3QQPA

Crystal structure of 11beta-hydroxysteroid dehydrogenase 1 (11b-hsd1) in complex with urea inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
270
structure length
270
Chain Sequence
QQPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyrrolidine-pyrazole ureas as potent and selective inhibitors of 11beta-hydroxysteroid-dehydrogenase type 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 99
structure length 270
sequence length 270
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qqpA00
3GZ4A 4OIMA 4S1VA 1LSOA 1DRVA 1XGKA 3JQ8A 4I5FA 1R37A 4E31A 5A5FA 1O5IA 2D8AA 4INAA 3C7CB 1MG0A 3K5PA 3PWSA 1PX0A 3R6DA 3DQPA 3FF4A 4D45A 1C1DA 2E49A 1EVIA 4L4RA 1GEGA 3AOGA 5IZCC 4JN6B 3EYWA 1EMDA 1E3IA 1ZK3A 3OEWA 3GHHA 2HUNA 3QRWA 5AXAA 1E77A 1HTBA 4BUCA 4BV8A 5TJHA 2PD3A 1LTHR 5BSEA 4QQRA 3FN4A 1ONNA 4BQPA 3DZBA 3RC2A 3EZLA 2VTDA 3C3XA 4TRMA 1A5ZA 5FF9A 4M89A 3JQ7A 1P74A 2BGKA 4YJGA 1Y6JA 3FNEA 1P45A 2Q49A 2W2LD 3M2TA 2O50A 3LT2A 5JAMA 5B37A 2FMUA 3ICCA 3ZN2A 2WSBA 3DZIA 1NTOA 3DMYA 3F6YA 2B69A 1UR5A 4WECA 5A05A 1YDWA 3ZWMA 2Y1EA 4CM9D 3Q0EA 4JLWA 3PJGA 4E13A 4LVCA 2I66A 1ENZA 4EDFA 1JVSA 2UVDA 2EGGA 3OA0A 4FQ8A 3WGHA 3HDYA 3SC6A 4NPCA 3DB2A 1MUUA 2OORA 1L7EA 2YFQA 3KYCB 3LT4A 1KC3A 1V8BA 1U2GA 2X5JO 3MCVA 1QV7A 4J1QA 1PSDA 3BHJA 2PKQP 1MC4A 3KLPX 1G6KA 3DONA 5IN5A 4FC7A 1W4ZA 5EPOA 5H81A 1ZCJA 3GEDA 1K6IA 1HYGA 1H9BA 3B6ZA 2NWQA 4CM8A 5F5NA 1HZJA 3I4FA 4PRKA 2D5AA 3HFSA 3I9LA 1BW9B 2B4RO 2DC1A 5LC1A 2PR2A 3VH1A 1ISJA 1YO6A 3BMOA 3WG9A 2ZB3A 4IQGA 3NV9A 3PJDA 1GTMA 1KEPA 4YR9A 3M1LA 5JDCC 3FR8A 1C1XB 3OJEA 4YBZA 3DTTA 3IS3A 3R0IA 2BF7A 3MTGA 2W4QA 4WLUA 2V6FA 4FJ2A 3FR7A 3NYWA 1P1FA 2FR8A 3VVCA 3EVNA 1EBUA 3ONFA 2JL1A 3DOOA 4P4GA 4HUJA 4YACA 5CDSA 4RDHA 1Q7BA 3KEQA 1KOLA 3RUEA 1WMBA 4X54A 3SJ7A 1WP4A 3BMCA 2LDBA 5F21A 1HDCA 1O89A 4BKRA 3ZWWA 4CM1A 2D4AA 1LLUA 1NPDA 3F1KA 2Q1UA 1GDHA 3G0OA 4IXTA 4LSWA 4CPDA 4IGFA 2HMVA 4NBWA 3ONEA 3GR6A 2X1HA 2NU7A 1B26A 2EF1A 1ISGA 4GWGA 5C3MA 4XYLA 2ZIZA 1T25A 3AUTA 2PA3A 1UP7A 1QORA 1UXIA 3DWFA 4CL8A 2ZYDA 2BFPA 4L75A 3W8FA 3B70A 5DP1A 3RJ5A 1PGOA 1HDGO 4U5QA 3WMWA 5ICSA 1U4SA 2B37A 2Y0CA 4CMJA 1IOLA 3IMFA 3KSDO 1I2ZA 4ILKA 2YFHA 4GMGA 2P68A 4DA9A 3GQVA 1YOVA 2Y1DA 2NLOA 1O8CA 3H2SA 1GV1A 2OUIA 3EDMA 4PG6A 2CNBA 3S2FA 3KYBA 5B4UA 4BO5A 3GDFA 3I9JA 4OQYA 4R9SA 3N74A 1U9JA 3OBBA 3PZBA 4H7PA 5A04A 4WOKA 2G5CA 3B1KA 4J7XA 4HP8A 2WE8A 3GC6A 4BNNA 2D59A 4XYEA 2C29D 5DCYA 4CMEA 3RUFA 3H9EO 4J7UA 3UCXA 1QLJA 5DBGA 2GCGA 2OMEA 2FP4A 3TWOA 4MKZA 5KJEA 4OQZA 4OJNA 4R5MA 1QRRA 5A4DA 2UUOA 1YB1A 2VHYA 1H5QA 1J6UA 5I9LA 1X0XA 1EQ2A 2PH3A 1DAOA 5JDIC 4NG5A 1GYQA 1YBVA 3GVPA 2WEKA 2CY0A 4EJ0A 1E1NA 2VHWA 1B0AA 3VPHA 4JGBA 2RHRA 2EP7A 1SEPA 4L9RA 3W4KA 4K6CA 1P1RA 5HWSA 4ND4A 3ZU4A 2R00A 4A5OA 4KDEA 4Y6SA 1SO8A 3EMKA 2BKAA 1P9LA 5G0WA 2HRZA 2X0RA 3U49A 2OGUA 4YAKA 2J5RA 2GYYA 4A03A 2Q50A 2O3UA 3H3FA 1DIGA 3QVXA 1YE3A 1SCUA 2PKRA 3EK2A 4BNWA 1P0CA 3X2FA 3QHAA 1QMGA 2VNAA 4E2YA 1O0SA 2O7SA 3SEFA 3IIEA 3LYLA 2NSDA 1EK5A 1VC2A 4M1QA 3VKVA 4WASA 2J3IA 1EUZA 4F3YA 3NT5A 1NFFA 2FWMX 5KIAA 1ADGA 3TL3A 1NVTA 5JXWA 5BQFA 4Y8VA 4YJGB 3ADOA 1Z45A 2QG4A 2HKIA 4MO2A 4DIOA 3NGLA 3Q3CA 3MJEA 3TZKA 4IDBA 2EW2A 4O1MA 4OKNA 3I9MA 3JV7A 4MVJF 3WGQA 3C8MA 1NWCA 1KVTA 1I3KA 2PD4A 4NH4A 1C0IA 1L7DA 2HCTA 4UUOA 3HDHA 3ITKA 3GHYA 3IDSA 3BXXA 1M76A 5C5IA 1FJHA 4U8GA 4YT5A 3HNPA 4J9UE 3OM9A 4J4TA 3VPSA 4HXYA 4NJOA 4JX8A 1WDLA 3IC5A 3RJ9A 1WVGA 4IDCA 5T5QA 3RU7A 3WXBA 1K2WA 5TT1A 4CMAA 4A0SA 5G0SA 1Y5RA 4K6FA 1WAMA 2ZTMA 1Z74A 5F1OA 5JCXA 1UDAA 1JAYA 1WXDA 3L9XA 4AJJA 2Y66A 4GGPA 4QEDA 3EUWA 3JQ9C 3UUWA 3WYCA 4C7KA 5BSHA 1GU7A 1PJ2A 3BHMA 2CVOA 4QO8A 4XYBA 1EBFA 3UHAA 3H8VA 2JD0A 4IDGA 4OKIA 4BO9A 3GGGA 1FDUA 1P33A 1ZXBA 3BTVA 4CMGA 4GBJA 1HDZA 1OBFO 4CLHA 1UDCA 3U4CA 1VJ0A 3AJRA 4OL9A 4AJLA 2IE0A 3INRA 3QVTA 1JAXA 3VH4A 1EEHA 1DFIA 2DUWA 2DPHA 4D79A 2WTBA 1ZSVA 3QIVA 4W9NA 3ZV4A 5G4KB 2B0JA 2Q2VA 1M66A 3GZNB 3KRTA 3F3SA 1JWAB 1JU9A 1DLJA 3F4LA 4FBGA 2F1KA 4LCEA 4MVJM 4UULA 1X15A 3BMQB 2NU6A 3PK0A 3PHJA 3VPGA 1LX6A 4W99A 5A03A 4EEZA 2Q2WA 4QFDA 2D5CA 2YUTA 1Y8QA 4E3ZA 3GEMA 3R3SA 3HE3A 2FY8A 3A06A 4CLOB 3PHLA 4BNFA 2ZK7A 3AK4A 5U1PA 3PTZA 3GLQA 1ISHA 4B4WA 1WLYA 4PN3A 1LUAA 2VRCA 3JD2A 2G82A 1FMCA 4DLLA 4B3HA 4ALKA 3QW2A 3S8MA 3OIDA 1U7HA 4DLBA 2NU9A 1EUCA 4K1LA 2PZMA 5I8WA 4HKTA 3PHIA 2X86A 4WCFA 2AG5A 3Q2KA 4LSMA 1ZEJA 2CDBA 3FNFA 1HE3A 1GYRA 1VJTA 4RPLA 3RC7A 4IDFA 3K30A 1NVGA 3FPCA 3D1LA 2WYVA 3WQSB 4NFSA 2E82A 4R3NA 1LEHA 5JFOA 1X1TA 3OIFA 1JW9B 2EGHA 1D4FA 1DC3A 2J5KA 2Q3EA 4FIZA 4IBOA 3WNVA 5IZ4A 4BHTA 1XSEA 4ZQHA 3E6AA 3FBTA 4CLEA 1K6JA 2JAPA 4AJEA 1XU9A 1F8GA 4GKBA 3QVSA 1PQUA 1WZEA 3M1AA 2DVMA 4U0JA 2VOJA 5EESA 2QHXA 1C0PA 2WD7A 3AI3A 1PJ3A 5T8KA 3I23A 3NKLA 4HX5A 2J8ZA 1RM4A 1V3UA 3WSVA 2EEZA 1JTVA 4CM4A 4JROA 1V3TA 1CWUA 1VKNA 2Q99A 3OJ0A 5CPFA 2G0TA 1E3WA 2VUTA 3HB5X 4E2ZA 4FB5A 2H9IA 2WWRA 4CR8A 3JD3A 3ZWOA 1BDBA 3B1FA 1R4NB 3CIFA 1HRDA 5COQA 5A3VA 3UVEA 1SOWA 4E6PA 2RH8A 1AE1A 3NT4A 1ZK0A 3P5SA 5FYDA 1GCUA 