4OMUA

Crystal structure of shikimate dehydrogenase (aroe) from pseudomonas putida
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
274
structure length
274
Chain Sequence
MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQGSGGNVTVPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVNAGVELAGKRILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFDELGPVVASGFAWLQEPVDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGKEPTPFCQWATKLGAAKVLDGLGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQLARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate dehydrogenase
publication title Crystal structure of shikimate dehydrogenase (AroE) from Pseudomonas putida
rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 99
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4omuA02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 4omuA01
3JQAD 4GGOA 2PTGA 2OHXA 2ZIZA 3ON5A 3PQDA 1NWCA 2FSVA 3QRWA 1BXZA 3C24A 1F17A 4D45A 1J4AA 4TROA 5LC1A 4BNHA 2B69A 4S1VA 4RL6A 2V6BA 3N7UA 3K2BA 5IAAA 4NJMB 4U7WA 2X9VA 5I7SA 1UDCA 2PK3A 1XELA 4UEKA 2PKQP 3ENNA 3G79A 1U7TA 3WDSA 1C3VA 1DRWA 1YDEA 4WCFA 3WSVA 1GAEO 4WEQA 5EIOA 4ITUA 1QMGA 1PJTA 3WJ7A 1QP8A 2GN4A 2J3JA 2ZTVA 3S8MA 4DXHA 3NJ8A 3PHGA 4Y98A 4E2XA 4J91A 3SLKA 1TB4A 1MB4A 3PYMA 4EGFA 4FFLA 5GZ6A 1IZ0A 1W73A 5A5FA 2IZ0A 1X7DA 2AE1A 5L4SA 1LTHR 1SPXA 3LT0A 3DMTC 1VSUA 4JNKA 3V2UA 2O3UA 1PJQA 2RH8A 3JQ9A 3WICA 4OQYA 3UCXA 4OXKA 2DPHA 2VRBA 1N1EA 3BHIA 4XIYA 1BW9B 2Q1SA 5CEEA 3A9WA 5CP8A 3GFBA 1X1EA 3I6QA 3DBVO 3LU1A 4FN4A 4LW8A 4FPXA 3ZHXA 2YV3A 4EEZA 3ANLA 1NPDA 3VVCA 3DXFA 3B1JA 1CDOA 2HQ1A 3EUWA 3GDFA 3V2GA 4D3DA 1RM0A 2QZZA 3IS3A 4RVGA 5IFLA 3UOGA 4KUHA 4Z0HO 3ITDA 1ZH8A 3CPSA 3GAZA 4L8VA 4J1NA 2JD2A 1ENPA 4F45A 5DZSA 1ONOA 3HJAA 3PZRA 1GCOA 1HXHA 3G0OA 4XQCA 1A5ZA 4N54A 3L6EA 4D3SA 5CEJA 4BS9A 3LVFO 3OQ6A 4CODB 3ZWOA 1U1IA 1QG6A 2A92A 2GZ1A 4CMKA 2GN6A 3K9QO 3D5QA 1RJWA 3WGHA 4UAGA 2HLPA 1T24A 