3QQPA

Crystal structure of 11beta-hydroxysteroid dehydrogenase 1 (11b-hsd1) in complex with urea inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
270
structure length
270
Chain Sequence
b'QQPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Pyrrolidine-pyrazole ureas as potent and selective inhibitors of 11beta-hydroxysteroid-dehydrogenase type 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 99
structure length 270
sequence length 270
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qqpA00
5L40A 4AJLA 1RYDA 2PWZA 3RC9A 2B4QA 2JCVA 4R41A 1H93A 1K6XA 5A05A 1C3VA 1ZK3A 2G17A 4EGFA 3HSKA 4UREA 3QVOA 1EBUA 2VOEA 3C24A 2VYVA 3LLSA 2G0TA 4EEXA 1MB4A 5IDYA 3L9WA 3RFXA 4RVUA 1I0ZA 1KERA 3H9UA 4NU6A 2YHIB 1NYTA 1Y8RB 4RF3A 2WE8A 5F1KA 1KOLA 3SXPA 3B1KA 3AUAA 4CQLA 3DHYA 1KVSA 1Z75A 3W1VA 2SCUA 3G17A 1TXGA 2JAPA 2UAGA 3QA9A 4UUMA 3WJAA 2ZQYA 4IGFA 1VJ0A 3AI3A 1NVMB 4GVXA 1YDWA 1NAHA 2O3UA 5CEEA 2C2XA 4CUKA 3ADPA 1NX6A 4BKQA 4ALMA 5L95A 2XXJA 3NRCA 3C7AA 4DLBA 2C29D 3I6QA 1WW8A 5JMWA 4GMGA 2A92A 2YY7A 1B16A 1C1DB 4U7WA 4XQGA 1RPNA 4BOYA 1UDAA 2EGHA 1J49A 3QVXA 4LMPA 4QXMA 4R3WA 5DOVA 3AM5A 2J5KA 4GH5A 1UXKA 4L0QA 4CLXA 3HB4X 1GQQA 2IZ0A 3BHJA 4Y6PA 4EUEA 3ROMA 1G0OA 1YJ8A 3ZHBA 5A06A 3V2HA 4DYDA 3FD8A 3Q6IA 1YL5A 2GZ2A 1BGVA 1DXYA 3CTMA 3KRTA 1ID1A 4FFMA 1H6DA 4YVFA 2GRAA 1E3JA 3D1LA 1UDCA 4CMBA 1MA0A 1FK8A 1Y7TA 2UV8A 3PDJA 1NR7A 2FRDA 3DTYA 3SJUA 1BHSA 3NDRA 2NSDA 1U1IA 5EESA 5KIAA 4ZQEA 1YJQA 4GVLA 5TJ9A 3LC7O 3RUAA 1ZW1A 2DAPA 4D44A 3JQCA 2OBNA 3TOXA 1N1GA 3V5NA 4B7XA 2VN8A 1M75A 4RPHA 3R6DA 1RM3A 3JQ7B 4BV8A 1C0PA 2B36A 4XYBA 4XRGA 4P22A 5COQA 1KS9A 1CERA 4JROA 4II2A 1QR6A 4JLWA 3ZWPA 3GZ4A 3GQVA 5L7TA 3GVXA 1U4OA 1EEHA 2IZZA 2XPCA 3LF1A 4YJFA 3G1TA 4D43A 3TL3A 3MEQA 3JQ8A 2V7PA 1KEWA 3E03A 2XXBA 4IQ8A 5F3RA 4HADA 1O9BA 3LDHA 2D59A 4N54A 1Y1PA 3TSCA 3S2EA 1PQWA 4FGSA 5JC8A 1E3LA 1YQDA 3LVFO 3O8QA 4UVDA 5J23A 2I65A 5KVQA 4DVJA 3TFOA 2HUNA 4OIMA 1L1FA 1IYZA 1JKFA 1LDMA 4EI2A 2Q2QA 4NK4A 3FBTA 4DBZA 1DJQA 5HRUA 4QSMA 2CZCA 4WOKA 1GFSA 2GN9A 5ER6A 4R9RA 3R0IA 2CF6A 4JBIA 5EERA 2HLPA 1VM6A 5GZ6A 3VZQA 4DMLA 2A35A 2QYTA 4OMUA 2PKRA 2QZ9A 1BW9A 3GZNA 4E4YA 1LUAA 4DA9A 3DBHA 4IMPA 2I3AA 1OOEA 3NJ8A 1YXMA 4MVJF 2YV2A 3IKVA 4A0SA 4BO8A 5IDWA 3JYLA 1EK6A 1QP8A 1U2GA 3RJ9A 2WM3A 1JLLA 2FZWA 5G4KB 4CLDA 4FCCA 1WZEA 1QYVA 4IINA 4XYEA 2OXIA 5JAIA 1M76A 2X86A 3JQFA 4DQVA 1XQ1A 3FSRA 5I8ZA 1ONOA 3QW2A 1WAMA 3F46A 2H6EA 3H4VA 4H3VA 4R9SA 4ZN6A 3JYQA 3PQDA 3AY7A 5AOVA 4Y8VA 3WTBA 3DOCA 4K26A 2OMEA 2RH8A 2JKVA 3ZWXA 4XYMA 1PL7A 2NVUB 2VHVA 2IDZA 1DRUA 1HWYA 1QMGA 3E6AA 3FF4A 1BWSA 1R37A 1OBFO 4HBGA 1K5HA 3TZKA 3RJ5A 3FTNA 1DIAA 5ES3A 5TGDA 1TA4A 3DZIA 1V3UA 5HWSA 4GX2A 3QVSA 4J7CA 4LW8A 1T1SA 1U7TA 2WD7A 4CL3A 2YYYA 4F45A 4DL9A 4IDEA 1E3EA 1LDEA 2EHDA 2G5CA 1IUKA 1E0DA 2BI7A 2PK3A 4QT0A 1SZJG 2DVMA 2WEKA 4CV3A 3KEQA 4Y98A 4TMFA 3CSDA 5L3ZA 1PZGA 3GH3A 4CMIA 1MLDA 4CM5A 3DBLA 1CWUA 4CMEC 4CMKA 2JCYA 4QUKA 5IZCC 2X8LA 3PQFA 4RPLA 5A5FA 1LQUA 2VHWA 4GAEA 1EE9A 3PJFA 3ZWCA 2GERA 1SB8A 1NVTA 4PLPA 1LTHR 3DHEA 4II3A 2J8ZA 3VDRA 5KWEA 4I9NA 4MVJD 2AEJA 3VH3A 1ULUA 1NQTA 3HN7A 1D1TA 2GF2A 2NUAA 4J4BA 4DYVA 3D3EA 3U49A 3KV3O 3LU1A 3OM9A 1XU7A 2DTEA 4OKIA 1BXZA 3F4LA 1Y8RA 3G3EA 4RVGA 3WIEA 1FXSA 1ISFA 2TMGA 4E2WA 4JK3A 4BNVA 5TF4A 3LF2A 5L4LA 4MKZA 5AVOA 1E6UA 1ENOA 1PGJA 2GN6A 3LQFA 4YCAA 3ABIA 2HAEA 1KY5A 3OBBA 1VPDA 4GSLA 2QZZA 3HZZA 4I08A 1XA0A 1TVEA 5FF9A 4CMAA 5U1PA 3MWEB 3PGXA 4BGUA 3VPHA 3DZBA 1HDZA 3IMFA 4XGKA 1I2CA 1CQJA 1F8GA 1ZMOA 3AWDA 4Q3DA 3WYCA 5JDCA 4L8VA 2AG8A 1ZCJA 3BMCB 1HE4A 1R4MB 3ON5A 3H3JA 1Y8QA 3GVIA 4KWIA 4YQZA 2D2IA 3CE6A 1P0FA 1U9JA 2GASA 4AJ2A 5AXDA 2GSDA 4E5NA 1ZJZA 2H1SA 3OJEA 4LISA 4BO7A 1I3MA 4MKRA 1Y81A 2GDZA 3WDSA 4QFCA 4F6LA 4BMNA 2Y0EA 1U8XX 1ISMA 1O8CA 2HMSA 3OFSA 4KTVE 3BTSA 4J1NA 1WPQA 2ZJ0A 4ILKA 4LRTB 5JBIA 5KJCA 2W4QA 1CYDA 5KNLA 3IIEA 1PZEA 2CVOA 3I9NA 5DCYA 1BDBA 1IZ9A 2GGSA 4WLEA 4FSHA 4IQGA 4R5HA 1ADCA 1C0LA 3I4FA 4AJ4A 5TT1A 4IIVA 4BGIA 2O4CA 1VJTA 5BSEA 1CF2O 2VHZA 3F5QA 2DLDA 2OHXA 4CM4B 1UXGA 3RAJA 1TB4A 3PYXA 1YO6A 2R6JA 3GEDA 2RCYA 3GT0A 2V6FA 1DFIA 1P1RA 3JD3A 4YEDA 4ZICA 3X2FA 1P3DA 2W8ZA 1RWBA 3JQ7A 1TEHA 3PJDA 1LLDA 3C85A 1U5CA 3LT1A 4IM7A 2W2LA 4WGGA 5MGBA 4XD2A 1R15A 3L77A 4LN1A 1E1NA 5HBRA 5I8WA 3NV9A 2A4KA 1PEDA 3JQAA 3GFBA 3OQ6A 2BI8A 2AE1A 5CP8A 5I7VA 1NHGA 4NR0A 3RFTA 3ZU4A 1XU9A 3RU7A 1I3NA 5TSDA 2ZCUA 1LSUA 3RASA 1PS8A 1WDKA 1HT0A 2JD2A 1M6WA 5C7OO 2HK7A 3DZKA 3WG9A 1ENPA 2JD0A 1TT7A 4K1LA 4LK3A 2D3TA 3JV7A 1ZK1A 2ZK7A 4YRAA 1DO8A 3MOIA 3JD4A 3HJAA 5IDQA 1EE2A 2H63A 3B20A 5KJ1A 5ICMA 1YBMA 2X0JA 5DZSA 4OGWA 1B8VA 2VUTA 3G79A 4J1SA 2ET6A 1NQAO 4OQZA 3DBRA 4Z3KA 5A9RA 1PQPA 2Y1DA 3GNTA 3PP8A 3H65A 4D0SA 1DB3A 3KOUA 1XWFA 1ZK4A 4CLEA 1NQOA 4FOSA 4BKUA 4DREA 5GY7A 4BNXA 1DJNA 1LC3A 2J6IA 4Y6RA 3OQBA 1U3WA 4N7RA 4WPGA 3ZNPA 4BQRA 4AJ1A 5G4KA 4YQYA 1R16A 1PJQA 3WS7A 4CLRB 1UZMA 2HCTA 1QG6A 1E7SA 1KVTA 1Z73A 1VI2A 3DL2A 3L9XA 4I5DA 4IGEA 4D45A 3W8DA 2DBRA 4BNWA 2HMVA 1HLPA 1W6UA 