2Z2IA

Crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
179
structure length
179
Chain Sequence
MAEPLLVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSLVLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRSVVAALGTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADATELLIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Structural Plasticity and Enzyme Action: Crystal Structures of Mycobacterium tuberculosis Peptidyl-tRNA Hydrolase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 57
structure length 179
sequence length 179
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 2z2iA00
1RYNA 3TCNA 5IVPA 3NEAA 3KJZA 4ZXPA 4LWQA 3OFVA 2PTHA 4IKOA 2Z2JA 2LGJA 3KK0A 4QBKA 2MJLA 4JC4A 4FYJA 4FOPA 5IMBA 4P7BA 4JWKA 4OLJA 4FNOA 1RYMA 4QAJA 2Z2IA 4QD3A 5EKTA 3P2JA 3TD6A 4DJJA 3TCKA 2NAFA 3TD2A 2Z2KA 5B6JA 3VJRA 4QT4A 1RYBA 4JY7A 4JX9A 4DHWA 4ERXA 3V2IA 4Z86A 2JRCA 4HOYA 5IKEA 4YLYA 4FOTA
chains in the Genus database with same CATH superfamily
2O2ZA 3BPSA 4DMHA 1SCQA 4FGJA 3W5SA 1YZHA 3NO4A 2YWFA 4JC4A 4L3VA 3IP8A 4PANA 1YJAA 4ZTZB 2W9XA 3I4LA 3DFZA 1JIVA 1QGUA 4Q7MB 1KQFA 2FR1A 5CCXA 2UZIR 4HYYA 2PFSA 2XCQA 3IPRA 3SS9X 4HDKB 4GM0A 4MW9A 4EHBA 1UF9A 1X7WB 3DEZA 2W4MA 3P4YA 5J63A 1BJTA 1P19A 1OZ0A 1UPFA 3CW8X 3FB1A 3FJ1A 2M1ZA 3WY9A 5C7IO 4JP1A 2RGUA 2G17A 4UDXX 3G9TA 3WRYC 3U16A 2W6NA 5BWMA 1CUYA 1E5DA 1N75A 2CXOA 1W2GA 3N8IA 1POXA 4ZQFA 2PJZA 1IUPA 2FMFA 2EIXA 4HWRA 4RLQA 2B7BA 4YI5A 2IWRA 5L3SB 4FJ1A 3W7AA 3I1IA 3ORQA 3EODA 4BO1A 1FYDA 4RCVA 1J70A 1EE2A 1JAXA 2ZBPA 3AGPA 3GBVA 3F47A 1F2TB 2Q0SA 1MH1A 1VL0A 2NYRA 3AEQA 4JLAA 1XDBA 2DWCA 1CQWA 1NDHA 2JGEA 3FPLA 3FRIA 3HKEB 1KO8A 3O26A 5KYVA 4CMAA 3EPKA 4DV4B 4RLHA 3EY9A 4ZHQB 1EFVB 4NDZA 3T1QA 2GZ2A 4Q12A 2AKAB 2R48A 5EKUA 4OI1A 3DP9A 4MICA 1C2YA 2FWIA 2REQA 3O83A 4O2RA 3I2FA 2V7PA 2X0KA 4DZTA 2GZ1A 3I37X 3R7DA 3JVIA 1F1BA 2GD0A 1ZWLA 3IVAA 5BN3A 1PI3A 1YJBA 2ZUDA 3L0SA 1G291 4C0XA 4FLMA 3IOBA 4MAFA 4JSTA 3WJAA 4QQFA 2J5RA 4Q9KA 4AO6A 4B79A 3RAFC 2XT9A 2WYVA 1CW2B 2JH8A 1HDZA 1NL3A 4QNMA 5F12A 4CEIB 1GT91 1VBKA 1YRLA 3RS7A 4RFVA 2H2DA 1UWVA 3CN9A 3L8EA 1NVKA 3PR1A 4N0MA 3ZH2A 5AI6A 2DBYA 1VSQA 4TTPA 1PQYA 3ZZ0A 4DBVO 1DFIA 5AW3A 4RULA 1E5LA 3QKTA 2JFPA 2W0SA 4AK9A 1K2WA 2PZJA 1MG0A 4G5XA 4O3FA 5FXMA 4KVGA 1IJKA 2BEKA 2OESA 1OU0A 1SBHA 2CLEB 2NW6A 2IH5A 1RM5A 4MRMB 4GPZA 4MB6A 4PHHA 4PFJA 1ECCA 2J4CA 4MMYB 3NDBB 2PJUA 1DWQA 4KXYA 3NP7A 4OHVA 2Z2JA 1UBUS 3IE2A 3VV2A 4LRUA 4MYRA 1TTTA 5FUWA 4RQBA 2ANCA 1VG1A 2QIPA 2QPTA 3DD5A 2QWXA 3AQ4A 3AY6A 1Y7HA 1DAHA 4ZQCB 2J0UB 3A6EA 1XQWA 4WJLA 4PXSA 2C8KA 1MB3A 5IN5A 1A4RA 4TZ0A 4EGJA 1F2VA 3A6DA 3O9VA 2ORWA 2ZBDA 2ONJA 3T3PB 4WBNB 1IIRA 1FU4A 1KZ6A 1AKEA 1BX1A 1I3CA 3GCGA 1Z7GA 1HE8B 1M7HA 3R40A 4BKMA 1QUEA 1XD9A 3BWYA 3PDIB 3RVJA 1B8OA 1J5EB 1T9ZA 2FV8A 5L7TA 4MTLA 4RSGA 3JX9A 2CT8A 4C88A 1ODSA 1KZ1A 3MRXA 1KJJA 3KZNA 4J6FA 4LPSA 4ZODA 3FR7A 2VZ9A 3NTVA 4IDDA 2J3JA 4C6SA 1Z0UA 2YOFA 2HPZA 2YN4A 2IGBA 2ZYRA 1Q0SA 3CX3A 3BXEA 3V8EA 5AVQA 2SNIE 4F6CA 4K3UA 1JFFA 1RYYA 3KB2A 4BB0A 4BNMA 2AUMA 2AFVA 4EMTA 1XYGA 2ZYVX 5IBPA 1JZTA 4V38A 3UTDA 2P30A 1IUKA 4GM4A 1SZDA 6REQA 3TSWA 3O8CA 2WZQA 1ISFA 3ZUPA 1PL7A 1TCCA 4DB4A 2P1DA 2HJRA 2VPYA 2EP5A 1N2CA 1TM3E 3N58A 1ARZA 4IMRA 3VSDA 1JI0A 1GZSA 3M4JA 2O8FB 4R8MA 1X70A 2HNAA 3K53A 2QRPA 3GRKA 4BKOA 3UCFA 3FHLA 4H3VA 1UOOA 4S1TA 1WZ2A 3N0WA 3ZYCA 1G63A 1U5BA 1Z4NA 2SECE 1UFVA 3D3EA 3EGDA 4YLGA 5CA0B 1UEIA 2F59A 1TQ6A 2C5AA 2JJMA 2C8JA 2GNPA 3V4ZA 1R0ZA 5AVJA 3NHAA 2X3YA 3Q3CA 1G41A 2PANA 2D00A 3LK6A 4M99A 3WLEA 1JDNA 1A8IA 4GAEA 2FE4A 4IL5A 4BGEA 4QDXA 5AWFC 2ORED 2Q8NA 4KYUA 4MR7A 4QT0A 4U7JA 4ZMBA 1XLWA 3FCAA 3G0HA 1IEQA 1LCIA 4OLBA 1DQZA 3UO8B 3WGMA 4WNAA 1O94C 3OWXA 2IYZA 4DABA 2NWQA 2OAP1 5B30A 2C7QA 1N2BA 4V39A 4DMUB 1NW9B 1L8XA 2HBQA 2ZQ5A 3QVMA 4B17A 2GJ8A 3EVTA 4UOEA 1DJMA 3SU8A 2WUEA 3KFLA 3N0VA 3IAM6 4HH4A 2WLSA 4BVJA 1FZQA 1RRVA 4ZIRB 2FOXA 1SCBA 2J5KA 3NC4A 3VC3A 3GCZA 1Z75A 2VVTA 4M8IA 3UQZA 5SYAA 4FFMA 4TX1A 4ZP1A 5ALSA 1I2DA 4K2AA 3WFZA 4PVDA 2EKPA 2SCUA 2YNMD 3IC5A 4EY7A 4PAWA 2X8JB 4CIAA 1O08A 4GQBA 2YHBA 1X8LA 2D7JA 1FS6A 3EC2A 3N2GB 4P38A 5JDIA 1SCUA 2HT6A 2XECA 2F67A 4II3A 3WL4A 2BR4A 1IZ9A 3O7MA 4PE5B 2E1PA 3UMJA 3E4CA 3T4XA 3K9GA 1SWWA 4PLYA 5FLEX 2KBEA 1IXSB 1Z9BA 2NZVG 3D7RA 3HA3A 3R5HA 2N42A 4NOLA 3COZA 3GIWA 1XI2A 2BFOA 2OWDA 3P0RA 3TO5A 1FP2A 2F17A 4YMSA 3GHHA 1GRQA 4C07A 2DPXA 3KIPA 4UW9A 4EJ2A 4NMWA 1JEQB 1NUUA 3F4BA 3PX2A 1JAHA 1OIVA 2JD2A 4HWSA 4LNAA 5EZQA 4BZQA 4BIMA 2IZZA 4M0LA 4P3XA 4AF7A 3C14C 3KXIA 4WASA 1U2ZA 3ENWA 5ADUS 2YJZA 3MQ2A 4CG2A 5IT9A 3I5XA 5ALGA 2A58A 5ALFA 3CKLA 4M1WA 5JAIA 3WJ7A 3LKZA 6PFKA 3V97A 2GD2A 1QHHB 4HHEA 3DAHA 4KO3S 2JKVA 3VOSA 1DUVG 3BRSA 2ZI7A 3X1DA 3H6GA 4XI9A 4J2OA 1AN0A 4F3TA 1A8UA 3T7CA 1MGOA 2ACEA 4F4HA 1CQIA 1YB6A 2FKNA 3L1VA 1GTG1 2PZFA 5ALHA 1J49A 3FBGA 4QTUB 1E58A 4NS4A 3E0XA 1Y6ZA 2WQ6A 3QFHA 3TJZA 4MUXA 4EDFA 3PVZA 1IBLB 1BEEA 1FVHA 4Z3OA 1F8UA 5KHAA 5I3CA 1TFUA 4LJ4A 2C4NA 5MFPA 3ERCA 1FW8A 5BWOA 3E5NA 3EC1A 2UV8A 2O5CA 3T4EA 