3QQPA

Crystal structure of 11beta-hydroxysteroid dehydrogenase 1 (11b-hsd1) in complex with urea inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
270
structure length
270
Chain Sequence
b'QQPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Homo sapiens
publication title Pyrrolidine-pyrazole ureas as potent and selective inhibitors of 11beta-hydroxysteroid-dehydrogenase type 1.
pubmed doi rcsb
total genus 99
structure length 270
sequence length 270
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qqpA00
1XR3A 3DZHA 3OHSX 3ZHYA 3ZNNA 4DQUA 1KBZA 3NT5A 4J0EA 3JQAD 5EPOA 1MC4A 2I99A 1ENZA 3CMMA 3EUWA 4UVHA 4KUGA 3SC6A 1WP4A 2NTNA 4IJUA 4K9DA 4WLUA 4Z0PA 1BXZA 4AG3A 3CH6A 3PRJA 2B37A 3K9QO 4J1SA 4BMVA 4B4OA 5JYEA 2Y1DA 4GPD1 1FXSA 1E6UA 1KEWA 5EINA 3FR7A 3JD4A 3M2TA 3NJ8A 4O1MA 4A2CA 1O95A 3GVHA 4PZCA 5G0UA 3ZWVA 1KVTA 4BO9A 2VNSA 1JKIA 2O4CA 4ID9A 2GRAA 4GKBA 3PZBA 1M6WA 1A9YA 2W90A 1E3WB 4KTVE 2EKPA 1I33A 4QXMA 1L7EA 4M8SA 4UEKA 3F3SA 3ZHZA 1XGKA 4GX0A 2FR1A 3QVWA 1LDEA 5JPIA 4R69A 4FFPA 1BSVA 4MVJA 2FSVA 3HJAA 4EGFA 2GN6A 3DBRA 3MEQA 2A9FA 4OXYA 4Z3DA 1UXHA 1B7GO 4CMHA 4RQUA 5DDIP 1RPNA 2WYWA 4J7XA 4RL6A 4LSWA 4IUYA 5CP8A 4J4HA 2PZJA 4XD2A 3GVCA 3GGGA 3MJSA 1DJQA 4NBWA 3I52A 1VRWA 4WK6A 1LRJA 3LDHA 4DRYA 2CD9A 3O4RA 3U4IA 2ZJ0A 1IL0A 2O3TA 1TXGA 4JBHA 3U0BA 1IY8A 1X1TA 3ANLA 4CM7A 2AEFA 3I6QA 3IC5A 3ONFA 2Y1FA 4U6SA 1F0YA 1QV6A 1YL6A 3GC6A 3INGA 2PNFA 3JQEA 5F1OA 4BMSA 1U2GA 1YWGO 4D3DA 1LA2A 4RVFA 3QVOA 1E3LA 3PEFA 4ZICA 5BSFA 5I8ZA 3H5NA 4JROA 5DP1A 4W82A 2BI7A 5G0VA 4BNTA 1I2BA 4CLDA 3PYMA 5K9ZA 4K26A 1AXEA 2PZLA 3FWZA 1I3MA 2DTXA 3JQAB 4W7HA 3E1KA 4AJHA 1DJNA 3GLQA 4XYEA 1P3DA 5T67A 3ONDA 3ETGA 3O38A 3STHA 1ZVMA 3L6DA 1KETA 3RC1A 2RCYA 2EXXA 1QYVA 3NGXA 3PQFA 3D1LA 2ET6A 2TMDA 3RUDA 2GZ3A 4CM8A 1HYHA 3GZNB 5MDHA 1CDOA 3E82A 2UVDA 2DTDA 5TSDA 4QTZA 4HNGA 4RCVA 4A5OA 4ND4A 4HP8A 4TZTA 4GLOA 1DRUA 1WPQA 4R3NA 1GU7A 3E5MA 4BKOA 5EQFA 4E2XA 4TZKA 4GVXA 5K6AC 4DQVA 1AHHA 4L0QA 1YXMA 2CF5A 2ZTVA 2UUOA 1F17A 1U2DA 3NTRA 3QWBA 5CEFA 4WEOA 1PZFA 1WDKA 1IZ0A 4XQEA 5KVQA 1WZEA 1A5ZA 4FGSA 2GERA 1NQTA 3B1KA 3L4SO 5A3VA 1ZH8A 3H9EO 4R5HA 3CIFA 1H9BA 3ZHXA 1HDXA 1NPYA 3BMCA 3NDRA 3I9JA 1LLQA 3PPIA 4BIIA 3LSYA 4XQGA 4YRAA 4YYZA 4B8ZA 3QVSA 1DC6A 2C2XA 2G5CA 1NVMB 4BGIA 3AU8A 4J9UE 3BHMA 2PD6A 1UXIA 2Y0DA 1J0XO 3KTDA 2EP5A 4OL9A 3UXYA 2VHVA 1OAAA 1E3IA 3JQBA 1X13A 4YJDA 4XWYA 1G0OA 1XA0A 3A06A 3GNSA 5GMOA 1ENOA 4BB6A 4BGUA 1UUFA 4IDBA 4B7UA 4LRTB 1HTBA 3A4VA 2EKQA 5JAIA 4MP3A 1ZSVA 1FJHA 4FC7A 4ZRNA 1WZIA 3UVEA 3SLKA 3VPSA 4FS3A 4F6CA 1GEEA 2CDBA 3PJFA 1RM4A 4JX8A 1GZ3A 2NM0A 3RI3A 3KLPX 1P33A 4II2A 1DLIA 1B14A 5KVVA 1PGPA 4CM4A 4L4SA 4DYDA 4MP6A 1JWBB 1BXGB 2BGMA 1MLDA 2Q1SA 4Z0TA 4H16A 1HKUA 5IN4A 1WDLA 3WGYA 2CVZA 5GZ1A 3V2GA 2UUPA 1FMCA 3RJ5A 5TNXA 4MKXA 3OJFA 4U5QA 4D45A 3H5RA 2E49A 1NR1A 1EMDA 2RIRA 1DXYA 4N7RA 5TT0A 3SBOA 4KQWA 1JKFA 4BVAA 4B3IA 1E6WA 2DKNA 4QUKA 1EK5A 2VWQA 5DCUA 4CM6A 4AFNA 1SEPA 3JYLA 1TVEA 4Q3NA 1XKQA 3KUXA 3PTZA 4CLOB 4RZIA 2ZYGA 4U0JA 4BNIA 3IDSA 2CDCA 2CF6A 4IQ0A 1C1DA 1Q0QA 3R3JA 3D4OA 4IS3A 2HU2A 3IS3A 5HWSA 4UULA 4S3MA 4BNKA 3FNFA 2OXIA 1FDVA 4RO0A 1LQTA 1ISJA 3DHEA 4QEDA 3ZV3A 4CMGA 1NR7A 2NQTA 3DBHB 3JV7A 2OBNA 4Q3EA 4QX6A 2X9VA 1I32A 2EWMA 1ISMA 4BHTA 3WGHA 2DAPA 4FFRA 4PCVA 2NWQA 1D1TA 2VUTA 3ICCA 3JQBC 1ZBQA 2NSDA 2BGLA 3KV3O 4HBGA 3UHAA 4HUJA 1X14A 2HUNA 4CM9A 3WS7A 4ZA2A 4XDYA 2C2YA 2C7GA 1KVRA 4R01A 1DIGA 2FPGA 4N5LA 2J8ZA 3WGZA 1PQPA 4QO7A 3I3OA 3KOUA 1YJQA 1R4MB 3RU9A 4A26A 5IZ4A 1R37A 2ZTLA 3ZU5A 1JW9B 3FBTA 3GNQA 2Q1UA 4GH5A 1ZXLA 1ONPA 1NX6A 3GZ4A 4GI2A 3I4CA 2XAAA 4CMIB 2OHXA 4BNFA 1XDWA 4S1VA 4E13A 3F4BA 5COAA 3I9LA 3TJRA 2ZQZA 6ADHA 2QZZA 1PJBA 1ZO8A 4UAGA 2JCYA 2WM3A 4UVDA 1Z7EA 4CR7A 4WLVA 3F9IA 2FR0A 2PA3A 4B3JA 1CIVA 3AOEC 4KUHA 4JJGA 4AICA 2DFDA 3MOGA 4X54A 2XF8A 3DTTA 1YOVB 4IJVA 8LDHA 4OAQA 1CQIA 1IE3A 1HF3A 3MOIA 2Q45A 3OIFA 4U0KA 4XA8A 5TRTA 2V6FA 1SEVA 3GEGA 3E6AA 4YRDA 1JDJA 2X8LA 3BIOA 1V3VA 4RPHA 4YEDA 3Q9UA 1YB4A 3C7DB 1MB4A 3DHYA 5G2OA 1A4UA 4BNJA 4WNIA 3OJEA 1XSEA 4NU6A 1ZSNA 1QORA 3NRCA 5COQA 3WTBA 4DTIA 1Y8QA 4OOFA 2YHUA 4XGNA 4EZBA 2E48A 3PWSA 1P0CA 1YGYA 5A9TA 4BV8A 3OQ1A 8ADHA 2CMDA 2XXBA 4UVGA 4URFA 4OSOA 1HE4A 4MVJH 1TLTA 2CNBA 3F6YA 4DPKA 5CDTA 2VUSA 3AI2A 1J5PA 1I0ZA 4P4NA 2BLLA 1MC5A 3IKTA 1PWXA 2EJWA 1NNUA 4WE3A 1PGOA 3ZV4A 1GUFA 4R51A 1YJ8A 3C7AA 3DQPA 5JMPA 2D8AA 1K6XA 3QWFA 1EVJA 1NFFA 1BTOA 1Z73A 2NTJA 1N5DA 3ROPA 1XIVA 2QX7A 3DFZA 3IP3A 2GN4A 3H9JA 1XU9A 2QYSA 2IRWA 4BO3A 3GAZA 4XGKA 3Q9NA 4WEQA 4YJHB 3QA9A 3OMLA 3HNPA 2NUAA 4PZDA 1JLLA 1LSUA 4UEJA 4RORA 4QT0A 1UJMA 4AJ4A 1UP4A 3PJEA 2IDZA 3QP9A 1KEVA 1ZMTA 2NU7A 3BMQA 3GH3A 3VPGA 2QRLA 5K0ZA 2AQ8A 3WGIA 1VM6A 3DONA 2O7SA 4XKJA 3ZH2A 2R6JA 5IAAA 3LLSA 3QSGA 2AQIA 5ENVA 1K6IA 4J1TA 4E21A 4OQZA 2HK9A 1U5CA 4HX5A 1UH5A 2AG8A 3ROKA 3JQ6A 2HLPA 4M54A 3WGQA 4CMAA 3JQAA 1GAEO 1U4OA 1DLJA 1PJ2A 5HRUA 3BA1A 1B8PA 2VHZA 1JKJA 3AUSA 5U9CA 1D4FA 1T26A 1DB3A 1GFSA 2VYVA 2CVQA 3Q2KA 5K6AA 2OL4A 4YRBA 5CAEA 