4OMUA

Crystal structure of shikimate dehydrogenase (aroe) from pseudomonas putida
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
274
structure length
274
Chain Sequence
MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQGSGGNVTVPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVNAGVELAGKRILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFDELGPVVASGFAWLQEPVDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGKEPTPFCQWATKLGAAKVLDGLGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQLARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Shikimate dehydrogenase
publication title Crystal structure of shikimate dehydrogenase (AroE) from Pseudomonas putida
rcsb
source organism Pseudomonas putida
total genus 99
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4omuA02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 4omuA01
1VL0A 4BNMA 2C5EA 1LLQA 4YA6A 3EGOA 1RJWA 4RDIA 5J23A 2O2YA 2E37A 5COBA 2VYVD 4KZPA 1P9LA 4PG6A 2JHGA 1ZBQA 4BQRA 4CR8A 5U1PA 1E6EA 2IYOA 3JYQA 4RLHA 2BFOA 3DB2A 4R9SA 4YACA 1ULSA 4YB8A 4OKIA 5KJCA 3P7MA 2HU2A 2Y1GA 5L45A 3ROKA 4FFMA 4AJEA 2QRKA 3EZLA 4KP7A 4TRJA 4UUNA 2I9PA 3RU7A 1E5LA 1P1RA 2W2LA 4ND4A 3UW3A 2VCYA 3PLRA 1Q2XA 1DO8A 3D3WB 1UJMA 3IKVA 3WIEA 3ZWMA 3RUDA 1C0PA 3HWRA 4E5PA 3D0OA 3TZQA 1EZ4A 4NJOA 1A71A 3KLMX 1MLDA 3I9LA 2V6BA 1KC3A 4B4OA 3RFXA 1IUKA 3GDGA 1NQTA 1XU7A 2DQ4A 1DDOA 4CM4B 1E7WA 3PJFA 5KVVA 1R15A 3PHJA 2VHYA 2IZ0A 2O3QA 4BO4A 2Y0DA 5C7IO 2CUKA 1HE3A 3DO5A 2CZCA 1NR1A 3JD4A 5IZCA 4YXFA 3D4NA 4GWGA 2VYND 3HUDA 1ADFA 1DSSG 3KEQA 3RFTA 3ST7A 2GZ1A 1E1KA 1GZ3A 2PKQO 4RPKA 3QY9A 4J2HA 2BGKA 1H9AA 4J4BA 2IYPA 1X0XA 2EERA 2ZTVA 3WS7A 2X5KO 3WGOA 1NQ5A 5JXWA 1U4OA 2BFMA 4AJ2A 2YFHA 2ZB7A 1XIVA 3L4BC 1PGJA 4FFPA 1BSVA 1ONPA 2YY7A 3QVOA 4MO2A 4OOFA 4BKUA 1PS8A 3CMCO 4BO0A 1I30A 4BB5A 1PR9A 3NDJA 4WLOA 5BT9A 1X13A 3IC5A 5BSHA 1MGOA 5TT0A 5BNIA 1Q7CA 3NEPX 4I5GA 2BMAA 1GQYA 5L95A 4BV8A 2VN8A 1D3AA 3GGPA 1E0DA 4BNZA 3WJ7A 5HS6A 4WNIA 3EHEA 2Q1WA 3GNSA 1OBFO 3RASA 4FS3A 3DXFA 1DRVA 4GI2A 4TSKA 3RC1A 4AJJA 4B3JA 3R3SA 1SOVA 5EL0A 3IAHA 3WJAA 1T4BA 2B4TO 2VHVA 2ZYDA 5B37A 1N9GB 4NFSA 5ICSA 2I99A 2RCYA 1NVMB 5CPBA 4A26A 3CZMA 3DAGA 3PXXA 4WPGA 4XX0A 3ZU5A 4CJXA 4R51A 3BMNB 2B5VA 4EJMA 4GMFA 1HTBA 4BNJA 1PZGA 2UV8A 3ETEA 3LT2A 3M2TA 4N5NA 3VPSA 3WMXA 1H6DA 3C3XA 1MC4A 2YV2A 4TRRA 1V6AA 4JK3A 5B1YA 1EUDA 3H5RA 4EGFA 5IN4A 1NASA 5LDHA 4BO1A 1PJBA 1YB4A 3AY7A 3RUFA 5BSEA 5IDWA 2Q49A 1ADCA 4J1TA 3UF0A 1PQWA 2FPGA 2GUGA 4DIFA 4Z0TA 2BRUA 5EPOA 4XEHA 3WQRA 3G49A 3JD2A 3BMOA 3OIGA 4IZIA 2Y1EA 3V1UA 2GR9A 4TQGA 1HYHA 1ISIA 2YZ7A 4DWVA 1FMCA 4OM8A 3I6IA 4Y6RA 1S7CA 9LDTA 2GYYA 4DMLA 3BTSA 3PP8A 4CM8B 3I9MA 3AI3A 1ADGA 4YR9A 1Y8QA 1WNTA 4CQMB 4RPHA 2AW5A 3TNLA 4GPD1 1IYZA 5THKA 5TF4A 4GL4A 3WICA 5A9SA 4PVDA 1L7DA 3E82A 1E3IA 1DXYA 1PGPA 3T7EA 1E77A 3DHYA 1VSVA 2C7GA 3C85A 5TC4A 5EQFA 1C0IA 1O0SA 2WE7A 3DMTA 4MVJH 2WJPA 1XKQA 4KQWA 5JAQA 3HG7A 2DBRA 4E5MA 4FC7A 1K6XA 2EF1A 2ZB4A 5EINA 4E13A 1AXEA 5IG2A 2D2IA 1DFHA 5ER6A 4BKRA 2VWPA 2G5CA 4AVYA 3LT0A 4CLDA 1ZEMA 3EC7A 1UDBA 4G81A 3C1TA 5TNXA 2H5LA 3DZIA 2P2SA 2X6TA 3NJ8A 4WASA 3GK3A 3NDRA 4GGPA 3TDKA 1ISJA 2H6EA 3G3EA 3E6AA 4YDRA 3JQ9A 4BO6A 2GN9A 1X15A 1B3BA 3HJAA 3QE3A 1YGYA 4O5OA 1MXFA 5F3RA 2E4AA 2Z1MA 3D3WA 1I33A 2X1HA 3WGZA 1HZJA 2ZTLA 3GG9A 5F5NA 1FK8A 4MP3A 1UXIA 4WCFB 1NM5A 1R4NB 3JV7A 2W2KB 4FFNA 4CUZA 1LSJA 1X1TA 1RM4A 4JROA 1E7QA 3NUGA 2X86A 4ONEA 5IN5A 4RVFA 3RUEA 4RZHA 3SVTA 4QX6A 2Z95A 4D3FA 4UUPA 2VWGA 4DLBA 3TFOA 3X2FA 1HDGO 4FSHA 3M1AA 1PJSA 5H83A 3HB4X 1HSOA 1Y6JA 2WYWA 3WGYA 1LI4A 4YEDA 1R4MB 4LMRA 3KSZO 3ZNOA 3HFSA 3AFMA 1XELA 1ULUA 3GGGA 2ET6A 4XRGA 3GGOA 2EJVA 2GZ2A 3HFGA 4GSLA 2Y1DA 4GX0A 5KCZA 3GVXA 2D8AA 3F5SA 4PLFA 1NR7A 2O4UX 2VT2A 2Y68A 4FN4A 2E49A 1LRLA 1RM5A 1VJ0A 3KHUA 3MTGA 3W4IA 4CLEA 2P5YA 3JQFA 2Q45A 3GPIA 1GQ2A 1CRWG 4IXWA 1U5CA 4H16A 3AOGA 4U6SA 4PG8A 4F45A 4IM7A 1OMOA 3MJ4A 3BMQB 2IEDA 1NX6A 3RUHA 5FI5A 5KVSA 3DZBA 3GEMA 4MDHA 1ADBA 1LSSA 2UUOA 4CLXA 2UAGA 1V3VA 1N9GA 1HDXA 2I76A 5A9RA 4AFNA 4QO7A 1ENOA 1BVUA 2P9EA 3E8XA 4WOJA 3BMNA 4PG5A 1R0LA 4FCCA 3AI1A 4W7HA 5T64A 2JD1A 4XYLA 1TI7A 4YAJA 3PPIA 1EFKA 2WTBA 5G0UA 3DFZA 4NMHA 4AJKA 4LSMA 1XGKA 1OFGA 2FR1A 2VOEA 4Y67A 1J5PA 2GRAA 3RC2A 3SX2A 1DRUA 5L4LA 4D3SA 3ZHZA 3H8VA 4M8SA 2PV7A 4BNXA 4YJFB 4XQCA 2DKNA 4BKOA 4D41A 3EYWA 3PWZA 4RPLA 4ZJUA 3GY0A 3K5PA 1O95A 3PIDA 5IZ4A 2VNSA 1KBZA 2B83A 2VUUA 1UP7A 3NTQA 3P2OA 4IIVA 3BHMA 5I9LA 2OL4A 4XDYA 1P77A 4CM9D 4BO8A 4XQ9A 1Q0LA 4CM8A 3SEFA 1XWFA 2FN7A 1DHRA 2HK7A 3RKUA 3KSUA 1ZUD1 4CQMA 3V8BA 1SMKA 3ASUA 4I08A 3DHEA 1BXZA 1OC4A 4Q3DA 3WR5A 4Y6PA 3O26A 4XJTA 3ETGA 3VVCA 2P9CA 3RWBA 2VRCA 1H94A 3WGGA 4II3A 2J3HA 5KVCA 1KVUA 4EBFA 1J6UA 2QZ9A 2YQ4A 4B7XA 4ZQFA 4DLAA 3CPSA 2VWHA 1LC0A 1P1IA 2Q3EA 2X7HA 2YFQA 4IXTA 4IPTA 4JJIA 1E6WA 1OI7A 1IHYA 1ZIDA 3TRIA 1ZSYA 1C1DB 2YYYA 4JQCA 2XXJA 3HN2A 5L3ZA 3I52A 1YBVA 3AFNA 3GH3A 4UREA 3WNQA 1LC3A 5DP2A 2JAHA 3LT1A 3BXXA 5DT9A 1Y9EA 3R0IA 1P33A 1PTJA 4FD3A 4BKQA 2G17A 1I36A 2B5WA 1XDWA 1WDMA 1QP8A 2NTVA 