3AM5A 1P3DA 1K2WA 2HK8A 3AUSA 1V6AA 2P4QA 4YJGB 3ADPA 2X4GA 4ZQGA 2NQ8A 1HE3A 4P4LA 4BHTA 5L45A 3OM9A 3OA0A 2CMDA 4RDIA 4OMUA 1E3IA 3TOZA 4CL8A 4QECA 4XRRA 2PH5A 5DULA 3DBRB 4XKJA 3ZZNA 3LC2O 4RZHA 4CLRA 2W98A 3AOEC 3ICCA 4DVJA 4XYLA 4A0SA 4EEXA 2Y67A 1TVEA 3D64A 2DM6A 3BMQA 4R41A 3DFUA 3UFXA 4R1SA 3JQ8B 1ZJYA 1E3WA 4WK6A 5G2OA 3D0OA 3CINA 3QWHA 2X58A 3FPLA 5JDIA 4J9VA 3CZMA 3CMCO 3FF4A 2DBZA 2G0TA 3TL3A 4YT8A 3PFWO 1HTBA 3QHAA 1MG5A 1PQWA 5COQA 4E5NA 1HDZA 3AI1A 1R4NA 3OJ0A 3SC6A 1VJTA 1ML3A 4RZIA 1GPJA 4ZQBA 3HB4X 2AQHA 1R0KA 2VZ9A 5TRTA 5T8KA 3OJFA 4DC1A 1WWKA 1GD1O 4J7XA 5A1TA 5KJEA 3KV3O 3Q9UA 1YL5A 1ENYA 1C1XB 4R1NA 1MX3A 4MVJD 3GK3A 3O4RA 1YBVA 4BNYA 4L9RA 1JVBA 4PLFA 4E21A 5CEFA 3PWZA 5L7WA 4FDAA 1EFKA 2Y0EA 4M87A 2DTEA 1OOEA 4E2ZA 1XDWA 4YCAA 1PJLA 2PZMA 1MXHA 2C07A 3GC6A 4S3MA 4D0RA 5KVCA 4PLYA 1GFSA 5DOVA 2ZYDA 3GMSA 4CM9A 1Y5MA 4XWYA 4YJFB 3C7DB 1Z74A 5HS6A 1UAYA 1DC4A 1XR3A 2XF8A 1VKNA 1R0SA 1YJQA 4IZIA 1FDVA 4IQ8A 1ZEMA 3SLGA 2GCGA 3W8FA 4EDFA 4HFRA 3RROA 1H5QA 4JBIA 4GVLA 4KUEA 3TZ6A 2GZ3A 5AOVA 1KIFA 3AI2A 4JLWA 1B7GO 1DRVA 3IMFA 3JCZA 3JQ7B 3RBZA 3GOHA 4URFA 4CR7A 4J7CA 4DPMA 5KTKA 1ZKMA 2HK7A 3TPCA 5JO0A 1KEVA 4C7KA 2W2KA 5CDGA 1QXSA 3KYCA 5THKA 2EW2A 2OL4A 4CMGA 4YAIA 3FWZA 5EQDA 1B2LA 4F6CA 3CE6A 4LN1A 3KM0A 4YACA 1NFFA 1YBAA 3RU7A 4D7AA 3OH8A 4MP8A 5G4KA 4UULA 5G0TA 4KQXA 1HZJA 3BMCA 3F4LA 1XA0A 1SCUA 2PNFA 2P9CA 3A28A 1PJBA 1E3JA 3DZIA 4PG7A 4BGVA 1LSJA 1Y8QB 1V35A 1DOHA 1CJCA 1UR5A 3Q6IA 4QUKA 4BKQA 1QYXA 3GZNA 3WGOA 3O8QA 3PDJA 4XEHA 4MOWA 3GT0A 4KTVE 1LDEA 5F1PA 4YXFA 2B4RO 4J4TA 5T6BA 4P22A 4GLLA 4B7UA 1H9BA 1JTVA 1I0ZA 2OUIA 2VTEA 4NMHA 3ZW8A 2YJZA 3FBGA 4OH1A 1T2CA 4A2CA 4MKXA 2W2LD 4PG4A 5DBGA 3FWNA 1LA2A 1QSGA 1U2GA 2W2LA 4ND3A 3GFGA 4R16A 3ETGA 4L75A 4XA8A 4AJ1A 5KJ6A 3WR5A 5JCJD 2GYYA 1ORRA 5DN9A 5K6AC 2FZWA 5A9RA 4CLOA 4O1MA 5IN5A 4E31A 1I24A 1KVTA 1SAYA 1VC2A 5JC8A 4GWKA 4CM7A 3H65A 1HYEA 2Z1NA 3U0BA 2EHDA 3Q2IA 4PZCA 