2PKCA

Crystal structure of calcium-free proteinase k at 1.5 angstroms resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE K
publication title Crystal structure of calcium-free proteinase K at 1.5-A resolution.
pubmed rcsb
source organism Engyodontium album
molecule tags Hydrolase(serine proteinase)
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 1993-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2pkcA00
1A2QA 1NLUA 1YJBA 2TECE 3DVQX 3D9QX 3CNQS 1TM1E 1Y3CE 1P7VA 1P8JA 4WOBA 5SICE 3DE0X 1ZVJA 3DE3X 1Y1KE 4AKSA 5FAXA 1DBIA 4LVOA 2DP4E 1WSDA 1TO2E 1AH2A 3LXUX 2ID4A 4K8RB 3QFHA 1KE2A 5FFNA 1V6CA 4DZTA 3GT3A 2Z30A 3DWEX 1Y4AE 2IXTA 1R6VA 1Y48E 3LPCA 5AVJA 4Z2AA 3A3OA 1SH7A 1PEKE 4AKTA 1Y4DE 1BE8A 2B6NA 5CW1A 2E1PA 1SVNA 1TM4E 3Q40A 2XRMA 1TMGE 3T41A 1GNVA 2ID8A 1SBHA 1YJAA 3AJ9A 4KPGA 1THMA 1SCBA 2SNIE 1KE1A 1SCJA 3DW1X 1OT5A 3GCWA 1UBNA 4ZARA 1MPTA 4OMCA 2Z57A 3DDZX 2X8JA 1R64A 1JEAA 3I37X 2PKCA 2PWAA 1P7WA 4CFZA 2W2QA 3BGOS 1SUDA 5AMXA 1OYOA 3LPAA 1SCNE 1WMEA 4DJ5X 1GTJ1 3EIFA 2ZWPA 1WVMA 1BH6A 4JP8A 3VYVA 3DYBA 1AU9A 3WHIA 1WMFA 1SUBA 3DW3X 1TM7E 3SICE 1GT91 3VV2A 1S02A 1SIBE 1SUCA 2P4EA 1AF4A 3ZXYA 2Z58A 3I30X 1GA6A 4YN3A 5ARDA 2PMWB 1C3LA 1SBCA 1GCIA 2PQ2A 4M1ZA 1S2NA 3PTLA 4LVNA 4HX2A 1SBNE 1MEEA 3PRKE 3VSBA 5B1EA 5JXGA 3QMPA 3DE6X 1AK9A 3VHQA 1Y3FE 1SBIA 1ZVKA 1SUPA 2W2NA 1R0RE 2WWTA 4HVLA 4OMDA 2Z2XA 3F49S 4RYDA 2QTWB 1C9JA 1BE6A 2W2OA 3DE4X 1KDVA 3TI7A 1SBTA 1XF1A 4CG0A 3DE2X 5FBZA 2Z2ZA 5JMOA 1SELA 1TM3E 2ZWOA 1SCDA 3GT4A 4DWWA 1CNMA 4FONA 2SECE 1NDQA 3L1KA 3BX1A 1SPBS 2XTJA 2DUJA 1SUAA 3DE1X 2SICE 3VV3A 1Y3DE 1AQNA 4NE9A 1Y34E 4MZDA 1YJCA 4ZOQI 2Z2YA 4B5LA 1Y3BE 5ARBA 1SN7A 5JXJA 3LPDA 3OSZA 2WV7A 3WIUA 1T1GA 2IY9A 4I0WB 3EE6A 1SIUA 1KDYA 3SQOA 1GTL1 1EA7A 1V5IA 1GA4A 1TO1E 3A3PA 1CSEE 2Z56A 3WQBA 3ZXXA 3F7MA 2HPZA 1PJ8A 1T1EA 2ST1A 2HD4A 1DUIA 1OYVA 1SUEA 5I9SA 3QTLA 1ST3A 1PTKA 1SCAA 1AV7A 4CFYA 1BFUA 3TI9A 1VSBA 3I34X 2PRKA 2DQKA 5B1DA 3EDYA 3H42B 4BWGA 3DVSX 3DVRX 4H6VA 3BPSA 1YU6A 3P5BA 2W2PA 4OV6B 4C3VA 3A3NA 4NMXB 1TECE 1PFGA 2W2MA 3CO0S 1Y33E 2G4VA 5AVKA 1C9NA 1GTG1 1TK2A 5AQEA 3TECE 3DE7X 4H6WA 3VTAA 3UNXA 5ARCA 2PYZA 1IAVA 1S01A 1ST2A 4NE7A 3WIVA 1BFKA 1C9MA 2GKOA 2V8BA 3AJ8A 4WOCA 3I2YX 1EGQA 1WMDA 2ZRQA 4C3UA 1LW6E 1HT3A 3F7OA 1NDUA 3DE5X 2SBTA 1GA1A 3GCXA 5JXHA 1Y9ZA 3AFGA 2X8JB 3D43A 3HJRA 4J94A 5JXIA 1AVTA 5K7SA 1T1IA 1SIOA 1KDZA 1BJRE 2PWBA 1GNSA 4KB5A 1IC6A 2WUWE 4H6XA 4KG7A 3Q5GA 2WUVA 4GI3A 1Q5PA 1TM5E
chains in the Genus database with same CATH superfamily
4HI0E 1HQYE 3VUFA 4CDGA 5J5VA 1PZNA 5DYTA 1UPAA 1N2BA 5SY4A 1JHPA 1L7DA 1PG5A 3K94A 3PXAA 3QVJA 3UBMA 9LDBA 2JJ2D 1EJ2A 4RNCA 5ICSA 1FA9A 1VSTA 5L51A 1JA0A 2NQ8A 4OLFA 1XRJA 4LFAB 2DHCA 4G41A 4ACBA 1M1NB 5JNTA 1PRYA 2H59A 4A0FA 4BQPA 1MIOA 4I50A 5A2GA 4JUDX 1JBKA 1NR1A 3RDPA 2I6SA 5FO1A 5KYKA 2B37A 1JIQA 1BHSA 4FXOA 1PD0A 1XTKA 4YAFA 3UV6A 1CVLA 1E66A 4J3JA 4EZBA 1FP1D 2JCGA 2PGIA 1MFZA 1FOEB 3NETA 1YL6A 2SKCA 1EGVB 4EJ0A 3QOYA 1WXGA 1MC8A 3DZIA 3N2KA 5TQ0B 4DNXA 1KDOA 1YQXA 1DRVA 2J7PA 3IP7A 3PNQA 3TRKA 2EZ9A 2JAQA 4TUYF 1S0UA 3OE7A 4BB0A 3BEOA 1TO2E 3TN7A 2XTZA 1CUDA 2C2XA 4K9SA 4UBLA 2XW6A 2OP1A 1AMOA 4Y0VA 1ULUA 3N2GA 1HF3A 3T06B 2XT6A 3ITKA 1AJEA 3MQ2A 1M0TA 1DDIA 1BXRA 3D4NA 4RTSA 2Z5GA 2B21A 4C3OB 4HQNA 3FPLA 4MAFA 4GWGA 1A5TA 5JD3A 3VMFA 3HTXA 1SU6A 2H4XA 2C3PA 3GJ8A 4C89A 4E46A 2IEAA 4XQGA 4DPKA 3AB3A 1HH4A 4P34A 1ZX1A 5A4JA 3THXB 4L5AA 1DWUA 3HWRA 5BQ5A 3HB1A 4OIFA 3IAAA 4ASUA 2JRLA 3TOCA 1C2YA 5EKTA 5FOSA 3UICA 1RRKA 1XEXA 3JQCA 3RB8A 3N2YA 2R8RA 4ENUA 3A3OA 2ZIVB 4RXTA 3RO7A 2VRWA 5E7JA 1P19A 2QE7A 3QP9A 3ONEA 4WZAE 1X1SA 1SH7A 2WJ3A 3VKFA 1WZEA 4KXUA 4JLBA 5BOSB 5IBQA 1GARA 2B7CA 2WLTA 4Z0TA 4B81A 1EDZA 1KQ3A 1YZ3A 4TQGA 1IHXA 1VGQA 4AP6A 3C6MA 4GE3A 2QE6A 3CRRA 1LVUA 2CE7A 4HAOA 2AMFA 1ECLA 2C2GA 1W0CA 2DZDA 4BIMA 4EUFA 3KHUA 5KAMA 4IH1A 5CX1A 3JQFC 5ANRB 5C52B 5DBFA 3A37A 1FUYB 4DCOA 1W30A 3BE5A 2OB1A 1DXHA 1NJSA 4HWTA 2W6CX 3MJHA 1XP8A 2QWXA 4EABA 4RORA 1Z17A 2EIXA 4BJ3A 2OCDA 2IA5A 4E5UA 1PZXA 3KFXA 4DDHA 3EZ7A 5BRNA 5AI4A 4XDHA 4ENQA 1NW5A 2Q8NA 4H77A 4RGBA 5EOVA 3L7KA 4CKXA 1UAAA 4MRRA 3UFXB 3G7SA 2NLOA 2I66A 3AVQA 3N0XA 3R0ZA 1G8GA 3HA5A 4AL4A 5TJ9A 3PFHA 3PRYA 1HSZA 2R79A 4ADSG 4EYSA 4EF6A 3ZDDA 3VNUA 4RY2A 5D00A 1M6VA 1CZHA 3F96A 5JCZA 3FAZA 3ICOA 4L3VA 4MV6A 4NARA 5I4IA 3BCSA 3PR3A 2F43B 2D74A 3B1FA 1HL7A 5JWOA 2PFSA 3NTQA 4LBYA 4LMBA 1H0RA 4JWTA 1VJTA 4RTRA 4MQMA 3G8DA 4EFLA 2I7TA 2PVPA 3RE1A 1RMQA 3M82A 3OT5A 3KJGA 1QHSA 5ER9A 1NC3A 2CZCA 4HGRA 1P81A 3RVMA 4MQEA 3TQFA 1V25A 4X85A 2NPFA 3AEQA 1UDBA 1DAGA 3R20A 2Z5FA 4HF7A 2C54A 5DHSA 1KO5A 5I7FA 4CM5A 4DG9A 1NVGA 2IYEA 4D4JA 4BLWA 4EQ6B 4YMUA 1P5JA 5IH7A 3N59A 5F33A 5FUQA 2P7IA 2I9KA 5HX7A 3U3DA 3REQB 1J24A 3IHLA 2I22A 1HURA 3DYBA 3EIQA 4FW8A 4MKGA 1H3EA 3S0JA 4J9VA 1YR3A 1KWGA 1ORVA 2QB5A 5FQOA 2N0SA 4BJ1A 3CCBA 1XLUA 2X2FA 4YRMA 1RSZA 4XGRA 4RELA 6AT1A 4GIBA 3O26A 1Q22A 2I1QA 4HQRA 4ZQEA 2PU7A 2VOJA 2ZYSA 2OGTA 4MA4A 3KQUA 1PDOA 4OUDB 2ZAIA 