3QQPA

Crystal structure of 11beta-hydroxysteroid dehydrogenase 1 (11b-hsd1) in complex with urea inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
270
structure length
270
Chain Sequence
QQPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Pyrrolidine-pyrazole ureas as potent and selective inhibitors of 11beta-hydroxysteroid-dehydrogenase type 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 270
sequence length 270
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qqpA00
1A27A 1I8TA 1U3VA 1HSZA 4J1QA 4TVBA 5G0SA 5L7TA 5CG1A 1BXGB 4QX6A 4P22A 1ZK3A 1BTOA 3D4PA 3S2EA 3NJ4A 2I66A 3CSDA 4J3FA 5CPBA 3JQGB 4RV9A 1ULUA 1LQUA 2NQ8A 3QP9A 3VTFA 2D4AA 3IJRA 4YRDA 4BGEA 3PEFA 1I3MA 5EQFA 5U4QA 1DFGA 3DOOA 1Z7BA 1ZXBA 3C7CB 1NFRA 1P31A 2GN9A 4CLHA 4AJ2A 1DAOA 3MJTA 3UN1A 5JLAA 3CMMA 1YB1A 4XQEA 3ZW9A 4DREA 4Y8VA 3ORFA 2IRWA 5ENDA 3WGTA 4FOSA 2Q1TA 3OJFA 4HX5A 4ILKA 1WDMA 1OAAA 5F5NA 3RC1A 4PG8A 3RUDA 5B4VA 4E21A 3PHLA 3QV1A 3U49A 5JO9A 3VC7A 2FMUA 2VNAA 3H9QA 5GZ3A 1R6DA 4GLLA 4GMGA 3QWBA 4CV0A 4BQPA 3PP8A 4XEHA 3TZQA 1Y9AA 5JAZA 3WBBA 4UVHA 5JAMA 1QYWA 3SBOA 4OSOA 1V9LA 3ETGA 4R54A 2IZ1A 3AOEC 5JS6A 4IZHA 1CQIA 4YJHB 2VRCD 4JX8A 5DT9A 4HXYA 5ES3A 2YUTA 3R6DA 5L53A 3D3EA 1RYEA 2GF2A 5TNXA 1ONNA 4BV8A 1NPTO 1I0ZA 3KYBA 3ZGYA 4GX0A 1ZKMA 2GZ1A 3PK0A 2O4CA 3QVTA 1T2CA 1PX0A 2DKNA 2B4RO 5DP2A 4PRLA 2YDXA 3VPFA 1BDBA 1EFKA 5IJZA 3H9UA 3QWIA 5FFFA 2P2SA 3EUWA 2PNFA 2NTVA 3MTGA 3JYPA 3GG2A 4U8GA 4CMGA 4DQVA 2NNLD 2UDPA 3LT2A 5CDUA 1NPYA 3BTVA 4NK5A 1PSDA 3U4IA 3IS3A 4PLWA 2FRDA 3PJFA 5TT1A 1XCBA 1E5QA 1LSOA 4MVJP 1N7GA 2OGUA 1WVGA 2VZ9A 2ZTUA 4R1TA 1ISJA 4D43A 3IDSA 4MVJI 1MXFA 2QYSA 1WNTA 3TSCA 3WIEA 5A02A 1Q7CA 3FSRA 4NMHA 4YB8A 2TMDA 5EERA 4EEZA 5A9RA 5MDHA 4TRMA 1KIFA 2GD1O 3I9NA 4JROA 1Z75A 4E5PA 1Z74A 2VHXA 1LDEA 1GPJA 4MVJG 3ZU4A 2NV6A 4YT4A 4TZTA 4DPLA 2FY8A 4L9RA 4XA8A 4JJFA 1LDNA 3VZSA 2A4KA 4ESOA 2CD9A 2J6IA 2JD0A 4NU6A 1YL5A 3RI3A 3PYXA 3IKVA 4FFOA 2BKAA 3DBHA 3IUPA 4UUPA 2EP5A 2Q49A 4BOYA 3KUXA 4O5OA 2ZTMA 2Y67A 4II2A 1ML3A 3KOUA 2ZTVA 2CDCA 3TL3A 4E2YA 4NBRA 4GVLA 3PLNA 2RAFA 1QSGA 3PYMA 1SMKA 4W6ZA 1PJTA 4WCDA 5DP1A 4CM5A 3LT0A 4BO0A 1R4NB 2X5JO 1R0SA 2AEFA 4YEDA 5IFLA 2B5VA 3PPIA 4CMHA 3RROA 1MXHA 4WECA 3N7UA 2CF6A 1F8FA 1EBUA 1E0DA 2HMUA 1ZSYA 3B70A 2CSUA 4YYZA 3UCEA 1VJ1A 3D0OA 4ALJA 1VM6A 2VOEA 2PGJA 3E48A 4AICA 3GFGA 4YJDA 1BGVA 4EW6A 2PD3A 4OGWA 1AUPA 4CMEA 4FB5A 2FPGA 3W4JA 3K8ZA 2HK7A 2HU2A 4L8VA 4YDRA 5L7WA 1H6AA 1Y7TA 1VPDA 3HDYA 1ZZEA 4HFNA 1DDOA 1Z45A 4JCOA 3DBLA 4GWGA 4YAEA 4DL9A 5I9LA 1U7HA 3WYCA 5BNFA 3QWAA 4CLXA 3M1AA 4LVCA 3KETA 4PGFA 1UUFA 3OSUA 1LSSA 5KCZA 4E0BA 1D7OA 1ZMTA 2OO5A 4Y98A 4D3FA 4J0EA 2PH5A 2PGDA 1DRVA 2IE0A 1AXGA 3PZBA 2IEBA 4PIVA 1A7AA 1H94A 1ZK0A 3VH1A 4DMLA 3RQSA 3NTRA 1I36A 5JCJD 5JDIA 3TFQA 2B69A 1YBVA 1U1IA 4FN4A 3TZKA 4Q3NA 3T7CA 2B4TO 4HADA 4ZA2A 3GVPA 4XD2A 1E3IA 5KIAA 1GUZA 2AE2A 4E2ZA 4W7HA 3HFSA 4GGOA 4JBHA 3ZH2A 1SEVA 4ND5A 4GH5A 1LDBA 1I01A 4XQCA 3RFXA 1DFHA 2EEZA 2Z95A 4B4UA 1CWUA 3RUAA 2HK8A 2V6GA 4D3SA 1KVQA 2PKQO 2UUPA 4E33A 2EXXA 1E1MA 4FSHA 1IB6A 1R15A 2OP1A 4Z3DA 3GDFA 3PIDA 3K5PA 1R4MA 3E9NA 3HDJA 4RVDA 8LDHA 5A05A 3PGJA 1UXGA 4A2CA 1ARZA 3OMLA 3IUSA 3JQBA 3MTJA 1YKFA 3D1LA 2CUKA 5EMHA 1KY5A 1ENYA 4UUOA 5JC8A 2WD7B 2FR0A 3GVXA 3AU9A 4LW8A 3RVDA 2HSDA 4XYBA 1MGOA 2EKPA 4CQMD 1LRLA 1E6EA 1PJLA 2JFGA 3WNQA 4BGUA 3VPSA 4ZRNA 4DYVA 1F0YA 4DIFA 1DRUA 1BRMA 4QECA 1T2FA 3UOGA 1YE3A 4DPMA 1EK6A 1A5ZA 1QKIA 2OORA 3GUYA 3RC9A 5JC1A 4RORA 1GZ3A 4H16A 5ER9A 1HKUA 3IC5A 4J4HA 4PLGA 1B7GO 3DZJA 1KY4A 3DHYA 2Q1SA 2J8ZA 4M55A 1ISFA 5ITVA 4CM6A 4CMIA 3NX4A 1H9BA 1VE9A 2J3KA 2CDBA 1LEHA 2Y93A 2JHGA 2XXJA 1HYHA 5EL0A 4DLAA 2JAPA 2YY7A 1V3UA 2LDXA 4CMEC 2VT3A 3DBHB 2BGLA 3U0BA 2Q46A 3K2BA 4HBGA 3SX2A 4CM9D 3EDMA 4MIEA 4ZJUA 4ZQBA 1F8GA 3DQPA 3GF4A 4ALKA 1BVRA 3OETA 2O3RA 3IKTA 2DFDA 4RCVA 5I7SA 4IDCA 3DB2A 2X0NA 4J2HA 1P77A 1H6DA 1RWBA 1P9LA 2C20A 3DAGA 4KUHA 3GGGA 3I9JA 1BDMA 1YO6A 1P1KA 1PL8A 1OFGA 2Y1EA 4RPHA 2PY6A 3GNTA 4S3MA 1QYXA 2NUAA 4RQUA 1PR3A 3D64A 4OKNA 3L0DA 2QW8A 2VQ3A 2IODA 2EGGA 4PG5A 5JXWA 2CVOA 3QSGA 4E30A 1GAEO 5IXYA 3WR5A 5JDIC 1WPQA 3BHMA 3RD5A 2A92A 4FGWA 3Q9NA 4BNHA 4BO4A 2JD2A 3NTOA 4N18A 3ZHXA 3QW2A 3PYLA 3DBVO 3GFBA 5KJ6A 5F21A 2BLLA 4OXYA 3EZLA 1P45A 1EDZA 1CYDA 2VUUA 3PQFA 2HUNA 4GVXA 3RUCA 1BG6A 4AFNA 3OICA 3ZNPA 2DT5A 2SCUA 3DTTA 4XIYA 2OBYA 2GO1A 5C37A 1Y9EA 3O38A 1PZHA 3A14A 3ABIA 3GPIA 4LSWA 4MIYA 5CDTA 1E7YA 2QRKA 3GUCA 4FD3A 1VL8A 4XYMA 3O9ZA 1GV0A 1DC3A 1IE3A 5BSFA 3DWFA 1SOVA 2RHRA 3JQBC 3TWOA 3TDKA 1SB8A 1NAIA 1YDEA 4CL8A 4WNIA 2GGSA 4N5LA 3GG9A 4IUYA 2GSDA 4OHUA 1IYZA 3DHNA 4PLFA 1P3DA 1DO8A 3HG7A 3A28A 1FDSA 5HS6A 1L7DA 4D7AA 2VT2A 3IP1A 3Q2IA 2GZ3A 3EC7A 4O0LA 3V8BA 5B4TA 1P1RA 4J16A 2OBNA 4IXTA 3SJUA 4LCEA 3TZCA 1NR7A 2NU8A 3IQDB 3H3JA 2HLPA 5H82A 2VTDA 2XF8A 4OOEA 3G3EA 3GRPA 1NVGA 5F3RA 4PZEA 3KYCA 2VWHA 4WKGA 4UVIA 5T57A 2FPIA 1R4MB 4G81A 3P7MA 3MJVA 4CM7A 1KS9A 5IZ4A 1CRWG 5IN4A 3WICA 4ZQFA 4EZBA 4EI2A 4ZU3A 1QG6A 4DGSA 4CMJA 