3FRJA 1DFHA 4CMEA 3FNGA 2C7GA 3R6DA 1JKJA 5BSHA 2B37A 3OFSA 1GCUA 4GX0A 1R0LA 1GPDG 3AFNA 1WAMA 2VQ3A 3FHLA 4I1IA 4NQZA 4YB8A 2BMAA 2ZTLA 4EJMA 3ONDA 2GPTA 5F3RA 1AHHA 4L76A 4DIFA 5A9SB 4J2HA 3X2FA 1MC5A 1O0SA 1H6AA 4J90A 3KLMX 3SJUA 4E5PA 4BKRA 2D2IA 3H2ZA 1LU9A 2TMDA 3TZKA 4NHEA 2BRUA 1V3VA 5IG2A 1EVJA 4M89A 1YQDA 4IDGA 5L95A 3HDJA 3IIEA 2G76A 3L4BC 4LCJA 1BSVA 1B3RA 1JKFA 1EVYA 3VH3A 5I8WA 4J9UE 3OF2A 4R9RA 3VZSA 3DONA 3O38A 3WGTA 3PFFA 3ABIA 3AI3A 4WLUA 4FOSA 2DBQA 1PJCA 5JNLA 2V6GA 1XYGA 4HV4A 4B3JA 1B16A 3WTBA 3JQ6A 5DDIP 2CUKA 3GA0A 4DIBA 3E82A 4AJIA 2YW9A 3FR7A 1MP0A 3VKUA 2PR2A 2W90A 1LJ8A 2E48A 4FQ8A 2VHWA 1UJMA 4CMIA 2QQ5A 2X1HA 4IJWA 3D4PA 5EINA 4CM6A 4YAEA 4W9NC 1NPTO 1LNQA 2VCYA 5ER6A 1NQTA 1HL3A 1XGKA 1IPFA 4BNLA 2WTBA 1OC2A 4H3VA 5KNLA 2POQX 2H9IA 4ZQHA 4P8RA 3KZVA 5FWNA 5FI5A 4BKPA 5BNFA 1FXSA 1UZNA 2CDBA 4KDFA 4NK5A 4WKGA 2CD9A 1K3TA 1XU9A 2EP5A 5BSEA 3ORFA 4NBUA 3OJLA 2VWHA 3D7LA 4B4WA 3NDIA 3ZW9A 4HWKA 3ZV4A 1T2AA 4FJ2A 3GVXA 5BSGA 3TFOA 3K92A 4R4JA 3IL2A 3JD3A 1LSSA 1U9JA 5AXDA 3VDQA 2RCYA 1Y6JA 4CMAA 1ISJA 4NPCA 1PZEA 1I33A 1R66A 3PHLA 4R5MA 3OECA 2O2YA 4XRGA 3AK4A 1E3LA 2NU9A 2ZJ0A 4D44A 3WYCA 3B6ZA 1K6IA 1LQTA 1LSUA 1XHLA 1ZSVA 2C20A 3QWBA 1KEWA 5JMPA 5JPIA 3ANMA 1RM4A 1A9YA 1BWSA 1DO8A 1AHIA 3CEAA 4EW6A 3JD2A 4Z9XA 1GUYA 2FOIA 5KIAA 5ER9A 3H5NA 1PR3A 4XGKA 2V6FA 1B8VA 5CAEA 3IJPA 4BMSA 4FFRA 3ZNNA 3MTJA 3JYLA 1GU7A 4EITA 3DAPA 3G1TA 5B1YA 2IYOA 3H5AA 5JMWA 1N5DA 1CIVA 1UZMA 4R3WA 5C7LO 4FFMA 1PJ4A 1TT7A 4YQYA 1FJHA 4CMBA 4B79A 5K6AA 1G0OA 2GUGA 1ZMOA 1QYDA 3VPHA 4ND2A 1JAXA 4PZEA 1VPDA 3PIIA 2YFQA 4DBZA 3RUEA 1XWFA 2BF7A 1ZEJA 3HB5X 4DL9A 2BI7A 2DTDA 4QSMA 3A06A 3RC9A 1BDBA 4WUVA 3QWIA 3RBXA 4JBHA 3H9JA 4YJHB 5KOIA 4LGVA 4CUKA 1Q7CA 3M1LA 1W0CA 2VHZA 4OJNA 2I3GA 2PGDA 4DBVO 4ZQFA 4MJLA 1P45A 2JFHA 5IJZA 4D42A 2EP7A 4WOJA 1Q1NA 5BNIA 2NADA 2IXAA 2JFGA 3ROMA 5CFZA 3JV7A 1IZ9A 1RYDA 3ZU4A 3DDNA 3PIDA 1OBFO 1M76A 3GAFA 3L9XA 