3TQHA 5CPBA 2QQ5A 4LRSB 1IL0A 5H83A 3WOHA 2W98A 4JP3A 3ZWAA 1DIRA 4W9NC 4YJHB 1KBZA 1A4UA 3JD0A 1WWKA 1I3MA 1GFSA 1OFGA 1P0FA 1R15A 1EVZA 2AQIA 1A9YA 2FPPA 3KEOA 4W7HA 3GOHA 4XB2A 4Y6PA 3O8QA 1YH3A 1T1RA 2PZKA 1JKJA 1Y8QB 5MDHA 4IZIA 4J1NA 1AUPA 5B1YA 2P91A 4OOFA 3PQFA 1PJBA 5KCZA 5CG1A 3HB4X 4B7UA 4A2CA 3WLEA 4JBHA 2C7GA 4IJUA 3IP3A 2VYVD 1P3DA 2H6EA 4LW8A 4BKOA 2RBEA 5JDCA 4CLRA 4DVJA 3K6JA 4OAQA 4DPMA 4AJOA 4H3VA 3N58A 1GL3A 4TSKA 5BSFA 1ZNQO 1XCBA 4ZQGA 4BGEA 4F45A 1ZW1A 1BXGB 2C7VA 3EW7A 4NJMA 3DTYA 3I83A 2AQHA 3UN1A 2DFVA 1Q1NA 1KYQA 3RCBA 3ZHZA 3WGZA 3WGYA 1YB5A 1ONPA 2QW8A 4YPOA 3NTRA 1HE4A 4BNZA 3L6OO 1H2BA 3MJ4A 5HS4A 1GUFA 4XQ9A 4TRRA 2PK3A 3FTNA 4ZN6A 3Q6IA 1T24A 3ADPA 2XXBA 4N5MA 3W6ZA 3DEYX 5J23A 2X58A 2Y99A 2O48X 5U9CA 2BRUA 3ROQA 2CFCA 5ENDA 2QRKA 2FHSA 5CEEA 2VHZA 4JJFA 1ZXLA 1WW8A 5L7YA 1BTOA 3AUSA 2VT2A 5DCWA 4B4UA 1EVJA 3QQPA 5DBFA 1VL8A 3BTUA 3WGGA 1N1GA 2GGSA 4E2XA 4LRTB 3WLFA 2WYWA 1CIVA 3RROA 4MP6A 1AN9A 1W0CA 1KERA 1LXCA 4YRBA 1OAAA 4RLSA 3I1JA 4O6VA 4O63O 4RQUA 1MA0A 2X0JA 3TJRA 2DAPA 3ZW8A 4DPLA 3KVOA 1T2FA 3T4EA 3WYEA 4E32A 3RASA 1PS8A 3WFJA 4CUZA 2TMDA 2EIHA 2VUUA 4HNGA 4MVJG 3OF2A 5G0TA 4RF3A 4E30A 4GQAA 3LF2A 4PLYA 2UUPA 5COAA 3WWYA 1GZ4A 3KYDA 3GVCA 1E7WA 3TPCA 1P1IA 2C59A 3H4VA 3RKUA 3DHNA 1IHYA 2HDHA 3MZ0A 3ANLA 4M87A 1Q0HA 2IDZA 3KBOA 3ORFA 1ZUD1 1PJLA 2JD2A 4QX6A 5ADHA 3TL2A 3V5NA 4TQGA 1ID1A 1MV8A 2AXQA 5BNTA 4FFLA 5AXCA 1QYVA 3PFFA 4OM8A 1QYXA 3KO8A 5TRTA 1ARZA 1I2CA 4I5DA 2O3RA 2JFFA 4N5NA 1HYHA 4NBVA 2DTEA 3BHIA 4NFHA 4XIYA 1PR9A 1U3WA 1B3RA 2NACA 2ZQYA 3K31A 1T26A 3AUAA 4MVJI 2AQKA 1HE5A 1HDYA 4FN4A 2I6TA 5KVQA 2Q1WA 4ND5A 2Y1GA 4CM6A 4YT4A 1GZ6A 2GZ1A 3HHPA 4YJFB 1YL6A 3PYMA 3PP8A 2QZZA 3QA9A 3T4XA 4YQZA 4XCVA 1HE2A 2NM0A 3E1KA 2OBYA 1HWYA 3BTOA 3ZHYA 4JJGA 2X4GA 4ZRMA 2I3AA 2Q2QA 1Q0LA 2OL4A 5JC1A 4FCCA 1U8XX 3JQ6A 3WDSA 3DBHA 3HSKA 4BNGA 4WE3A 1ZVMA 4CUJA 2X23A 2GLXA 3OETA 3DAPA 4MIEA 5CAEA 4MVJA 1E3LA 4NFYA 3BTSA 3QWHA 2PGLA 4ZICA 1XLTA 2BELA 2G76A 3ZGYA 1NQOA 4AJ2A 4LCJA 3Q9UA 3D3WA 2AA3A 1PTJA 4D42A 5TIIA 5EN4A 4QT0A 1MLDA 3JQ9A 5T67A 3GGPA 4RDIA 3NRCA 1ZIDA 1DC5A 1X7GA 4MIYA 4MOWA 1LRJA 4BNJA 5ES3A 2POQX 1Q0QA 3ZU3A 1GPJA 3ZH2A 5G4KA 4XQEA 1ZKMA 1ISIA 3ASVA 1E1MA 3MJTA 1NX6A 5LDHA 2NTNA 1IE3A 1NFQA 4J90A 4IM7A 3ZV3A 3TOXA 4OH1A 4I5GA 1PWZA 3S55A 1EK6A 3H3JA 1A9ZA 3OMLA 4NI5A 1I10A 3PWKA 2YZ7A 1FDVA 2YJZA 3E18A 3GH3A 3ST7A 1U2DA 3IJRA 3GFGA 4J91A 5ILGA 4CR7A 3FSRA 4QUKA 3ANMA 2NQTA 5JAQA 2RAFA 2EXXA 4YDRA 1ZO8A 3FI9A 1VI2A 4E5PA 1NP3A 2O3QA 5AXBA 2J3JA 1MB4A 1EDZA 1P1HA 4UEOA 4BVAA 4R01A 1OI7A 2PFGA 3JYQA 5A02A 5L4SA 5THQA 4JP2A 3VZPA 3OSUA 3ZWCA 4GVLA 4KUHA 2HK7A 4DWVA 2X5OA 3F5SA 1EZ4A 2J3HA 3EC7A 4UUNA 1PGQA 4BMVA 1TLTA 1Y8RB 4OYRA 3OEYA 3PI7A 4AJ1A 5IG2A 5JAIA 3CE6A 4R16A 5C7OO 1S6YA 2NQ8A 1AXEA 2WE7A 3DMTC 4P4LA 4CODB 2YY7A 4GX2A 1OOEA 4NK4A 4Y9DA 3BA1A 4TKLA 3LK7A 2YHIB 1MP0A 3SBOA 3GMSA 4IIVA 5BR7A 1D8AA 2DFDA 4GLOA 4FC6A 2NUAA 4WLEA 1UZNA 3SC4A 3D7LA 4EW6A 1PZHA 4XRRA 2OP0A 5B12A 3GG2A 4J3FA 2NVUA 2B4QA 5JCJA 2AHRA 2VZ8A 1RPNA 4N5LA 2E6UX 4XIJA 5CG2A 3DC2A 2Y1OA 2GNAA 4N54A 1JKFA 4GL4A 3RIHA 5DOVA 4B8ZA 4FOOA 5TT0A 1XQ1A 3V2GA 4PGFA 4RF2A 1E92A 3PFWO 4R51A 4F46A 3FHLA 4Z0PA 1RYEA 3LVFO 3QWBA 3JQCA 3PXXA 3DZKA 5JW6A 1WNTA 1EQUA 2FSVA 4L73A 3DOCA 2JHGA 2HAEA 3DZFA 4IJWA 3ABIA 4CMCA 1P1KA 1R0SA 1SNYA 4RPKA 4D0SA 1DJNA 4DIFA 1GV0A 4MJLA 1GD1O 4NR0A 3WQQA 3HDJA 3KXDA 4R68A 2WD7B 1QYWA 1Z6ZA 2ET6A 4R1NA 1E7SA 4UVDA 4XGKA 1PGJA 2ZCVA 4EYEA 4IZHA 4BO0A 1Z7EA 2NVBA 1NM5A 1KETA 1CRWG 3SXPA 4FPXA 4ND1A 2ZQZA 1HDXA 2AEJA 3O4RA 5I9NA 3KLMX 1XIVA 3PDJA 4WCFC 4XEHA 3PPIA 1DPGA 1EE2A 3H2ZA 1PEDA 5HA5A 4FGWA 1O6ZA 3S1LA 5FWNA 4IUYA 3PVZA 1IPFA 2HQ1A 3K96A 2DTXA 1VKOA 2BFOA 2VNSA 4A27A 2HO5A 3LU1A 1ISFA 2CMDA 3IP1A 3PJFA 2NV6A 4FJ0A 2YQ5A 1XELA 4TKMA 2GERA 3RVDA 2W2KA 4IPTA 5G2OA 1ENPA 5GY7A 2B5VA 2HU2A 3PQEA 1I3NA 2OZPA 4Z6KA 4RPHA 5F1KA 2CDCA 1YJQA 4XR4A 1ZSYA 5EMHA 5ER9A 5G4LA 4F6CA 1M75A 3OICA 3EGOA 1I8TA 3AWDA 3ONDA 2CVZA 1GY8A 3JQAA 4GGOA 2PH5A 1DC6A 3CINA 3OQ6A 4WGGA 3MJSA 1PGPA 1UZMA 4B7XA 1VM6A 4D7AA 1LLDA 5JMWA 1UH5A 2GDZA 1U5CA 1GPDG 4XD2A 3AU8A 3B1JA 3U9LA 5HTOA 1YVEI 1MXHA 1GZ3A 1NYTA 1PIWA 3DMTA 3FPLA 5KTKA 1S7CA 1YGYA 4RO0A 4UVEA 2DBQA 3H9QA 4J16A 1DO8A 3I9OA 3ZNOA 3IKTA 3WJ7A 1HKUA 2X5KO 4BMSA 4BMNA 1EDOA 3WBFA 3GZNA 3WTCA 5L95A 4J7CA 1NFRA 3E48A 5L3ZA 4YEDA 4B4OA 5BNFA 3BIOA 1UXJA 3QVOA 4CMKA 5F1PA 3OHSX 3EHEA 3GAFA 4PLTA 4DYVA 1EFLA 1QYCA 2R2GA 3L9WA 2EJVA 4XZ3A 1TB4A 1LC3A 1N9GB 1LQUA 2EHDA 4NZ9A 4Z9FA 1U3VA 4QFCA 4KMSA 1LBEA 2XOXA 4JCOA 3BMNA 2P9EA 1HZZA 2VRBA 4FSHA 4O5OA 1I3LA 2C54A 3K2BA 3L77A 3Q1LA 4YVFA 2CDAA 4PLHA 1IYZA 1GYPA 4IXWA 1GAEO 1CERA 3K73O 3AM4A 1B8UA 1LDMA 1ENYA 4RL6A 1I36A 4BNXA 2C5EA 4BO1A 3TZQA 3A4VA 3HWRA 3U4IA 4BNMA 1ISMA 4IMPA 5T64A 4GVXA 3KTDA 3ZWYA 2Z5LA 1KVSA 3U09A 2X22A 3F46A 1XKQA 3JQEA 1CF2O 2BI8A 1HL3A 3UOGA 2Z1MA 8ADHA 4EBFA 2VUSA 4EUFA 4YT8A 2I99A 4G81A 2Y93A 4XKJA 2HLPA 2DPGA 3GRKA 4IJVA 3HADA 4CM8B 4IDEA 1UXKA 2W2LA 3AUUA 3BMQA 5KWEA 