4MO2A 1P1KA 5A1TA 1JKIA 1YL7A 2EEZA 2AE2A 2X0RA 3HB5X 4OH1A 1E1LA 3B6ZA 5AXAA 3JQGA 1B0AA 1GUFA 2YQ4A 5HS6A 2HK9A 4GPD1 4NJOA 4R54A 1BXKA 4EJMA 1PR9A 3DXFA 1UP7A 4HFNA 3OMLA 1UJMA 4E2ZA 3OJOA 1RJWA 4ALNA 1ADBA 3G1UA 1PJBA 5H82A 2O23A 3GAZA 4L75A 4J43A 3HFSA 2D0IA 5G0TA 3T7EA 5MDHA 1FJHA 3Q1LA 2VRCA 1LEHA 4GKVA 4OOEA 3SEFA 5JO0A 1EBFA 4G2NA 1VRWA 4NK5A 4ZD6A 1ZXLA 4RCVA 4XIJA 2YFQA 3GA0A 2FP4A 5TC4A 1GYQA 3U9LA 2PH5A 3IJRA 2C7VA 4TROA 1T4BA 4YB8A 1GZ3A 3RBVA 1DFHA 1P1HA 3RKRA 3V8BA 3V1UA 1E3WB 3SC4A 4MIEA 3F47A 5F5LA 4BL5A 4IBOA 2PGJA 2BHLA 5AYVA 1F17A 1ML3A 3JD0A 1JDJA 4Z0PA 4BNYA 4PG7A 1YH3A 4ND1A 4MVJI 4DBVO 1BXGA 1E6EA 4URFA 2VOJA 1ZXBA 2I76A 3PWKA 3VKUA 4F6CA 3WGZA 3TQHA 6ADHA 5DOZA 3VPXA 4CUJA 1EDOA 1QRRA 2HJRA 3MWDB 3H9GA 2NU9A 2HJSA 1SNYA 4MKXA 1E1KA 2P68A 4R51A 1OC4A 2HSDA 2VT2A 3NTOA 3AU8A 3PJGA 1B3RA 2FHSA 2PD4A 4KTTE 3ZDFA 5L53A 1Z7BA 1XR3A 5IAAA 1R0SA 3BTOA 3RUFA 3CMMA 1U28A 2D5AA 4B8ZA 3FCOA 3N58A 4BGVA 3WYBA 4E32A 2DFVA 1A72A 3TF5A 3NKLA 3U4CA 2B5WA 4LCJA 3L4SO 2H5LA 4P38A 4MDHA 4RF4A 1K6IA 1IULA 1NR1A 3FI9A 5C7LO 1PWXA 1SOWA 2CD9A 1VL6A 5JNLA 1Z7EA 1N1EA 2J3KA 3L07A 5KJEA 1ENZA 5A02A 4BO0A 3BMCA 3OEWA 2YV3A 2O2SA 4AFNA 5IXSA 2WDZA 3K5PA 3WTCA 4B3HA 4IJVA 4WECA 4WCDA 5T8KC 2UDPA 4GLOA 1ONPA 4J0EA 2VHXA 5CEJA 4H16A 5BSGA 2EF1A 3GEGA 3PI7A 1GAEO 1HRDA 2AQIA 2BFAA 3ZU5A 2W2KB 4XR9A 2NVWA 3GDFA 1Q0LA 1YKFA 8ADHA 4YJHB 1QYDA 3QWIA 2R2GA 3DTTA 4JCOA 4CPDA 2Z1NA 3F4BA 1D4FA 3UKOA 1KY4A 3QQPA 3DO5A 1Y5RA 2C0CA 3GVCA 2XOXA 3QWFA 2DQ4A 2VWQA 2GPTA 4FFLA 5GZ1A 1IY8A 4RF5A 3WGGA 3TRIA 4YBZA 3ADOA 1RM0A 4KUEA 4J1QA 4P8RA 2C2YA 2B69A 4KUGA 4ITUA 1I36A 3HNPA 3M2TA 3T4EA 4NI5A 4ZRMA 3BMQA 1UH5A 1SC6A 3AY3A 4J6FA 1I2ZA 4GL4A 5L7YA 1MG0A 2OP1A 4BB6A 3PPIA 3JQDA 1JWAB 3M1LA 2X9NA 1LQTA 4JJIA 3AK4A 4L4SA 2VT3A 3WBBA 3L4BA 2JFGA 4UVIA 9LDTA 1PL8A 3PFWO 4UUNA 1V0JA 4CQMB 4YYZA 3BTVA 4BNTA 3C1TA 4MP6A 3PHGA 3HDQA 2CVQA 2VTDA 4YWJA 3D5QA 2OFPA 3SLGA 1Q7CA 3ZZNA 3VPFA 5I7EA 4M86A 1AUPA 3U4DA 5TJHA 4QECA 4YACA 3DMTC 2Q46A 4HXYA 4OSOA 4AJJA 4B7CA 3B1FA 2Q2VA 3EC7A 3KVOA 2HMTA 4YT2A 5JFOA 2Y1GA 4HY3A 3CPSA 3FRJA 3A28A 5U9CA 4DWVA 2ZTMA 2GNAA 3E82A 3UCEA 2OGUA 4G81A 1DIBA 5L4NA 5IN5A 3LK7A 4FGWA 1P1IA 4PG4A 3PDUA 3WSVA 5B4TA 2NU8A 2BFMA 2VWPA 4IIUA 1PIWA 4JJFA 1EMDA 2QYSA 3ENKA 3S2GA 2D5CA 4BO2A 4J9UE 1NFRA 1MP0A 2P5UA 1KETA 3RQSA 4DQUA 1NQ5A 4XR4A 2IE0A 4TSKA 4NBRA 2OOSA 2X6TA 4W82A 2P4HX 3GPIA 3VZSA 1E92A 1MFPA 4OKNA 5DDIP 3EZLA 1DAOA 3D64A 3U4IA 4M8SA 2PZJA 1HE5A 1WMAA 1Z82A 1GV1A 2LDBA 2O3SA 3Q9NA 4LVCA 4BIIA 2CUKA 3I6IA 4I1IA 1YOVB 5BNIA 3IJPA 3E8XA 3AY6A 2P4QA 4OL9A 1LA2A 2DT5A 1U3UA 5JCJA 2VHYA 3W8FA 1NXQA 3HDJA 4CMCA 3U09A 3WJ7A 4U6SA 3DDNA 4XYGA 2G82A 5L45A 2WMDA 5LDGA 3E48A 1C1XB 4PVDA 1K6JA 3GFGA 3KM0A 2DFDA 4OJNA 2NV6A 3TN7A 1ZJYA 1O95A 3UH1A 1R4NB 1GU7A 4B7UA 4WEOA 4L74A 3VHRA 3MTGA 4WASA 2A9FA 3EUWA 1JA9A 1D7OA 4L73A 5C7IO 1T2FA 2EG9A 4A7PA 5G0VA 1XEAA 2FPPA 5CEFA 1LDGA 3EW7A 3PYLA 2AW5A 4S3MA 5ITVA 5EN4A 3BYZA 5F1OA 1SEPA 1E3WA 1GPJA 2POQX 4DLLA 2ZJ1A 4PZDA 4PRLA 3C7DB 2ZYGA 3OSUA 1GV0A 3JQFC 3F1KA 3A9WA 1LLQA 4ZA2A 4EUHA 4KUHA 4C4OA 3VPGA 4IXWA 4P4GA 3GAFA 3TDKA 1Q7GA 3UICA 2YDXA 1U8FO 2ZB3A 4CM6A 3WIDA 5CAEA 2DKNA 1XHLA 3H2SA 4RLHA 1ADFA 4IDBA 4BVAA 2R00C 4BNKA 4N5NA 1NTOA 4GI2A 1YQXA 1I2BA 1ZVMA 3DR3A 1ZSYA 4KMSA 2BGLA 3N74A 4YRDA 1Y9AA 1HKUA 3I5MA 3R3JA 5I9LA 4BKOA 2EWMA 1XIVA 1BVUA 3FTPA 3DHNA 2YDYA 3NT5A 3QE3A 4UAGA 4UULA 3I83A 5JC1A 1KC1A 3F6YA 4QX6A 4D3DA 4A73A 1QYWA 2FPGA 3GHYA 4J9VA 3BMNB 3ZV4A 3QIVA 4DC0A 5CFZA 3LSYA 4FJ1A 5L4SA 1YBAA 4CL8A 1NPYA 3K92A 4IS3A 2E82A 3ZNNA 3UN1A 3UAGA 3ZV6A 2Q1SA 4BNMA 5GMOA 1B15A 4DC1A 4HFMA 1D8AA 5A5EA 5T67A 1ZKMA 2NACA 5DBIA 3NTQA 1JTVA 4YJHA 1X7HA 2O3TA 4CR7A 3QV1A 1O89A 2A94A 4PZCA 2BLLA 4YDRA 2HDHA 3UVEA 4EJ0A 3BMOB 5JAQA 1M6HA 1L7DA 1RM5A 4BO1A 1O0SA 4G65A 5A3VA 5C5IA 2J3IA 2Y67A 5A9SA 2IYPA 4WUVA 4DUPA 4E30A 2W2LD 1V35A 4WJZA 8LDHA 5KTKA 3IC5A 4OXYA 2VQ3A 1T26A 1XGKA 4KP7A 5G4LA 2VRBA 3GG2A 1ZFNA 3COSA 3PZRA 1FDSA 3JQAD 4E31A 3E18A 4NU5A 3V2UA 5KVCA 1G0NA 2PV7A 4AJNA 4FFPA 2DPHA 1JVSA 3PGJA 1RKXA 4FDAA 4FC7A 4R1SA 4CM7A 3ULKA 3FN4A 1NPDA 1HSZA 1MX3A 3JQBA 2I6TA 1XLTA 1DFGA 1YWGO 1C14A 1F0YA 5DN9A 7ADHA 4YA6A 4CQMA 3DC2A 2HMUA 2G76A 1GY8A 2PZMA 4PLYA 3M6IA 5HA5A 3Q9UA 3OF2A 1I01A 4E21A 4Z0TA 4EJ6A 2Q1TA 3JQEA 1I10A 3KEOA 4IZHA 3AUTA 4UEOA 5IXYA 1VL0A 1A7AA 1GEGA 3SBOA 2PLAA 1H6AA 3GVHA 1GR0A 3I1JA 1NASA 5JAZA 3GN2A 3WGYA 1ISGA 1IZ0A 3KTDA 3U3XA 1BMDA 3JQ9A 4IDCA 4M49A 4NJMB 3I9JA 2C5EA 4MVJM 1I3LA 1LC0A 1EVYA 1X13A 4NMHA 3KZVA 4XJTA 5HM8A 1J5PA 1WNTA 2ILTA 1M66A 1OZAA 4FBGA 5T6BA 3INGA 1HTBA 3RD5A 4ZGWA 3OA0A 4L9RA 1P1FA 2C7GA 4MVJE 3SVTA 2FSSA 5B12A 4RZIA 3PFFA 3ONFA 1T1RA 3PHHA 1B26A 3ZNQA 1VSUA 2C07A 1MG5A 4Y6SA 4ZQFA 5FI5A 5B37A 2C5AA 1CDOA 2IRWA 4IJUA 1E3IA 4ZQHA 2OBYA 4CJXA 4EZBA 2HRBA 5JDIC 4GSKA 1CEQA 4PLFA 3ITDA 2P9CA 2WYVA 2RHCA 3I3OA 4MINA 3K8ZA 3ZHXA 1V8BA 3OIFA 4PVCA 4TZTA 4PGFA 3W6ZA 3I23A 1C0KA 1HZZA 4A10A 4BO6A 2F00A 1PU2A 4LGVA 2FSVA 2YHIA 4MP8A 1YOVA 4UEJA 