5JAQA 1GEGA 3GGGA 1JQBA 1LC0A 4QO7A 5U1PA 4A73A 4N5LA 1XQ6A 1UP6A 4A27A 2EERA 4MVJG 3CKYA 4RGBA 1O95A 3GG2A 2B36A 2NLOA 1FDUA 2WEKA 3FCOA 3P5SA 3ZWMA 5B4TA 5L4LA 4OAQA 4XDZA 3WGGA 5TJ9A 2GDZA 4XB2A 4Z3DA 3OMLA 1WDMA 4F6LA 4A5OA 4BVAA 3V1TC 1D3AA 2JCXA 1AUPA 1EUCA 1O94A 4HY3A 1I3MA 1JDJA 1GUZA 4XX0A 1GL3A 2O50A 4IINA 3U4IA 3O26A 1PS9A 2AHRA 1HE2A 1DRUA 1H9AA 2B4TO 5F5NA 3WB9A 4UVGA 3I9JA 3BMNA 1DC3A 3LLVA 3GUYA 4YT5A 4BOYA 2GN8A 1PJ2A 2EV9A 1DAPA 1LC3A 1P1HA 3LF1A 3SC4A 4IMPA 4IJKA 1IULA 1B8PA 2A94A 2DBVO 3GNQA 3T4EA 3PGJA 1E1LA 2JHFA 3NKLA 1K0UA 2A9FA 2C2XA 3PHHA 3VZPA 4CV3A 3ASVA 3WMWA 3G49A 1CETA 3H7AA 3LDHA 4E4YA 2G17A 5A5EA 3UHAA 5JW6A 4PRLA 2VHYA 3FN4A 3U62A 3TF5A 4LMPA 3AFMA 4PN3A 1NVMB 4UVDA 1IB6A 1O6ZA 1FDTA 1QLJA 3NYWA 4GMFA 4NK4A 2HU2A 4OQZA 1T25A 1QYWA 4CM4B 3JD4A 4EBFA 3RUIA 2VNSA 4YVFA 4BB5A 1DJNA 2ZYGA 3BTUA 3NDJA 4E2WA 1ZW1A 1IY8A 4J0FA 5L40A 1QORA 1GQYA 5ICMA 1LDNA 4PIVA 4IJVA 1PJ3A 2WD7A 3RVDA 2AEFA 2Q1WA 3B1KA 1E7WA 2DFVA 1I8TA 5C7OO 5I9NA 3PPIA 1I3KA 3KYDB 2ZCUA 4OYRA 4RLSA 1XG5A 4CQMB 4NFSA 2GLXA 3W4IA 1DLIA 2D5AA 3F3SA 1NAHA 4OIMA 3EMKA 4CM8A 1UXJA 1ZIDA 2HSDA 4AICA 1N1GA 3DHNA 4J2OA 2I9PA 3K96A 3HDQA 1E5QA 1VLLA 2GNAA 4TRRA 5IDQA 5KWEA 4TKMA 3NTQA 3KO8A 2VWGA 3ZU5A 1DIAA 1LDGA 4C4OA 1E1MA 1M66A 5TLSA 2Y1OA 3GN1A 1ADFA 1E92A 2BFAA 2QX7A 3K31A 5LCXA 3H3JA 1H0KA 4DWVA 4QFCA 1ISFA 1B15A 2DVMA 4ND5A 2PZKA 1YBMA 4BKUA 4FW8A 1Z45A 3VDRA 4XYMA 1SC6A 3NDRA 3WOHA 3M2PA 1E5LA 3GPIA 2EJVA 2ZJ1A 1YB5A 5BNTA 4WCDA 4I5FA 3INTA 1IHXA 4XD2A 3WFIA 5I7EA 3BHJA 3QIVA 3JQBC 4BO3A 1F06A 3ZNQA 3U4CA 3WG9A 2O4CA 2Q2QA 5EL0A 2AE2A 2DC1A 3OSUA 3K73O 5BT9A 3IDSA 3JQAB 4TZTA 1QYCA 4ZQEA 1VKOA 3HDHA 2XXJA 5G4LA 4ND4A 4OXNA 1UP4A 3TWOA 2BKAA 4HFMA 4ALIA 4JP2A 4ZJUA 2QRKA 4Y8VA 4AJPA 3NEPX 3U09A 3DHEA 2JHGA 1ZO8A 1ZVMA 1Z82A 4IXWA 3SBOA 1B0AA 2VZ0A 1WLYA 1EDZA 1PR9A 2GF2A 3QVOA 3CZRA 3E9QA 4RVUA 4WCFB 3NAQA 4IUYA 1LBEA 2HMWA 2UAGA 3E9MA 3NRCA 4B8WA 2IEBA 3GVCA 