1EFPB 1YKGA 4FZRA 1QBGA 4GUAA 1YR6A 2XUFA 4E70A 2DECA 1IEWA 3SMQA 2PLRA 4MP6A 1DDOA 4NZYA 3TBHA 4ZVPA 4RK7A 3CZ4A 1OAOC 1PG2A 1YB4A 3HFSA 1K7FB 4IH9A 1E2QA 1ZL2A 1MJGM 2IEIA 3MOSA 2OMKA 2G1UA 1LPBB 1ORWA 3GRZA 2XEDA 3E82A 1U0GA 1XB2A 3PXBA 4OGWA 4DXAA 2OTCA 4YI3A 4H1HA 3DOEA 2BCGY 2JAPA 3G17A 3FTNA 3NHUA 3AI1A 2OQIA 5IM4F 1H5UA 3HUUA 4OL9A 3ILYA 3VMFA 3ZV4A 3H2GA 5AXAA 4WN9B 4FB5A 3G8AA 1BROA 5A3RA 1RLIA 1SVIA 1VL6A 2HTEA 3C7CB 3DLPX 2OXEA 2EARA 3L1UA 5FFFA 4ZVMA 5KC9A 2H11A 4KN9S 4DCNA 3VZRA 1NR5A 3O8OA 3GJSA 4W7IA 3TYXA 1HQCA 2A9PA 3VJLA 5HEKA 3FA2A 4TL6A 1RKQA 2FU5C 4UNRA 5GZ1A 1FDVA 4UVIA 2IXTA 4X6LA 2NTNA 5AW8A 4DSUA 1I2ZA 2F1KA 4K6KA 4R05A 3NONA 5EWJA 5SY9A 1QTQA 1A5ZA 2IYAA 3DOCA 2W6PA 3LY7A 3MA0A 2QRVB 4JT8A 4KW7A 5KQLA 4D46A 1NMYA 2ZJOA 1LK0A 4XVCA 3U4CA 1VG8A 2IHBA 5CLIA 3U17A 4D4IA 5JAOA 1DNPA 1PU2A 2KSQA 3PYLA 4HZUB 1QRUA 4MKHA 3PE3A 5J2TF 4BC1A 1EB9A 2I87A 3NXSA 2QN3A 4Z0TA 1I0IA 3WGOA 2C7RA 3U60B 5I4KA 4O2BF 1IEXA 5DHPA 2VT7A 1PJ2A 5ED4A 4NONA 4O2AB 4M0MA 4LVCA 2FG7C 3ICVA 1X1CA 2UZ0A 3ESRA 3HA5A 1JAZA 3PPWA 4KYIB 4BV9A 1J2RA 2COKA 1VKRA 2QMEA 2C7GA 1ZHFA 3OA2A 1FX1A 4QM6A 1YRWA 3MGKA 4FVTA 3Q7QA 1YZUA 2NVUB 1FF9A 4HAOA 4N41A 1B93A 3T6KA 3WKDA 3NHFA 3EIFA 4GI7A 3WKCA 1ABFA 1WXFA 1GU0A 3OJXA 1QF7A 4QREA 1ZSNA 4PHTA 2AQ8A 2R00C 5D85A 1Y6QA 3YASA 3N6XA 1G66A 4WUTA 4P84A 1QHIA 2PX6A 1Y1TA 1RR6A 2DWOA 3OPVA 4PRLA 4OB6A 1HNZB 5T4EA 2FN3A 1PG5A 3NBUA 1E66A 1UAYA 4WKOA 3FCXA 4XWKA 5K01A 3PT9A 3II6X 3UC5A 3M6VA 1D07A 2W2KB 2IP2A 3L7OA 1UKEA 3E3MA 4LOAA 2FHSA 5HRUA 3OHMA 3I30X 4J16C 4G4IA 5KJFA 3WHLA 1AKUA 4KXXA 1KMHA 5DM1A 3WMEA 4BJ1A 5C2JB 3DKRA 1EQUA 4M89A 1WD5A 3Q3VA 3FMGA 1XUOA 2XT6A 5EJ9A 1U2PA 4K0KB 1SHJA 2BGJA 4GNKA 4DY4A 1PDVA 3GH1A 2E1RA 2F3PA 2X0JA 4QU5A 2DUUA 2VDQB 3ESQA 2PKQO 4HAYA 1D2AA 4U2EA 5KSPA 1T5HX 2ET6A 3PJGA 4U8HA 4G5SA 3W5DA 3JQBC 4TL7A 1DC7A 1LSOA 3K0AA 4C5BA 3PC4A 4JZKA 1N7GA 2EERA 4ZYYA 3R5SA 2JHCA 2ZSDA 1BX3A 3LUCA 5KHOC 1P2VA 4PBSA 3H1EA 1KFKB 4NQZA 1IPHA 4D81A 1J33A 4FOPA 3PQ5A 3F3MA 2PUGA 3HKDB 4UTZA 4C2TA 2C5LA 4AZ3A 1XTQA 3C3MA 3VHRA 1V3TA 1C4WA 4AW9A 3P2MA 4C04A 1XQXA 3U7GA 3QRWA 2YVKA 4GIBA 2HXGA 3JSXA 5LWHA 2XUJA 2JIDA 4H31A 4V0OA 4GHWA 4OI2A 4Z9YA 4HLCA 1VJTA 2B1RA 4J9VA 4L3WA 4OU5A 1DUSA 4ME6A 2FSGA 2I3DA 3RIGA 4UM5A 4CCWA 1F4PA 4EJSB 1FUKA 4GYJA 5FCDA 3CLHA 1R88A 1IBSA 4M21A 5C52B 6CHYA 3QI7A 3PR3A 1G4UR 4GZMA 3FOZA 1YJXA 2DAPA 3JQGB 4TMWA 4MCAA 3PYXA 3BA1A 5EJFA 1U2QA 2C5BA 4C0QC 1KK2A 3M89A 2EZ9A 4MWOA 1TM4E 3D3QA 2HC9A 3L7AA 1JQKA 3C7DB 4KTTE 5C7LO 1MRSA 1NV8A 1C9EA 2E6UX 3HYNA 4IV0A 2AF4C 4YJ2B 4EHJA 3RC9A 4LKRA 2O8BB 5JJIA 3NHBA 1LXCA 1JR3D 3HRHA 3LQ2A 4PQRA 1DSSG 4X1IB 1EX6A 4F3YA 3UMVA 5D3MA 4F4DA 2FMHA 3RFVA 2PWYA 1ZLXA 2QT0A 1TUIA 4DZRA 4IFIA 4Q48A 5EE5B 1EQ2A 3FNHA 2BGGA 5I47A 3SDBA 3ZTYA 2ZWIA 1CRLA 3SJBA 3QLVC 2C7VA 3IAEA 4FZJA 5JH7F 3KQUA 2GXQA 2K87A 4IHAA 2M98A 1YDWA 5BQPA 1U2SA 2OD2A 1V8ZA 3BXHA 3JQ6A 1PSZA 3ZYZA 1SRQA 1L5GB 5JPDA 2XE8A 9MHTA 4QU0A 1I5RA 5IM5A 2G5TA 4A6PA 3QFRA 4F06A 5JWOA 3D43A 1NVAA 4KUHA 3RTBA 1TGYA 1UL1X 1RPZA 4BRZA 3BXZA 2ZRJA 1OBHA 1V11A 3HKCB 4G36A 1H65A 4U9IS 4E14A 4KZPA 6YASA 5LC1A 3C3CA 1GA4A 3NUZA 3O21A 1Z4OA 1Z6YA 1CLUA 2A4KA 3DLTA 3OTQA 4H15A 2AMLA 1E0AA 3IT1A 1C4OA 2O2GA 4L57A 3IVCA 1QFYA 4MA0A 2FFQA 4G23A 4DCOA 3MHTA 2WKSA 2G36A 4HNGA 2JLAA 1CU1A 2GT1A 1FTNA 3DZBA 1NLMA 4RESA 4KXUA 4ZAGA 1VIAA 2DTXA 3VDQA 1ZKMA 5ER6A 3GBSA 4TMKA 3RAEC 2J41A 2UUPA 3I12A 4MGZR 4DJFC 2QGNA 1RWBA 4B4KA 1U3FA 3CFYA 3PICA 4ZCPA 4EX7A 5ADHA 3FLAA 5HILA 1IXKA 2PWZA 3KYBA 1UKZA 1A50B 3CR8A 1ZD5A 2E48A 2MMCA 2HHAA 2ZIXA 3NBZC 4GOKA 4URZR 4WX2B 3EWAA 3RUFA 4PTLA 5DBFA 3LBIA 1FYXA 1Q11A 2OY0A 3RBVA 1GTJ1 3TI9A 2B69A 2XQVA 4IJ6A 3JQDA 1MDBA 4KDCA 4HRAA 5FPQA 1NLUA 4Q82A 4IJKA 2DSTA 2HYDA 3OIYA 3DMHA 3QTTA 4NX2A 2BMFA 4M9ZA 2C54A 4RIGA 4RXMA 4UEKA 5ITVA 2AWOA 1QGUB 4XM1A 4YLYA 2IC5A 1L5WA 1QIMA 1TO6A 2FY8A 2PJDA 5CH8A 4YUAA 1DQSA 5IDQA 4PC3A 3GP5A 4MWSA 3OQIA 3WFJA 1EUYA 1PGJA 4UNPA 2A8YA 4D97A 2H5IA 5KOYA 1ST2A 5DPMA 4LTDA 4NR0A 4MKRA 1DG3A 2H1FA 5CYOA 4NEHB 3EUEA 1PWEA 5B37A 1WCIA 4PYLA 4W63A 3UPDA 3KHSA 2E4XA 4MVCA 4R16A 3KPYA 3AF0A 3SLRA 2ZSJA 1XNGA 2IU0A 2HBYA 4MVJI 4L8GA 3QVJA 3ZY2A 1CR4A 4E5SA 1DTEA 2HDOA 3GMIA 2XHEA 1QNLA 5ALIA 4U7GA 2PRYA 3E9QA 5M04A 3WRWA 1N1DA 4A6EA 4HS9A 1JJVA 4K40A 4R7TA 1Z33A 3QI2A 1RJFA 1TA0A 1Y1RA 3CH4B 1E7RA 3BWEA 3C6BA 1R0SA 1WSWA 1EDBA 3VZCA 1NMZA 3BX1A 4P0QB 2NN3C 2A0FA 1EVQA 1VL1A 3EXFA 1OZHA 3WKEA 3GEIA 7MDHA 1LVUA 3GJ8A 1DBVO 2WABA 2DULA 1MNQA 3OEWA 4QD3A 1JIIA 1TUGA 3BD8A 3KB1A 5BN3B 3MW8A 4Q9JA 3N7AA 3ZQJA 2RI1A 2NAFA 4B3BA 1LY1A 2AC4A 4FDVA 2OAEA 2VF5X 2ZJAA 4K86A 3NGLA 3SY8A 1TIBA 2CJFA 4G26A 4RMGA 3RTGA 1KEUA 2YXLA 4X8LA 3WHIA 3H5WA 2OCKA 3DDOA 3DKIA 3EZ9A 3QE3A 5DV9A 4F7WA 5DNCA 4JBXA 5EOVA 1MFPA 1L4KA 1WUIS 2ZJ6A 4W8OA 2JRCA 3T5MA 2VP2A 4F04A 1WZCA 4PG7A 3DYIA 4GKJB 1GKYA 4BZXA 4YRRA 3W78A 5GV8A 4DUYB 1JKMA 3RS8A 4W9RA 3K6JA 4HQLA 3C3EA 2UVQA 4J1QA 1VCMA 2GTPA 1I6LA 2H1RA 2W2LA 4HLNA 2VCEA 4JVNA 4WLFA 2Q28A 1DEHA 2DPLA 4GSKA 3HI4A 