2ZYAA 3ASUA 3NTRA 2EW8A 2CMDA 2VYNA 2O3JA 5CPFA 5LC1A 3TOZA 3KYCB 4BNGA 4GX0A 1YQGA 1NNUA 1P1JA 3ITKA 3WQSB 3IL2A 2EKLA 2WWRA 3K2EA 1HLDA 1QKIA 2BGKA 1KVUA 3MJCA 4BNJA 1KIFA 4DQXA 1NFQA 4AL4A 1UZLA 1I3KA 2GN8A 3GUYA 4OOFA 1DC5A 1LJ8A 2I67A 3AU9A 2UUOA 1J6UA 3F9IA 2NTVA 1BRMA 4NFSA 1C1DA 2YJZA 4OHUA 1A4IA 3ZWWA 2EGGA 3ENNA 1YB1A 4I9UA 1LSOA 3EAGA 2Y93A 4IMRA 4XRRA 3U5TA 1PJ4A 2BFOA 2Y66A 1HXHA 5C37A 4WOJA 2EW2A 1LSSA 4YT4A 2B0JA 3INTA 4I5GA 4YAJA 3QSGA 3IUPA 3ZWOA 2B5VA 3A4VA 5B1YA 3ZHZA 2WSBA 4RDIA 2BGMA 1NFFA 2RH4A 4NBTA 3VDQA 1EK5A 3LT0A 3RIHA 5KOIA 1WVGA 2GLXA 4XQEA 5TS3A 3PLRA 4EDFA 4W7HA 4AJEA 3UW3A 1VL8A 1X7GA 2I5PO 2QIOA 3WGIA 1N8KA 3HHPA 1T2CA 2IEDA 4JJGA 4B79A 3DAFA 5BSFA 4J2HA 4RVSA 2RAFA 1SAYA 3L6EA 5A4DA 4WCFC 4Q3AA 4BHTA 3CEAA 2Q4EA 1HL3A 3TL2A 4DIOA 3RROA 4YAKA 1E77A 1WMBA 4FFOA 1A7KA 1U7HA 4E13A 5JO9A 2IYOA 4NFYA 1WWKA 1AHHA 4CR6A 1ZK0A 1GYRA 2Q4BA 1ZIDA 4CMEA 5L51A 4TRRA 2CF5A 3C1AA 1H5QA 3BMNA 3D0OA 4XGNA 1WXDA 5DF1A 4XA8A 4J1TA 1BG6A 3NX4A 4RVFA 1NWCA 3NJ4A 2E37A 2NQTA 4LVUA 4XYLA 4IY1A 2GZ1A 5L7WA 3MJEA 4U8GA 3EGOA 3NGLA 4KQWA 4J49A 3JD2A 2NQ8A 2CSUA 2OO5A 1CETA 1N7GA 3GRKA 4XEHA 1B8PA 2NTJA 5BSHA 4NBWA 2CFCA 2Z95A 1OAAA 4FQ8A 4TQGA 3TZHA 4GX1A 4IDAA 4BKRA 1PZHA 2BELA 3KBOA 5IDXA 3PHIA 2PGDA 4E33A 3KETA 4WLUA 3BMOA 4K6FA 5DCUA 5DNAA 2O50A 1E7QA 4U5QA 4E6PA 3RC1A 4WE3A 1PWZA 4WNIA 2V6GA 4CM9D 2DU8A 2B4TO 4GLLA 5JXWA 1EQ2A 4XGIA 4W99A 4JP2A 4UVHA 1IHYA 1DIHA 1F8FA 3Q11A 5H81A 3MOGA 4Q3CA 4J4TA 5CDUA 1LNQA 4IZIA 3H7AA 4PLTA 4J4HA 2EXXA 3S55A 2NVUA 1B7GO 3ONEA 1BTOA 3GGGA 3RVDA 1DC6A 1KEUA 2V6MA 3TPCA 1EQUA 1XELA 4LSWA 3AI2A 4QO7A 4ZHSA 3JYPA 4LCEA 3WWZA 4W9NC 1V3TA 4TKMA 3GR6A 1SPXA 3G0OA 3VTFA 2ZQZA 3BHIA 4WLOA 5JPIA 4I5EA 4Z9FA 2EIHA 2F1KA 3D7LA 3AUSA 4D0RA 4FR5A 3NT4A 3FNGA 2VNAA 4S1VA 4NJMA 2H9IA 3AI1A 2DBVO 4L4XA 1AGNA 4HNGA 1LRLA 1XYGA 1DHTA 3OICA 4CQLB 3E9MA 4AJIA 2PKQO 3IP3A 3PLNA 3ZH2A 4DPKA 5ADHA 3HDHA 3PWSA 2HQ1A 3TWOA 1GPDG 2Q49A 3QJ5A 2VYVD 4MVJG 1GTMA 1MXFA 4XX0A 3TZQA 3IOYA 5CG2A 2DUWA 3NUGA 1X7DA 4GWGA 2Y05A 4L4RA 1T24A 2VZ0A 2TMDA 3KLMX 3MJVA 2J3HA 4PCVA 1H2HA 5KCZA 5CG1A 3RSHA 1MC5A 1JAYA 1O5IA 2ZATA 2ZYDA 3D3WB 3FHLA 5GZ3A 3ZW9A 5B4VA 5JCJD 1G1AA 2UYYA 2CVZA 1GZ4A 4NIMA 3L4BC 5HS4A 3RUDA 4NH4A 1QORA 4ONEA 1DSSG 4U0JA 2Q45A 3GGPA 3UF0A 1RYEA 3KSDO 3QWHA 3RC2A 2I9PA 2P9EA 1U3VA 3CINA 4RGBA 3NYWA 4TWRA 2Q50A 2NADA 3R3SA 4PLWA 4BNUA 4TRNA 1KBZA 1MC4A 3H8VA 2ZKLA 4J16A 4NDNE 3KYCA 9LDBA 3IUSA 1T4DA 3FR8A 2ZTLA 4WK6A 2O3QA 2ZB8A 3D4NA 4J91A 1B2LA 2HKIA 3ZN2A 1HYGA 4DXHA 2AA3A 3F3SA 4RPJA 3ZWYA 4Q3EA 1DRVA 4D41A 1DPGA 3C7CB 4HKTA 3PHJA 2NWQA 1N9GB 4ESOA 4D42A 3ZWVA 5JMPA 3NDIA 1ADGA 2X5OA 5K6AA 1R4MA 2NVBA 3WMWA 2NU7A 1DC4A 4HFJA 4QO8A 4BMVA 1OFGA 1H94A 3SJ7A 4NQZA 4PZEA 2BFPA 1LSJA 4E2XA 3H9JA 1I33A 4R68A 4A5OA 4J7XA 3AOGA 1PX0A 1PGPA 1LRJA 1P77A 1BSVA 3MCVA 4MIYA 4MVJP 2PD6A 2Y1OA 1GZ6A 1W4ZA 3GOHA 3EYWA 5THKA 2ZCVA 4OYRA 4YAGA 5BNTA 5T64A 3E9QA 2PH3A 1ZNQO 1LRKA 2OL4A 1DBVO 4ND3A 1DDOA 1PJLA 3L0DA 4ALLA 5JCXA 1UXHA 3E5RA 2G1UA 4A27A 4YTEA 5BR7A 3I9MA 2Y68A 3K73O 3DZHA 3INRA 2FR8A 2D8AA 3NGXA 2VZ8A 4OXKA 3O8QB 4U0KA 4RVDA 4CM4A 4YT5A 1VC2A 2GO1A 5IZ4A 2BMAA 2QG4A 1U5AA 1C0IA 3ORFA 1U4SA 2OORA 3HADA 1YRLA 3H9QA 1H6BA 5DBGA 3W4KA 1ZSVA 3I9KA 3Q3CA 3IP1A 2PA3A 4HUJA 4BNHA 1MUUA 3AOEA 5BQFA 2AEFA 4BNLA 1YBVA 2FN7A 3A06A 4IPTA 3NDJA 3IQDB 4XWYA 3SC6A 5CPBA 4CLHA 4CV0A 4ZVVA 1NP3A 4R01A 1BW9B 3GZNB 1E7WA 3CH6A 5FEUA 5KVVA 4XQCA 3OP4A 5I7FA 1NBOA 3PRJA 3FBGA 1J4AA 4ALIA 2GR9A 4E3ZA 4M55A 4FD3A 1H0KA 4R5MA 3FNHA 1SO8A 4YPOA 3O26A 1AHIA 1E5QA 1PGOA 3K9QO 2GN4A 2VWGA 2ZTUA 2XF8A 2JHFA 3I9OA 4EEZA 3FPCA 3WX0A 3WSWA 4J2OA 3WNQA 3L6OO 3WB9A 3GC6A 4FPXA 4EITA 4BNNA 4E5PA 2HRZA 1CIVA 4GGPA 4UVEA 5T5QA 4BB5A 4BQPA 3ZWNA 1HYHA 1ZO8A 3LT4A 1EUZA 2JFHA 4M1QA 1GD1O 1NM5A 2CDCA 1OC2A 4Q39A 4B3IA 2X4GA 2Z5LA 1FDWA 2JD1A 1Z45A 3GF4A 3ICPA 3CKYA 3DOJA 2JJYA 3RUIA 5KKAA 1FDVA 4CLRA 2O7QA 3OA2A 4U6QA 3HDYA 4MJLA 1FMCA 2BRUA 3KXDA 2HK8A 1HZJA 3GDGA 1ARZA 1E1MA 2PKQP 3KSUA 3JYOA 2NM0A 3FPLA 1F12A 1ZZEA 4TRJA 4E5MA 4N5MA 4YJDA 4BO3A 5IF3A 2E49A 4FJ2A 2I99A 1TT5B 3TZ6A 1HE3A 4YJGB 1QYCA 3WLEA 3QRWA 4K9DA 3VH1A 2VZ9A 3C8MA 3ZU2A 5I7SA 1QSGA 3CZMA 4Z9XA 2GZ3A 1FDTA 2C59A 3NAQA 1HDGO 2B4RO 4DPLA 4CM1A 2B35A 4NPCA 2AMFA 4R1TA 3PXXA 5K9ZA 4E0BA 1MV8A 4B4WA 1F06A 4IS2A 3S2FA 4RL6A 1I30A 1ZSNA 1W0CA 3ZWAA 1I8TA 4EBFA 4PLHA 5KJFA 7MDHA 1WLYA 4D79A 4XQ9A 3RI3A 2D1YA 5IFLA 4NNJA 2GUGA 2QRJA 3ZNOA 2JFFA 3TZCA 3W8EA 1CQIA 1NVGA 3JD1A 3L6DA 3P5SA 2JHGA 3G49A 2UUPA 2BD0A 4PRKA 3VZRA 1AN9A 4DPMA 4YRBA 4J0FA 1H9BA 3D3WA 5AXBA 1XKQA 2VYND 1DIRA 1A9ZA 1T25A 3GMDA 4M89A 3WMXA 4GBJA 1M2WA 4F3YA 1X1TA 5LCXA 3JQBC 3P7MA 4GX5A 1UXJA 5IN4A 5CHEA 2J5RA 5B4UA 1R66A 3ZI0A 2VCYA 4MPDA 1E7YA 1N2SA 1Y8QB 3LZ6A 3SX2A 1DIGA 4XZ3A 3HN2A 2PZLA 5JE8A 4O6VA 3AM4A 2O7SA 2GD1O 5I9MA 1XG5A 5G0SA 3WQQA 5FWNA 1SB9A 4BO9A 4LMRA 1PSDA 1MGOA 3EY4A 2WTBA 3OETA 3DMTA 1ZBQA 1HEUA 1G6KA 1V6AA 6LDHA 3HG7A 1GEEA 1VJ1A 3K31A 5DP2A 4N5LA 5FFFA 3JQ9C 1HF3A 3GPDG 4FN4A 4AG3A 