5T5QA 1UXJA 3JQ9C 3KYDA 1ZK3A 4YTEA 1JAYA 4TRJA 5TF4A 3U4DA 3DAGA 3HG7A 2I65A 3O9ZA 4G81A 1ISIA 3UW3A 3LC1O 1MGOA 4YT5A 2OBYA 4RF2A 4DLLA 3GK3A 4FPXA 4EJ6A 4AJPA 5EN4A 4IZIA 5KJ1A 2ZIZA 5DOVA 4C7JA 4R1SA 5F21A 4KOAA 4TVOA 1CF2O 3VDRA 1F8FA 4FDAA 4XRRA 2JFHA 4OO3A 3WJAA 4ALMA 2B4TO 2VHXA 3RIHA 1LNQA 1SCUA 4Q9NA 5B4UA 4O6VA 1XQ1A 4EJMA 1KC3A 3WICA 4B79A 3MWEB 3T4XA 1B8UA 3C3XA 4YAEA 2D1YA 2PD4A 5TGDA 2HRZA 3CINA 1EBFA 3V8BA 5ILGA 3W6ZA 4JLWA 3ZZNA 1QLHA 3JD2A 3FR8A 1HDYA 3Q0EA 5H82A 3RCBA 1GTMA 3HDQA 1KC1A 4IGFA 2ZATA 1R4NA 3NDIA 4PGFA 2PLAA 5CPFA 1QP8A 3VH1A 4D79A 2EIHA 3CUKA 4BS9A 4TWRA 2O7QA 3U49A 4XDZA 2X58A 3LU1A 2EERA 2AE2A 1E0DA 3QY9A 4ZQHA 4O59O 2BD0A 4UUNA 5KKCA 2GYYA 3EVNA 3KRTA 5BT9A 3GDFA 1BWSA 3TQHA 1MFPA 3P7MA 3OJOA 1P0FA 4R1TA 1JTVA 4LCJA 2C0CA 1LQUA 4OHUA 4FD3A 4L73A 4CM3A 1FF9A 1OFGA 4GX1A 3RSHA 2C29D 3CPSA 1UP7A 2J5QA 1N9GB 1V3TA 3TF5A 3D4PA 5CEJA 3TL2A 1K0UA 1HE2A 2VYVD 3EGOA 4AJLA 3NX4A 4DA9A 3ROMA 4J0FA 3AM4A 4I5EA 2A4KA 2CFCA 4D0RA 4IDGA 2GD1O 4N5NA 1QYCA 3MTJA 1DRWA 4JCOA 4BB5A 1RYEA 2DVMA 2X5JO 1C0IA 3RJ9A 4RQTA 1GADO 4Z0HO 3TFQA 5CG2A 1MX3A 5U1PA 4Y6SA 3ANMA 2LDXA 2VQ3A 3TZHA 1YBMA 1ZIDA 1ZUD1 2V6BA 4LVUA 2PR2A 1QR6A 4GWGA 3GMDA 4HADA 3DEYX 3AI1A 1T2FA 3FNEA 3WQSB 2GGSA 1LDBA 4E2ZA 1C1XA 4R9RA 4BNWA 3P2YA 3HQ4O 3JQDA 1CWUA 4IDFA 4FB5A 2PGDA 4OOEA 3RBZA 4DL9A 4HV4A 3PXXA 3VZQA 1GUZA 1YO6A 4MKRA 2YV2A 5AXCA 2F1KA 4OMUA 4CMEC 4YPOA 2X22A 1PWZA 2ZB4A 3KSZO 3ZW8A 3I4FA 3I6IA 4ONEA 3K2EA 1GDHA 4HFRA 4JQCA 1PJ4A 5EJ2A 1LDNA 4XYMA 1U9JA 4M1QA 5G4LA 1E7QA 2FPIA 4NK5A 2GUGA 4WGGA 1H6AA 2W2KB 1X15A 1UAGA 1A27A 4NMHA 4FQ8A 4IIUA 2AE1A 3DTYA 4Z3KA 4DXHA 1DAPA 3B6ZA 4BNNA 3U4HA 2Y93A 2CZCA 5DNAA 2PKQP 4IDEA 3H4VA 5AOVA 1Z6ZA 2O3SA 2QRJA 3U09A 4LW8A 3WGGA 2NTVA 3WOHA 5TJHA 3WNVA 1CJCA 4J6FA 4NDNE 3VZPA 3F5SA 3PYXA 1SNYA 5DBIA 3WSVA 4AL4A 4TMFA 3ANNA 3ZWYA 3HFSA 4H3VA 1DC3A 1W4ZA 3ZHBA 2VRCA 3HUDA 4DYVA 5JE8A 3AW9A 2EJVA 3HN7A 5IF3A 2BELA 4U8GA 4GGPA 2PZMA 5ES3A 4DMLA 3V2HA 4MVJG 3NJ4A 2PY6A 4GMFA 4DIBA 3QWAA 5ENDA 2VWPA 5AXBA 5A4DA 1Y1PA 4YT2A 2DFVA 2Q2QA 4TSKA 4ALJA 1DIBA 1P1RA 4CQLA 3DR3A 5A5FA 5I9NA 2GNAA 4F45A 3QE3A 4CMJA 2BFAA 2R00A 1JAXA 1SOVA 1UP6A 5DOZA 2HMWA 2IYPA 3ZU3A 5ITVA 2X23A 4P4LA 1DFIA 3D5TA 3OJLA 1HE5A 5L7YA 1A72A 4RF4A 1KERA 1Z7BA 3HFGA 3JQ7A 1UDCA 1ISFA 3U62A 2H5LA 2VHWA 2YDYA 1BVUA 4XIYA 5TLSA 3DZGA 1I3KA 1DBVO 3QV1A 3GEDA 1Y8RA 1N7GA 1OZAA 1BRMA 2H9IA 1C1DB 2YV3A 3JSAA 4AJ1A 4IBOA 1YQXA 1E1LA 2BH9A 3ABIA 1MP0A 4I5FA 1HRDA 4OYRA 5LDGA 2P9GA 1O8CA 2HAEA 5LC1A 3B20A 1CQJA 2B83A 1I2ZA 3HDJA 4YB8A 5KVSA 2B4RO 4RPJA 5DN9A 4QFCA 1PGNA 1E3JA 1QXSA 4BNVA 1E92A 3U4CA 1Q7BA 1EFLA 4R54A 3RUIA 4INAA 1I36A 1ULSA 1U3TA 3KEOA 5TT1A 1SAYA 1NP3A 3DAFA 1DFHA 1NHGA 2HK7A 2Y66A 4JP2A 3UKOA 3MZ0A 3RVDA 1XLTA 2YHIB 1IHYA 1YS4A 3AWDA 1C0PA 3M2PA 5IDYA 2PV7A 3U5TA 4EUFA 1DAOA 4RPGA 1FK8A 1Q2XA 3EW7A 3COSA 4ZQGA 5BNFA 3RFXA 3V1UA 2WEKA 1DRVA 3OEWA 2AG5A 3FD8A 1GEGA 3DBLA 4Y98A 4KUEA 1Q0LA 4Y67A 4M49A 1Y81A 5THQA 4NH4A 2V65A 3RC2A 3TRIA 1AE1A 4G2NA 4OKIA 2JFGA 1P1FA 4JXKA 1DC4A 3VVCA 2D5CA 2Q1WA 4PLPA 4PLHA 1PS8A 1ID1A 3T7CA 4IQGA 5F5NA 3OM9A 5I7FA 4BNHA 3IL2A 3AM3A 1M66A 5CDUA 4MPDA 4UUPA 3AUAA 5C5IA 4OM8A 3HB5X 4RDIA 3HSKA 1MG5A 3GNTA 2B0JA 1QSGA 1O0SA 4M87A 3VOSA 1DDOA 5EL0A 5IFLA 1VL8A 3EMKA 3PDJA 1EFKA 3WLFA 3ZGYA 4J43A 3IP1A 1TT5B 2WWRA 4YWJA 2Q2VA 4RPLA 5ADHA 4CUKA 1D8AA 4LN1A 3KYBA 5F1PA 2EW8A 2G1UA 1YB1A 4R3WA 3EZLA 3KSDO 4WLFA 1Q0HA 2YFHA 4KDFA 1ZNQO 3WMWA 3V5NA 2C54A 4RVUA 4L75A 1A7AA 4GKVA 1BMDA 2C82A 2JFFA 4ALKA 4CQMD 4DVJA 4XQCA 5TC4A 4D42A 4ALIA 1E1NA 2Z5LA 3VKUA 5DF1A 5CFZA 2FOIA 3DBVO 3ZU4A 4BNMA 4WKGA 2BFPA 1JWAB 3W1VA 1NQAO 1PR3A 3WGOA 2FZWA 1LSSA 1CETA 4J1QA 4ND3A 2VCYA 5EESA 1I10A 3ZNQA 4HWKA 4PRLA 1LI4A 2V7PA 7ADHA 2YFQA 9LDTA 2ZB8A 1LX6A 1HWYA 1GQYA 5JS6A 2FPPA 1LLUA 1QYXA 3GHYA 4J7UA 3PIDA 4OQYA 4Z9FA 3TNLA 4FJ1A 2RAFA 4A03A 2DU8A 2J6IA 3ULKA 3DB2A 3ZWWA 3K73O 1WDMA 2AXQA 3UN1A 2ZYDA 2IE0A 4RLHA 1WMAA 5C7OO 2B35A 1EE2A 3PLNA 4GGOA 3IOYA 1T4DA 2YHIA 1GUYA 1U8XX 2EKLA 3I23A 3JD1A 4B4WA 5JSFA 4YA6A 3E9MA 3U3XA 1E7WA 1E6EA 4ZU3A 4J7CA 3LC7O 3H8VA 1NQ5A 2VWHA 4BV9A 2VT2A 1ISHA 4BNLA 3P2OA 1IYZA 4E30A 3JQ7B 1WAMA 4ZHSA 1HYEA 3SVTA 1H5QA 2DUWA 4IDAA 1U3VA 2G0TA 2BI8A 4E5YA 3BYZA 4J4TA 1OC4A 2YUTA 3QW2A 2YJZA 3SEFA 5DZSA 2V6GA 5KWEA 1X1EA 2YW9A 2P68A 4W9NA 1YQGA 3CSDA 1NQOA 3ZW9A 5CG1A 1QMGA 2WE7A 1ZK1A 4XZ3A 4PG8A 1YVEI 4FR5A 4II3A 5IDQA 1EK6A 1ZEMA 1ARZA 1F14A 1F06A 2D2IA 4EUHA 3I5MA 4IPTA 4BKRA 1T24A 2I6TA 4O63O 2W8ZA 4XYGA 4D3FA 1QRRA 3Q6IA 3DBRB 4DIOA 4W4TA 3GN2A 3VPXA 5A03A 4BUCA 1ZMOA 3K8ZA 3WNQA 2D4AA 1VL6A 4JIGA 1HDCA 3KEQA 2Y05A 2BF7A 3MTGA 4DPLA 1Z82A 3H9QA 4LGVA 2Y0CA 3WFIA 3JD0A 4C7KA 1UZLA 4I5DA 1BDBA 3PQDA 5G0TA 4BNZA 1DC5A 4UVEA 3MJCA 3O03A 1VPDA 1YE3A 1O6ZA 4CLHA 3N74A 3PGJA 4CQMB 3GAFA 3KLMX 4A10A 4CQLB 2C5AA 4GSLA 1J6UA 1H94A 1BXGA 6LDHA 4YQYA 4M55A 3FTPA 3CZRA 4PLWA 3WTCA 5LDHA 3G0OA 4XJTA 5TQVA 4BNGA 1D3AA 1GR0A 4PZEA 3BMOB 4E3ZA 3GVPA 4WOKA 3BMNB 2PKRA 4WCDA 2W2LD 5HA5A 1MXFA 3DXFA 