1U0FA 3I0NA 2A2ZA 5B58C 4N48A 1C3OA 2ZEJA 2SICE 1PYDA 1ZNWA 3LHSA 3GPIA 1OY1A 3H8SA 2CEKA 3LTNC 3RTAA 1MIHA 2PMDA 3JQEA 2VP3A 1N34B 3EW7A 1LZLA 2Z6VA 2J7KA 1IM2A 3HP7A 1CJCA 4J9UE 1GZ3A 3D8NA 2PXAA 2HQ1A 2O8VA 3GNSA 5AJZA 4BO3A 1FFCA 3GZTB 1QQ7A 4Y3UA 3STTA 2GHTA 4NAVA 3ZDAA 1FL9A 1PDWA 1Q0PA 2XMQA 3FYUA 4BN5A 3K1TA 2C9YA 4CM5A 3N1UA 1PZXA 1UDCA 2RHHA 2C31A 1X74A 5LQNA 2BT4A 4PYIA 4UVDA 2KHZA 2CNWD 1DELA 3PDUA 1AUXA 3AUSA 3DZGA 1R6TA 4FFBB 3JARB 5KQSA 4QODA 3S2IA 1FCJA 2F2TA 1AB6A 1T4GA 1M2OB 1Y5RA 2ENUA 1ZYUA 2GRUA 1ML4A 5I7FA 1U99A 1IEVA 3QW2A 4BEJA 2B61A 4YRSA 2BHSA 3GD5A 5HPYB 2GM9A 2JFHA 3AF4A 1SVNA 1PJ3A 2FDRA 3G2JA 3I6ZA 4NPCA 1FSPA 1J2YA 1Y6FA 1SUEA 1OC4A 2HU5A 2V4ZA 3IKMB 5AKGA 4NL4H 5EVCA 1QE5A 1UKYA 3TGWA 3W3ZB 1J9EA 1G8PA 3NM4A 1X7ZB 1JEYA 2HOQA 2XUZA 2IX3A 1DC6A 3KKZA 2VOJA 1MEOA 3IH5A 4J0DA 3ETCA 2A88A 3A37A 3TRJA 3KQOA 2SKEA 3WNQA 5IUJC 2WWFA 3ZWWA 2WUFA 2FN9A 5TGZA 1B6SA 4G4SO 1N2CB 3RYIA 5BVGB 1FE8A 1N2CE 1T5IA 2VJOA 2Z0MA 1MC8A 3JYNA 5JE8A 3U4HA 4CQMD 5FQOA 1NJGA 4ZO9A 3QVVA 1UBSB 1R74A 2VSQA 3H5LA 4GX2A 3ZE9A 4CMJA 2WU8A 3VBEA 4MI9A 1SKYB 2UZ3A 3SJUA 3LF2A 1XZJA 1SKYE 4XCXA 2HGSA 2R5FA 1U5BB 3A0RB 5IUNC 1EKXA 3EGDB 3EISA 4Y9RA 5KB3A 3LIIA 1OHHA 3C43A 3JSAA 3EXAA 1BGWA 1YB2A 1A1SA 4JFRA 2RI0A 1VZ2A 4DIFA 4BO5A 1XDZA 2P2DA 1F14A 3O2NA 4MQFA 1TIPA 1QKKA 4MR7B 4PX2A 2VAVA 3QYJA 4GECA 4JUDX 3NGMA 4WNAB 2F9LA 3TZQA 4O3MA 3H2ZA 1H4VB 4HWPA 4M9SA 4G81A 3WG9A 3CF4G 4QOGA 1JSCA 2FWNA 1AKMA 3OMXA 4INJA 4P6VF 4Z99A 4EFNA 2L69A 4B82A 3W0LB 5ALWA 4LSWA 2B99A 2WNIA 4WOKA 1Z22A 1T3GA 5B7NA 2W6CX 5HKKD 1I3KA 4KQKA 4QASA 4AULA 1NIPA 2QLLA 4CGZA 1PTKA 1XTVA 1KTIA 1C0KA 2IXDA 4QBHA 2KPOA 3WOVA 1JJIA 2TRSB 3DO8A 4NABA 5IJ0B 3E6AA 3QBTA 5CFRA 4MVYA 4RMNA 4ARUA 2RONA 5TX7A 4EO4A 2G3YA 4QEKA 4NEGA 4BQFA 2SCUB 2A0WA 1IN7A 4UOQA 4LQCA 3ITNA 5EE1A 3NVKI 5EUBA 4AZTA 5A62A 2JLYA 1AA9A 1DAGA 1GU1A 3IL2A 3WGUA 4BTLA 4EGAA 2IF0A 4D1YA 2H2IA 4L07A 5E8JA 4FEEA 2ZS8A 1SCUB 1HT0A 5ALMA 1JHAA 2GSDA 2AFHB 4D4MA 4AQ7A 1JKIA 2AFHE 5JNVA 3S2FA 1O6ZA 4X60A 2GDZA 1XRSB 3L1IA 4G0XA 1E9DA 2EZ4A 2LR0A 4QYWA 4US0R 1SXJC 3IJ5A 1ZN2A 4J0QA 3K9BA 2MMGA 4HQKA 4MWTA 5FTKA 3VO2A 5JZMA 3GELA 1T91A 4X3CA 4UJ3A 4ZZ0A 4M88A 4Q03A 2RHJA 1V3VA 4Q3AA 5JS6A 2ZTMA 1DBWA 1EH5A 1N2GA 2H2FA 1JQJC 1R0YA 4WL0A 3TTTA 3B1ZA 3FTEA 2PT7A 4O02B 2P3LA 1GAJA 1PR1A 2D5BA 3V8MA 4KVAA 2HV9A 3KQQA 4ER5A 1XKQA 2Z5LA 3K09C 3PR2B 1IN4A 3GB9A 1ACJA 3GR6A 5FFNA 1WPGA 1CCWA 1P72A 1TQ4A 2Q1YA 3P96A 1NG1A 3U7QB 5I8PA 1KMNA 2P9ZA 5H3LA 3RRFA 2MR5A 4CTNA 1F20A 1RCTE 3I9V1 5KJ1A 3L9WA 1O77A 1M7GA 2P68A 4P3OA 1JALA 1E2IA 2XDQA 3QLUC 4S2EA 5FO0A 5HK8A 1JYEA 4EKIA 1CQIB 3ZWNA 5JCXA 4BKRA 1S2NA 3O92A 2WIGA 2MU1A 1S2DA 1TZCA 4FSDA 2BFPA 1W19A 4BB9A 1AZSC 4MS1B 3SBXA 4K03A 2H5LA 2KM1A 5FLXA 1QFJA 1H94A 2GEBA 2XX3A 3QYAA 1QIDA 3T3HA 4AJ1A 1EJ2A 4PHFA 4JGGA 2W2VA 2C9MA 3EF1A 3AIKA 1WUJS 4RVNA 4QFCA 4E33A 4OXRA 5C5IA 4CEHB 4IOKA 4ZDIA 1TAUA 4BP8A 1HTTA 2P41A 3QMMA 2AN5A 4ZRNA 1Q0HA 4KTVE 4EZIA 3B48A 4MX8A 4NCHA 2QYTA 3MT9A 5A1JA 4HQOA 4FKMA 4DGSA 4DJ5X 4ZGWA 1S8AA 4BOYA 2CBXA 5AOBA 1W581 1RWXA 1V6CA 4V0SA 2IEDA 5JAZA 3KJIA 4LTMA 1U7TA 2X1MA 3DCNA 4KI0A 5KTRA 4G85A 4PNPA 3VNQA 3AR2A 2O52A 2ZREA 3GO4A 1XR3A 4TTJA 4XKJA 3T4UA 3VOTA 4BMOB 1LK5A 4OMDA 4XWTA 3KU1A 1A8QA 2GNOA 2B9EA 1VRCA 3LIPA 3PJFA 4YPVA 3TX2A 5L4SA 2ZJZA 5G40A 2B8JA 4GO1A 1PUIA 2ST1A 4ZAFA 2NV2B 1NN0A 4YRNA 3N6VA 5LQUA 4QE3A 3DZFA 2WKQA 2B1QA 4LNHA 1S7CA 3BCHA 5TJHA 4S1OA 2NZJA 2IY8A 2P78A 3TECE 4ZU6X 3ORHA 4AY2A 1NTOA 3SR3A 5DBGA 4MKGA 4B46A 4EITA 3L0CA 3H5OA 5D5QA 1HURA 1P5JA 2IY7A 2P75A 2WOOA 4I4TB 1GY8A 5EGSA 5G2OA 2ZB7A 3TDNA 4D3DA 1ZJ6A 1RNLA 5ES4B 5KKNB 2E5LB 1RXIA 3O90A 3OMLA 4RD1A 1P6XA 2Q46A 5HZGA 2X7JA 4LDJA 2WIBA 1Z63A 1ZGHA 1MA3A 2P9YA 1NVGA 2DHCA 3Q10A 4L7QA 2NYVA 2RJNA 1CC1S 3C1AA 3QWAA 2C42A 3ER6A 2VJYA 1K7YA 1IQPA 5AJHA 2C2WA 4P31A 3WISA 4H18A 4QJ5A 4G9EA 5REQA 1OBOA 3T9AA 3ADDA 4JWKA 4D8TA 2W2MA 1MAVA 4WCVA 1W36C 5B3JC 1RU3A 3R76A 3SC6A 1K86A 1XZNA 1VRWA 1WG8A 3ZQ4A 1S2GA 4IH1A 2HH9A 3TNJA 1KYZA 4Z9BA 3DZIA 5AHXA 3HXOA 2Y0EA 5ITZB 1RFGE 4AI6A 3VU9B 2X1LA 5IH7A 1F17A 2Y1CA 5FTWA 4JLSA 5EQJB 3M8KA 4IG4A 5F77A 2C1ZA 3I5MA 3HUEA 2XA2A 3O1IC 1UP7A 1NLFA 2Q5EA 5FRDA 3THXA 2FMUA 1GHTA 4U8GA 3S27A 5IZCC 2F62A 1CF9A 1F0YA 5LLSA 5LL6P 5K0CA 4AY6A 3GC6A 2GX6A 2XUHA 5C80A 4CIYA 2PTHA 3FAZA 2I1QA 1SCIA 1NJSA 1KZYC 2HSGA 1J25A 4QBGB 4S12A 1N5JA 2IHYA 1YBHA 4GICA 4FT4A 1GJRA 3HVJA 1KAQA 1R8YA 1XKTA 1W9MA 3P32A 2HHCA 4WFQA 1CY0A 5EC8A 2WT8A 3SQMA 4Z0HO 2RFLA 1JJBA 5B5SA 5ARCA 1N32B 3GJYA 1VL2A 3QSYA 5ETJA 4LXTA 5EESA 5ICSA 2ZK7A 1EVIA 3PFWO 4C01A 3ZE6A 3KQMA 3VH1A 2CL7X 2PV0A 4FBLA 3AH8A 2XZTA 2XOKD 4K9NA 4RY8A 1B8PA 4YQFA 4OPMA 3E15A 2Y1XA 3QU4A 1TVEA 1I7SB 1DOZA 1NNI1 1XTZA 4OFZA 4P36A 3UJCA 4CUKA 3CEHA 3QH4A 4P4SA 2DR0A 3CVWA 3PEVA 2Q2NA 2XRMA 2CGEA 3HBAA 4U39A 1KR5A 1W1UA 1FOEB 1EDDA 1RJEA 1YU9A 1M34B 4WXEA 5T64A 4OK6A 1GDTA 1M34E 1XIVA 4B73A 1RCUA 1HEYA 5FI1B 1T5TA 3B2EA 1L5HA 3U5TA 2OQRA 2EU8A 2V5AA 2J5XA 1PJZA 4RA6B 2Q5OA 4HMOA 3ZD8A 2H0AA 2NZXA 