4YAIA 5CDSA 1TVEA 1HDXA 3RJ5A 4OJNA 4MPDA 2FOIA 2X0JA 4AG3A 3ZV3A 2A35A 3WXBA 4GKVA 1AHIA 1EFLA 1X0VA 4B8WA 2X6TA 1D8AA 3G17A 4WLOA 4FW8A 4GSKA 4LSMA 4XCVA 2VWQA 3NT5A 2C5EA 4ZHSA 1B8PA 4AJJA 2YFQA 5I7FA 1JWBB 4TMFA 2X9GA 5JDCA 3F4BA 3ST7A 1T2EA 3SXPA 1XQ1A 3AI1A 2YDYA 1ZEMA 2ZYDA 1FDUA 4EUFA 1BW9A 1NXQA 1UDAA 1X7GA 2P9GA 2X0RA 4RDHA 2P4QA 3BZUA 2DFVA 1BXKA 1PEDA 2JKVA 5BQFA 5COAA 1QLHA 2R2GA 1LTHR 1GR0A 2B5WA 3WJAA 4CMIB 1DC6A 3WMWA 4QFDA 4NK4A 1CIVA 3L07A 3KO8A 3CINA 1O89A 3RKRA 1H93A 1UDCA 3JCZA 4LGVA 2DM6A 3DFUA 3QVWA 4AJNA 4BO1A 3H8VA 4Y6RA 3X2EA 2YJZA 5DBFA 4Q39A 3S8MA 2X23A 1R66A 5IDXA 3Q3CA 4RF4A 3WQSB 4J0FA 3EK2A 2D5CA 5IXSA 5U9CA 2W2KA 3PGXA 1KVRA 1GD1O 1R12A 2J5QA 3GNSA 4I1IA 5U1PA 1HYEA 3L77A 4R3NA 4YJFA 2QZZA 5HA5A 1DPGA 3ADOA 4PFJA 4FQ8A 5KKCA 1AN9A 3NDJA 1ZK1A 1L7EA 4PLVA 3WOHA 3A9WA 3ICCA 3FD8A 3TN7A 2PGLA 4MP3A 4HWKA 2BGMA 4B4OA 3S1LA 3GN2A 1B8UA 3S2IA 2GPTA 3JQ9C 4KQWA 3JD3A 5L3ZA 3JD1A 3E5RA 4NNJA 4BL5A 4J1SA 3AFMA 2FPPA 1N8KA 5DULA 3VVCA 4NBUA 1HRDA 1B15A 4IDDA 4Z0PA 3OA2A 2Q4EA 2ZTLA 4QFCA 4BO6A 2PR2A 4FJ2A 4IXWA 5AXCA 4BO2A 5KTKA 3WFJA 2E4AA 4YT5A 5DOZA 1HLDA 3GDGA 4J1TA 3W6ZA 5JW6A 4TKMA 1PU2A 3GHYA 4LISA 3LZ6A 4EJ6A 3KSUA 3ZHBA 3WTBA 4QT0A 3I9MA 1T2AA 4A27A 2NLOA 3ETDA 3TOZA 3KVOA 1U5CA 4R41A 5HBRA 3OEWA 1M6WA 1B3RA 2PZLA 2C82A 2EG9A 1PGOA 3AY6A 2E48A 3GY0A 1UJMA 1M75A 5DBIA 4MKXA 2O4UX 4MVJF 1P1IA 1GYRA 4BNJA 1A71A 2ZQZA 1X15A 2VHWA 5KJFA 4K6CA 1PZGA 3U4CA 1U2DA 1X7DA 4BMNA 4UEKA 1PS0A 4IDBA 1OC2A 4R9SA 1UP6A 4Y67A 4IMPA 4ND1A 3ZN2A 3WS7A 3D4NA 2AG5A 3AOEA 2FR8A 1ENPA 4H7PA 6LDHA 1IHYA 4RZHA 1I24A 1Q0LA 1ZXLA 4EUEA 1TA4A 4TKLA 1WDKA 1FK8A 3DMYA 3CEAA 4GLOA 2WYUA 2C7VA 2WE7A 2VHVA 3CMCO 3N58A 4IJVA 3WGZA 1S7CA 3GMSA 3T4EA 2DTDA 1IULA 4WNCA 3JYLA 4YAJA 2J3JA 2JD1A 2W90A 3F6YA 1E92A 4UAGA 5TS3A 1M2WA 1Z73A 4NQZA 1UDBA 2CMDA 3SC4A 1ZJYA 3H5NA 3OBBA 1TB4A 1WLYA 3UKOA 4A7PA 1H6BA 1CJCA 1NNUA 4I8XA 1CERA 3WWZA 1PWXA 4RGBA 3D7LA 5JMPA 4OMUA 4Z9FA 4BNXA 4J49A 4L75A 2C0CA 1T25A 3FBTA 4FPXA 4DA9A 1HWYA 4XB1A 3I6IA 1VSVA 3ZNOA 3I5MA 3JQAA 4J9UE 3RUIA 4ALLA 1BW9B 1AXEA 3ZWVA 1OC4A 1KVUA 1X13A 4YJGA 3HN2A 2HAEA 2GASA 3RFVA 1GDHA 3QQPA 1O95A 3UVEA 4CUZA 1UR5A 5FI3A 2FZWA 3IIEA 4WJZA 4C4OA 1PR9A 5B4UA 4B8ZA 4RVHA 1ENOA 4N54A 2PZMA 4GL4A 4UUMA 3JD0A 3C1AA 3E03A 1EQ2A 5L95A 3BMQA 4ZQEA 2EWMA 1B2LA 2E6UX 2GN4A 1V3VA 4TVOA 1X1TA 4BKPA 4E12A 1IY8A 3ANMA 4R1NA 3EGOA 1EUDA 3ROKA 4CQLA 2EHDA 2W2KB 4J7XA 4BNYA 2C2XA 4ROSA 4Q3CA 3C85A 2JFHA 1YB5A 4FC6A 1NHWA 3TQHA 1DAPA 4NFYA 1XA0A 1Q0HA 4RLHA 5HTOA 4YJFB 3NUGA 1H5QA 3MJEA 4BUCA 4R9RA 3I1JA 4BNMA 3F1KA 3KM0A 4KDFA 1QRRA 3W6UA 4H15A 1YQDA 3U62A 4CMCA 4JN6B 2P5YA 1BMDA 5T67A 5I9NA 4R1SA 1GL3A 3QIVA 3VAZA 3WGOA 4F3YA 2B35A 2I99A 2NVUA 3B1JA 2RH4A 4DTIA 4IDEA 3L6OO 4B3JA 4XQGA 3GDOA 2W2LA 2HMSA 3SLGA 3G1UA 1GY8A 2CDAA 1IHXA 4J2OA 1G1AA 1PZEA 4DRYA 2J5KA 4D79A 2C07A 3BAZA 2V6MA 1MC5A 2D59A 2HQ1A 2EW8A 2Y99A 1NAHA 4RPLA 1HDYA 4K6FA 3D5QA 2GRAA 5JNLA 4A10A 2C7GA 2AHRA 3KLPX 2HK9A 3GA0A 1J4AA 3ZW8A 4S1VA 3VDRA 5BSHA 1XQ6A 5CEEA 1JVSA 1U2GA 1M6HA 2QRJA 4L74A 1NBOA 4Q3DA 4CM4A 1ZBQA 4BKQA 4D45A 2WD7A 3QJ5A 3QHAA 1U7TA 4YXFA 5TQVA 3DONA 4YRAA 5THQA 1Y8RA 2WYWA 5TC4A 2QZ9A 4N5MA 1YH3A 3LT1A 4XYGA 5F1PA 1T4BA 1YXMA 3Q11A 2EF1A 4D0SA 4IJWA 4BO5A 2I67A 1LC3A 4BNIA 1K89A 1G0NA 2B37A 1ISGA 2O2YA 1LRKA 1J6UA 4RZIA 1HZJA 1IZ0A 4GGPA 5KVQA 4FOOA 1PZFA 1Y1PA 3BA1A 4KWHA 3VZRA 4U6QA 2YYYA 3H7AA 5ITWA 3I6QA 4AJPA 3TNLA 3M2PA 3ZDFA 3W8EA 1LLDA 4OQYA 3HNPA 4GWKA 1EVJA 3B20A 3I4CA 4HNGA 2ZJ1A 1DFIA 4PG4A 2WDZA 2O23A 3HDHA 1BVUA 1HDCA 2WTBA 2DPGA 4E13A 1UP4A 2V65A 3JQAB 3KV3O 5A1TA 1B14A 3AI3A 3FI9A 4UULA 3OHSX 3PWZA 4CR6A 4XB2A 4GX1A 4YJGB 4AJEA 3PWSA 3VVBA 2Z1NA 5CEFA 4M86A 2DLDA 1E3EA 5F1OA 2CZCA 3MEQA 1RM0A 1R16A 3ENNA 5KJ1A 4P4GA 3IAHA 1XU9A 2GYYA 1NWHA 3INRA 2BH9A 3GVHA 3INTA 4BMSA 3ASVA 2NADA 3OIGA 1JW9B 3Q9UA 1KETA 1X1EA 1E1NA 4Y9DA 2P68A 2G76A 3BMQB 3V2UA 3MOGA 1XEAA 2XAAA 1GTMA 2JAHA 2YW9A 5EIOA 1HTBA 3ZI0A 3SVTA 3KXDA 1PIWA 2CY0A 4HNHA 1DOHA 3MJCA 5EN4A 3CH6A 1VC2A 4MOWA 1NHGA 2Y1CA 4CQLB 4ZICA 5JY6A 2PK3A 5H83A 1K6XA 3AM4A 3RIHA 1JLLA 3NRCA 4AJIA 4JJGA 4CLRB 1LSJA 5ILOA 1TI7A 4BNFA 1ADFA 1UZNA 2NTNA 5AXBA 1HDRA 3FR8A 1AHHA 1DIRA 3VPHA 1N5DA 2FWMX 4MKRA 1DB3A 1HE3A 2D2IA 3E8XA 4WLNA 3K31A 2WM3A 3ETEA 1MG5A 3OQBA 3VHRA 5A06A 2UUOA 3QVOA 3FBGA 4IIUA 3O26A 4NFSA 3ZU2A 1DBVO 3H5AA 4CLEA 3NT4A 2Q45A 2V6BA 2NVUB 2J5RA 4A03A 3AI2A 3LDHA 3QA9A 4BS9A 4AJKA 5IZCA 2PKRA 5B12A 3HUDA 4UEJA 3FTPA 3DO5A 2YHUA 5DCUA 1C0IA 1ID1A 5T5QA 4B7UA 1KEWA 4ZVVA 5TGDA 5THKA 4RO0A 2VWPA 3WNVA 4PN3A 1ORRA 1E7QA 1GUYA 1DC5A 2NU6A 1LLQA 4TRNA 2NVBA 1E7MA 1HE4A 2DQ4A 3ZHZA 3IJPA 3IMFA 4RPJA 4DYDA 1BXZA 2TMGA 5I9MA 4DXHA 5A9SA 5G4LA 4DUPA 3QY9A 1BHSA 4DIBA 3K30A 1X0XA 5L40A 1ZSVA 2JCYA 4KP7A 1PJQA 3KEQA 2XXBA 3SLKA 3DBRA 2B83A 3RBXA 4CM4B 5DNAA 4E5KA 4NBVA 4NJMB 1EVZA 2Q99A 2YHIA 2CF5A 4KMSA 1ADCA 3DOCA 1JTVA 2Y0DA 1Y8RB 1N1GA 4GKBA 4R51A 1YB4A 2OP0A 3ZWAA 3EW7A 1RYDA 3PWKA 1WDLA 3BMCA 4TZKA 4A26A 1LSUA 4EITA 1Z6ZA 1UXHA 