3JD3A 2I3GA 2HMUA 1H2HA 1R12A 1T1SA 2O50A 2ZTUA 4MVJM 3OETA 2E4AA 4NHEA 1P1KA 3KXDA 3WIDA 4CV2A 1VSUA 1IZ9A 5GY7A 2DC1A 2EG9A 2H1SA 1VKNA 1LRLA 4TRRA 4BO8A 4CLEA 4F46A 4FIZA 4UVIA 2R2GA 3N7UA 3E18A 1K6JA 3ZU2A 5TJ9A 1C1XB 4ND2A 3O26A 4DBVO 3H5AA 2GN8A 3OF2A 4ALNA 1MA0A 3OIGA 2PGLA 5FFFA 3E48A 3Q2IA 2W2KA 4O0LA 4DGSA 2X5KO 3IJPA 4B3HA 1CEQA 1EQUA 1VC2A 2OMEA 4KMSA 4J4BA 4OIMA 4OSPA 2O3RA 3CMCO 2QIOA 5FWNA 2ZJ1A 1Y7TA 1E77A 1Y8QB 2JCVA 4RVDA 2WJPA 1DFGA 3TZ6A 5IZCA 1PL6A 5CDYA 1QKIA 4EYEA 5EMHA 5KCZA 4CL3A 4Y6PA 4XB1A 4KDEA 3TSCA 4P38A 5JCJA 3OFSA 3IJRA 3RASA 1YKFA 1PSDA 2VYND 3C1AA 3N58A 3G17A 4BO1A 4WASA 3AI3A 4ZRMA 1N2SA 3VVBA 4UREA 3S2GA 4BO5A 1ADGA 3ENNA 2VZ9A 4JJFA 2AA3A 3OBBA 5HS4A 3GVIA 4NG5A 3EVTA 4QSMA 3GOHA 4UUMA 2JAHA 1EUDA 2JD2A 3VKVA 2Q4BA 3BMCB 3NEPX 4E31A 3ASVA 2A92A 2XOXA 1G1AA 1LSOA 4OH1A 1V0JA 4N5MA 1MUUA 4CR6A 5BSHA 2HMVA 1KEUA 1H2BA 4FN4A 1NXQA 3ITKA 4FGWA 2FP4A 1XELA 1XU7A 4F3YA 2DQ4A 3E03A 4LMPA 3MJVA 3UCXA 1AN9A 1HDGO 2HK8A 1U7TA 2EW2A 4E5MA 1HXHA 4ND5A 1JN0A 2E82A 1N9GA 3I83A 3LT2A 4ZJUA 1T2AA 2B5WA 4L9RA 2X4GA 2FZEA 1P9LA 1KVSA 3NKLA 3BMNA 4YCAA 2PWZA 1KOLA 3S2EA 4WUVA 2E6UX 1KEPA 2G76A 2HCTA 4IY1A 1I24A 3PIIA 5KJCA 3WSWA 1EDOA 2Q99A 2AEJA 2EEZA 4U6QA 1M76A 3MWDB 4PG4A 4CLRB 1ML3A 3GPIA 5I7SA 2RHCA 2J5RA 4BKQA 5T8KC 2GDZA 5L4SA 1RWBA 3DZBA 5JYDA 3PVZA 1V3UA 3ZDFA 3JYNA 1T1RA 2QQ5A 4FJ2A 4DREA 5IDWA 1PJCA 1S7CA 2P91A 3AOGA 1B8VA 3EAGA 3ZWNA 1E3EA 4NK4A 1ZK4A 1SBYA 2CVOA 2IZ1A 3FHLA 3NGLA 4RLSA 4LRSB 5JDCA 5BR7A 1DSSG 2DBZA 4MVJF 2IEBA 3ZWMA 1DO8A 5A06A 3HE3A 2HSDA 1U4SA 1ONNA 4OJNA 3ASUA 3GPDG 2OGUA 2C07A 2FMUA 1GD1O 4BGEA 2B5VA 1DIHA 2OZPA 1UZNA 3AUTA 4IJKA 1XG5A 3IMFA 2NQ8A 2O3JA 3FTNA 2GASA 1PGJA 1NBOA 3ICPA 4ZVVA 3C8MA 2YZ7A 1VL0A 3QWHA 1U28A 4AJEA 2E37A 3GFGA 3A14A 4CLOA 4DQXA 2X6TA 1R15A 2YDXA 3DDNA 4IGEA 3ZNOA 4E32A 5EERA 4I1IA 1PS9A 2BKAA 3PZRA 1Y5MA 4GAEA 5ICMA 3U9LA 2G82A 1U5AA 5L7TA 1BW9B 2LDBA 2I76A 3JQ8A 3WWYA 4E0BA 4E6PA 5A02A 2IYOA 3EK2A 3E5RA 3D0OA 3RWBA 4NZ9A 3EDMA 5JAQA 1Y6JA 3VPFA 2OUIA 1EE9A 2EGHA 2B36A 3OICA 1PJSA 2UYYA 3PHLA 3V2UA 1E7RA 3GHHA 4MIOA 4WLNA 3KHUA 1I30A 2DBRA 4CLRA 2Z1NA 4FJ0A 4I9HA 1T2EA 1K89A 4EITA 5KJ6A 3RFTA 2J3JA 3AK4A 4BO6A 4IXTA 3PYLA 3I9NA 2NU8A 3JCZA 1LC0A 1Z45A 4PVCA 4IS2A 2X0JA 5I9LA 5KIAA 1S6YA 4FSHA 3PHJA 3GFBA 3PHHA 3R1IA 4XX0A 5C7LO 1IPFA 4CV0A 1C14A 1A4IA 1EEHA 1EVIA 2GN9A 5F5LA 4CL8A 3I1JA 1V8BA 3L6EA 1GQQA 2P5UA 2C7VA 1D7OA 4J49A 5THKA 4RVHA 1KIFA 3OA0A 4BO7A 4RJTA 4H15A 3AFNA 3T7EA 4RVGA 3DFUA 4DIFA 3HB4X 1FDUA 3ONEA 1PJTA 5DP2A 4BNUA 1TEHA 3FNGA 3M1AA 3AY6A 3ZI0A 5EQDA 3GDOA 3KB6A 4CJXA 3LQFA 2DLDA 2AHRA 3NUGA 3DOCA 3CZMA 1UXKA 4Y9DA 3G1UA 3MJ4A 3WYCA 2Y67A 1PJ3A 2X1HA 5A9SA 1T2CA 3OP4A 4E4YA 5L4LA 2CDAA 1AXGA 1ZFNA 1YQDA 1K3TA 3GT0A 4PG5A 4J91A 3WLEA 3ORFA 1P44A 4PLGA 2NVUB 3S8MA 2GLXA 1E5QA 4R9SA 4TKMA 3DWFA 5COBA 4BQRA 3INTA 4NQZA 5ILOA 2ZB3A 1GYPA 2YQ4A 3TN7A 3TZQA 3H9GA 4TRMA 4I08A 1BDMA 4R16A 2ILTA 4U7WA 4IMRA 1YOVA 1PZEA 1AUPA 2X9GA 3BZUA 3HHPA 3RC7A 3OJ0A 2WD7A 1HETA 3C85A 1W6UA 3AY3A 1GCUA 1A9ZA 1GZ4A 1PJQA 4DLBA 1ADCA 3UAGA 1MG0A 4YVFA 4CM8B 1HDOA 4L4RA 1F12A 3MJTA 2DTEA 1YRLA 3K31A 3WQRA 3I9MA 3WXBA 5U4QA 3LZ6A 4W7IA 3PFFA 1DIRA 4Q3AA 4HNHA 5JAMA 1IHXA 1P1JA 1GV1A 1JVSA 1PX0A 3DL2A 2GZ1A 3TL3A 3ADPA 3R6DA 5L4NA 2YY7A 2ZCVA 3ITDA 3PK0A 5G4KA 1WWKA 1E1MA 3BTVA 4E2WA 4NFYA 2OP0A 3NTQA 4E5NA 1BW9A 3A1NA 1HZZA 3JQ8B 4R1UA 1OI7A 4K6CA 3DZJA 3W4KA 1I3NA 3AU9A 4YAIA 3GG2A 1GPDG 1YB5A 4B7CA 3A28A 4ESOA 1E7MA 1QLJA 2Q4EA 3OH8A 2P5YA 1U8FO 2FY8A 1ENPA 1PU2A 4PRKA 4G65A 5G4KB 4PG7A 3JQGA 4R68A 1VJ1A 2WTBA 1LC3A 2O48X 1VJ0A 3H2ZA 4CQMA 1PL7A 5J23A 4YT4A 1O5IA 3CEAA 4NIMA 4E5PA 3OQ6A 1HE3A 1YH3A 3LT4A 4J1NA 4MVJD 5HTOA 3PWKA 3RBVA 1HYGA 1YL5A 1PQWA 2O4UX 3AFMA 3DHNA 3GEMA 5DCYA 4D44A 4TROA 3ST7A 4IQ8A 5IXYA 2IZZA 3DZKA 1I2CA 3WYBA 3K30A 4BKPA 4C4OA 1X0VA 1WXDA 4ILKA 3QJ5A 4CPDA 4MVJE 4CMEA 4NBUA 4BNXA 3G1TA 4FOSA 2GR9A 1PIWA 3H9UA 1Q7GA 4AVYA 4IDDA 5JO0A 4A27A 2JJYA 1QV7A 1FDTA 1G6KA 2Q2WA 4XYBA 3O8QA 1TI7A 1UZMA 2VOEA 3RUEA 4E5KA 2JKVA 4BOYA 3PJDA 1E3SA 2HDHA 3GUYA 4D46A 1N92A 1VLLA 1DOHA 5FI5A 2IODA 1JA9A 1R0LA 2F00A 3WB9A 4PN3A 1B3RA 4CM1A 5B4VA 1XHLA 2SCUA 3B70A 3NT2A 1NWHA 3HDHA 1Z74A 2GSDA 2ZK7A 3CXRA 3HDYA 1KS9A 3D5QA 1MV8A 2O3QA 4XJSA 1LDMA 3F1LA 5JMWA 4CODB 1HSZA 1X7HA 3WBBA 3G49A 3LT1A 3EZYA 3H2SA 3K5PA 4I9UA 4WCFA 3LLVA 3K6JA 1DHTA 3IAHA 3ZCXA 4JBGA 1NFRA 2UV8A 1LU9A 3FWNA 2AQHA 1PEDA 1GY8A 1RJWA 1ZCJA 3B1FA 3PDUA 1PTJA 1NHWA 1YONA 2J3HA 5FYDA 5BNTA 4D3SA 1ZJYA 1GZ6A 2BFOA 1AGNA 1YDEA 4FOOA 3FBGA 5JBIA 1VJTA 4I9NA 3EY4A 1H6BA 3BHIA 3TDKA 4NBTA 2Q46A 3D4NA 4ZD6A 2PKQO 2BGKA 1C0KA 3GVXA 2Z1MA 3JYOA 5HBRA 5C37A 3ZWPA 4BQPA 1T25A 4HKTA 4DPMA 4NFHA 3UICA 2RH4A 5IJZA 1PZGA 3L77A 4TVBA 4UUOA 3PJGA 4PLVA 4RV9A 4BNYA 1EVYA 4CV3A 1LDYA 5A9RA 3OEYA 4UEOA 4HFMA 4MO2A 1A7KA 3KM0A 2QG4A 3WIEA 4YXFA 1QYDA 4LCEA 1ADFA 3RQSA 2DBQA 3IKVA 4J3FA 2AQKA 4K1LA 4CM9D 4AJ2A 1Y9EA 1UDBA 3W8DA 1JQBA 2GF2A 3L6OO 3VDQA 1TB4A 4DMMA 3WWZA 3D7LA 3WX0A 5L7WA 2PTGA 2HMSA 