4XB1A 3AX6A 2AS0A 2XLBA 1MRZA 2ZUFA 3NJ8A 3L4SO 4C05A 1FU7A 4ROSA 4LOJA 5FA8A 3WNVA 1JB9A 3BDIA 1ZM9A 1YBMA 3T9EA 1XLTA 2EZUA 5EZYF 2Z04A 3Q0TA 5BNIA 2P2CA 1ECJA 4ZDJA 3M6FA 4BMXA 1YMUA 3OX1A 3D6MA 3LX4A 4RGBA 3UT5A 4LJRA 4KGXA 3A6JA 3O4RA 1SHZA 4BNGA 1DL5A 3LLVA 3UUWA 3DWGA 3CNOA 1PQPA 3AEUB 4R6XA 2BKVA 2PY6A 3B8EA 5JWRA 1I9GA 3S1AA 4HT3B 4B3FX 3FN4A 3LBNA 1WBJB 3TNDA 5BNWA 1E4OA 1L8LA 4FS3A 4CIXA 1BN7A 2DQYA 2DU8A 3EUFA 4G1VA 4W7SA 5EZYB 1ILEA 3O95A 3EPHA 1TCAA 4KRYA 1UAGA 1K8XB 1ADYA 1Z4JA 5DGDA 4ITVA 2JLQA 4M3NA 3UJ7A 1V8BA 2VDRB 3ULKA 3NGXA 5BVHB 1QS0A 1ISSA 3DEIA 1AG9A 3NFRA 4YRLA 1ZIDA 4TLMB 4V1CA 1ZVQA 2Y67A 4RSHA 5CXSA 5K0ZA 2B6NA 3TOXA 1WBBA 1YCGA 2K7FA 4M1ZA 2XTMA 1SQFA 3VBCA 1EWQA 1WZEA 5D3MB 4AROA 3P0JA 3SEZA 3DUWA 2M6SA 3OMWA 2A9KA 3W9SA 4O4HB 1TMOA 3R6GA 3FVTA 5BMOA 2XWQA 4I3FA 1W0JD 4E21A 4H7FA 4BNIA 3K2BA 2Q4DA 1GZ4A 3TFQA 2HO4A 1IBMB 4M1KA 3MC1A 4YXFA 5THKA 1Q2UA 4NBUA 4DLAA 4LZJA 1HEIA 2F1RA 1QNFA 4LZOA 4X93A 2RHTA 1I30A 3EXEB 3VTZA 1V11B 3I1JA 4WH0A 3EOZA 3PKIA 2YIMA 2HBRA 4XR4A 4E7PA 3HB4X 5JSQA 2A92A 3EX7C 4TRJA 2I99A 3ETJA 5M3BA 5TXGA 1DAEA 4MPPA 1QP0A 1I32A 1RLUA 2X3FA 5IW8A 4MHTA 1I3NA 2G67A 3PHIA 1JLHA 2WSIA 4DLSA 3QHAA 3ZEAA 3DZCA 5I45A 3OC6A 5JXGA 5AI5A 1EVEA 1NJ5A 3EMVA 4UMVA 4ZOAA 3EVCA 1KSJA 4I36A 4KRGA 1KJIA 3HJNA 4RTLA 3U7FB 1R64A 3OE1A 4YX9A 3NRJA 3NBKA 2A5LA 2FP4A 2OO3A 1OSNA 2F9FA 2HK8A 3GGCA 1C30A 1NQXA 4N8EA 4TMTA 1TK2A 2ZIXB 4MWCA 4UU7A 3JZDA 5HBGA 1RE0A 1BE8A 4L4ZA 2OCAA 1AGNA 3IV9A 3OLXA 2ZG6A 1PT8A 2BTQB 2DFDA 3LVFO 3OURA 1WVIA 2AJDA 4WW0A 3R3YA 3ZNQA 2X4DA 2W70A 3WX0A 1I7QB 2G76A 3DDUA 3LJKA 3HJTA 1XVLA 3IDFA 1S01A 4NCJA 4B4OA 4BDTA 2PQ0A 3IKJA 4DUZB 2HX1A 3LVBA 4FN5A 1FLVA 4IFBA 3V7FA 4TKVA 1CS0A 3OQIB 1QK3A 3CLUD 1F5SA 3KZ1E 3DAGA 4NIMA 1II9A 3QZUA 1WW2A 2OCLA 1UMCB 4PHGA 1Z5UA 5DM0A 3CTPA 4LDAA 5DTJA 1QP7A 2YJ3A 4JT4A 3CBQA 5K09A 4BU1A 1A71A 1GA1A 5FWXA 1SHKA 3TFWA 1Q6YA 1SU8A 1YJ5A 1Z4PX 1D09A 1JJ7A 3GFSA 2VQFB 3LPCA 3GRPA 4EIWA 4EY4A 1PRYA 4XIJA 2YV2A 4GXQA 3MWDB 3AMVA 4MYTA 4TUYF 1KARA 1Z08A 1MF7A 3HC7A 3KXPA 4G5QA 3OF5A 4WK4B 1EESA 3KTDA 1VE7A 3UATA 4ASUA 3RT1A 5DO9A 1RT9A 4ZPJA 1EK1A 3IVMA 4JLOA 1XMQB 4ALLA 2ECKA 4QARA 3NHMA 3QPDA 2I2AA 5ALDA 4X65B 4QKQA 2ZDHA 5FH9A 3E84A 3HFRA 3IBFA 3TE6A 4KYVA 2IPOA 2QSZA 1N5LA 1OI3A 3I83A 3OPYA 5C4GB 3RO7A 3ZZUA 2RGEA 2Q8QA 3E9CA 3EFBA 4F8EA 2HREA 1W4BA 4FYPA 4CIWA 3HB0A 2Y92A 4TUYB 2B7LA 5JS2A 3H0KA 2IVFA 2VPTA 6Q21A 1FMFA 3FWZA 3UC9A 1OZFA 4LF6B 2CFTA 1ZLYA 2BJWA 1UK7A 2XUIA 3FX2A 3OQBA 4G5HA 3CF2A 4IDNA 4IVNA 4R9RA 5AHRA 4PRYA 4ZDWA 4DKXA 3EUAA 1PJLA 2FMXA 4U6QA 5COQA 4DEVA 2HSWA 2H4YA 2JC3A 1MAUA 1ZNYA 3U2QA 4B3SB 1YS9A 3INRA 1XRPA 2WHPA 3HVKA 2VJLA 1D0SA 1JDJA 2WJAA 1TCVA 3FGZA 3MXOA 1QVRA 4RCYA 1HL7A 1XPOA 3JWJA 1SCDA 2PN1A 2GLUA 4KE6A 3H2YA 5IM4A 3K96A 1K5GA 2YVLA 3WA6A 4TMXA 5THXA 1WMDA 1S2MA 1LDEA 2WU4A 4GPAA 3ZQUA 1PNOA 4IWYA 3O82A 4MCJA 5AKZA 2IV3A 4YJ3F 1XXHA 5H83A 3JY6A 3TMAA 5HG0A 2XVXA 5LQJA 2IZ7A 1P3JA 1CUDA 1KMIY 3BRQA 1AKWA 3PEFA 5E1OA 5JALA 1KFCB 1M6VA 4Y9TA 1PFGA 3RK4A 4BNTA 3FYUB 5BNZA 2Y1OA 1GZVA 2JFQA 4XLZA 3T0FA 2PX4A 1HDCA 2ZDGA 1A2BA 5A5FA 5K6TA 2W98A 3F9RA 1GARA 2P3OA 2X22A 3CNHA 4GI5A 5LJIA 2XB2A 1EM8A 2XPCA 4ZVKA 1KEWA 1U3TA 1E18A 1CJUC 1XHEA 3DEJA 4KP7A 4PLPA 4Q3LA 3PQCA 4CMGA 2V4UA 2CBGA 2VHVA 3L46A 4AFNA 2I6GA 4K05A 3IAXA 1IU9A 1P7CA 3B1WA 2I2XB 4IJUA 2H54A 4I1SA 4KR7A 3WL3A 1N6OA 4B6EA 1KDRA 4N5HX 3TR5A 1LLUA 4B76A 5AQ1A 2YN0A 4EFKA 4R71A 3HRKA 1TQHA 2IXBA 3PHHA 3CSSA 1L8OA 1U1EA 2BBWA 3UKOA 1C0IA 1ZXLA 1A4UA 2HCTA 3BICA 1N9GA 4O2BA 3H9UA 3ZLUA 4LQ4A 3HU5A 4K26A 1PWZA 3G9QA 4FX5A 4JC0A 3ZVNA 3SG0A 5KZMB 2Y1EA 2I6SA 3BIXA 2ZUUA 5TVGA 2EJWA 4Z2AA 2JIRA 3HMQA 1URPA 2VZEA 1YQQA 1VOTA 5B3JA 1J0XO 2A3RA 4AKIA 1JIKA 2IHKA 2WMNB 1FJGB 1JEDA 4EG5A 3HEAA 2PYZA 3HPQA 3OQOA 1UP4A 2BEVA 4P8RA 4TOIA 3T7RA 2OQVA 4BGUA 4I4NA 3ZDRA 1LQUA 2NV6A 1Z16A 4XQ9A 5EJEA 1O94A 1V0JA 1DX9A 1JHQA 2QTFA 2D6FA 3IEIA 4DARA 3FCYA 4UVEA 4PBTA 3R7AA 1Y5NA 3HJHA 2YXNA 1D1TA 2WOJA 1X2BA 1EHIA 2YIJA 3ZD7A 1VSUA 4XASA 1P4JA 1YL6A 1NBWB 4W1RA 3V3TA 2GPSA 1IY8A 1BE0A 5JHHB 1Z88A 3HXLA 4R1SA 4UNSA 4B71A 1T2VA 4MI6A 3BULA 4BVKA 5I7WA 1LJLA 5JZBA 1H1LB 2P9EA 1CD5A 2XCSB 1RLMA 2AXQA 2ICAA 3O4FA 3S7TA 4FCWA 1QK4A 1XK7A 2QX9A 4NH0A 5K6RA 4G84A 1K88A 5DT2A 4YQZA 5KVQA 1JR6A 1SIWA 3KQYA 5ALNA 5DWDA 4BLUA 2N0SA 1CQZA 5IJ9A 4L73A 2DKOA 5EYPB 1Y98A 3UCEA 1QKJA 4GRIA 2AH5A 1JLKA 2CUNA 3A1SA 4ZV9A 4JP8A 4M1EA 2CVPA 4Q1AA 3IUYA 1FFDA 4L0DA 3TPCA 5BV2P 3K1YA 5JMTA 1A77A 1QFMA 1RYDA 1C3LA 1DTSA 1ZG3A 1I4LD 2DQZA 3B7WA 1GA6A 1JNYA 3EG5A 3NHPA 1JT2A 1HGXA 3GLHA 3HO8A 4IJ5A 4L50A 4MQ6A 1GGHA 1U31A 4G25A 1FSSA 4A0FA 3BK7A 4DLNA 3BBPA 3WI7A 1XZAA 3CLTC 4JBHA 4BO8A 3LGSA 2IW3A 1IQUA 3I8OA 4ZAZA 4DA7A 2NUPA 4C0WA 4YRMA 4MZXA 2RB4A 3AR5A 4OREX 4C0HA 1QFZA 5D00A 2VK1A 4YAJA 2WZDA 4JFAA 1EFRA 4N7MA 4BPBA 4XVQA 4YALA 2J46A 4U6SA 1XMXA 3K9QO 5L3RA 4AMUA 2Q7XA 3LYAA 4KK3A 3LLMA 3PX7A 1GU7A 1DADA 2J0EA 3GRCA 1PEKE 3ZV3A 5I01A 9ATCA 4J1SA 4DWVA 2PH7A 1WOYA 3WB2A 1WQ3A 3EA0A 5A5VA 3NDPA 