1HF3A 4GX2A 4JK3A 1LJ8A 4EBFA 5G0TA 4LCJA 3FRJA 1V6AA 2X7HA 3ONDA 2PKQP 2ZCUA 1ISIA 2HJRA 4KUGA 4BO9A 2O3UA 2D8AA 2H9IA 3I9OA 4BGIA 2FN7A 4MIOA 1FF9A 3GOHA 4CM1A 4IZIA 1DIBA 2ZB4A 3HFGA 1EE9A 2VRCA 2H1SA 3F46A 3JQDA 3F1LA 4B4VA 2HCTA 5KKAA 1C1XA 1Z7EA 5AVOA 3WB9A 4TRJA 2IYPA 3OH8A 3K92A 4BNKA 5BSEA 1T26A 1RJWA 1MG0A 3FHLA 4R16A 5CPFA 5G2OA 3V2GA 2AQKA 2P5UA 1IPFA 1NP3A 1ZEJA 3NDIA 5A3VA 4IS2A 1I3KA 5C7LO 1HDZA 3H2ZA 4MP8A 2AMFA 6ADHA 3NTQA 4YT8A 2GLXA 5CHEA 3PLRA 5BR7A 4RDIA 4CM3A 1FDVA 4EGFA 4CMKA 1GEGA 1MLDA 1T1RA 3PJEA 3ROPA 3A4VA 3JD2A 5T8KA 4CR8A 1K6IA 2NACA 2DUWA 3OQ1A 3V5NA 2WJPA 4MVJM 4AJLA 2W98A 3C1OA 1LU9A 2PZJA 3C1TA 4OM8A 4WUVA 1HE5A 3VH3A 4BNZA 4W4TA 4HFRA 1KERA 1SPXA 3I23A 3GPDG 5AOVA 3BTSA 5L9AA 1LI4A 4NFHA 5DDIP 5IZCC 3U9LA 4IQGA 3WGIA 4L4SA 5FF9A 5JMWA 4XRRA 3JQCA 4Q9NA 4H3VA 1HDOA 1NQ5A 4CMBA 3GK3A 2FSSA 1T24A 1Q2XA 4JIGA 2Y0CA 3CE6A 1O0SA 4WLUA 1QMGA 3MWDB 1F12A 3AU8A 4IDAA 5F1KA 1NFFA 4NBTA 4ND4A 1LBEA 4Z0HO 1LA2A 2UVDA 3TRIA 3O8QA 3HADA 4YTEA 3FNHA 3FNFA 1E6UA 4NBWA 3HZZA 3JQ9A 3KSZO 1P33A 1WAMA 5IG2A 1HETA 1K3TA 4NHEA 1R0LA 4YVFA 3FNGA 3MZ0A 4O63O 7MDHA 1I32A 3OEYA 3OA0A 2VYVD 2Q50A 3OECA 3EYWA 3KB6A 3GEDA 4OAQA 4MINA 4J4BA 4OL9A 3BXXA 3LLVA 4LN1A 1P0FA 4WOJA 2ZB3A 1PGPA 4IBOA 4TQGA 1VJ0A 1LDGA 1ISHA 2BI8A 4BIIA 3H9GA 3JQ7B 5EPOA 1N92A 4J7UA 4HV4A 5COQA 1W8DA 4CR7A 4BNUA 1XSEA 2Y0EA 3VDQA 3NT2A 4E3ZA 4D3DA 5G4KB 1EVIA 1JAYA 2XPCA 4M8SA 3JQAD 3B6ZA 2JCVA 5C7IO 2HMWA 5A9SB 1LRJA 4J90A 4J43A 4KQXA 3VPGA 3W8FA 4DMMA 1EZ4A 1JA9A 4XX0A 3ULKA 3BTOA 5FI5A 4E5NA 1XWFA 1QYDA 1W6UA 3UXYA 4NU5A 2C2YA 2FZEA 3DBRB 3E6AA 1Y5RA 2BF7A 2AE1A 3RKUA 1A72A 5I8ZA 3WG9A 4XDZA 4PRKA 2NQTA 3O03A 2EKQA 4K1LA 4CM8A 2YHIB 1WWKA 3WQRA 4DQXA 4EJ0A 1U9JA 4Z9YA 4URFA 3MWEB 2DBRA 1JAXA 3F5SA 3L6EA 1VJTA 4YQZA 1TEHA 3K73O 2WSBA 3WBFA 1UXKA 1NX6A 2PA3A 3BMCB 1VSUA 3K6JA 4FR5A 4OYRA 2VUSA 2E49A 3I9KA 4IPTA 3WWYA 3UFXA 1EQUA 2DTXA 3DZFA 2ZYGA 1JKIA 4PLYA 3PJGA 2C54A 1H9AA 3TJRA 3DXFA 4K9DA 3BTUA 4JJIA 3NJ8A 1DLJA 2B0JA 2RIRA 3C3XA 3RUEA 1I33A 2X5KO 4TRRA 5T8KC 3LC7O 1XKQA 4QXMA 1R37A 4K28A 3I52A 3M6IA 1ZK4A 1EE2A 3FNEA 4U0JA 4QO7A 1DEHA 1MA0A 1C1XB 1SNYA 5ILGA 3PHIA 1HYGA 3GGOA 5COBA 2NWQA 3BIOA 3NGXA 4E5MA 3Q0EA 4RPKA 1WZEA 1YJ8A 3ZHYA 1ZNQO 3GZ4A 3BMOA 4JP2A 4RJTA 2W2LD 1LNQA 4BVAA 2IYOA 2HMTA 1CETA 2DBZA 2WYVA 4CQMA 5HM8A 2JL1A 1EEHA 1G6KA 2PLAA 2W4QA 2DTEA 1LC0A 3VKVA 4XZ3A 1IUKA 1UH5A 2P9EA 5TT0A 4AJ1A 2QIOA 1KC3A 4I5EA 1ZFNA 1V3TA 3DFZA 5C5IA 4CLOA 1DHRA 3OJ0A 3UF0A 1KVTA 5KJCA 1OI7A 4JLWA 3BMNB 4RVSA 2O2SA 4E31A 2VZ0A 4PG7A 3ON5A 2Q4BA 3L9XA 4JBGA 1PL7A 1DC4A 1WXDA 3HWRA 4I5DA 4CUKA 3UAGA 4D46A 1GCUA 1U3TA 3V2HA 1E7WA 5JE8A 4A73A 2F1KA 3UUWA 1K5HA 1HXHA 1NFQA 3DAPA 1YWGO 3OIFA 4PZDA 4FFRA 3RU9A 2YV2A 1NPDA 3K2EA 4KZPA 2I65A 2YV1A 3L4SO 1ZUD1 1Y81A 1PS9A 3AWDA 4IMRA 4BB6A 5IF3A 5KOIA 5CG2A 4B3HA 1ENZA 1PJ4A 4MDHA 2BFPA 1A9ZA 2D0IA 1E7RA 3PHJA 4XR9A 3ICPA 4CM9A 2AG8A 3TZHA 3TZ6A 3O8QB 4EUHA 3VH4A 3WJ7A 2EERA 1NQTA 3D3WA 2DAPA 4L4RA 4XWYA 1GPDG 2NU7A 2I9PA 3WSVA 3I4FA 4L73A 4C7JA 4M1QA 3SJ7A 4G65A 5TJHA 2ZK7A 3GVIA 5IDYA 1V0JA 5BNTA 4OXNA 5TJ9A 1B3BA 1JU9A 4FFPA 1UZMA 1LX6A 4OH1A 2O7QA 4E6PA 2BI7A 1PQWA 5CEJA 2GZ2A 3AM3A 2YZ7A 1Y8QA 1U5AA 4E32A 2LDBA 4BNVA 4W7IA 4BB5A 1MFZA 1N7HA 3PQEA 4PLTA 4JP3A 4FBGA 2WE8A 2ZIZA 1GEEA 2OUIA 1N9GB 4Q3AA 4MVJA 1CF2O 1J0XO 1KC1A 1NQAO 3DHEA 2RBEA 3F47A 4FJ1A 4G5HA 4TROA 2BRUA 3ZWMA 4XKJA 3ONEA 1BSVA 2VNSA 3GMDA 2X0IA 3H5RA 3VPXA 1JVBA 1A4UA 1E3SA 3HB4X 4PLHA 4BKRA 5L51A 1M66A 3Q6IA 4E2XA 3N74A 3CPSA 5ER6A 1KEPA 1RKXA 2X22A 5G0WA 4NPCA 4WCFA 1YGYA 4P8RA 1GQQA 3AY7A 3WSWA 3UICA 1SB9A 4CM8B 5JFOA 1PQPA 2VOJA 2ZCVA 1J5PA 5GY7A 2DUUA 3UHAA 2RHCA 2OOSA 3FF4A 3FPLA 3IP3A 3L4BC 3ROQA 4ALMA 1C0PA 1U4SA 4R68A 4ALNA 4KDEA 4R5MA 1ISMA 3UCFA 3V1TC 3WYBA 2QHXA 5L7YA 4MJLA 1IZ9A 1F14A 3D5TA 1QR6A 4YQYA 5AYVA 1DLIA 4BV9A 1T2DA 4BKOA 3P2OA 1S6YA 1MUUA 1ZO8A 2GDZA 2EJWA 1UAGA 3DZGA 3AJRA 2ET6A 2AQIA 3GAZA 3PRJA 4YWJA 4B4WA 4XYLA 3H4VA 3ZCXA 2F00A 5BSGA 4FFNA 3LT4A 1ADGA 3T4XA 2GN8A 1D1SA 3KHUA 1XIVA 4JNKA 4CUJA 3ROMA 2D3TA 3S2FA 3PDJA 5JSFA 2H6EA 4BHTA 1YL6A 4XJTA 5K9ZA 8ADHA 1U8XX 3E18A 4OOFA 4YR9A 2DPHA 1TT7A 3Q1LA 2AA3A 3RUFA 2G1UA 3BMOB 1E3WA 5T64A 4DC1A 2G82A 1YOVA 4RLSA 5TLSA 3ZWBA 3AOGA 3LLSA 3FTNA 1QORA 4CQMB 4CLRA 2EP7A 5JAQA 2X86A 2I3AA 5CDYA 4R01A 4AVYA 5G0UA 5GZ1A 4RF3A 1VI2A 4J7CA 4WASA 3QVSA 4NIMA 5TF4A 3PQDA 4CLOB 5A5EA 9LDTA 3E1KA 1P1HA 3PDUA 3E82A 4PZCA 1EBFA 2DU8A 4Q3EA 4JGBA 5AXAA 5K6AC 3GN1A 4LVUA 3GR6A 3NKLA 1T4DA 2X9VA 3JYQA 4NZ9A 3ANLA 1OOEA 5A03A 1Q7GA 4A0SA 4MVJH 4FCCA 3TF5A 3PIIA 3GNQA 5I7EA 1E77A 3S2GA 2Y66A 2CFCA 1SC6A 3HB5X 1CDOA 3AUAA 1K2WA 3C7AA 4NJOA 1FMCA 5HRUA 2J3HA 1PGQA 3GVCA 4GAEA 1Y5MA 1E1KA 1SO8A 5GZ6A 2WWRA 4B3IA 1EUZA 1C14A 2JJYA 1JKJA 4XJSA 2VCYA 1ADBA 2DVMA 3AUSA 4UVGA 4QUKA 3PXXA 3NYWA 1P1JA 1NYTA 2IXAA 3D3WB 2BHLA 5CFZA 5IAAA 2Q3EA 1EK5A 3O4RA 4M54A 5A04A 4GI2A 4MP6A 3LSYA 3GZNA 5LDHA 1GV1A 1YRLA 3ZV6A 4NJMA 4PVCA 1VLLA 1W73A 4WCFC 2EKLA 3F4LA 4RL6A 1RM5A 2X9NA 1O8CA 