4HWKA 1IE3A 1JAXA 1DHRA 1N9GA 4A03A 4CLOB 1ENYA 1KEPA 1YVEI 3Q2IA 3PVZA 4E2YA 5K0ZA 4CR8A 5JYDA 2HO5A 3H6KA 4QEDA 4TVOA 1X14A 4XB2A 2X22A 4GQAA 4IQ0A 1AXGA 1U3TA 4GMFA 4XCVA 4CUZA 5KVSA 4R1NA 1P0CA 1SMKA 1LDBA 5JYEA 4AJOA 2JL1A 1E3SA 3DAGA 3I52A 5TNXA 3H2ZA 4FW8A 2X0IA 4TVBA 3RKUA 2X9VA 1P74A 1EUDA 1P45A 4YR9A 5EJ2A 3GVPA 3DZJA 1K3TA 3DB2A 2W2KA 3K30A 1Y6JA 1HYEA 1EDZA 1ULSA 2DTDA 2IZ1A 2Y0DA 5L9AA 2X9GA 3ICCA 1ISHA 1HDXA 2QX7A 3IDSA 1M67A 2YW9A 3JQAB 3F5SA 3GK3A 4FOOA 4O1MA 4AVYA 3WBFA 1CRWG 3D5TA 1YDEA 4JXKA 3DBVO 3ROQA 5AQ1A 3U0BA 5DP1A 3FWNA 4RF2A 2WYWA 4BUCA 3Q0EA 3W6UA 1ZH8A 1ONNA 1Q7BA 4GKBA 1PJ2A 5T57A 1VKNA 3KYBA 3PWZA 4R4JA 1WP4A 1CJCA 1P44A 1PQUA 4R1UA 4KWHA 3JTMA 1PGQA 4Z9YA 1UZNA 4FFNA 3W4IA 4KDEA 5A3JA 1EUCA 1PL6A 4PLCA 4W4TA 1IHXA 1O6ZA 2NLOA 2Y1CA 4CV2A 1UP6A 3DBRB 1PJCA 4CODB 5G2OA 3UFXA 1WDLA 5JDCC 1UUFA 2OP0A 3H5NA 5G0UA 1UDBA 3LC1O 1ISIA 1A5ZA 1H9AA 2FPIA 1IPEA 4B4UA 3DAPA 1NHWA 4AICA 1Q0HA 3ROKA 1ISJA 2YFHA 2BF7A 4RJTA 3IAHA 5KJ6A 1R0LA 2Y1EA 4OXNA 5THQA 4ND5A 3ZU3A 3CUKA 3ASVA 4KQXA 2X23A 3UOGA 3FWZA 1H6CA 1YB5A 2Z1MA 4UVGA 4ALKA 1A9YA 4ZJUA 4JNKA 1W8DA 5ITWA 2AXQA 2R00A 1HE2A 2W98A 3JQGB 3EVNA 3VOSA 3BAZA 4UEKA 4CMHA 1Z6ZA 3DMYA 4JX8A 1D3AA 1YGYA 4QQRA 2J3JA 5TIIA 5F21A 1P31A 1K2WA 1JN0A 3GNQA 1GADO 4J3FA 4WCFB 4QFDA 3CXRA 4RQUA 3T7CA 3UUWA 1AXEA 1RM4A 4BO4A 2EERA 1SBYA 1KVRA 1PTJA 1HDYA 4BNIA 4BS9A 2X7HA 5F5NA 3WXBA 3KYDB 1K0UA 3ZHYA 4GGOA 2DBQA 1QXSA 3OIGA 4NBUA 3EDMA 4PN3A 3BZUA 4RDHA 3RUEA 3N7UA 2ZB7A 1LU9A 2FZEA 1BDMA 3VH4A 4IDGA 1NPTO 1T2DA 1X0VA 3HE3A 1Z74A 4B3JA 3T4XA 3QWAA 4P4LA 3MJ4A 3DQPA 1TT5A 5TQVA 4X54A 3PIIA 4HX5A 1T2AA 3LYLA 3PZBA 4I5FA 3WNVA 4WEQA 1MFZA 3BIOA 1GCUA 4YJGA 4GWKA 4RLSA 2VRCD 4NHEA 3OHSX 4LSMA 3D4PA 2X5KO 1LLUA 2P91A 2WJPA 1C1XA 1BXGB 1T2EA 1SEVA 1TI7A 3V1TC 2VUSA 4BMSA 4CMGA 2QRKA 5ENDA 4JGBA 3ROPA 4AJPA 2Q3EA 2NTNA 4H7PA 4KDFA 3KSZO 3RWBA 1B8UA 1R4NA 2B83A 1QLHA 4QTZA 2P5YA 1VLLA 3GUCA 1HSOA 2YUTA 1K89A 3RBZA 2FWMX 2DBZA 4F46A 3DZGA 2YZ7A 4XDZA 2C54A 2CY0A 4RPGA 2RBEA 3M2PA 5TRTA 3KLPX 4O63O 3WWYA 3H5RA 3NT2A 4XB1A 2QRLA 4N18A 4W7IA 4OQYA 5ILGA 4RPKA 1LI4A 1PZFA 4Q3BA 5BNFA 3ANNA 1UAGA 5ER9A 3HUDA 2E48A 5DBFA 1Q2XA 4FJ0A 4WLNA 1D1SA 2IODA 3DFUA 3S2IA 2D4AA 4JP3A 4BNZA 3IS3A 5EMHA 1ORRA 3GDOA 1V9LA 3A1NA 5TLSA 2Y99A 2JCXA 1LDYA 3JCZA 3PJEA 3WYEA 3O9ZA 3KHUA 1KEVA 4JQCA 5CDYA 1UR5A 2CDAA 2FR1A 1YE3A 1V3VA 3ST7A 1PGNA 4R3NA 4YXFA 1DEHA 2LDXA 1YL6A 1I24A 5EINA 2Y1FA 2VNSA 5DCWA 3JYNA 2E6UX 3X2EA 3OEYA 2EV9A 3OJFA 4FFRA 5IG2A 3B70A 5CDTA 1JKJA 1BVRA 1GUYA 4AJKA 4CM3A 1GL3A 5DT9A 2I66A 4RORA 1OMOA 3D4OA 3PQEA 4CLOA 1S7CA 4TKLA 4PLZA 3VZPA 3OH8A 3RFVA 5IZCA 2O4UX 1JWBB 3U62A 4L76A 1NAIA 1IL0A 2NNLD 3JQ6A 3BMQB 3GG9A 1DC3A 2X5JO 3O4RA 3ANMA 5JY1A 3VC7A 3W4JA 4ZU3A 3PEFA 3WGQA 4CM8B 3QVTA 4P4NA 2V6BA 5JDIA 5G0WA 4HFRA 3WGTA 3KO8A 1O94A 4B8WA 4CMJA 2O48X 3EVTA 3BHMA 4O0LA 2J5QA 3FNFA 1X0XA 4BO5A 3P2YA 4RVHA 4OO3A 1HDRA 3MTJA 5ILOA 2GCGA 4NZ9A 1JVBA 2PGLA 3Q2KA 2AQKA 4I9HA 3PTZA 2P9GA 3NEPX 1FDUA 5DULA 4IJWA 3ZWBA 1IOLA 1QV7A 3OQ1A 3ZCXA 3ETGA 4MP3A 3O38A 1DLIA 4DRYA 3EHEA 2RIRA 2ZB4A 3ZGYA 1EVZA 4EUFA 4WKGA 3DWFA 4WNCA 4XJSA 3WQRA 4TZKA 5A03A 5JAMA 2YQ5A 4JBHA 3VH2A 4EYEA 3UXYA 3F1LA 2I3GA 4FIZA 5U4QA 4XIYA 4PLVA 1TLTA 2PD3A 5JY6A 5K6AC 3AW9A 3A14A 1Q0QA 5AXCA 1F14A 4Z6KA 3ANLA 5ICSA 2W90A 3ONDA 3PIDA 4PG8A 4NG5A 4RV9A 5LDHA 3GMSA 1IB6A 1NWHA 1P33A 3K96A 3ETDA 2AHRA 2DM6A 3OIDA 4ND2A 4OM8A 3DONA 3CZRA 3E9NA 3K2BA 3EZYA 3WGHA 3LC2O 3GEMA 4YAEA 1A27A 2RHRA 4UUPA 3QP9A 3BXXA 5FI3A 4YT8A 1L7EA 2X1HA 3WOHA 4E5KA 4ID9A 2ZIZA 1GQYA 1PJ3A 2EJWA 3UCFA 4R69A 3KB6A 2AG5A 3DFZA 1A71A 3V2GA 2VWHA 3DOOA 1XQ6A 4E12A 4YAIA 3U4HA 2WD8A 4MVJA 1Q1NA 3VAZA 3CMCO 2DUUA 3ZWMA 1X1EA 3AFMA 3DEYX 1KYQA 4Y67A 3E5MA 4PLGA 3GGOA 5I9NA 1B3BA 3RUCA 4DMMA 3OJ0A 3OECA 1I32A 1XCBA 4WCFA 4XKJA 4NFHA 3WLFA 1UP4A 4OSPA 4C7JA 2Q1UA 3IKTA 4RZHA 3RC7A 4K28A 5TT0A 3LT2A 3S8MA 3V1YA 1PR3A 4MOWA 2FOIA 3C3XA 1YS4A 4KOAA 3WFIA 1LXCA 3AOEC 5EPOA 1J0XO 3STHA 3KYDA 1R0KA 2AQHA 2BH9A 1E6WA 1ZK2A 4D3FA 1FF9A 1DRWA 4D3SA 3BA1A 1A4UA 1B14A 1Y5MA 3I4CA 3QWBA 3ZV5A 3AFNA 2C20A 3PYMA 2QW8A 2O3RA 1UAYA 1I5RA 2QHXA 4H15A 1DOHA 1N5DA 1SCUA 1VE9A 3HQ4O 4O59O 4UUOA 3VVBA 3R1IA 4R16A 2AEMA 1LBEA 2E4AA 4K6CA 4PIVA 2EP7A 5JLAA 1WDMA 2DTXA 2DC1A 4ND4A 2EP5A 1Y9EA 5ENVA 4RQTA 4Z0HO 4WLVA 2X0NA 4HNHA 4HP8A 3C1OA 4DIFA 4FB5A 1LLCA 2VUUA 4DGSA 4PG6A 3ZW8A 1PS0A 1E7RA 2WE7A 3QVWA 5JW6A 4WLFA 5JS6A 2OUIA 1HDOA 3GNSA 4ALJA 1EFKA 3H5AA 3AUUA 5EL0A 2NU6A 3QLJA 3RBXA 5F1PA 4B4VA 3VKVA 3MJTA 3VPSA 3DZFA 3QY9A 4FC6A 4Y9DA 3VVCA 2IXAA 2P2SA 1H2BA 1YB4A 3TJRA 3UCXA 3VTZA 4Z3DA 5COBA 2HU2A 3FNEA 1ZEMA 1JW9B 3K6JA 1N92A 2IEBA 1VKOA 4BGEA 2O2YA 1IPFA 2FMUA 2QQ5A 2DPGA 5EQFA 1ZEJA 1JQBA 5IJZA 3E1KA 3M1AA 2X58A 3ZV3A 5HTOA 4LRSB 2CNBA 1S6YA 3P19A 2PR2A 2GYYA 4YJFB 4KZPA 1P9LA 3JQ8B 2UVDA 5KKCA 1AE1A 1LX6A 2FR0A 4XDYA 1JU9A 3WFJA 1XSEA 1GDHA 3QHAA 1KC3A 5TX7A 4BV9A 4BKPA 5COAA 4J90A 1YONA 4O5OA 3WR5A 2EKQA 4W9NA 3GHHA 2IXBA 1HDCA 2ZTVA 4EW6A 4ZRNA 4Q3NA 1DAPA 