3PI7A 3L4BC 4MIEA 1X7GA 3FCOA 3KBOA 1XWFA 3NTOA 1R4MA 4ZQEA 5KNLA 2PD3A 3LC2O 4AJNA 3GG9A 5BSGA 5I8WA 4Y8VA 3DOOA 3VH3A 3WFJA 4BMNA 4CLXA 2BMAA 1BG6A 4YAKA 4Z6KA 4XQ9A 3VPHA 4EEXA 1H6CA 5HM8A 4ZQBA 2Z95A 2IXBA 3RD5A 5I7EA 4RVSA 4PG6A 5I9MA 5JY1A 4R41A 1HZJA 3Q11A 2O2YA 3GQVA 1EUCA 1OC2A 3DBHA 4WCFC 1H6DA 1C3VA 1VI2A 1W8DA 1CERA 3PLRA 3S2FA 4Z9XA 2A35A 3QHAA 3QVTA 5FI3A 2P4HX 4IDCA 4GLLA 1Y8RB 3GGOA 4HXYA 4D43A 4YQZA 2OP1A 4G5HA 2G17A 1M2WA 2NADA 4NJMA 5AVOA 1F8GA 4KZPA 4HFJA 4L4XA 4XR9A 3WR5A 3C24A 1P74A 4KQXA 2VWGA 5BQFA 3OECA 3TOZA 2I9PA 4TQGA 1E5LA 3KETA 3TWOA 2I3AA 2RBEA 4WOJA 3UOGA 2W4QA 4TKLA 5A3JA 3KO8A 3PFWO 5H83A 1ZEJA 4YACA 5AQ1A 1D1SA 4PLYA 1I5RA 2DBVO 5L45A 3I9KA 4IJWA 1I3LA 1P1HA 1V6AA 3M6IA 4RZHA 1BHSA 1N7HA 2O23A 1SB9A 2O3UA 3VTZA 3PHIA 4FFMA 4RDHA 2Y1EA 1G0NA 3WYEA 4WLOA 3DMYA 1EVZA 2NNLD 1YL7A 4GWKA 5GZ3A 3KYDB 2BFMA 1GYQA 3X2EA 3AUUA 1NVTA 1E3WA 1N1EA 4WPGA 3INRA 1J4AA 4IM7A 4J2HA 4MVJI 4B8WA 3GGPA 4D0SA 4E2YA 2X9NA 5GZ6A 1DPGA 5IG2A 2H6EA 5TX7A 3JYPA 4J2OA 3UCFA 2TMGA 1HDZA 1ZXBA 2FHSA 3ZNPA 4NR0A 1W73A 2YV1A 3LT0A 2NU6A 5A1TA 4YBZA 3S55A 2OO5A 3D3EA 2P9CA 4HY3A 3RROA 4NBVA 1P31A 1R16A 3ADOA 4M86A 4Q3DA 1RM3A 1ZKMA 5C3MA 1EZ4A 1KY4A 4J16A 3JTMA 2D3TA 3BTSA 4JN6B 5B37A 5G0WA 4GX5A 2C59A 3FI9A 3W6UA 1ZZEA 5DCWA 4N54A 4MOWA 3AJRA 5JW6A 3S2IA 2JD0A 3HN2A 1YBAA 3OIDA 4YJGA 2PZKA 5IDXA 1PS0A 1M6HA 4DWVA 3BTOA 5JAZA 1W0CA 1WVGA 1IULA 3RUAA 2O2SA 3K92A 3R0IA 1ZW1A 4WLEA 3DZFA 3DOJA 2Q3EA 4BL5A 1XQ6A 3NV9A 3SC4A 1ZK2A 1SB8A 3QWIA 5L53A 3ETEA 2GZ2A 3WDSA 1BXKA 4NU5A 2ZKLA 2NACA 5IXSA 2P4QA 2ZTMA 1VE9A 3L07A 2QRKA 2I66A 4A0SA 5JC8A 1OMOA 3EC7A 4IXWA 4LK3A 2I5PO 4YAGA 5JFOA 1L7DA 1PL8A 3M1LA 4RF3A 2VN8A 3JYQA 3I9OA 4M89A 5FEUA 1EQ2A 4ZGWA 3OSUA 4GVLA 3FRJA 4DC1A 4JK3A 2Q1TA 4XYLA 1C0LA 1K5HA 3NT4A 2Y1GA 5CDGA 1E7SA 4WJZA 4D41A 3X2FA 5L51A 3RKRA 1LTHR 4NNJA 3NYWA 1HLDA 3CTMA 3GZNA 1X7DA 3PP8A 2X7HA 1IUKA 4PLTA 4PLCA 3ON5A 5JCXA 3IIEA 2GPTA 3RAJA 3T4EA 5BNIA 1SO8A 3C1TA 4KWHA 4E12A 1E1KA 3FNHA 5JY6A 1NFQA 3OQBA 3UGKA 1LSJA 5I7VA 2JCXA 2EF1A 2NU9A 3GDGA 1E7YA 4RF5A 3GMSA 3ZWCA 1O89A 4IINA 2Y1CA 3RUFA 4RGBA 1RYDA 3UCEA 2FSSA 5JDIA 3AOEA 3W8FA 4KWIA 1NYTA 1SPXA 3HADA 4GQAA 4W99A 4QFDA 3D64A 3TOXA 4IIVA 2VT3A 2WD8A 2WYUA 1SC6A 3ZWBA 4JJIA 4BO4A 4CMKA 3O8QB 3DO5A 1CYDA 4O5OA 4PIVA 3L9XA 2VZ8A 3BMOA 1HSOA 2DM6A 2X86A 3D3WA 1MFZA 4HFNA 5JXWA 1KVQA 3DMTA 2HQ1A 3ZV6A 5AYVA 1M75A 5KVCA 4L74A 5CHEA 3VTFA 3B1JA 4DC0A 4JP3A 1Q7CA 1RKXA 1NPTO 3RU7A 3GN1A 3WBFA 2W2LA 3ETDA 4FFLA 4CUZA 1UXGA 1ISGA 3E9NA 3H3FA 4Y6RA 9LDBA 4JNKA 5DBGA 3IUPA 1NPDA 3HZZA 1IPEA 1O9BA 4F6LA 5KTKA 4ALLA 1CRWG 4CMCA 1N1GA 3JQCA 4PLFA 1X0XA 3CE6A 4YJFA 2DPHA 3C7CB 1PQUA 2Y0EA 3LF1A 3DC2A 5H81A 2D5AA 1IOLA 3WGTA 3R3SA 2X0NA 1R66A 1N8KA 3BHJA 4FFOA 1R4NB 1RM5A 2HO5A 3UF0A 2RHRA 4A73A 1P45A 2IZ0A 4WECA 3E9QA 4JGBA 3F4LA 1NM5A 3FF4A 5DBFA 2NVWA 4CMBA 2VUUA 1T4BA 4WNCA 4EW6A 3ENKA 3IUSA 1YBVA 1HEUA 4FW8A 5LCXA 1LJ8A 4Q3BA 2EP7A 4XGIA 1PR9A 4QECA 4CUJA 3V1TC 1ADBA 4QO8A 3JQFC 2FRDA 3SX2A 3L4BA 2NVBA 4LMRA 7MDHA 2PH5A 2VRBA 5MGBA 5A5EA 4RPKA 2HRBA 4DLAA 4DBZA 3WMXA 3SXPA 1V9LA 2VTEA 3QVXA 3QIVA 5JC1A 1JVBA 3F46A 5JDIC 2J3IA 3TFOA 3H65A 2DPGA 1L1FA 1SZJG 5KOIA 1DHRA 2YYYA 2EHDA 3PGXA 5C7IO 1ENYA 4TRNA 4GBJA 4K6FA 3LF2A 2Q49A 2WD7B 3LYLA 4P22A 5B12A 3RKUA 1Y9AA 3K96A 1GPJA 3JQ9A 2JHGA 4DUPA 4XIJA 3MCVA 4MJLA 4FBGA 2EV9A 1ONOA 3S1LA 1M67A 3DMTC 3VZSA 3WJ7A 1J49A 3W8EA 1QG6A 1DEHA 2HMTA 1LRKA 1UDAA 2H63A 3TZCA 4BO0A 3GRPA 1U7HA 2R00C 3K2BA 2GCGA 4QQRA 5JLAA 3RUCA 5HS6A 1LXCA 3KYCB 1B16A 4FC6A 3UH1A 1MXHA 3KYCA 4R4JA 4EBFA 2PFGA 1B15A 3DZIA 2QHXA 5L40A 4W9NC 1H9AA 4IZHA 2PGJA 5DULA 4J90A 4NBRA 2Q50A 4MDHA 3VC7A 4PLZA 1P77A 2J5KA 1U3WA 4XEHA 4B4UA 2W98A 2FWMX 4EEZA 3UUWA 1XYGA 3DBLB 5IN5A 2UDPA 4ZN6A 1VKOA 1KYQA 1UAYA 2I67A 4L76A 4WCFB 3GUCA 2BHLA 4MKZA 3P19A 5B1YA 3VAZA 3NAQA 2JD1A 4NJOA 2IEDA 2HJSA 5JO9A 1B2LA 1NAHA 1B0AA 3H7AA 4R1NA 4E33A 1Z75A 5ER9A 2CUKA 1PZHA 1OOEA 4YAJA 2QYTA 5EIOA 5KKAA 5FF9A 5CEEA 3E8XA 1TT7A 5KJEA 1VSVA 2D0IA 2P9EA 2X5OA 2DT5A 3Q1LA 3Q3CA 3SLGA 4CR8A 4MINA 4P4GA 2NLOA 3A9WA 4IMPA 4PVDA 1PGQA 1FDWA 1NWCA 3BXXA 1EBUA 2CY0A 1BGVA 1RM0A 3ROQA 3FSRA 4OGWA 3DAPA 2ZYAA 4OXKA 5L3ZA 5F3RA 4GMGA 4OKNA 1H0KA 4XB2A 1T2DA 2JL1A 4Q39A 4XR4A 4BGVA 4XRGA 2PH3A 5G0SA 2QW8A 3NDJA 4CM5A 2XPCA 3V1YA 4ROSA 4YJFB 5TIIA 1GQ2A 1R0SA 1I8TA 1A71A 1WMBA 4EI2A 3RFVA 1GCOA 1ULUA 5AXAA 3VH4A 3F5QA 4ITUA 1EUZA 3BTUA 5BSEA 4ND1A 3RUHA 1R6DA 1K2WA 3GR6A 2YQ5A 1B26A 2Y68A 3VZRA 3ZWAA 2WE8A 2V6MA 2FR8A 3BAZA 2B69A 5B4TA 1DIAA 1ZK0A 3SJ7A 1AHIA 4NJMB 1YDWA 1OBFO 1UR5A 2VYNA 2VTDA 3AM5A 3GY0A 2OFPA 2VHYA 2UAGA 4GSKA 1O94A 3KZVA 5IZCC 3PWZA 4MP8A 3ZN2A 1I01A 3JQGB 3L0DA 1LDGA 4FFNA 3D3WB 4LSMA 2PK3A 2VZ0A 4MIYA 1H93A 3RBXA 1HL3A 3QQPA 2POQX 1Y5RA 2DUUA 1KVUA 3G3EA 2WSBA 5A05A 2QZ9A 1B3BA 2AEMA 2Y1OA 4YR9A 3G79A 2OORA 4LISA 1LEHA 2XXJA 4XCVA 5L95A 4EDFA 2A94A 3EYWA 4KP7A 4NI5A 1Q1NA 3UFXA 5JNLA 5T57A 3AY7A 2D59A 2C5EA 1GL3A 3GRKA 1ZSYA 2GO1A 4B4VA 4H7PA 1P1IA 4OXNA 4JBIA 4NFSA 3L9WA 