2AEMA 2ZQYA 1FDWA 2NVWA 2HJSA 3Q2KA 3ZWWA 1KEUA 1SCUA 1Y8QB 1I3LA 3B1KA 2JFFA 1EMDA 4IGEA 4O6VA 4NR0A 3ZWNA 3LF2A 1IOLA 2JHFA 3ZNNA 1YBAA 3MOIA 2NSDA 3L6DA 2PD4A 3DMTA 4MVJE 2Y1DA 4KTVE 3RSHA 3ITKA 1HEUA 3LVFO 1PQUA 3ENKA 1H2HA 2PD6A 1NVMB 4FFMA 5TRTA 1D4FA 1QYVA 2Y1FA 3AK4A 3TFOA 3M2TA 3B1FA 1V8BA 3LF1A 3RC7A 1YL7A 1I2CA 4WCFB 1KBZA 3DEYX 5EJ2A 1I3NA 5FEUA 1EUCA 1O6ZA 1HL3A 1X14A 1ZH8A 2GCGA 2HDHA 2Y05A 4GSLA 2P4HX 1ZK2A 1MX3A 4DPKA 5EQDA 3MJSA 3HHPA 4IQ0A 4W9NA 2W8ZA 1RM4A 1XG5A 4IJUA 1TXGA 4J91A 4B7XA 2WMDA 3STHA 1GFSA 3H9EO 1HE2A 3V1YA 1LLUA 3OM9A 5L45A 2G17A 3I83A 3L9WA 1C3VA 3H65A 3HE3A 2HRBA 2Q1UA 1YVEI 3SC6A 4BO3A 3UCXA 2POQX 3NEPX 1ZVMA 3IL2A 4DQUA 4W99A 1W4ZA 1QLJA 1MC4A 4ID9A 3OIDA 1P44A 4CV1A 4PG6A 4M87A 4BNGA 2IDZA 2NM0A 4ND3A 1WP4A 3BHJA 4NH4A 2D5AA 1NVTA 3OJEA 2QG4A 1E6WA 2Q2WA 1V35A 3NV9A 5EESA 2PFGA 4BKUA 1GYQA 5DF1A 2D1YA 3LYLA 2VYNA 4N7RA 2QRLA 4WLFA 2OXIA 5CP8A 5DZSA 4ITUA 4F46A 1MV8A 3GEMA 2YQ4A 3W1VA 3DZKA 1PJBA 4WEOA 4JQCA 1E3WB 2RCYA 1DRWA 1YOVB 4AJHA 2JCXA 1UZLA 1D3AA 2BFOA 2FSVA 3DZIA 4U6SA 2O7SA 3RASA 1I2ZA 3ZV4A 5B1YA 4RVUA 3RCBA 1SAYA 2Q2VA 5KVSA 2OL4A 2X8LA 1H2BA 4NI5A 5AQ1A 2Y68A 4CV3A 1NTOA 1NASA 2X5OA 4IM7A 1LLCA 5KNLA 2Q1WA 1GCOA 5GMOA 3WYEA 4ZGWA 2VRBA 2O3TA 1HDGO 1RM3A 3ONFA 1DIGA 3FWNA 2PV7A 4O1MA 5L4NA 1U8FO 3QWFA 4R4JA 4F6LA 1E7SA 4LMPA 5DCWA 1Q7BA 1NR1A 4ONEA 4UEOA 3EAGA 1C1DA 2ZATA 3E5MA 3KBOA 5BT9A 5ICSA 3U3XA 1MB4A 1PJ3A 4WE3A 1L1FA 3JQ7A 3KYDA 1E3JA 3I9LA 3BYZA 5JO0A 1DHTA 1N2SA 4YBZA 4NG5A 1EVYA 2E37A 3W8DA 1A7KA 5G4KA 2I6TA 2O3QA 3UH1A 2EIHA 3CUKA 1N1EA 3QRWA 4KOAA 3DMTC 4C7KA 2CVZA 5TX7A 1SBYA 2R00A 2C29D 4HFJA 1JKFA 1T1SA 3R0IA 4YPOA 4WEQA 4CMAA 2HKIA 3UW3A 5DCYA 2G0TA 3GZNB 3R1IA 2Y1GA 4OO3A 4XRGA 4GMFA 3U09A 1LUAA 3WQQA 4PVDA 3W4IA 4Y6SA 1NQOA 3JTMA 2NTJA 2QYTA 3KTDA 3GLQA 3TOXA 3FR7A 3WLFA 3OP4A 4W9NC 4I9HA 1OBFO 2IEDA 4UVDA 4LK3A 4YAKA 2Y1OA 3F3SA 4OSPA 4PLCA 4L76A 2VUTA 5J23A 3VKUA 4E2WA 1Y6JA 3JQ8A 4R69A 3CTMA 2A94A 5LC1A 4TWRA 3GEGA 9LDBA 1QV7A 2UYYA 3WDSA 2IZZA 2EJVA 1XR3A 4CJXA 2OMEA 4K26A 3DZHA 1U3WA 3P2YA 2ZJ0A 3DTYA 2O50A 3KZVA 4IDGA 3NDRA 4WLVA 4RF2A 2H5LA 3WGYA 3I3OA 5C7OO 3TPCA 1I2BA 4UUNA 4IY1A 4GBJA 3WGHA 4P4LA 2CVQA 1CEQA 4FGSA 3ANNA 1TT5A 3CIFA 5A9TA 3RUHA 4JBIA 3OQ6A 3WFIA 5KVVA 5JYEA 1SOWA 3EVTA 5JY1A 2I3GA 1A4IA 5DN9A 4ZRMA 5TIIA 4RQTA 5JAIA 2Z5LA 4FC7A 3LQFA 3COSA 3HDQA 1JQBA 3PJDA 3ADPA 3E9QA 3ZU5A 4BO7A 1FJHA 1A9YA 2VHZA 2YFHA 4A5OA 3AY3A 4BNNA 1OMOA 3EY4A 4BNLA 4BO8A 3CXRA 3ZWYA 4GQAA 4XQ9A 1ULSA 1PS8A 1KOLA 4N5NA 3GRKA 3JSAA 2BD0A 3RBZA 2B36A 3U4HA 4PLZA 3BMNA 1LDMA 4WLEA 1XU7A 3INGA 3KEOA 4HUJA 4L4XA 5JCXA 4DC0A 3AW9A 2RH8A 5HWSA 4XGKA 3DDNA 4ND2A 3RAJA 2ZYAA 3G79A 3ITDA 3F5QA 4X54A 3GAFA 3JQEA 5KJEA 1ZSNA 3JYOA 3W4KA 3G0OA 4YRBA 3P19A 2ZKLA 3QE3A 1QXSA 2O48X 3WMXA 1E1LA 2PWZA 2QX7A 3ZWOA 1B8VA 4I5FA 4TSKA 4IJKA 4LRSB 1DXYA 3FPCA 3U5TA 4MVJD 3FWZA 4ZQGA 1YQXA 1PJCA 2EW2A 2R00C 1PWZA 3DBLB 3EMKA 3JQ6A 4IDFA 4IQ8A 4XDYA 4DBZA 1HT0A 4FJ0A 4YACA 4J6FA 1H6CA 2WEKA 4R5HA 3ZWPA 2ILTA 4P38A 3H3FA 7ADHA 1XGKA 4HKTA 3AUUA 1LDYA 1XLTA 2AW5A 3BHIA 3LC1O 2ZB7A 3DAFA 1JDJA 3GGPA 3HN7A 5IDWA 1C1DB 5TSDA 1C0KA 1YBMA 4M89A 4IGFA 2V7PA 4NDNE 5MGBA 4WK6A 5LDGA 1UAYA 3HSKA 2GUGA 3KYDB 3TL2A 4UVEA 3V1UA 3K96A 4O59O 5ENVA 4BMVA 4CV2A 3G49A 2A9FA 3NGLA 1XELA 1DSSG 4PCVA 1F06A 2IZ0A 5I8WA 1YJQA 1N9GA 4PLPA 4RVGA 2YQ5A 4QTZA 2WD8A 1LXCA 4FDAA 3ZWXA 3OF2A 1GZ6A 4E4YA 1JN0A 4JXKA 1PGNA 1FDTA 3WLEA 3HJAA 4GX5A 4DVJA 4AJOA 5G0VA 2O3JA 4XGNA 1R0KA 4INAA 4IINA 3WX0A 3JD4A 1I5RA 3MCVA 2VHYA 1GU7A 3QLJA 2R6JA 1KEVA 1VKOA 2BFAA 3C7DB 3VTZA 4U5QA 3PHGA 1P74A 3DC2A 1AGNA 2BFMA 4M49A 4B7CA 5I7VA 5JCJA 3KSDO 5L4LA 1PGJA 3QWHA 2EGHA 4LMRA 1ONPA 5CAEA 1BWSA 3RBVA 5CDGA 3GH3A 2QQ5A 1KVSA 2P91A 1O9BA 2PH3A 3X2FA 4HP8A 2Z1MA 3VH2A 1Q1NA 3JQ8B 4Z3KA 2EV9A 4J1NA 3SEFA 1WMAA 4IIVA 1C0LA 4I9NA 1K0UA 3ZWCA 5A3JA 1B26A 3F9IA 3VZPA 3EHEA 1VRWA 4DLBA 1DJNA 1QV6A 5A4DA 2E82A 4F45A 3JQFA 4LRTB 1I30A 4HY3A 3M1LA 4KUEA 4GPD1 4R3WA 3LU1A 3R3JA 1M67A 3G1TA 1D1TA 1XHLA 5ICMA 3LK7A 1ZIDA 1CQJA 3PI7A 2VWGA 3RJ9A 4E5YA 3CZMA 5ADHA 3IOYA 4CODB 3U4DA 3DL2A 1KYQA 3H9JA 3L4BA 4UREA 3VOSA 1J49A 4YT2A 4HFMA 1TT5B 3EVNA 3JYNA 4P4NA 4CLDA 4FIZA 3ZNQA 4YCAA 4F6CA 1YS4A 1ONOA 1PJSA 5KVCA 2B4QA 3FN4A 1WMBA 4OIMA 2VTEA 4XIJA 3GC6A 2DBQA 1LQTA 4DLLA 4DIOA 1B16A 2OFPA 5T6BA 4AJ4A 1DJQA 1YONA 2FR1A 1BXGA 4FFLA 1E5LA 2VN8A 1PTJA 3R3SA 1O94A 3WIDA 4W82A 3JQGA 4Z6KA 4OQZA 4CL3A 4I08A 3H2SA 5JPIA 2HRZA 2V6FA 3KRTA 4Y6PA 4EEXA 4EYEA 1U3UA 3GQVA 4L0QA 3ASUA 3ZU3A 2GR9A 3DZBA 4DWVA 1X7HA 1Q0QA 1U4OA 3RFTA 3EZYA 4MKZA 3GHHA 1ZW1A 3VZQA 1GZ4A 3H6KA 3JV7A 3AFNA 1VKNA 5LCXA 3ZV5A 4QQRA 4I9UA 1YDWA 3WGQA 1UXJA 3PHHA 1DIHA 1Z82A 3CZRA 1SZJG 1HLPA 4OKIA 4RPGA 3GT0A 2BGKA 3AUTA 1E3LA 1JWAB 1W0CA 2PTGA 3P5SA 3WTCA 3DR3A 2O3SA 4OXKA 4Q3BA 3PTZA 3C24A 4R1UA 5K6AA 2X4GA 2GNAA 3D4OA 4D44A 2G5CA 1UXIA 2C5AA 4WOKA 4QEDA 5FYDA 3C8MA 3UGKA 5A5FA 1F17A 1EDOA 4YA6A 1IL0A 1UP7A 5FWNA 3NAQA 3RC2A 1U28A 5AXDA 1GUFA 2PZKA 4U0KA 4BGVA 5DBGA 1B0AA 3WGGA 