2SCUA 2IZZA 2UAGA 3UCEA 2YDXA 4MP3A 2EKQA 4ZRNA 3ETDA 4LMRA 3HUDA 3JQAD 1E3EA 2CZCA 3AOEC 3GY0A 4WPGA 3IJPA 4ZJUA 1DLIA 3RBVA 3ZWPA 4D43A 1Q2XA 3ZW9A 3G1TA 3K92A 4YXFA 1N92A 1JA9A 3I9KA 3RD5A 1RJWA 4TRJA 4XGNA 5ICMA 1LU9A 2QRLA 1ZBQA 1NVMB 4L76A 3WS7A 3V1YA 3W6UA 2GASA 4YT2A 1E7QA 3ZZNA 1KEWA 4UREA 1PJTA 1XG5A 2QIOA 5CEJA 4N18A 2BFMA 4CMHA 4Q3DA 5IZCA 2EW8A 3ZU2A 4KP7A 4AFNA 3HN7A 2HRBA 3OIGA 1UXGA 2H5LA 4ALNA 4CLRB 2LDXA 3QLJA 3TZ6A 2I9PA 2C2YA 3OH8A 4QSMA 4YA6A 3RKRA 2OHXA 4CMBA 2WMDA 3EAGA 4MIOA 4JIGA 1BMDA 2VOEA 3UFXA 4BO2A 1V3VA 2V6GA 1P1JA 4NU6A 3UCFA 3VZRA 4K9DA 1Z75A 1HSZA 1YONA 5THKA 4D0RA 5TQVA 3RUIA 4W7IA 5CDYA 2JCVA 1PS0A 3EZYA 3PYLA 3QWFA 1B7GO 1R66A 1ZEMA 4Z3KA 3U0BA 2XAAA 4CM3A 2PNFA 3LC1O 4RV9A 1FDWA 4IMRA 4DQUA 5CDTA 3G3EA 1XA0A 2IYPA 3ZHXA 4IGEA 2JAHA 3DZGA 5JO9A 4RGBA 5T6BA 4DYDA 2BH9A 1NPTO 4MP8A 4EUEA 2NVUB 1DXYA 4YJDA 4Q39A 1TVEA 3HFGA 3JQDA 1DIHA 3R1IA 1XQ6A 2VZ0A 3DBLB 4ESOA 4R54A 2GN6A 1GADO 2O23A 4KUGA 5TJ9A 3IUPA 1E1LA 3S2GA 2D2IA 5IDXA 3WB9A 1YXMA 1VL0A 3BYZA 3JCZA 3PGJA 4UAGA 4JXKA 1B14A 3TOZA 4PLWA 4RVHA 1I01A 2NU8A 3JQFA 4CM7A 1HYEA 1DB3A 3LZ6A 3MOIA 4OGWA 2YDYA 4ALMA 1DEHA 1PWXA 1YQDA 4MVJP 2Z1NA 1VLLA 1UXHA 4R3WA 2OXIA 5IFLA 4FGSA 4PVDA 3U5TA 2Q4EA 4DUPA 3PQDA 4I5EA 4I9UA 5JE8A 4CV3A 4KWHA 3PLRA 1Y9EA 3PEFA 3C7DB 2IXAA 2EKPA 1M6HA 3LLVA 1ZFNA 1LRKA 3AOEA 3NTQA 4NU5A 2P5UA 2OOSA 1ENOA 2W8ZA 3GUCA 2D3TA 1NXQA 1T2EA 3P19A 3WBBA 4KZPA 3CPSA 2HMTA 4YAJA 4BNKA 1H94A 2RIRA 3M2PA 1ZMOA 1L1FA 2BGMA 1BSVA 3DR3A 3JQBA 4HBGA 1AXGA 5BSGA 1PR3A 1B8PA 1FDSA 2E48A 3PHGA 4O0LA 5A9TA 4A10A 1IB6A 1Y8RA 1JLLA 1UP4A 2PZJA 2GZ2A 3JD4A 4YTEA 2Y05A 5L9AA 1HXHA 3C85A 5AVOA 3RAJA 1FXSA 1GR0A 4FJ1A 3I5MA 3GT0A 5EL0A 2JHFA 3MOGA 4RVUA 4J2HA 3CH6A 4W4TA 4LGVA 4D3SA 4NK5A 2YHIA 4ND2A 4CUKA 3I3OA 2NVWA 1H0KA 4Z3DA 4AJHA 2YV2A 3TN7A 3CXRA 4OO3A 3QP9A 3MEQA 1U5AA 3GDOA 1I32A 3L4BC 1I0ZA 4S3MA 1JQBA 2W90A 4YJHA 5KJFA 1H93A 1YL5A 1DJQA 2DM6A 2IEDA 3WTBA 1MXFA 4HFRA 4CMIA 4R41A 4UEKA 2YW9A 1B15A 4GSLA 2HK8A 3FNGA 4O59O 4L8VA 3D5QA 1NWHA 1QR6A 1EUDA 3TF5A 4QTZA 1R4MA 2FR1A 3C1AA 3AM5A 4AG3A 3AM3A 4TMFA 3ICPA 3DFUA 3VPFA 2PY6A 4J1SA 2Y68A 3O8QB 1Q7GA 5L7TA 4Q3BA 5I9MA 1MFZA 2A9FA 1KY5A 3RC9A 5L4LA 3NTOA 4JBGA 2PZLA 2RCYA 1E3SA 3DOJA 1Y9AA 1YQXA 2G17A 3KM0A 3CTMA 1DC4A 1KIFA 4W6ZA 4WUVA 3TZHA 4Z0HO 4G5HA 3NJ4A 2C0CA 7MDHA 4FS3A 3OQ1A 4RZIA 2FZWA 3L07A 3ZU5A 2RH4A 3KSZO 4AJIA 3Q9NA 1MC5A 2VWGA 3E5RA 4NIMA 4NMHA 3UAGA 2O7QA 1TA4A 4OMUA 1KEUA 4LISA 2P4QA 4HFJA 3JQ8B 2X7HA 3D4OA 4I9HA 2I76A 1G0OA 3NEPX 4Z9YA 3FTPA 4EEXA 3AY7A 1PQWA 2IZ0A 5DN9A 1HDOA 2EP5A 1F8FA 1Q7CA 4IS3A 1LC0A 3TZCA 4DTIA 3RFXA 4GH5A 1VL6A 2OFPA 3DHYA 5HRUA 3VH2A 3UGKA 1NQ5A 3GN2A 3GNTA 1J4AA 3BMOB 3TRIA 4MDHA 3F4BA 1PGNA 4OOEA 3JQ7B 4B4VA 3G49A 5TLSA 1KVQA 3V2UA 1DSSG 4GWKA 5JYEA 4GKVA 2J3KA 4ITUA 3W4JA 3L6EA 4L0QA 1JN0A 1WMAA 1YS4A 2D1YA 3G79A 4DGSA 1I33A 2GD1O 2Q46A 4XGIA 3LC7O 1YDEA 1I30A 5IJZA 2VTEA 5IXYA 5MGBA 3A9WA 2FSSA 1ZJZA 1SC6A 3KYDB 2CSUA 4YQYA 1C1DB 1TI7A 2YV3A 4E12A 4PIVA 4TROA 3PWZA 2CVQA 1M2WA 3D5TA 5FI3A 1HT0A 2JKVA 4YCAA 1FK8A 2PLAA 4OSPA 3W1VA 4URFA 2GSDA 4JBIA 4XJSA 3W8DA 2DLDA 3D4PA 4MINA 3ZHBA 2YV1A 3U62A 1LQTA 1MGOA 3E03A 4MVJE 3H9UA 2BFAA 4XYMA 3WMXA 5C7LO 2X0IA 3GG9A 1TXGA 2B4TO 2O3TA 3A1NA 4PFJA 4A26A 4BNYA 5DULA 4FFOA 1LSUA 1D7OA 1X1EA 3KZVA 3MWEB 1QP8A 1NHWA 4RVFA 2HK9A 3I6QA 2A94A 2JD1A 1JWBB 1ZMTA 3K9QO 3U4HA 4I08A 1W73A 2HMWA 3LLSA 3RC1A 1W8DA 3T7CA 2FOIA 4E33A 2UV8A 1Y5MA 1F17A 4QECA 1KS9A 2Q1TA 3E5MA 3RBZA 2FZEA 3TFQA 3IL2A 4RORA 4EUHA 4KWIA 1LRLA 1SB9A 1NNUA 4PRLA 1PU2A 3OFSA 1EFKA 2DUUA 3BZUA 1V6AA 1OC2A 2J6IA 3O03A 3ITDA 5JSFA 4YAEA 4KTTE 4RVGA 4GPD1 2VYND 5DOZA 2GN9A 3GNSA 5K6AC 2I67A 2G1UA 4J49A 1GQ2A 3VZQA 3BMCB 2ZB4A 4BNUA 4CV2A 1HEUA 1ORRA 2HMUA 1E6WA 3IKVA 1WDKA 2IEBA 4HNHA 1LSSA 5IDYA 4B8WA 1Z73A 5G0VA 4AJNA 1O95A 1F14A 3IUSA 4TWRA 1KY4A 3GEGA 4WNIA 1QSGA 5DBIA 2O3JA 3D64A 5IXSA 5KNLA 1C1XA 1QV6A 2V7PA 1KC1A 1R6DA 1PJQA 5AOVA 3ENNA 1U1IA 3RSHA 1E1KA 4BS9A 3GN1A 5KJ1A 5KJ6A 3GFBA 4DL9A 3I9NA 3FD8A 3LQFA 3VDRA 5EINA 3V2HA 2W2KB 1WPQA 1E7MA 1RYDA 4BV9A 3ZV6A 1OC4A 5GMOA 2BD0A 4WLNA 4LN1A 5EJ2A 2AE1A 5AYVA 3WICA 4A7PA 2Y0DA 2OP1A 4CJXA 4YAIA 4J6FA 3WR5A 3E9NA 3OA2A 4TRNA 1E3WB 2VWHA 4Y6RA 5LDGA 1PZGA 1C14A 5BT9A 1XHLA 4FR5A 3KYCA 1UJMA 3COSA 1K5HA 4JJIA 4II3A 4PZEA 4PVCA 5CP8A 2EV9A 3A14A 3JQGA 2IXBA 3VH3A 2GN4A 3JYPA 3GVIA 4YRDA 2ZATA 1WDMA 2B83A 4BO6A 2CF6A 3HZZA 3QE3A 1D1TA 3AFMA 3ON5A 3ZV5A 3HJAA 2OO5A 2JCXA 3VHRA 1EVYA 1FF9A 2QYTA 3N7UA 5JAZA 1R16A 1G1AA 3H5NA 3GDGA 3X2EA 1A71A 3H5AA 3I4CA 2QYSA 4BNHA 1Y1PA 4K26A 2Y1FA 1I5RA 2QX7A 4IS2A 2R00C 2ZYGA 3E8XA 4J4BA 5U4QA 1T4BA 3FWZA 4M49A 1Z82A 2YHUA 4P4NA 4LK3A 3OQBA 4B7CA 2Q4BA 1N7GA 2C20A 2NNLD 3Q2IA 3GAZA 4I1IA 5KKCA 1YRLA 1H6CA 1B8VA 1DDOA 1K89A 2O3SA 8LDHA 1GCOA 2PWZA 3E9QA 1V35A 3ZNNA 2A4KA 3UF0A 4E2WA 4CM9A 4GSKA 5L40A 4B79A 4U7WA 1EE9A 4J2OA 1FDTA 4WLOA 2XXJA 1LDGA 1YBAA 3HQ4O 3VZSA 4M8SA 4Q9NA 2AEFA 4RLHA 1BVUA 4ALLA 2B5WA 4PLCA 3HDQA 5T8KC 1YBMA 2WDZA 3RUDA 1UAGA 