4A26A 4NBVA 4IDFA 3GN1A 4A2CA 3LLVA 1GCOA 2BKAA 3GRPA 1EVIA 1R6DA 2CDBA 5CDGA 2PY6A 1DLJA 1MXHA 2YHUA 2Q1WA 3TFQA 4PFJA 4DLAA 5C3MA 4D7AA 4ROSA 5A9SB 1XDWA 4W6ZA 4Q9NA 2XAAA 4RO0A 3DBHB 3RCBA 1E7MA 3BTUA 4PG5A 4IJKA 1QV6A 2AQ8A 1GYPA 1GQ2A 1PS9A 4JN6B 3I9LA 3WICA 4MVJH 4J7UA 4TRMA 4IUYA 3RU9A 2Q99A 5CDSA 4JIGA 2PTGA 3EK2A 4I8XA 2OZPA 2Q2WA 4ZQGA 5JSFA 3B1JA 4BNFA 3O03A 4CM8A 5EIOA 1ZMTA 3GLQA 3OJLA 1U2DA 3RUHA 3HFGA 1R12A 2B37A 1WZIA 1LDNA 1W73A 1GUZA 2EJVA 4M54A 3ETEA 4M87A 1QLJA 4CM9A 5A04A 3MZ0A 2FY8A 1SOVA 2C82A 3MJSA 2WYUA 3WGOA 3S1LA 4HV4A 1UXIA 1PJTA 3H3FA 1X15A 1ZUD1 5H83A 3JSAA 2JAHA 3TNLA 1QYXA 3KUXA 2HMWA 4E5YA 4D46A 3HWRA 2VTEA 4C7KA 1VSVA 3SLKA 3PHLA 2Y0CA 2WD7B 2PFGA 1OI7A 2PZKA 2EKPA 3AJRA 4OAQA 4FS3A 4CQMD 3UHAA 3CIFA 4JBGA 5BT9A 4DTIA 3FR7A 1EVJA 1KVQA 4INAA 1EZ4A 1N7HA 1E5LA 1PJSA 1HETA 4IXTA 3EMKA 4AJHA 4CMIB 4CV1A 3P2OA 1EFLA 5EQDA 3DBLB 2PNFA 5FYDA 3GY0A 4B4OA 3UGKA 4MIOA 4G5HA 4DIBA 5A9TA 3AM3A 4IDDA 5T8KA 2V65A 3H9EO 4ZQBA 3PK0A 2YV1A
chains in the Genus database with same CATH superfamily
3BL6A 5L40A 1RYDA 2PWZA 3D6MA 2B4QA 1X6VA 3NCTA 4R41A 1S2MA 1ESCA 4L2IB 4F5YA 2PDAA 4TTTS 1UC5B 1Q21A 5A05A 1C3VA 3ZHVA 2HL6A 3SSNA 3WDLA 3HSKA 2RK3A 2VP3A 2NTYC 3TUZC 4S1WA 2VOEA 3AGQA 3H05A 1KORA 4EUKA 4IHQA 5EJ7A 2DGDA 4XSVA 4EEXA 1HYQA 1XC7A 5AVSA 1QZTA 5IAKA 4EHLA 1UF9A 2WF8A 4R8LA 3KVYA 4Q7LA 1SXJB 2ODTX 1EG7A 5JZVA 1F0NA 3PTAA 4QTUB 3AUAA 2E1PA 2P9TA 2V74B 3DHYA 1KVSA 1WJGA 1Z75A 2SCUA 1CUWA 3MCAA 5BN5A 1TXGA 3HZRA 4ZC1A 3WJAA 2ZQYA 3E0QA 4G0MA 4C6TA 4LY3A 2R3SA 1KO7A 3BDVA 1O58A 1ZN7A 2BHSA 3N07A 4ISBA 3RK0A 1BH6A 4UZEA 3FPSA 4JA2A 4DDHA 1RWNA 5IC6A 3CB2A 3TIGA 4CUKA 5E1BA 4YAFA 4BKQA 1U8TA 2PVPA 4U9IS 1K7YA 4Q00A 2P40A 2XXJA 4MR7B 1XZKA 3LVBA 4MA4A 2BM1A 4P31A 3C7AA 2GX6A 4YRIA 1MX9A 2ORVA 3CU5A 3ZKWB 1RC0A 2I0FA 5JMWA 1CQJB 3CEPB 5KO2A 3K0BA 1SVUA 1DOZA 2A92A 4U7WA 1XLTC 2EFDB 2Z2IA 4QRHA 1NW6A 4XQGA 4DJTA 1RPNA 1S8NA 4AUKA 3QSYA 1RMQA 4YJ2A 3LUJA 4A23A 1OVGA 1BOFA 2WZDA 2B78A 1FS6A 3N2IA 4UD2A 2HREA 3TZEA 1JZQA 4IDNA 2FETA 1G20E 3R9IA 3MVEA 3FHCB 2EBUA 4CLXA 2H0AA 1W5TA 5BV7A 5I45A 1TZKA 2YX1A 4NRDA 4Y6PA 1OPXA 1NT4A 4DUPA 3FH0A 4EUEA 3ROMA 2H2DA 4C76A 2ZRCA 5A06A 2J85A 5EHZA 2AZMA 3GB9A 2VJMB 4TLMB 3IYLW 3TTXA 4DS3A 3IALA 4Y1RB 1BGVA 1UJ2A 3ASYA 3RYCB 4NMMA 3QVVA 3DV0A 3OPNA 4WJLA 3D1LA 1UDCA 2G5PA 2IL1A 2Z4RA 4JJKA 3Q3IA 3OX2A 1M9NA 1PR2A 1HTTA 1ZIXA 3A9RA 2GJSA 2K87A 4ZYXA 4OHRA 4BTEA 3TLGA 5F76A 2R5WA 2OCYC 4ZC8A 1U1IA 5EESA 3AL0C 4ZQEA 4QGAA 3ZIUA 4M37A 4UHJA 4DZTA 1LBQA 2DAPA 2XCTB 4D44A 2OBNA 3LUAA 4PF1A 4AF8A 3Q3EA 4B7XA 2ZE5A 5FR2A 4F7WA 5MN6A 2FMIA 3R6DA 1J8DA 5CBKA 2A9VA 2BFDB 4BV8A 3LCRA 5HNKA 2ONYA 1F2TA 5K2MA 1L8XA 4L8FA 3ETNA 1DDGA 2BDTA 3KELA 1KS9A 2XRYA 3M4NA 4LYEA 3KZNA 2IBTA 2C5SA 3HWSA 3MUOA 1HT1E 3ZWPA 3DR5A 5K3CA 4GZMA 1M34B 1NSYA 1EEHA 5E7QA 4IHAA 1PFQA 2V55B 1ITZA 2ERCA 2IZZA 1P72A 2YVLA 3F6EX 3LF1A 4QBIA 3RANA 3ZCSA 3TL3A 2JVKA 4EO7A 1FTWA 3U5ZB 2Y76A 3CA8A 3DLHA 3E03A 4MKHA 5F3RA 1ODTC 1U4NA 3MGCA 4EHBA 5C52B 1D2CA 1Y1PA 2CCGA 2IHKA 4JT9A 2VQFB 1KH3A 3S2EA 3KKQA 3P0RA 1J5EB 2IUSA 4UVDA 5L8VA 1I2DA 3IEIA 1E1QA 4D9MA 3TFOA 4N82A 2F9MA 3AKEA 3DVAB 1JEOA 3KL4A 2Q2QA 4GR5A 3TSYA 2B9VA 3HVIA 4UAUA 5D00A 3U39A 3ZHSA 3KLBA 4E09A 3OJXA 1JXMA 1CUGA 4DBZA 5HM6A 5HRUA 5KQRA 2OAEA 5ER6A 2JGIA 2CF6A 1O96B 4JBIA 4ZVPA 1OX4B 2CLCX 3H0KA 5K8VA 4ZT6A 2QYTA 1PQ4A 4CEIB 4NZOA 3ZIDA 4C29A 4IMPA 1SHUX 1YXMA 5K3OA 4EB0A 4RKEA 2HJ9A 3FVRA 3EGCA 4M7PA 3R6TA 3TW4A 1LPAB 1L5SA 4JBNA 1XZAA 1RCFA 2CL5A 5IARA 1EVLA 3OESA 4QM6A 3ELDA 5AKKA 4C06A 5G4KB 1RMYA 2QVZX 4XYEA 4CLDA 3UWMA 2L82A 4G5FA 4ZV7A 2G4LA 1ZUIA 3IIKA 3VHLB 1XQ1A 3FSRA 4RZQA 2H6EA 3H4VA 4H3VA 4R9SA 5SZJA 2IS1A 2JGDA 3JYQA 4BP3A 1OYWA 4P32A 3G13A 4G0VA 1M8GA 3FPAA 4K26A 1O6BA 5JV5A 4KLAA 5DN6A 3SHFA 2VK8A 3JATB 1PL7A 4JB8A 3W3AD 1XTJA 1KP3A 5J2TF 2COEA 2XKAA 1OF1A 2VDKB 2I1LA 1BWSA 3F96A 2W6CX 1OBFO 1X9IA 3NHZA 4IXDA 4LVOA 3ZU6A 4EKYA 3AF6A 4ZXPA 1MC8A 3RJ5A 3G2JA 1DIAA 3IMCA 1TA4A 1WF6A 2AH5A 1TJ5A 3DZIA 3WGUA 4EYSA 5HWSA 2ACWA 1DMSA 2FW0A 4LW8A 1T1SA 1U7TA 1Z29A 3GEIA 4YXWD 4M1MA 5I7AA 2G5CA 1DX4A 3RS8A 4ANFA 2PK3A 3T7KA 4DIEA 4MUXA 3KEQA 3ED1A 4NSNA 2G08A 2VJBA 1RTTA 3P0FA 5JSYA 5L3ZA 4Y7CA 3W2FA 5CH3A 4LYHA 4CMIA 3FGPA 2VP9A 1GUBA 1DMRA 2JH3A 4L8WB 3PUVA 1W9HA 2HSGA 4IVQA 1CWUA 3ET4A 3VKHA 5DMXA 4B71A 1PNRA 3BGSA 5K51A 2X8LA 3PQFA 4OQEA 4RPLA 5IZCC 1LQUA 2VHWA 3KE8A 3EWIA 3ZWCA 2Q3LA 1I1HA 2GERA 3KQWA 3FLMA 2WOJA 3O9MA 4FGZA 4GI3A 4IG4A 5AKYA 1R0RE 2FG6C 2W83A 2R6DA 1LTHR 2QLTA 4D8VA 1QPZA 2J8ZA 3UT5B 2YN2A 3O8NA 5ALPA 5F2NA 2AEJA 3T7IA 2O07A 3GEHA 1EXDA 4KQCA 1YRHA 2GJ9A 1M2VA 4DNFA 1Y6RA 1XVIA 3P9SA 3U40A 3HN7A 3RUDA 4KV7A 3LCJA 4J4BA 2FSFA 2Q1YA 1GTZA 4FEEA 4K5QA 3L02A 1UCFA 3U49A 4CEJA 4BLTA 3KV3O 3DDHA 1JB1A 1XU4A 3LU1A 2P6UA 1H65A 3D02A 2DTEA 3G7SA 3FOWA 2FGJA 3H84A 4FR0A 3F4LA 4OKIA 4CIXA 1H0HA 2FEAA 3G3EA 3TAXA 1UBCA 1T3LA 2OWDA 3NEJA 4OHZA 4GI1A 1ISFA 3ZHTA 5BWBA 1I7QB 1X3SA 3UJHA 2D2EA 3L7JA 3AONB 3KYJB 4JK3A 4BNVA 2XWSA 1TUBA 4R6WA 