4YJHA 4ALIA 5IDQA 2BMAA 3PVZA 4Z0TA 5BNIA 3KLMX 4G2NA 2GERA 2HMVA 5K0ZA 2FP4A 3FCOA 3PZRA 2C59A 4EDFA 4U7WA 1PJ2A 1XDWA 4WPGA 3AM5A 5EINA 3ZZNA 4XYEA 1VL6A 3OJOA 4QSMA 2CNBA 2OZPA 2DC1A 4RF5A 4EJMA 1XYGA 1DIAA 1QP8A 4ZN6A 3JQFC 2H63A 4KWIA 1P1FA 1GQYA 4D0RA 4J4TA 1GQ2A 4I5GA 5B37A 3S55A 4BQRA 4BNTA 1M76A 4II3A 5DOVA 5JDCC 1OZAA 4CPDA 1SEPA 4D41A 3HQ4O 4DBVO 5H81A 4XR4A 1NM5A 4J9VA 1H0KA 4B79A 3KYCB 1FXSA 4ZD6A 2BELA 3DOJA 2DBVO 5KWEA 5IN5A 3OFSA 5L4SA 2NU9A 1WW8A 1GYPA 2OHXA 3RWBA 2VYND 1G0OA 2AQHA 2VYVA 4ZQHA 1GADO 3QVXA 1PL6A 1WZIA 1P0CA 3A06A 1IPEA 2AQ8A 1ZMOA 2IXBA 3OJLA 2UV8A 4YAGA 4IS3A 1VL0A 3LC2O 1YQGA 2P9CA 2X58A 5JYDA 2Q2QA 1MFPA 3K9QO 2J3IA 4Z9XA 1NWCA 1ZCJA 2AEJA 2GN6A 1RPNA 2ZB8A 3CKYA 2VZ8A 3PFWO 4RVFA 4XGIA 2FHSA 3MJ4A 2I5PO 3A1NA 1R4NA 1HZZA 5JBIA 2X1HA 2YV3A 4WGGA 4KTTE 2AXQA 4QO8A 2HO5A 2I76A 5F5LA 2UAGA 3RU7A 4D42A 4BNWA 4AL4A 5C3MA 3E9MA 4FS3A 1I10A 1HSOA 1AE1A 1O5IA 1ZJZA 1TLTA 3PFFA 1MP0A 1QYCA 1K6JA 2XOXA 3T7EA 4MO2A 5HS4A
chains in the Genus database with same CATH superfamily
3MD9A 1I8TA 1N6NA 5L7TA 1HSZA 5LP6B 5G0SA 3MINA 2PUJA 1BXGB 2OWDA 4P22A 3PUWA 5CB6A 2VPZA 1ZK3A 5KYNA 3L8DA 3NJ4A 2J33A 4CEHB 3MG9A 5CPBA 3G85A 3RTDA 3R7WB 2YASA 2ZAIA 4IV8A 5DLYA 1Q0ZA 4OB8A 3U3MA 1WW2A 1LQUA 3QP9A 1ZY2A 3HY6A 2GK6A 3IJRA 3MAAC 4BGEA 4J94A 3OFND 3HL4A 3WWDA 1ABFA 1I3MA 4PGMA 5U4QA 5F98A 1L5RA 4MRPA 2CLFB 2LIPA 1II8A 4U2BA 4Y6GB 1P31A 4QIHA 4CLHA 5ELXA 1A3CA 1A50B 1K2VN 1PG5A 3CRVA 3UN1A 2A58A 5JLAA 3CMMA 1YB1A 3GRZA 2PXAA 4RH3A 3AIOA 1W35A 1WHSA 4Y8VA 4PRYA 3ZW9A 4DREA 2NSYA 5C81A 2IRWA 5ENDA 4DJTA 1Z15A 2C5SA 2VKQA 4X92A 2YVKA 3EXHA 2FUG6 1WDMA 3IUQA 4RK4A 5C8YA 1NYLA 3V7WA 3WA7A 2IHTA 5IT5A 1CHDA 2ZIXA 4I3GA 5B4VA 2ZM6B 4O2AB 1D07A 1XRJA 1V26A 2JCGA 4JLBA 2WJYA 1KNQA 3U44A 1GSAA 3UATA 2JA2A 1N0IA 2IU0A 3UXEA 3VC7A 5TGZA 4D1YA 5GZ3A 4QKQA 2SICE 4PHHA 2XT6A 4FT4A 4GLLA 1NUTA 4RY0A 2JGNA 1W30A 5FAKA 2WIAA 4CV0A 2H5EA 4MUFA 1Y9ZA 1FX0A 3GCDA 3PP8A 4XEHA 5DGXA 5AW9A 1GTG1 1KXJA 3M3PA 4A3SA 4I55B 3RHTA 5JAZA 5BVGB 5FDFA 5HZMA 5EE5B 2HGSA 2WHPA 4L4YA 5DRTA 3MRSA 2V7GA 1L5MA 1TA0A 1UCFA 3C2QA 4DBLC 3R74A 3A2KA 4YJHB 4RMJA 4Q3LA 1W76A 2QL9A 4YT4A 4DM7A 1KRXA 4CYMA 3JZMA 1L4HA 1KQFA 2YUTA 1JQDA 1KI3A 2QRPA 1G17A 3DFMA 4NV1A 5DHUA 4UTRA 2BFNA 1O96B 3PHCA 4E5VA 2ZI4A 5KSOA 3B6JA 3VKWA 1I0ZA 1G8KA 4OYHA 2JGJA 1RYHA 1RLIA 1YRQA 4NYMR 5CM2Z 1ZKMA 4DNXA 5LUAA 1T2CA 4J7AA 1U04A 4PRLA 3QFCA 3VPFA 3WADA 3SYNA 3L18A 2G1AA 4K6KA 1NXPA 3H9UA 3ZGOA 4CTMA 3LTEA 4LYHA 4DIEA 3DGEC 1GPNA 1YJCA 2NTVA 3BXZA 4RIIA 5H3LA 2EJUA 3MTGA 3VYVA 2Q5IA 3VUFA 2OY0A 4WXEA 4MQEB 2HB6A 4HQKA 2NNLD 3V7UA 4RACA 2HSGA 1NT2A 1NPYA 2X8AA 3L4EA 1GNSA 1E2NA 2I7XA 3BTVA 1PSDA 4HAVA 4JKYA 3U4IA 3HRIA 3IS3A 4MYRA 5DNDA 5EWLA 2HHLA 3QFRA 3PJFA 4PWZA 4HGYA 5IP5A 1LSOA 3HXTA 1RCUA 2OGUA 3QG1A 1WVGA 3SSAA 1YA4A 3GH1A 3Q5EA 3KQPA 1I1NA 3IDSA 4MVJI 4MW4A 2R7AA 4QATA 4KKXB 1Q0PA 2IYAA 1SBHA 2J0QA 5A02A 5J4HA 1JFLA 2QRHA 2ZUUA 4YB8A 4EEZA 3NXSA 5LOVA 4YONB 5MDHA 4YWHA 2QSZA 1KIFA 5GADl 3I9NA 4IFTA 3HBJA 3VPCA 3KP1A 2KHZA 1HMPA 2PGIA 4XQ0A 3MCAA 1GPJA 4UM8B 1FJXA 2JNWA 5A3RA 1TQHA 2IOQA 3UG7A 3BKWA 3OCWA 1YQWA 4X6UA 2CXRA 5G0WA 4ESOA 1EESA 1QQAA 1S1CA 1N5KA 4JUDX 2W6PA 4R0VA 3VFDA 4DR6B 1V71A 1DKLA 2G80A 1PLKA 4H7FA 1YL5A 1T6BY 2V7BA 3AIMA 5SZIA 3PYXA 3EPLA 4B31A 4UUPA 3W79A 3ZBQA 3KUXA 2QPAA 3PFKA 1GNLA 1T8WA 1JEDA 2Y67A 3VR5A 1NIPA 1PZXA 2PKWA 3TM5A 4E2YA 4P86A 3ICVA 1IVYA 4WOPA 1P2SA 5DP1A 3UAXA 2ECOA 1HT1E 1DE0A 4MWZA 2X5JO 3A31A 2C61A 3FYUA 3LNCA 4YEDA 2PWPA 4QEZA 4CMHA 1QLWA 4M0FA 1R8YA 5HIKA 2H7CA 2RJNA 3ZDXB 1YD7A 3BL8A 3N7UA 1FRZA 4WECA 1USIA 3GEBA 4LPSA 2IYXA 4CN9A 4RVCA 1CEEA 1K7EB 3B70A 1AKMA 2CSUA 4MR8B 4YYZA 5AVQA 2O1XA 5LNK6 3KSBC 2VNJA 4EB3A 1Z0ZA 4RGQA 1QDEA 2HNAA 4BQSA 1U31A 2IH5A 4AICA 2PGJA 3FG9A 4L0MA 3MXTA 4KI0A 2LIVA 3HBNA 1D2AA 4Y2XA 1OPXA 1XZKA 1L4LA 3PVCA 1XAHA 5FOXA 1C8KA 1RRGA 1G55A 4YHHB 3TXYA 1ESCA 2VDOB 3DT6A 3HM2A 1SKMA 5JNRA 3TNDA 1H6AA 1F2TB 1E9SA 3CKLA 4IO0A 5CR9A 1VPDA 1ICEA 1U1DA 1RJDA 1U99A 1P5HA 3QI7A 4GOOD 5LYYA 1K92A 3TS1A 1F8UA 3DBLA 1I4LD 3K15A 1X2BA 4GWGA 1G7CA 1U7HA 2ZJFA 4JHXA 4RA9A 2IYLD 2OAGA 3QWAA 4AP6A 1X42A 5F2NA 5LSAA 3M1AA 1SK9A 4LVCA 3GPLA 1SK8A 3ZGXA 3OSUA 2LR0A 4CCSA 4H31A 5EAIA 5KCZA 1ZOPA 1ZMTA 4Y98A 3TO5A 3LQYA 3IPXA 4F9EA 3T5AA 4DB4A 1JH9A 1TQDA 2X76A 2PH5A 4JY7A 2HSWA 2JLZA 2C1EA 4EHBA 3FPKA 2YRFA 1NLFA 3WRXC 4PIVA 2HA0A 1H94A 1X1AA 2F43A 2WUWE 2HF8A 4KQCA 4B6SA 1ZMRA 3FMFA 3MM4A 4QBHA 3DAOA 3VH1A 3RQSA 2I80A 3NTRA 1JHDA 2WA2A 2IV7A 3NHUA 3TFQA 4Y1FA 1U1IA 1KDVA 5FBRB 4NU8X 4ZA2A 3GVPA 2D62A 2FHPA 1UFOA 1EFVA 4J0JA 5E38A 2CDNA 1RR6A 2Q3LA 2WJWA 3FZNA 4JT9A 3UC9A 4DJAA 4W7HA 4E2ZA 3HFSA 4GGOA 3U2QA 2O54A 3ODPA 1JMKC 4ND5A 3WYAA 3VO9A 3FUWA 2GM3A 4TTSA 4PZUA 1CJTC 1MF7A 3O84A 3U5ZB 2XNDA 1L7XA 1DFHA 4TZ6A 1VBFA 1DBIA 2QDXA 2C9CA 4KPUB 3AHIA 3E7WA 3OBIA 2V6GA 2GJ4A 2OFWA 4D3SA 1YCDA 4EFDA 3CO0S 2GBGA 4OI1A 1TC2A 5BORA 4YXWA 3VSDA 2C2GA 1R15A 1CQIB 1P9WA 3N2KA 4CL0A 5KTNA 1WY5A 2AUNA 2JVJA 1MO4A 4GDMA 2W2NA 