1VI2A 2VOJA 4I5DA 4MVJH 2EXXA 2D59A 1JU9A 4RPLA 3RJ9A 1E6UA 4R68A 4Q3BA 3K5PA 1NYTA 1YS4A 4WEOA 2VYND 4ALLA 2LDBA 1XU7A 1I10A 1LRKA 1PS8A 1SNYA 3RIHA 4RVFA 1N9GA 2VYNA 3VZRA 3A14A 4BNVA 5EJ2A 4JX8A 4M86A 1VJ1A 1H6CA 1DLJA 3DL2A 3KHUA 3Q1LA 4EI2A 5ITVA 2VHVA 3LF2A 4K6FA 4Q3CA 2I67A 4PLVA 1YB1A 4R9SA 1G0NA 2X0RA 3ZV6A 4UEJA 1BGVA 2FR1A 3ZCXA 1JKIA 1NX6A 4BNWA 4EYEA 4GAEA 2JFFA 3ZN2A 2FR8A 4FJ1A 3PJEA 1YVEI 1H94A 1Q2XA 4BO8A 1PIWA 3U4DA 4RCVA 1CERA 3WSWA 1P77A 1AXEA 4IM7A 1XQ1A 3VH4A 1I3NA 4W82A 4E30A 3ETEA 1KBZA 1IYZA 3RCBA 2XAAA 3MJTA 2NTNA 2VUTA 2NV6A 1E6WA 2OXIA 5G0VA 1K89A 1SZJG 5L7YA 1PZFA 2NQTA 5TX7A 4BV9A 2WYVA 4FBGA 2PFGA 3EZYA 1Y1PA 1F8GA 4QQRA 4PRKA 1WVGA 4BNFA 2VN8A 3RI3A 1YXMA 1MG0A 5IDYA 5JAMA 3FD8A 2O7QA 1UP7A 4CLRB 3H5RA 5TJHA 3RBVA 4EUFA 1DIHA 2J3IA 3DBHA 3I83A 4GX1A 4PLWA 3GRPA 4TKLA 5ES3A 3SJ7A 1HYHA 3BMQB 2RHCA 3EVNA 4J49A 3ZWBA 4MPDA 1E3WB 5I7FA 3IQDB 2PKRA 4RO0A 3S2EA 1P44A 1DB3A 2P2SA 4YDRA 1U4SA 2RHRA 3RC7A 5TC4A 1T2EA 1O89A 1X7HA 4B7CA 3WGYA 1Y9EA 3ETDA 3MCVA 3OP4A 3WFJA 4AVYA 1QLHA 1E3EA 1BVRA 3OIFA 1PJSA 1R4NB 3QY9A 4DLLA 1FDWA 1HRDA 3WBBA 3AWDA 3GPDG 5KJFA 1KVSA 2A35A 3I52A 3L07A 4U0JA 3FTPA 2PZJA 4INAA 2ZTUA 2PKQO 1EEHA 4E0BA 4FCCA 2ZQZA 1DC6A 1LRLA 4PGFA 1IL0A 3ICPA 2ZTMA 3BAZA 4RORA 1XSEA 1PEDA 4LMRA 1P9LA 2AQIA 2PD6A 3DFZA 3E03A 3ZWPA 1U5CA 2O23A 3R3JA 3RC2A 3ZWCA 1GYRA 5A4DA 5FEUA 3GGPA 5A9TA 1YRLA 4C7JA 2PD4A 2WYWA 2EG9A 3LLSA 5JE8A 2GD1O 2DUUA 3A4VA 3HN7A 4I9NA 5ICSA 3KSDO 4J7UA 4PVDA 2EWMA 1GV1A 4GL4A 3KEOA 1MXFA 3BHMA 1EBFA 4PLPA 1OC4A 3DBLA 4MVJI 3G17A 4YBZA 4E6PA 2VWPA 2EGGA 1E0DA 1KY5A 1SOWA 4YPOA 3PRJA 4PZDA 4CM9D 2R00C 3L4SO 2I66A 2BH9A 4RPKA 5KKAA 3V1YA 3FNFA 4IJUA 4CQLA 4DMLA 4ZHSA 4GWGA 3UW3A 1U7HA 1U3TA 4KMSA 1JN0A 1E3SA 1YJ8A 5DT9A 3VVBA 3E8XA 4ZICA 3PDUA 4WE3A 9LDBA 3HN2A 2B35A 2YHIB 3D1LA 3RFTA 3Q9NA 2WSBA 3DMTA 3VHRA 1NPYA 4FB5A 2O3JA 3T7EA 3SX2A 4N7RA 5HM8A 5IZCC 1PGOA 1NR7A 1JLLA 3S2GA 3VC7A 4FSHA 2I65A 