1K5HA 4TZKA 4IDEA 5HS4A 1QORA 4D0SA 1BTOA 4RQUA 3HZZA 2Y67A 2FY8A 4WCFA 5I7VA 1R4NA 2OFPA 3KYDB 3ICPA 2W2KA 3NV9A 2DAPA 3WGTA 1KC1A 3ZWOA 1GDHA 4BNKA 1AXGA 4DBVO 4BMSA 1E1NA 3K30A 3D5QA 4R54A 2P91A 3RUAA 4AJ4A 4PVCA 4IDDA 1VM6A 5L7TA 5JO9A 3WIDA 1QR6A 4XGIA 4CMBA 4DYVA 1GZ6A 4RF5A 1EE9A 4CLHA 3B1JA 2BKAA 1C0KA 4FFRA 3AM4A 3GG2A 1IZ9A 3Q2IA 4J43A 4UULA 4R01A 1A9YA 2W2LD 3RC9A 3NDIA 1KVRA 2ZB8A 3OP4A 5JDIC 1DLJA 2BGLA 2V7PA 2DUUA 1LBEA 2FSVA 4NU5A 3GF4A 3RFVA 4IS3A 1ZKMA 4I5FA 5ENVA 3F47A 3FCOA 3GVIA 4RORA 3N58A 3ZWNA 2ZIZA 3HQ4O 1YDWA 2NU7A 1M6WA 1YJQA 4LMPA 4IMRA 1I01A 1Z7BA 1ENZA 3PRJA 1ZXBA 4HWKA 4IQ0A 1Z7EA 1SC6A 1UR5A 2J5KA 2Y1OA 2V65A 3BMQA 5L4NA 1CQIA 4CPDA 5JY1A 3V5NA 4OXYA 3PZBA 5MGBA 3DZFA 2Y1FA 5T57A 3LDHA 5H81A 5C3MA 4L75A 3JYOA 2A9FA 4RPJA 1GEEA 4M89A 2RIRA 3ANLA 1QYVA 2HMVA 4ESOA 2GGSA 3IKTA 4KTVE 2QQ5A 3PQFA 2AE2A 4KWHA 1JKIA 1HDOA 3VDQA 4BO7A 1C1XB 5F1KA 5A9TA 2Q4BA 3OMLA 1NP3A 2CDBA 5AXCA 2GF2A 4KDFA 4I5EA 3DAFA 5T8KA 1YH3A 1E3LA 1HE4A 1KOLA 4YJFA 3JQ6A 3RC7A 1K0UA 1NBOA 3OH8A 1PJ2A 4LVCA 4P38A 4RV9A 1WMBA 2BFAA 2X8LA 4EZBA 1U7HA 1EK6A 1WXDA 3HDJA 4IDGA 3NTOA 4PGFA 2O3UA 4FOOA 2XF8A 4OXKA 4C7KA 1XSEA 5DP1A 4BNFA 1EFLA 4RPGA 3S2IA 4WEOA 1GZ4A 1G0OA 1H2BA 3CH6A 3RQSA 2CNBA 3LQFA 4ZICA 2G76A 5FI3A 1PSDA 1D1TA 5JPIA 5DZSA 1D1SA 3F1KA 4FQ8A 3TJRA 1ZVMA 3GHYA 5FFFA 4B7UA 3DBHB 1OZAA 3GFBA 3NGLA 3H9EO 3GVHA 1X7HA 4UVHA 2JCYA 2XOXA 1DFGA 4DBZA 5C5IA 1WDKA 3O4RA 4O0LA 4C7JA 3JD0A 4MVJF 1OAAA 2WSBA 3U3XA 2HMSA 3DZHA 1LA2A 3MZ0A 4NFHA 4XB1A 1FDSA 2O50A 1F8FA 4O59O 4Z0PA 1GD1O 3S2EA 4PRLA 4KQXA 2QW8A 3DBLB 3PHIA 1O6ZA 3QLJA 3I23A 1V3UA 1O9BA 1CWUA 4JXKA 5EESA 4UAGA 2C20A 1CEQA 3C24A 4FPXA 2OBNA 2PZLA 4N5MA 3CKYA 1FJHA 3JQGB 4BOYA 2JD0A 4TMFA 1MFPA 5CEJA 5CG2A 4E30A 4BO9A 3OJLA 1C1DA 3WTBA 2CMDA 1E7MA 2EJWA 2CF5A 1YB5A 4RF4A 3I4CA 4BNWA 3HB5X 4MVJM 2VHZA 3D4OA 3OBBA 3CUKA 5TLSA 2RBEA 4D45A 4S1VA 2BD0A 4CMEC 2FSSA 4GQAA 4JBGA 3KUXA 4DQXA 5IDQA 4OOEA 3ASVA 3FR8A 4CM1A 2QIOA 1ZFNA 3OJOA 5CDTA 3KYDA 4B4UA 1DC5A 3AU9A 4ALKA 4MVJE 3UICA 8ADHA 3RBZA 5A4DA 5HM8A 1E3WA 3ZW9A 4GX2A 3U4DA 2Z5LA 3FSRA 3G0OA 1ML3A 2A4KA 1M2WA 5ICMA 4BNTA 4J49A 4ALMA 1GYPA 4EYEA 2P4HX 2X0JA 2DTEA 4B7CA 3AWDA 3JYPA 3V2HA 3OEYA 4ZN6A 2PGDA 3R3JA 5JDCC 3STHA 3LYLA 1NQAO 2VOJA 2ZYGA 3AJRA 3ITKA 4CM6A 4KWIA 1U7TA 2Q2WA 1PX0A 3CTMA 1CYDA 1ZO8A 2JFFA 5A05A 4L76A 4P8RA 1U3WA 3GAZA 1H2HA 3TWOA 1MA0A 2P68A 1AE1A 1DEHA 2O3SA 1V3TA 2E82A 3GZNB 2AEFA 3UAGA 4U0KA 5DDIP 1QV7A 1M75A 3GN1A 3H65A 4YJGB 1HE5A 3UGKA 4HADA 1RWBA 3LK7A 4LCEA 4JIGA 3RU9A 2IDZA 3ZWBA 1NHWA 2OOSA 1GU7A 2DT5A 1PQUA 3PFWO 3L4BA 3U09A 2IEBA 3QWIA 3FWZA 3OIDA 3SXPA 3DOOA 4A27A 1U8FO 2G82A 1W6UA 4W9NC 3I6QA 2HJRA 3DWFA 2ZCVA 4GKVA 3OA0A 4IDAA 4DL9A 4BO5A 4NDNE 2C82A 1LLCA 4WGGA 2Y99A 1P0FA 3VZRA 3IJRA 1TVEA 2NU6A 3WGQA 5C37A 3FBGA 1YDEA 5ES3A 3PGXA 2UYYA 3IS3A 3ZN2A 3IIEA 1G0NA 4ND2A 3O8QB 4HUJA 1O94A 1T2DA 3ZU2A 4HNHA 5KJ1A 5FEUA 3KYCB 3JQAD 3TPCA 1E3EA 1N92A 5JYDA 2X0NA 3PJGA 4TZTA 5H82A 3U5TA 3L9WA 3G79A 1LDNA 3ZV3A 4NPCA 5HTOA 4JJGA 4D46A 3GR6A 4NIMA 1FDUA 1B15A 2FP4A 3H5AA 1O5IA 2R2GA 4XIYA 4N5LA 5A06A 4OKNA 4FFOA 4MVJD 2OBYA 1HT0A 3AU8A 3L6OO 1A7KA 4A73A 1EBUA 1G1AA 2HCTA 5JFOA 1I5RA 4Q9NA 1M76A 3BMCA 2J5QA 4ZQHA 3RUIA 4O6VA 4PG7A 1PJ3A 3E9NA 4IGEA 5TJ9A 4FFLA 5JC1A 1DC4A 4UVGA 1UZNA 2FOIA 4HNGA 1KY5A 1NTOA 4TRNA 2ZATA 3K2BA 3ADPA 4J7UA 1EUCA 3DBHA 1LLUA 3OA2A 1F8GA 3QWAA 4OXNA 1D7OA 2VQ3A 2WWRA 4RCVA 5FF9A 1QRRA 3ZWCA 3QVWA 1IZ0A 1RPNA 1VJTA 3CEAA 2VWQA 2GLXA 1PJLA 3ORFA 2EG9A 1HETA 2D0IA 3UCFA 1AGNA 1A4IA 1Q7BA 1NAIA 2Q1TA 2Y0CA 2AG5A 4E5KA 5AXDA 3GZ4A 3PYLA 2EGGA 3ZDFA 5IF3A 5L7YA 1EVJA 3WSVA 5IXSA 3DBLA 1ZJZA 3W6ZA 1Q0QA 3GEDA 4H7PA 1AHHA 4Y9DA 1CF2O 3VDRA 1R6DA 1YO6A 3JQGA 4L4SA 4B8WA 4PLGA 4Z3KA 4LRTB 1ISGA 1LDBA 1SEVA 1U28A 3N74A 4XYEA 4ID9A 5BQFA 2YV3A 3ZH2A 4QQRA 2GASA 1MG5A 4PLVA 1ZK2A 2EW2A 4LVUA 1H0KA 2EKLA 4J7XA 7ADHA 1ONNA 1KETA 3CINA 2V6GA 4PLHA 1DPGA 1GQQA 3A28A 3AW9A 3F6YA 3LVFO 1MG0A 3PVZA 4PLCA 1F17A 1YJ8A 4R69A 1GY8A 2DVMA 3Q9NA 1HRDA 5T5QA 1R0SA 1I2CA 5KNLA 2NSDA 1LDEA 5IDXA 3WXBA 4E31A 1UXGA 3TQHA 1VPDA 4XGKA 4XZ3A 4JX8A 5JO0A 2EIHA 3M1LA 1P1FA 1R0KA 2DBVO 2X0RA 2JFHA 1E92A 2XPCA 4XGNA 1K6JA 4YQYA 1M67A 4L4RA 1B14A 4NH4A 2A92A 2FPPA 3Q11A 3ONEA 2O4CA 3ICCA 2BH9A 3OJEA 5IFLA 4WLUA 3MEQA 2NQTA 1VL6A 2DPGA 4BO3A 3QRWA 2B37A 3OHSX 4NZ9A 1WP4A 2ZQZA 1YRLA 2A35A 5U4QA 2WM3A 4WOKA 4D44A 3PZRA 3DR3A 1YONA 2CVZA 2D5CA 3G17A 3NGXA 3S2FA 1S6YA 3VH1A 1E1LA 4XYGA 1LNQA 1IHXA 5KWEA 2VHWA 5A3VA 4EUEA 1DBVO 2O2SA 1Y9AA 4M55A 3FPLA 3MJTA 5CPFA 4Z9XA 3GN2A 3KVOA 3Q1LA 3QWHA 4PLWA 2GN8A 2YJZA 4S3MA 4PCVA 5AXAA 1SEPA 1Y7TA 2W98A 3HADA 2I5PO 1HDCA 3CMMA 3KEOA 4ROSA 4YRBA 3OSUA 3GZNA 5GY7A 4JGBA 4YJGA 1E6UA 4I5DA 4MINA 5KVQA 2ZCUA 2I66A 3GUCA 2XAAA 1YL6A 2VTDA 3M2PA 2R00C 1ZZEA 1VLLA 1MX3A 5TT1A 4J3FA 3OQ6A 1XYGA 1LU9A 4YAEA 2DU8A 1KIFA 5HBRA 1XU9A 3DZGA 3T7CA 5F5LA 4E12A 5MDHA 3WBFA 1IPFA 3C7AA 3FHLA 1UXJA 2YHUA 1F06A 2H1SA 2WE8A 3PK0A 1JVSA 1GPDG 2VNAA 3R6DA 4YT2A 3PIIA 3K96A 1QMGA 4OMUA 4YAKA 2PFGA 4QTZA 4WUVA 1Q7GA 4CL3A 5CAEA 