4QD3A 3NOQA 4L8GA 2M6LA 2O8VA 1E2EA 3PIDA 2QTVB 1R4MA 5KMGB 3E9NA 3NB0A 2DFKB 3HI6A 3CS3A 5SZHB 1J0CA 2WKPA 4AI6A 1OA0A 1ARZA 4MLCA 1CB7A 1GPUA 3IBYA 3JQBA 3MTJA 4L5AA 3R5HA 1S4QA 5JNSA 5EMHA 3NUQA 1F9AA 1KY5A 3QITA 5LZ4A 4WT7A 2WD7B 2ZU0C 3BA6A 3OI7A 5TVKA 3VSEA 4DUGD 5L3SA 2OBFA 3S8EA 3WAJA 2HSDA 3PNMA 3G6KA 3WNQA 3E9DA 3GLKA 1DNPA 2VF8A 2VYQA 4DYVA 5A4JA 3AEKA 1T6YA 1BRMA 1BYIA 1K8XB 2GBLA 2PX0A 4NFLA 3UOGA 2KI5A 1YE3A 3HACA 1DCKA 2X2FA 3AUYA 1VLZA 1P6UA 2PUWA 2QY9A 3H87A 3A7DA 4BZWA 4Y1GA 5JC1A 2OTCA 3IGFA 2ZR0A 3OZCA 4XLZA 5LA6A 4JI0B 1YZQA 1ESZA 3G8CA 3LUGA 3DHYA 2FU5C 3P97A 2J8ZA 1DWUA 4C6HA 2VK4A 1UL1X 3KB8A 1VE9A 1XKXA 3O0DA 4MITA 4Y2GA 2J3KA 2V7EA 3FVTA 5CXSA 2OAP1 3WY9A 3IAFA 1LEHA 1Y1SA 2QMYA 4LQDA 1J56A 5C4IA 1ZH4A 3QKRA 5LZ9A 3DLIA 4RUKA 4A8TA 4F60A 3ITNA 2BYTA 5A62A 1RMQA 4CMEC 4G0WA 2C4UA 2VT3A 2PX3A 4WJLA 3K2BA 3SM3A 3LFTA 1PFYA 4INZA 1UANA 2R86A 3EDMA 3F2VA 3FDZA 5AH0A 4HQ0A 3QUBA 4F84A 4UPDA 1M8GA 1CZKA 5TQ2A 3FROA 4EENA 1HH4A 1ABEA 3QJYA 3HJFA 2J3DA 2PS3A 1P77A 3MTQA 4R9UC 4AS3A 4BJ1A 4HQ6A 2BM9A 2NSJA 3W1EA 3R5XA 5JMOA 1NRXA 3S99A 3Q7IA 1WIWA 1Z9BA 1PL8A 1V3QE 4S3MA 2WFLB 1GFIA 4PIPA 2GVDC 4OKNA 2OV1A 4M99A 1Y98A 2VQ3A 2J0UB 2EGGA 3NTXA 3SDSA 5AUPB 2CVOA 4E30A 1GAEO 3M4JA 1P3Y1 3WR5A 1U1GA 5IXYA 3EPHA 2CXTA 4Z5XA 1U8AA 2CYBA 3OKAA 2H06A 1WW3A 4KR0A 3HGTA 4N18A 3ZHXA 5J3JA 2APJA 3QW2A 4BBJA 3GFBA 1J09A 3TB6A 5A2QA 5F21A 1M0SA 4OXYA 3EZLA 1P45A 1PD0A 1CYDA 3KPVA 3W6ZA 4EVQA 4DIKA 2I6SA 2AZDA 4KFCA 4OG2A 1BG6A 4HZUB 1NL3A 4W8HA 1BN7A 2L0XA 2P1DA 3GJZA 2SCUA 2B2CA 4YCNA 4XIYA 3P9YA 2OBYA 2G06A 3F3MA 5DTIA 1Y9EA 3G2IA 1Z5PA 3A14A 2EOAA 3GPIA 4UATA 2NZVG 4BB0A 3FA2A 4MIYA 2H16A 1Z38A 1ORHA 2UZ0A 4ZTBA 4K9SA 1E7YA 1X80A 2Q41A 4HLUC 4MWGA 1YB2A 3ZHOA 4U2FA 2YY5A 1W2HA 4K81B 4NZMA 5DTRA 3W7VA 4BVKA 3FSEA 1TECE 2C3MA 4PS0A 5FA5A 3W6OA 4PPFA 2AOUB 3BXHA 1NRIA 1IE3A 1U94A 3C3AA 4AZTA 3DWFA 1J21A 3TNFA 5YASA 5CW2A 1KZ1A 1BD4A 2W6ZA 1EYZA 4FFSA 1YDEA 2ZJ6A 4O4IB 1MH1A 4G1FA 3OLYA 4KBYA 5BO5A 2QM3A 2GGSA 3AR8A 4YC7A 1E63A 3S2UA 1IWPB 4JVLA 2GSDA 5IKXA 3L0PA 1T5DX 4PLFA 3UAYA 2JLVA 1WUYA 2ROQA 2OV3A 4ZVUA 5B1EA 3X1DA 1DU4A 3UV3A 4FYXA 4D7AA 5FUXA 3ZCSA 3Q2IA 3QVGA 4ZT4A 1S2DA 1P1RA 5JEDA 5AI9A 3EGWA 1HT2E 1COZA 3FRHA 3ZZUA 4I7EA 4F72A 2HLPA 1XAGA 5CD9A 1NSFA 4OOEA 3G3EA 1NVGA 4PGHA 5GINE 2XH8A 3M6LA 5BYKA 5JMTA 2ZSFA 3KYCA 4PZEA 1RXSA 1UBOS 3R8XA 2O8NA 4PHGA 3FVRA 5T57A 2BTQA 1KS9A 2B1JA 3O75A 4HSEA 1KAHA 2XWQA 4UKDA 3ED1A 5I45A 3D7SA 3LBAA 5IN4A 3QLVA 3UGJA 1XD8A 4TLEA 1LW6E 1CS4C 1QG6A 1QK5A 3K4PA 4CCAA 4PN7A 5JVDA 1MTZA 4FBLA 2HK6A 5KQRA 4LK2A 3C5VA 2A88A 1TVEA 1YDHA 3RJ5A 2IDKA 5AJXA 1U2PA 4JYPA 4QUEA 4U63A 3EMDA 3KD2A 1XMPA 1R7RA 1L4EA 1IUNA 1TKRA 2HPVA 1D8AA 3G17A 1C4OA 4KO2S 2IHKA 4JUBA 4WLOA 3UC5A 4B40A 1CZHA 1BX3A 5BOSB 1ZC3A 1B2RA 2GLTA 5I9LA 1MIOA 2C5EA 3S3TA 3CG0A 3KLOA 1B8PA 1XQXA 4HD8A 3ND9A 1OCEA 4N3NA 4TMFA 4AJJA 4B81A 1YA8A 3SXPA 1ZIPA 4CHTA 1XQ1A 1IXSB 1RU3A 2FPLA 1DS6A 3AI1A 1LWOA 3F5DA 3I4LA 5KSWB 4BTVA 1BD3A 3DXXA 1AU9A 4UBOA 1DTEA 4EW3A 1X7GA 2P9GA 3OM1A 3HP1A 4WVFA 5AW1A 1J2RA 1KFCB 1CE8B 3I2KA 1G8AA 1E69A 4OMDA 1NNI1 2PZAA 4PV7A 3T5TA 1AG9A 2I29A 2JKVA 2X7XA 4RL4A 3QOWA 5COAA 1QLHA 5JYCA 2BBTA 4B3MB 2PL5A 1Q2UA 1DC6A 2DCUA 2OHJA 2XNKA 4HMPA 2QD5A 1CIVA 4MJ3A 2D7JA 2QLMA 1QP4A 2DHQA 4LSGA 5GVSA 1H93A 1KFKB 2AH5A 2H9YA 3ESZA 3IEPA 2V3VA 3QVWA 1GZVA 1XA4A 3DFKA 4UC0A 2I1VB 2DXIA 4EG1A 4JKIA 3X2EA 1LZKA 2BR4A 2YJZA 5DBFA 3PD1A 5IX8A 2X23A 4MV3A 1WA5A 4Z1MD 3U4QA 4J0FA 1RZRD 1II9A 5C4GB 3TOCA 5U9CA 1WZUA 3D6TB 5AWFC 4NCBA 4Q6BA 1Q50A 4J6EA 5M7EA 3UKJA 4TMZA 2ZSKA 4I1IA 4KXVA 3E35A 4OHFA 5EUCA 5FI0B 2KW5A 5PNTA 4D96A 3ASYA 3ENVA 4C4XA 1P5RA 2JAOA 1HGXA 4HN2A 1T4GA 2G83A 3HB9A 5CXXA 3EWNA 1DPGA 2AJDA 5EKXA 3VX3A 4UE3S 4LJRA 1AN9A 2C9YA 3UJ6A 1CR0A 2WZCA 3I72A 1L7EA 2JHPA 1DCFA 2O0KA 4PLVA 3WOHA 4KRGA 3A9WA 5MFPA 5IJAA 2WAAA 3TN7A 4V1CI 4FP9A 3ZXSA 2BGMA 2JIDA 1DTWB 3CIOA 3E27A 3JQ9C 4OHCA 2ZRFA 1BMFD 3E5RA 4WY8A 3WGLA 2MJLA 5K6TA 4J1SA 3AFMA 2OT3B 1Q15A 2CXHA 2O6HA 1JR3E 4G4IA 3OJCA 3ZD6A 5DCLA 1B15A 2HNKA 4QNRA 1GT6A 3BSSA 3KQSA 5JSZA 1SWWA 1QPGA 1S9HA 5J2UB 1YKGA 3REQA 1O6FA 2FWJA 3F6BX 2AR7A 4XTCS 4BO2A 3KTFA 5KTKA 3EEIA 1OLUB 1A8IA 2CHVA 3DVQX 2GKGA 2B34A 4KOEC 3VSBA 3QF4A 2V55B 1H2AS 3LY7A 3VV3A 4JU8A 1T2AA 1RQ7A 2NLOA 3PL5A 4IUBS 4FE4A 4UTPA 3TOZA 1U5CA 1R6BX 4KRFA 4R41A 4H4DA 3O8CA 4B3RB 5HBRA 1M6WA 1ZM9A 2AI3A 4YV2A 4RS3A 3LLMA 4NABA 1XEXB 2PZLA 1K75A 2C82A 3LBYA 4JJ4A 2I9KA 1C80A 5HIJA 2H2IA 3GY0A 1CLEA 1M75A 2ZGVA 4MKXA 4UM7A 5DBIA 5C5EA 3DKKA 1GYRA 1ZD5A 1H1TA 1TF7A 1Z8FA 1S2IA 2AOTB 2C3YA 2VHWA 2WUDA 3G82C 3QBTA 3A1WA 3R0JA 2HTEA 5EUQB 2JFZA 1CUBA 2EC5A 1UC4B 4DDVA 1U2DA 2JEZA 1L5ZA 2EL7A 3P4UA 1LBTA 1WTAA 4CN8A 1M10A 4LEIA 3DW3X 4R9SA 3K0AA 4DNOA 3OCCA 4MCAA 2H07A 3PQ4A 1U0RA 2AG5A 2MINA 3AOEA 5G1NA 1A69A 1OGIA 1ENPA 4OHKA 3DOHA 3BGVA 4H7PA 6LDHA 3R9KA 1NW6A 3WLTA 4RHUA 2XVZA 1WEHA 3C4QA 4OIFA 4RZHA 1TA4A 1L5HA 5KYTA 5E4TA 4RD2A 1WLSA 1WDKA 1FK8A 2ZIWB 3DMYA 3DDWA 2KWIA 2LV8A 1DMSA 4MS3B 