1JHQA 5UKDA 3UMJA 5HM8A 3ASUA 5J1TB 3R44A 4E5YA 1W7AA 2DERA 2REQB 4FNAA 8LDHA 1WO8A 2J32A 3OF3A 2RK4A 1M9NA 5IC4A 5GOZA 1OTHA 2MYPA 2Q5JA 3F46A 4JKIA 1W0JA 5A05A 1QYIA 5T57A 3VO2A 5CEFA 2CF5A 3MXOA 1LTKA 1DRJA 2QL5A 3AG6A 3H3JA 4LISA 1WOYA 4B3RB 1I3LA 4OGWA 1IVSA 1IAQA 1H5UA 1XZKA 3DQQA 4RZSA 3PBKA 4FFPA 2X9VA 1K7SN 3OY7A 4RZIA 4PBSA 3GU3A 3V8BA 2J3LA 1T4GA 4M9QA 3T6KA 2R1VB 4U2DA 1KJQA 2WNHA 4HXGA 4MCHA 3ANSA 4HH3C 4JBXA 2FR8A 3V7NA 1QP7A 2H7XA 3HO6A 3ABIA 1ZLYA 4N7JA 1GYQA 1JSXA 4HH1A 1R00A 1JR2A 3QMMA 3I0NA 4DWVA 1WZUA 3B89A 2D4AA 4BB5A 3VSBA 4OJKA 4ZKDA 3K9HA 5F5LA 5TF0A 1QS0B 3DXFA 3P9YA 1P9LA 1YIAA 4FGJA 1MA0A 1VYVA 1IN6A 4CL0A 3FZQA 4X66B 1PJZA 1U0BB 5EIAA 3RARA 5JFGA 2HQ1A 2C7QA 3OKFA 1V8DA 3FNBA 2H5JA 4LRSB 4EHLA 2FEMA 2OGSA 2HUNA 3Q9UA 7ADHA 4H7DA 4X1KB 3E70C 2WA1A 3O3MB 1TZMA 3P5SA 4M6WA 1QRDA 4PYKA 3OQMA 3HCFA 1TYDE 1WCYA 2G9NA 1NYLA 3AEXA 4IKOA 3ANYB 3K70B 1PJRA 4RZUA 4QOGA 3ABQB 2XTMA 2HGSA 2Z2XA 3AHEA 2XQJA 2QTBA 4PO3X 2Y3IA 1IMJA 1QE0A 2FPKA 2W2OA 4YMSA 1N6LA 1X39A 3EEFA 1K9VF 2C3YA 3TK1A 1CQJA 2Z98A 1DC4A 4TTJA 1KDVA 6Q21A 1DRUA 3PRJA 5CFNA 3HB4X 4MWSA 1LTHR 3GZ4A 2MINB 3VU1A 4BY9E 1BQEA 3DP7A 1IQ0A 4I5GA 4P58A 5H81A 2ECQA 5K45A 5DM2A 2GEDA 1JZSA 1U9IC 2CLLB 3F71A 4L4XA 2ZWOA 1ZIOA 2R7MA 4RLFA 2EAUA 2XQIA 5HILA 2G4LA 4DV7B 3O4IA 4MRSA 4C4XA 1ZD2P 1QKJA 1SY7A 4FE7A 2ZWVA 4DAOA 3AB7A 4FYYA 3BRCA 2A5JA 1S3SA 1Y1SA 1PNQA 2ZUCA 4QBGB 5HXAA 4AI6A 3ZHQA 2XMGA 3IC5A 4BLOA 2Y6UA 5K4HA 1EAYA 1P2BA 2GHQA 3VV3A 2BDEA 4IIXA 1N1MA 3X1YA 4NE9A 1JHMA 4JI1B 1OA1A 2BTEA 3ABOB 2W8BA 3HJGA 3GPDG 3OIDA 4HZUB 5BUQA 3VC7A 4PZEA 3D7MA 2ZZNA 2YHIA 1MW8X 2UZIR 3AP1A 3RSHA 1XAIA 4BXOB 3UQYS 3LBIA 3K0CA 1YK0A 3UUFA 1SN7A 2BSAA 3PPYA 2RHRA 4KFTA 3ZCVA 2FDRA 4BTLA 4TQ9A 3T9DA 4HNTA 4RK4A 3CX7A 3EVZA 3Q6IA 4L02A 4JXXA 3TZEA 1HWYA 5JCJA 2I29A 4FGKA 4C07A 3SDSA 5CLQA 1N6KA 4CDRA 1OB2A 5H70A 4LKRA 2C4KA 4F2HA 4CLOA 2D6FA 3U7QB 5E4YA 1C8KA 3CLRD 4O2RA 2VAVA 1TO1E 2GD6A 1E61A 3AUXA 3BN3A 4KYVA 1KEPA 4MV5A 3T5DA 1RQXA 5LM3A 2C7PA 3E9MA 2GBLC 1DCTA 4BC1A 4DTCA 1RE0A 2RCYA 2YOHA 4KQEA 3TNYA 4MW0A 2B4TO 2UYQA 1K68A 4LS3A 4CCWA 2WKQA 4F1JA 5GZ3A 2IGTA 1XZHA 1K86A 2VHUA 221PA 1TTQB 1L5FA 1HYQA 4NPCA 2HN9A 2JLZA 5GGXA 2YOGA 3NQ41 4A4DA 3QUSA 5HJEA 3WIOA 3EOAI 1HLDA 2DM6A 3QBTA 4JLDA 1G20A 4YBRA 1YMUA 2WAYA 1XSEA 1UBHS 2N47A 2VR1A 4U2GA 4WNAB 3GLFA 3IELA 1FFDA 2WM2A 4N3GA 4KE9A 2AUTA 2OORA 3INRA 4OXXA 5BMVF 5I6DA 5IG2A 5FLYA 1RXVA 3OOYA 3UAZA 4L50A 1E1QD 4WVFA 5LNK1 2CNBA 3VZDA 3KE8A 1CUZA 4FCCA 4W7HA 4RK1A 2CWDA 3HU2A 1B6TA 1FDIA 1FU7A 1VB3A 2BP7B 2YVQA 3B1WA 4HR7A 2C7RA 2HV9A 2VFAA 2WA2A 3FPJA 4OU4A 5IM5A 3I3SR 3K53A 1H0SA 4O4LA 1TUIA 1AV7A 4X84A 1YHZA 3FI9A 3T9BA 4F85A 1KHHA 2PA3A 4IG9A 5LWQA 3IYLW 4GMXA 4Q05A 4ZHQA 3Q9NA 1AXEA 1EX1A 1MT0A 1WEHA 4JVMA 4Z86A 3HNOA 3IPAA 2A4MA 3Q7IA 1Z28A 4CCSA 3NG1A 4ZGBA 2ZGVA 3BAFA 4XQEA 2L17A 4H0NA 1CULC 2P2ZA 2NU7B 4G0NA 4XTRA 1K0UA 1UFOA 3JAWA 3EDYA 3MOSA 4UW9A 2C4WA 3PPIA 4YCSA 3UWMA 5ALZA 4RKEA 1I7SB 1IN7A 2W90A 3IE2A 1BA2A 3LX5A 1DL5A 3KXLA 4RL4A 4WV3A 4X93A 3UV7A 5JBNA 4PSVA 2VF4X 2JAHA 3HPQA 1T25A 4MI1A 1NJGA 4MAAA 3VZPA 2DHQA 3M6XA 1QG6A 1R2QA 1FSPA 4CQMA 1IM5A 1KSFX 3CUVA 3ETGA 3Q6NA 5CPBA 4HNRA 4DFDA 4JVSB 4O4IA 5IHPA 1NXPA 3WVNA 2FJ0A 2KWIA 5A0TA 1LDBA 5IUNC 1NR5A 2PT9A 4LYHA 2GJKA 1TB4A 4YAEA 5J2TA 2C2KA 4BB6A 5KDDA 1GITA 1TKCA 2RAFA 2CLDX 3DUFB 3E48A 3L4BA 1J8VA 5EG5A 2FFHA 2X9LA 2QW8A 3IX7A 4ZAGA 3SAJA 1L8XA 1V8ZA 4UZEA 1UKBA 3BWYA 3SEAA 1JKMA 2AC4A 5E4TA 4BEWA 3P1JA 4E08A 4Y1RB 2BC9A 4JBLA 2C7VA 2XNHA 2ZJ7A 4O5OA 4UNNA 3WMGA 4XDZA 1ZH4A 1MO4A 4ZEWA 4DMCA 2DLNA 5HIMA 4JC0A 5IULC 4RJKA 1F60A 2OM2A 4M1WA 4Q93A 3RIHA 3GCDA 2DLDA 3HH8A 5E3JA 3FOWA 3PC4A 3JWPA 5E2AA 4DLVA 5LQJA 4LF4B 3ADBA 5HJ2A 4BNVA 1O77A 2D2XA 4BVHA 3GDOA 2AMVA 5G0UA 3O8QB 2P2LA 1RKUA 2WICA 3JSAA 1IXYA 5LYJF 4HTFB 3DTYA 5AR1A 8ABPA 1NQUA 5JQWA 2GKOA 2H1FA 2WTMA 5KMGA 4OM8A 3GZNA 2NZYA 2QR2A 1M34A 2XD9A 4OU5A 1U5BA 1WMDA 1WBBA 2MSKA 1XTTA 4MEJA 2ZUUA 5ILGA 5A7GA 1RI4A 3TE6A 2XYPA 3MJTA 3R4CA 4MUNA 2ZQYA 4RC9A 1LH0A 1CVIA 4KGDA 1A82A 3SF8A 5KNBH 1V4BA 1FZQA 4YJKA 1V71A 3FUVA 3QEJA 4XARA 1Y9EA 5JSYA 1RHKA 2AXEA 4XCQA 1QZZA 1E3IA 2ZT5A 1QWSA 2ZRAA 4RY8A 3NVAA 1Z0ZA 1ECCA 4H7IA 4AC9A 4BP1A 1FFWA 1C0LA 5ULLA 1SOUA 1J9GA 2CFTA 3R5SA 4ZIRB 5IWCA 2CNWD 3K1TA 3NRCA 4AUEA 1OILA 3GLUA 4GICA 4PS1A 3DLIA 4U00A 1PF7E 1XTZA 1Z82A 2EBWA 2GK7A 5JVDB 4EKEA 1FL9A 2DFVA 4Z1OA 1UOPA 2I9PA 3AKDA 1SHZA 3ACCA 2YTZA 3LUFA 4XXHA 5D84A 1JDTA 1T1IA 2HK9A 2VQ6A 4LZZA 5EIFA 5ALEA 5L3VA 1QRTA 4U6NA 4ERNA 1FU4A 1W0KD 2H52A 1F8YA 5BN4B 2ZAOA 2PWBA 4KAJA 1VKOA 3EY9A 5D3MB 1ARZA 1IC6A 5CB8A 1WM1A 3L7AA 2ODBA 3OM8A 5KPJA 3HM2A 4AQDA 3TTUA 2V55B 2RGCA 4LOKA 4XGNA 2DB3A 1KBQA 1V5WA 3A1VA 1TQ6A 3KWJA 3MMZA 4N03A 2VNKA 4ZVPA 2CB9A 2WAMA 3BJEA 3PX7A 2XRZA 4UQPA 4DXAA 2BI8A 2Q6IA 5B7NA 4TT3D 3OLQA 1XV5A 2I80A 4MMXB 1U04A 2XYGA 4BP9A 5B6PA 5EMNA 1Y63A 3QYJA 3NCTA 2ZJ2A 3R5TA 4M0EA 2NVUA 1RZUA 2OK8A 1JSRA 1TVKB 4QDOA 2QN7A 1EFRA 2XDYA 3L1IA 3M7IA 2AOVA 1QG4A 1YRAA 5FTLA 