2BFPA 3RBXA 5CG1A 1MB4A 5JAZA 3BHJA 3O8QA 2OMEA 3VZQA 5KTKA 4ZQEA 1X0VA 3U4HA 5TRTA 2JJYA 6LDHA 3LU1A 1DIBA 3INTA 3KYCA 1K2WA 5DNAA 4RJTA 1HF3A 4XR9A 5JS6A 1PEDA 3B70A 2QRJA 4W99A 4DQVA 1ORRA 4HFNA 4CMGA 1ZXLA 2FMUA 3PGJA 4CM4A 1I24A 1ZMTA 1YQGA 1BVRA 1MV8A 4PZDA 7MDHA 5K6AC 1ISFA 4ND1A 3ZI0A 1PL6A 2O7QA 3HN7A 1QLHA 1U1IA 4BNUA 4AG3A 1E1MA 4DLLA 1PL7A 4BHTA 3VPHA 5TQVA 1L1FA 5EERA 3WG9A 2VYVA 3A1NA 4YCAA 4E21A 1WWKA 4WLVA 1M6HA 1OC2A 4JP3A 4YRAA 2DBQA 4K6CA 3O03A 4GVXA 4XA8A 3RIHA 3PEFA 5JMWA 3TOXA 1FDVA 2FR0A 3M6IA 1NFRA 1YL7A 2HSDA 2DC1A 2I65A 3VTFA 3VH4A 2I6TA 4E33A 1C0LA 4L4XA 1R66A 1PJQA 2YV1A 1N1EA 1H9BA 1MC5A 3SJ7A 3X2EA 3GRPA 1PJ4A 4J90A 4R3WA 2WD7B 3HDHA 4B8ZA 4DUPA 1YOVB 5G0WA 4CV2A 1BDMA 3PQDA 1E7YA 2NWQA 2B0JA 1Y5MA 1TT5B 4QUKA 1ZK0A 1G6KA 3EVTA 2BHLA 5LC1A 1Y81A 1GADO 3FBTA 3E5RA 4DGSA 3QW2A 3OFSA 4DREA 1WDLA 4IQGA 5T6BA 1E7SA 1T2CA 1OOEA 1EEHA 2W8ZA 4UVEA 4CV0A 3DQPA 2B35A 3QVXA 2DFDA 4MP8A 2DTXA 5C7OO 2AXQA 3ZWAA 3VH3A 1H6BA 4NJMB 3NTRA 1D8AA 3BTUA 2VYNA 1EVYA 4OJNA 4GAEA 3VKUA 4Z6KA 1UZLA 4YAGA 2O3JA 1K89A 3KV3O 1C3VA 5G2OA 2HMUA 2AEJA 1B8VA 2B4QA 1JWAB 1VE9A 3AM3A 3MCVA 3B1KA 1MFZA 4CMIB 1GFSA 1YQDA 2AG8A 3ADOA 4ZRMA 4CUKA 2Q46A 3WFJA 2O48X 3S8MA 3NX4A 4JJFA 2O7SA 4BNHA 4AJNA 3GNTA 3E9QA 4CQLB 1EUZA 2Q99A 4Z3DA 5U9CA 3E48A 3BA1A 2DUWA 4W6ZA 2JCXA 1BMDA 3B20A 4Q39A 2TMDA 4FW8A 3WFIA 3VOSA 4XIJA 3ONDA 3Q9UA 3RJ5A 4P4GA 1EDZA 1BXGB 1LQUA 3DBVO 4XB2A 3DZJA 3KOUA 2NVUB 4HP8A 4N18A 3UVEA 4LK3A 3D64A 3PLNA 4J1NA 4W7IA 4L8VA 1J4AA 4ND5A 1XR3A 4ZGWA 1T24A 3ONFA 1ZJYA 1PR3A 2D3TA 1CERA 3AUAA 4FJ1A 2X23A 3NYWA 3PYXA 4I8XA 4LISA 5L7WA 3CE6A 4Y8VA 4FOSA 2PD3A 3T4EA 4PFJA 4RZIA 1A5ZA 3W8FA 5KJ6A 5JDIA 2NADA 2NTNA 2HQ1A 1JQBA 1KERA 5G4KB 3TL2A 4UUOA 2NQ8A 2J3KA 4Z0HO 4BNIA 4R1TA 3H3FA 1FDWA 2WDZA 4WCDA 2YDYA 4BNYA 4XCVA 3JTMA 4AJHA 5JSFA 3W6UA 1K6IA 4Y98A 4TROA 3L6EA 3OIFA 1P31A 3AI2A 2QYTA 3PFFA 4GVLA 4E2WA 4LCJA 3HSKA 3WNVA 1KVQA 5ILOA 5KJEA 3SLKA 3E9MA 4D43A 4EITA 1V8BA 2JL1A 3EW7A 3LC7O 3MOGA 4K6FA 2I67A 4K1LA 2GO1A 1Y1PA 1H93A 4MKZA 1I10A 2X0IA 3LF1A 3DAPA 1T4DA 2QZZA 4O63O 5A5FA 3FF4A 1XQ1A 2RHRA 3WQSB 4WJZA 5AYVA 1BDBA 5G0VA 2JFGA 1GL3A 4BV9A 3DBRB 3ON5A 4MKXA 4G2NA 5A04A 3Q2KA 3VC7A 4G5HA 1ZK3A 2Y66A 3TL3A 2PWZA 3R1IA 4J91A 1AUPA 4XYBA 2ILTA 2B69A 3GHHA 3GAFA 1NNUA 3ANMA 1I2ZA 1T1RA 3KRTA 3VZSA 5JBIA 3WX0A 3L77A 3ROQA 3H3JA 1R4MA 1ZMOA 1Z75A 1N7GA 1N1GA 3TN7A 3A4VA 4HFJA 4QFDA 1CJCA 1V35A 4KTTE 3JQEA 1JU9A 3MJSA 5I7EA 3DTTA 4AJLA 5B4UA 1YQXA 5L53A 3H9QA 1U5AA 1FF9A 4UVDA 4YJDA 2NU8A 3KBOA 4B3IA 4E2YA 3IUPA 4J1QA 5COQA 3VPFA 2QG4A 5EQDA 3UN1A 1U2GA 5IAAA 4DPLA 3GFGA 3CZRA 4IJKA 4J0FA 1ARZA 5I8ZA 5I8WA 1BRMA 4K9DA 4GLLA 1HLDA 4NBVA 1T26A 2G0TA 3WWZA 1Q0HA 4R1SA 1M66A 3MJCA 4QXMA 3AK4A 4C4OA 5JNLA 2WD7A 5F1OA 1YOVA 4FJ0A 4PLZA 4XD2A 1DHTA 1PZFA 3INRA 1KY4A 5AVOA 5JW6A 2F1KA 3LLSA 5JE8A 3AOEC 1LX6A 5COAA 1X14A 4IMPA 4RF2A 1H6AA 4OYRA 4CR7A 1Y8RB 4FGSA 3NKLA 1EMDA 1LTHR 4YQZA 2G1UA 4DRYA 1KEVA 3PWKA 1ZNQO 5EJ2A 5DBFA 1JA9A 3S55A 1UP6A 1PZHA 4YAIA 1P74A 4IBOA 4UEKA 4K26A 1TA4A 4QSMA 1I8TA 2PK3A 4AL4A 3HDQA 3HHPA 5JMPA 3I4FA 2B4RO 3ENNA 3WTCA 3IL2A 4N54A 3TFQA 2DPHA 1GAEO 4MVJI 3U4CA 3TZHA 5CDYA 1RM0A 4NR0A 2RHCA 4NI5A 4M86A 3ZNQA 4E5NA 1HSZA 4R5HA 3UCEA 5FYDA 4MVJG 1YBAA 4AICA 4ZA2A 4CMIA 3ZHBA 3FWNA 2DFVA 1CIVA 3GT0A 4CMEA 3DOJA 2J3JA 4OQYA 2C54A 4JNKA 4DQUA 3RUCA 1WPQA 4CQLA 2PKRA 2GN4A 3V1YA 3A06A 2NLOA 5GMOA 3D5TA 2AA3A 2IRWA 2PD4A 3AM5A 1EBFA 4IDFA 1RYEA 1T2FA 4MJLA 3ZU3A 3ROPA 4FDAA 4LN1A 3TZCA 4E4YA 1A4UA 2J3IA 1HL3A 1VC2A 1VKOA 2HUNA 3UOGA 4L0QA 4IDBA 2B36A 4F6CA 3DEYX 1JLLA 1HZZA 3LLVA 4NFYA 3D3EA 4YVFA 1KVTA 3EUWA 3WSWA 1U3VA 3VPGA 3FTNA 3QVSA 3BHIA 2VUTA 4NNJA 1JKJA 5JDCA 5ITWA 1D4FA 5DBIA 1U8XX 5THQA 2HJSA 4WLNA 1IY8A 2HMWA 3AUUA 3OICA 3QA9A 4J1SA 3ZV5A 5ADHA 2CD9A 3KYBA 3DONA 1E7RA 1JDJA 1K3TA 1EK5A 3LT4A 5KKCA 5G4KA 1DC3A 1IB6A 4I9HA 5KKAA 1YXMA 1IL0A 3COSA 1MXHA 3INGA 3H9GA 4BS9A 3KB6A 2TMGA 4FB5A 1U3TA 2JHFA 2BELA 2GNAA 1ZK4A 1J0XO 3F1LA 4UUMA 4R16A 1VRWA 1DB3A 2VZ8A 5B4VA 1UZMA 3L0DA 1P44A 1PS9A 4IS2A 4DPKA 4OIMA 5HWSA 3QWFA 4Q3BA 4W9NA 4DC0A 4HFRA 2VZ9A 4BGUA 1DOHA 4ND3A 4CM9A 3UFXA 1Y5RA 2X9GA 1PWXA 4ITUA 5JLAA 4LW8A 2JAPA 1V9LA 2J5RA 3H7AA 4P4NA 4KUGA 1QKIA 3JYLA 2IODA 4L9RA 4IUYA 3RCBA 4Z9YA 1NWHA 4LSWA 2Y93A 3IP1A 3DBRA 2X9NA 1E3JA 3BTOA 2OGUA 1WLYA 2CDCA 2BI7A 1BW9B 3FNFA 2HK9A 4OO3A 1HXHA 2CF6A 3BZUA 2H9IA 3E5MA 5TX7A 3FNGA 2C5AA 3P2YA 1N2SA 3WLEA 4URFA 2IZZA 1YS4A 3FRJA 4J6FA 3K73O 4UEJA 4CMKA 1ISMA 1W4ZA 4WKGA 2PD6A 3WYBA 2IE0A 4E32A 2X22A 4D79A 3NT5A 5F1PA 1GCOA 4NU6A 2IXAA 4YWJA 3W8EA 4IY1A 3FN4A 1RM3A 4LRSB 4Q3EA 4U0JA 1U4SA 4BNGA 2FWMX 5A03A 4TWRA 2X9VA 1B8PA 3AUSA 1LRKA 1NWCA 3WB9A 5ENDA 1MP0A 3ZV4A 3ZW8A 3I9NA 2P5UA 5CP8A 2Q2VA 2EKQA 3A14A 4DVJA 4XKJA 1JAXA 3FTPA 5CEEA 1PZEA 4NG5A 3CSDA 2I3GA 2PKQP 4R41A 4CV3A 1Y8RA 2IXBA 2NU9A 4KUEA 3ULKA 3IJPA 3WGHA 2XXBA 3GOHA 4XYMA 3GNQA 2RH4A 1SCUA 3WOHA 4J9VA 1SPXA 1PGOA 1P1JA 5G0SA 3H5NA 2VT3A 4TVOA 2C2YA 4L73A 3TOZA 2GZ3A 4HV4A 1C1XA 1QLJA 1QYXA 4QT0A 2ZTUA 2YW9A 2E6UX 1W73A 3JQBC 