2FSGA 4BLWA 2CV2A 4KLAA 4RJ2A 2WE7A 2VHVA 2XCSB 2PMBA 2O8EB 3HGQA 1W47A 2J3MA 3IURA 3PWTA 5EZ5A 5JAPA 3ISTA 4WNCA 1IULA 3JYLA 5LQAA 2JS7A 1JBQA 4EMUA 4NDZA 1O6CA 1XZBA 2H11A 2ZAYA 1SG6A 1E92A 3F6YA 3Q7EA 3UK1A 3UWSA 3N8GA 3QNUA 5AT1A 3UM9A 3W6NA 3C43A 2FEOA 3H5NA 2PZGA 3E05A 5CB4B 1UKVY 1TB4A 1DT5A 1QWOA 1GGVA 4Z4GA 3S29A 2AF4C 1CJCA 4KFUA 5KYUA 4I8XA 4NAHA 2GARA 2RGGA 1Y6QA 3IVXA 3QH4A 1FX1A 3PC3A 3GFFA 1UKZA 4HZIA 1YKSA 3D8BA 4OMUA 1VRVA 3FBTA 5JD5A 2A5JA 5IKPA 2CLHB 4DA9A 2H7XA 2HQRA 1UK9A 3HPQA 2UXCB 4MZDA 3G2OA 3ZNOA 3G0GA 1W0JA 4CIXA 3RUIA 4ALLA 4Q7MB 1HYQA 3B85A 3IQIX 3PR1A 5AKGA 3ZWVA 1OC4A 1KVUA 2FMXA 3P71T 5AVKA 1X13A 4AKTA 4ZJPA 4HDCA 3EXEB 2CHGA 3RFVA 2C4KA 1DQYA 1GDHA 2XUDA 4MRSA 5AK5A 1UPCA 4BFVA 5AJTA 4Y2HA 1XVAA 1PN3A 2G8LA 1Q7RA 1VIMA 4NS4A 3CG4A 1PDWA 1FMTA 4DW8A 1GARA 2CL5A 1ECLA 3DCNA 3DVSX 3NM4A 3STWA 1P29A 3TB4A 1BEZA 3A1FA 2M1XA 3E7DA 2Q62A 2PZMA 4GL4A 4HTFB 4ZEVA 4UUMA 3JQRA 3JD0A 4I6JA 2BFFA 3E03A 1EQ2A 3FOWA 4IHAA 1P7CA 1TX4B 2ZSUA 3FCXA 2E6UX 5BP7A 1V3VA 1X1TA 3TI7A 4E12A 5JAUA 1F4PA 1ORDA 1GDTA 3PNPA 1KARA 1EUDA 4CQLA 5BRNA 4HS4A 3D6MA 1QQTA 2K7ZA 3G0DA 4J7XA 1DCTA 5I7OA 3QKUA 5HE8A 3ZQKA 5KSPA 3DL7A 2JLCA 2O2EA 2PX6A 1ZJJA 4IHQA 3KQNA 3AZOA 4XASA 3DVAB 3OQJA 2D1FA 4OGLA 4CETA 5IJ0A 3IQEA 1QH1B 4RLHA 1H5QA 4RLQA 2AFIE 4BUCA 4R9RA 3T34A 3KM0A 4FM9A 1M1YB 1SFRA 5TGTA 1YQDA 2VDMB 1EBBA 1W2WB 3QEJA 5BSTA 5FUMA 3DEJA 2VO1A 4JN6B 2RSLA 4CGYA 3A37A 3GLFB 2YIDA 1OI4A 4R0MA 2OM6A 2CVPA 2EFGA 5I9NA 6Q21A 1RYFA 1GL3A 2OXCA 3C0KA 1XDSA 3RB8A 3U17A 3ETNA 2B35A 3LQKA 4NCHA 2VA9A 1KY2A 2FPPB 4NDAA 4I2NA 3QUAA 4ZXFA 3RARA 3T9EA 4DLNA 4CIBA 2ALJA 1YF3A 2WMYA 2CNOA 2PYDA 4E7OA 2W2LA 3ZV7A 1G4AE 3MMXA 3UB3A 5CYOA 3G1UA 3DBIA 1IHXA 3Q15C 4TQ9A 3W05A 1RFGE 3EN0A 2OXEA 1I2DA 4DRYA 1L8XA 4JJAA 2NOAA 2BY4A 2C07A 2RARA 2FR8C 5JH7A 1YZTA 2HQ1A 2VBIA 4LOIA 4RJIA 5IARA 3AYXB 2BSXA 5LKRA 3Q8XB 4IDPA 3D5QA 3DSRA 3LP6A 3M0EA 5KTSA 4MQ5A 4AYXA 1D03A 5ICFA 4ZZ2A 1ZGJA 3EFHA 3QBVA 2WWYA 1UAAA 4F4IA 1JYSA 1M0TA 3KLPX 4TM8A 2HK9A 2OO7A 4F3NA 1DP4A 1M74A 1YK0A 4M0KA 1JMYA 3ZW8A 4Z0NA 4BP1A 3OZXA 3PL1A 3VDRA 2HDOA 2VYCA 1NLUA 4MQMA 1JVSA 3RS0A 4X95A 4L74A 1RRCA 2X40A 3PKJA 4Q3DA 3WIOA 4CM4A 2Q29A 2KMLA 4YIKA 4L85A 5DM4A 5AVJA 1DZIA 4EY7A 2FPXA 2YWGA 5CFMA 3MSCA 4L5CA 2VF7A 1NW4A 1HV8A 2X8JB 4R9NA 4F97A 1SUFA 5K1ZA 1XXHB 2Q9AA 2BEUA 4ZO8A 2OC9A 3COYA 3C3DA 4L0CA 2ADMA 1Z4KA 2FEMA 3GGJA 1YH3A 3P9QA 1IJEA 3CNEA 1FNNA 4OF4A 4TS4A 1JHRA 3ZLUA 3A1UA 1T4BA 3WNDA 4B3CA 4EGCB 5LUBA 4NYJQ 4UNQA 1SKYB 1APBA 3B53X 2I67A 1LC3A 1M6NA 3G88A 2R85A 1K89A 4OP3A 3H11B 4LHWA 3OP1A 4U4AA 4X45A 4ZQCB 1OLXA 2O2HA 2QN7A 2OBXA 3JPYA 2O2YA 4WZBA 3SZRA 4CEIB 1LRKA 2RGAA 2CD7A 4M1TA 4RZIA 4ZJZA 4C0LA 4ARIA 2ZUEA 4FOOA 3DP9A 2A5GA 4GDFA 4RVOA 1MV5A 4D9BA 3H7AA 4F5YA 1O95C 1DXQA 3I6QA 3R2JA 5ITWA 5BYJA 1KYZA 5AK3A 3TD9A 4K9QA 1TFRA 4MR9B 4E94A 2C4NA 3HNPA 2P3SA 2Z6VA 1R9MA 3LKZA 5CH8A 2GETA 3BICA 2JFQA 1JTEA 1TVKA 1YR9A 3CRZA 3EULA 4RJKA 5KPDA 3BKXA 1JIXA 4RABA 3HDHA 1HDCA 4AAYA 2WTBA 4U39A 3O5AA 5ERYA 3ZK7A 2WHXA 1H3NA 4I9FA 2V45A 7REQA 1TZCA 2E85A 4KXXA 2GNPA 2IQ5A 4AO8A 2PL9A 1MIHA 1QIHA 1U9IC 3MS7A 3P9CA 3R20A 4NWIA 4MGYR 5A1TA 1SIUA 1B14A 3FI9A 3WRYC 5AUOB 4PSUA 2QPTA 1M2NA 2FOLA 3O8OB 4MTLA 4CR6A 4D9GA 2BONA 3ESCA 4GX1A 1FYFA 3PWSA 2Z1NA 4LG1A 4Y2JA 5F2KA 1OPRA 4JI7B 2WABA 2VDWB 1SJ9A 4WCVA 3DE5X 4BWYA 3ENNA 1T0BA 3G7UA 3NQ41 4P4GA 5ABPA 3ACCA 2PPVA 4YRGA 1PJRA 3BWMA 4RKQA 4HDMB 1D9XA 1NWHA 4B80A 3K9FC 3N76A 3INRA 2BH9A 4D8VA 1OH7A 1VGRA 1G6OA 3SZUA 5D85A 3OIGA 1BEUB 1JW9B 1YVRA 3FKSD 1KJQA 3LFHA 3Q9UA 3OKFA 4ZO7A 3N05A 1E1NA 5IUJC 1QFMA 1J20A 1M6VA 5EIXA 1ZAKA 1XEAA 2XAAA 3CRMA 5EIOA 3SVTA 1HTBA 4NE2A 1PIWA 4I0WB 1DV2A 2H17A 3KK0A 2GM5A 3MJCA 4MOWA 1VC2A 3IMCA 4HGRA 4P3YA 4ZICA 3DDUA 1U8EA 1QRSA 5H83A 2CB9A 3RIHA 3LVRE 3P2JA 1HE1C 3DYIA 4LRXA 5CNMA 3IAS1 1ZD4A 3KB2A 3MWDA 4KAFA 3K0CA 4HDNB 1L8AA 2FETA 3QPUA 4BJ3A 1TI7A 3L5OA 1ADFA 5BRJA 3S1AA 1AX9A 3CEMA 1N32B 1XROA 1LF5A 1HDRA 4B34A 1UDWA 1YE5A 2R44A 4A36A 3BE8A 4BFUA 2FWMX 2D2IA 3QELA 2AMYA 1KMNA 2WM3A 3ETEA 2RHBA 3K1AA 2QD2A 4AB1A 4HRXA 4TS9A 4BVLA 3MTBA 4BZZA 3IDAA 2KQUA 2ZFUA 4JB2A 3ZU2A 2IQIA 1BWQA 1DBVO 2XDQB 2YVAA 2FGKA 3JAKB 3LQ2A 3R0XA 4ERXA 1TGVA 2FWIA 3U7QA 2J5RA 3U9TA 3HCOA 1KA9H 7GPBA 3QA9A 5IZCA 2V9PA 4DAEA 1JXOA 3GDWA 3IKJA 2PRKA 4HLNA 3ZDCA 2WTNA 5DCUA 1C0IA 1WUHS 3HCPA 5JNUA 4RVNA 4R9VA 1KEWA 1NVFA 2DP4E 3W2FA 5J9FA 4HAWA 4NZPA 1JU3A 2VWPA 2AD5A 4FKBA 1XALA 2C5GA 3E1SA 4GXNA 1RKQA 3TLKA 1GTRA 1GUYA 1EXDA 1LLQA 2IP1A 1VL2A 4TRNA 4MEJA 4IXDA 1E7MA 3DOIA 2QGFA 3LA6A 3MQ4A 2VAPA 4P93A 2PKXA 4NEHB 2OZLB 3TFWA 4FNOA 1JKJB 1OYVA 3IMFA 4RPJA 4F86A 2DH5A 1PG2A 3OZDA 1BXZA 3VNAA 4F93B 4LC9A 2TMGA 1W88B 4OQLA 1U0JA 2VNHA 4UQLA 3I9FA 5IFKA 1G5IA 2I22A 4GMKA 2W2XA 4GZMA 4TV8F 3IE1A 1V25A 3IEVA 3EBPA 1S02A 1QGZA 3QY9A 3OFNA 3K30A 1ACMA 2H85A 1Y3CE 2R4UA 2YZKA 1A8SA 5JH7F 1KJNA 3LSTA 4BEVA 2CBXA 2V7WA 3RBXA 3D2LA 4F4CA 5KBYA 4XB6B 4YAUA 4DSTA 4P7BA 1EVZA 2Q99A 2YHIA 1NLMA 3NBXX 3K32A 3QG5A 5CUQA 