3E8XA 1P7VA 4KCGA 1KJYA 3C1OA 5A5GA 3A0UA 3FPAA 1LCIA 2P5YA 4TS3A 4WA7A 4L9AA 5EHIA 4F91B 3U6BA 1OWOA 4JEIA 3TW8A 4YQYA 1MQAA 4JI0B 1G0OA 1GKKA 4YXWA 5T4BA 4D5GA 1RQGA 1XJQA 3FFBA 4V0NA 3RVRA 4QC2A 2VHTA 1L5NA 4TVKA 4PCUA 3VR4D 1Y81A 3I9JA 1ISFA 3PHBE 3ZU6A 5HKAA 1XJ5A 2HPHA 2A5LA 2ZI7A 4XB6B 2VK8A 1XC7A 1YR8A 3BJZA 5B1IA 5NULA 3OEHA 3LCVB 5JAOA 4RFSB 1JTFA 2NO0A 2WF9A 3TW4A 1QIEA 4WBNF 3LX4A 3RAFC 1G63A 4NHOA 3GP3A 5BV2P 1J8YF 4NJEB 4K1XA 1G59A 4UBMA 2K6GA 5CFPA 5JROA 2XJ4A 1W8DA 1AQIA 3DWEX 3O9ZA 1QC5B 2NWQA 5BN5B 3VU8A 2WU8A 3ZCUA 4XJTA 1QB7A 3QBJA 4BV9A 3NJRA 4MVXA 2DBRA 5GIPE 2RFLA 4E5VA 2PKQO 3LPCA 3TRJA 3MRVA 3LS2A 3P0FA 2JGDB 3WO1A 3CE6A 1H9CA 4ZRNA 1KFCB 3NI2A 1OB5A 4H7PA 4NJOA 5EIBC 3UQZA 1KO1A 5TT0A 1BCRB 3TLCA 4I6EA 2RARA 3H05A 3Q5EA 2PX0A 4II7A 2HMVA 4LZAA 3C7DB 3I1IA 2O8CB 2BM9A 2VJDA 1XWFA 3OM1A 3PNKA 1KI8A 1LFDB 2V0CA 5AVXA 1Q7RA 1Z83A 2I3BA 1JIJA 1K6JA 1NUPA 4N0QA 4PC3A 3V2IA 1E3QA 4CM1A 4ZV4A 5BNTA 5KC9A 3PNPA 5FOWA 5H3LA 4ENTA 2VDWB 2CKMA 1PJ3A 1NJ1A 4RSRA 3H6GA 5DEIA 3CNBA 4WADA 4XVHA 4L74A 1BWQA 2EYQA 1DV2A 1TJYA 1WR8A 3P4UA 4H3HB 1T1JA 4RM3A 4ZQFA 4DM7A 1FJHA 1X7ZB 5JQGB 3HK2A 4BLPA 3JATB 4L72A 3ZWQA 3C5CA 1E5LA 4EUHA 3E35A 1Z18A 2CXOA 3IBGA 5CAEB 1YQUA 1Z5PA 1JQKA 2CLOB 3N8HA 4ND8B 2VDJA 3T4PA 1E1RA 1ORIA 2BGLA 4XGIA 1F0PA 3PX3A 4OSEA 2ZSUA 1KF0A 3GCWA 4NECA 4TMTA 3KAPA 2Y1EA 2G3YA 4DGQA 5K3CA 2ZRPA 4QIHA 4MIYA 3SIPA 2WIAA 3V8VA 1CZNA 1BQ3A 2X8JA 4FINA 2FRDC 3V46A 4C0BA 3NMUF 2Q1WA 1E69A 2XA9A 1NW7A 3KZ1E 3LY7A 1EWYA 3ZEIA 4XDGA 3SC6A 1Y82A 4BOYA 1QX4A 3K4HA 1IPFA 1SWWA 3RJ9A 3ED1A 1FW8A 2E37A 3AERA 3AWDA 1ICIA 1DXQA 2NT4A 1GPYA 2W00A 1QHEA 4CEIB 5CA0B 1RBZA 2QPTA 1O7JA 3LGXA 2C7BA 2QTFA 3IKLA 2Q4DA 4I9UA 2C1EA 4BFLA 3V4SA 4EYEA 5JMPA 2YJ3A 2Z95A 2FEPA 2H51A 1X3SA 4JVOA 1UKAA 2ZWPA 3IKVA 4X24A 2Z4RA 2QTVB 4C7XA 5L3QB 3NP9A 4QM6A 3HBLA 4MUJA 5H7XA 1SXGA 4JQYA 1SC3A 4MA5A 4ZVVA 5LXTF 1EPUA 1PVDA 4WTOA 3EC2A 1WUKS 5ECDA 2DKFA 3RS7A 2ZM5A 1Y1LA 2XQGA 3HG7A 4G6ZA 4KUGA 3VAYA 1OC4A 2ZIAA 3VV2A 2W6MA 4DRXB 3TD2A 4DR6B 4ETNA 1EXVA 2YMLA 4TLMB 2I67A 1ISIA 1N8KA 4GUAA 5D87A 1EH5A 4YJFB 3UPDA 4YS6A 3U3OA 4WSOA 1P0IA 4ILEA 4U2CA 3UK0A 1LQ2A 3CCFA 4D4MA 3A9SA 3S8MA 4QELA 5B2EA 2IOYA 2UXDB 4WERA 1GTVA 2Z9CA 4L4UA 4Y1GA 3UKJA 3GCZA 3TEMA 1DJOA 5IDVA 1SZPA 2CXNA 3UMYA 1DEAA 4MJ7A 5AHXA 3MCTA 2C7OA 1QBKC 2Z58A 3FYUB 3M2PA 1SFRA 2EHDA 1A9XB 5DI3B 5JVDF 3CWQA 1JKXA 3B1ZA 5TQ0A 3V8QA 3DV9A 4HMOA 4TYPA 1XZIA 4WN9B 1T0IA 2WW8A 3HKBB 3HKEA 4IMRA 1T36B 4D79A 3TTWA 1U3TA 4MIOA 3MPOA 3GGPA 3PUKA 4NU6A 5CT9A 2J9FB 4C6SA 4NG4A 2HRDA 4QBHA 3OJEA 4JBNA 5KNCD 5KYYB 4BEVA 1G291 3B9QA 1GAJA 1WQ4A 2SKEA 3NH6A 5IAGA 3OP1A 3RADC 1FP2A 1MEEA 2K87A 4N41A 2B25A 2IBSA 2NX2A 3MIZA 3IQGX 4XASA 3A4YA 1XQ9A 3EVTA 4YY3B 4K86A 1AURA 4Z4QA 2W98A 1KL7A 1P18A 2WJWA 3EZFA 1OI7A 5KINB 3W79A 1QAQA 4U3JB 1PBNA 4XPZA 5F7JA 3CWZA 4DA8A 1Y7HA 4IWYA 4H1VA 4XW2A 5F51A 5T4FA 4Q7QA 4OFBA 4RTMA 1OLOA 3KALA 3VHRA 4Q3DA 1IG0A 2LNDA 3PT9A 4FMDB 1G9TA 2Z3WA 3OZRA 1RCTE 4OH7A 3NEAA 4LCJA 3MJEA 3GF4A 1Y6JA 3SF0A 2QRZA 4H31A 1NXTA 4POAA 5DYGA 2VWHA 4XDYA 1H69A 4ZA2A 3RIYA 1EVZA 1UAYA 4RTOA 3KVNA 3NYQA 4G8DA 3O8CA 5BOSA 3BXPA 2PS1A 3HQ4O 4FEGA 4HAWA 3A1WA 5LDDC 1NN5A 2J9XB 4AY6A 2YFQA 4OUKX 4GKKB 2DQSA 1JXOA 3V8EA 2VJNA 2BYTA 2QTWB 4CLRB 1MJNA 1A4IA 4M83A 3FNFA 3TEJA 3VM6A 3YASA 3H5NA 1FLNA 4BWVA 4CKBA 1AMUA 3DT9A 3OLCX 5ESDA 3R9XB 1V9CA 2RGRA 4UBJA 1HGXA 5LOVB 5LQCA 3SVZA 1Z4NA 3N2NA 3KOZA 3MM4A 2J3HA 1PJTA 1QJCA 2OAP1 3C8HA 3W2FA 4D44A 2Z0MA 4DEYA 2YICA 4ZCSA 1AQNA 1Y7PA 1ZVMA 1CNMA 2FR0A 2IDKA 4OQDA 5ICCA 5JI3E 3FMVA 2AKYA 5AKGA 1OU4A 1XEAA 1OPXA 3KQTA 3WRYA 4C7VA 3UFXA 2IZZA 2CF6A 4Y6OA 2Y71A 4A0GA 1R6XA 3BX1A 5G3YA 5LQDA 2HCJB 3ZKAA 3W77A 5AKYA 2IUSA 5L40A 3GDWA 3QG1A 4NOLA 3T3PB 3SZGA 4F4HA 2F3SA 2C2MA 4GMDA 4ENSA 2JD2A 4EFMA 3UJ8A 2DECA 4JSYA 1U8YA 1I2MA 1PJSA 2P9HA 1A8IA 2OA0A 2QDKA 1N7HA 2F8MA 1I01A 2GRAA 2R6DA 3PGA1 4H18A 4IFEA 4LGVA 3PQ2A 4WY8A 3UZUA 3WWEA 5EP2A 1P1KA 2QG9A 3FLMA 2DFTA 2BGKA 3UXYA 3RS4A 2H2IA 4B3HA 1GSIA 1U2DA 3ZE8A 1CRLA 1P1IA 2RK6A 1LTQA 3A04A 3GEIA 3MWDB 5EAIA 4DT1B 1Z37A 1UBEA 2EZTA 3D2BA 2Q4BA 3D1VA 1UJCA 5A5FA 4NBRA 3DD1A 3CF4G 3UFBA 1ISJA 2CC2A 1FTNA 4R1SA 3AM4A 3WIUA 2X8BA 1H8EA 4UCQA 4C04A 5GTDA 4Q39A 2IEIA 5JBQA 3KKNA 1I4LD 3VBEA 5DKFA 2WAOA 3D4LA 4ZEOA 1V5IA 4EHJA 3SYLA 5JCOC 3K05A 1Y80A 3REQA 5J4HA 4I55B 2W7TA 2H4WA 3A36A 5EINA 2I1VB 4DOMA 1KIFA 5B4TA 3LA8A 2A33A 2C04A 2BUCA 1QHNA 1FNCA 1ZK4A 5B3LA 3U16A 1E2DA 3FPSA 4E5KA 5CUQA 4MW7A 2YJ6A 2G6BA 3QXJA 2AYYA 3K2BA 3PHGA 4GI2A 1BZYA 5DMHA 2ATVA 2DR0A 5JT1A 2E48A 5BV8A 3D4IA 2FLKA 1YRBA 5LA6F 1ABFA 3EUAA 3COVA 4GYYA 4IOLA 1PCXA 3BGVA 4QJBA 3AIMA 2REQA 4Y2RA 4DLUA 3LGAA 3ZU5A 2WJYA 4JR1A 2O2IA 5C31A 2ST1A 1LRKA 1OIVA 2EX1A 2Y67A 1R50A 4GQIA 1NBME 1RXEA 1NQTA 4JXZA 4YIKA 4QOHA 1D9ZA 2CN1A 1P31A 2FPSA 2HSJA 3BK2A 1PTJA 2FN8A 2H4YA 3ZY3A 5CDGA 4GPIB 2PV0A 1BHO1 2OYRA 3M1LA 4OFZA 4O3MA 1G8HA 1VHQA 1QH0A 1QGUB 1NVWQ 5FJIA 2R751 2NG1A 3FLAA 3KKLA 1F2VA 4YQZA 3FKQA 3WMXA 1E2UA 2C5AA 