2QTNA 2ZETA 2X6QA 3T06B 2IEBA 1HMPA 2RH4A 3L4JA 3URMA 4DQKA 2VNJA 1B14A 1FFXA 3I9V6 5IEBA 4ZXFA 3F2VA 4ZT5A 1FSFA 3M1AA 2F3UA 3GGOA 5FV4A 3EPPA 1XF1A 5LOVF 3P9CA 4QDUA 3GNQA 1UOEA 3GAMA 2OV1A 2P3QA 3RTCA 4X97A 1NQAO 3A8TA 2P1ZA 5IG2A 3CJQA 4DCUA 5KPDA 1OJ7A 4TKLA 4ZJUA 1Z15A 1JGTA 2P9HA 4JC8A 5FA5A 2Z5VA 3GWGA 3ZCQA 2JI9A 5EJ2A 3L2OB 3CB4A 3AJDA 3HMKA 4LJ8A 3Q7SA 1S89A 3E61A 3BFPA 2F8LA 5COAA 3MBKA 3EQ6A 1U2GC 5BP7A 4ZCRA 3D4IA 5LOVB 3RASA 2WDPA 4KAJA 4DQ0A 2B8NA 4MHSA 1DXYA 2CXUA 1W4RA 1YDEA 2ZIVB 5BV0A 2UUBB 1HT2E 4NJMB 2PBFA 3H2JA 1H22A 4IOJA 4OGKA 3I72A 4D4HA 4KE7A 1Z2OX 4DIMA 3L8MA 5FWAA 2GEJA 3OT1A 2JIZD 1NFQA 3IRVA 2B36A 3RRXA 4LF5B 3FOFC 1SUDA 1BA3A 2ABWA 3NLLA 1PK8A 2WUGA 2ZJ7A 4FNMA 2GCGA 4KVZA 1V48A 4CDNA 3SLKA 4D9CA 1SC4A 5TPZD 4FKBA 2VN8A 2JVJA 2OG2A 3ADKA 3NOXA 3GROA 5L40A 4NG5A 2VRCA 2PCJA 2XRFA 3GPCA 2GRAA 2WQZA 2YWRA 1SH7A 2Z2XA 1T25A 3D59A 4EX6A 3KOUA 5ERYA 2A86A 2OC9A 3D6NB 3B6JA 3MWLA 4M36A 1YRAA 4RJIA 5DGHA 2FWJA 2WWYA 3E7XA 1U9YA 4HADA 4CMHA 1YTUA 3NAGA 4D74A 3V4FA 2NQ2C 1YS4A 5IC6A 5C8VA 1TKRA 2DCUA 4EVQA 1X6VA 3GX1A 5F5XA 1JWLA 1XVIA 3OQ1A 4J75A 1FQJA 3T1TA 4IPTA 4Y1GA 3I64A 1CQJA 2OKCA 5HHTA 2VXBA 4AAYA 5DEIA 1N2EA 2NNLD 3FWNA 2G6TA 4KN8A 1IAQA 4HB0A 2B94A 4XVRA 5KAPA 3GDGA 4YXWA 4ZI7F 3DL0A 3FVWA 3SZUA 3KJQA 3QPCA 3ZC3A 1YZKA 3THOA 4ZMRA 2IP4A 2HUNA 4C9BA 4HNQA 3C3JA 4IV5A 3RB8A 3D6FA 5BY2A 4AYXA 1SUPA 4KEAA 2BCJQ 3BXOA 3H9QA 3DJYA 4HUJA 3ESYA 3FYCA 5H82A 4LHYA 3N76A 5TS2A 2NUBA 3L0OA 1I7PA 1E4VA 3V8RA 3VGPA 5HMMA 4YDQA 1X9GA 2ADFA 1YI0A 1J8MF 1ORHA 1JF8A 2MSEB 2VNAA 2YC4C 3A1TA 3OOWA 3P9QA 1PJCA 3ZY4A 3EE6A 5JY1A 4AF8A 3WKBA 3PQFA 4KXVA 3CTMA 3GCDA 2B30A 4KN5A 5REQB 1E2UA 3WLFA 1VMAA 2JZNA 5FL7A 3ZS8A 3NTQA 2GXUA 5FEUA 2C4KA 1PV2A 2WJHA 3ENZA 3AG5A 4B84A 2J9FB 5AW6A 3DUFB 2ZJ4A 1LNZA 2ZYTX 1JH8A 2R00A 5BSHA 1LZKA 4UASA 3IHKA 2R8RA 3SEAA 1Y4ZA 2DC1A 1TKBA 3FGNA 1Q0QA 5LYJF 2QRGA 1AKQA 1YFZA 2DFVA 3E4DA 2F7SA 3ZWYA 3THXB 1INLA 1M0EA 1FFSA 2P9CA 4D9HA 1DDGA 1M2WA 3DP7A 1IONA 3S40A 4B3DA 4J16A 3V2HA 1F38A 1QPGA 1AY0A 3BTUA 3MNFA 4IILA 4LI0A 2AJBA 1M6YA 1H1DA 3Q15C 3P0EA 2QP3A 3QXHA 1RJ9A 4F46A 5ESWA 3HJUA 3OQHA 1QP8A 2OO5C 2G7MC 1SVUA 2M6RA 4C4RA 1UBOS 2WC1A 3FF4A 1AKNA 3L4BA 5D2CA 3USZA 5JATA 2PRIA 1L2TA 3AEYA 4KI7A 2OGZA 3JQBA 4QPPA 2HD4A 4FD2A 1J8QA 3L43A 3KQPA 3PQ6A 4HRVA 4D5EA 5KWIA 1L8AA 4GRDA 2C9ZA 4P4SB 1I5OA 3TJMA 2PO7A 2IU4A 4EG4A 2GGSA 2A0XA 2XTZA 3SAJA 4ZT7A 4J7AA 1VYTA 2ECFA 4TMZA 5GZ6A 3PX3A 1GILA 4QXQA 2WSLA 1L5HB 1LW7A 2XGSA 2G4CA 1P44A 2GK4A 3WTBA 4E11A 1P29A 4CG3A 1FFHA 3CEJA 4JP2A 1RWMA 1KSHA 1GG2A 1R6UA 4GMXA 4NQRA 2RB5A 4OBEA 4PZUA 3LOQA 2W2OA 3HN6A 4HR7A 3Q7IA 4TT8A 1KYXA 2JH3A 4RLSA 3WK7A 3WK5A 5EVJA 3K3PA 3P4XA 4AS2A 3GLFA 3D1LA 3ZGNA 3MMZA 3OIDA 4OYLA 3WP1B 3PJRA 1GYPA 1GN9A 2FX5A 4NE2A 4NYMQ 1X80A 3NW9A 3UT5B 4HH1A 4CTOA 1QGDA 3BIFA 3LTEA 2X6RA 3NDRA 3OQPA 1P0QA 3LQKA 3ED5A 2OGTA 3LT0A 4EJMA 3ZXUB 4B0OA 2ZT6A 4DQDA 1G2IA 3WWEA 1W2HA 4MEJA 1OGIA 1RRPA 4KJXA 2CFOA 3C45A 1Z0SA 5LP6C 3S1AB 3SKXA 3MVEA 1ZUWA 4YYZA 3ZGZA 2AI3A 2JCSA 2R96A 5E0OA 4GX5A 3G23A 1BE6A 1TZ2A 1XQYA 5C1OA 1GYQA 3U9LA 4I50A 5GWXA 2XI4A 3GYGA 3JAKA 3P52A 2JANA 1X39A 4WEOA 2DSNA 4OKNA 1TVMA 2PXHA 4QRIA 1E6LA 2GJ4A 2W2QA 5C37A 1R7RA 2P9FA 4YAWA 3TQSA 5L45A 4QXRA 4ZT2A 2E21A 2WUDA 3GXOA 4F9EA 4L2IA 2EVWX 1O9HA 3LNTA 4WNCA 4ZZ2A 4V1CB 3SIRA 1E2EA 2PZGA 4J6EA 5DCWA 1IXYA 1YUMA 3ESBA 1WZUA 4GVXA 1W0KA 3KYJB 4MR8A 5DBHX 3UA3A 1ONSA 4C2AA 1G64A 4D26A 5AW0A 2VJQA 1L9XA 4PTZA 1XWWA 2A78A 3AGQA 5E2IA 1AMNA 1RM3A 5JFGA 4BLSA 4DLPA 1E1QD 3IPYA 1UDWA 4W5NA 1NUPA 1Y3AA 1MT3A 1TJ4A 4ON9A 1CRPA 4OD0A 5FUXA 2CJYA 1GL6A 1RMQA 3ODGA 4QX6A 4OJNA 5I9NA 1DCKA 1SBZA 2QENA 2FNAA 3PFNA 3KB8A 3ETHA 3AU8A 4L0MA 5E4FA 3HVUA 1V43A 5EIEA 3HB7A 1DCMA 2I1LA 3C87A 4C3UA 3FUWA 3L7LA 4KV9A 2GSWA 3Q7RA 5K3SA 4C76A 2HYIC 2IK8A 3AFGA 1V5WA 1XNJA 3LUFA 5C4IA 1U6KA 4QOHA 4OAPA 3QLEA 3LQFA 4B3MB 1QZ3A 3S5JA 3OC0A 5AYVA 1M2KA 1JPJA 1UK9A 3STWA 4CCYA 1KOLA 1XL1A 2N3ZA 1S6YA 2IYYA 1E89A 2CHFA 3IE0A 3IT0A 4FHFA 3QVGA 4ML3A 2N1BA 3TUJC 2PUAA 1BMTA 1QV7A 4GDMA 4J07A 2OXRA 3G02A 4YMGA 5K4GA 5GADl 1Q7CA 3OFND 1XHLA 3UAYA 2AEFA 4OHBA 1GZHB 2XDAA 4W8GA 4PFSA 2XRYA 5A7HA 2VYVA 3MERA 2BL4A 2BJHA 3F67A 4FZ3A 3AKCA 2Q2WA 5J43A 4G09A 3BL8A 4YAEA 2FP4B 4ZO4A 1KI4A 3IT3A 3UMMA 1OI2A 3EBOA 3VR0A 2BDEA 1P4RA 4P5PA 2Y8EA 1WHTB 4ADSG 1YKFA 3B1XA 3ZLTA 3EXHB 3DD1A 1SZCA 2BGRA 3U4DA 1AGXA 1KMQA 4Y2QA 5TPWA 4AN1A 3LYHA 1FNSA 3UK1A 3P9SA 5CYGA 4FBGA 4DLWA 3B2QA 3HZRA 2QTCA 1QJCA 3AVUA 1R3DA 5DOVA 4KLNA 2Z83A 2OD7A 4M1YA 1QQAA 3CNEA 4DR4B 4LY9A 3SEQA 2UXBB 3NZEA 3IAAA 4GBJA 3K05A 4U2KA 5P21A 4L5CA 1NXPA 4CUZA 4R8RA 3TBFA 2J5BA 3OIGA 3WMGA 2Z6UA 1GVHA 1B2LA 1V2GA 2CLLB 3GXBA 1BAPA 1Q0UA 3ET5A 4QYSA 1FVOA 4EEZA 2QP9X 2D4AA 4OK5A 2IY9A 5M5BA 3A1WA 3FMVA 2G82A 4Z0NA 4JLUA 1OX4A 4B2LA 2Q45A 5FWXB 2H06A 1QH0A 1H69A 3C6KA 2BUBA 4OH1A 5BN5A 4LXQA 2DP4E 2HU8A 4TLCA 5B55A 2GI4A 3CRMA 1SA0A 1GR0A 4JITA 4MGHA 5A0TA 3BE4A 4ZQHA 3HUDA 1RPJA 4G8CA 5JV5A 2IZ6A 4HDNB 5DMHA 3T3EA 3UYLA 2ZCJA 4DW8A 1KZGB 3OPNA 