3OEHA 4MKZA 3VQTA 4K9OA 3I61A 1E6UA 4NENB 3LQFA 1A5AB 1Z4JA 4HLQB 4MV4A 3PNKA 5FV4A 2HAEA 1DBQA 1QE5A 1B23P 3IIIA 1MVOA 3CZ9A 3IAS1 1A8IA 2F59A 3HZZA 4UBNA 4D9HA 5IWAB 4FYMA 3ORHA 2D1QA 3OIVA 2V54A 4CMAA 2YN4A 2OV1A 5LKRA 3PGXA 1NN5A 3AZOA 2IPMA 5T7BA 1NP7A 3REQA 1TK2A 5JWOA 3HXOA 4Q3DA 3WYCA 1PV4A 2GN0A 2I6QA 2M2IA 2ID9A 1ZCJA 5SZKB 2F9FA 2DBYA 4P93A 3UYKA 1R4MB 2G1KA 3UAVA 1XQVA 1A7JA 3C1UA 3O82A 2YZNA 4ZDIA 1BYUA 1L8QA 3BL8A 4PFSA 4YQZA 1JEAA 2RHWA 1U9JA 3A6FA 4ZDKA 1HGXA 2GSDA 1J7KA 4PYIA 2XNKA 4RWZA 3V4FA 4DUYB 3BGWA 1W4RA 1EWTA 3FFBA 1UBMS 4D9KA 4NBSA 3PBKA 3WDSA 4F1KA 1H2ZA 3G9XA 3R7SA 4C0KA 3LXRA 3OZAA 2RJ3A 3T99A 4F6LA 5EHIA 1OLXB 3LE8A 2FF7A 1U8XX 3A4TA 3KQMA 2IIBA 4PO1A 3LUCA 1GGKA 1S8AA 5A7GA 1WPQA 4AC9A 4URXR 5JBIA 4C4OA 5KNLA 1K8YB 5JH7A 1PZEA 3I9NA 4P5DA 4YRMA 3R44A 1HI9A 5BORA 1UWCA 4JR0A 4YLYA 3PICA 4QBKA 4ZZ2A 1JDBB 3CF4G 1FDOA 4IIVA 3H17A 1GAQA 2JGKA 4R2JA 2WJAA 1TUEA 2GTIA 2Z2YA 2J3MA 1XLVA 1KS2A 3F5QA 1E58A 1WX1A 2XZPA 2ZBVA 4OSEA 3RAJA 2HA5A 1TB4A 3L05A 3GEDA 2OBBA 2RCYA 2ZVPX 4J0KA 1DFIA 1P1RA 4AY5A 2Y0PA 4ZICA 1CFZA 1P3DA 3JQ7A 1ODFA 1UIRA 4PXAA 3PJDA 4L3OA 3C85A 1U5CA 1ZOOA 3E4CA 3LT1A 5F73A 2Z2JA 3X1ZA 5JISA 5AR1A 3LP6A 2EGUA 5LB4A 1V71A 5MGBA 1NUAA 2IY8A 3L77A 2XNDA 1E1NA 4KV9A 5HBRA 3G2MA 3PNLA 3MSXA 2B82A 1YCDA 3JQAA 4B9AA 1IOWA 4R84A 1ZGJA 5JANA 4PCAA 1YAHA 2QZPA 1FSSA 1NKTA 2BI8A 1E2NA 3SD7A 3VR5A 1Z9BA 1ZR2A 3GW8A 2P7IA 3TCKA 5ABPA 1CP3A 1VRVA 5MF6A 3VPAA 2FV8A 3JASA 4AD8A 5TSDA 5IVPA 2V7QA 3RASA 4DJFC 1TTHA 3O1HB 3U1BA 3A10A 1HT0A 2JD2A 5C7OO 5CCEA 3R9WA 2PMKA 3JARB 1WHTB 2JD0A 2V1UA 2OZVA 2P65A 1ZN2A 4RS3A 1ZK1A 3T5TA 1HNZB 1LTQA 3MOIA 5LXTB 1WMFA 3NASA 1EE2A 3I53A 2FJPA 3B20A 4QDKA 5LOVF 3RE1A 4OGWA 4BFLA 4CI0B 4QM7A 1ECPA 2NP6A 3CSSA 1QQ7A 1Z4OA 2C4KA 2PBRA 3ND6A 2J9ZB 3DM9B 5A9RA 3PF8A 1SHLA 2FPRA 1FP1D 1FYDA 4H7IA 4MW0A 1NXTA 2Y1DA 4G0NA 4NCJA 4D0SA 4Q1EA 2IX3A 1B93A 4A5SA 2PBLA 3I34X 4LXQA 4GNKA 1N3LA 1NQOA 3KP1A 3KXPA 1I6MA 3CLRD 2XNHA 2QNBA 3VYWA 1DT3A 1PDWA 2IXDA 2WJ3A 3DP7A 1DJNA 1LC3A 4JD5A 5BUZA 3WRXC 4WPGA 4BQRA 2VF4X 5CJPA 1T9BA 1YFJA 3PFCA 5F7JA 4CLRB 3O31A 1DWUA 1QANA 2HCTA 2PSSA 3MQFA 1DUSA 1Z73A 3L9XA 1N9KA 4JP5A 4NE7A 1SHKA 3K09C 3TBKA 2HMVA 4AMGA 3TUIC 3N2KA 1NF3A 2VRWA 1B6RA 4JB0A 5EJ5A 3S6JA 1TQ8A 1PKEA 1YL7A 2X0RA 3HB5X 3L7BA 5CU7A 4C7VA 4R2IA 3FYDA 1RWPA 3KUUA 4OLHA 1E1LA 3CUVA 4G5SA 1RFLA 1V5IA 3JQGA 1T1GA 4G9EA 4F91B 3Q3HA 3ERCA 4BY9E 4ENSA 3HWWA 5FTKA 1WTAA 4AUEA 3GIDA 1Y5IA 3HBJA 1UKAA 1GGFA 4GW3A 1RU3A 1BXKA 2O0JA 2FHPA 4C20A 3VSCA 2CV2A 1ZJJA 3KJNA 4NTZA 4X0EA 1Y6FA 1UP7A 2MYPA 5B6PA 2BFCB 2NUTB 3BF7A 3M70A 1QGED 2WF7A 4R8SA 2HHHB 2SECE 1UJMA 1L9KA 4E2ZA 2OGSA 1KKUA 3G1UA 2BJWA 1PJBA 5DM4A 1T8WA 2RH9B 2LWIA 1V2HE 3FETA 3IXMA 4L75A 4MS4B 4YRQA 5G0TA 5A3SA 5REQB 3SS9X 4EY6A 3Q1LA 4QOJA 1LEHA 3SEFA 3QGMA 1X19A 4WCVA 1VRWA 2GJ8A 3OZFA 4XIJA 5TC4A 3LGXA 2FP4A 3IAM1 4QPCA 4R8KA 3V8EA 3OFVA 3R40A 4R81A 2FPPB 3SQOA 4PIPA 3ZGOA 1GRNA 4TROA 4YAUA 2IGBA 2JEZA 2ZJBA 1AN0A 3MMNA 3MTIA 3I0NA 1WUKS 4QXOA 1P1HA 2JB9A 3GA7A 1PR6A 2NPIA 3R0XA 4DT1A 5EZQA 5CD1A 2VTBB 4BL5A 2I34A 3EXG1 5K4GA 3UWPA 4W5TA 5AYVA 1SC4A 2E0IA 2YXPX 5DVZA 1P7YA 3GU3A 4Z49A 4BNYA 4P54A 3DL7A 4I5IA 3DNFA 1JDTA 4DBVO 5FOSA 4KE9A 3L7CA 1NF9A 2I7TA 3UB3A 3VKUA 1ZXBA 3F8TA 4UU1A 2POCA 3MUEA 3WGZA 4MGKR 5ALJA 5CAEB 3TQHA 4CUJA 2V59A 3IR7A 3UMSA 2Q5OA 1JR3A 2NU9A 2VG8A 4G24A 3ZY3A 2XCOA 1CFJA 1E1KA 4KO2S 4MROA 4QLOA 1STOA 3ZY2A 3M4XA 5IHPA 3ZDFA 5L53A 1B0UA 4TUYB 1BJRE 4GOMD 4JYBA 4PEVA 5FBRB 4AULA 4OBBA 5LP1A 1CUVA 1UM9A 4HEA6 2EJBA 2P7HA 1NGSA 4RY8A 3CMMA 5KYVA 1Q3HA 1U28A 1M6YA 2ZR9A 1T5OA 4B8ZA 4DV6B 5D5QA 3VZBA 3ID6C 1G5FA 4E32A 2C61A 2PGIA 4TLLB 5IM4A 2EJTA 2LVBA 3DAYA 5HUJA 4HGRA 1RKBA 4RNDB 5TR9A 2WSYB 2B5WA 2IYSA 2YJ6A 2NPFA 1WG8A 2H5LA 1RYNA 3HVJA 4MDHA 4RF4A 1JTEA 1FIUA 3E3NA 2ATXA 4F2GA 1PWXA 1QX4A 1SOWA 3MWEA 3WXMA 4EPWA 3VBCA 5C7LO 5JNLA 4OYHA 5BQXA 1UDRA 1ZQ1A 1A04A 2I8CA 2FPGB 3C3DA 4HJXA 1Z08A 3LGAA 4KU4A 5FQOA 2ANCA 3BMCA 3OEWA 4IV5A 4EI7A 4Z4FA 1DELA 2O2SA 3I6MA 4AFNA 2JK1A 4ZTBA 1UT6A 1CY1A 3PLAE 5T8KC 4GLOA 4II7A 4G4SO 1MJFA 2ZUWA 4J0EA 3K8OE 5CEJA 3PR1A 1X8LA 2OHIA 3R4CA 4TWZA 5BSRA 2HA3A 4DR3B 4LZPA 3AHEA 1CZUA 2C88A 2PPVA 3DQQA 4V2UA 5AUQA 3GEGA 2O8CA 1S2DA 2BKXA 1G5HA 1NNI1 4DLVA 3D3JA 3AETA 1S2OA 2AZDA 5CITA 4JVSB 3U3JA 4BV2A 4EB6A 3PHBE 3JWHA 2J0UA 3ZLVA 2HQSA 2NVWA 3GDFA 8ADHA 2WWHA 3ZY5A 1QYDA 3P45A 1Z37A 5D2CA 3T1NA 5KTYA 3FRIA 4D0NA 1D4FA 2CL6X 4B3MB 1L4LA 2B1QA 3FKQA 1W34A 2ECPA 2HEIA 3N2EA 1DQPA 3DO5A 4QJ4A 2C0CA 2WK1A 4QVKA 5CLLA 3GVCA 2XOXA 5CNKA 3OOWA 5AQEA 1O6FA 1W87A 4FFLA 4JB2A 5GZ1A 2F55A 1IY8A 3ABRB 2GOYA 3P9NA 4L7QA 1RM0A 3CS3A 4KQ2A 1U8YA 4J1QA 1KARA 4ZO4A 2C2YA 1J8YF 2MCFA 3UENA 4KUGA 4ITUA 1PW7A 2HBQA 3C98A 3VYUB 2W22A 3CR8A 1KRXA 1WLSA 4U7PB 3ZWKA 1NG1A 5FPTA 1AGYA 1ZD9A 4TT3A 2AD1A 4CKXA 4K0RA 2XVYA 1LQTA 1TAQA 2XD4A 5NULA 3HNOA 4DCVA 4RY9A 2XXAB 3FPJA 5JXJA 3L4BA 1J33A 2JFGA 4UVIA 9LDTA 4EG4A 1U9IC 2ZJFA 2ZZKA 4UUNA 4UD6A 5B3JC 2BMDA 4Q7QA 2UYOA 2CMGA 1WBBA 5LIRA 