3LC1O 3QP9A 4PIVA 4DPMA 1SB9A 3W4JA 1JVBA 1BGVA 2OUIA 4PZCA 4E6PA 2PZJA 5CEFA 1VL8A 4ZQBA 2NTJA 3EY4A 4AJIA 2CY0A 4CODB 3DC2A 5TJHA 4W82A 3F46A 2EGHA 4RVDA 3U4IA 3AY6A 4D42A 4MP6A 1Z45A 3EAGA 5BNFA 1TLTA 1F12A 5DOZA 2Q2QA 4NK4A 4NK5A 4GBJA 4WK6A 3F4BA 4U7WA 3UHAA 5FWNA 5TGDA 4WLEA 4R1UA 1E3SA 1B3RA 4GLOA 5CDGA 2GSDA 2HRZA 4ALNA 4X54A 3PDUA 1TT7A 1TB4A 1LEHA 3H2SA 4PG4A 3RI3A 2FR8A 5TIIA 3D4PA 5DN9A 2PY6A 1PU2A 3JYNA 4QEDA 3L9XA 4MIOA 4GKBA 3S2GA 4JBHA 4KOAA 1JN0A 3GA0A 5CHEA 2QRLA 2VTEA 2GN6A 1QYDA 4BNNA 1GUZA 2GCGA 3QV1A 4TRMA 2R6JA 4BMNA 4K28A 5DULA 3JQAB 3IQDB 2VZ0A 4GMGA 4BGIA 4PZEA 2YHIB 1T1SA 3G1UA 3GC6A 3PYMA 2BI8A 1VJ1A 3IP3A 1C14A 1FDTA 3L07A 2YUTA 3S1LA 2CVOA 4DTIA 1LQTA 1V0JA 2AHRA 4MOWA 1UAGA 2F00A 3KO8A 4WLFA 3I9KA 2R00A 3JD1A 1KYQA 2P4QA 3K9QO 3U0BA 4CQMD 2RH8A 4J4HA 4ZRNA 3U62A 3GPDG 1YVEI 2C0CA 1QYWA 2EKPA 2X58A 3PHGA 3MOIA 2FZWA 1GTMA 1WMAA 3FR7A 3GDOA 3NAQA 1H6CA 2OP0A 3OETA 1GYQA 2YDXA 3WMWA 4IJVA 1Z82A 3FPCA 1XQ6A 1E5QA 3OQBA 4R5MA 4TKMA 3PI7A 4FC6A 2VRCD 3SJUA 1XLTA 1ZH8A 2RAFA 1I0ZA 1CDOA 1YE3A 1HYEA 3CIFA 5JCJA 2PLAA 1YL5A 3LC2O 1ZCJA 4H3VA 4BL5A 4CMCA 3PTZA 3UKOA 1YBMA 5IZCC 2NACA 3G1TA 4RF3A 3VAZA 3DDNA 1BW9A 1Z6ZA 1B0AA 3QHAA 3IOYA 4TVBA 3WYEA 5T67A 4NBRA 2CSUA 2WYVA 5K6AA 1NVGA 2D5AA 3VTZA 3IDSA 3KLPX 2WD8A 3SBOA 3QJ5A 2EHDA 1GYRA 4OSOA 4YPOA 4W4TA 4WEQA 1Q1NA 3JQ7B 3NRCA 4CLOB 5ER9A 1SBYA 3DZKA 5C7LO 2SCUA 1A7AA 1PS0A 2O23A 4RVSA 3U49A 2IZ1A 3K2EA 3AUTA 4J2OA 4DIOA 4IQ8A 2ZJ0A 1KS9A 1DIHA 1R16A 2Q1UA 1DC6A 2O3RA 5BSFA 3ABIA 3HNPA 5G4LA 2DBZA 1NFQA 1P3DA 5ILGA 3K92A 2EWMA 2PA3A 2C59A 4AJ1A 4EW6A 4JP2A 1LDYA 1WZEA 1R12A 4GX1A 4D7AA 8LDHA 3RVDA 4OQZA 3KETA 4HXYA 3ZHXA 1J49A 2FHSA 4YRDA 3C7CB 4EUHA 2CVQA 2ZJ1A 4U6QA 5L40A 3ZNNA 2ZB3A 1QV6A 3O9ZA 4XJSA 3C8MA 5I9MA 4A0SA 2J6IA 3E18A 3MJEA 1PIWA 4Q3CA 2AEMA 3DHNA 3ZWPA 4QO8A 1WVGA 4JBIA 1SNYA 3RBVA 4BQPA 4U5QA 4J9UE 3PQEA 2AMFA 1NPYA 2WEKA 2V6FA 4IINA 3ZHYA 2PH3A 1SB8A 4YT5A 4A7PA 1NVTA 5JAIA 1KEUA 1ZEJA 3W4KA 1BHSA 1P1KA 1DRWA 2C7VA 4WE3A 4YJHB 4R68A 3H6KA 4BB6A 1UXHA 2AQKA 4MKRA 3KTDA 1IPEA 2DM6A 4KUHA 1SAYA 3KSDO 5KOIA 3W8DA 4P4LA 4IIUA 2PZKA 4MVJP 2Y1CA 4UEOA 3Q6IA 1XG5A 3BTVA 5K0ZA 2Z1NA 4JLWA 1UDCA 3GLQA 5A3JA 2FZEA 2VRBA 5A02A 3I1JA 5DF1A 5EIOA 3A9WA 1QSGA 3GDFA 4MPDA 4CM5A 2X4GA 4E2ZA 3IMFA 4I9UA 3L4SO 3T4XA 1XCBA 4P22A 1YB1A 1I32A 1VI2A 1WZIA 3DMTC 4UVIA 3GRKA 2WMDA 3ZWWA 1LDMA 1NHGA 4AJOA 3ITDA 4ZHSA 4XRRA 4Q3NA 3B1FA 1HE2A 3GEGA 4PLTA 2OO5A 4M54A 1EVIA 2EEZA 3VZPA 1NPTO 5I9NA 1SOWA 3JQAA 1ISHA 4KMSA 1EVZA 1ZSNA 1X7GA 5ITVA 1HKUA 3H4VA 2YHIA 4R4JA 4B4WA 1LUAA 3H9UA 5G0TA 4BIIA 3DTYA 2NVBA 4HBGA 4PLYA 3TZ6A 4HY3A 4BO2A 3I9JA 3JQ9C 3I83A 2OZPA 3NJ4A 4MVJA 4B3HA 5HRUA 5CDSA 4CV1A 4BGVA 1GEGA 4GX5A 3Q0EA 4CLRB 5A1TA 2NM0A 4FJ2A 3VKVA 3W1VA 1JKFA 3WDSA 1LRJA 4E2XA 2I3AA 1JW9B 4OH1A 1ZK1A 3SC6A 1DIGA 3MWEB 1EQUA 2V6MA 1CETA 3EVNA 3SLGA 1B2LA 3Q3CA 4CMJA 1XEAA 1BG6A 5L4SA 1X7DA 2EV9A 5L9AA 1B8UA 1WAMA 1GUYA 3LZ6A 4RO0A 4ZU3A 4BGEA 5EMHA 4R1NA 1DLIA 3TZKA 4DXHA 4EJ6A 4F46A 5KJFA 4RQTA 4NBTA 3V2UA 4YBZA 2GD1O 2D59A 3K6JA 1ONOA 1ID1A 1LSUA 4QECA 4ALLA 4BUCA 3MJVA 4CM7A 1SZJG 1A27A 1FXSA 4B79A 3WLFA 5JY6A 2ZQYA 3PDJA 3L6DA 2NNLD 3JQ7A 4CLOA 9LDBA 1QG6A 4FIZA 1HDZA 4MIYA 1ENYA 4NQZA 4A03A 3P5SA 2AE1A 1I3NA 1U9JA 1PGNA 4AJPA 3EK2A 3VHRA 1AHIA 3ENKA 2GDZA 1B16A 1YWGO 3GUYA 4GH5A 5IJZA 3WWYA 2HMTA 1I2BA 1GV1A 2O3TA 3NT2A 2HLPA 1T2AA 4BNVA 4HFMA 2CFCA 3JQFC 5GZ1A 5JC8A 5I7FA 4J0EA 4RLSA 4BMVA 4Z9FA 2EP5A 1R37A 2QHXA 3FNEA 4NHEA 3DOCA 3QWBA 5DCUA 1X1EA 3FD8A 3UXYA 4EEXA 2ZK7A 5CDUA 3AY3A 1NXQA 1Z73A 2OP1A 4RGBA 4CR6A 4CUJA 1F14A 2Q50A 4B4VA 3VPXA 3ANNA 1LDGA 4DIBA 1GV0A 3WBBA 1IOLA 1UXKA 1I3MA 3AOEA 1VKNA 3EZYA 4ALIA 3B6ZA 1KEPA 2OORA 2NVWA 2W90A 1H5QA 4XQEA 3JD3A 1W8DA 2JCVA 4XR4A 2PGJA 1A9ZA 1T2EA 2AQIA 3H2ZA 4OGWA 1BXKA 2PNFA 1DAPA 4BNLA 2PTGA 2HDHA 1JWBB 5KIAA 4BVAA 1UP4A 4EUFA 3PHLA 5B12A 5K9ZA 3JQCA 4CMHA 1EDOA 4NBUA 4YJHA 1DJNA 4EI2A 3E03A 1RYDA 2X5JO 3OQ1A 4GGOA 2HKIA 2D4AA 1T25A 3EDMA 5A5EA 4FR5A 1LSOA 5IDYA 1XA0A 2HAEA 3V1TC 2H63A 4ZD6A 1JTVA 3FI9A 4R9RA 5IXYA 1NFFA 3UH1A 1E3WB 4DMMA 5DCYA 3DL2A 4FBGA 5BNTA 4I9NA 2J8ZA 3ZWXA 1GCUA 1DJQA 5DCWA 1P0CA 2NUAA 1AN9A 3V2GA 1GR0A 5LCXA 1DIAA 3RD5A 1EQ2A 3FNHA 3HDYA 3OEWA 2WYUA 1N8KA 2HO5A 3QVTA 5TSDA 1I3LA 4I1IA 4EJ0A 3WGIA 4FGWA 3JQ8B 3E1KA 4J4TA 4M87A 4ILKA 2D1YA 3K31A 4CM3A 4EDFA 1TT5A 3C1OA 5F21A 3PJDA 1F0YA 4E0BA 4CL8A 2ZYAA 5B4TA 5TS3A 3N7UA 1GPJA 4J7CA 1QXSA 3ZV6A 1P45A 4E5YA 4IZHA 1SO8A 2PGLA 3U9LA 3NT4A 4F3YA 3ZWYA 1XHLA 2A94A 4LGVA 1I3KA 3F5QA 2PZMA 4WNCA 1CQJA 2BLLA 4NJMA 4CLRA 1O89A 3PHHA 3F9IA 4INAA 1A72A 3RROA 3QSGA 3VH2A 3ZCXA 1PWZA 3HE3A 3WYCA 2HRBA 4YT4A 2FRDA 2JD2A 4HX5A 2GERA 3OF2A 1TEHA 3QIVA 4CMAA 4TKLA 2AQHA 4WCFC 3UUWA 3ZGYA 3RKRA 4H15A 4N7RA 2W4QA 1B26A 3EMKA 1GUFA 2LDBA 2C2XA 1QYCA 1IULA 4HKTA 3TSCA 4J16A 3GMDA 3ZZNA 1DIRA 2C29D 2FPIA 4M1QA 4D0RA 4DYDA 1U2DA 2DLDA 1HYGA 3JQDA 4KDEA 3ETDA 4OL9A 3H9JA 4A2CA 3VVBA 3KZVA 1HDYA 1BXGA 4JN6B 4PLPA 3F3SA 4NBWA 2Q1SA 4A5OA 3TF5A 5JYEA 3RJ9A 4PN3A 2EP7A 2NVUA 1W0CA 1KVSA 3GVCA 3BMCB 