3ULKA 3KSUA 4HWKA 4DLAA 2CD9A 4HV4A 4PLPA 4QXMA 1E7YA 4WCFB 5L45A 1UZLA 1ONOA 1ADBA 3U3XA 5KVSA 1B3BA 1QYDA 1NHGA 1VE9A 1JKIA 4WEQA 1R4NA 3NAQA 1P77A 3ZWXA 4D46A 1XDWA 5TSDA 4L4SA 1N8KA 1X7DA 2DT5A 2YQ4A 4YYZA 4ROSA 3RFTA 1XWFA 5ILOA 5CDUA 3GA0A 3ZNQA 1X0VA 3LT1A 2JFGA 3D3EA 2ZKLA 3ROKA 4ZQFA 3RUAA 1LDYA 3H7AA 1H2HA 1X13A 1SPXA 1A4IA 1T2AA 3GRPA 3V8BA 5FI5A 4MVJH 5H82A 1N1EA 7ADHA 4Z9XA 3ETEA 3F47A 3WX0A 4MVJD 4DPKA 5A5EA 3STHA 4PG8A 4TVOA 2GUGA 4BB5A 5DF1A 2BHLA 3ENKA 4UEJA 5I7EA 3DL2A 1LDNA 2FRDA 1ZZEA 3TSCA 2AEMA 4JNKA 3MWDB 4E5MA 4P8RA 1D1SA 4ID9A 1MX3A 2DBRA 3C1TA 3JYLA 3UW3A 4CLOA 3E9MA 4R9RA 3EY4A 4PG5A 2FR0A 3FNHA 4ZQBA 5I7SA 4CMEC 4WKGA 5L4NA 3PHHA 3JQBC 1CDOA 4XWYA 5TGDA 3FBGA 4R1UA 4BNVA 4Y67A 3IQDB 1VPDA 5L53A 3R3JA 4AICA 1LNQA 1X7HA 4XYGA 4ZGWA 2NTVA 2J5QA 4CLXA 1BW9A 4DMMA 5CFZA 3RWBA 4CQMA 4Q3EA 2GR9A 2WYUA 5CDGA 4OHUA 2GPTA 1W6UA 4OSOA 4BB6A 4ONEA 2DQ4A 1J0XO 2TMGA 4NBRA 4ND3A 1Z7BA 4DBVO 3L4SO 4I8XA 4J0FA 3CKYA 1CETA 1M6WA 4ZD6A 5JY6A 3QVWA 5GZ1A 1T2CA 5HM8A 3DFZA 2HMSA 2VYVA 3LT0A 3PZRA 3NDIA 3QY9A 4R69A 1C3VA 3DZJA 3P2OA 1KVRA 1OMOA 2BI7A 5CEFA 5ITVA 2X0NA 4KQXA 4H15A 5A9SB 1N7HA 3I52A 1ADFA 4HY3A 3ANNA 4IJKA 1HDRA 2EG9A 3WIDA 1U8FO 3PIIA 4AJKA 1BGVA 1CJCA 2XPCA 5FEUA 4E5KA 2VN8A 1GQQA 2HJRA 2VWQA 4DC1A 3PGXA 4D3DA 1ZK1A 1BRMA 5EERA 4M86A 3OP4A 2HSDA 4FFMA 5JMPA 4RF4A 2XF8A 4ZVVA 4BNLA 4B3JA 2O2SA 4IQ8A 5KKAA 1LI4A 1YWGO 2OBNA 4WEOA 3AW9A 2EERA 4UUMA 1SEVA 1DIAA 4L74A 3UICA 4E0BA 1DRUA 1BDMA 1ULSA 1BWSA 1SB8A 3DDNA 1J49A 2FPGA 2C5AA 4ZA2A 1E7RA 1HF3A 3JD1A 2A35A 3GF4A 4DXHA 4XDYA 3QWIA 4PLFA 1B2LA 3MTJA 4KQWA 3GGOA 3WYBA 3GPDG 4WLFA 1C0LA 1PS9A 3GNQA 4DIBA 4PG4A 3OJOA 5B4VA 3BMNB 1GQYA 4EITA 5I7FA 2PV7A 4NDNE 1U4OA 4CQMD 2VCYA 2ZJ0A 2DKNA 1MG5A 3WJAA 3TFOA 1PJCA 1VRWA 4Q3CA 1P44A 1I2BA 4ALIA 1DFHA 1R0KA 2VQ3A 3WIEA 5JBIA 2PTGA 4YB8A 5BNIA 1DHRA 1PZFA 1NBOA 4PLVA 4WOJA 1R12A 4BO4A 4BGVA 4DRYA 3L0DA 3QV1A 4XRGA 3ZWBA 9LDTA 1RM3A 3RQSA 4RJTA 4PZDA 5EQDA 1H6AA 2CUKA 2IZ1A 2ZCUA 2Q45A 4NHEA 1QKIA 1QG6A 4UVIA 2JJYA 1A72A 4RPJA 4CM4B 3O9ZA 1U28A 2I65A 3WGTA 1VSUA 5A06A 1H9AA 3GK3A 3I6IA 1YB4A 1ADCA 3NJ8A 2BMAA 3RUHA 4Z0TA 4R1SA 3JTMA 3K2EA 4MKRA 5K0ZA 4OXKA 3KB6A 5AQ1A 4W82A 3JQAB 2X9NA 1C0KA 1E0DA 1BVRA 4RVSA 4DQXA 3KETA 2WJPA 3SJUA 1U3TA 1U7TA 3VPXA 1LLCA 4RQTA 2X8LA 4AJ4A 4R5HA 4CV1A 3WNQA 3OJLA 1T2DA 2H1SA 5L7WA 1DBVO 4N7RA 1Y81A 2HJSA 4RCVA 1HLPA 5DNAA 4B3IA 3JQFC 5ENVA 4QO7A 2DU8A 2EKLA 5I7VA 1UP6A 1H6BA 1TEHA 4J4HA 4J9VA 4DMLA 4CMIB 4P38A 4XR9A 4AVYA 5KJCA 2PGJA 5JS6A 4YAGA 1IULA 4XQGA 2EWMA 2I5PO 2AQ8A 3M6IA 4ALJA 1T4DA 3ZNPA 1E5QA 2RHCA 3V1UA 4DREA 5JLAA 4Q3AA 2ZTVA 3CMMA 3WQRA 4FW8A 4F6LA 4K28A 1IHXA 4FD3A 1R4MB 5GZ6A 4BO3A 1A27A 2AE2A 1DHTA 1NQAO 4YWJA 1DFGA 2BGLA 1YOVB 3DBVO 3H5RA 3G17A 1G0NA 4GAEA 3CEAA 4CQLA 2GF2A 3D4NA 5ER6A 9LDBA 1CQIA 4U6SA 2BLLA 4XX0A 4EJ6A 3V1TC 3NX4A 1N9GA 2VZ9A 4D3FA 3LDHA 1U3UA 4ZU3A 2Z95A 4GLLA 1YL7A 2C2XA 1PQPA 3Q11A 1IUKA 4BKPA 4UUPA 5JPIA 3DBHB 4XB1A 4IQ0A 3TDKA 2ILTA 5EQFA 3W4IA 4EZBA 3C24A 4RF5A 5ITWA 1TT5A 3O38A 4DBZA 1HETA 2V6MA 3F1LA 3JQGB 1NASA 4IIUA 5JO0A 5KVVA 3OECA 2V6BA 2O2YA 1TT5B 3NUGA 3T7EA 1JDJA 1K6XA 4JK3A 3QWAA 2C07A 2GN8A 2PGDA 1HSOA 4ZHSA 2ZYAA 3VC7A 1LJ8A 4FDAA 4NJMB 5L51A 2IRWA 1ZJYA 1PJ4A 4WNCA 1X14A 4GI2A 3GPIA 1RM5A 2P5YA 3AY6A 3WWZA 1BXKA 3ZI0A 2YYYA 1ZK2A 4BQRA 4CL3A 1IY8A 1K0UA 4CM5A 1YKFA 5JYDA 4R4JA 1BG6A 3P2YA 4BGUA 4WJZA 5IAAA 1UDBA 2C82A 3SLGA 4IINA 4GX0A 3SVTA 3DBRA 5DT9A 3WGIA 3GUYA 3EVTA 4E5NA 2WD8A 3WGOA 3NDJA 2DTDA 1BXZA 2GRAA 2FPIA 2DBVO 1HLDA 1GEEA 1M67A 1XR3A 3VTFA 3TNLA 1OZAA 4U0KA 2CF5A 1LDEA 2EJWA 1R0LA 4GX5A 4P22A 2NTJA 1ZK4A 1DAPA 1DIBA 1AHHA 1TT7A 3C1OA 3CMCO 3PJEA 5T57A 2D0IA 5F5LA 1V0JA 4IY1A 5HBRA 5A9SA 1WZIA 2VT3A 4A73A 2E4AA 5IN4A 4FFRA 4BNTA 3BAZA 5HS6A 1NR7A 1XU7A 1A7AA 4HADA 3P7MA 3RFVA 1ML3A 3KHUA 3PLNA 2VWPA 3NT2A 5C37A 5GZ3A 3LC2O 4WCDA 4MPDA 1P31A 4MKXA 2X9GA 4BGIA 3S2EA 3IOYA 3RUCA 2ZTLA 5KVCA 4J0EA 1LLQA 1IPEA 3C7AA 2P4HX 4J43A 1KEVA 4C7JA 4PG7A 3ETGA 3GVHA 5K6AA 2AMFA 3CUKA 4Y98A 1J5PA 2O4CA 1KVUA 3INGA 1E3JA 1NAIA 1DRWA 1ULUA 4EGFA 3D3WB 4G65A 4TZKA 4D44A 2E37A 4II2A 4C4OA 3KOUA 5LCXA 3KUXA 3LSYA 1XEAA 4GX1A 3VVBA 4FFNA 5JNLA 4WLVA 3G1UA 4FFPA 5JDIA 4XA8A 4EI2A 5C7IO 5EIOA 3KV3O 2JCYA 4G2NA 2ZB8A 3L4BA 4J1TA 3DBLA 3QJ5A 4E21A 1ZH8A 4M54A 4Q3NA 1ZSNA 5G0UA 1LA2A 3ZCXA 4BO8A 3AI2A 1E6UA 1UUFA 1UAYA 2P9GA 2Y0EA 2UDPA 3F9IA 4YRAA 3FCOA 1N5DA 3WSWA 1F0YA 3H65A 3MJVA 1E6EA 4IDDA 4M55A 3DAFA 3NGXA 3PYXA 1GUYA 1RKXA 1V9LA 3FWNA 4ZQEA 3VKUA 2DBZA 1O9BA 3H9GA 1PJSA 3U4DA 4CR6A 2B36A 1D3AA 2V65A 2GO1A 2JFHA 4LVUA 1CQJA 1PZEA 1RWBA 1T1SA 1XYGA 2UYYA 4BNIA 5TF4A 4UVGA 4BOYA 3DXFA 2P2SA 4IDAA 4OXNA 1MFPA 3DBRB 4RZHA 3JYOA 5IDQA 4R1TA 3UXYA 1AGNA 3ZWVA 3W8EA 4E5YA 1O94A 5KOIA 5CHEA 3SLKA 5TC4A 2F00A 1I24A 4PLGA 5DDIP 2AG8A 1Y7TA 1CYDA 3AU9A 3DAGA 5DCUA 3K8ZA 3PDUA 3AFNA 4H16A 1LDBA 2ZB7A 3ROPA 3FRJA 4NQZA 2WM3A 3AY3A 6LDHA 3F5QA 3DO5A 4BL5A 3A28A 4BIIA 3CSDA 2O4UX 4KDFA 1NQTA 1PL6A 4TVBA 4D41A 1B16A 2A92A 3GVXA 3RU9A 3HN2A 