4E88A 3I1FA 1H5QA 1KFJB 1QIGA 5DW0A 2ZAIA 4AS3A 4BV2A 4O8CA 2VP5A 1ULTA 2CCGA 4RTRA 4V3BA 3U44B 4ZQGA 4Q4JA 2Q3CA 3NALA 5ICMA 3OAAA 2PEYA 3EY4A 4FYJA 5LNK1 1EG7A 5BSRA 1WSBA 2ETXA 2QGFA 5LB2A 1BKDR 3OPYB 1HKUA 3RRBA 3TMKA 4CRWB 5BMVF 3KFVA 4BV3A 3T1YB 2BGTA 5PNTA 3DE6X 5ENDA 5LWQA 2OORC 2R6GA 4H7KA 4II7A 1FTSA 2J0QA 1T1EA 2W22A 2XR1A 2CHEA 3RU7A 2EFDB 3O4GA 2EW2A 3PFKA 2C2KA 2XH8A 5JCJA 4M1QA 3TRDA 3DXYA 3G89A 1TLLA 2D2FA 2JLXA 1K1EA 3W5JA 1B7GO 3GFRA 3G5LA 3AERA 4M0PA 3TTUA 3WIVA 3R7SA 2PUTA 3FDJA 4CV2A 4Z6KA 2Q27A 1JHRA 3NNSA 1K63A 3OZGA 2HSEA 1ULAA 4PGMA 2WHPB 1FYFA 2ODPA 4TRRA 3TLYA 4FC6A 5KWVA 1SD5A 2P8JA 3GEPA 1G20B 2YX1A 1TM7E 3G68A 2D74A 3WGLA 1G20E 3R0VA 2CUZA 3Q87B 1PZHA 2AT1A 4B5LA 2EG9A 1XMVA 3V7WA 3MAAC 2NUAA 2XE6A 1U8UA 1Z47A 2BZSA 3JWGA 2VYND 3D0RA 2KJQA 1ZK1A 4H6PA 1Q95A 2ZT5A 4PCVA 3QKUA 3BUSA 1XXHB 4QDZA 5LP6F 1OTYA 1XXHE 3LPNA 3B36A 3SM9A 1XF9A 1M6VB 2BONA 2QPOA 4XD7A 2OYSA 4O6VA 5ALVA 3KZVA 4YO7A 5K0EA 5AICA 1NV9A 3LUJA 1S0UA 4LRSB 2ZKLA 3BFKA 3TS1A 5JVDF 4UAJA 4IIXA 1PVDA 3M3HA 2CK3A 3ONWA 4TYPA 4OYRA 1KVSA 2WTNA 2FEMA 1ZICA 1YH3A 4BKPA 3R0ZA 4J29A 4AXBA 3JQ8A 4PZZA 4BBPA 4Y2YA 3G49A 2VQSA 4FIZA 5HFAA 3NS7A 2TSYB 1YQWA 2FPKA 3ZWMA 2AR0A 1M2FA 2VPXA 5JS1A 5B1DA 4UMDA 3OE7D 3M4ZA 1OCEA 2GAFA 2IXFA 2OILA 3KT3A 3OQVA 1ND5A 1VSVA 3FROA 4BO4A 3GA7A 1B1AA 1RQGA 1XJCA 1FTQA 1GAWA 2IYSA 4QJIA 2ZT8A 3TPZA 3D7MA 4ER6A 3ENNA 2GCIA 1H05A 4I8XA 3CRQA 4RD2A 4ZO6A 5K6AC 1A95A 3G13A 1E2NA 4EUFA 2HNKA 4EPTA 2P9BA 1P62B 3OY7A 5MN4A 1SC3A 2X6TA 3I23A 3IUEA 2FPUA 1OLUB 1D2EA 1E32A 1XTSA 3RSSA 3K9CA 1YI1A 1NW8A 1Y3DE 3A1CA 3NNNA 4W4TA 4ESEA 2ZJ5A 4MYDA 4U9UA 1OV4A 2DE0X 3FKQA 5FBKA 3A4VA 3F78A 3EH2A 3X0DA 4EI9A 2CV2A 2E5FA 5J9FA 3LY8A 3BJMA 5FX2A 1L7VC 3MUNA 4E5VA 1PQ4A 4QFMA 4PSVA 5A06A 3A2MA 3WIOA 1NRXA 1O57A 4JUAA 4O0MA 4AIRA 4RTQA 3STVA 4BASA 2RH8A 1P2FA 1I0LA 4NWIA 4QJBA 2O8DA 1V7CA 4J0GA 1R0KA 1TRKA 2NIPA 4LA4A 1U0OC 3IB6A 4CLOA 2IUUA 4CN9A 2BCEA 1MIOA 2NOAA 3L0ZA 7ABPA 2WTXA 2JVIA 3ROPA 4BTEA 2XB4A 4MB2A 3WSVA 2AF3C 4EUHA 2QRLA 2PMEA 1V5FA 2A5DA 2ATIA 3HXTA 3VI3B 4M0KA 3H1BA 2VH2A 5IJ9B 1RHQA 4GR9A 4JLVA 2FCRA 1CUWA 2HRQA 2I8CA 2ZRQA 4RA9A 1XAIA 1F8GA 1WB6A 2HPVA 3KR2A 2BBOA 5LDHA 4DLUA 2HR1A 2CJXA 5G1PA 4RY2A 1WLYA 3L8ZA 2FYTA 1AE1A 3FHOA 3WGZA 3UJHA 1TMGE 3GLHB 4F0JA 5FDFA 4HI0E 4Y98A 2CYCA 3GLHE 4A2WA 3IEPA 4RAOA 3WNBA 5IVDA 5I51A 3CUYA 4MROA 2JFUA 1LW6E 3A3PA 3HDHA 3DOFA 4DV1B 2NUPB 1BE1A 3AIOA 4WT7A 3WRVA 2BISA 3VHLB 4HAZA 2JIPA 3VPSA 5C81A 2KE5A 2RIPA 3NC1C 4JA2A 3AEKA 2QD5A 2EJVA 2P5YA 4P83A 5CVUA 4E32A 1VCOA 5JS7A 5FYDA 4YV7A 4K6FA 1PJAA 1DE0A 4LJSA 2C94A 5KX5B 1DI0A 4W7HA 5T7BA 1H2AS 3LP6A 4XGIA 4M49A 2H1IA 5LA6A 5AM4A 4CF3A 3F6PA 2LXNA 4D9BA 3C1TA 3ZLJA 5KCMA 4R84A 1DV1A 3LXRA 1UZLA 2ODEA 3C15C 3UH0A 4Y9UA 1G8HA 4B7AA 1U28C 1M5TA 2QLMA 1FFXB 1SVWA 4OOEA 3GFFA 3ICCA 3PPIA 3QLUA 3L6CA 2QXYA 3TTXA 4CXMA 2EFHB 1OXMA 1E3SA 3IBGA 4U7WA 1J22A 1DCFA 1OILA 4CHGA 3GF4A 1ZIOA 4XM0A 2XDYA 4K9MA 2W6QA 4PPQA 2YWHA 3RI3A 2I80A 3N70A 5A9RA 4P33A 4E4YA 4MLCA 1EBUA 5FJJA 1ULBA 4V24A 4MUMA 3IHTA 3TZLA 3IIEA 1NM5C 1EK0A 3B13B 2I6XA 2VXOA 4FUTA 5EP2A 5H16A 4GOOD 3MYRA 1XCOA 2QUAA 4NARA 4D43A 2VBFA 4HGZA 5B7GA 4F45A 1D8AA 1RXVA 1ZVJA 1W4AA 1GSHA 1QC5A 1H0KA 5BSVA 2H1WA 2ZRMA 1EE9A 1NRJB 3I92A 3QM1A 1XZCA 4IIYA 1L1FA 1GPBA 1VE5A 2WB4A 2QNBA 1NJ1A 5BW8A 3HM2A 3U1BA 3GLGA 1GUDA 4CKXA 3VYSB 2R8OA 2VZ0A 3V3KA 1RQ7A 1RZRA 1XMIA 1RYMA 2D1RA 2OUIA 1DBQA 4BS9A 5GONF 3IDZA 2M6KA 4BZWA 1LBIA 4XB2A 2KS6A 4DA6A 3OETA 4FGWA 4WY2A 4RKFA 5KOJB 4ERNA 3UAOA 4WESA 5YASA 3PFGA 1Y7IA 2D1QA 3U3KA 3DVSX 1RKXA 4U7HA 1VG0B 4H60A 1KKMA 1G8JA 1X86B 4II2A 3ADCA 2GVDC 4YMWA 5KUTA 3NUQA 3F8TA 4WCDA 1Z5NA 2I4RA 3HCCA 4A91A 1GQOA 1W35A 2RGDA 2YN2A 2A9JA 4EGSA 5JNUA 5EY5B 3PE4A 1SVSA 3CLRD 3D81A 3TUIC 3HJBA 3SM3A 2VIIA 3ADBA 4YMVA 1H0RA 2FQ1A 4V3CA 2XCUA 5KNCD 2HIHA 2P6PA 3DZ8A 1RRMA 3W6PA 1OXBB 2EV9A 8AT1A 5F7JA 2QVLA 1H6DA 2FW9A 5AM2A 2RAFA 4DLZA 7REQA 1E9FA 4LXHA 4UXIA 4IWNA 2YXPX 3LYUA 1PK9A 2WP8J 4BN0A 5KIAA 1FLNA 1CE8A 1MXFA 4URHA 1RC1A 4BNLA 3H18A 5EHNA 2VDJA 1V16B 3Q72A 2A0YA 3DCJA 3QVUA 3UN1A 3WLTA 3RFUA 3GLUA 3OP1A 3H2KA 4O4JB 2PMBA 4ZQBA 3CXUA 1XRQA 1IXRC 3OJCA 2G08A 3KBOA 1OFUX 4D8UA 4JNCA 1FMJA 4FT2A 4P4GA 2B4TO 4PICA 4FHEA 1ZGZA 3B60A 3RARA 1OIWA 5IZCA 2R44A 1QTNA 4HDSA 4QXAA 4DIBA 4YCCA 1HE4A 3HL0A 5I9IA 4OHRA 2BGUA 3M6LA 1UH5A 4Q3KA 1TEXA 1O58A 5DGXA 5BWBA 1IK6A 1PWHA 1XEAA 2ID9A 1EFKA 3JR7A 4S0XA 3ZZTA 1DGQA 3I0MA 3QYPA 5JI3E 3LI2A 2VAWA 2HY7A 4EELA 1I1NA 1RKBA 3MINA 1JFLA 5T3YA 1E92A 2R11A 1L4NA 2R5WA 2VA8A 1AM4D 3NI2A 3FSJX 4HRYA 5IAEA 1RJGA 1H93A 4ZD6A 3G7NA 3PHCA 4BMNA 4QGAA 1G17A 5L9AA 2GF2A 4PSUA 4GZ5A 5J2UF 3MRTA 3OJ0A 4UVGA 1PZFA 4OXQA 2XRZA 2ZB4A 4PQYA 7MHTA 2Y71A 3UK6A 3WICA 3LUAA 1QLHA 2PKCA 1L5NA 3TM5A 4JVSB 1L4LA 3WMWA 1MQSA 2YV1A 1ADGA 3E9EA 4EYSA 4MCHA 4CKYA 3N0XA 1CB0A 3UV7A 3MSCA 5GJVC 2O7SA 2C78A 2VSXA 1K7CA 2B9VA 1ZNXA 4BMSA 2NTEA 1XHFA 3QBVA 1U0HC 2IF2A 3MCAA 1F4LA 2WE8A 1PIWA 3O8RA 2CLDX 2RGCA 1JR3E 1LJ8A 2G5CA 3KUUA 4IJMA 3UAGA 4HUTA 1DPFA 