2GPTA 2NV6A 1IE3A 1HWYA 1PJTA 1PGQA 3ZWVA 3DFUA 5BSGA 4RVHA 1EE2A 2LDXA 2C07A 3OJ0A 5JCXA 1YKFA 2E48A 3ZU4A 4EEZA 3SC4A 3C1AA 5AOVA 2POQX 4E3ZA 3CXRA 4IGFA 4M49A 3JCZA 5JCJD 1ZW1A 2YQ5A 1BWSA 3JSAA 1LLDA 1UH5A 1VSUA 5LDGA 4II2A 1JAYA 2JKVA 1PL8A 2VUSA 4RVGA 4A10A 4YT8A 1MUUA 1KEWA 1LJ8A 2BGMA 1N7HA 3PWSA 1PQPA 2QYSA 3BIOA 4OHUA 3RAJA 2UVDA 3ZNPA 4RDHA 1ZSVA 1DFIA 3BAZA 2OXIA 4G65A 4WECA 4ZQGA 2UUPA 5CFZA 5JAMA 1TXGA 3I9OA 1HDRA 5DOVA 1B7GO 1WW8A 5AQ1A 3IUSA 3O38A 2OHXA 2UDPA 4OSPA 4BKPA 3K8ZA 1P1HA 4Q3AA 2PH5A 3ROMA 2DTDA 2Y05A 3OM9A 4XDZA 5T8KC 3DMYA 4IJUA 3LSYA 4JCOA 2AQ8A 1Z74A 4QFCA 4IJWA 1NAHA 3UCXA 5L51A 1O8CA 4O1MA 5AXBA 4DA9A 1PJCA 1RKXA 4D3DA 3MWDB 1NQOA 1N5DA 3F4LA 4RVUA 3WQQA 3I5MA 3OECA 2CDAA 6ADHA 3GMSA 3JQBA 4GWKA 1L7EA 3C7DB 2ZKLA 4ALJA 4IDCA 3BMOB 3QQPA 1NYTA 4Y6SA 5EN4A 2PR2A 3MTJA 3GVPA 3GQVA 4OAQA 3BYZA 4XQGA 3RSHA 3OJFA 5GZ3A 1UUFA 2HK8A 1HLPA 3I3OA 2Q4EA 2X5OA 2VHXA 4R3NA 1UDAA 3PJEA 5DBGA 3P19A 5BR7A 2BF7A 4F6LA 3D7LA 5I7SA 1DAOA 3LF2A 1UAYA 4L74A 3D1LA 1Y8QB 2P9GA 4PRKA 4YYZA 4GSKA 3KXDA 4ZVVA 3KM0A 5GZ6A 2EW8A 1NPDA 4XWYA 1HEUA 4DC1A 5A9SB 4RL6A 2EXXA 4YTEA 1U3UA 1LXCA 2Y0EA 2ZTMA 5HA5A 3JQ8A 4U8GA 4MIEA 2QX7A 1ENPA
chains in the Genus database with same CATH superfamily
5EWJA 1AB6A 4RHFA 4U2KA 4EKIA 2ESRA 3FB1A 3DJYA 1ZOOA 1PI3A 4YA6A 6REQA 2HWXA 1MJGM 2QPOA 2SNIE 3W7VA 1XPJA 2O2YA 3IE0A 4GE3A 4LI3X 1DWQA 1TZCA 2V55B 1EGMB 1V2GA 1T13A 1ZBQA 3HJGA 5ALZA 1O5TA 3ZDYB 4AWAA 4CR8A 1Z5VA 1G16A 5U1PA 3LBYA 3VOAA 2ZUUA 3LPMA 1V1RB 4LBYA 4EKEA 2OEPA 4R9SA 1KH3A 4OK6A 1N6HA 4YACA 3OX2A 1ULSA 4ZI7A 1L8XA 4YB8A 4OMDA 4OKIA 2ZJZA 3CO0S 1QIEA 2BFDB 2Y1GA 3NDPA 1KSHA 1XAHA 4HB0A 4L4ZA 4HDRA 3DVAB 3UPTA 1K4MA 2PXHA 2JBWA 2RHMA 3RARA 1YDGA 1JR4A 3ZW7A 4YBRA 1NUUA 1C1YA 1EK1A 1P8AA 2COEA 4HVTA 3V7YA 2NNWB 4JWKA 2CNWD 4LMAA 2OB2A 1KNXA 3I09A 4BBPA 1HYQA 2W6ZA 2BHRA 4MUNA 1YRAA 3UV6A 4I99A 3ZWMA 3VC3A 3WLSA 2L2QA 3DEAA 3R7AA 3RUDA 1C0PA 3HWRA 4E5PA 4WIAA 1EZ4A 4NJOA 1MLDA 1EINA 2ZREA 1CUWA 1ZRSA 3A1DA 4YALA 4QRDA 1AZLA 4R0NA 1KC3A 2CL0X 3FFWA 3FLEA 3HYNA 1GRNA 1QO7A 1P62B 3LUPA 4EFKA 1HOXA 1NQTA 1CUJA 4TV9A 2VDMB 4LQDA 1SA0A 3PJFA 5B55A 4B43A 5AVWA 4N76A 2GK6A 2FPSA 3GJYA 2A88A 1A8IA 3TM5A 5KYNA 2CUKA 3GGCA 1T9CA 3DCIA 5C2JB 4LWOA 3EFBA 1BN7A 1QDLB 4GWGA 4K88A 1RBZA 1DBWA 4LOLA 2VYND 4NXNB 1ADFA 1NX9A 4S04A 1DSSG 3LKDA 4WK4B 4JVNA 1D2GA 4H6VA 4P93A 5EXTA 3RFTA 3ST7A 4IHJA 1E1KA 1QHIA 2PKQO 3B12A 1CDZA 3DT9A 3W4JA 4CCAA 5CITA 1TA0A 2PWPA 3DLPX 4G56A 1CLUA 3DE1X 4JLPA 4J4BA 3WS7A 1X0XA 2EERA 2ZI3A 1QCCA 2ZTVA 5JMOA 3NDBB 1VQ1A 1U4OA 1D9XA 5B7GA 4GL2A 4B2IA 4AJ2A 1IY2A 4ISBA 3L4BC 5CYGA 1D2MA 2COKA 2GD0A 2IHYA 3QY0A 4JU8A 4H4EA 3QXHA 1VG9B 1KRWA 4C4XA 1PS8A 1Y8ZA 3CMCO 1I30A 3R5JA 2PBLA 3NDJA 2OR3A 3TD2A 2G5GX 2J7PA 1FTSA 5F7JA 3RVBA 2LGJA 4D9KA 5BSHA 1PV4A 3B3JA 5A6VA 4I5GA 4ZVUA 2BMAA 1GQYA 1GSHA 4BV8A 4YMLA 1G9SA 4M0KA 3GGPA 3UGJA 1VKHA 1WMDA 3WJ7A 5HS6A 4IMJB 3GNSA 1PZNA 3QE4A 2L42A 3SXUA 4LUCA 5CT8A 2QV0A 4TSKA 4PSVA 2XOKD 1FSZA 3R3SA 5EL0A 4URWR 1AKRA 3WJAA 1T4BA 3QYAA 1T8WA 2ZYDA 3FYUC 1LVHA 4KKVA 5EUQB 5B37A 4YPVA 5FV4A 3CBGA 3I0MA 4B83A 5ICSA 4JBLA 1UJCA 3BEDA 2I99A 4KOEC 1KL7A 1NVMB 4PYQA 2CXRA 4QRHA 3HB0A 4EHLA 3GMTA 1DV1A 1Z07A 2ZDGA 2UV8A 5EG5A 3AVTA 1C81A 4HDOB 4N9WA 3VPSA 3CRNA 3PQ7A 2C97A 4ENSA 4OHWA 2CLIB 2HF2A 4B6SA 4B6GA 1GPWB 2YV2A 1V6AA 2PN1A 4JK3A 2Q7DA 3LZDA 1BNCA 4K87A 4IUCS 5BWOA 3MWDA 1NASA 4OFXA 2YWRA 4UXHA 2P35A 1YB4A 3AY7A 4OKSA 3KE9A 2NVOA 4BO1A 2XITA 2D1QA 4YLYA 2GUGA 3SYNA 4DG9A 4Z0TA 2WKSA 3RTGA 1T2UA 5IJ9A 1GLGA 4N0PA 4OGGA 2D54A 3V1UA 1Z5NA 3FOZA 2Q3DA 4TMYA 3BCSA 3NOXA 3WLMA 1ISIA 5BXQC 3EXHA 1BEUB 4D3ZA 4MMXB 1RRGA 1WZNA 2HDOA 2XY4A 4Y6RA 2X76A 1ID8A 2GYYA 1M34E 1ZOIA 3PEWA 5H02A 4WESB 3AI3A 4CM8B 1VPEA 4AMYA 3BRWD 4JELA 4YR9A 1WNTA 2G6BA 3DBIA 2C4VA 3EEFA 4AB1A 4F4HA 3HXPA 3ZWQA 1QH9A 3M6UA 1IYZA 2OGZA 5IJ0A 4GL4A 5ITZA 3IOMA 3JWEA 2HXGA 5KYWA 3P2KA 1D0SA 4NLLA 2CMFA 3WOVA 4EJ2A 2NT4A 2K7ZA 1RYBA 1WBBA 2C7GA 4IUBS 4UUBA 1ZGHA 1VDZA 2CBZA 3QBTA 3PQ8A 4R2IA 3Q15C 1O0SA 2WE7A 1GL9B 1YI1A 3ZTWA 1AB5A 3AVXA 3N59A 4NOMA 2CLHB 1O6BA 3G9TA 4E5MA 1LZLA 1QH8A 3IUEA 1ZKDA 4A0FA 4DCUA 5IK2D 5EINA 4NCIA 2FFJA 3QMPA 1AC5A 1DFHA 3R5FA 5ER6A 4XIGS 5REQA 2G0AA 3AB8A 3TW4A 2VWPA 4BKRA 2G5CA 4AVYA 2XBLA 1YR8A 4Y2GA 4XUGB 3RVRA 4CLDA 1IG0A 3EC7A 4KBGA 5JSHA 3I1IA 1R5JA 3PVSA 1VL1A 3DDCA 4NFLA 4A2PA 2MYNA 2VYCA 2VDVE 4G81A 5TNXA 4JEMA 1RQXA 2H5LA 5C1PA 2QSZA 3HKCA 1VZ3A 4DG5A 4YMVA 1CQWA 3F6BX 1W85B 1D2HA 3D9QX 3GK3A 3W2HA 1IPHA 4GRDA 1ISJA 1M74A 3KALA 4L16A 5LP6C 3OOJA 1TE2A 2CFTA 3NHZA 4BWVA 1X1BA 3C6QA 3PUJA 4Y6QA 4UEWA 1NBME 4J3JA 3GROA 3FSEA 1X15A 2QRMA 1Z5PA 2FF5A 1ZNYA 4O2AF 3VO2A 4O5OA 2A3NA 4DUGA 1PK8A 1Z6AA 1GFWA 2D7CA 2FN8A 2RI0A 3HCFA 3WNDA 1ISSA 4LJ4A 5KPDA 1VL2A 1X2EA 3L5KA 3QOFA 1FVHA 1FK8A 2IIPA 1EFVB 1NM5A 4LOHA 2HYDA 4AX8A 3VHXB 4FFNA 3SZLA 2ZSDA 1LSJA 2AFRA 3P20A 4WN9A 2E85A 4JROA 2WUEA 2X86A 1Z2CA 4RVFA 4YPFA 5IN5A 4RZHA 3K9FC 3LQ4A 2YC2C 3FMIA 2F9LA 2VWGA 1HGXA 2YXLA 3OLZA 4L07A 4AX4A 2WNHA 4Y1GA 1Z4QA 1RAEA 3BZWA 2O06A 