5TNXA 3VDQA 4BO7A 4XJTA 3H6KA 2NADA 3UH1A 3VAZA 4I9NA 2H63A 4PCVA 5DZSA 4AL4A 1GUZA 2Q1SA 4JQCA 4NNJA 3ASUA 1IZ0A 1QXSA 5A3JA 2VHVA 4GMFA 2R6JA 3GMDA 5K9ZA 1F12A 4DQVA 1AHIA 4KTVE 4KOAA 1QLHA 1IZ9A 3MJCA 4LMPA 5F3RA 5IF3A 5IDWA 4DC0A 4FOSA 3ROMA 2GZ3A 2ZJ1A 5B4TA 3D0OA 4PLZA 1CEQA 2ZTUA 2FN7A 1SZJG 2PKQO 4CQMB 3O26A 4EJMA 2Y67A 4WK6A 3RI3A 4CQLB 1VSVA 3IAHA 5AXDA 1BHSA 4PZCA 3AI1A 1SBYA 1E5LA 1JVBA 3LF1A 1A7KA 2I3GA 3JYNA 4XQCA 3UKOA 3JSAA 4KUEA 3PIDA 3DZHA 4TZTA 5JC8A 1RM0A 2QZ9A 6ADHA 3E82A 4UVHA 1SMKA 3OJFA 3RBXA 5COBA 2X9VA 3CZRA 4BKUA 1YJ8A 1H6DA 3HG7A 3DHEA 1VJ1A 4RVDA 3S2IA 3WFIA 2VRCD 5TS3A 4RPGA 5I8ZA 1DOHA 1N2SA 1NR1A 3SX2A 4NBUA 1SAYA 2QRJA 4CLDA 5A1TA 1K3TA 1NAHA 1PL7A 2P9CA 1SOVA 1NPYA 4XDZA 2IYOA 3NDRA 3ZWNA 2VYNA 1F06A 1LSJA 1YQGA 4YJFA 3CZMA 2PD6A 3VOSA 2VHXA 5TX7A 2IODA 3H9JA 1PL8A 4CV0A 4HFMA 4L4XA 1BXGA 3VTZA 2AW5A 4OXYA 3B20A 3L6DA 5JY1A 5DP2A 3PRJA 3QSGA 4AJPA 2B35A 3ZDFA 5FFFA 4E4YA 5JCJD 3INTA 2Y1CA 4HFNA 4BKQA 4NBTA 5A9RA 2X6TA 4U6QA
chains in the Genus database with same CATH superfamily
2IELA 2XSZA 3OZVA 4OIMA 4I5FA 1NW3A 3B8HA 2D8AA 3C7CB 4QRIA 2A5GA 4QSHA 4DEVA 1HFEL 3SQLA 1FYFA 2NYRA 3R6DA 2L0XA 4YJKA 3ZDYB 3ITEA 2GILA 4F8JA 3FF4A 1U7DA 1GJRA 1QTIA 4DDWA 5JZSA 4IXDA 1VPLA 1C9DB 4BEVA 5IWAB 4L4RA 3LPAA 3VU8A 1GEGA 2ID7A 3CLTD 4JJEA 4ZOLB 3S8EA 5BT8A 1EMDA 1ZK3A 2VATA 5FUXA 2CHUA 2AV6A 2E55A 1ZRNA 1MO2A 2I1VB 3CH5A 5DX8A 4IDPA 4ILEA 2E1RA 4JJ4A 4IFEA 5BSEA 1J33A 2I4NA 7GPBA 3IEMA 1JG6A 5KNCH 5FL7D 2R68A 1OAKA 1M1UA 2G06A 2VDNB 3HCDA 3LYAA 3V42A 3RC2A 3BBLA 1G7SA 3WWPA 4M89A 1PK8A 3VZBA 1UXOA 3JQ7A 2XSZD 3UTCA 3KB1A 4RY9A 1QNFA 4HYQA 4LXIA 1DKUA 1P45A 4LSGA 2BBSA 3O8CA 3OT4A 1TIKA 2O50A 4CF7A 4KK3A 3SHTA 3WISA 2I4TA 1Y3FE 3HEAA 4Q9IA 3W05A 2FMUA 2IXTA 5DHUA 3ZDEA 4G4GA 4WK4B 2ZSFA 2V6JA 5A71A 2I4RA 3DZIA 1TK2A 5IT9A 1RZVA 2B69A 5MN4A 3NDPA 3TXXA 2D1FA 5A05A 5LZ7A 4IDQA 3H04A 4NS1A 1TTTA 3OQMA 1MB2A 1T0BA 3NOQA 4JLOA 3QKSA 3PJGA 3H8WA 2A88A 3SXUA 5FT9A 4LVCA 3LGSA 1RXCA 1ENZA 2RARA 2CCGA 4EDFA 2EGGA 4RTQA 3QPWA 3FDIA 3A2KA 1L5MA 3L04A 8GPBA 4J0JA 2IZ5A 3OA0A 1ILWA 3CSSA 1FQKA 3G2KA 3SC6A 2IY9A 3DB2A 2ZYIA 4UE3S 1XXHE 2J3MA 3RVOA 4HHEA 1CDZA 1L7EA 3KYCB 3OG9A 2J6HA 3DSRA 4LJYA 4OK3A 5KTTA 2I91A 4EO4A 1QV7A 4J1QA 1PSDA 3A05A 2XB6A 4A23A 5IN5A 1FTGA 1W4ZA 4FC7A 4OJMX 2NYVA 2Y0PA 1M0WA 3MGGA 3N70A 4X41A 3GEDA 3IO5A 3SMVA 2BEVA 1HYGA 1H9BA 1SRRA 2P2GA 2R6HA 1OF1A 4NCJA 3SDZA 3UC9A 4CM8A 5F5NA 2HPAA 2QMUA 3F3KA 3CWQA 2BEUA 2ZI9A 1OYYA 2J9YB 3X1JA 2D5AA 2I4MA 3B1WA 1TA0A 3HFSA 1HT3A 5SZJA 5THXA 5AO9A 1I6WA 3AV0B 1ZISA 3MTBA 2ZWAA 5I3CA 3DXZA 4RZ2A 3CF0A 1WZNA 3C6BA 1D4ZA 2IIBA 1E98A 2H54A 1VHJA 2ZBFA 5BSRA 3FW1A 3PJDA 1GTMA 1KZ1A 2AVDA 3CONA 5IDVA 3UXMA 4ZDIA 2JLWA 3OJEA 4C0QC 4YBZA 1PI3A 3DTTA 3IS3A 2BF7A 1H65A 2W4QA 1R74A 1QB7A 1SULA 3LUPA 4FDMA 5G40A 5TF0A 3RRXA 4EY8A 3NYWA 4Q1DA 4B6OA 4C0SA 3PL1A 3VVCA 4E11A 2Q3BA 2K87A 2FG7C 3UJ3X 3C3EA 4YV0A 4L50A 1E4YA 4GEKA 3ONWA 1WRBA 1XMVA 4S2EA 2WD9A 3KEQA 2F3PA 1G4AE 1WXGA 2ZJ4A 4JELA 5EVJA 3CR7A 5DK6A 1WP4A 3RUEA 5KTPA 2LDBA 1PVVA 4EI9A 4JYCA 1VLQA 2J59A 1ZNZA 1O89A 5SZHB 3TQQA 3UPUA 2ACWA 3FZNA 1BX3A 3EGWA 2YMPA 4B1FA 2X1HA 3WBKA 4D4MA 3DLIA 1XLVA 2EF1A 1ISGA 3MOSA 4MYRA 4MI3A 3VNBA 1GG2A 4UM9D 1T25A 3GFTA 4KV7A 4X1KA 3A9TA 1C3LA 1QYRA 1UBRS 1WTCA 2OHGA 2BFBA 3DWFA 2Y27A 3E70C 3ECAA 2GRUA 3NFYA 4G8JA 2ZYDA 2BFPA 4M1SA 5LBIA 3TQTA 1PO7A 3F98A 3W8FA 3B70A 1Z28A 1UJBA 4HGNA 2YXPX 4L0MA 3RYFA 4U5QA 1JFFA 5EKDA 1JA0A 1QR2A 1G8AA 1YNSA 5EIXA 3TVYA 1IOLA 2EFGA 3IMFA 2RAUA 4O2BF 3TIGA 1PYDA 3GQVA 2NX2A 1YOVA 2NLOA 1O8CA 1GV1A 2CHQA 1Q22A 1ODJA 2YZKA 3ABOB 16PKA 4GOKA 1QQBA 3A31A 3AJEA 5FX2A 2P79A 3I9JA 1TC1A 3QVMA 2BFFA 3DNMA 2V98A 3N74A 3G9TA 4LCBA 5LQSA 3T54A 3PICA 1E99A 2AB0A 5IJ0A 1XNQB 3HB7A 5K05A 1TLLA 3L1KA 4Y2YA 1XCLA 4D92A 4J7XA 2J5XA 2D0OB 2D59A 4LXUA 4DMFA 5K3OA 3PITA 3U44A 1DO0A 2GD2A 2XT6A 1TM5E 1ILEA 4HNAA 3VR4D 3WKDA 2QZSA 3P9IA 3RUFA 4LBWA 3N86A 1PX2A 1U7WA 4NCIA 2NO6A 3HMKA 4DTCA 1KO5A 2AUNA 3AVPA 4N49A 4NZPA 4CHTA 1U28C 3WLKX 2OMEA 3UMSA 1GO2A 2KI5A 4R7TA 3T1VA 4BWYA 3TWOA 4EY4A 5HF5A 3PPWA 1T5DX 2JDID 4MKZA 3KWMA 5KJEA 3GT4A 4E5SA 4ISCA 1Z25A 3K0HA 3ICWA 3MNFA 1QONA 4UPEA 1YB1A 2VHYA 5I9LA 5K3EA 3OUTA 4M22A 3K0SA 2PH3A 3DDCA 2WEKA 3KD3A 3LQ2A 2CY0A 4W1SA 2XTJA 2VHWA 3X44A 2MHCA 5IC5A 1SBNE 2O2DA 1LF5A 1KI9A 4H1VA 2B34A 3SF0A 5KDDA 3F74A 1DE0A 2XA2A 2QNIA 3JWIA 3R9IA 4K46A 2R00A 4OFZA 4EJSC 4C5CA 1SXJA 3UEOA 3JWHA 5CW1A 1P9LA 2DZDA 5G0WA 4YAKA 2X0RA 3Q5GA 3QMMA 2QJFA 4KIJA 3HM2A 1T8RA 5BQOA 2ZDQA 1FNSA 4QU0A 2W2QA 3QVXA 3VZDA 1SCUA 3VR2D 2PKRA 4BNWA 4GDFA 4DUGD 1YA4A 4OUDA 4IVRA 3WLLA 2P3QA 1YMVA 3L93A 5HJEA 3X2FA 1QMGA 5LZ9A 4KG7A 5LPNA 2BLNA 3EXHC 3VA7A 3TW6A 4R1OA 3N0WA 2HYDA 1EK5A 1VC2A 4M1QA 3MK31 1K9VF 4MLCA 2BBWA 3UB4A 3T1QA 821PA 3IIKA 3DR5A 1ZD8A 4R8VA 1O4VA 2J7KA 1NFFA 1NMYA 1KJ9A 1ADGA 2INGX 2QMEA 2M6LA 4GR4A 1NVTA 5BQFA 5ETJA 2XUOA 1PV2A 2OVBA 3RGGA 1AOXA 3V33A 4LFBB 1Z45A 2QG4A 1FFYA 3KT3A 3NGLA 2G67A 4QQ8A 1UMCA 2A7QA 3HDVA 2HLDD 3CQ9A 