1R0KA 4W6ZA 2J3KA 4B7XA 3BMQB 1HDRA 5F1KA 3KSUA 1PJLA 2Y99A 1WNTA 3F47A 5TS3A 4P8RA 3GF4A 1LUAA 4EUEA 3C1OA 1HT0A 1KY5A 3PHGA 4YJHA 4D7AA 3SJUA 5ER6A 2X0IA 5DT9A 5T6BA 1XEAA 1IB6A 3WQQA 3ZWOA 3H3JA 4GX2A 4K28A 2FN7A 3QRWA 2AW5A 2VRCD 2AMFA 4J9VA 5A04A 3EHEA 1NVGA 3WG9A 3P5SA 1V35A 2WMDA 2B4QA 3CKYA 4PFJA 3W4JA 3HWRA 2X0RA 3IQDB 2C20A 5CDSA 3LVFO 3TZKA 1LLCA 2CSUA 4FCCA 4AJKA 2ZCUA 3OA2A 4CM4B 5KJFA 5T8KA 4I8XA 3VHRA 3LK7A 1TA4A 4EJ0A 4ZQFA 5T64A 1SOWA 4YDRA 4N18A 1QYWA 2IXAA 2OOSA 4GL4A 2EGGA 2ZB7A 3F1KA 4CV1A 5CPBA 2WYVA 4NPCA 4YJGB 4L8VA 3ZV5A 5JCJD 2NV6A 1TT5A 1NAIA 3RC9A 4YT8A 4I5GA 1BVRA 1SMKA 5ICSA 3TPCA 2WDZA 4BKUA 2HKIA 4AJJA 1XCBA 1EDZA 2P2SA 5ITWA 5L9AA 5JDCC 1ORRA 3FPLA 1NTOA 1ZJZA 4MVJP 1GV0A 1HLPA 3GA0A 2NVUA 1U1IA 4R5MA 3W4IA 4Z9YA 3PQEA 3QLJA 3ZWXA 2VNAA 1U3UA 3MJEA 4A7PA 4AJOA 2ZQYA 4KTTE 3KVOA 5AXDA 2HJRA 3VH2A 1WLYA 2JAPA 1NASA 2VOJA 4LVCA 5A9SB 2RH8A 3FN4A 1LLDA 1FDSA 3JQFA 3H6KA 4BO2A 1JU9A 1WW8A 4Q3CA 1GYRA 2JHFA 1LBEA 3FPCA 4AJIA 4CMIA 2BRUA
chains in the Genus database with same CATH superfamily
3ASYA 1JNYA 1OY1A 5EKSA 3UO8B 1XR3A 3DZHA 421PA 3CWCA 4RZ3A 3ZHYA 3ZNNA 1KBZA 2JZCA 1AZSC 4Q4AB 2YBDA 1XKXA 4ZT4A 1Y42X 1HO3A 5EPOA 3SF8A 3GRFA 2C0QA 1HG1A 3PDHA 4KAXA 1KYWA 2NTNA 2GN0A 5KQRA 5KYWB 4Z0PA 2WJJA 5IYZB 4AG3A 3URMA 1I4LD 4M9UA 4J1SA 2QJRA 5JYEA 2J9ZB 2Y1DA 4KXYA 3B3QA 3BJZA 3RYFB 1TTTA 1X39A 1KEWA 5CURA 5AW0A 4OQMA 1UKBA 3JD4A 3M2TA 4RE6A 5KNDH 4DAOA 1L8QA 3K2IA 4D9JA 1KVTA 4JLBA 1RQRA 4WBSA 3TB6A 4BO9A 4C20A 2PXHA 2OKCA 1XN4A 1E2NA 1WA5A 1XXHA 5EPUA 1WU7A 2H48A 4BLTA 5ERYA 2HDOA 3FTFA 1I1QB 3K94A 1NW8A 1XNJA 3PZBA 4RMJA 1TPYA 5DGIA 4BBJA 1QQBA 1A9YA 4QJIA 1T4GA 1E3WB 1NMZA 1OV6A 2EKPA 1MJGA 5HFNA 2D1RA 4YUZA 1I33A 5DMXA 4QXMA 4BAUA 3EXHC 2IYNA 4UEKA 5IJWA 2X4LA 3F3SA 4RTNA 1NIPA 3MWJA 3L3BA 4QUEA 5EYPA 1CY1A 1JE1A 1PZMA 1RBYA 3UXHA 3TD9A 3K71B 1LQ2A 2Q9CA 4RXUA 4Y1EA 3NUZA 1P1BA 4NQRA 3ND9A 1LDEA 5C8YF 2Z83A 3FSJX 1DX9A 5EXPA 4FDUA 4Q3KA 4P92A 1SRQA 1BSVA 2FSVA 1H0SA 1TM5E 2ANBA 2I03A 2JIPA 3DBRA 3HJAA 1M2NA 3VDNB 4CMHA 4RQUA 3ZIAA 3E4DA 1O2DA 3LY9A 2XBLA 3A27A 2QMHA 1U9IA 1VHQA 1X9GA 4GLBA 1GARA 4TYMA 2OTCA 4Y0AA 1VRVA 3T5PA 3MJSA 2VF4X 2WP8J 2FWPA 3RAPR 4LOAA 4JQOA 1TVMA 2GHQA 3I52A 3V80A 1E94E 2EFCB 3GEPA 2TRSB 3UB3A 2CD9A 4R6XA 1JHVA 1Y3IA 2FZ5A 2G6BA 2IPLA 4Q7KA 1V1RB 2HJHA 1EX6A 2O3TA 2IDJA 3E8MA 4K9RA 1X1TA 2CC2A 3D8HA 3FNRA 4CNQA 3OFNA 2PUGA 2B0CA 1QKKA 2WF9A 3IC5A 4L6AA 1YUMA 4EO4A 4ID3A 4PBRA 4NZZA 4HAYA 4UKDA 1YTLA 2CNWA 3GC6A 5F1OA 3ZDZB 3JQEA 4PZAA 1W5FA 3G0BA 2DF8A 4YROA 4OUDA 5DTJA 1LA2A 4A0GA 5JYBA 3PD7A 4YH1A 1IY2A 5B6PA 5KOJB 4H7FA 3PEFA 5I8ZA 3I2IA 1NU8A 2QR5A 3FGPA 1F60A 4W82A 5C1DA 1YJXA 2QTVA 4CLDA 3DP7A 3SIWA 3DFIA 1VBMA 5FNVF 3N07A 1I3MA 2DTXA 4MYTA 4YNBA 4BX8A 3ZBTA 4W7HA 3QX3A 4AJHA 1FNCA 1HPLA 4FX5A 2GHIA 3IQZA 1EGVB 1VP9A 3TUJC 2Z2JA 1Y4AE 2Z2ZA 3ONDA 5CT9A 5IM4F 2CMFA 1RHQA 3ETGA 3NONA 4LBZA 1EDEA 1ZVMA 3L6DA 3PUWA 2PNJA 3SNHA 5IH7A 2IE8A 1QYVA 1YMUA 2VF5X 2D2EA 2WHPB 2ET6A 3NGXA 2OQIA 4KYTA 4TWJA 2W7TA 3HXTA 2ZI4A 4B76A 3P94A 1H2YA 3KTAA 1CDOA 4BWYA 5HOQA 3DTVA 3GGSA 1SBTA 2NG1A 4EF5A 2UYOA 5IUNC 3L4KA 2IVZA 3NI2A 1TMYA 4A5OA 1IM5A 4AQYB 3I5AA 2ORIA 3EXHA 1JEDA 4KPUA 3SU8A 4F86A 3AMVA 3K6SA 1T8WA 4ODIA 2TSYB 2I22A 1EZZA 1YVUA 3H04A 1VYUA 4QQNA 4S1TA 3E5HA 4EK9A 3ZC3A 3NTRA 2CF5A 2C2HA 4D80A 3EGEA 5SICE 3NXKA 5JQGA 4LYGA 1TD9A 2R66A 1WZEA 1A5ZA 4FGSA 1NVVR 4DUZB 3B1KA 2LVBA 4CCYB 4G0VA 1H9BA 1NZJA 3D6AA 2ZIVB 5MN6A 5B2ZA 3IB3A 3IKLA 3RS4A 1WRBA 2JFOA 3F2IA 2VSXA 2VXBA 1WVIA 1LLQA 1QIKA 4FOTA 2RDMA 3LSYA 5HMLA 4Q47A 2XA2A 2BL4A 2QLNA 2OVBA 5BN4A 4MW2A 2C3UA 1XRPA 3ZHQA 4A5SA 4ILEA 3AU8A 4BGIA 3EF3A 2GUWA 4PV7A 4F8EA 2H1VA 2B2NA 1UXIA 3SG0A 4N8DA 3ZKWA 5BRJA 4K6MA 1Z36A 3FKJA 2EP5A 3UXYA 3A6LA 2GDJA 1GWNA 3WXMA 2YCBA 4LG1A 4ZO8A 2J0EA 4XWYA 3A06A 5CW1A 4QNMA 1JWLA 4IIJB 3GNSA 3PKZA 5CVDA 3SPXA 1TDJA 4BGUA 2CZGA 1O4VA 2TYSB 2HRDA 5A2GA 4LRTB 3GRYA 4Z86A 5JAIA 1ZSVA 3DUFB 4NMLA 3LXRA 2ZLBA 4LNUB 3B2EA 2P6UA 5EHQA 4X6UA 4OP3A 3SLKA 1T8YA 2XA9A 3N8HA 4ZO6A 3RGWS 1UQTA 4LJ4A 3PJFA 2JGKA 4DSOA 3N6RA 4ZMRA 3C3BA 5FL3A 4OUDB 3C3YA 1T8PA 1GZ3A 2C9ZA 1DQSA 2PDAA 4NARA 2NM0A 5EP1A 4OI0A 1P33A 4M38A 2ZE5A 4KXLA 4RZQA 4CM4A 1V16B 5J4HA 3GCZA 3HKDA 1YZGA 5EJFA 1E5TA 1WV1A 5KB3A 5LP6A 3LG2A 1UFQA 1BXGB 3PGVA 1IY9A 2Q1SA 4H16A 2QLBA 3R3YA 4JI6B 3K0HA 5BQXA 5IN4A 2FH5B 1RAGA 5GZ1A 3IHLA 1BS1A 1LCIA 1UFRA 5TNXA 3SCZA 3ELUA 2VJYA 4L07A 4D45A 1W9MA 2I4LA 4J16C 4GT1A 5CA0B 4PCAA 3FYSA 1PFWA 2GJ9A 3UG6A 2HBQA 3WHPA 1YQQA 3K9LA 1I0LA 3R5XA 4MKIA 4N7RA 2ROQA 1Z0JA 5TT0A 3CW8X 4KQWA 2PPVA 3ENVA 4ZK6A 4KI0A 5FTMA 1QFZA 4GF5A 4QUKA 3DKRA 1IXSB 1NLUA 3AR6A 3HGTA 3E3OA 4M0CA 1U94A 2CLLB 2J7KA 3N2GA 5FHRA 2IF0A 4CM6A 1NG1A 4AFNA 1IG0A 4GPBA 2I4NA 4N3BA 1Z56C 3PTZA 3S2UA 4Y9RA 2ZYGA 4BNIA 1J0AA 3PUVA 1VSTA 5BOVA 4FXPA 1Q0QA 3R3JA 1OXMA 4L28A 4TWZA 5I6DA 4IS3A 4RGQA 2HHLA 1N3YA 4S3MA 2CCKA 1W36B 1SUDA 3FW1A 4F72A 4CCAA 4EZIA 1IM2A 1ISJA 2X14A 3NASA 3OQJA 4HC4A 3L93A 4J76A 4W1RA 3IP9A 4ZU1X 3X0DA 3ROZA 