSDA 1E2BA 4NV1A 3B5EA 5G0VA 4RHXA 1AGYA 2IXAA 1OW3B 1JB9A 2WZQA 4JI6B 2HK6A 3BRCA 2VXCA 2Q49A 1T8RA 4LPKA 1JX6A 4P38A 3THXB 1KZ1A 2ID8A 5CMLA 1NVEA 1RP1A 1Y34E 4GHWA 3OZBA 3TZ6A 3PA8A 3LSTA 1Q50A 1Z4PX 3E23A 2IEGA 1JA9A 4JOSA 3SAJA 1ADFA 1PF7E 2FEOA 3RARA 2O2XA 3B6ZA 1ETUA 2GXSA 1QH1A 3ORYA 4NHOA 3L7AA 4NF2A 5AJTA 5TPWB 2FFRA 4C5CA 3HDJA 4JELA 4MYTA 1EDEA 1NA5A 4QDOA 3FCCA 3P2KA 4AZTA 2PGAA 3A6HA 3OE1A 3FVWA 4AQ7A 3I9JA 1JDVA 3VSEA 4G4IA 5KREA 3BZBA 4PN3A 4A0SA 3OJOA 5FWXA 1XE3A 3B78A 5ALTA 3FRJA 2LCIA 1EE1A 5HYVA 2HRBA 2BW0A 3QXGA 3P7MA 3A9VA 1THGA 1LK0A 3IQIX 4BWYA 3EEFA 1A76A 3GI1A 2WIKA 2YWEA 2J3MA 4M46A 3I9LA 3BWEA 4NHEA 4LRYA 4DLPA 5JYEA 1PHPA 2BT4A 3EIQA 3QLJA 4B7AA 4CU5A 1M5TA 4PCLA 2CK3A 2AYYA 4MWCA 2QY9A 3VPAA 4GPTA 4FJ2A 4JJ7A 4X5OA 1TUBA 1Z2NX 4F6LA 1G3RA 4BGIA 2OQIA 2BV3A 4C2AA 3W04A 3EJ6A 2YHIB 2YUTA 1QGAA 1OGJA 3U56A 3SJCA 4R2IA 1CNFA 4ALNA 4OQZA 1J0EA 4EL0A 2A7QA 3MGBA 4PXYA 5GM1A 1M2JA 4S2UA 2DY0A 2Q2QA 2W2NA 3ABIA 3EFHA 4HC4A 3ZGLA 1XHFA 2JJQA 4DC0A 5IM5A 1Y37A 4DADA 4M38A 2PD6A 3NBAA 4E4TA 1L5NA 2PNJA 3BXFA 2UUOA 1NXWA 2MYPA 3U2QA 3KLPX 1U8FO 2QZZA 2XTZA 4UC0A 4YYEA 2C4NA 4HVAA 1RBYA 1CEXA 1JTEA 1NVGA 5EEHA 1Z75A 3DMTC 5LC1A 3VH4A 2BGGA 2WJZB 5EQTA 5CB4F 3IUMA 3JAMA 1ZM7A 3ZZ0A 2MU1A 1ZI6A 3NWJA 3DQPA 1HQCA 2X2EA 1J07A 1QUFA 1V35A 4PTYA 3U1TA 1XVIA 1NFFA 4LYAA 2X23A 4QPPA 1EGAA 1SKMA 3M6WA 2SKEA 2BDTA 4UREA 1KYVA 4ECAA 1UK8A 1OFUX 3P9SA 4X63A 2F90A 2VF4X 1XP5A 4HAUA 2WNSA 3EGDB 1FNCA 3OE7A 1DO0A 3F1LA 3PUWA 3WLKX 4DCPA 3KPWA 4DREA 5FV7A 2CJXA 4BNGA 1NLUA 2W58A 5EP1A 3A3OA 3FMPB 1UBSB 3KKPA 4CV1A 4XUDA 2VLBA 5KZMB 2BFPA 1TD9A 1RMQA 2G1KA 3WYCA 5KX5A 4PNZA 1BRTA 3O8QA 5JT1A 4L3VA 1ABBA 3R5TA 4HWOA 2ZBUA 1N8TA 4EEZA 5AR1A 2PL9A 3Q3IA 1LSJA 1YBFA 4I19A 5BQ5A 2ZJOA 4MJXA 1N2CA 4PN7A 5B12A 1Z7EA 1RQPA 2GETA 4IM7A 2V8OA 3M1LA 2CXSA 1CP3A 2GOYA 3KZXA 4MH0R 4MVJD 4N7MA 5KKAA 4RJJA 1P0MA 4PIMA 5EKTA 4ZT4A 1T36A 4LJYA 2PQ0A 4UTOA 5JBIA 2CF5A 2XT6A 1D9XA 2EGUA 2GEKA 1XXHE 3M9LA 4ND5A 2PTGA 3TZLA 4DIOA 1CV2A 1GUZA 3O8OA 4JVNA 1EEHA 4DA9A 1C3JA 1G98A 3NTUA 3P9IA 4J1QA 3TIGA 1BHSA 1LK5A 