4IDBA 4TQ9A 4U00A 2Q4OA 5FWDA 4R71A 2EW2A 4LKOA 4O1MA 5IBQA 5EJEA 1Y1RA 2L18A 3OM0A 1K5PA 1G42A 2K6GA 5IJ9A 1XKTA 3C8MA 3L01A 2VP9A 3ZI7A 4IHJB 2FETA 2PD4A 4GD3Q 2RGUA 4NH4A 3NVKI 4CTMA 1C0IA 3U3JA 1L7DA 1M1NB 1I7NA 2VPPA 4FLFA 4UUOA 3ITKA 1HPLA 5CK4A 2HHJA 2PUJA 3PXBA 2O7RA 1QIDA 4YT5A 1CKEA 3HNPA 5KS2A 2J9ZB 4HXYA 4JX8A 3CUEF 1WDLA 4J0QA 1WVGA 4IDCA 2NZUG 3MRTA 5ALIA 5TT1A 2ZBRA 4FYYA 2XBLA 1Y5RA 4GI7A 1WAMA 2B5OA 4GYWA 4QELA 1MOQA 1AX9A 4XPIA 3STXA 1TL7C 4WGFA 3TTUA 5JR3A 4DHEA 1WXDA 4JP8A 5J5AA 3EH2A 4GOJA 5K45A 2M32A 5BN4B 4KVZA 4TZ6A 4DDHA 3JQ9C 4RQAA 3VR5D 2GBFA 2JK1A 5EFOA 2GFIA 3AFIA 3LW7A 3O84A 4QO8A 1DAKA 3ZGVA 3CB2A 5JXGA 4YCNA 4AMGA 3FPGA 4EYSA 5BUSA 2ZSJA 4IDGA 1FMLA 3GGGA 4LTMA 4UARA 3WO0A 1ZXBA 3NWOA 4PZAA 2YJ4A 3Q6NA 3K15A 2C9DA 5LMCA 1GPNA 1UDCA 4OL9A 2GRJA 3EVGA 5IULC 4K7JA 1RAFA 1CEYA 1QGDA 4QHYA 3HY4A 2IE0A 5HGXA 2BI4A 2Q4DA 3BXGA 5B1HA 1EEHA 2RK6A 4GOXA 2Q2OA 4Z54A 3NCHA 4HAZA 1ZSVA 2J85A 4K9QA 4MS4B 5KU1A 2B0JA 2ZRFA 4KACA 3KRTA 1KMMA 1JWAB 1JH8A 1ACLA 4HLUC 3R3VA 4HTFB 5IAKA 1U0GA 3F4LA 3K0KA 4OF4A 4ZGGA 4XWKA 1SWVA 3D6NB 5GV8A 2BN4A 1CZUA 1M6VB 1VCHA 2FE4A 1KQ3A 3FA2A 1CXZA 4MVJM 5A0TA 3GLRA 3NMUF 3OQNA 1P9OA 1X15A 3F5FA 1MX1A 1G41A 3LUKA 3PHJA 5I7AA 1Z39A 1L9XA 5JJIA 3LNTA 2BSQA 1LX6A 3ZLTA 2W11A 3TQOA 2C9MA 1FNNA 4RVCA 4OAPA 1ZI8A 2Q2WA 4LFAB 2LE0A 1PR0A 1Z2DA 4RJIA 2C31A 4UKDA 4HVLA 1JSRA 5EJAA 3GEMA 3R3SA 3LFUA 3R3XA 2FY8A 3A06A 3ONVA 3UMCA 4EW1A 2ZK7A 4FOTA 1QIJA 4KI7A 1B00A 5FUWA 3TIVA 1UEIA 2F17A 4WXPA 3T38A 1DEOA 2GBIA 1JJAA 1WUIS 2C94A 4OLHA 2IDMA 4A8JA 3O7WA 4H7FA 2MIIA 4JOBA 1FMCA 1H8EA 2O5VA 1OLSB 4YP9A 4WBXC 1GT6A 1UMKA 2J30A 4DLBA 1JHAA 2C5BA 3FUWA 2DE0X 2J0VA 3IAFA 3ROFA 3ECSA 2OGTA 4MEBA 2QAGB 2ZEJA 4WCFA 2I8LA 3LYUA 4TWAA 4UEQA 4LSMA 2R48A 3WYFA 3ZLJA 2CDBA 1PT6A 1AF7A 4S1NA 4NATA 5B3KA 4QM6A 1T15A 2R47A 3RC7A 3BB1A 4YHBA 3RYHA 3ZLBA 4COOA 3FPCA 2E4VA 2VYFA 5AM1A 1P5HA 3WQSB 4ZCMA 4V0MA 5K0LA 1TAHA 4LZAA 5JFOA 4FXOA 5KNDA 3OTQA 1X1TA 2F64A 2WA1A 1IG3A 1W9MA 1JW9B 2OTCA 3OIFA 3E4CA 5LQCA 1IK4A 5IF9A 3OLQA 4ZANA 2I54A 4URZR 1LTKA 1GNVA 3HV2A 4FIZA 3L7DA 1NXOA 1IH8A 4TSRA 1CJVC 3MILA 3W1WA 5IZ4A 2QR2A 3B6JA 5JD6A 4ZQHA 1R4AA 3E6AA 4JZKA 1XK7A 2EDCA 4FFDA 2MSKA 3SFZA 3NJRA 1K6JA 2XQKA 1YQUA 4AJEA 5KHLB 3S2ZA 1XBTA 3HP4A 3M1AA 4JEHA 3GJ4A 4X1IB 5AFSA 3L0BA 1JXQA 5DTJA 3ZJ5A 2WTNA 1TUIA 3AI3A 5FA8A 1XROA 3HUUA 3L40A 3I23A 4QUDA 2Z9CA 3N6VA 3D7RA 4HX5A 4XCXA 2J8ZA 2Z4TA 2M6SA 4QM7A 4BMXA 3AWIA 4R9UC 4TYQA 1XF9A 5EE5B 5LYJB 1M2NA 3NWPA 5AK5A 1EFDN 4AIRA 1NRJB 2CLCX 2Y4OA 3K53A 1GRRA 4CM4A 4DABA 3FVTA 2WYOA 1CWUA 2Q99A 3HCWA 5CPFA 5K4HA 4PYOA 2G0TA 1SUWA 1T3LA 3HB5X 1R18A 2EU8A 2WWRA 4QGHA 5CMLA 4C6RA 1SC3A 2XQVA 3QTBA 1L7VC 2DWUA 3B1FA 1P6UA 2OCGA 1Z5ZA 3L49A 3MB5A 1SBCA 4M9QA 4QARA 4QFMA 3QYAA 5JD3A 4E6PA 2DR0A 5CVDA 4ZYTA 3SE0A 2P9BA 2RH8A 1AE1A 3CEJA 3NT4A 4MR7A 4P6VF 3PUZA 3HA5A 4IJMA 2Y76A 4ER3A 3WKEA 1M5RA 4C87A 3OO0A 4R2KA 4OH7A 4OU4A 3TE6A 1Q16A 3D6HA 5H83A 2IH4A 2W98A 2Y1XA 2JC3A 3ZWAA 1SPBS 1KJZA 4W9NC 2AN5A 3ETHA 4FILA 4YJHB 3U81A 1KBZA 4YMLA 2C4KA 4TTVA 1A4UA 1NF2A 1Z5NA 1W46A 3H86A 1MPTA 1J0DA 2RK4A 4PNZA 4RQTA 1EVZA 2RDMA 1A9YA 2JCGA 3KEOA 3GOHA 1H42A 3TD2A 2OKCA 1TKCA 2YWJA 1T1RA 1O5OA 2V7BA 1L5YA 4DBLC 3BE4A 5MHTA 1U6KA 4UCQA 2P91A 4OOFA 3PQFA 4YAOA 3H5WA 1KRXA 2CXTA 4TMWA 1E2LA 4Y30A 3QXGA 1U6IA 4L85A 3HB4X 1M54A 3MGBA 4ZVQA 4B7UA 2VDMB 3JWGA 3WLEA 4C22A 3P0HA 5CIQA 1QU2A 2IYEA 2E5FA 4QYWA 4R2HA 4WDRA 4V2UA 1D5CA 2H6EA 2RBEA 3OUUA 4BP1A 4TTRA 4XDGA 2CFOA 4A1OA 3K6JA 4OAQA 1B8NA 4Y2UA 1G5RA 3N58A 1Z22A 2FQXA 2O52A 3L8FA 3K6KA 4RXTA 5K3FB 1KFBB 5BSFA 2C1ZA 2W6IA 3BCRA 3AKEA 3QY0A 4DG5A 3I1FA 1ST2A 1Y1TA 2XMRA 2C7VA 3W3AA 5DLEA 3EW7A 4FNOA 1XZGA 3QIAA 4Z7JA 2JLVA 3EG5A 1UBMS 3GNLA 1H69A 5AK6A 1JXMA 3R41A 4UTOA 3RCBA 1JHDA 2HU8A 3CX6A 3TZEA 3WGYA 1YB5A 2GCEA 4EQZA 1Y5NA 1JQDA 4YPOA 2FLVA 4OAOA 4RKFA 2D5IA 4FZ3A 1XL1A 2QXUA 4PRYA 4V0RA 4FZJA 1P4RA 2X6QA 4G5OA 4XWAA 3NBKA 1VYTA 4K9MA 3TLYA 1G5TA 4WK2B 4GECA 3RRNA 2PK3A 3FTNA 4O4IB 3M3DA 1GZUA 3ZQ6A 1Z5UA 1T24A 4DSUA 1FPQA 1PW7A 1MQ9A 2RJNA 5GVRA 3W5UA 3W6ZA 3K70D 1L3CA 2IHZA 3A9SA 3BGOS 4MNTA 2PS9A 2Y99A 3VOAA 3AVVA 2BRUA 2JGKA 4JY7A 1M0EA 4HRVA 2V3WA 4A26A 1D6MA 2VPTA 1CQXA 2EATA 1P5JA 3BK1A 1XUOA 1YR1A 4UEWA 2CVPA 2QRKA 2FHSA 2QOEA 2Q1YA 3LKDA 3PNVA 4UFOA 4KNVA 2ODPA 3H6GA 1NVVR 3NOOA 5LP6C 3VDNB 2B20A 1ETUA 3DB1A 1UMDB 3AUSA 3QX8A 4RIGA 2BP7A 3QQPA 1VL8A 1Q95A 1N1GA 2GGSA 1ODTC 4E2XA 1CIVA 4I4CA 1NXTA 1SQ0A 2DKFA 3CRVA 3HEBA 4EHBA 3A6EA 1EPUA 4JYBA 2VTKA 4OB6A 3VO8A 1PYGA 4KPYA 3NKVA 2ADOA 3C5HA 1A7JA 4RQUA 2J46A 3MCAA 1LBHA 1NJ1A 2X0JA 3TQIA 5CT6A 4UOZA 4KCGA 2XUZA 1ND5A 4R1QA 3HI6A 4A6EA 3GJ0A 4IZ6A 3C6KA 5ERXA 1RQRA 1NW6A 4C21A 1P2FA 4RTOA 1ODSA 2BGTA 1ZIXA 3DBOB 4HNGA 1D1PA 1P8AA 1XMIA 2ZOSA 3OF2A 4LJ7A 4RF3A 2H59A 2UUPA 1B8OA 3IUQA 1KEEB 3JQRA 4ZT4A 1NBIA 4ZEWA 1E7WA 4LOHA 3HWX1 4M87A 4O4JB 3ANLA 4PU0A 3CZ9A 3LZDA 1OTXA 4QUEA 1QRTA 1A77A 2IDZA 4AP5A 1B1AA 1ZUD1 2GEVA 4EVRA 1W5AA 3B9RA 5FD8A 4DM4A 1NZFA 1AN0A 3RS2A 1BOOA 