4BFSA 3GJ8A 3ZV3A 3DGFC 1NR7A 1FW6A 2F8SA 3DBHB 1T9CA 1TTPB 1RACA 2EWMA 1HFEL 5C46F 1SWWA 3MJFA 4FFRA 3MBKA 4NOMA 4ZRDA 3L6CA 1GU0A 1BCRB 1TX4B 3NBFA 2O19A 1K9SA 1DJPA 2EX4A 2NWQA 3AETA 4MUAA 1OJ7A 4GYYA 1ES9A 2XUGA 3KV3O 1CW2B 2PZBA 3VZCA 4EGJA 2IXGA 1EP9A 2YMMA 2ZYVX 1FLNA 4HNSA 2ID7A 1KVRA 3SDSA 2VNHA 1NJ2A 3R6GA 3H1EA 4FHEA 2QTRA 2EFYA 1RLUA 3EIHA 5J2UF 4MVCA 1GLVA 2ALJA 4NS4A 4QO7A 1A9PA 3G9TA 3I3OA 4FFSA 3RRXA 5IZ4A 5H80A 2XT9A 5C5CA 4DKJA 5LLTA 5F78A 1DX6A 3TLJA 1E5DA 3GNQA 1MAVA 4B2IA 3GWZA 2XYGA 1ZXLA 3D2BA 3D6NB 1ONPA 1RJ9B 1BZYA 1K63A 1KDVA 4QICA 4GI2A 1TZKA 1TMOA 1O03A 2Q4DA 3I4CA 1BJRE 3PB3A 2ZUFA 2VEDA 4HQLA 4BNFA 3L1VA 1L7RA 1O96B 4JQYA 2XIJA 4KR0A 1TJPB 4LKOA 1RBQA 3IYLW 1OVGA 5JSUA 2QZZA 4FLEA 2ZRKA 1A97A 1J1UA 2AMLA 4UVDA 2HA4A 4ZOLF 1YRHA 3BCHA 2FQ1A 1KZHA 3MTBA 5C18A 4Y6OA 4B3JA 1CIVA 1Q7EA 3AOEC 5G1PA 4L3OA 3RVSA 4A3SA 1ZHFA 1EA5A 1CQIA 1V1MB 2MHCA 1XZMA 1Y3HA 3ZD9A 1HF3A 4U0KA 1VCNA 1WHSA 2BY4A 3L6RA 3OIFA 5FUVA 1G5IA 3GV0A 4GZ6A 5TRTA 3L5KA 1UBCA 2R2AA 3KU1A 2DP4E 3UB4A 1H1DA 2VAVA 2QTTA 2ZYHA 1V3VA 2AR9A 2I7TA 4OBWA 3S81A 3QUQA 2GPBA 3Q9UA 2CW5A 3X43A 4BWFB 4ZZ0A 1U0LA 3QBVA 4WNIA 1WJGA 2FPPB 4NU6A 1YRWA 2HT1A 1QMPA 1Y8QA 5KC9A 5KOHA 2ODBA 1H3EA 4R98A 2GT1A 1FZTA 5JIBA 1YGYA 2WAOA 4DDVA 4B3RB 2GF9A 4TN1A 3OLXA 4HGQA 2JFVA 4HDMB 1HNNA 4DY4A 4HWGA 4MR7A 2CNBA 4NESA 2O8NA 2ZSEA 4WT7A 4DPKA 2PN1A 5CM9C 1T5SA 2C04A 1J5PA 2ORED 3TVYA 1QCCA 3QKSA 2GPYA 1UJNA 4KQMA 2XB2A 1QZ3A 4NH0A 1FZQA 1M54A 2AKAB 3DG9A 4MRAA 4E03A 1PGOA 1EFPB 3ZV4A 4A36A 4GOJA 2QTBA 1UZAA 3C7AA 5AMXA 4BLRA 5AW6A 2XZLA 3ZWDA 1N6HA 1P2TA 5JMPA 1SK8A 3UH0A 3EXG2 1BTOA 2NTJA 2QX7A 3T1HB 1ZYUA 2V45A 4PCLA 2G67A 2HH9A 3H9JA 4OXQA 1F7VA 2GBPA 1C7QA 2Q3JA 2XD9A 2H52A 3WIBA 3GXBA 3Q9NA 4YJHB 2NOAA 3E61A 4QYIA 4AG6A 3OMLA 2P6NA 4YV7A 3HNPA 1S8AA 1JDVA 4PZDA 3TLYA 1YJ5A 4RORA 2OK8A 5IT5A 1KDOA 2QX9A 4AJ4A 4ZOBA 3U7FB 1AY0A 4PZYA 5JXGA 1KEVA 2YMLA 3W34A 1XEXB 3GIWA 5JNRA 3LKBA 1RXWA 3LQKA 5FP0A 5K0ZA 1VGVA 4DB4A 1EBBA 3CGWA 2O7SA 3DONA 3EFOA 2XWJI 4JUAA 2LCQA 1T5HX 5IAAA 4G0NA 4LIPD 2AQIA 1S89A 3RR2A 3NWPA 4YMLA 1XQWA 3BWEA 3V4SA 4OQZA 2HK9A 1Q1QA 4E21A 4ZDIA 3QMPA 1NU6A 2CJPA 3D8RA 3AYXB 1XJ5A 5KWVA 2VA9A 1WSAA 1AA9A 1T1EA 2HLPA 3JVEA 4LZNA 4M54A 2ZXFA 4TKUB 1R4AA 2Q8PA 1SM4A 4GC9A 3UHOA 1DLJA 4O2BF 4DWOA 1WP9A 1PJ2A 5AM3A 2JLZA 4QM6A 3BA1A 4MS1A 3AQ4A 4LWPA 4DUGA 2UVPA 3FCEA 1T0BA 4M3NA 3RSQA 4EAAA 1D4FA 1T26A 1DB3A 4Q9KA 1IJBA 1MHPA 1Z08A 4JT2A 3DVQX 2GK7A 3Q2KA 4P84A 5LOVA 4W1QA 5K6AA 4G8BA 1CT9A 3CWQA 4REOA 5KYUA 4GNRA 2I4RA 4A8JC 2Q5HA 1EXDA 3TLXA 1PJAA 4PC6A 2NV2B 4G81A 4IV8A 1Z83A 1ISIA 1NJSA 1I4TD 2E9SA 1XEWY 5BORA 4RF2A 5KQPA 3KHTA 3QMMA 4JBLA 4EJ6A 2GBLC 3CJQA 4AJPA 1M8PA 2X2OA 4GIBA 5CH5A 2ISQA 4D4MA 3STXA 5JWOA 3TGPA 5HK9A 5DOVA 1Z07A 4RY8A 5EXXA 3K16A 5ALPA 3IKMB 2CB0A 4INOA 4YHHB 1H85A 4FE3A 2X42A 1CF2O 1BFDA 2OFWA 1RR6A 2HF9A 1F8FA 2JFHA 1SBCA 1W59A 4OO3A 3WJAA 1DQPA 2QM0A 3HCEA 2C5BA 4AXBA 2P90A 5EHZA 3Q8WA 1LNQA 3HZHA 3E9CA 5BVHA 4HDNA 1OFUA 1P2VA 4ZKEA 3TLMA 3WICA 5JU6A 1NXOA 2ZREA 3CLUC 1WBDA 2PS3A 3PVCA 3MAGA 1FX1A 4QDKA 4LVOA 1LF0A 2PD4A 3QFFA 4PSKA 2PUBA 1SULA 3DO6A 4ZC8A 3L05A 2CNLA 1MPTA 4N1AA 1QLHA 3PD1A 3ODGA 3SQXA 2BBOA 3LKDA 2NW6A 1HDYA 4RS4A 1TQ6A 2B20A 2HIHA 4URZR 1O58A 3LA8A 5H82A 5GJBA 2QL9A 2ZATA 4ZC1A 3TE6A 1J9EA 4EKEA 1POWA 1FMJA 1V25A 1EM8B 3VH1A 5DNYB 1UDRA 5KYYA 2HWWA 4JCCA 4I4TF 4O4LA 4S12A 4LMAA 2AE2A 3EGIA 3PXUA 3EBLA 3NHAA 4J0HA 4ZQHA 4O59O 3U37A 3HCCA 4LFBB 4UUNA 4FKZA 4IP0A 1Q83A 2BUBA 3GDFA 1BWSA 4C0HA 4D26A 3MGKA 4I8DA 3P7MA 4QGGA 1HOTA 4RBNA 5JFTA 1XT6A 3E05A 3VU3A 1J09A 1L5ZA 1G5PA 1RVV1 4FD3A 4XWTA 3TBKA 3KLOA 4MGZR 1JEQB 4LZWA 4BX2A 4K0RA 3AQIA 1U2PA 3LX6A 1Z5WA 2C29D 1OSNA 4BFTA 1H4TA 1XL1A 3D54D 1EVKA 2WWGA 1HE2A 1LLFA 2QQFA 1V6SA 1JTEA 2NO6A 3PVSA 4MRPA 4NE7A 1KAMA 4HWRA 5AJXA 1ZH4A 521PA 4B74A 4ZI3A 5K8LA 3PGMA 4DDHA 1GG2A 2W22A 3N9IA 4MDEA 1DDIA 4WJKB 2NTEA 3NJRA 4IDGA 1RT9A 3CPHA 4D0RA 1W4RA 2R4TA 3LDFA 4BV2A 1C0IA 3A6FA 3QLUC 1Q0RA 3WQBA 2JFPA 1GADO 4X6LA 3NNNA 1N6NA 2HEIA 3TFQA 4V0ME 3E3LA 4YGXB 2BP7B 2CFTA 2JEZA 1H2XA 2PZ8A 4X8HA 5DM2A 3U7QA 1SCDA 2ODEA 4XD7A 3AXSA 5CR9A 4B47A 5AVXA 4DRXA 1DV2A 3H83A 5DE3A 3WYFA 1T1IA 4TKVB 1Q3KA 3GMDA 2R4QA 3DOFA 3NBAA 1B1AA 3FNEA 1Z0SA 3R7WA 3AJEA 4E2ZA 3BEOA 4R9RA 4G0QA 4TS1A 3THRA 3THWB 3EASA 5IRCD 2ZM6B 4YBRA 3F3KA 1H3NA 1CWUA 4FB5A 4NYJR 2AJLI 1XZQA 4HG2A 3UMGA 1Z0UA 3AF0A 4PM4A 5HR5A 4HV4A 1B2RA 3PXXA 5EVCA 4CT4B 1YO6A 4JKOA 3OTQA 2IS4A 5K3CA 3R6WA 1EP1B 2F1KA 2ORYA 4OMUA 4JT9A 2BUAA 4ZCTA 4C88A 5DHUA 1VL5A 5AVYA 1NSYA 4K8RB 3I6IA 3IHWA 1ZHOA 2IYFA 3NS7A 3QU5A 3PUZA 4MKHA 5EJ2A 3MD0A 3WRYA 3OCWA 5EHGA 1E7QA 3G5UA 1OF1A 1WMFA 2IDMA 2RAVA 3TMKA 4LZAA 1AS2A 2PEZA 5LZ9A 1N75A 2XB8A 4KE8A 3ZBQA 5IKXA 4AP9A 3OCVA 2AN4A 3U13A 1D7AA 1MEEA 2F3TA 1RI4A 3A4YA 3LQ4A 4XLLA 3ISJA 4KNYA 2PQ0A 2Y93A 5KX5B 3X2EA 2PKQP 3MYYA 3ZS8A 3RG2A 2R9VA 2FG6C 3H4VA 5TQ2A 1XQ9A 1YE8A 4X45A 5AOVA 4I2NA 1OXVA 2A6PA 1USUA 3WOHA 3CF4G 3NLLA 5TJHA 5FA5A 2V7TA 1FYXA 4NDNE 3VZPA 2P0EA 