4HRYA 3WB1A 2VJNA 4CYMA 2FPIB 3C1TA 3SYKA 3MRXA 2N42A 2VTDA 2JJ8A 1T29A 4LDZA 5JTUA 2OFPA 3PFBA 5HRCA 5EIFA 1JMYA 1P60A 3VPFA 1XUOA 2EFGA 4UHEA 2ZDHA 3SXUA 3PQ5A 2Q6TA 4QECA 4L6IA 1M74A 3DMTC 1DE0A 5B2EA 4HXYA 4D8WA 4KWTA 2Z98A 2MDTA 1KP2A 1D4ZA 4B7CA 2MU1A 1VDZA 5HJ2A 4E5SA 3VAAA 3GUHA 5KQPA 5E8RA 2TMYA 2Y1GA 4M0CA 4HY3A 2PHZA 2XUZA 4QWWA 2XCIA 3S2YA 5U9CA 4RLFA 2JI7A 2C97A 4DWVA 2GNAA 1AA9A 3E82A 3FLBA 2XE4A 5MGNA 2P9JA 5L4NA 4XJVA 1JAHA 2R65A 5AVRA 1P62B 3TS1A 1DKRA 5K8JB 3G8CA 1POXA 2WIKA 1WA5A 1VI6A 2UYQA 1P1IA 2FE4A 3BD7A 2WJYA 3BRQA 4FGWA 4H1HA 2BFMA 1NXVA 4G5RA 2O8VA 4IIUA 4INJA 1JHXA 1WXEA 2Q0HA 3PGA1 1ZGBA 4RJIA 5AHKA 4BO2A 4UBLA 4B2YA 6AT1A 1Z16A 2H16A 1A9XB 1NFRA 2P5UA 4J9UE 5JSHA 1DADA 1XL1A 3NIBA 1NLZA 5HKKA 1V7CA 1SD1A 2W2PA 2GZAA 1H22A 3JXEA 2XRFA 2C96A 2JLBA 1JG6A 1N2HA 1XEXB 4NBRA 4NS1A 3WNVA 4TL9A 2HLNA 3HY6A 4G5YA 1XRNA 2F90A 4A1OA 2FQWA 1SHZA 1C9MA 1E9BA 2A8YA 2P4HX 2QKYA 3GPIA 5IH7A 3E5HA 4MPRA 3WWPA 1Z82A 2LDBA 2O3SA 3QKRA 4RV4A 2EYQA 3X1YA 2MWMA 4DV5B 3OZUA 5CB4F 3T3MB 3IJPA 3QEMA 2DT8A 2WB2A 2GCEA 1WD7A 5FUMA 1RQLA 1U3UA 4LGMA 2Q2NA 5JCJA 2JLUA 3KK0A 4TM8A 1CUEA 2AB0A 2FW8A 3QENA 4FLEA 3RV4A 4CMCA 2H9AA 3WJ7A 4E7PA 2C83A 1U0NA 1NI4B 3ZZTA 3QHPA 4IMIB 3AP2A 5CIQA 3E48A 5LDGA 4P36A 4WFKA 5G02A 3JR7A 1K6JA 2XGSA 4PE5B 5C18A 3PSAA 4LWQA 3UT6A 1DEXA 4OJNA 1N36B 4C0WA 3AUJB 3KKNA 4U2CA 3TH5A 2X5XA 3HLTA 3HVHA 4NP6A 3QZUA 4DA4A 3CX6A 2CBGA 1ZISA 5AFSA 2TMKA 3PFNA 3GJYA 2ZJ7A 5TV2A 2XMCA 1DQSA 1T2FA 2EG9A 4UBIA 5J63A 1AC5A 1Z0IA 3LYAA 2WM8A 5BW5A 2BZ1A 5G0VA 4YUWA 4ABTA 1XEAA 4QGGA 4UTRA 5CEFA 4UDNA 4EJSA 1XFDA 2YXEA 2F4VB 1QOPB 3PYLA 4QUGA 4Y9UA 3T1TA 4FIDA 3F49S 3CO5A 5ITVA 3O5AA 2LIPA 3P0IA 4RKRA 5I7UA 4LX0A 1NNEA 4MLDA 4J75A 4LKRA 4DLLA 4HLNA 4RPIA 1H4TA 4PZ0A 1ZM9A 4TTVA 1V25A 3OSUA 1GV0A 2WHPA 2O7RA 2ZLBA 3JQFC 3N8IA 2ZT8A 3A9WA 5ALUA 4ZA2A 5AKEA 4ENTA 1CVRA 3C3JA 3TDKA 2DLCX 3MTAA 3OEHD 3REOA 2ZB3A 4MQFB 1EGAA 4DB4A 4RLHA 3B1XA 5K3BA 4AURA 4IDBA 1RE1A 3C41J 3RVKA 2OM6A 2R00C 1A0OA 3D8SA 3MJRA 2VKTA 2WW8A 3LNTA 1NDUA 3TE7A 1GPKA 4G8BA 1GVHA 2VJCA 4TYYA 2HK6A 3VR6A 1YQWA 3R3JA 2Q5EA 4BKOA 4R9UC 1ORDA 2Z5GA 2EWMA 4H18A 4ZXFA 1NZJA 3SZ3A 2A33A 2RHBA 3E2IA 3P9XA 3I2JA 3WGKA 1ZKDA 2YDYA 2CJFA 1K8ZB 1T8TA 4WN3A 5JC1A 2XLBA 4R2MA 3NB0A 3V80A 4A73A 2D3WA 3OPXA 1BAPA 2G06A 3U4AA 3TTSA 4H9GA 2JFWA 1VI5A 1YR7A 5A0TA 3BMNB 3V8VA 3DXYA 3VPDA 4DC0A 1BIFA 5JD5A 2YJ4A 3GJ6A 4DC9A 1XAIA 3HJCA 3Q2OA 1C7JA 3RYIB 2XTMA 3RS9A 3T38A 4YPFA 1JG2A 4CL8A 3K92A 4PQGA 5MN4A 4WBNB 3UN1A 4DW8A 2I9KA 1TAGA 3UAGA 4E22A 4MRMB 5E0OA 1HT2E 2WIBA 1NDQA 3BWXA 3GDHA 4P83A 2ZJ2A 4Q1AA 5CDFA 4PBTA 1B15A 4S1OA 4BRUA 4HFMA 4M21A 4DC1A 1D8AA 2QWXA 2P78A 5T67A 5DNCA 4JH0A 4TXHA 3EH2A 5FO0A 1FQWA 1ZKMA 2NACA 4CCYB 1JTVA 4YJHA 3I92A 4QUEA 2RH5A 5BN1A 2OSVA 4QG3A 3PSHA 2ZXEA 1QTIA 4MYCA 1O89A 2A94A 3SF8B 1W1IA 1C29B 2P41A 3O0TA 3CN7A 3P2JA 1KSJA 4YDRA 2C95A 1ZUNB 4ZKEA 4D57A 1XRSB 5JAQA 4F85A 1SCDA 1RM5A 5A3VA 4KLZA 4TV9B 2X6RA 1PKXA 3CNBA 1NMSA 2IYPA 3UJ3X 4AXXA 4S35A 4JUBA 8LDHA 5JXGA 4IUCS 521PA 1PT6A 2BISA 5GONF 1LS6A 4OXYA 2Q6VA 1Z18A 2VQ3A 3A36A 3ELBA 2GVZC 2O2JA 1K75A 2B6HA 2GD6A 3C3CA 1MDBA 1ZFNA 3COSA 2QSUA 1XMIA 3JQAD 3JZIA 4I3HA 4E31A 5IT0A 3NBXX 5EKDA 2A3NA 1UBFA 4K87A 4O4JA 1Y5NA 3VR5D 2PV7A 4AJNA 1WY7A 4FFPA 4OI2A 3ZK9A 2FWPA 2YWBA 4JX9A 5LYJF 3LCMA 2FPXA 1NNLA 3ULKA 2C4TA 3PUKA 2CXXA 3SAJA 3TTWA 1NPDA 2V7QD 4FFVA 5CFNA 1HSZA 2K7ZA 3NDPA 5DSZA 3IBSA 2XNCA 1XK6A 1XLTA 1ZGCA 1DUVG 2EQ5A 1F0YA 4UPEA 1L7RA 2AYZA 2HMUA 3AP1A 3OI7A 4BFWA 4NXNB 1LX7A 3V4OA 2Q4TA 4BGDA 3U60B 1CZHA 1G66A 2J3QA 2A1UB 3M6IA 4FDVA 4G0QA 3T7RA 4EO4A 1G38A 2AX4A 2CV0A 4HLUC 4YCLA 4HUQB 1C7ZA 3Q9UA 2JGFA 1LV8A 3WL5A 4IKOA 4RFVA 2H1CA 1WU8A 3QX7A 4M1WA 3NHBA 2Q1TA 3VI4B 4BC0A 1I10A 4E21A 1S0UA 4UEOA 3KG2A 5IXYA 5JSZA 1K7SN 1ECJA 4B6JA 3T95A 1RTKA 2HPZA 3U19A 4GBMA 1GR0A 4OGFA 1Q6ZA 3FGNA 5E0KB 3TTVA 3ILYA 5JAZA 1QHGA 3GN2A 1IZ0A 3U3XA 3P4XA 2PRJA 2C9BA 2P3QA 2G9ZA 1RPZA 3UFBA 4GLFA 4INPA 2GZHA 4IWYA 2X2EA 2O0MA 1A95A 5EZYF 3DPSA 2F1HA 1EVYA 4W1SA 3ZJYA 2HIGA 4IILA 4XJTA 2QOEA 4NAVA 1M66A 3UMCA 1S3SA 1VP9A 4PX9A 3WWEA 3RD5A 4I50B 3OA0A 1Z7GA 1XZQA 9MHTA 1G60A 4AS3A 2FSSA 4OHXA 5B12A 3PFFA 1IZ7A 3ONFA 2XAUA 3HYRA 4IV8A 4OUDB 3NBQA 1YCHA 2HHCA 3RWOA 3WSTA 1TM2A 2VF2A 1KSGA 5FI5A 5KU1A 2GRUA 4L02A 2V3CC 1ZM7A 3MGGA 1QRUA 2NSHA 2XD9A 4WKCA 1KK1A 1ZPDA 3MCUA 4YRLA 1P3Y1 4GSKA 4UEWA 1O94C 2CK3A 2RHCA 3FIUA 1KI9A 4HL6A 1V8BA 3BT7A 2Q8QA 5EIAA 1PG2A 2J4CA 2IEYA 2VJOA 3G6KA 4PBSA 3D7KA 3I23A 4PGFA 4S1PA 4O4LF 4YI3A 1SK9A 3TL6A 1L7PA 3HKCB 4X92A 5LJIA 3AKZA 2XX3A 2JIZA 1QVRA 3RS3A 4DNOA 1P5HA 1BJTA 1YOVA 4M53A 4TL6A 1MRSA 4KYVA 4UEJA 1KDYA 4D4MA 3NTRA 1I0IA 2EW8A 3EGDB 1P2VA 4HSEA 4YRZA 3VJKA 4O4HF 4DDUA 2YYSA 3TOZA 4BNGA 3OO0A 5AJUA 2LZ0A 5KKNB 3AEUB 3FKSA 1YQGA 4GX0A 2ESRA 3CXUA 3TRKA 3ITKA 2R66A 3W90A 4LV8B 5J2UB 3IL2A 2EZ8A 5I7OA 1VKHA 1HLDA 1M5TA 3O91A 4QWMA 4C7OB 4BNJA 1KIFA 3OPYA 1TYZA 1UZLA 4OOFA 1F8XA 1I4EB 4YQFA 1N3IA 1LJ8A 3DHVA 1RLJA 3T41A 2QSYA 1QG0A 4NESA 3TX6A 