3O8DA 3NYRA 4KR0A 5H83A 5EMKA 1HSOA 2JARA 1X7ZA 2YN0A 1NDHA 1D1PA 2P2DA 2X1VA 4WXPA 4YRKA 1BH6A 1R4MB 2JAXA 2CVHA 4MRMA 2C8VA 3I01M 4DUZB 3KKPA 1YVDA 3O4VA 1KDYA 5BVGA 1PE0A 2WTMA 4KG7A 1FA9A 3EXG2 4MRNA 1PNTA 4OAPA 4DA7A 3GGOA 2BUBA 1ACJA 2O0LA 3BUSA 5ICEA 3DZCA 3G9XA 5BWMA 1AY0A 1QE5A 1Z83A 2FEAA 3LYHA 3OEHD 4IIJA 4MV9A 3NXKA 4NQRA 4R2XA 4XW2A 3T3HA 3VR5H 4BE4A 1N0IA 2GKSA 3QKSA 3UUGA 1L5FA 1OHHA 1AUQA 1G7TA 2PT5A 1JR2A 2PUFA 1ZH6A 3BKWA 4KXQA 2Y68A 1XZEA 1VLZA 1XTBA 4S24A 3NTLA 1VJ0A 5E7QA 3RIYA 2AMLA 1L8AA 5FHRA 1PDVA 4ZEOA 1GPKA 4MLDA 2NU7B 2PO7A 1E8DA 5FA5A 2KQUA 2PUJA 3R0XA 1U5CA 4KXNA 1JDPA 4NULA 1V7QA 4QUHA 5HF9A 1I4WA 2XTAA 1IN5A 2BFBA 3BMQB 1NX6A 3EGCA 3CLTD 1Y7PA 3P5BA 5KVSA 3GEMA 3LHSA 4N5HX 4WDRA 1FX0A 4IDPA 3GP8A 1ADBA 1LSSA 1G1MA 2VXYA 3FDXA 2UUOA 1EU1A 4BVJA 1WQ3A 4CLXA 3MRSA 4OXQA 2QN8A 1PNQA 1ENOA 1FOEB 1OXMA 3SXJA 3T3EA 2P9EA 2WZQA 4A1FA 3T52A 3E8XA 3BJEA 3FDIA 3BMNA 3NR2A 2ZR9A 1NBMD 1R0LA 3DNPA 4GP7A 1NYRA 4WOJA 5EE9A 4F9GA 3KT6A 4KFCA 2WTBA 3QLUC 3QFFA 4W5TA 4IUDS 2I55A 4AJKA 2C3UA 1NLMA 1XGKA 1S9HA 1GO2A 4NP6A 521PA 2FR1A 3JVEA 3BFKA 4WKBA 3ABQB 3BL5A 2PLNA 3L3BA 1A0OA 3L8DA 3RC2A 3SX2A 2I7XA 5JXHA 2X13A 3X1KA 3H8VA 4D3SA 4WKNA 4PC6A 3FCCA 4F56A 3T5TA 4B7AA 5AVXA 4XDGA 4YJFB 4XQCA 1O95A 5DRYA 5A3QA 2VNSA 1KBZA 1YIDA 2VUUA 1L5SA 1QQ7A 2I3ZA 1TGYA 5K3OA 3RS0A 4F86A 3E35A 4GM0A 3VR2A 1EBBA 2N0SA 3A1EA 2JIBA 3MUNA 4LYGA 1PYOA 3MIIA 4JP1A 3I42A 3MUOA 2AXEA 1AGXA 2QS9A 4NZMA 4XDYA 3KAJA 5LB2A 3T54A 4HN4B 3BILA 5AUPB 2ZXUA 3GL9A 2E4ZA 4LPSA 3LWNA 4MYTA 1WXWA 1BN6A 4QAQA 1E4OA 5E1MA 1UCFA 2NSLA 3SEFA 3D8BA 2HK7A 1DHRA 3BH0A 3C87A 5HUHA 2XXAB 1RJEA 2N1BA 3WGMA 2AG6A 2C2BA 1SMKA 1VBFA 3AJDA 4O2BF 4I08A 5BN3B 1FNSA 3DCNA 1JIIA 4KO4S 4GMDA 4XJXA 1BMFA 5KS2A 3K2IA 4LJAA 2FLKA 2Q5OA 4JC0A 4KK4A 4LHZA 2VPYA 2JAOA 4ND7A 4DCMA 2BUCA 4XJTA 3VVCA 1AMUA 3CJQA 3DAYA 2RK6A 1R27A 5J1TB 3RWBA 2VJAA 3BSSA 3K9NA 1VYHA 3NWOA 1YUBA 3OC0A 5SY9A 4JYAB 1W4CA 3NHMA 3WGGA 3ZHRA 1EFTA 3CYFA 4TM7A 5TS2A 3QLTA 1JUDA 2JA2A 4M36A 3MMZA 4HTFB 4EGSA 1KYXA 3CR7A 3QF4B 3KT3A 3HR4A 4MRPA 5FLKA 2QZ9A 4EBFA 1SKMA 1V8PA 4PIMA 3V8MA 3CPSA 3GT3A 1ZUIA 2QMZA 1I5OA 1P1IA 4TTPA 2X7HA 5ICFA 5JALA 1WETA 4QPZA 1HMPA 1IHYA 1TZJA 1ZIDA 4FOLA 3TRIA 1R8QA 4IZ6A 4RH0A 1YNOA 2GPBA 5L3ZA 4N6OA 1B73A 3I52A 3AFNA 4U1RA 2X0EA 5LD2C 2VEDA 5DP2A 2JAHA 1KSJA 1FNBA 4FHGA 4ACAA 1Y9JA 1TJPB 5DT9A 1P33A 1Z15A 2WMYA 2HA6A 1O6FA 3L7AA 4UTXA 3E84A 4CFZA 1FUKA 2IHBA 2RGNC 4HYEA 4LC0A 4TOIA 1WDMA 2KWIA 3UFXB 2BFEA 1NY6A 3AV3A 3I2HA 3VR4H 3UKDA 4BZPA 1RMQA 1QORA 4XM0A 2PMDA 4RQUA 2HGZA 4PZZA 2Q27A 2QGZA 2WSMA 3IIJA 1JQ3A 3KYDB 4IIGA 4P33A 1IHDA 2WHRA 1CQPA 2A1IA 3DLTA 3H87A 1XRNA 3NV9A 4P2GA 4HWGA 5LMCA 1KC1A 2MINB 3FUCA 4GPZA 4TPKA 4ZOLF 3GLKA 3QU7A 3IDFA 2OPBA 4HLDA 1TCAA 2JKYA 5K0CA 3TL6A 4KPGA 1Y4ZA 2H2AA 3PT9A 4OHXA 4ZZ3A 1PYGA 4M8NE 4L8LA 4DIMA 4IDDA 3TNYA 3J7AC 5L7TA 5MGNA 4S1WA 2QR2A 3N0WA 1ZMXA 2DP4E 3DVQX 4ZT2A 4C6SA 4E1BA 5AM3A 8GPBA 5EIWA 3QEMB 4YAUA 5KQSA 4JQOA 4RSGA 3G0HA 3C3AA 5EA2A 2G71A 4RF5A 3B1JA 2BKAA 5E1DA 2P6RA 4FFRA 2JJ2D 4J29A 3V8QA 4MS4B 1FX1A 2V0CA 5DM2A 4G1EB 4IJMA 5C8YF 2A84A 2G63A 2W2QA 3CCCA 3WLRA 4ENUA 2QBYB 4R01A 1A9YA 2ZE6A 2JJ1A 2PUEA 2IXDA 3LQKA 3A7EA 2WPDA 4Q7LA 3NDIA 2A9QA 4ZCIA 4UM9B 4REOA 2JFVA 3R7WB 2BGLA 2V7PA 2E5FA 2WIFA 3EWIA 4JAVC 3DT8A 3GLUA 4X94A 3SCZA 5CURA 3GF4A 2H92A 2QLNA 5K3EA 1V8DA 1NE7A 1QFZA 2Y2VA 3MB8A 1ZKMA 2GCEA 3O2JA 3O73A 1OGJA 4WZBA 2FUG1 1SXJE 4P5DA 5GVSA 5MF6A 2HSWA 3FCOA 1A8HA 2GQ0A 5IDVA 1SD5A 4E14A 3OM1A 2BI4A 2JGDA 2ZIZA 3KVNA 3JZFA 4ON9A 2FF7A 4LMPA 3TI9A 5CB4B 5EPEA 5EQJB 5F23A 1XVAA 1X77A 1ZRMA 4YYEA 4L0DA 1TUBA 3MXTA 4JP8A 2C7PA 2C00A 5IVIA 1NVBA 5L4NA 3QF7A 2K87A 4X61A 3CPEA 3V5NA 4UDOA 2FH5B 2NU6B 5MGBA 4PQRA 1ODLA 3DT6A 4N01A 5T57A 1SG9A 3PR2B 3WKAA 1N8TA 2FSPA 3KVRA 3JYOA 4V3BA 2XE8A 4CTOA 1H2AS 4PO8A 1BO6A 2K5UA 2FX3A 2FKNA 2HMVA 2TSYB 1X86B 4ESOA 3IKTA 2OXFA 1P4HA 1SUEA 2C77A 4XWYA 1IQ0A 3G5AA 1NBWB 2IEIA 3MCAA 4LYHA 3LGAA 4X6YA 1XRRA 4TT3A 4XOUA 4B3CA 4LAFA 5SZKB 2FSGA 4GU5A 4OGKA 5AXCA 2G4VA 4PQGA 4ARBA 5KYXB 4KDFA 4I5EA 2YV5A 2FP4B 4JHLA 3N76A 4LE1A 1C7EA 5D87A 5T8KA 1U7WA 3C3DA 4NKRA 1JBQA 4P38A 4QE3A 5F64A 2C3OA 4DR5B 1FFWA 3HKEB 4QQNA 5HFJA 3P26A 2K2QB 1MABB 1JFTA 3FTFA 2DHDA 1BDJA 4DXHA 1DT5A 2XJ9A 3NTOA 2SKEA 5LSAA 4HMPA 2OAGA 2V5AA 1YMVA 2O3UA 2XF8A 4FOOA 4IRUB 1Z6TA 1XSEA 1NI4A 1U8UA 5DP1A 4RPGA 4BNFA 3IMKA 3TG2A 4JA0A 3ZK9A 4WEOA 3E0XA 2WU3A 1V39A 1YJ5A 1BYUA 1RZVA 3RLFA 2A2ZA 4LNHA 1JTFA 2V7GA 3UBMA 4UE3S 4QU9A 3WK7A 4HAVA 2A33A 3AJAA 3AI7A 4FQ8A 4L3VA 5D00A 3RVQA 1Z0IA 2YIDA 4B7UA 1CUXA 2H57A 5EIBD 5EZYB 3NGLA 3H9EO 4JU9A 1SVSA 3H1BA 1CDDA 4G5RA 5AJWA 3EDYA 3SR0A 3T61A 3ZH9B 1P80A 1TTPB 1NOJA 1Y4UA 4KQJA 1NNEA 2C4HA 3S70A 5DSXA 2X19A 2R4UA 2XOXA 3H1PA 3P9RA 4YXWA 3A4NA 4K6OA 5C5IA 1YA8A 2Q29A 4P0TA 2WJGA 1GNVA 3V9AA 3K9WA 1OAAA 3DZHA 4RXUA 3MZ0A 4V1CB 4QU8A 5E6RB 1FDSA 2VTVA 3TR6A 5C18A 2QRPA 4O59O 6CHYA 1DKOA 2HSEA 1S2DA 4ZHQA 1SXJD 1TFUA 2QJTA 2G40A 2WTEA 2Y4NA 3DBLB 3PHIA 2TRSB 1MDBA 3BB3A 4MS3A 3I23A 4WY8A 1V3UA 5CD9A 2HA4A 