1CKEA 2V7GA 1T0PA 1SNYA 4EQ6B 5JBQA 4B35A 3MTDA 4AL4A 4RM2A 4TMFA 3SFZA 2R7MA 3M9LA 1V41E 2PSFA 3HFSA 4LAFA 4YQEA 1YDFA 3ZHBA 4BCBA 1T5IA 4KZKA 1PT7A 3BK2A 1A3CA 1F8YA 3AW9A 4PYNA 3QXSA 2PKCA 3D4IA 2BELA 3O1IC 5ES3A 1KQ3A 2VP0A 3S8EA 2PY6A 1Z5VA 3NR2A 4EFMA 3A9CA 2VWPA 3L8ZA 4I50A 5A4DA 5E38A 2ZVDA 4MRMA 5DM60 5IARA 3ID6C 5THXA 3V3TA 1QHHB 4CQLA 6YASA 7YASA 3NRBA 2VSQA 2A1TR 3QE3A 4TQAA 2GWRA 2BFAA 3PNVA 1CE8B 1JAXA 2G5GX 5DOZA 2OAEA 3QLTA 3WYGA 3TR6A 1YNOA 3PR2B 2X23A 3RRMA 3S8YA 1DFIA 2WAYA 2BTOA 4QFBA 2OVFA 1H8ED 2QAGB 3D5TA 3L7LA 2WY2D 4GE3A 1P4JA 2H5IA 4C29A 5CW2A 2RC6A 2AVNA 2QV0A 4G1BA 1ISFA 2P6MA 3DA8A 2CL0X 4X63A 3EGVA 2ZYRA 3HA5A 3TQOA 4D9BA 1XWWA 4IWYA 1JR2A 2ERXA 2WMOB 3C4JA 4O8CA 4B43A 5TLSA 1I3KA 1L5MA 1C7EA 4FFBA 4B8YA 3P9RA 2IKQA 4UQOA 3IB6A 1CQJB 4H18A 4A23A 1N7GA 5LLSA 4TV9A 3MLAA 2YV3A 4IG9A 1YQXA 1EJ0A 3O3NB 5G02A 2XWPA 2Q4RA 4TZ0A 3GAAA 3EAFA 4IF6A 1TZJA 1QIJA 1TA9A 1TF2A 3F9RA 2XBMA 3K0FA 2B1GA 3B20A 2A8YA 1I2ZA 2B83A 2V54A 1XZGA 2VPWA 5KVSA 5BVGB 1Z2EA 4MQFA 2JASA 3AUFA 3OKAA 4QFCA 3FDIA 2II6A 3GJ5A 3CSSA 1KYTA 3PICA 4BNVA 4C0XA 2J45A 5L3RA 1Q7BA 2V7WA 4N7MA 3PF9A 4ZDJA 1QHIA 4RSRA 1HFJA 2I2DA 4R54A 2B25A 1I36A 4INAA 4EGSA 3KEOA 2WQZA 5TT1A 2QN6A 4CW7A 2ATVA 1NP3A 5DN6D 1F5NA 3CVOA 3DAFA 3DTNA 3N8KA 1JBKA 2FMIA 2CBXA 1DFHA 1U7PA 3NFRA 5DK4A 3T0IA 3DVAA 3QSYA 3UKOA 1IDN1 1PD0A 2Z5FA 4TMVA 3N05A 2C5FA 4Y2JA 1BU8A 2VUHB 4TYQA 4POOA 3RYCA 3RAGA 4C08A 3PI6A 4ENSA 3E9EA 3MG9A 2IIPA 1C0PA 4WZAB 1W46A 3NOXA 3LNCA 1YDGA 4PFSA 1XO1A 3ZLJA 3AG5A 1GRCA 1NP6A 4FNGA 1Q2XA 1ZMBA 3SI7A 2LGJA 3COSA 1DMRA 4FMDF 1B8NA 4ZQGA 2PYDA 1U31A 1L5KA 5FD8A 3V1UA 1DRVA 4B80A 2AG5A 1SQ0A 3CKMA 1TW3A 4XM2A 3RSCA 4UNIA 5KI6A 4ZO7A 2X8JA 3UBMA 3LQQA 4BCCA 4KWTA 5IN5A 1Q0LA 2FPKA 2IOFA 3B3GA 4Y67A 5D00A 3FKSD 2YTZA 5EEGA 5FX2A 3W77A 4WDQA 3KR2A 3VBEA 3VXKA 3I4LA 3LDAA 3ZE0B 2E18A 2P3QA 3QFRA 1KR2A 2BZGA 2HF8A 4UBKA 4BAGA 1NE7A 4H7KA 3TRIA 4Y30A 1W8IA 3DUFA 3KUUA 2XBUA 1DC4A 3VVCA 2D5CA 2Q1WA 4UTXA 4PLHA 3BK7A 3MINB 3OM9A 3I04M 4BNHA 3GGDA 4GWLA 1QJCA 3QM1A 1M66A 2H7YA 3RRNA 1AV7A 5EWJB 1NN3A 1Q20A 2QGFA 2VDPB 4RVCA 1E4YA 4XPIA 1M1NB 3HSKA 2Q3MA 1HLGA 3T5BA 3OG9A 5DHFA 1Y80A 3L46A 5EL0A 1ZN2A 1D1QA 3PDCA 1ZGCA 1NA5A 4NPAA 3WLFA 3KVYA 4J43A 1Q0ZA 3IP1A 4N5HX 4JP1A 5IWAB 1A9XB 4AKIA 2Q2VA 5ADHA 4NXMB 2R44A 4CCYA 3UMMA 4RIIA 3KHSA 1BD3A 3EQZA 3K0EA 1YB1A 3CJTA 4K9PA 3D6JA 3K4QA 3RF7A 4QUBA 1R64A 1KGSA 1WE2A 1X8JA 4FINA 2H08A 4KDFA 2A84A 3WMWA 4AUMA 5SZHB 2XQJA 2P40A 1OB5A 2F55A 4RVUA 1L5VA 2I1WA 4GKVA 4ZKDA 3QE9Y 2PANA 3ICVA 3RHZA 2CVHA 1SH7A 3NHWA 4XQCA 1RE0A 4AG5A 1SBHA 5DF1A 1DJMA 2FOIA 3DBVO 3E7WA 3T94A 3C3WA 4XASA 5FPHA 1W30A 1O87A 1TO6A 2IIVA 3IUNA 4DHWA 3U7QB 4DY6A 5JV5A 1KJQA 1CETA 2AMVA 3BULA 4JBWA 3G2KA 1YJBA 3N3AC 3SOZA 2O6HA 4HWKA 1S3GA 2OO5C 7ADHA 3WFZA 4G63A 4HNQA 4F97A 1N2CA 1NJ8A 2WUVA 3CWZA 4I1UA 4LV6A 2O0LA 3BH6A 4G0ZA 5CB8A 1QYXA 4P3PA 1CVIA 1NBHA 3KKKA 1VBNA 3MOSA 5AKHA 1AZWA 1QOQB 2B8TA 2CHEA 3C8DA 2J09A 4F4JA 3U4QB 3GPCA 4A03A 4UU8A 2VPPA 4IICA 4O4HA 2J0UB 3K0FB 4Q9AA 3KLNA 3ULKA 4AQDA 2VPTA 2AXQA 2V4UA 1V48A 4DR6B 1AC5A 1FUUA 2B35A 5BP7A 3SY8A 3F7NA 3PLNA 5B7QA 4Y2UA 2WM2A 2HHCA 5AI5A 1QIHA 1T6ZA 3BG5A 2PMFA 4TXMA 3EGXA 4YCDA 5JSFA 3KUKA 3U3XA 1E6EA 3KUDA 1Z6GA 1SA0A 4I0WB 2JDIA 5HQTA 2O2JA 3WK7A 4Z4FA 1ISHA 2M9MA 4R7TA 2C88A 1WDWB 3QF4A 2FW0A 4CKEA 1QM5A 1WAMA 3RRFA 2AS0A 2QW1A 2AB0A 1G5RA 1K88A 3ROTA 2G0TA 1N2OA 2W6IA 4OI4A 5EUQB 1GVNB 2O1XA 1Y6QA 5IYZF 4B0OA 5DTMA 5FAXA 4QQKA 2BR5A 3SEFA 2V6GA 4YRPA 3NDPA 4DSUA 1GTRA 4Q4LA 2Q5OA 1E1RD 2J9RA 1D1PA 1NF9A 1TPZA 1QMGA 1GT91 2O0KA 3BL8A 1TU4A 1ZK1A 3OCCA 4K88A 4EHBA 2AN3A 1DO0A 6NULA 3MGCA 2PRKA 3LUCA 1ZEMA 1OHHA 2XQVA 1F14A 1GAQA 1LK5A 2P2NA 4G0OA 2VDOB 2OCGA 3BQNB 5F77A 2F4VB 4G5GA 1SWVA 4XYGA 1RI5A 3Q6IA 5J4LA 2JAOA 2I6SA 5JRZA 1XP8A 3GT7A 4U9UA 1J2RA 3B1WA 2XEDA 2HMAA 2IUEA 4C1BA 2XT6A 1ZMOA 3K8ZA 3OZWA 1EVLA 1VL6A 4JQSA 4RMNA 3OZVA 4ZPJA 1HDCA 1QANA 3KEQA 3WLRA 1BS9A 1ESMA 5ITZA 4DPLA 1Z82A 3KQTA 4YP6A 1GZHB 1UZLA 3FWHA 2C4WA 4B6FA 4DV0B 4I5DA 1BDBA 5LMUB 1Q95A 1M8JA 1G9TA 5ESWA 1IOZA 1RZ3A 1YE3A 2A5JA 2V0NA 3N74A 5KBYA 4BVGA 5K3FA 4CQMB 1ZUWA 4GXRA 4QYMA 4CQLB 5IJ9A 2EKZA 5K51A 1T0JB 1J6UA 3KTOA 3OHPA 3JRXA 1KBQA 4H6XA 4PLWA 3U7IA 5LDHA 3DYBA 4NPHA 5TQVA 1GR0A 2AC4A 4PZEA 3ZUPA 3BMOB 3W3ZB 4E3ZA 3PCRB 3L84A 3GVPA 4WOKA 1MQSA 3BMNB 3PDWA 5TGTA 1L4MA 4HUTA 1OYWA 3JD3A 3ZXYA 1Y7HA 3NM4A 1QS0B 1F2UA 1K3UB 1VXOA 3F97A 4KR9A 2E4AA 4LHWA 4AQ7A 1VMDA 3UATA 2HPVA 4BUJA 1KSGA 3QFTA 4Q4JA 4NCJA 1MU0A 2DC1A 3F7OA 5AUQA 1CJTC 4N0EA 3VNBA 3I3SR 4F0JA 4BY9E 3ZDAA 5KTYA 2PJZA 2XQFA 4TKUA 2YWEA 2Z6VA 4BO8A 1AO0A 4DA0A 4F46A 3R5SA 1YKSA 1MB0A 2ZVPX 3H17A 3ZU2A 3R9IA 1W29A 4M1SA 1IXKA 3M5PA 3SKVA 5K2OA 2DQSA 4HS9A 1C1XB 1J90A 2VP5A 2O7NA 3W2GA 4DBVO 2I4OA 1OBVA 1PK8A 1GTL1 5EUCA 3H5AA 1P0PA 2GN8A 1KMHB 4JY7A 4O02B 4KO4S 5PNTA 4CT5A 4GL2A 2ZJ7A 3B60A 3HRKA 3P8ZA 4GZ3A 1UOOA 4LDAA 4LBWA 3THYA 3I39X 2B98A 2BVNA 2WG2A 4BN0A 1S01A 4PYQA 4JZYA 3AUJB 4DGSA 4OXRA 1FNSA 3DR5A 3ORRA 4KACA 4F38A 