1KK2A 4JL5A 3H1PA 5IJ0B 1U7PA 1H2WA 1ID1A 1MV8A 3EAQA 2AXQA 2QAGC 4G8DA 4D0LB 4DCJA 3PFFA 3T0IA 4CCYA 2R7AA 1QYXA 2X40A 3G2LA 2QG9A 2W2TA 1ARZA 5FWYB 3N2ZB 4I5DA 1JBKA 3DMGA 3E23A 4CETA 2W42A 1T6BY 4N5NA 2RI0A 4DLVA 4NBVA 3BIFA 1NVEA 2IY8A 2DTEA 2JFUA 1DBPA 4NFHA 3R0ZA 4RACA 2QV7A 5ERYA 2PHZA 1VGQA 1B3RA 2ZQYA 5AW6A 2WUGA 4RH3A 4F4DA 1VP9A 3RSZA 1JRLA 3AUAA 4MVJI 1H1LA 3IBCA 4Q01A 1ZLXA 3QV2A 2AQKA 3VO9A 4TTSA 4YMHA 5I48A 4FN4A 2I6TA 5KVQA 2C04A 2JGNA 4ND5A 1JIXA 1V95A 2LIPA 4UUQA 4CM6A 3MMZA 1DWOA 1QBGA 3G1WA 2J32A 1UMBA 1A9OA 1YS1X 1OASA 4YQZA 4FP9A 2YWBA 4XCVA 2NM0A 4BJ3A 2VJCA 2G1KA 4V0ME 3ZHYA 2APJA 1K2VN 3EDOA 2Q2QA 1SD5A 3K9FC 4TN1A 2CKDA 1JL3A 4FCCA 1K75A 1U8XX 3MUNA 4G89A 3WDSA 1M0SA 5E3IA 3TQCA 1C80A 1SUSA 3SIPA 4EA7A 3HCPA 1ISSA 2M9MA 3D3JA 1VLMA 4S04A 4WINA 2GLXA 1M7GA 2P9ZA 4MIEA 1DVRA 4TV9F 2L42A 1Q2UA 3AW8A 4MWBA 4M2LA 5ALPA 3WVNA 3QWHA 2P40A 1X6VA 4ZICA 1DO2A 2G76A 4M38A 3NIFB 3U31A 3T5DA 1NQOA 1PLKA 1VMKA 1PTJA 4EZIA 1UPAA 1X74A 2CXRA 4QT0A 5EN4A 1U0RA 1HNZB 2XX3A 3H18A 1BYUA 3JQ9A 4EB8A 4RDIA 5ECWA 1II8B 3NRCA 3C16C 1ZIDA 4RABA 5BYJA 4C0AC 4K8RB 3RC3A 1X8XA 1JG7A 1IN7A 1Y3CE 2J9FB 1QFSA 2YFYA 1F20A 1LRJA 3ADKA 4M8NE 2I4OA 2FSHA 3I73A 2POQX 2XUPA 1QGZA 3U7RA 4Z4HA 3PKIA 1IOWA 1BO6A 2R3SA 3ZJUA 1ZKMA 5B3AA 4PGGA 1E1MA 1PVOA 2WFLA 4R6XA 4NNPA 5LDHA 3B60A 4J90A 5KYUB 3B3FA 4C9BA 3NBMA 4IM7A 4LPKA 4P5DA 3ZV3A 4AN1A 3EE6A 4OH1A 1TIBA 1Z08A 1PWZA 2ZRDA 1EK6A 1QO0A 3DO8A 1IVYA 1I10A 3PWKA 4UNRA 5IWCA 4PYKA 1TIPA 1FUEA 3GH3A 5I51A 1EXWA 2H18A 4K9RA 4EX6A 3ABRB 2XCSB 3M9LA 4CIXA 4X7RA 5FI1B 5D1NA 2YJNA 3DYVA 3RTCA 4XH9B 4YDRA 1LLFA 3FI9A 4RS4A 1W5BA 4UHCA 5FI0B 1W7AA 2O3QA 5HFJA 1WMFA 4J0GA 4UEOA 4DSNA 3JYQA 3N5CA 4EGSA 1SVUA 5L4SA 1J39A 4US0R 3VZPA 1WIWA 4DM7A 4DG9A 4DNOA 3OSUA 3ZWCA 3UA3A 1Y9JA 4LHSA 4LPSA 4KUHA 4L2IB 1J8FA 2W9XA 4FMCB 4O8CA 5GTDA 1XNRB 2CJPA 4QTTB 3JZIA 4UUNA 1BQEA 3TB6A 1TLTA 2XHZA 4UOEA 3EGEA 1SQ6A 2GPAA 4EHFA 3RFCA 1G20A 5EFZA 2QX8A 3CE6A 1YCFA 3HKEA 1S6YA 5KSOA 4G4JA 4P4LA 3DMTC 2WE7A 4PQGA 2YY7A 1H4QA 1O3YA 3F96A 4GYYA 4M60A 3VO1A 2HGZA 2QN6A 4J16C 2QPOA 1WV1A 2JI4A 4C7MA 1B6GA 3LK7A 3SBOA 4CCSA 5DTQA 5C1IA 5H80A 3ZIDA 5IBCA 2P3OA 4FC6A 4TZ0A 4HH3C 1LW7A 2AUMA 4FDUA 3EULA 3SC4A 1JZTA 4EW6A 1PZHA 4TQUS 4JP5A 4XRRA 4CQJA 3P26A 5BV1A 2HR1A 4LXQA 2PXAA 1VCMA 1R6XA 2B4QA 2WG2A 1OY1A 4N5LA 3AHEA 1BZYA 1PR4A 4QHSA 2F4NA 3OCXA 5EWJA 4E15A 4IVNA 1P7CA 2GNAA 2RIPA 4GL4A 3HZHA 3PC8A 4G56A 2HF9A 3T3IA 5A6VA 5K0JA 4RF2A 1M0TA 3EZ6A 1RPTA 4G4SP 1TQ8A 3FHLA 4C0KA 3IP5A 4Z0PA 2D2EA 3KHTA 3MTDA 2IYSA 4M0DA 4U2FA 2PVCA 4EKIA 1PWYE 2R4QA 3ZZMA 4FI3C 3HCEA 2ZRPA 4X3PA 4Z1MD 5G53C 1V16A 1D0VA 4GZ5A 2X6RA 2A67A 3DZFA 3ABIA 3Q8XB 5ARCA 2ONYA 4RPKA 3R7WA 1XAGA 4QPDA 1UBKS 4DIFA 1RADA 1T9AA 5ALTA 1OWMA 1FUKA 1NBWB 3ZY2A 5HG0A 3MWLA 3KE9A 4QVKA 4KXYA 5CBPB 3KC2A 1E7SA 5H9WA 4XGKA 1K97A 3HYRA 4EYEA 4IZHA 4BO0A 3LDFA 2NVBA 1LNSA 3RGWS 1WXIA 2AZTA 4ND1A 2RGAA 4MPPA 1EM6A 1C1YA 2ZQZA 4D4LA 2BMWA 4MA0A 3FIJA 3PXDA 2XGSA 3PDJA 4WCFC 3FMFA 1EE2A 4HC4A 4DSOA 3F8SA 3AIKA 5DYYA 5H3LA 2QLMA 4FGWA 3ZCUA 3UT5A 7AT1A 1AKYA 3S1LA 3SZMA 1U2RA 4ZCLA 1USUA 2G08A 2PBLA 3OOHA 2OHOA 5IJAA 2HO5A 1I4WA 1Y4AE 1G3IA 3PGLA 4F5WA 5JYCA 3CRMA 5ALQA 4G86A 2YQ5A 5HNKA 2X2OA 3H11B 1Y3AA 2CL6X 3FUTA 4HZUB 3RVDA 1D07A 3J7AC 4MCHA 4F5EA 3L0IB 2RGEA 4QDTA 2OZPA 1BMQA 4Z6KA 1T1JA 2G9NA 3UJBA 4AZ3A 4H17A 1CCWA 3UPTA 5G4LA 2PANA 4RTLA 2G6TA 1I8TA 5A5VA 1ZL0A 1LH0A 3EQ2A 3BZBA 3KALA 4XUCA 1J5XA 4GGOA 1NDHA 2ID8A 3QFHA 5EUCA 3V6LA 4GXTA 2YRXA 2ZJZA 1UZMA 3PXUA 4D7AA 1L7MA 4H2DA 2WJIA 4ZYWA 3A10A 3BSWA 3Q6MA 5HUJA 3SM9A 1NI3A 1P39A 4IJ6A 2BTQB 2RJOA 1GPDG 2DFLA 1ZIPA 4GM1A 3THRA 1ZVJA 1IJKA 3AU8A 3B1JA 3EDCA 3U9LA 4AKEA 4CKBA 2JAUA 3PE3A 4N6OA 5AIAA 1MXHA 1GZ3A 1PIWA 1MZPA 5BURA 5DYGA 3UNXA 2WVHA 3E3MA 3DMRA 1RP7A 4LXTA 4R0MA 5EC8A 1BIFA 2GZMA 4RO0A 2DBQA 4YCDA 2ZGVA 3H9QA 3DZ8A 4DLYA 1UKEA 3ZNOA 4OI2A 3FCAA 1IBLB 4HWOA 3WJ7A 1Y9DA 4RGQA 4RA9B 3ZJTA 4KE8A 1EDOA 3ELBA 4ZOLF 1RRCA 3EWIA 3P1JA 1YZUA 3HU2A 1ZD5A 1W96A 3PEUA 1JKMA 3KTAB 3AEKA 5DBOA 4B4OA 4B73A 4D9FA 1HT1E 3IVRA 1RACA 5DTMA 3FCXA 5BNFA 1UXJA 2PQ6A 3EQZA 4CMKA 5F1PA 3OHSX 4CTOA 5IXJA 1RLUA 1EFLA 2R2GA 3MCZA 1HR0B 2EHDA 1UJ6A 3OFKA 2MJLA 3G6KA 1U3VA 3THXA 2AD1A 3AEZA 2RHTA 4QFCA 2DGDA 5DHQA 4LZPA 5TQ0B 1AMOA 4JCOA 2KJQA 2HF8A 2P9EA 3IMEA 5HOEA 4KXUA 1U8UA 1NKTA 2IVZA 4FSHA 4YV2A 2OAEA 3CPEA 1MNQA 1F3OA 1OLXB 1M8PA 1GXSB 5AHKA 2GCPA 5JVDB 2FSUA 1GYPA 4MEJA 4WL0A 3RYIB 3WRXA 1FZTA 3K73O 4HH1A 4Q1VA 1Y6GA 1YKGA 1LDMA 4RL6A 1FJ2A 1I36A 5P21A 1Y9ZA 3H1EA 1FYXA 3CN7A 1X39A 4K6HA 4MYCA 1SZDA 3C98A 2VXBA 1ZRSA 4PPYA 5IYZA 2X0FA 5EXTA 4M1KA 1BMFA 3EISA 3CLTC 2X22A 3F46A 4GW3A 4ZZ0A 5C7YA 4E3WA 3TUJC 1CF2O 2W6OA 2BI8A 1O08A 3RTBA 2IHNA 1DWUA 1AKVA 4LJKA 1CJSA 2YWHA 2Z1MA 8ADHA 2YNMC 3W9SA 4QTXA 1XMSA 3N0RA 1DCTA 3FX2A 5DWQA 4CM8B 3HADA 3PEEA 4IDEA 1UXKA 2W2LA 4MJXA 2IYNA 1A2OA 1KYVA 1YZLA 4M76B 5KWEA 1Z7YA 1IN6A 1O0CA 1DBRA 1NW4A 2DWOA 3CEMA 3MT9A 3UCEA 4MUEA 2VCHA 4MP3A 4F21A 3L8GA 2BUBA 4WPGA 2CZCA 2WOJA 