2AQIA 2WJJA 2QXYA 3GCDA 2HREA 4Z8YA 5EWMA 3UJDA 3VKVA 4IXMA 1UJ6A 4JYPA 1RCUA 4MW5A 4LQDA 4JQOA 3DTVB 2IIQA 3U09A 1H2WA 4URVR 5BMOA 2VT7A 1G8GA 3OEYA 2OBNA 4QGGA 2R6CA 2CLFB 3JYHA 2GEFA 2QUJA 4EKNB 4R71A 1A2KC 3TAXA 1HDXA 2VPQA 1P9LA 3EQ6A 4J0FA 2N1BA 1T2DA 1RD4A 2VRCD 5EY5B 2G7ZA 1OILA 2F6RA 3HNPA 3HRIA 4HGPA 4NH0A 4W6ZA 4YRKA 3CF0A 3ZDZB 1J99A 1E20A 1D0SA 4CM5A 5AXDA 4WN9A 3VC1A 1MVLA 5J2UB 5T67A 5CT5A 1TD1A 2FFBA 4EH1A 1FJGB 3DMPA 1Y82A 2HBZA 3AEQA 2JNWA 4Q3EA 4BYMA 3ER9A 4QDKA 3DZBA 1E7RA 2Q6LA 1QZTA 3RSZA 4HNUA 4IZHA 1UPFA 2O3TA 4JUFA 4AMBA 1VE1A 4KX3A 2VLIA 5ITWA 1MABB 2RHLA 1FDWA 3PHBE 5KTTA 4M8KA 2AC2A 1TDJA 5L7YA 5AM3A 4Q4DA 4HKTA 1NT4A 5EWLA 3N7AA 1NOJA 1RNLA 1GUAA 4F2DA 3TLMA 1GQOA 2X14A 3E9DA 2UZ1B 3IP5A 2HNBA 4K05A 4DY6A 1HG1A 4C89A 2XUPA 2VYVA 1L4BA 3AFGA 3VR4D 4OKNA 1YRWA 2CXRA 1I3OA 2ZE5A 2ZJBA 3PEEA 3DVQX 4FFWA 1SGWA 1E0JA 2Y1WA 2O2EA 4JH0A 5E9WA 2UUPA 3N8IA 3X1WA 2VBFA 2J41A 3C3WA 1QU2A 5EG5A 1BDHA 2QUKA 4NOKA 1QPGA 1N57A 4TMKA 2BGWA 3HE3A 1JE0A 3JYNA 3SC2B 4D3ZA 4C7OA 1VLJA 2P9CA 2YYZA 4INAA 4MVCA 3OU7A 2PLNA 4RVGA 4AWXA 4DJ5X 1J90A 2B36A 3A06A 3WNZA 1XV5A 1ZRSA 4ER7A 5EIXA 2Q5FA 1QG2A 3HKBA 2FVXA 3OU6A 4JIGA 2J87A 2WT8A 5IFLA 3BXEA 4BC1A 3JASA 2K7ZA 4S0XA 4YJ3A 2PAFA 2YYAA 4GYYA 4QJ5A 2WAMA 4LQLA 1K6IA 3U4AA 4PZ9A 2ONYA 2FMKA 2DWOA 5FBLB 1ZD1A 4G0XA 2H4FA 5ECDA 3HR7A 2X3FA 2AVNA 3K72B 5ELLA 5CLFA 1RQXA 1UDCA 5MN6A 2QZ4A 3OO1A 2DBZA 4L8VA 2BI8A 1KK2A 3JPWA 4LZPA 1V2GA 5IT4A 1KH1A 5B58T 2PX0A 4NYMR 2CCKA 5GJCA 1UFQA 1ONSA 4QXAA 3FPJA 4EJMA 1RLTA 4HX5A 3O3NB 2TMKA 3L1JA 4H16A 4PVCA 2OBLA 1I30A 4DYVA 1PYGA 2DPHA 1P2FA 1E0SA 1U3TA 1XK6A 2RB4A 4FE4A 4IKPA 4PAMA 2XCSB 3C6XA 1K75A 1VP9A 3UMGA 4D79A 3PX2A 3WIDA 2QQGA 2VXYA 2YN0A 4WFQA 3GLHB 4XX0A 3T6KA 5JZBA 1T9ZA 4WZBE 2AKAB 2PZBA 3AIOA 4FP9A 2C8KA 2WHRA 2BGIA 2HWYA 2ODNA 1Z6PA 4RIFA 4BLSA 5CAEA 5TLSA 2JA2A 4PXSA 1XT6A 1VRWA 2NSLA 3ZKWA 3ZWYA 2WB4A 3X2EA 1Y8ZA 2LNDA 1EHYA 4B5LA 1HMYA 4RA9B 3NAMA 2D2IA 1ZGAA 3LKZA 1ES9A 5GONF 4BZZA 1KNQA 1VL5A 4E3ZA 5I7WA 2ZQZA 3D2BA 3DJFA 3FZGA 4RKEA 4FFBA 1XDWA 4GI2A 5FEMA 2Q5HA 2V7QA 3LUGA