5HUQA 1WPRA 4RUKA 5DYGA 4J4BA 1JLLB 5JCOC 2FE1A 2VC2B 4P4GA 5SYNA 3I5XA 3QX9A 1E77A 4YMIA 1DFGA 2XVZA 4K2HA 1M8FA 3H0KA 2COKA 3EMDA 3NOVA 5C4GB 1JG2A 2B1RA 1QKIA 3N0RA 2VJQA 4F12A 4YMHA 1AQ6A 5KCZA 2GM9A 4XB1A 4Y6PA 1QF9A 5CXXA 3LI2A 1K75A 4HXFB 5LYJF 5JCJA 1P17A 1XVAA 4INZA 2FSHA 4OGGA 3RO7A 4KREA 3KPJA 2DWQA 5FRDA 5JD3A 3AL0C 1JNXX 1NULA 3FZQA 2CXPA 4GFDA 4L3WA 4TWBA 4BAZA 1UFOA 4MNTA 1Y9JA 4ZRMA 5FWAA 3LO8A 2X40A 2YHAA 4HEA1 4K9MA 3TRHA 4B6PA 4HZUA 2A57A 2H1HA 3S2GA 4U2GA 2WOOA 1CUDA 2VZ9A 3UJ3X 5LKAA 4HAVA 4BLPA 2QDKA 4AO8A 3KSAC 1U1FA 1SUFA 3GVIA 3AFIA 4OJQA 3KQKA 3O82A 4LX0A 1O0BA 3W5JA 4M1WA 3SJAA 4ARZA 5F7OA 4C0KA 4ZZ3A 3WX0A 1EUDA 2G6TA 3EG9A 3H3XA 1BROA 1TJYA 3KOZA 3KHKA 4E31A 2PX5A 3ASVA 4YUAA 2YZGA 1A2BA 2PO7A 3ZGLA 1LSOA 3W5IA 1V8OA 1WTAA 1KNQA 3SDZA 1NXSA 1MUUA 3RTGA 2K7FA 5BSHA 4Y2QA 4FN4A 5CIQA 3ITKA 3N5CA 4FGWA 3G2JA 4TLAA 4OLBA 1JG6A 2IKSA 4PX5A 3E03A 4HZIA 3HXOA 1JQAA 4EA7A 5AP9A 3ZEAA 5EMKA 2QL5A 3HMQA 2XUJA 1U7TA 3JU3A 3PFNA 2JG3A 1H66A 3SBDA 5FI1B 9GPBA 2ECOA 1OXXK 3SEAA 4B45A 3SQDA 3C5CA 5JZSA 3TXYA 4EKIA 3TPZA 2B5WA 1Y8ZA 2C5SA 4C4SA 5E4TA 4ZVQA 2D1QA 1BEUB 4IAOA 1DOZA 4BMDA 3CFYA 1KVSA 3BHNA 3BMNA 3T61A 3Q8LA 1V9CA 2FSFA 1KOLA 3V1KA 2YVKA 1UBHS 3OZSA 5FJIA 2E1RA 4ZALA 4IY1A 2HCTA 1F6WA 1A8PA 2ODTX 3PNYA 1I24A 3TPFA 1RYMA 1VQ1A 5DM4A 4ER3A 5LU9A 2ID9A 3O95A 3WSWA 3FBWA 3DOUA 2HU5A 4CLRB 1JDSA 1L5QA 4AP6A 2VDKB 3BXOA 3VMMA 5I7SA 1W85A 3SYMA 3R3ZA 2J5RA 3IJEB 1MA3A 3R7BA 5JJBA 3HHEA 3FCSB 2OXCA 1JDTA 2FTKE 1SHUX 3GCWA 4QPJC 3QPDA 3JWHA 1DEXA 1KI1A 3K09C 3L0OA 4FZRA 3S44A 3QX7A 1E2GA 2NN3C 3JYNA 5IZCC 5DRTA 4Q9DA 5EP4A 1DPFA 2E5WA 3PNMA 3WLMA 3ZWNA 2P91A 1PDVA 5EP2A 4AN4A 5C7YA 3E7FA 3CUYA 4MUIA 2I33A 2FK8A 2IZ1A 1SBYA 3OE1A 1KRXA 3NU1A 4I3FA 1IN7A 5JDCA 1VG1A 2DBZA 3Q7TA 1NVWQ 2IEBA 2LKDA 3ZWMA 3VU9B 5FTWA 5EA2A 5A06A 2FDCA 4N0PA 1JKXA 4CFYA 1IK6A 4OJNA 5JNSA 3ASUA 1QVZA 2H2FA 5AI6A 3RKSA 3H97A 3FCUB 4BGEA 1CIPA 4LXYA 4EUSA 1XG5A 3V4FA 1Q0TA 1S96A 2NQ8A 3EXIB 4LYJA 1R8XA 4Y2SA 2GASA 3A6KA 4ZVVA 3C8MA 2Z43A 1VL0A 1V4VA 5SZKB 1IC6A 3UMSA 2PKXA 2VSFA 4M46A 4RKRA 4DQXA 1Z5ZA 2PRSA 4ZAYA 5FTKA 3ZNOA 5BR4A 5EERA 4I1IA 3KS9A 1YQ9A 5CCEA 3RJTA 1CF9A 2LIPA 2ZIXB 2C58A 3A6JA 2G82A 5E95A 4YJ2B 1MQ9A 3OM1A 1ZISA 3MWLA 1BW9B 2J5BA 2UVPB 5KAPA 3R8XA 4E6PA 5A02A 1UPUA 3EK2A 3FOEC 5J2UA 2V6JA 1MAHA 1U8ZA 4QXPA 2NXEA 1YCHA 3EDMA 1WQ3A 4YIKA 3AKCA 2OUIA 1EE9A 3H11B 4JLVA 1K6MA 3A1DA 5K3DA 2EGHA 4RH0A 5KYVA 1PJSA 1HE1C 3KJQA 3VR2A 2YWRA 2VAPA 5CXQA 1V5EA 4O4HB 1KEEA 2PT5A 4E14A 2AC2A 3KHUA 4OFBA 4CLRA 3U4QA 4FJ0A 4JYPA 4Q93A 3EFOB 3CLRD 1N7JA 2B9EA 4B3DA 2R5FA 4PO8A 1R6TA 3TCXB 5LP6B 5CVUA 3IEMA 2NQ2C 2J3JA 5HF5A 4OI1A 3VYSB 1M1YB 2XDAA 2C97A 4KKVA 2P78A 5DCLA 1XP5A 1XAIA 3SR0A 5JVDB 4BO6A 3D7MA 2JLYA 3I9NA 4B17A 2A2ZA 1CP3A 1VIAA 4MDYA 5GJVC 4DSNA 2XY4A 1BOFA 2VHUA 3FE2A 4BV3A 5I9LA 5CFMA 4OFWA 5KIAA 4C7OA 1KQPA 1L5HA 4QYTA 1IPFA 3WZMA 2AJDA 1JAIA 3L1UA 2ERCA 3LPMA 5DI3B 3PGLA 3OQHA 4LRXA 1EEHA 2GN9A 1GZVA 5F5LA 3PBKA 2IBMA 1GQQA 2WV7A 2M6LA 1BMFA 4M0KA 2PEYA 3JVVA 3R40A 1URPA 3KWFA 3OA0A 2C7BA 2VP2A 2ZDHA 3MCAA 4H15A 1AKQA 3AFNA 3AL2A 2FN4A 4YHBA 1RNLA 3HVIA 3YASA 5DP2A 5IAOA 5JD4A 3CZPA 4LF4B 4DLRA 4K0KB 1Z6PA 3FHCB 2CB9A 1Z4LA 4P83A 5I7WA 3GDOA 2IK8A 5B3LA 3A37A 2AHRA 3NUGA 1JZSA 1L9KA 1P9RA 4QBGB 4QBIA 3SZ3A 2PXCA 1XNQB 3MJ4A 1YKGA 3PUJA 4ND8A 3R0ZA 2FRXA 4FGJA 1OLUB 3OP4A 4IFTA 4LDQA 2FPXA 2Z98A 2YMQA 4LF7B 1U7XA 1K06A 1MF7A 3EXFA 3L0CA 3IO5A 3RSGA 2OAGA 2J59A 3WLEA 1V7PC 2HI0A 1P44A 5H3CA 1VPWA 4H60A 2NVUB 3JY6A 4TLEA 5LNK1 1E5QA 1UPXA 1W581 2ZZKA 1C3XA 2F1JA 1XZ8A 3H0EA 1SG9A 3UW1A 4RSHA 5ALTA 2RI6A 1I7LA 3INTA 3X3HA 1QNLA 4O3FA 2ICAA 3K9GA 3N59A 2ZM5A 3LWNA 1XAHA 1HEIA 3W8NA 1A4XA 4TRMA 1JHQA 1BDMA 1OX4A 4JXXA 2O2EA 3K72B 4C2BA 2HSJA 2PXAA 1U2QA 2CSXA 2G8LA 4LJKA 1PZEA 5JS8A 3G0HA 4XX0B 4WXRA 3WYDA 4YC7A 2RHTA 1JFSA 5F35A 3QJGA 4BQFA 3OJ0A 2NU6B 2DQYA 1UBJS 3C85A 2WHYA 3EPLA 1EAYA 1W6UA 4BFVA 4DV1B 3AY3A 1VDMA 2XMRA 1EK1A 1ADCA 1E5VA 4M22A 2MYPA 5FB3A 3SMQA 1MG0A 1Z28A 4HF7A 1F12A 2W2MA 4B1FA 4FCVA 4NCNA 4LECA 2CJWA 2DTEA 3M33A 3QE4A 1YR7A 3I9MA 3BE8A 4MVYA 1ESZA 1M34E 5IJ9B 1DUIA 3RVOA 2YIVX 1RYFA 3WRXC 3ZGOA 4GYWA 2AX3A 1QCZA 3I53A 1UKEA 3K0SA 4REQB 4I99A 4CGZA 3EJ6A 2WFAA 3IVAA 4G0UA 2G1JA 2FSPA 2GZ1A 4MTLA 4TTVA 2XKBA 2ZUVA 3NAMA 5H1YA 3CM0A 5DBHX 3ITDA 3N2ZB 4IFEA 4RACA 5KYTA 5L4NA 4L6IA 3EXG1 1FQWA 1KAHA 1GG8A 3E81A 3KJEA 1U0NA 3KPVA 2OP0A 3EIQA 4E2WA 4KPEC 4HH4A 2JIOA 3HCBA 1F1BA 1XFDA 3TQCA 621PA 4LXQA 3O31A 3T06B 1OI7A 3F6SA 4K6CA 1Y82A 4BIIA 1L6RA 1ZUHA 2VJOA 5KSPA 1X8KA 4Q1DA 2VVTA 2JZOA 3A28A 1E7MA 3OTHA 1GITA 3PFIA 3QXJA 2PVPA 2P5YA 1U8FO 3OY2A 4QBFA 3RIEA 3LTNC 2JRLA 1D6SA 3GJ7A 2VYFA 1M2VA 4PRKA 1U9CA 3JQGA 4FYJA 4TUYB 4WK0B 3F73A 1SXHA 2QVXX 5E3IA 5JRJA 5KQSA 5CFNA 5KTTA 1S4MA 1J24A 2EFGA 2HC9A 3P0RA 1OWMA 3QKRA 3CEAA 1FL9A 4FFBB 2IH5A 4ENRA 3OQNA 2YS7A 4D9GA 1XK7A 5KVAA 1YH3A 2L17A 3CBQA 4J1NA 4LY9A 2F90A 3U1VA 1BDHA 3PWKA 4L9WA 1HYGA 1VIMA 2Z8ZA 4ENVA 3CEHA 1PQWA 3DHNA 4FEYA 2QLTA 2V5UA 3JXEA