2KLHA 2G72A 4UHBA 3ZXIA 2W2LA 4Q4DA 4D57A 3VKVA 1HQCA 2C5LA 4YCJA 3UAYA 1BFUA 1QPZA 2CHGA 4W63A 1QOPB 2VH1A 1S1CA 4ZANA 3AETB 1F4PA 1SXQA 2ZRJA 4GR9A 4E5SA 1C14A 3GEDA 4I1RA 2DEUA 2AFIA 5EE3A 2G8NA 1OVGA 2CLMB 2NADA 1QS0A 4ZALA 4UTNA 5G02A 4NONA 2WIKA 4Z1MD 2LWIA 3ICEA 4FI3C 5AI5A 5KWJA 5GV7A 3O3NB 2JKZA 3L1VA 1NF2A 5AI9A 5J2UF 3HJBA 1GAXA 1JIIA 2Q1UA 4QU9A 5IVIA 3B3QA 1KI9A 3IDOA 4X1KA 1A50B 3U81A 4BP8A 4LJ4A 5CFOA 3BG5A 4D5EA 4HNUA 4WEQA 1HKHA 5CT4A 3FCOA 4MV7A 5U9CA 3FN4A 4MWTA 3NP7A 3P5BA 2XECA 3MRTA 5AM0A 1PQYA 2GAOA 1MB2A 4GT1A 3V8NA 4C3VA 4D4IA 4Z7JA 4UQLA 5JSQA 2OXCA 2OMKA 3ZWWA 3SP1A 1IN5A 3T3IA 4LRWA 1TECE 2BMWA 2WYWA 2X1LA 4KOAA 3AI3A 3IDAA 4CODB 1U4SA 4PIPA 5H4GA 1YR9A 4BZZA 2WT9A 4X60A 2GB4A 4C4YA 1JR3A 1TF7A 4IILA 1MFPA 4PXYA 4QUDA 3LT4A 4NNJA 1AMNA 2FFBA 2OO5A 4QGSA 3UJ6A 4ENRA 2OOKA 3O5AA 3CZ9A 2QLFA 2MINA 5ITVA 1LGYA 2CFIA 4OXRA 5CJ2A 3TSZA 5KIAA 4K46A 4E6EA 4HB3A 5BR8B 2PWZA 4DA0A 4DLTA 2JFFA 1UPCA 1MNAA 2FG5A 5JSKA 4DPMA 3DE7X 1LX7A 5JATA 5HWSA 3WI7A 2COKA 2I7DA 4D0SA 2BV3A 3G2LA 2EWWA 2AJBA 2B8WA 3LXRA 3QEMB 2PS3A 4IJ5A 3TIGA 2ZK7A 2AFVA 4DV0B 1F14A 5JTTA 1DXOA 4CMEC 3RRJA 1TW2A 5C37A 1G38A 3E2MA 1PX0A 3CLRC 1EXDA 3PFFA 1GKYA 4LY0A 4PR0A 2DQYA 5I7WA 3CF4A 2PJUA 4HBZA 4H0FA 3ST7A 4FMCB 1GQYA 3L02A 1BXZA 3N3AC 1R16A 3BQ9A 4HZUA 4L9RA 4F3CA 3KYJB 2GUWA 3D7SA 4HDAA 4C3UA 1HKUA 4BFYA 4DHWA 4E7OA 1VA4A 2H7CA 3VR4H 3WLRA 3DH0A 4L07A 5FYDA 2QNRA 4DR2B 4F3TA 3HZHA 1MAHA 2CMHA 5F64A 4A3SA 5PGMA 2GM4A 3W3ZB 1XZGA 2PPVA 4Y2XA 1VKZA 4ZJYA 3OD1A 4B17A 1VL1A 2Y66A 5L3ZA 4QXOA 1Y9ZA 1Z4IA 2RI1A 1ZMXA 3C8ZA 4ZO4A 1ZD9A 3AONB 3U7QA 2BE9A 2J3DA 3G0DA 4M8KA 3K6RA 3I6BA 2GCIA 2XXJA 2V6FA 1BSVA 2PL5A 4OIMA 4KQHA 1MAUA 2IYPA 3UENA 4CIXA 3R5HA 1P5FA 4PM4A 3VSCA 1VI2A 3WX0A 1LPOA 1F6DA 3L0YA 4PF1A 4RQAA 4F04A 5CH5A 1B6RA 2OZLB 3D6UA 1V5EA 4E33A 1DIGA 2AC7A 4WLFA 3EFOB 3DHEA 2E4YA 3O4HA 1U7ZA 5U1PA 1SBQA 3TBKA 1QYVA 4M86A 3SEQA 5E4FA 4YRKA 3W7AA 4HUQB 2GK4A 5C7LO 1Q11A 1NX9A 3QVGB 1WD7A 4U0KA 3GLVA 4BNMA 3F8WA 1JS1X 2VRCA 4WNAA 1MH1A 4ZQHA 3TNJA 1JA9A 3WGVA 4KMRA 1JIXA 1XQYA 3K71B 1ZR2A 3T3MB 1OHHA 4EVQA 4TRJA 4DUPA 2AZ4A 4UCFA 2GPNA 3LGSA 1U9JA 4C3ZA 2BP7A 3SHOA 4TLAA 3D9QX 4L4ZA 5M5BA 4BBZA 4JMLA 2PDAA 1ETUA 2ZTSA 2TRSB 3BWBA 4JJFA 5JNRA 4I9NA 1XRQA 3DAPA 1DZIA 3AU8A 1OVMA 3A2LA 1H3NA 4MW4A 4MJLA 3VC2A 1NXQA 3HWX1 3BK7A 4HQLA 4UTPA 3T1HB 1ZNXA 3AM3A 4GYKA 3ZJYA 1ZVJA 1BS2A 2IE0A 4ARSA 4Y2SA 3PC8A 4MI3A 3EXHC 2MCFA 3HDVA 1JQ3A 2NU7A 2AQKA 2XVXA 3W2IA 2DLCX 3KXIA 1GCUA 4L0MA 2QRKA 4R3UC 5CIQA 3BC1A 4J03A 4FN5A 1P5ZB 2QMUA 4I4LA 1KP9A 1N8NA 1F8FA 3U17A 1GPDG 1JFTA 2X23A 3DAGA 1Z2EA 3N2IA 1C0IA 1X8XA 2YWHA 5K0BA 4EG6A 4XJXA 1NE2A 1Z33A 4HDNB 3ORYA 1CJUC 3PNYA 1V16B 2VDMB 4B46A 3B1VA 3BK1A 4Z7OB 1L0BA 3LE8A 3PQ6A 1XOIA 2GOYA 4TXMA 2CT8A 2GH1A 3EEBA 5ER6A 5FUYA 1KH2A 1THTA 2JASA 4RJLA 1EM6A 4DZTA 2JCSA 2PZMA 1KI6B 3RS9A 4Y6SA 3UGKA 3ZLVA 3QK7A 2BSXA 1QYDA 3QQ5A 4LHWA 1NOJA 1YJQA 2O0LA 3DUFA 5BVGB 3GUCA 1JQJC 2QG4A 3R0XA 2YJTD 4BRUA 2AEFA 2XIJA 4BJHB 3SKYA 1NGSA 2QVXX 5EUCA 1HG1A 3HSYA 1YZFA 1JG4A 1U80A 4JJKA 1C0EA 1R37A 4Y1RA 2I55A 4M0CA 1LZKA 3M5PA 3UCEA 2AV6A 3W5SA 4OX9B 5IP5A 3PQEA 3HYNA 4HY3A 3WLOA 2IYNA 2H11A 2ZRMA 3U4GA 4IFBA 3QLEA 2EGHA 2PGDA 3E8MA 1OTXA 2ZB7A 3GPBA 4LTNA 5DVZA 3OKPA 3WGOA 3KOMA 1BGWA 1SVNA 4R6WA 5D3KA 3NYRA 3RVSA 2ZYTX 3KU1A 5IK2A 4C0WA 1BU8A 2PKQP 1E20A 2GFIA 1RYHA 2PXAA 2VYCA 3AXTA 3ENKA 3H65A 3I04A 4OOFA 4WD3A 5LMUB 1X8LA 1TMGE 4AU1A 4G01B 3KNZA 2ZETA 3O8QA 5I3ZA 1OX5A 5CH3A 4HTFA 2UAGA 1B43A 4KJZA 1R3DA 3D7KA 3KT6A 4DLRA 3G68A 2PBLA 3B6ZA 5K0EA 3CNEA 1UJ2A 1VCNA 2XCTB 5KKAA 2LE0A 2UV8A 3PFCA 5AI0A 3R7AA 4TKUB 1TUBB 4DM3A 5IZCA 4OQFA 2XUGA 1UBGA 1PEAA 2JIZA 5DM4A 1XLVA 4U5XA 1T10A 2ONCA 5L4NA 1TVMA 3OCJA 2C2WA 1RWXA 4B33A 3IQWA 3PTZA 1OT5A 2Z5VA 5T67A 4B4VA 2O54A 4NBTA 1SXHA 1FUKA 3GDGA 4TZTA 4UHDA 4MVJD 5DP2A 4NS4A 3TIVA 1L5OA 4GKVA 2AB0A 4M36A 4OMCA 4DMRA 1TA4A 2AOUB 1GCGA 4QXQA 2BFBB 2PK3A 3IQDB 3FPKA 1JPNA 4WASA 4KR3A 4B31A 2CL7X 4ZMBA 4M55A 3EGXB 3L07A 4X3PA 4ZIRA 4ZYTA 2CY0A 1G21B 4ZT3A 3UMCA 3WBKA 1YH3A 3P8ZA 5JVDA 2R7KA 3VDQA 2XCRB 4UEQA 5DULA 1L7XA 1T5BA 5BXYA 1ZD4A 2QA5A 1WCIB 2D5IA 3DV2A 3JY6A 4KUHA 4A91A 2DRIA 2PKCA 1D0SA 3EXEB 1M2FA 3DUWA 2ONJA 2R6HA 4S1OA 4F2PA 1EVKA 4UAGA 2EKDA 2E1RA 2P9QA 4TROA 3RVBA 4MPTA 1SKMA 4KE7A 3HCCA 1F38A 2B78A 2W2QA 2GBFA 4F46A 5BN4A 5D3MA 3PF8A 3C41J 2G36A 3UT5B 1OYOA 1Y37A 4X6YA 3WBJA 5LDHA 2J3JA 3KQVA 4J7AA 4UE3S 3G6WA 3AL3A 3OWHA 4JB3A 4CV0A 5CJPA 3WYBA 3U3ZA 3FGNA 3MIIA 2B1IA 1VLLA 1A9PA 2ZZKA 1PQPA 1ZUWA 4WH0A 2C98A 1ZY2A 1ZOSA 1JDJA 1DB3A 4K2AA 1HETA 4BKQA 4QG3A 1L1EA 2F55A 4LYDA 4BQNA 2O52A 2V1XA 2Y99A 1BX1A 2JJQA 3EJWA 1A8HA 3PWKA 4Y2JA 2VPPA 1C4OA 2DSNA 4FBMA 3WNQA 2KI5A 1NLZA 2VCEA 1RYNA 1HLFA 3U19A 2PZAA 5DGIA 2IUFA 4HJRA 1W85B 2IDZA 1OXBB 2DJ5A 5HUJA 3LWDA 4W5NA 1WCV1 4IGFA 1NYQA 4W6ZA 5C9ZA 1I94B 1U0GA 3SMQA 2LXNA 3EQ9A 3F67A 3AKYA 4I6JA 5E9AA 2B1QA 1KMQA 3TSWA 3UWDA 3I92A 2BFOA 1YL5A 4B7ZA 3IQFA 1QP0A 3BKWA 1NVMB 2FG6C 3C6BA 4MOWA 4J0CA 3MGKA 