3M5CA 2JAXA 4D25A 4MV6A 3B3FA 2VO1A 4IO0A 5IJAA 1CB0A 1E63A 1LH0A 3P71T 1A4IA 4CFSA 4DABA 5CB6A 5ALFA 2IH5A 4JV5B 3ENNA 3I6BA 1UPUA 5IUNC 3R5SA 4W5OA 2Y93A 1BE6A 4MW4A 4DM4A 5CDTA 4NZZA 1SU6A 3CLSD 4ZVKA 1IN8A 1EP3B 3R2JA 4B6PA 5EJEA 2SHKA 3VO1A 1OLUA 2OD2A 4PSKA 1KTVA 1W19A 2FA9A 3AT1A 5DNYB 1RRVA 1LSSA 3ZCUA 4Y2HA 3L82B 3IUPA 1N5LA 1TA9A 2B0CA 3QU4A 3ZWOA 6CHYA 1FLNA 3CF4A 3HPRA 3CT4A 5F7OA 4KIGA 1YRBA 1YZUA 1NFFA 4L5CA 3N2NA 3W1WA 3V4VB 1ZOSA 1EK5A 1C9NA 4XASA 3S44A 1V1MA 4KN5A 3KJQA 2Y4OA 4EDFA 2R44A 5I48A 3QBTA 5E6SB 4KPUA 3EXIA 4AJEA 1BH2A 5AT1A 1CQZA 4HDRA 3OCCA 1X7GA 2QIOA 4C4PA 1T2CA 4D81A 1QH0A 1W48A 5H02A 4B79A 3DAFA 5BSFA 2RAFA 1SAYA 3L6EA 2GM3A 3BH0A 2PCJA 1SVKA 3BIWA 4F3CA 2Q4EA 1KZHA 3SVZA 2R4TA 3TL2A 1EIZA 4YAKA 3FCSB 4LBZA 2QXYA 3CVXA 4LZNA 4Y1GA 1OUMA 3AVPA 1HDEA 4Y2PA 3HXKA 2AUMA 1O2DA 1IWOA 5JO9A 4A92A 4ZFNA 3K6SA 4JGGA 1FNSA 5H8WA 1WWKA 1AHHA 1H69A 1SQ5A 2P3LA 3CUYA 3QKIA 2Q4BA 3MD0A 5L51A 4W1QA 1S3GA 2CF5A 1OHHA 2HPAA 2A57A 3BFKA 1H5QA 2XUGA 1M0SA 3IPCA 4DSNA 4D26A 3D0OA 2PZBA 4QGHA 1WXDA 5F2EA 2PAAA 5AQ1A 1BJKA 4XA8A 4DCNA 5BW8A 1BG6A 1QHNA 3K53A 3NJ4A 4C4YA 4JBXA 1XD2B 4A1FA 4KQ9A 1XAGA 4M98A 1JGTA 5K3EA 1QQTA 3MJEA 4OFXA 5E3IA 3IOEA 4OHWA 3EXG2 4GE3A 1JAZA 5JVDB 2ZRQA 5JPDA 2J0QA 2D1FA 1S96A 3Q3JB 3NIDB 3V33A 3EDYA 1CD5A 4HVTA 3QXXA 1BYIA 1ETUA 5FHQA 2A14A 4XEHA 4HB0A 1GNQA 1VHLA 1THTA 3HDVA 1GUDA 1CKEA 1ONSA 1Y7PA 4YASA 1OH7A 2Z95A 4FQ8A 4TQGA 3TZHA 1CJVC 2VP6A 4GX1A 4MQBA 3HSYA 1R8SA 4UNNA 1N6LA 3KBOA 4O1HA 4TQUS 4XVUA 6YASA 4L8LA 5FA6A 3VX3A 5K5EA 2JLYA 2KS6A 4K6FA 2IXEA 3E3OA 4CIYA 1N77A 1OXKB 2GCOA 5AKLA 3ZH9B 3PUJA 3DFKA 4I3FA 4HH0A 1RQXA 3DNMA 4WE3A 1UBHS 3ZDRA 1W29A 4CM9D 4DJEC 1C7IA 3K6KA 1G4HA 3QK7A 3W5VA 1UMDB 1FS5A 2YV4A 5P8WA 1YU6A 1ORVA 3EF1A 1FU4A 1UEJA 4GPZA 3QX8A 1CUDA 2J46A 3PVCA 4JP2A 2FCRA 1PFVA 2QIPA 4TSFA 5GVRA 1YNOA 3S7ZA 4R7TA 4PHFA 1FRQA 3C4VA 3ZGXA 1C80A 1TJPB 3GJZA 4RZ2A 5INTA 3ER6A 2N0SA 1QO0A 4J4TA 4EUNA 5CDUA 4A8JC 5KZMB 2CJYA 2I55A 4HDSB 4PBRA 4J4HA 5HF6A 1BRTA 1Z36A 1XVTA 5DISB 3UMVA 3M6AA 3LPNA 2NVUA 2ZOSA 4Q24A 4HNAB 3ONEA 4KQFA 3ZR4B 1BTOA 1DBSA 3MCWA 3T0IA 4DDVA 2QW1A 3RVDA 5LWHA 1DC6A 1VSTA 1KEUA 2V6MA 3TPCA 1T0UA 2KSQA 4HK4A 1ATZA 4JT2A 3V97A 3AI2A 2RI1A 3EQ8A 4ZHSA 1HFJA 3BSFA 3D3KA 2AJCA 3G68A 3GR6A 1SPXA 3FE2A 3HXLA 2VHEA 4K9NA 2XB2A 2NVOA 1XHFA 2RFLA 5FOTA 3KQTA 2WYIA 1EB9A 3AHDA 3FPFA 3L92A 1C3OB 4I5EA 4N9WA 4WLOA 4Z9FA 5JPIA 1ILWA 3GLFE 3N86A 4S1VA 3A6DA 4ZO7A 1JLKA 3C43A 1KEEB 3RTBA 5AP9A 1NC3A 2DBVO 1AGNA 1LRLA 1XYGA 3MLBA 4WESB 5HKKD 1CT9A 1USWA 2FB9A 1DHTA 1VECA 2JFNA 2WWTA 3HEBA 3K2QA 3OICA 4FSDA 4Q9DA 4DMCA 4F6RA 2ON6A 1OBCA 1XMVA 2PKQO 3PLNA 4DPKA 5ADHA 4L6CA 3PWSA 4L4ZA 3ECAA 1UEXC 2ZBFA 4HC4A 4UU0A 3V1KA 5JU6A 1DAGA 4FYPA 4UZFA 2H2AA 3FA2A 3QLUA 1GTMA 2XWQA 3KE9A 4MVJG 1ZVVA 2YZKA 2QT9A 4PZPA 3HACA 4YCCA 1PAUA 3GFQA 3WV4A 4KAAA 4L4RA 4W7SA 5TB5A 3KLMX 3MJVA 1AUQA 4PCVA 2J3HA 2NAFA 3FUUA 1G2QA 1GJRA 4X94A 4KOEC 1MC5A 4M2LA 3RSHA 1N6IA 2FW7A 2XT6A 5KX5B 5JCJD 4YCBA 3RSQA 3ZW9A 2UYYA 3GUZA 1B76A 2RHJA 3ZZMA 1IJBA 1QORA 1D03A 3H97A 1FDIA 4ONEA 4RMHA 1DSSG 3OQVA 4U0JA 2GBCA 1D4OA 2RHTA 3GGPA 3UF0A 2X3UA 3D8TA 3DWGA 4LFAB 1EHCA 2I1VB 1G9SA 2D7CA 3IERA 4KIJA 5D5HA 5DTJA 2R0QC 3AR7A 2Q50A 4YJ3A 1W44A 3T7DA 4QICA 1U3FA 4LNUB 3C14C 4NKRA 4YAOA 4Z1MA 5CCBA 4IZ6A 5SYNA 4V1CI 2HFKA 3TW8A 1KO8A 1T8UA 5A7HA 4KXUA 1YJXA 4DNPA 3WWOA 2XGMA 1G9TA 4BAUA 5DB4A 3SBEA 1Z6TA 2CXTA 5LUAA 2WZCA 5HEKA 3D4NA 4LJYA 2HKIA 4JBWA 1QTRA 4MQUA 1DZ3A 4RPJA 4YCNA 1EXVA 5GJWC 3SZOA 5F4BA 5LIPA 2ZXUA 3LWZA 1QBGA 1E94E 3DTNA 2RE8A 1E79D 1AZWA 4IHJB 2V98A 3T5BA 1A2BA 3V8MA 3BG5A 3WGJA 4BVGA 3D5EA 1CV2A 3T8YA 1ZYUA 4P4UA 3HLYA 3T1QA 2NZYA 1QHSA 3ECCA 4OLJA 4X1YA 4NYMQ 1V41E 2DPXA 3L6RA 1H2WA 2NU7A 3JZFA 4KLNA 4QO8A 4C5CA 1OFGA 1ESZA 2AFIB 3LDAA 3LOQA 2PUWA 3PDWA 4PZEA 5FLYA 4X9XA 1YJBA 3D6UA 2BFPA 1LSJA 2H51A 2VAMA 3ESAA 2JCGA 3L2OB 2I3BA 4OHKA 3WRXA 1QF7A 2CLHB 1U3CA 2FLWA 1LBTA 2IUEA 4A5OA 3B1YA 3SJAA 5A6SA 3LQ2A 4L95C 2BSQA 1BSVA 4IIJA 5KHAA 3MIIA 4UU8A 1J56A 4MVJP 4I0WB 4BRWA 5ITZB 3GOHA 3K09A 5KDDA 4DR7B 4ZAYA 5KYYA 3S5UA 4Q4JA 2NV0A 2VATA 1AURA 5H59A 1T9AA 3OM1A 5L3QB 3RR2A 1QDUA 5KYWB 1DBVO 1SUIA 1JKMA 1FSFA 3AJ8A 4G0WA 1M5RA 4I9FA 4ALLA 3E5RA 4ZOCA 3Q5EA 4MYTA 4HYQA 4GSYA 5M7EA 2VHTA 4YTEA 1Y9ZA 1GPWB 5HJ5A 3W9UA 3KKZA 4U0KA 1EWRA 4G1UC 4CM4A 3F0TA 3L04A 4GHWA 5IZ4A 3CTPA 2BMAA 2OB1A 4B3CA 1Y1TA 1C0IA 1HYBA 1L4YA 1P7ZA 2OORA 1WSDA 3MERA 5DBGA 1ZSVA 3ABQB 2O1SA 3Q3CA 3U3ZA 3TR5A 5FD8A 1QK3A 2B1IA 2HSEA 5BQFA 4YIHA 5IJ0B 2BCJQ 5LFAA 3U2QA 1Z33A 2FN7A 4Z9BA 2QTLA 1Z4MA 3NDJA 4G1EB 4WK4B 5DBHX 3EXEA 2J31A 5CPBA 2WICA 2CYCA 4CLHA 4TTSA 4CV0A 2QS9A 3BCHA 1NP3A 1BX1A 3EN0A 1Y7LA 2M6LA 1ODKA 1I4WA 1R4AA 1Q1BA 4G3XA 4LHWA 4V0LA 2VBFA 3CH6A 4IIHA 2IU4A 5FEUA 4S2EA 2XZTA 5IKXA 3LUHA 4U5XA 1JIKA 3LQRA 4LDJA 2QX9A 2YH2A 3OIUA 4ALIA 1TM1E 2H4WA 1GGJA 1BS1A 1C30A 1C9YA 1N5IA 1NUPA 2YY6A 2YXLA 2Z2ZA 5KHOC 2AUTA 3LLMA 4MWGA 1IJKA 3TQRA 4G2TA 1U90A 2X7XA 3O26A 1JI0A 4PCLA 1KK0A 1EM6A 1QH9A 3K9QO