5AJUA 2QLLA 1XXLA 3RKSA 3S68A 2AR7A 2W2MA 2VO1A 4QQNA 3ZW7A 3QLVA 1Q2XA 1YMUA 3CNLA 3D8UA 3WGUA 5K7SA 3ZTYA 4UAUA 3GLFA 2JHPA 4R2XA 4ADSG 4OQEA 1U2GC 1V25A 4QU5A 4WW0A 2E3JA 5KTYA 4F0JA 2O19A 1JA9A 3D0QA 3I9KA 2BZ1A 2JK0A 3FLBA 1ODLA 2O2IA 5ICMA 4QXOA 4LFCB 4KZKA 5BV7A 2AMVA 2PXCA 2GASA 4OSEA 2H5IA 4YT2A 2VH1A 4JQSA 4ZV9A 1W87A 5DFAA 4N18A 3TSWA 1JHPA 4CMHA 1O7JA 4Q3DA 3U4QA 1RPZA 2W6QA 3ZU2A 5IBPA 4AFNA 1G5QA 1CB7A 2E2WA 2R1VB 3HN7A 3PFCA 1NKVA 1WXQA 2CYCA 2HRBA 2JGRA 3OIGA 4YALA 5B5SA 2PUFA 4ALNA 5F7XA 1NBMD 2C2YA 4Q5IA 3OH8A 4LYHA 4QSMA 1H1LB 1S1CA 4YA6A 1T9GS 2OHXA 2A0YA 3QXJA 4HX2A 1BKSB 4XIIA 3H2JA 3ZYCA 1A9PA 3U7HB 1FX0B 2VOEA 3E1SA 5F78A 5F7ZA 2AX4A 1SKAA 1U6JA 3CS3A 2I6XA 3GJ5A 3HS3A 4K9DA 3GJTA 4G8CA 4MS3B 2BKLA 1ZN7A 2HF7A 4Z4CA 4A3SA 1G9XA 1NF3A 5IM5A 1UAAA 3HP1A 3ORYA 3RUIA 3USCS 1FLVA 3GJSA 3EZYA 4JL6A 1B7GO 2ZIAA 2OKGA 2ZJ6A 4W5JA 4Z3KA 5KNDH 3FOFC 3OQOA 1WOMA 4MWDA 3V34A 2XAAA 2XXAB 4CM3A 3LC1O 3WHIA 3RVJA 1D1QA 4Q7QA 3M3HA 1P61B 3QITA 4ZOQI 1L4EA 1YR8A 1XA0A 1MT0A 1TQHA 1RIFA 4NTZA 2NO0A 4ZZ1A 3PNOA 4G0NA 2QUZA 1HE1C 3LUGA 4I55B 5K3SA 1HORA 4PYNA 3DZGA 2EKBA 4IGKA 3ILXA 4QRHA 4PYMA 4RGBA 2BH9A 1NPTO 4MP8A 4CTJA 2NVUB 5AVVA 2GH1A 4Q39A 4A6PA 3DFMA 2Q4RA 1EKXA 3A3PA 1GPAA 3UQYS 1XQ6A 3ZZUA 1IVNA 3AUKA 1M2OB 1JIVA 4KO1S 4ICIA 3FJ1A 1FX0A 1GADO 1X1BA 2O23A 2VR1A 4LHVA 5AI6A 5TJ9A 4IDNA 3HR7A 2BR5A 2YJ3A 4B6QA 4BQFA 3H16A 1H66A 1VL0A 4UAGA 1WXEA 4ZI7B 4TXHA 3H4TA 1A9XB 5DTEA 4PLWA 4RVHA 3O3CA 2NU8A 4A82A 1JHYA 1U0SY 3N9IA 4L8YA 2XD9A 3TCXB 2I2DA 4OGWA 3VQTA 4CQNA 1DEHA 1FSFA 1NJ5A 1YQDA 4IWXA 3OMXA 4Q4AB 4D2IA 3O2JA 4QOIA 2UXDB 4PC6A 1U0TA 2QXTA 1NI4A 4PVDA 1JDNA 4PXYA 5LKAA 1DJOA 3U5TA 1KJWA 3BREA 3PQDA 4NG4A 4I99A 4OHOA 1UT6A 4CV3A 4F60A 4OHYA 1G60A 3LA8A 3SQDA 1NONA 1IWBB 3PEFA 3EMVA 2WFAA 4EDHA 2CFRA 2IXAA 3HVIA 4B6SA 2JLCA 4V1CA 1A50B 1K4YA 1LRKA 1Z15A 1NG1A 1RS0A 1ZFNA 2QUJA 3NTQA 1D04A 1L5QA 4RMJA 4B2PA 1Q83A 2QM8A 3BFXA 3P19A 3WBBA 2IEAA 4KZPA 3CPSA 3KYIB 4NE7A 4DZTA 1V39A 4EI7A 2GBCA 3BJZA 4G0PA 3MINB 3L3BA 2BGMA 1BSVA 1LGYA 1ISPA 1S9HA 3EIEA 3IAM6 3CWCA 3LP6A 4HBGA 3SBDA 1IU9A 5H59A 3GRFA 4O0LA 1YVUA 3U1TA 5A9TA 3SHVA 4A10A 1IB6A 1UZAA 4ENRA 1JLLA 2ISSD 2GAAA 1IZ7A 1UP4A 4LWZA 1I94B 3JD4A 1T3HA 2FN8A 1P4SA 4FEGA 1GL6A 3I5MA 2ZYVX 1G3UA 1SM4A 3GT0A 4L1KA 2XT0A 1DTSA 3LV8A 1E5DA 5E4TA 5AVSA 4YXWD 2ZXFA 4J2HA 1XMQB 3LKVA 4LGVA 4D3SA 1H85A 1LVGA 2NVWA 4LWPA 5JPCA 5BMOA 1YT5A 1Z2OX 4P4SB 3FKQA 4OO3A 3QP9A 3HXPA 3MEQA 4G84A 1G5PA 1I32A 2OO3A 4URYR 5F52A 5U4XA 3AL2A 4IUCS 4LJLA 1BQ3A 2W90A 4ZPJA 3AIOA 1WCIB 4BBJA 2WICA 2Q6TA 4O3FA 2FZ5A 3ZGNA 1NVKA 4W5QA 2GX6A 1UBGA 1SXJB 1C2TA 4DNQA 2E5LB 3PSAA 2REOA 4GSLA 4O59O 3O3MB 4J07A 4TLAA 4X1YB 2JIRA 2O57A 3D5QA 1C5KA 4MRSA 5TMPA 2D7DA 3BIWA 3NFRA 1R4MA 1GVNB 4Q82A 3C1AA 4KQ1A 5E6SB 4D4HA 3SD7A 1IHPA 3AM3A 4JLMA 3ICPA 2L17A 3EPPA 3OEHD 4TMFA 13PKA 4KE7A 1W44A 1GZ5A 2PY6A 3STTA 2Y68A 1NUPA 5L7TA 5I9MA 3RC9A 2FDRA 3HLYA 3OPXA 4GBED 4HEA6 4DEYA 1YR6A 2DFPA 2GHRA 3NG1A 3RS4A 3SIRA 4EFKA 1QG0A 1YDMA 2H06A 2VK2A 3DVSX 3OZUA 3I2FA 1E2IA 3KM0A 3CTMA 3TZHA 1CDEA 5BW8A 2Z3ZA 1WABA 4G5HA 3NJ4A 2F6RA 1I0IA 4C2UA 4FSXA 3WB2A 2JGAA 3L07A 1FFCA 3WMEA 2ZUTA 2AKEA 3W3AD 4AJIA 4TXMA 4LKRA 4MKIA 3VGJA 1QCZA 1OCEA 1RBMA 4NENB 4HS9A 2BGIA 3FYSA 1KEUA 4YRJA 2OO7A 1B23P 3BDAA 1ATIA 3WOVA 3JQ8B 3KKLA 1HQCA 2X7JA 2F3QA 3EUFA 3AB7A 4I9HA 1VB3A 3TRJA 2QPAA 2DPYA 2J3LA 5GM1A 1M2HA 3DLPX 3FTPA 5K3CA 4EJSB 1DNPA 1F0KA 2YHSA 5DN9A 5FV7A 3X0DA 4DA6A 1WQ4A 1F8FA 1VBKA 2P5SA 4XSVA 5LZ4A 3K71B 1WLSA 1JLRA 1CP2A 1C9KA 3K70C 3RADC 4DS3A 2VLIA 5JCOA 4DTIA 5AICA 1OXKB 1WX1A 4PX5A 3F4KA 4WFJA 1VHDA 3VH2A 2HTFA 3BJMA 4RETA 1UBHS 2OAGA 3DZDA 5IAEA 4FWBA 4QNRA 4L78A 4MDHA 3L1JA 3TRIA 4EY5A 4Q1BA 5FPKA 1Z5WA 2AOTA 4LRXA 4MQUA 3VFDA 5ALJA 1PR2A 2DQSA 3G5TA 3T9AA 5LFAA 1GNPA 4PS0A 1L1QA 3H11A 3WNBA 1E64A 2ZM5A 1OIWA 2BOVA 3U1BA 3N07A 1PN3A 4GWKA 1BE0A 1I6MA 2IJGX 4C03A 3Q87B 5HXAA 5EEGA 3P4XA 3HU1A 2JG3A 3RTDA 3OQVA 4BZPA 3UIEA 2B2XA 1RLOA 4TTIA 3L7AA 2ZJOA 2QSYA 3AP3A 3NBUA 4CRWB 5KO2A 1NBHA 2XOKD 5E4YA 1XZ8A 5ED4A 3FKJA 4FCVA 4ITRC 4RAQA 1J2RA 1NW9B 4EL5A 5MGBA 4RY2A 3BRCA 2R87A 2FSSA 1GPYA 4YECA 4FYVA 1YAJA 4EF4A 1P2UA 2B8WA 2NU9B 1SUIA 1OXMA 2OZVA 3L8MA 4ZT3A 1QZTA 1TJ5A 3FM9A 3SEZA 1J1UA 3JZDA 1PFGA 3AL0C 1M2WA 1TM2A 3D5TA 5DXAA 4A8JB 2YJTD 4D4GA 4YCAA 4D9HA 1FK8A 2LGJA 3W1VA 3WYAA 4RTKA 4TKUB 3U6KA 2Y8EA 3GLGB 3W8DA 1W30A 4FUTA 2HU5A 4TMXA 4AMVA 1VJ5A 3AERB 3D4PA 3G2OA 2ODAA 3HVUA 3NNDA 3OEED 4K81B 4M0PA 4RSGA 2N47A 1Z7GA 2BFAA 3O9VA 4G5SA 4G1BA 1FP4A 1VE1A 4XYMA 1HNNA 1U0EA 5AKIA 3WMXA 2X0IA 2Q5IA 3GG9A 1Y3BE 3CZQA 3FSGD 2HK6A 3OQJA 1GR1A 3QYFA 5ANRB 1L5LA 2WAOA 5FL7A 4LRWA 2WQ6A 2XMPA 1LVHA 3KZVA 4D9GA 3K05A 1QTQA 1J09A 2DUJA 1JDBB 1NN1A 4LTNA 1NHWA 5E95A 3DS8A 4RVFA 4AXBA 4DJEC 1S3GA 4GXNA 3WL5A 4RTPA 1NQWA 1TVMA 1T9DA 4BQSA 3K1TA 1EFAA 4BFVA 4CF3A 4HI0E 4WFIA 1W73A 2HMWA 2I4IA 3T7CA 1CVIA 2FOIA 1GZHB 2I3BA 2UV8A 4E33A 4KAAA 3EVZA 3NM4A 3H97A 4X8HA 4YUYA 3U61B 2Q1TA 4B45A 3RBZA 1GDDA 4EUHA 3ZBQA 4GE0A