3GLGB 1H69A 4AMZA 3HJCA 5B7GA 2IELA 4I4NA 3CKMA 4OY3A 1FFHA 1JTVA 2Y0DA 1GZ7A 3Q8WA 4GKBA 4BECA 5BV8A 2FFQA 3PJRA 2ZR9A 2PE5A 1J1ZA 4LAFA 3D6VA 2OP0A 3ORHA 2I8AA 3DAYA 1DRJA 3UMJA 4EKNB 4F9GA 4EA6A 1WDLA 4UTNA 1XPUA 1B1AA 2W48A 4A26A 4EITA 4GNKA 5AIAA 4MS1B 2A0UA 4EKIA 4FYIA 4JI2B 1CDEA 4JK3A 2J07A 3KYIB 4KAXA 4RMIA 5AFSA 3KQTA 4OA5A 4QPNA 5EVJA 3ZG6A 3O21A 1LCIA 2X7HA 1OLSA 5LQRA 1CVRA 1GA1A 1ISIA 1XQVA 4BO9A 2E21A 3U16A 4U9HS 2PUHA 2FN7A 3KCNA 4GRIA 1ZN8A 3GOHA 5HJ2A 3WWEA 5LIRA 4BGDA 3F73A 1X3SA 4CM1A 2MTBA 3BORA 2E18A 3HFGA 5E6UA 2XHEA 3G8BA 2UZIR 5AJUA 3VR4H 5KO2A 3JQDA 3F1LA 5H1YA 3L0CA 4E6EA 1EA7A 1UKCA 1YULA 4GE3A 4DCVA 5JIBA 1QGDA 5AVOA 2AZMA 3K0FA 3OH8A 3U40A 3AF1A 2IYYA 1RJWA 2VJLA 5DXAA 3RNOA 2AC7A 3JVVA 4PFKA 5CPFA 3TMAA 4ZCMA 2AQKA 3NKFA 1NP3A 3LHSA 1IN4A 3KX2A 4IS2A 1I3KA 1TFUA 2PT6A 3P0RA 2GXQA 4RDCA 3ANSA 4YT8A 5EMJA 1NW9B 3TZEA 3BT7A 1JHUA 3LUPA 1JJVA 2XX3A 4RQAA 3O6VA 1FRNA 5H9VA 1FEZA 2FSVC 3KQOA 1EJ2A 1MU0A 2PRSA 1ILWA 4O4LB 1MLDA 1VA5A 5CVDA 3UT5B 1IIBA 1IM8A 3JD2A 1A8HA 3GRFA 1ZMXA 4CR8A 2DY1A 1FLVA 2NACA 2DUWA 4H2DA 4PYKA 1TUIA 3V5NA 5HQTA 1T5LA 4MVJM 2JH9A 4MPPA 2YHSA 2FRVA 2ST1A 3EZFA 3F96A 4LV6A 3C3PA 1O6BA 3ZE7A 1SHZA 1ZUIA 3ZU6A 3C1TA 2I87A 4UDYX 5JCXA 3H2BA 4BNZA 3PENA 2CXQA 2W70A 1OFUA 4HAUA 8OHMA 1KERA 5K8TA 3I23A 1ZW6A 4G6ZA 4YRIA 2F48A 4K9NA 2LCFA 2WHEA 5AOVA 1EK2A 1PJ8A 1LI4A 3DOFA 4NFHA 3BD8A 4KGDA 1KU0A 2OMKA 4MS4B 1GPBA 1UMBA 3BSYA 1YZHA 2XECA 1UBJS 3Q8LA 4EYKA 1HDOA 2PRZA 4CMBA 4QQFA 4JI1B 1T1JA 4C21A 2AN4A 3OE7A 2FEPA 2I7CA 3AU8A 1UBLS 4MX8A 4V0QA 1Q20A 3SHTA 3FLAA 3A36A 3FUXA 1MB0A 4ND4A 4EPYA 2UVDA 4F5DA 2UZ1B 5FQNA 4EZEA 4LJLA 3NFYA 2L17A 2E55A 3GA7A 1EP2B 1WAMA 1XRLA 5IG2A 2JANA 1K3TA 2XIJA 3ANYB 2HWUA 2PA0A 2RJOA 2ERYA 2DKOA 1RE0A 3S1SA 5BV0A 2F9MA 1UC5B 4EPWA 5CFOA 5DYYA 1G8MA 3UJHA 3P9RA 3ZWKA 1PT6A 1XTQA 3A8TA 3GEDA 3QUQA 4K6MA 2UVPA 1FE8A 1DRKA 1ZH2A 4Y1RA 3TRKA 4LN1A 5B36A 1EGVB 2B8WA 2LGJA 2SKEA 5D3KA 1P0FA 1KWKA 2ZB3A 3N2EA 1FFSA 3M1YA 3GD7A 3OPYB 4MV8A 4IBOA 4DC9A 3EIEA 3BCUA 3N8NA 4HDAA 5K7SA 5F12A 3EJ6A 3HY4A 1KP3A 1KYYA 1OA1A 1ISHA 1WDWB 2IKSA 1WQ4A 5EPOA 4J7UA 4DKJA 1RDFA 2NU6B 4P7GA 1JIJA 1QVAA 1Z2PX 1U7OA 5COQA 3QFHA 3EXFA 2Q5CA 4I3FA 4OQMA 2XTZA 4A23A 4IQFA 2AJTA 4RLFA 5TMBA 1XCLA 4U8HA 5G4KB 4D3DA 4EG7A 4YV7A 4DCNA 4EH1A 5IVPA 3U7GA 4M8SA 1CQWA 3JQAD 5AICA 3EGDB 1OJLA 2GEBA 5A9SB 1YGPA 4KQXA 4J43A 3WHKA 2Y4OA 4P4SA 2MMCA 3ELWA 3OFJA 4NBSA 1VHQA 3FY4A 3RVQA 4B85A 4DMMA 4XX0A 4C3OB 3O8BA 4BJ5A 3BTOA 4E5NA 1E8DA 1Q1AA 2NXEA 2RDMA 1I7QB 2FZEA 3DBRB 2WJVA 1IQ0A 4X41A 5DYIA 3RKUA 1TQ2A 2AE1A 1R0ZA 3IVAA 1JFTA 2SBTA 3QSYA 4OQNA 1Z0FA 1PLJA 3O03A 4GYJA 4KX3A 5L3RA 1JECA 3TW6A 3WQRA 1PV2A 4CM8A 4QGSA 2R97A 1QE5A 2VCEA 2IPMA 3G2MA 4RFSB 3MWEB 2PKCA 4EVRA 4Y0VA 3F5SA 2BMFA 3O91A 3HJRA 4RELA 5DNVA 2XWPA 1TEHA 2FRXA 5FNVB 5K3AA 2IV2X 2WSBA 1UWLA 2C96A 2DHRA 2WIKA 1ATIA 3L05A 4UBMA 3AR4A 4PW0A 2ADFA 2QRZA 1IVSA 5KWSA 1NR5A 3PR2B 3QYJA 4V2UA 1Y42X 5TMDA 1NGSA 2G0NA 5HUHA 4LX0A 2DTXA 1NW8A 5HKLA 4B6OA 1YZNA 3PJGA 4OJKA 3KQHA 1LPMA 3ZE9A 4Z99A 4D6XA 4URUR 4BQFA 1UKYA 1BIFA 1XNGA 4K9DA 4JJIA 5CNIA 2A59A 1AV7A 2PG3A 2QX4A 4MPJA 2AZTA 3FAKA 5LPNA 4W8GA 3AT1A 1U0GA 2FUEA 4QXMA 3FDXA 4G1VA 3BFJA 4YV1A 5IRCD 5LP6F 3R6TA 2C2HA 3KC2A 3FNEA 3KELA 4DTCA 4FU0A 3N0VA 3OOSA 2HZBA 2JJ2A 1SNYA 2DRIA 3X44A 1HFEL 1X86B 2QSUA 1UK7A 4Y6LA 5DW0A 1C5KA 2OCBA 2JHAA 2Y9PB 4KN9S 4A0RA 4NYIR 1X7ZA 3BIOA 4E5MA 2XZTA 4G1EB 4EFLA 1AHNA 3BJEA 1NI5A 1ZNQO 3GZ4A 3M82A 1KAGA 4RADA 1KI6B 4AY5A 1ZQ1A 3DUFA 1RXEA 3D8TA 2DBZA 3QBDA 3L1KA 4L9SA 4IW3B 4OBXA 5GGYA 4DMRA 1P7VA 5LQMA 4KQIA 4JQZA 4KVAA 1FDRA 1Z5OA 1MEOA 1JXAA 2P9EA 2V5UA 2BGTA 1WQ1R 2RGBA 4RENA 3HI4A 2QUAA 5TT0A 4AJ1A 4E14A 2XB8A 3RRMA 2Q7DA 4BX2A 3DFZA 1DHRA 2F4NA 4KJZA 5EEHA 4FT2A 3UWPA 4O2AF 4R2MA 1BKDR 3THYA 1BGWA 2CCKA 1NBHA 3CU5A 2P30A 2R4QA 1C1YA 3L9XA 2VBCA 3GYGA 1ESNA 1PL7A 1DC4A 2BHRA 3H5OA 3O74A 4K86A 3PUJA 4TMKA 1B0ZA 3UAGA 4C0WA 5K0SA 3AH8A 4EJFA 3CJQA 3CUUA 4KE6A 4P4TA 4RSMA 4LF5B 4JMLA 4I55F 1HXHA 4EO7A 4AMGA 4JT2A 3NBUA 1ND6A 4PZDA 3RU9A 4Y7DA 5B53A 2F3QA 2OFOA 3K2EA 4KZPA 4HNVA 3OUUA 1FFCA 1ZUD1 2OZVA 3A2LA 1Y81A 1PS9A 3HYSA 2IGTA 4BB6A 4BE9A 4D6YA 3EMVA 4DR1B 4Z53A 1H2RS 2GDJA 1PJ4A 4MDHA 1L4YA 1A9ZA 1Z6PA 2H8KA 3M4XA 4HDKA 1GPLA 3H8SA 2D0IA 5ALKA 3EPRA 4PBSA 1SCNE 3TZ6A 3K70C 3GJ3A 1XDBA 1D2MA 2RGNA 1U2ZA 2VJMA 3WRWA 3IQWA 3N59A 4GR5A 3HCAA 2J59A 3NOVA 1GN8A 3JRNA 5DEIA 1JG6A 2DAPA 4L4RA 1WQ3A 5ALQA 4QG3A 4DUYB 1GGEA 2NU7A 3RQIA 3WSVA 2IPLA 4KIJA 2HYDA 3ZCUA 3BREA 1OU0A 4ZVRA 4OLBA 4U6NA 4TTRA 3GVIA 4FD2A 1SXQA 2BSAA 2GAAA 4QU5A 3W5CA 3TLGB 2P9JA 4OXNA 3R3HA 1YSCA 2FZ4A 1JU9A 2RKBA 2O2ZA 1LX6A 2ATIA 2QPOA 4ENWA 2X3FA 1MO5A 1T3GA 1Q1GA 1U5AA 3NASA 4E32A 4Z4HA 2LDBA 4R31A 1R5NA 2F67A 3OCJA 1G5RA 1AZSC 5FPTA 3R7FA 3T5GA 3BXFA 1CY0A 3BXGA 4PLTA 4H1UA 4L15A 4JP3A 4UJ3A 2VFAA 1KMIY 3AUFA 2AIRA 1QHIA 2ZIZA 5CLHA 1J2EA 4FKZA 5EKSA 3RVPA 1N9GB 2Q9UA 2XYRA 3V4ZA 4ZMBA 1P8JA 3A3KA 3DHEA 5BNZA 4FJ1A 1RXWA 2RBEA 3GQBB 2QVXX 3KU4A 5EIHA 3H4TA 2BRUA