2RC5A 5IWAB 4UAGA 2C20A 3T34A 3C24A 3EISA 2AXNA 2IU6A 3G0BA 3VAAA 2OBNA 2IDKA 2X0FA 3O21A 4N5MA 2IOYA 1FJHA 3JQGB 4N0EA 1T0JB 2JLRA 4N40A 1XRJA 1QZ3A 2YWGA 5DGIA 1Q22A 1M0EA 3IDAA 2ADMA 3HKBB 4UBKA 4TYYA 1OD6A 2XV1A 3WTBA 3D43A 1TU3A 3UTCA 4Y2TA 1EAMA 1GCAA 1UPTA 4JY7A 1YB5A 4RKYA 4RF4A 6YASA 3ITNA 2QGNA 2BGRA 4FFBA 4GPAA 2DGDA 3WAKA 3P0IA 2WAAA 3GLFB 1PYDA 3HB5X 4PS1A 4XVQA 3BK1A 2O2EA 2OQIA 1DOAA 1FYWA 4BUZA 5EJEA 3SHQA 4LJSA 3IIKA 3ASVA 3MTDA 4F2PA 5KQPA 4CM1A 1F5SA 2M2IA 3EIQA 1V71A 3FRIA 1ZFNA 3KJXA 4X7MA 1N1DA 3T3PB 2IH4A 3F98A 3LVQE 3MFQA 4KYIB 3H5VA 4R7TA 1HQYE 4ALKA 4D4LA 1RZRA 3DQZA 2G4CA 4MVJE 3R6GA 3SQDA 3RADC 5A4DA 1IBKB 3UJAA 2YWHA 4GX2A 4QQ8A 5AI6A 1UBGA 2K7FA 3G0OA 3G2OA 3R9IA 2R0QC 4WZAA 2DHRA 4K1XA 4YP0A 3CLTC 5JYBA 1H8HD 2FPOA 4PNHA 5HEKA 1ZQ9A 1M2WA 3GRUA 3MCUA 5ICMA 1VIAA 4BNTA 1LI7A 4J49A 4ALMA 5ICGA 1CUZA 5KNDH 2FW7A 2CZQA 3UXEA 3RYIA 1YZUA 3JYPA 2H0RA 5HKKA 1P2BA 5HILA 1AV6A 2WMOB 5JDCC 3STHA 4D6XA 3LYLA 3BJIC 2Q5EA 2W6CX 4JI3B 1N2BA 3N5KA 1SCAA 2VOJA 3S68A 1VHJA 5DASA 4KWIA 4LE2A 1U7TA 2XMZA 3CTMA 3G2LA 1R4ZA 4RJ2A 2JFFA 2QRVB 3BK2A 3QXJA 1UBNA 1U0BB 4P8RA 4QBHA 4V0SA 1DEHA 4OCZA 2O3SA 1L1QA 1UFRA 3GZNB 4U0KA 2YMLA 1LI5A 1QV7A 2QQ0A 1PDWA 4Q12A 2VO1A 2HN9A 3KFXA 4A15A 4LCEA 4V2IA 4JIGA 1JDUA 1NHWA 2VDPB 2OOSA 1Q0PA 3PFWO 4RUKA 2PKWA 2Q5QA 3L4BA 4KYUA 3QWIA 1RRFA 3FWZA 3OMWA 3Q7EA 5J4KA 4KWEA 3LQ2A 4X1YB 4L8FA 2OAP1 1W6UA 1GITA 5DX0A 4U5XA 4W9NC 1BMQA 3QVVA 3SS9X 3DWFA 2F43A 4Q05A 5LZ5A 2LTAA 1JBKA 1K5PA 4RFLA 4IDAA 1SZCA 5DGHA 1M9NA 4K3VA 1LLCA 2Y99A 2PX3A 4OGLA 3HUFA 3IJRA 4P1ZA 5L3SA 3EBOA 3PFIA 1OZGA 4TSFD 3WGQA 3A2KA 3EC1A 1U8YA 5KNBH 3CNHA 4CEHA 1NJ1A 1CR4A 2GM5A 4HB3A 4IWNA 4NMWA 1U1DA 4QWWA 3RVSA 3O8QB 4Y18A 4C0LA 2IHJA 1T2DA 2CXOA 1JS1X 3LWBA 4GKKB 2DWCA 2TYSB 2BGIA 2IW1A 2WT8A 5MFZA 3JQAD 1E3EA 1J97A 4OHZA 5LA6A 4JLKA 4DCPA 3T7RA 2YIVX 3O75A 3HS3A 5EXPA 3IT3A 4D46A 3UMGA 3NOQA 1O5IA 4CGYA 1FTGA 3E4DA 3ER6A 4BLRA 5A06A 3RM3A 5NULA 4GC9A 4MVJD 4DCOA 3B2QA 3ADCA 1MOSA 1A7KA 1YVRA 1UQRA 1G1AA 2BEWB 4U8HA 4EABA 3HTXA 2WOJA 2PSDA 2ZSIA 4Q9NA 3VSAA 4X62B 4ER5A 4TSRA 3LBHA 5F3DA 3BMCA 2J5QA 3HYLA 4BVGA 1BWQA 1XZNA 1PJ3A 4HH0A 5TJ9A 5JC1A 3HU5A 3FTEA 1NMEA 1UZNA 2FOIA 2FWRA 4BU0A 3GUVA 1KEEA 3BGVA 2ZATA 2DFNA 4E1VA 1T9AA 3NRJA 3R5TA 1L3CA 3TW8A 2V96A 4JQSA 4CCYB 1NIPA 2PGNA 2HHCA 4JWTA 2P9FA 4RCVA 3ZLTA 3ZWCA 4MDYA 4DJFC 1U6JA 1X94A 4Q5IA 1SD2A 4DR1B 3FCYA 1T3ZA 4OX9Y 1P81A 2JW5A 2WY2D 1NYLA 3LOQA 3WQHA 1HETA 5J2UA 3TMYA 4DB4A 1IBMB 3EFOA 1RLTA 2Y0CA 4KFUA 2AG5A 2R5WA 5EYPB 1VGRA 2J0QA 3O8NA 1JHVA 5L7YA 2OVBA 3CRZA 3OCVA 2QNRA 4AROA 2DH5A 5I9SA 3OFJA 4LTDA 1RQNA 1USGA 1JG3A 3VTAA 4CI0B 1IEQA 1B6TA 2A9OA 3R77A 2ADOA 3BSFA 1E8MA 3T9CA 2GESA 3BWYA 5JRDS 4PLGA 1I94B 3P2EA 2R7LA 4UOEA 2FEWB 2H4FA 1NW5A 1SCJA 4M1YA 4PQFA 4RX1A 4ASUA 3N74A 3OPQA 3SF0A 4M76B 2ECQA 1ZX1A 1WKCA 3ETCA 5ALGA 4DM3A 1ZK2A 2EW2A 3WLNA 4DMGA 4QKQA 4GUAA 5MN6A 1ONNA 1KETA 2K6GA 3F96A 1W581 4ZT5A 3G5TA 1GQQA 1WOYA 3A28A 4DXDA 3U3KA 1I13A 4HUQB 1NUPA 1AK2A 2GZMA 1GRCA 1XRMA 2IOQA 4QUJA 1QM5A 1N4DA 4UATA 3V9PA 1ZBDA 5T5QA 1R0SA 3IR6A 4Q00A 4URUR 4XD7A 4C0HA 3UJ3X 2NSDA 4F9EA 1BEEA 3Q6MA 1UWCA 3R5KA 1ZJ5A 2IKSA 4EYSA 1VPDA 3LXUX 4XGKA 4XZ3A 2EIHA 3EIEA 1P1FA 4RKFA 1ES9A 4DKJA 3U7QA 4XGNA 2PZFA 3RVLA 2PLRA 3RTAA 3R6WA 1UEXC 2RGWA 1PT6A 4TWAA 1B14A 1L5VA 1I4DD 2C4MA 3ONEA 2PT7A 3DKKA 2BH9A 3OPYI 1VXOA 4P81A 3A4YA 2DPGA 4LMBA 3OX1A 4UBJA 4J0QA 3QRWA 3D8HA 1C9DB 3KVVA 3MGAA 3OHSX 1WP4A 3P9PA 2GHRA 2FR8C 1PJZA 5DK6A 3HN6A 3I1FA 5B1DA 2ZS8A 2WM3A 3AIKA 4P3KA 4WOKA 1DINA 2XUOA 1M0WA 3PCRB 3OZIA 3S27A 4BFZA 1QZXA 2YX1A 3JQQA 3G17A 3CHYA 5BN5B 2H54A 1MAHA 5DTRA 1W49A 4XYGA 1T29A 1H2RS 1LNQA 4YY3B 2VHWA 1DBVO 2QPAA 4NY1A 2FN4A 1AK1A 1Y9AA 3C3JA 3HJUA 3ETNA 4U3JA 4ZALA 2PX6A 1NU6A 1WEKA 2RAVA 3DNFA 3ICOA 5CPFA 3Q1LA 4X60A 5LOVF 4CKXA 4CTNA 1Z2AA 3H42B 1US8B 4R9UC 3AINA 5AXAA 1QTRA 4CT4B 1K3UB 1W25A 1J7JA 3CLSD 3WKEA 1Z4OA 4AQ7A 3JXEA 2PGAA 1NXSA 4JVSB 1N0WA 4TKUA 5FUVA 4BEVA 1NXWA 5KOIA 4JUCA 5FA6A 4JGBA 2YUIA 3B13B 4YJGA 1E6UA 3AF3A 5F2NA 1UZUA 4MINA 1BXRB 2I66A 3GUCA 2XAAA 1BD3A 3PQCA 4ARZB 1GU1A 2OSBA 2XGMA 1V1RA 3MJHA 2B99A 4I6JA 3C6ZA 4FZVA 3VO8A 4J3FA 1XYGA 5FD8A 1V1JA 4M1EA 5C4GB 4YAEA 2DU8A 3V48A 5MDHA 1XU9A 3Q3EA 4G0NA 3KWFA 5F5LA 4NYIQ 2OAQ1 3WBFA 1OCEA 4DCTA 3FHLA 1Y6ZA 2VJLA 1B8NA 3DFKA 3JZDA 1EXVA 3A25A 1K66A 3QU9A 3LGXA 4WXEA 1JVSA 1ZD5A 4DFDA 1GTRA 4A8JC 3QX8A 4F7DA 2FE4A 3SYKA 1Y48E 4EG4A 4OMUA 2I62A 1N5KA 3MIZA 4TM8A 1NF3A 2Q41A 3MPUA 1MB4A 3PF8A 2DKOA 4R05A 4RZQA 2FETA 3RIEA 4RZUA 3VZQA 1X0VA 4E88A 3U4HA 4JI5B 4OHFA 4A4DA 2AR9A 2PL5A 2W00A 3CW8X 1KNQA 5C9ZA 1DIBA 1ZM2A 2CV0A 3KYCA 3IT0A 3I05A 1EIWA 2E4VA 2O0JA 1SOAA 3WO0A 1WCV1 3HB1A 3JQRA 4JB0A 3AJEA 3FUTA 4HFNA 2HWWA 1OTYA 4Z1MD 5F7XA 2ZIEA 1RYZA 2FMUA 3ES9A 3PGJA 3LGSA 3TLMA 3AGPA 1Y1RA 5B64A 1D8TA 2PX0A 1BVRA 1SXJC 1IAQA 2O54A 4FSDA 1FVOA 5T3YA 4JC5A 4PIPA 4TUYF 2O0HA 1S2NA 1ZM4A 3H11A 3E61A 5ALUA 2H1OA 2XWJI 1P1CA 3HN7A 1U1IA 2CT8A 3V32A 2FFRA 1ZLYA 2GLTA 1PL7A 3NEYA 4ZCSA 3VPHA 1JDNA 1FFAA 4ECAA 5J59A 3WG9A 