2Y0DA 1R16A 4RZ3A 4JKOA 4RZIA 3TBKA 4CIDA 4QLBA 3DPUA 1YSCA 3BXXA 3CIOA 2B82A 3EVGA 4OMCA 5CT6A 3OLZA 3COYA 5BNTA 1GGMA 3C4VA 2PJRA 5EKXA 1SU7A 4P2GA 2QZSA 3QF4A 5JQGB 1OZAA 3CGGA 3P0HA 1M2JA 1YR2A 5CB6A 2O0HA 3DFUA 2ZYUX 1ZR4A 5D51S 4A0QA 5F4ZA 2C1XA 5CVDA 3R75A 4QPNA 1DX4A 4AP6A 1HNXB 2Y66A 1SZPA 2QJTA 3WRXC 1NP3A 5CH3A 3PGKA 3GLFB 1SUWA 3PC8C 2WTMA 3ELDA 2GHQA 3STYA 3GLFE 1U2TA 2FRDC 3AL3A 1STOA 4JNKA 1ZSYA 4QQKA 2PX3A 2VPZA 3WHKA 4IJQA 5JJCA 4KXNA 5BNFA 3EFEA 4LOKA 5F3DA 4UUAA 5FAXA 5HM6A 2D1TA 3DKVA 1NATA 1KJQA 2HZ7A 4LWQA 4Q1BA 1QG4A 1BDMA 1PLJA 2WMOB 3G6KA 2VLBA 4RD3A 2AG6A 3Q7PA 5B3KA 3UBTA 3ZJ4A 2ZRGA 4WPGA 4F5YA 4S1WA 2ZI9A 3FPBA 4S35A 3OX2A 1P91A 2Z09A 4NDAA 4DTIA 3L7IA 4YC7A 2BI8A 4Q9HA 2WMYA 4EI2A 1TC1A 3TQCA 3MRSA 3SFZA 3TD6A 4UAUA 1ADJA 1IUOA 1MCZA 2CSUA 4I50B 5KQMA 4J4BA 3RKUA 1GPAA 1L5FA 4LYGA 2R4QA 2HMTA 1ZSVA 1SIUA 2DUWA 2F1OA 2QIOA 2QRMA 4BMCA 3GZNA 2LKCA 2RAUA 3ZU3A 3HWRA 3PUZA 3KXKA 2ALJA 2G4LA 3P8ZA 3K70B 1Q0LA 3S28A 3QUAA 2WB2A 4Y2PA 2RHLA 3GRFA 2H1HA 5TQ2A 1E3TA 1BQ3A 3BDAA 4MR8B 5ELLA 2EQ5A 4ND8B 3VO8A 1NQWA 3PXDA 4WE3A 1NF9A 4UUOA 5EXSA 4J2HA 4PO9A 3D3KA 4H0FA 2AOUA 3EYWA 3ZNNA 3OZ7A 4EECA 1KF0A 2QY9A 3AR4A 1OVGA 1CUZA 2ZRBA 1YJ8A 4Q1FA 5TQ0A 1DC5A 2YFHA 3MTGA 3H4VA 2R1VA 3HFJA 3PTLA 2ZWAA 3MILA 2P77A 5AK0A 3KNZA 1MOZA 4D8VA 4B7UA 4EJ0A 4I5IA 4KREA 3FW1A 3L6DA 3DR3A 2VBCA 4XVHA 3V1NA 4PGHA 3KKPA 5GQSA 1HH4A 2HF7A 2NACA 1TMKA 5HKAA 1UKAA 1ZGBA 3AHDA 1WVGA 3VH3A 4HVTA 2ZS7A 3WYDA 4FOTA 1HQKA 1RYNA 1TIKA 4MYHA 4FJ2A 2FZLA 4DM7A 1PFQA 3UUFA 3FSGA 4X62B 3BL6A 5K3DA 3FPEA 3ELUA 3OVMA 2HIGA 2PUWA 1QH8B 1H8HA 3AUAA 2YS7A 3Q0EA 3TW6A 4BL5A 4DOMA 1O96B 1VPWA 2QM7A 4MRAA 3G5UA 1SUCA 3HHPA 3F7TA 1AUOA 3JYLA 1PSDA 2GBFA 3DVRX 3LWZA 2R1UA 1NASA 2RD2A 1L9KA 2JARA 1T36A 2G04A 2YZGA 3MRVA 4PLTA 4UE2A 4N3NA 1QRSA 1T2FA 2ZITA 4UCFA 5G0UA 1F6WA 3GDOA 5LU8A 1FFGA 5ILOA 5CVJA 2PL5A 4MTCA 1JR2A 1NVEA 1O9BA 4TWRA 2G9UA 1OZGA 1NMQA 1AB5A 4TXHA 2RBGA 5ECYA 3SFTA 5DSTA 2ZIZA 1KEZA 4U02A 3TDMA 3WYFA 2ZCVA 1PS9A 1JDBC 1JNXX 2HLNA 3ANLA 1KBOA 3D7KA 5D6OA 1C3EA 3K0FA 5LXTA 1I33A 2EFJA 1NURA 3ISJA 4JJGA 4PX9A 3AJAA 5CT5A 3QVKA 5TEWA 3TXAA 1GV0A 1UBCA 3MGCA 3FMOB 1J0BA 4FW8A 5JOQA 2WYWA 4FHCA 3SQDA 1JA9A 2C0CA 3H3FA 3ODPA 1FS5A 1ZJ5A 4N5IX 4XH9B 3GQBA 1OGJA 4MVWA 4Y6QA 1HT3A 1SK8A 4B4VA 2O3SA 3ASYA 2WAYA 1P9RA 1RD4A 3RS9A 4WCFA 3TMYA 2V7QA 3PIRA 3FTDA 2PIAA 4ARZA 3UXEA 4XLTA 2JNWA 2JKZA 3IP3A 3CNQS 4MW7A 4DPLA 1OX4B 1LBEA 1P2BA 2FEKA 2FW6A 2WVGA 5JW6A 1N0HA 3DCIA 3CLSD 3JD2A 5BN5B 3V1UA 4DC1A 1KZHA 1R00A 4LVNA 4P86A 5LNK6 3P97A 3RVPA 1E3QA 3FYSA 4P5DA 4YBRA 2WIKA 5GP1A 2O2EA 5HIMA 4EQ6A 3V8PA 4DEXA 2IBTA 1TF2A 1ESZA 2JCGA 3WYNA 3D4PA 1R50A 2CBZA 2R47A 4GBED 4WZZA 4MJ3A 5JXWA 4LF9B 3CNNA 1EGVB 1EVYA 2W11A 5LR6A 2N9UA 2IXGA 1SOVA 2WA1A 5CUQA 2GPAA 4Q4JB 4RNDB 3LDUA 1CUUA 2SKCA 4UHBA 4ZJPA 5A5DA 2A0KA 5KPJA 2Y4OA 3HGTA 2RGBA 5JYDA 4F11A 1ETUA 4TL8A 2HEIA 1QPBA 4GX1A 4EPWA 1XU4A 2FEWB 4QVKA 5FADA 4AX8A 4EW3A 4WNIA 1NWCA 5GM2A 4BLOA 2IA5A 3AFIA 1XMOB 1JE1A 4UE6A 2VJMA 3IHWA 1Z4IA 4A0GA 4US2R 3FF1A 1J5XA 2WHEA 1QIHA 1GNSA 2Q0HA 1OWLA 4XCQA 3OWOA 2Y3IA 2ZFUA 1T6XA 3LO8A 5TMBA 1GQRA 1CRWG 2YRXA 5TVKA 2DWUA 4WECA 3DZDA 4BFUA 3AERB 5HYVA 3OTHA 4DSZA 4M98A 4CQMB 4XQGA 4Y0NA 4PLCA 5KYKA 4IHJF 3M2TA 1XZMA 4LEIA 5KNBD 4EO7A 3VJRA 5DNDA 3JATB 4XDHA 1UBRS 2QN9A 5C0OE 4B3XA 2EFYA 3OM9A 1SHUX 3AU9A 2C57A 1CULC 3H5TA 3EGWA 3NM6B 3KPWA 1AXEA 3KG2A 5BW6B 3KEOA 4BMPB 4GFDA 1IIBA 1YR3A 3C5CA 1GQQA 3KD2A 2NUAB 4TWZA 4I6GA 1JP7A 1L3BA 5GGYA 2PSHA 1KA9H 3WZLA 1Z7BA 2HJWA 3HY3A 1T29A 2QUZA 4GBGA 4IDOA 1DIGA 4AMBA 1O97D 5DISB 3SE0A 5KYYA 2CZQA 5JISA 3VSEA 4GXNA 4C3OB 1DKLA 3TLAA 3ILSA 3SYKA 3H0CA 5HCNA 3ZVLA 2DCMA 2PFGA 3AK4A 1U81A 5BW4A 3JQ8B 4TLBA 1LSJA 3O47A 2HA6A 1FNBA 1UBFA 1ULZA 1YQEA 1A9ZA 4K9PA 5FNVA 5TJ9A 4B6FA 5AW1A 3QUTA 5E7MA 3F1LA 4KBYA 5EKSA 2NZWA 1EWYA 4O8ZA 3COVA 2CHQA 5EZ5A 4DCSA 2ZROA 1GZUA 1RADA 3HCRA 4KQHA 2JHFA 3OQ6A 4XIFA 1L7DA 2LV8A 3HACA 4OF4A 1V3QE 2DPYA 2FLWA 4XPIA 2GXAA 1Z5OA 1KY5A 2CXNA 3OQNA 4QFDA 3KTOA 3C2QA 3O91A 3KJEA 1OT3A 3IP6A 4INPA 5IP5A 4E5KA 5I4BA 4EW1A 2B1JA 4DA8A 3WVNA 4HGYA 2GN2A 4FQ8A 5T67A 3W6ZA 3NT4A 3LP8A 3BAFA 4KAFA 1UIRA 2BFAA 5CNIA 4D02A 4HNRA 5J58A 2GHRA 2QPLA 1U1DA 3IPCA 3JRXA 3AUUA 4YBZA 5CX1A 4ZAXA 2YINC 4YUYA 1I10A 2ILVA 4BVGA 3L8FA 2J31A 3T1HB 1ZA2A 4MV7A 2AVDA 4ZXPA 1VHTA 1W59A 4IHQA 3G2NA 1HRKA 3MTDA 5CLLA 1O5OA 4AJNA 5FBQB 4C6HA 4ZRDA 3AL2A 5EQFA 3CW9A 4PPGA 1DU4A 4HXFB 4E15A 3EQ8A 2OHOA 1JXMA 5B6PA 4N0PA 1CQXA 1K6JA 1ZWKA 2H00A 5B7QA 3VGJA 3EEIA 3DBHB 1MGPA 3ZXYA 2JAQA 1HFKA 5GM1A 4LF4B 3K0CA 3UA4A 5DRYA 1L1RA 3FNBA 4KXFB 2PVSA 2FR8C 1GPLA 1KO4A 2V7GA 4CLOB 2O48X 5G1OA 1SBQA 1T10A 1MIOB 1VCNA 2DKNA 1LVGA 1XU9A 3MWJA 4PG6A 1DEXA 4FHZA 4Q02A 3ZI7A 2XUAA 2DEUA 1ULSA 2F3SA 3AFOA 1QH9A 1PS0A 5B53A 4LX0A 1GKUB 5IK2A 3QU9A 1ID1A 2ZR7A 1F7UA 4IYRA 1T0UA 3TZKA 4EBFA 4BKQA 3ZHZA 1BW9A 1HA3A 3UJ9A 1OWMA 1MJ5A 3UMRA 3VH4A 4WI1A 5DYWA 4IF4A 3RVBA 1ABBA 2R79A 2WY2D 3MQFA 3OZEA 4G4GA 4PLVA 3PQ7A 4L0QA 4Q3CA 2IE8A 1DRKA 1LPOA 