5HUQA 2JIMA 1N5KA 4RLHA 5K2MA 3WYCA 3DKVA 5BUZA 2I1WA 4FK8A 3SWWA 1GZ7A 3P52A 1GA6A 1QX3A 4A6XA 4HRXA 3SS9X 4RKQA 4DWOA 3HUFA 4M37A 3BORA 4L16A 5E2BA 4ISCA 3HV0A 4D6YA 2ZR9A 3C5WP 2C2ZA 4TSRA 1EVQA 2C5GA 3MLAA 2V9CA 3LK6A 3TCKA 3ZBQA 1YQDA 3E7WA 3KQMA 4LY6A 1W34A 1YDFA 4RFSA 5G1NA 3DQPA 1CXZA 1OXSC 3BIOA 2EFGA 3MVEA 4FFBB 4MZXA 4U7WA 5AKIA 2E82A 4EPXA 1TCVA 1RWPA 1IJBA 2VHZA 3T15A 4NJEA 1YBFA 2O3UA 2ZITA 1IZ8A 5ADHA 3CONA 4D9CA 1L7OA 2ESRA 2GXSA 2CMGA 4FYXA 5A3SA 3UCXA 4PLTA 1N3LA 3ZYZA 2O5EA 1T5OA 2O3JA 3CUTA 4BB9A 3UMBA 3Q85A 1QC5A 4I08A 4QPZA 5BN5A 2E18A 4BU0A 4RD4A 2ZE8A 3QKWA 1NAIA 3A6LA 1C1DB 3DTVB 5CR9A 1EP2B 4HATA 4U2EA 4EH1A 4HXFB 1RP7A 1AS2A 2HWUA 1DT3A 1IXSB 2JGDA 5ALGA 3T1NA 1VZ2A 1R6TA 2BUBA 1NNLA 1NASA 2X76A 2XUQA 1G18A 2ABWA 3ESAA 4MVYA 3VH1A 3MSCA 1MVNA 3DOHA 3ZDYB 1BCRA 4FLMA 3DZHA 4HAIA 4YRPA 3FNHA 3MC1A 3GRUA 1RW4A 5DT2A 5IJ9B 2HF2A 3P9SA 4ZAZA 3ZDCA 2R00A 1CW2B 2XE8A 3PUJA 4OLHA 1ECBA 3MJDA 3G6KA 1MABB 3AW8A 3EA0A 4S0ZA 4EMUA 5EIOA 2QZPA 1L5MA 2VDWA 3OOJA 4FLEA 4HGZA 2PVCA 3RKRA 3TCNA 2H2HA 4NF2A 5FT9A 4DSUA 3LPLA 2Y2UA 3SQDA 2PR2A 1Z0FA 4QBKA 2ZPUA 2XITA 5EKDA 5JMOA 4OSOA 2JAXA 3GYGA 1X7ZA 3NTUA 3C3JA 1GD1O 5LP1A 3JATA 3IUSA 4P6VF 2JI8A 1DS6A 2P9ZA 4JP3A 4KRGA 2X40A 2XUOA 3PEVA 1JG7A 2AD1A 1P33A 1QDUA 1NYTA 3PHLA 4TQAA 5CHEA 4ND8A 5CP8A 3V2GA 3WQQA 3H9JA 5IYZB 2HO4A 1HUQA 1N2XA 1GL9B 4HN2A 4OYLA 5HNKA 2Q3JA 1PJ2A 2P2NA 3F2IA 2P0EA 3SHWA 3PLRA 2QP3A 3HEAA 4PX9A 1X77A 3UUEA 4JLSA 1T2NA 4G0OA 3LW8A 1SM4A 4AY2A 4PZZA 4YRAA 1IHDA 3QVSA 4RYLA 3C6YA 2OHHA 2PSEA 1Q57A 2FCRA 4PEVA 4KXLA 3GFTA 2OBLA 1VYHA 4O02B 4P3YA 4P84A 4NH0A 5DYNA 5LZ9A 4FDMA 1V35A 3ORRA 4BBAA 1ONNA 4QDZA 3PKZA 4ZTBA 4TS4A 2FWBA 5JWRA 1A5BB 1Q83A 4J3FA 3K16A 4LF8B 4HFMA 1SGWA 1ZD5A 1RKQA 4CEIA 5CA0A 1B6GA 2PAAA 1UCFA 1CY4A 2V58A 1RPJA 2J48A 3G2IA 2AJ8A 4S1WA 5JJBA 3AEKB 4PGHA 2B5WA 3U3RA 2NV0A 1OFIA 2WJVA 3P9RA 5L3QA 2QTVA 2YY6A 3OTHA 3KCNA 4J7UA 2HUPA 4US1R 4IQGA 4M87A 3OESA 4TKMA 2QNBA 1XJWA 4QJ4A 2UUCB 2C3OA 2PGNA 2YQ5A 4X0EA 4IGIA 1CUYA 2JGEA 5A02A 1HA3A 2BGMA 4GLOA 2R66A 1G5FA 2O06A 1EQAA 3UWKA 1Z6GA 2H9IA 2P77A 2DT8A 2YJ5A 3QOXA 4HPXB 4Q3CA 4QBFA 4AF7A 1PW5A 4C4SA 1A88A 1ZLXA 4IY1A 4DRXA 2D54A 1QWOA 5F3WB 1SQ0A 3MGBA 1KJ8A 1QTQA 1TEVA 2GF2A 3I72A 2XIQA 3WQBA 5KBYA 4FCTA 3QZUA 2HPZA 4YJFA 3ROTA 5TVKA 2ZR7A 1QF9A 1LI7A 2A0KA 3AZOA 3PPWA 5TEVA 3QU7A 3VU9A 4B8ZA 4KX3A 5AVRA 4BQRA 1DFHA 3OUTA 5JPDA 2ERCA 3RSOA 5HKKD 4FWIB 2RHWA 4K2HA 4IHQA 4OHOA 3KXDA 1AUOA 2ZRCA 1OWNA 3JW8A 3OJLA 3WADA 3N5CA 1E79D 1FC0A 1X2EA 4I19A 2BELA 5DI3A 5EHNA 2CNLA 2CNOA 2FEWB 2GXUA 3Q9SA 3ZE1B 4KPYA 1T29A 2WKPA 1V2HE 2RSLA 4Y30A 4WN9A 3HKBA 1F3LA 2HNAA 4V39A 5FI5A 1T36A 2WSIA 4YUZA 4CMIB 3KQSA 4DQLA 2XBMA 4FCWA 1V95A 4POOA 3K72B 2J9FA 1I8TA 3BJRA 1JHUA 2P2SA 1YAHA 2CMDA 3AQ4A 1UC5B 1KI3A 1NT2A 1X9IA 5KYYA 3AL0C 4N5DA 3VVLA 4K9LA 1ZM7A 2H1HA 3ASVA 3MINB 2WF5A 4WPGA 4IO1A 1KYZA 2KYRA 3LFHA 3GMSA 4QOJA 4JP2A 4REQA 2AZMA 1E6WA 2BMEA 4RZHA 1BRMA 1N57A 1FJXA 4RAOA 4U3JA 3IIIA 5IDYA 2Q1SA 4U6SA 3RWBA 1E2NA 5AW3A 1P2TA 1OAKA 2LW7A 4M0DA 2X5XA 1D8AA 2BGWA 4UM8B 5IJZA 4TV9F 1E3MA 1YRLA 1X80B 2PT5A 4NZZA 1XZ8A 4CQLB 3ILYA 3KOYA 2BFMA 1PS9A 1I3CA 3IVMA 1OH6A 3E5RA 2RHOA 1JLSA 2XUKA 3A27A 3DDNA 4QO7A 4O4JF 2PD3A 1YOBA 2A58A 1DQRA 2HTFA 2XTNA 3TPFA 3WQHA 2P4QA 1TJ3A 4OPMA 1Y6QA 2Y1XA 4BBJA 4CNBA 1QRUA 2HQRA 3CSSA 3IRVA 2PE5A 1AKQA 1W6RA 3HBNA 1AY0A 3GGDA 2IU0A 3W9BA 5C2JB 3KPJA 3FWNA 4FTWA 1FDTA 1FDWA 4FZ3A 3MMNA 1YVPA 2UUPA 4CLRA 3QVLA 4DLLA 3COSA 4LXHA 2P67A 3UATA 1Q6YA 2PS9A 3MQFA 1U3VA 3D6HA 4Q0MA 3UYKA 4HC4A 1C3OB 5F3DA 5EJ4A 5GMOA 3R9XA 4QKQA 2ECPA 3K2QA 3QWIA 5LOVA 2CDRA 5F5XA 4EW1A 5AJWA 2DT5A 1W6UA 3RJMA 3HGMA 2ZUBA 1QONA 2WP8J 2I2BA 4NNPA 2QG6A 5FNVB 3FIUA 5DM70 1ACMA 2V4ZA 2PUBA 2QAGB 4BTVA 5E1DA 4WCVA 5FOTA 1OFVA 5EUBA 4JEHA 3FWKA 1JX6A 1PR6A 3ICVA 2PYZA 3KBBA 3WFIA 2VSYA 3CQ9A 1BEZA 1UP7A 3CPEA 5T5QA 3HB9A 2JPDA 3TM4A 1Z7EA 1UPXA 2F17A 5AHOA 4EHNA 4EEZA 4YASA 3TMAA 4JR0A 3BS4A 4Q12A 5FL7A 2A3NA 2C42A 3FGOA 3FWPA 4ML3A 3LO8A 3T0FA 4WLNA 5IJ0B 3ZJ5A 4DLPA 4LBVA 1GNLA 2YWRA 2QP4A 1NWHA 2E85A 3IGFA 3JPWA 3FOCA 3FOBA 3HP1A 1A2KC 2MIIA 3E1GA 2ZRQA 3LUCA 4ZTUB 4ARIA 4EB6B 1YOVB 1CB0A 3GMTA 1NUHA 2O2HA 1BWRA 5J4VA 1XCMA 3F7OA 1YB7A 3RKUA 4DT1A 4NZ9A 3S68A 3M0EA 4YYZA 1ADCA 3AY7A 1T5IA 1CQIB 4NAUA 1NXWA 1FSFA 3FDIA 1OH7A 1BKSB 3DBOB 1RZRD 1L3IA 3WP1B 4WKOA 2R8XA 2XHEA 4JQOA 4WQMA 4CIAA 2JFBA 4MYUA 3R74A 3HJRA 1YUMA 4U7GA 4P3PA 1LLFA 2GZHA 3LHKA 2EZ4A 1WUHS 2I2DA 1NBOA 4NESA 3H5WA 1SJ9A 2IYXA 4I55A 4HRVA 3EARA 4WFJA 4GM0A 4UM9B 3IIJA 2AGVA 1Y89A 2QUZA 4F2GA 4LRYA 3S1AB 2O3RA 3FSEA 3UT0A 1AQJA 3U5ZB 2VBGA 2WVGA 1VLVA 1QUFA 1XRMA 2ZOSA 3O3CA 4YREA 2IUUA 4CM3A 2D8AA 4DCMA 4KG7A 1MGPA 4MYDA 2QRQA 4WOJA 2BR3A 1GG5A 3QI7A 4J1TC 3WJ1A 1PFUA 4EKNB 1SG9A 3JASB 3K0EA 4I9GA 5EJAA 1MJGM 3H4MA 3GRVA 3T7IA 3S2YA 4LHYA 5FPSA 3PG5A 5GGYA 3X44A 5AKXA 3TIFA 1I6WA 2EGUA 1ZNZA 1T9DA 1E9CA 2C0QA 3E3OA 2OO7A 1B14A 2XWJI 5IH3A 4AX8A 5GVRA 4QNMA 1EZZA 3GROA 4WCDA 1VPLA 3AINA 3QWBA 5IKXA 