3IBYA 1V5IA 5FNZA 2RHDA 1NUAA 5HF5A 3HBFA 4AYWA 3EGXA 3CIOA 2H48A 4E21A 1UOQA 4WLVA 2FI1A 1M6VA 4JP3A 4LV8B 3CSSA 4O4HB 5IT0A 1QE0A 5E0KB 5JNWA 1YS9A 3N2EA 3DUFA 3PEFA 2FX5A 3Q5GA 3RIHA 3TOXA 3TSZA 3VSBA 2FR0A 4BASA 3SICE 3HU1A 4ETNA 3VA7A 1OFUX 3M6IA 1NFRA 1GLVA 1EB8A 4P3XA 1NURA 4R83A 3VTFA 2I6TA 4YRGA 1TEZA 5L3VA 4WFQA 1XLWA 3QKIA 5J2TB 3ZE0B 3AG6A 1VA4A 4JOBA 2D5IA 2P40A 4U6NA 1R66A 4IICA 4ZZIA 4RTLA 5CA1A 4K7JA 4N4AA 4B3MB 5FOSA 3X2EA 1MRSA 2CNWA 3V55A 1GR1A 3CNLA 1DWUA 1DUSA 4QBGB 2NV0A 4C6TA 2EF0A 5KDDA 3HDHA 4ETIA 2QUIA 1W36B 5G0WA 4CV2A 5DXFA 2NWQA 2V6IA 1Z63A 3NMUF 1SCDA 1VG8A 5K0LA 1K8XB 4QUKA 3THRA 1VHLA 1ZK0A 3EVTA 4CG3A 3A6HA 2BHLA 3GJ6A 3JAWA 4BMYA 1GQFA 2PZGA 3RRYA 1Y81A 1OX4B 1GADO 4MA0A 3FBTA 2FUEA 4TN1A 4DREA 1L7VC 2QM8A 5LIPA 4HVAA 1QG4A 4IQGA 5T6BA 1IN4A 1BAPA 4DHWA 1E7SA 1PLKA 1T2CA 2O05A 3ABRB 3UMYA 4ZCRA 2B34A 3W05A 3WWPA 4CV0A 2VSYA 4RH3A 5FBHA 2DTXA 2P7HA 4YCJA 1CUUA 4ZOEA 1YQQA 2WTUA 5JNSA 4CF6A 2APJA 2QTBA 4NJMB 3QYJA 4QLOA 1FFDA 3SE7A 4LDPA 4INPA 4C7OA 2VYNA 3WL5A 4OJNA 4BAGA 3F67A 4DRZA 4Z6KA 2DULA 5DSZA 3FMFA 4JEUA 2R5NA 4BY9E 2C8JA 5BRNA 4PO1A 2HMUA 4HUTA 5K3FA 1WCWA 1JWAB 4RYDA 1P9RA 2XE6A 5FT9A 1QG0A 1MFZA 3B1KA 1GFSA 3G0GA 3RYHB 3DO8A 1KU6A 2GILA 3T7DA 1OYYA 4JJFA 2O7SA 2C0QA 2J4CA 1IRIA 2JRLA 4AJNA 3DTNA 4DEYA 2IELA 3GNTA 3NBFA 4CQLB 3ME5A 4QPJC 3LDFA 3ICEA 3E48A 2IDMA 4F12A 4C4YA 3BA1A 2DUWA 3A6FA 5A9SB 1OV6A 4W6ZA 4KPUA 1XJCA 2JCXA 3L0IB 2PE5A 1VSQA 4P3PA 1PLLA 2VH5R 4HDAA 2C0PA 2TMDA 3MVEA 4GQBA 4ZVSA 2GARA 3VYWA 3WFIA 4MA4A 4OPMA 1KYIA 1T3SA 1XAJA 1Y8AA 3OLYA 4GDFA 5A3RA 3KPJA 1ODFA 3PU6A 2IPXA 3MJRA 4P4UA 1BEZA 5DYGA 5J2UF 3DZJA 4EVQA 1NJ2A 5IC6A 4DYHA 5LYJF 4HP8A 2AMYA 3IULA 3TAXA 4HV4A 3AV0B 4UTVA 4FT4A 4KXVA 4YLGA 4J1NA 2QL5A 4ENRA 2I34A 5AK0A 2W2PA 4O08A 4ND5A 1QX4A 1SKBA 4PYLA 3RVOA 1Z7GA 2QR5A 3RRXA 4AZVA 4ZGWA 6AT1A 4HAXA 2J9YB 1PR3A 1RWOA 4IVPA 3V8VA 1M2KA 3NYWA 3PYXA 4FE4A 4CZ2A 5E9WA 5T3UA 4HVCA 1QVZA 2PSEA 3DR5A 4PFJA 2UYGA 4E7PA 4EENA 2NADA 2NTNA 1EFUA 3E3MA 4XLLA 5CHYA 4MXDA 3HK2A 1IOZA 3QE2A 1GFIA 5G4KB 4BNIA 4EPYA 2G83A 4G25A 2V58A 1WKVA 3E9CA 1EHIA 4FTWA 4RW0A 1FDWA 2GPAA 1MNQA 3AEUB 4IKPA 2F7SA 3ZDCA 4P7KA 1KJQA 3S28A 1J8VA 1C2TA 3W6UA 5JSFA 4JVMA 4YUWA 3O93A 1M2OB 4JB3A 2N75A 2B92A 2ZZMA 3HABA 3PFFA 2QYTA 1C8LA 3WNVA 3EQ6A 5KJEA 1CJUC 4PBRA 4QUEA 3E9MA 4EITA 5LP6F 1T9BA 3GELA 4QBTA 1V8BA 2R6AA 1XT6A 2VHCA 2EFDB 1XDBA 4CE6A 5ESWA 2VDWB 3BIFA 3EW7A 1DX6A 1I7NA 2MJLA 2M6LA 3T3OA 4BQOA 2GO1A 1VIYA 2FFAA 5JQGA 1F0NA 4MQ6A 4RL4A 3MNFA 1AKTA 1D04A 3BRWA 3ORHA 4QHSA 4I4NA 2VATA 1GGJA 2CVFA 2ZIVB 1T4DA 2GWHA 3DAPA 3LF1A 2XT0A 4FEEA 4O63O 1M7BA 4C3VA 4KH0A 3FF4A 1W88B 3WQSB 1DIOB 4WJZA 5AYVA 1P73A 2FOLA 4V0MA 3DBRB 2CE7A 4DRXA 1G20E 2QIPA 4G8DA 4UNQA 3REGA 1GGKA 3TIIA 1KAEA 3D8TA 5B5SA 2PWZA 4KNWA 4XYBA 3DW3X 4E15A 5EFZA 5D85A 3GAFA 3JASA 1T1RA 5CW1A 5JBIA 2J45A 3DJFA 3H3JA 4ZIRA 2YVQA 1R4MA 2HV8A 3L0SA 3OJCA 1ZGCA 1JHPA 1GKIA 3HVKA 4B4DA 3IAS1 5ERYA 4YONB 5LUBA 5K0GA 4OQFA 3NIFB 2QD3A 3JQEA 3NW9A 1JU9A 4KTTE 3WV4A 2GKGA 1M6EX 1DE0A 1SULA 2JJQA 1JG4A 4MUFA 3TQRA 4QPDA 5I7EA 1R0YA 1MIOA 3COYA 4AJLA 5B4UA 3H9QA 3IFSA 4M9UA 3GQBB 2F62A 2G9RA 4LS3A 1FFBA 1EK0A 1WHSB 3HGMA 3WJ2A 3B85A 1PRYA 4J1QA 3A6ZA 2RE8A 2W0SA 1UPAA 2IT1A 3PC8C 4OGFA 4DPLA 5CXUA 5I8ZA 1AQLA 3HL4A 4GNKA 4L2IB 4RJLA 5FBZA 1HLDA 2HDNB 1XZBA 2F1RA 2XVMA 3G8AA 2ZVJA 4I4CA 5CGZA 2R8EA 2I4IA 1AIPA 3EXEA 3F7NA 4R1SA 3OZGA 2R751 1JIUA 3IVAA 3N3AC 4M4SA 4YCSA 4X84A 5JNLA 4U63A 1OILA 1CUHA 3JARA 2NXWA 1PJAA 2OKCA 3EUAA 4MVYA 5AVOA 4ETWA 5CNKA 2XCTB 1VE3A 2F1KA 3LLSA 2PSHA 4QUDA 4D82A 2GHIA 5CW2A 3SDSA 3JAKB 4CR7A 1M1UA 2PRYA 2QM7A 3FOFC 4FGSA 1ITZA 4HR7A 4IRMA 4O3MA 1LTHR 3N7AA 2OORC 1FYFA 1KEVA 4Q3LA 5M34A 1ZNQO 2ZU6A 4MV5A 2PUTA 3THXB 1J2YA 3QVMA 4N03A 2EFYA 3GIWA 4Q4AB 4IBOA 1C50A 4QSMA 2HADA 1CRZA 4AL4A 2EFEB 4QLBA 4D9JA 4EQ6A 4C0SA 4KGDA 1ZI8A 3HCRA 4OQEA 1WXFA 3FYCA 4LGCA 5JMPA 3DXZA 4QD3A 2COUA 1KMHA 3WWDA 2BTQA 2P1ZA 1KQNA 1M34A 3AR4A 4EF4A 4HAYA 1ZI9A 3A6GA 3GCDA 4M37A 3TZHA 3U4CA 5CDYA 2BMEA 4EY5A 3TPZA 4LQCA 3K1TA 4PAWA 5LWHA 4F6RB 1VKJA 3ZPXA 1H5UA 1SVLA 1TCBA 2CUTA 2CHVA 3K0AB 4OG2A 3BE6A 1YBAA 5DIZA 1H2YA 2R60A 5HCIA 3CG4A 4QXPA 1CUSA 4LDQA 3ZHBA 3OEHA 5T41A 3GT0A 3EQ9A 3RVMA 4X64B 3CFYA 3C8DA 5D3ZA 1WB9A 3MUFA 5ALVA 4ZZ1A 1Z9BA 3RUCA 1VTKA 4EVRA 1VFNA 4D92A 1XMPA 3CM0A 3NM5A 5D5QA 2SECE 2HC9A 2R66A 2MSCB 3C3CA 3KKLA 3A06A 2OOKA 5GMOA 3QVJA 3AM5A 4X1KA 2FRXA 1P4GA 2Z3WA 2CNNA 4FDAA 4HO1X 3WKCA 1K4KA 4Q4LA 1CP2A 2WP8J 4LN1A 1CUBA 2F3TA 5J5VA 1A4UA 4F97A 2XDQB 2W71A 1VKOA 5FR1A 1M1NB 4IDBA 3ILHA 3G89A 1U9IC 5EGNA 2C5BA 1W0JD 5F9HA 4GT1A 2CFSA 4ZANA 5ADVA 1UMCB 2XLBA 4LDNA 4MITA 5ANRB 5LFAA 5AOAA 1O7JA 2QT9A 2BM8A 2WF8A 1L7XA 1JU4A 1HLGA 2NP6A 2XCQA 3BHIA 4C14A 2JIPA 2NG1A 4R2MA 3GLSA 5JDCA 1JDZA 1NBMA 1D4FA 4MGZR 1IAVA 1PWYE 4O4JA 3H2YA 4EI8A 4HTFA 4Q82A 3QF4A 4HQKA 2HMWA 1UWVA 3AUUA 2I1WA 3ZV5A 2AN4A 1M83A 4W1RA 1E7RA 1HFJA 1K3TA 1VHDA 3EQ8A 1Z4KA 1TM3E 1UKEA 3DKPA 1V5FA 2Y9PB 1YXMA 3OSZA 1KFEB 1OLXA 3H9GA 3ZI4A 2KE5A 2IPNA 1ESEA 1Z13A 2TMGA 4BS9A