2IPNA 3SZRA 4BYMA 4ZYVA 4PNZA 3DHWC 3ILXA 4LZAA 1ADCA 4KDEA 2YW9A 2BEWB 2IUEA 3TW0A 1F2UB 3LKVA 5ILGA 3A6ZA 1NLZA 3MAGA 3UJBA 2LIVA 4S04A 2O4UX 4IVRA 1EUZA 3GFOA 3WNDA 3OH8A 1GPUA 3F6SA 4V0ME 2DQKA 1E4YA 5DM70 2BMWA 2GA9A 3O94A 5AKLA 1FLDA 1LX7A 3R77A 3WLKX 3NH6A 1WCV1 2E0IA 1TMYA 1ZK2A 2FPRA 2HDHA 4D45A 4F84A 3LBFA 2TMKA 3NANA 2ORIA 5IT5A 2NQ8A 2PD4A 5LA6B 3AF5A 4ISBA 1D2RA 2V6MA 3COPA 1L4HA 4TT3D 4KSYA 5EIBD 3ZV6A 3QJ5A 5L4LA 4M9CA 4JLWA 4C22A 2UZ1B 4O29A 1WS6A 4R40A 4RV9A 2FFAA 1RXSA 2EX4A 3F3YA 3G2KA 3GARA 4Q1DA 4HGOA 2C1EA 1VJCA 2KW5A 4I2VA 4QTTB 3VPGA 1KI6A 3FCEA 1E3MA 1TLTA 1WA5A 1U2GA 1HBJA 4K2HA 5FWYB 3WK9A 2J3EA 4FPXA 4CFYA 5C8YF 4FYKA 1E1YA 3EOBI 5FOVA 1NC3A 4B3HA 4DV6B 4DLXA 3UK7A 1CY6A 5B57C 1XPUA 2WUWE 1SAYA 2QQ5A 1U7PA 1F12A 3DMDA 2E9SA 3CLUC 1FW6A 3T41A 1U0NA 3WAKA 2VSYA 3L6BA 2I4LA 4CDGA 4DNPA 4EUNA 3NHKA 4RH3A 1K9VF 5FFMA 2RKWA 3B20A 3BC1A 2AN3A 3QU7A 4AO7A 4BFLA 3KOZA 1YI8A 3D2AA 4KNVA 1G7SA 4DCGA 5C8YB 5I48A 2IQIA 4OUDA 4BLWA 3TIXB 3LSYA 3FOCA 4UXHA 4C4TA 5LD2C 3WQHA 4P3YA 3ZD9A 3A10A 1E0SA 1EK5A 2HCFA 5E9QA 3PGJA 1YD7A 3AR8A 4EGQA 3GLGE 3DO5A 4FYXA 3A6LA 2FZGA 4IO1A 4DN6A 1NULA 3WAGA 4K81B 2LIPA 1D0IA 3I05A 2W2XA 4OL0A 2J3HA 4Q4HB 3RBXA 3ZH9B 3DLHA 2JGRA 3AW8A 4NZOA 2V4MA 4Q01A 5DM4A 1NAIA 3TNYA 2CDAA 3WGTA 2ZB8A 3A4YA 4WXPA 4ZYLA 1NKTA 3BHMA 4ZVRA 4F8YA 3TE7A 5LLTA 3CZRA 5ALKA 3DXFA 4KGZA 2BVNA 3RVOA 1N8TA 3A6PC 1P5HA 2GVNA 2VWHA 1FNDA 2PSSA 4J4TA 2R65A 1CZOA 1KC3A 4L8LA 4KPFC 4IXMA 3SQOA 4Q4DA 5IVHA 5FIUA 1S1CA 3EMDA 3GT0A 4FX2A 4RL4A 4Y6OA 4LBZA 1PHRA 1BXZA 1P6UA 4HFMA 2YVQA 5DXJA 2VQ3A 2WWRA 4RJJA 4YONB 2OOSA 7REQB 4FEGA 5I7SA 5IYZF 5I3ZA 3UOGA 5K3OA 1P45A 4BAGA 5KTMA 1XQ1A 4ND5A 2QE7A 1CE8B 3MG9A 4LV5B 3VM6A 1T8UA 5LU9A 2P9QA 1T5OA 2AN1A 4LHEA 5JZSA 1XO1A 1U2RA 1YVEI 2ZYHA 1OLXB 3N3BC 3PBKA 1XKXA 2AEMA 4XIYA 1AURA 3GYBA 2Q1XA 4FDMA 3EPRA 2QD1A 3QWIA 4KGVA 1ZGCA 3MMPA 3NTXA 4FMDB 2Y05A 3WXBA 2BFEA 3CSUA 4ARSA 1BOOA 1I4WA 4NMXB 1D0VA 5LYYA 3ASZA 1L1EA 4E4RA 1KRHA 5IYZB 1I14A 1L7NA 3PU6A 3RU3A 3SMVA 4TM7A 2AW5A 2LDXA 1X94A 5EEGA 2CD7A 3H5RA 3W6OA 1Y7TA 2HJSA 4OP1A 5AKEA 3RRZA 2UVPA 1OMOA 2GK6A 4JUIA 3WMRA 7GPBA 4PIMA 3NYWA 3E7PA 1H42A 3VPFA 4B3IA 1E4EA 3O0DA 1YFKA 3K4HA 3MOGA 4X90A 2OO5A 2JI6A 5IU6A 3V6LA 2DB3A 1MH9A 1EIWA 1GL3A 1WL8A 4GH5A 2OGUA 4H3HB 1Z74A 4F93B 5AOVA 3AKZA 1JSRA 3MN1A 5C4MA 2QSUA 3JWIA 1P7ZA 3HEMA 4NRDA 2NG1A 3B5EA 5F64A 1HX7A 4NS1A 2ZAOA 1XD2A 4P7KA 3PLNA 4PAOA 4LXIA 1WEKA 4AP5A 2V3WA 1Z8FA 3DKKA 2XWBF 5HIKA 1DQNA 1MX5A 3B89A 4HX2A 1MTZA 2GPBA 3GN1A 4Y2XA 2IV7A 4NP6A 1XQ9A 3BK2A 3FETA 3O38A 5LDDC 2ZTVA 1CHDA 4Q4CA 4AP9A 3IEXA 3ND7A 4DMRA 3G2HA 3I52A 1A9SA 1N3IA 1ZH6A 3GNTA 3NATA 4B2YA 1MB0A 1UFOA 1FRNA 1HL3A 3GJ0A 5DN9A 1KE1A 2WF8A 3KEGA 2OPHA 3T3IA 1EHCA 4B7ZA 5CDSA 4KKVA 4Q6BA 3CW2A 5JRDS 3LECA 2PT5A 4RZHA 1C29B 1RJDA 1O6FA 4IQ0A 3TKYA 2ZPTX 2AZTA 4NXMB 1EFLA 2IYRA 4MVJF 1CUEA 1RMYA 4CR8A 1XXLA 2BZGA 1WRBA 4GX0A 3VR6H 2GUGA 2ZUBA 3I2KA 4O33A 1CP3A 4XUCA 3SR0A 3QX9A 1J6UA 2E3JA 3DF9A 4UNIA 3WKAA 3N7UA 1ZI9A 1KP3A 4QULA 2QRUA 1NUAA 2Y68A 4JJ4A 5JWHA 5TMDA 4YUVA 2FSHA 4OFWA 2B1GA 4MUGA 4DREA 4OQXA 4MW2A 2QB5A 4FDAA 5J1TB 5LPNA 1FS4A 1MP0A 2XNDA 1OBCA 2YVUA 2DM6A 3SSNA 2XJ9A 3EARA 3MIZA 2G7ZA 4OSEA 4R7ZA 4DIKA 2YYAA 4FB4A 3VHQA 4BQPA 2O57A 5K03A 3UHJA 2ISCA 1USWA 4MRVA 4JV5B 2WF6A 5FOQA 4G65A 1A7AA 2AZ4A 1I1HA 1ESCA 3QXCA 4MW0A 4PPFA 1MB2A 1T6BY 5I5GA 4B31A 2REXB 3RFTA 1YVUA 1TRHA 2V6IA 3GZNB 2HKIA 2BRUA 4OI4A 1CR0A 1TF5A 4LQLA 4YDHB 5BQ5A 3SSAA 3TQHA 1THGA 3MYYA 4RTPA 1H2XA 4OSOA 3LC7O 1PVOA 4RUKA 4BFVA 1TE2A 1IHPA 1W4CA 3C98A 5DASA 5IAGA 2OYRA 2J5QA 1XDGA 1W49A 3F49S 1KC1A 2YUIA 3EZYA 4X94A 2EF1A 5JRJA 1M0TA 5CG2A 1H3EA 3PHGA 2J4FA 2AOUB 3RC7A 1XBTA 3QU2A 2ZJ2A 2WKRA 3UJPA 3ZBPA 2D3WA 3Q6NA 1OA1A 4R2LA 5TQ0B 1Z2EA 3BMCB 2IOYA 5EXTA 2R1VB 1YBVA 3VMMA 3DAYA 2E4VA 4QDOA 4AJPA 1FJ2A 4IM7A 5CCBA 5K20A 1OWOA 4OQPA 2DOKA 4GLJA 4OO3A 2HXSA 1NXQA 4UZSA 5H81A 4HEQA 1P0IA 5SZJA 3ZHUA 4F72A 3RKSA 2O6HA 2UUOA 4FINA 4HF7A 5JTUA 4CETA 5IKMA 1CRZA 1XJQA 2R87A 4RDHA 5L7WA 1P81A 2CDRA 5HQ3A 2G71A 3KQWA 3WLIA 3VXKA 3O5AA 1KFBB 4S1NA 1F2DA 2C0QA 4EEXA 2NXEA 2KWIA 1OOEA 3IR7A 2O3UA 5DWVA 4LRTB 1IOLA 1ECFA 4RX1A 1VLZA 3JYQA 5E3JA 1A72A 2ERYA 4WTOA 4PZAA 1E99A 1LSUA 1NWHA 4M83A 1N3BA 5L4NA 3E9DA 4ZAYA 1BMFA 3TSOA 5TLSA 1HG1A 4GEKA 5HMLA 3PZBA 5D1HA 3Q0IA 1U4OA 2C20A 5FAKA 1T9HA 1OT5A 2NX2A 2HJHA 3CVYA 1DC8A 4HSGA 2GKOA 4LRQA 1LUAA 1X92A 1XN4A 1C50A 2JGDB 3EZNA 4IIUA 4WXHA 1UC8A 1T0BA 1BVYF 3IJRA 4I8IA 4MAAA 4K9DA 2ZIFA 2X5NA 4UDYX 2XY4A 3M82A 3GG2A 3FFBA 1TX4B 2BEUB 4NXNB 2GK3A 2WIFA 4A03A 3GLSA 5KTSA 2E6KA 1KK1A 3E1GA 1Z37A 4LF8B 4ESHA 3I9MA 3K0FB 5LXTB 4LS3A 4UD2A 4OHYA 2ZUTA 1PGQA 5G4KB 4K28A 3O2SB 3KJXA 2EX1A 2RBKA 4WLEA 4CNBA 2Z08A 1XCGB 3U0VA 1CR6A 1RWQA 3R6TA 4CKEA 2EQBA 1Y6GA 3GQBB 4YRPA 3T3OA 5FV7A 1Q92A 4PRKA 4IO0A 4OQ4A 3SBDA 4WCFB 1KHHA 1A97A 1A9YA 1GEGA 2GN6A 3AM1A 1L4EA 3C39A 1NF3A 4HO1X 4LHSA 4XTCS 1IC6A 2JDIA 3O2QB 5G0SA 3B2NA 1MQ9A 3KKLA 1ELOA 1WXGA 1ZJJA 2D06A 1YRHA 2HA2A 4LJ9A 2ZTUA 4NV1A 3TZ6A 1Z45A