1PSZA 1DCMA 1QGUA 4JC8A 4KE8A 3SNKA 1A2OA 4AZTA 3KSUA 1XBTA 4PNHA 4JLNA 1BWPA 1TM1E 4ZYYA 3IURA 3S4YA 1FS6A 1TIKA 2FP4B 2OBBA 3LLCA 4O29A 2G0TA 3NHFA 2CD7A 4D9BA 3Q0TA 3HDJA 3ZDRA 8ADHA 1P8JA 5TXGA 1ZSYA 3UXEA 1UK8A 3JYLA 1IK4A 3FYHA 2GBGA 2RIPA 4G5SA 4BQQA 3JQ7A 4ECAA 2UKDA 5AJZA 3CBGA 4MQFB 1WQ3A 1Q92A 5E3HA 1VMAA 4N9QA 3QUBA 1ZI6A 1J70A 3R1IA 1W4ZA 4CHTA 1L5KA 4HNSA 4KXWA 3AUSA 3RH0A 2O07A 3W3AD 2P2CA 3ROZA 3WMFA 4Y0AA 4OATA 4JR2A 3VAAA 1W35A 2HWXA 3V1YA 3WR5A 2R6ZA 5F1YA 2X2PA 3WA6A 1WSDA 2EWVA 4BQFA 3QUTA 2XJ9A 4RMJA 4WLOA 1NIPA 4RCYA 1I80A 1SEVA 2NZJA 3JRNA 4NX2A 3IKMB 3LFUA 4RPIA 4MRMB 5BW6B 3TD6A 4EFDA 5BWLA 1L9KA 1T2UA 1W1WA 3CPJB 4OLBA 3PVSA 1F12A 4K8RB 4RWZA 6REQB 2BBOA 2D62A 4H6PA 3UAWA 1Y3AA 2VTKA 1QCYA 3WNBA 4D56A 1YA6A 1CY1A 1U0LA 3GDHA 3MZ0A 3TL3A 3A6PC 5EIHA 3G8YA 1HLPA 2Q7DA 1N6IA 1LBQA 3DLAA 2G0NA 1GUBA 5AJUA 1LNSA 4EGSA 4WK6A 2AFHB 2WIBA 3HR7A 2WVHA 4MQUA 2NP6A 1A04A 5I7OA 1SC1A 4QOIA 4KHPB 1AZWA 1QR2A 4AJIA 2CBGA 3NOQA 1DCKA 4F6RB 3LY9A 2LVBA 5LQRA 4A6PA 1TLLA 1US8B 3RTBA 2IOFA 2ZATA 4AJJA 4F6LA 1CFJA 3ZHUA 2QD5A 1PEKE 4AKTA 3ZGOA 2PUGA 1IONA 1ZI9A 4F12A 4XAQA 3PGXA 3GMIA 5IT5A 1EFAA 4N6NA 1GDTA 1Z0JA 3B12A 5TMPA 4ES6A 1X13A 4P80A 4IDEA 4TVBA 3QEMA 2GBLA 4Y0NA 3TL2A 5C3MA 4URZR 4UEKA 1H6CA 3TMYA 1E6CA 1UZMA 2IVFA 1K98A 4ZOBA 2WHYA 3F3YA 1O9BA 1R8JA 3NBKA 5L7WA 3C6ZA 3L5OA 2YZNA 1G4AE 5CG2A 3MT8A 5BUCA 4F06A 5C1BA 1KZ4A 3ADKA 2DVMA 4BAUA 1OF1A 5IKPA 4M9XA 3LO5A 5PNTA 3V5NA 2B4AA 1UWVA 2HA4A 2Z2IA 4XIIA 3ROPA 3TXAA 4DN6A 3GJYA 1F8GA 5JJKA 3TR0A 1VBNA 2XCIA 1D03A 3QG5A 5J5AA 2V0NA 1SWVA 4I4CA 2UUAB 4TXJA 3TX2A 4KQMA 1MPTA 1FQWA 2Q2WA 3IEIA 2G4CA 1S2MA 2V9PA 3DDZX 1J97A 2RHLA 3QIVA 2CCGA 3TXXA 2L2QA 4INAA 4PAGA 5HRCA 4QUAA 5KYVA 4L8WB 3DV0B 5IEJA 3G02A 1KKMA 1L4FA 1N6PA 1I4EB 1IXRC 3BM5A 5EXDA 2BISA 3I37X 4HX9A 3U31A 4B4OA 5L4SA 1MO6A 3LQ1A 1KVTA 2C5FA 4CMBA 4D25A 3TTTA 4AQ7A 2E87A 5FNVF 3AJEA 3PC7A 2OZLA 3RLIA 3MD0A 3ME5A 3B13B 2VPQA 5AMXA 4TSFD 3KTAB 4XWYA 1NN0A 3EFOA 3KEOA 3LT1A 4NKRA 1OXVA 1NPYA 2D1YA 2JEZA 2OMEA 4L1KA 1GQRA 1LWNA 2WJHA 3EIFA 3OTIA 2WT4A 3DTTA 3AR4A 1Y1RA 1RYYA 5JARA 3DZKA 1DC5A 2WWVD 3ONNA 2HLDD 1ML3A 5DN6D 3NIWA 1M1YE 2QGNA 3DW3X 3ZJTA 1D6SA 3BXZA 1J1IA 3OIYA 3LT2A 3NBMA 1KH3A 1PK7A 4EY6A 2JS7A 4L5IA 1J4AA 4WKCA 4GX5A 4CTNA 5CA1B 1IPEA 1S02A 1BX3A 3BDAA 2GHTA 2ZTMA 5G1OA 5IANA 5KVSA 3TUZC 1EWVA 1FFAA 2ONYA 4YRNA 4J0EA 4G1UC 3ADOA 3U49A 1HEYA 1NUQA 2H9AA 4QQKA 4MS3B 2VJPA 3QF7A 1VIYA 4K6HA 2GK6A 1OXUA 3A4MA 1N4AA 1G5PA 3WLSA 1QIMA 1TU4A 2PPLA 3IBCA 4HHEA 4OGGA 1E1KA 1Y3IA 4NPAA 4ZDKA 1L5LA 3X1ZA 5D7BA 2I87A 5JOQA 3B3AA 3BFJA 1MXFA 3E61A 4JBHA 4BE9A 3BE6A 1CX9B 4NQZA 4EW6A 3KXPA 4YR7A 4Q9HA 1VSUA 4LJLA 1YCDA 3B6EA 1P7ZA 1S2NA 2FMUA 4HDNA 2GETA 3KQKA 1A27A 1V16A 3L1UA 4B6PA 4PYRA 3WNVA 4OP3A 2OBNA 5CXUA 1QQBA 1YL7A 1I6LA 2GLUA 4L5YA 1QYXA 3W8DA 1YQEA 5IWAB 3M8KA 4GLJA 3KR2A 1RTTA 5KTTA 1A9TA 2O6LA 3TFOA 1KZGB 3IKTA 4QECA 4DBLC 5MN6A 4DQKA 3R7NA 2JLSA 3SBXA 9MHTA 1E2EA 4HG2A 5F2KA 5BVGA 4Y8VA 3P0IA 4UE6A 2YRFA 3R7WB 4D6XA 1H2ZA 4URVR 3FTCA 3SJUA 2PZBA 1EB9A 2EYUA 1T2EA 2ZBGA 1M6WA 3DBLB 3EIHA 3JQGB 4RGYA 1EE9A 2PUCA 3E3LA 2JFWA 3N7AA 4O3FA 2ZYGA 2IYZA 2FX5A 4LC1A 4ALMA 3EEYA 1B7GO 1G0NA 1NWCA 1GUFA 1SNYA 2Y0CA 3SIXA 1YDHA 4R7GA 1HE1C 5EKSA 3HNPA 4NPHA 4E4YA 1LPSA 1TJ4A 2DMRA 3AOEC 5BOVA 3WZ2A 2X3UA 1A7KA 2BT4A 4RA9B 3BZWA 3BWEA 2QLTA 1ZHOA 5C5DA 1HT0A 4LJKA 1MD9A 3EPRA 3VZCA 3GEMA 1PV4A 2H1IA 1YB5A 2I6GA 3O7MA 4K9OA 3F5DA 4LYYA 5JCJD 2QJOA 1NG1A 1IK6A 2P90A 4D99A 2CBZA 2NM0A 3Q7QA 1UC8A 3NC4A 4PC7A 4Q82A 3VNAA 3EQ7A 3G17A 5COQA 3E82A 4QT0A 5FV7A 4QODA 5EQTA 1JWLA 1K7EB 1YZLA 4HNGA 4ID3A 4G2NA 4TKUA 2YWBA 2H0QA 4FKZA 4DIKA 3F4LA 1P17A 3EZ9A 4B3IA 1P4GA 5E6RB 4HNAB 4N8DA 1XRSB 5DTIA 3TLJA 3WYNA 1E2JA 2PZGA 4FZ5A 2JHGA 1E6LA 3D6MA 1R0YA 4IHJB 3QE2A 4JH0A 2ZSFA 4KQIA 4RH1A 3I1JA 1USVA 5DMXA 5E4JA 1PVVA 1GT6A 1H5NA 1QK4A 2NIPA 3DE1X 1IHUA 4CKWA 2BFBA 1NXOA 4HDRB 3EGXA 2IOFK 1G21A 4EJ2A 5G40A 2FZVA 2QAIA 3O1JC 5BT8A 3ZZ0A 4F1KA 1QGAA 2Q7XA 4CN9A 1WCIA 3FJ1A 1XTRA 3MELA 2OOSA 3EXEA 4R1MA 1NHGA 3CVYA 3RT7A 1X15A 4R8KA 1ORTA 4UM7A 3PQ7A 5FPYA 1J9EA 3UVEA 3SQWA 1HPLA 1FNSA 4ZVTA 2E2WA 1OCEA 2EL7A 2VWQA 3B60A 3L6BA 4R1UA 4MW2A 3BL6A 1Y7TA 2TMDA 3WOHA 3TLXA 5KTPA 2B8NA 3N9IA 5JYEA 3NV9A 4LV6A 3OD5A 2IP2A 5FA5A 3JR3A 3K73O 3OZEA 4DYHA 2I8LA 2BAGA 4WBXC 2K2QB 2QUAA 1GZ5A 2GZSA 3R7LA 3H2YA 4F9GA 1EDOA 4Q1EA 5KNDH 1K89A 2GMWA 3A70A 4YDRA 4GPAA 2JHAA 2P4HX 2UVPB 1SXIA 1HYBA 3L6OO 2P9GA 2XUPA 4ZRMA 1W85A 2EJBA 3ROKA 3THOA 3TZKA 2IWHA 3RC1A 3V8MA 3K1ZA 1K7FB 5DW3A 2AF3C 2FW6A 2NYUA 3F7MA 3K1AB 4NR0A 1I6KA 4NBNA 4BMPB 1IN8A 1JJVA 3MPUA 1O94A 2H92A 4EW2A 4HWPA 2NNWB 1ZXXA 2FOLA 3KYDB 3RRZA 4DR5B 2NO5A 1I7DA 4CQMD 1PDWA 4JK3A 5IVPA 1QJ4A 4MJ3A 1E9BA 4IIUA 5D5HA 4YAUA 1XQXA 1BJKA 1T2AA 2E0IA 1KKUA 1UODA 1H6DA 4DARA 2VUSA 2D2VA 1FB5A 2ATIA 4P53A 2I4IA 3UK6A 4O4HB 4JJ4A 4BLVA 3PXUA 2C8JA 1BA3A 2Y1GA 5EJMA 1YI0A 4RVUA 4CTOA 5CAEA 5I7UA 5LR6A 1XK7A 2H5LA 4MB2A 4KGZA 2OBMA 4CMJA 1MW9X 2ZS8A 4IGAA 1U7TA 3HN7A 4I8DA 2WUGA 2ZM6B 3GLGE 2FMHA 2B8JA 2ZJAA 1L5ZA 2LDXA 2PX2A 5BSWA 1PHRA 2YZGA 5K20A 2JHFA 4YUAA 4B73A 4JELA 4IP0A 4Y98A 1OZHA 4BWGA 4YJ2B 2Y0PA 3HV2A 7GPBA 1KEWA 3W5VA 3LCUA 1GGVA 3N76A 4QPJC 2WMOB 2JA1A 2WM9B 4WK0B 1C1DA 3L0IB 3DTVA 3BSSA 2EP7A 3AW9A 1O6BA 4ZU6X 4UVEA 1KNQA 5JS2A 4E0BA 1KERA 1KAQA 3GG2A 4P7FA 3GGJA 1XZDA 1M8JA 1L5SA 3FGZA 2YV3A 3OMWA 3CRQA 1DQYA 4G1MB 1RC0A 3PJDA 3K4PA 3OCVA 1J90A 5JJ5A 3SQXA 1M2WA 1P9WA 3HCEA 5IJ9A 2W2MA 4ZO6A 4ABTA 3NGXA 3EA4A 1MABA 4RPHA 2JLXA 3QLVC 3AEZA 4MQLA 3KPYA 3AESB 1JILA 4QO8A 1ZHHA 2RAPA 1OKKD 5TPWB 4NCBA 3R9WA 2O8BB 1WAMA 2OBXA 1ID1A 3E84A 4ZYZA 4EBFA 2FRXA 3FG9A 3NX4A 3G5UA 1GL6A 4FQ7A 1BKDR 3PDUA 2A1TS 1R0LA 5EXTA 2R8ZA 1IB0A 3JXEA 4DSOA 5JC8A 1ZL0A 1XMJA 3LHSA 5AK4A 1FXSA 3KSAC 4TKLA 2PLAA 4B4WA 4C08A 1SVSA 3ICPA 2W2KA 1L8AA 3CZAA 5IYZA 3QFSA 4G1VA 4HD8A 1G2IA 3KUKA 4M88A 4DMUB 3AU9A 5EJ7A 1CKEA 4M7OA 3NFYA 2LRHA 4FFNA 3NAMA 5LLSA 4ARCA 4MWGA 3VHLB 1S01A 4P98A 3V34A 5GINE 2NXWA 1T1SA 4D41A 2VDKB 3CT6A 4B2IA 2PBFA 4JFAA 3ELUA 2P5UA 2VBCA 4K6KA 1E6UA 3A6FA 1VBFA 3AEYA 2VT6A 4G4SP 4WEOA 3JCZA 3OPQA 5EQFA 5FADA 2W6IA 2X7XA 2DSTA 5IX8A 5CMLA 1ZGGA 5HIIA 2WIDA 5TEWA 4XUGB 1WIWA 4MUIA 2W4MA 5E1BA 1PNTA 2CDBA 3CNLA 3W3AH 1DQNA 1UOOA 2W48A 2JLVA 1JYEA 3X2SA 3DE5X 4NVRA 3ZHRA 2CLIB 4X1IB 2FMKA 4A73A 4KO3S 3TZLA 1JG6A 2VHCA 5DNWA 4NCKA 4A1FA 3TYXA 2AJDA 2VZEA 1JVSA 2VT2A 3AEKA 4G5RA 4JLMA 5DHPA 1XALA 4XEUA 3D43A 1AUQA 3DYVA 1D3AA 5H83A 1V26A 2OCAA 1M2GA 2SKDA 1N2HA 2EKBA 2LPMA 1B0AA 1NZDA 4LXGA 1Z68A 5CNJA 4RTJA 1NNEA 1DIAA 4QATA 4YXWD 4PGMA 2XUFA 3P9ZA 5AESA 1P2SA 5JSUA 3MS2A 5F12A 1ML4A 2ZWMA 1T9GS 3NWJA 1U2TA 2WSSD 1L5VA 2HOQA 2R8YA 2EJWA 4FX2A 5A4IS 1OH5A 3KZXA 2YIMA 3AUKA 2JAWA 1LPAB 4BLQA 5JAZA 5HQTA 3W5CA 4AKIA 4DNOA 4OHRA 3ER6A 1YS9A 1NN1A 4IUYA 2OAEA 3L8HA 4X62B 4OKIA 3F97A 5F5NA 4IHJF 2DF8A 1PHPA 2YHUA 4KQWA 1FU8A 4PHHA 4Y2PA 2JFZA 1V8BA 121PA 4GI3A 4KLRA 4AZ3B 4DCJA 3HVJA 5HZMA 3KAKA 3FB1A 2Q0XA 2EZUA 2HSWA 3SM3A 4B09A 3S2UA 1FPMA 4BWYA 3IKJA 2CL6X 2Y92A 2P41A 2VJOA 3ETHA 2GAJA 2XE7A 3I2JA 3OEYA 4LWPA 3C3YA 1N5MA 1CETA 3ESBA 1D2MA 2Q5FA 3AGPA 4OQPA 4DCPA 3FMPB 2V4MA 3IP9A 1LLDA 1NI3A 4ETWA 3WE7A 2FPLA 3FA2A 3ODGA 4MGKR 4F8EA 3UJDA 1GUAA 4AKEA 4BCCA 3QE4A 1PW7A 1GRQA 2FOIA 3LVBA 1CY7A 1TXGA 5ESXA 1XCBA 3M4YA 4CMIA 3CNQS 5A9RA 3P4YA 4AWAA 1PQWA 2VT3A 1Y3HA 4TL8A 3ADCA 1PS0A 1AZTA 3QLUA 1QOQB 3BE8A 4BRWA 2WYVA 5LYJB 3PL5A 4FFMA 1Z8NA 2ACKA 2C29D 4WE3A 5HBRA 3CR7A 4JI3B 3MINA 2XF2A 2VQFB 2XCQA 1C1XB 5E7QA 5K6RA 2P9TA 4RVSA 1E2QA 5BW4A 2VK2A 3QPBA 3WLEA 4FJ0A 1Y1KE 1CU1A 4IX1A 2Q7OE 3V7UA 4FOPA 2PEZA 3DDUA 4DBLE 5FEUA 3DR5A 4RIHA 3GA7A 3WK8A 3QFTA 2CXTA 1IB6A 1RVV1 1U2GA 4Y9UA 4KQ6A 1W4CA 3RVLA 2IXDA 1R18A 5FEMA 2RHMA 3QLTA 1Q0TA 3AY3A 4G5OA 3G59A 1BO6A 1QP8A 1X80A 2MR5A 4PFSA 1G5QA 1WKVA 2E49A 3CB4A 3FZNA 5E0KB 4CQLA 1J0DA 5LZ4A 3GD7A 4IF6A 3E7FA 5FFNA 5I01A 2J85A 3HXPA 1EFLA 2Y6VA 3H9BA 3QHAA 2ZT7A 2B20A 3RKSA 4QQ8A 4HOYA 1VM6A 3NWOA 1A77A 4Z0HO 1K0FA 1GILA 3KB2A 4MVJE 3WIEA 1WNFA 1RU3A 1YD7A 2OVBA 3P27A 3M1IA 1N0IA 2OL4A 2I8AA 3DLCA 4QDXA 1C3OA 3B70A 3I64A 4UXJA 4R8RA 1XAHA 1U2SA 4A27A 5CCBA 1PR5A 4LXYA 3T99A 2Z1NA 4EP1A 1YONA 4HNHA 4MR7B 4CCAA 4M4SA 2E6UX 3L82B 1NJ8A 2IX9A 3QIAA 4ZDWA 5A06A 3UTDA 4RK7A 5ICMA 1UJBA 2QAGA 5AP9A 1JDBC 3SGLA 2IHNA 3G7UA 4WZBB 3SOZA 3GBVA 4K6CA 2HFKA 1ID8A 4D0RA 1D6NA 1PEDA 1GN8A 2XRMA 4GZLA 5C51B 5GADl 2DXIA 5CIWA 4PG6A 3W0LB 1WPRA 3S29A 1UBJS 5IJ0A 1J42A 1FXWF 3U9LA 2GNAA 4ID9A 1VCMA 2WFAA 1J20A 5I8ZA 2B2CA 1N5IA 1VPTA 1HNZB 4EB6A 1CR4A 2D13A 2W22A 2ODWA 1SCBA 4DY6A 4HVCA 1AKUA 1XYVA 4TMVA 2C0CA 1Q1ZA 3LU1A 3W34A 4RW0A 1N6OA 2CYAA 2A84A 1AO3A 2JKVA 3OCZA 1CQIA 3KPUA 4YO8A 4EDHA 4ARZB 4LV8B 3CEJA 3NW9A 2VAWA 4IXNA 3QVXA 2BI4A 4YV0A 1P9NA 3LQRA 3WB1A 4C0SA 1TPYA 4PHFA 2Y4NA 4JV5B 1FDVA 2EDCA 2G5TA 1RMYA 1PT9A 2QQEA 2QENA 1WU7A 1EM8B 2JFQA 2O1WA 2QD1A 4GKBA 4MMZB 4MUGA 5GZ6A 4JA2A 4DUGD 1E0JA 3QEAZ 2CJFA 3KR9A 3NPMA 1I0ZA 4B34A 3U44B 3AFMA 4OM7A 3R7FA 3F73A 1XCOA 2PYDA 3AEUB 3HDHA 3A3YA 4QUHA 1E3TA 2WP0A 2M6SA 2P1DA 5SZIA 3S1AA 4BKRA 5F9FA 2WHEA 3I23A 1V48A 4UTOA 3RIGA 4MH0R 3PFWO 1WE2A 3RFVA 2VDNB 2AMJA 3GNTA 4KSCA 2XMPA 2B61A 3U7EB 2A78A 4RD2A 1THGA 3PHCA 1NJ2A 4RPKA 4LX0A 1WMEA 4IDGA 4B32A 5BWMA 4GL2A 3IR5A 4Q18A 1W75A 2IUYA 5I48A 1XZPA 2VHYA 1P61B 3GAZA 4G67A 5B1SA 2P0AA 3KV1A 4PYQA 3SXUB 4CDMA 1WHSB 1Y0BA 3R8CA 3ANTA 3JASA 2FTKE 2CXUA 2Q21A 2XX3A 3PYXA 3W1EA 4AS1A 2IQIA 1GFSA 3DEHA 2ZTLA 1P1FA 3GFRA 1A96A 3PIRA 4A8HA 2GK3A 2R47A 5ALIA 1TZKA 3WGMA 1SUBA 2R8OA 3PEEA 3MCZA 1E18A 4BZXA 2IT1A 5ALXA 4WESB 5EN4A 2GM5A 2PA0A 1KSGA 5HJ7A 1WXDA 3CLTD 5JZSA 4H7KA 2PZ8A 1SULA 4R5HA 5HE8A 2OXFA 2C9DA 1QV7A 4PRLA 1YMVA 5B58T 3T4XA 4EZIA 2A7XA 4XA8A 4PRKA 3TCXB 3EF3A 1W36B 2FP4A 1SIBE 2G9RA 2P6UA 5HUHA 1MAVA 3H0CA 1DDGA 4D9FA 5JD5A 4QDUA 4RXMA 3HADA 2RIRA 1KYIA 1SPXA 2CD9A 5FWNA 3ZWPA 1FSZA 1U4NA 1E7WA 4MQFA 5DHFA 1MX9A 3ZXYA 1XLTA 4DBZA 3OURA 3RSGA 1QH9A 5H3HA 3SQMA 2PUWA 3F3KA 2JCVA 2OD9A 3IODA 4AJLA 4CM7A 1N2OA 4JLVA 4OXIA 3THYB 2HQOA 1P9RA 2C4MA 4I1IA 4V1CI 5IAOA 1K7XB 1G2QA 2NZVG 3OCUA 3A4IA 4NWIA 1CZUA 4LUCA 4UVGA 1W52X 4YRRA 4QLBA 4J3NA 1Z2CA 4HH4A 4LCBA 3IO3A 3VH4A 3KB8A 4DQVA 4YJ3A 3IXLA 1DNPA 3I2FA 2F62A 1PNVA 3E8SA 3BQNB 4ON9A 2QZSA 4MRMA 4CMEA 3W5DA 1PYDA 2ZRBA 1OGYA 4HX2A 2QBYB 5HHTA 1UJ6A 3ONFA 1E77A 2L42A 1KBOA 1IQPA 1JJIA 6REQA 4HDMB 4QPPA 1XB2A 2A0UA 1TJ5A 1U2EA 2MOKA 3BB3A 2UUBB 2WUDA 4LKOA 4WOPA 1CS4C 4ZI2A 1FFEA 1LDYA 1SHLA 4PTYA 4JL6A 2B5OA 3DWFA 4RQBA 1G6Q1 2VP9A 5EFOA 4ZVKA 4I7EA 1G1MA 3D0KA 4EA9A 3UPTA 2AFHA 2ZE5A 5IASA 1TTTA 1CJVC 1NRWA 4C88A 4BVEA 3LP5A 2K4MA 4IXTA 4JC5A 3L6DA 1NDHA 4ND1A 1XDDA 1FDRA 3HRKA 4DW8A 2Q5QA 3BGIA 4F6RA 1NP3A 1Y4ZA 1SXJD 1SZCA 3IVCA 1US8A 4C4OA 4CYMA 2W2NA 1R0RE 2BGNA 3I45A 3K5PA 3PD7A 4JBWA 3VKUA 2H85A 5E9JA 4DXHA 5K6AA 2ASVA 4NFLA 5AHWA 5LUBA 4A36A 3VJRA 4OMDA 4BKOA 5LWHA 5EIXA 2PX8A 5BV7A 2JVIA 2VO1A 4GSLA 3H2SA 4RHUA 2YINC 2Q5LA 1FNBA 4QVIA 4RQUA 4YLYA 1T13A 1YJ5A 1NFQA 3JYNA 3FLEA 2BCEA 1GGEA 4BFCA 2XOXA 4HLCA 2Z08A 4R3NA 4TL6A 3SCZA 1OFHA 2JCXA 5LQMA 2C5SA 4KXMA 1XJCA 4MAMA 4WFIA 3T61A 2IH5A 4JLAA 5GONB 3IB6A 3U37A 3L93A 1E89A 4Q4AB 2PZEA 3ENZA 3LUKA 3UG7A 1E2GA 3TQHA 4OK3A 1GHTA 2EC5A 3T9EA 1GRCA 1NI4B 1Z35A 1TYAE 1CNEA 1M83A 4HLNA 3T95A 1O0CA 4EY3A 4NU0A 2YWXA 2FR8C 5DFAA 4JVNA 4NJMB 4EUSA 5ENZA 4Y6RA 1I10A 1RZVA 2Y1LA 3HEMA 4NS1A 2YVUA 4CDNA 2HDHA 3G2QA 1SUAA 1D2HA 2GN4A 3UTCA 4C1NA 3PGMA 1WCWA 5EE9A 4IDPA 4QGAA 1P5RA 2PKWA 4LZOA 5AM4A 4EELA 1YQGA 2ZWAA 2JG3A 1CRQA 5LP6C 1YJCA 1RYMA 3DV0A 1IG3A 1F4VA 3HR4A 1T5DX 2NZXA 4Y2HA 3PA6A 4V38A 4ER7A 1FTYA 1NVVR 5JNWA 2G1PA 4TTSA 3D4BA 4M76B 1B16A 3F74A 4K9MA 2ZU0C 1PGQA 3N7TA 1FVFA 1KEEB 4HSEA 3HUUA 4NIMA 3EXHA 5JXJA 4G8BA 1J2TA 1Z38A 2Q27A 3KTAA 1WB6A 4TZKA 3ZR4B 4AROA 2PU5A 2WYOA 2PS0A 3CMCO 4I0WB 2JLAA 3HBFA 3GZJA 1A2BA 1GSOA 4NFSA 2J5XA 1JMKC 3E4CA 4N18A 3C4QA 1DIRA 3AI2A 4C2TA 4FXPA 3SZUA 1WTCA 2IXEA 3KUDA 4XPIB 4UDXX 3T3DA 4EATA 3VPCA 1OTYA 1G4HA 3QEBZ 2OWEA 2JAPA 3OCYA 1HTBA 3B9BA 3S7TA 3TOXA 1Y4SA 2RGYA 3C3EA 4DV2B 3B3FA 4MDFA 2WPDA 4OQQA 4B40A 1Y5NA 1FVHA 3IVXA 4RD1A 5FQNA 4P4SB 5DWDA 4N0DA 3VNRA 3WQSB 4AJHA 2WSMA 1DMSA 2QMQA 5CA1A 2EATA 2YHBA 3L8EA 4BLRA 4REMA 1RHQA 4FYMA 1BGVA 1M8KA 1S3GA 1Z25A 4LF5B 3KPWA 3KKMA 1EVJA 2GFQA 3JWJA 4QBIA 5COAA 1PAUA 1RRVA 5DDIP 5FR2A 1UKVY 3WLPA 1UEJA 4MB0A 4MS3A 5D51S 1U5CA 1XN4A 1C3XA 2YASA 3UEOA 4XLZA 1BVHA 1THZA 3VR6D 1LQTA 4MW1A 1AKEA 3FCCA 3GIDA 3EZXA 2G8LA 4EGQA 1UMCB 4IDQA 3K2EA 3I6YA 3GD5A 5CITA 2G88A 4KNWA 2HU2A 4NAHA 2F00A 2RCNA 2XRFA 4IJ6A 1Z15A 1GQFA 1KO4A 1TX4B 1E96A 1JR3D 4TWZA 3D54D 1KOFA 4HLQB 3ICQB 2H48A 2NTEA 4PQFA 3PK0A 3S6JA 1T4DA 2FN4A 2CJPA 3R41A 4L78A 2OHIA 1MOQA 1RWWA 1IOWA 2DX7A 3EW9A 3QKRB 3VSEA 3IBTA 1H4QA 1QF6A 5KDOA 3D3JA 3PQ3A 2ZJ6A 1WXFA 1N6RA 2CNWA 2O2ZA 1TC2A 2OFWA 4RD0A 3K0CC 2RG1A 3Q0IA 3T7CA 3IEVA 1GQOA 1VA5A 2AMLA 1GYRA 1HTWA 2UZ1A 4LECA 4W5HA 2PRYA 3AR5A 4CTMA 3BB1A 2NVBA 2MSLA 4QQFA 3CG4A 2YXEA 3H42B 1W0KA 1HMPA 3PICA 3R7WA 4XB1A 4QNNA 3ZX5A 4GPD1 4EKYA 3BHJA 4WXMA 2OXIA 5K99A 3PTAA 1P0FA 3DBLA 4Q7JB 3DBVO 1T3LA 2WFLB 2PUHA 3ASZA 4BQSA 1P6QA 1M0SA 4GMHA 4A7PA 3FNIA 1ZDMA 3HVKA 4C0LA 3BUSA 1M6YA 4QASA 1N1GA 2FWAA 4RA9A 2D2FA 3F5MA 1RLIA 1C8LA 1UDXA 3MB8A 4GYJA 4N5MA 2G7MC 2JNWA 3CX6A 4DA6A 3T3EA 3FNQA 1PFGA 1C9YA 2WWWA 2X3FA 3M6WA 1ZK2A 5A4MS 2Q45A 4C0QC 2AZXA 2GSWA 1LC0A 3M6LA 4TT3A 1RAAA 2PNFA 4U2KA 3DG9A 1EAMA 4KXVA 1KAOA 1UDWA 1YACA 4QUBA 4Z99A 3RU7A 3W5BA 4O2BF 3VVCA 2KQUA 2CL0X 1LK0A 2GF0A 1RIIA 3GR6A 5JMTA 5MFPA 2X0IA 3MNFA 4YRDA 1G7TA 1VHDA 4OBWA 4DC0A 2JIQA 5B3JA 2I7XA 5ICFA 4P3KA 3O2NA 5EZYF 5NLLA 5JNSA 4G0ZA 4RLSA 2TSYB 2JIPA 2OORC 2PGJA 5B58C 4L6IA 2JHPA 2C4TA 2YYZA 3AR8A 2QVBA 3NT5A 3NFRA 1N3IA 1KVQA 4LYFA 4HNAA 1I4TD 1IFXA 4IIJF 5E6RA 3TR5A 3S2FA 1JQLB 2VYND 2VUTA 5DBEX 2IYRA 4I8IA 1BKYA 2Q2OA 3IMEA 4JZYA 3FUUA 3HXLA 1KOLA 3VR4A 4JAVC 2HKIA 4L9WA 1IAVA 1P8AA 4I5EA 3TZCA 1Z29A 2DQZA 3OH8A 1BRTA 2J30A 4PPGA 2Q62A 5AJXA 1GVNB 1JMVA 1KPGA 3BFVA 4N01A 5HKLA 5C4MA 1M75A 4HDRA 3KT8A 5ENDA 4PFQA 1ZIDA 5JALA 5JNUA 3NAGA 5TSDA 1EGQA 5HK9A 1SC4A 3NBQA 2C4HA 4HNVA 1WNTA 5JNLA 1T6BY 5JJCA 4YHHB 3AR6A 2K7FA 5CB4B 4X6XA 1ODCA 4CMGA 1OBVA 1XTJA 3IE0A 2I71A 2FN9A 4XX1A 2CVHA 4RPLA 1YFLA 5LUAA 3DJFA 3OQIB 1U0FA 1XF9A 3NDPA 3E4DA 4L3WA 4L76A 1C41A 3RC3A 2J5QA 1GM5A 1CTQA 3G3EA 4Q9DA 2AN3A 1EFPB 4BV3A 1X38A 2ERXA 1QLJA 1ZKDA 2BZ0A 5SZHB 1Z36A 2W93A 1WPXA 2ZAYA 3IAEA 4UDOA 3RSSA 3IFSA 1NQXA 3B48A 3QPWA 4GXQA 5FBHA 4P5EA 4UNIA 2VBFA 4J0GA 5DTEA 5KJCA 2R6GA 1I7QB 3FOAA 4O2AF 4G0QA 3FPHA 4G07A 5KJEA 3CA8A 1ELOA 4FM9A 1NN3A 2HA6A 4PN3A 4MHTA 2IPLA 3L4BC 4GNRA 4JXKA 4W1QA 1QV9A 3W4JA 3ZZTA 5IRCD 5JRZA 1B8OA 1HK7A 1ORRA 5LC1A 4B74A 3LX8A 1FFCA 2WZDA 4PYNA 4WBSA 1EUQA 3V3TA 4YRCA 3K1AA 1JEDA 4HEHA 3RFXA 2Z09A 4YDHB 2VJAA 3UHPA 1XXHB 1OI3A 1NP6A 3FHLA 3URKA 3T1QA 3KYDA 4E5NA 2I3ZA 2DULA 3EXG1 5JJIA 3D7RA 1DEKA 3WKBA 3DMRA 1DJQA 1VHLA 2PQ0A 3NKVA 4EI7A 2H7VA 3NT4A 3ZVKA 2DHDA 2X1VA 3CGGA 1JRLA 1W5TA 5H8WA 3NHMA 1LVGA 4NU8X 3NAZA 3PI7A 4FP9A 3RS2A 1ODFA 4B6GA 4EZEA 1Q0UA 5GM2A 1J2RA 3RJ5A 3PYMA