2O3SA 2B5VA 4HKTA 3K2EA 5G4KB 5HWSA 4U5QA 3BMCB 2X0IA 4MVJM 4XJTA 2O48X 2BGKA 2P5UA 1H93A 4BNIA 1HDGO 1U8FO 2OO5A 4ZA2A 3EVTA 3L6OO 3GZNB 1BMDA 4R51A 3FBTA 4B7XA 4YAGA 1YB4A 1E6EA 4UUNA 4XR9A 1ZMTA 4JJIA 5COBA 1ZK1A 3MJVA 3NGLA 2FN7A 1ZK0A 4X54A 3I5MA 1WMAA 4RPGA 4XGNA 1V8BA 3GH3A 2GGSA 5AXBA 4JBGA 1SB9A 1ZK4A 2YDXA 3DZBA 4IIUA 1I2BA 3VH1A 2IEDA 2VOEA 4ND1A 3PYXA 4GKBA 2FRDA 3ADOA 3AW9A 3DQPA 3IC5A 6ADHA 3GR6A 3R1IA 1I5RA 1MUUA 1PWXA 2RIRA 2TMGA 4MVJP 4ZU3A 1K6XA 5HA5A 3W4KA 2DFDA 3ZU2A 5IZ4A 1PGPA 2X86A 3UN1A 1VL0A 1RM3A 3HFGA 3OJOA 4GH5A 1T1SA 4IZHA 2Y1EA 3AOEA 3CXRA 2R6JA 3RUCA 4AJJA 2NVUA 2RH4A 2B0JA 1GADO 2O7SA 1Q7BA 1UDAA 4U0KA 1PX0A 2Q2WA 4CJXA 4LSWA 4D41A 2IXBA 2SCUA 1KVQA 1P1RA 3HSKA 4J4BA 3FNHA 4I9HA 3PYLA 3QVWA 5L7TA 1HLDA 2FPPA 4JQCA 4U6SA 3ZWNA 4RQTA 1L1FA 4ALMA 1A9ZA 1KEPA 2AG5A 2CZCA 3H9GA 1HDCA 4B4OA 1ISGA 1XKQA 2V6MA 5TT1A 3WYBA 2GASA 3K30A 4BO6A 4CR6A 4NDNE 1Z7EA 4ALKA 4RLHA 4BNJA 4CUZA 1SMKA 3RC1A 1HYGA 4K6CA 4TRJA 4JIGA 4D43A 2YUTA 3HADA 3QQPA 4CLDA 3WBFA 3KUXA 1M2WA 1YGYA 2P9GA 3EW7A 4B4VA 1FF9A 4WLFA 4GMGA 2AG8A 1UZLA 5I9LA 1HT0A 3MJEA 2ZCVA 4N18A 1R16A 2D1YA 3DOCA 4OSPA 5C5IA 1X0XA 2QYSA 3LZ6A 4DUPA 5DOZA 4CMIB 4WOKA 1LDBA 1L7DA 2YQ5A 5HRUA 5T57A 3KLPX 4IDBA 4E5KA 1NWHA 1MGOA 5HTOA 3NTOA 1IUKA 3UCEA 1NFQA 4EUEA 1X15A 1W6UA 1EBUA 4II2A 2Y05A 4QX6A 5A9SA 4XGIA 4XIJA 4Z9YA 3G3EA 3ZGYA 1F14A 2C2YA 1UDBA 1E77A 1B14A 1KETA 3PI7A 2EKPA 1OI7A 3TN7A 3OICA 4H16A 4XCVA 2HKIA 2NTJA 3B70A 1U3UA 4WLNA 4YT2A 5MDHA 4I08A 1V3UA 3GF4A 1HLPA 2E37A 5KCZA 3UAGA 2OBNA 1BTOA 3JQCA 3NT4A 1YO6A 4WGGA 4P4NA 4NNJA 2CDCA 2VTDA 4DA9A 3KXDA 5DCUA 2OP0A 1C1DB 1YOVA 1U28A 3WGZA 3ZWAA 1Z6ZA 4KQWA 1W8DA 4Y6SA 1MFZA 3V5NA 3PK0A 3KYBA 4ID9A 2C5EA 2ZKLA 3S2IA 4K9DA 4M1QA 3PVZA 2CNBA 3M1AA 2RBEA 4ZVVA 2WE7A 1ISIA 3LC1O 2UYYA 4DQXA 3B20A 2J5QA 1HF3A 4HUJA 2YHUA 4G2NA 1K6JA 3IOYA 4GGPA 3OHSX 4A03A 3TJRA 5THQA 2UVDA 3DWFA 1HZZA 1SOVA 3ULKA 1WMBA 4P4GA 1D1SA 5TSDA 3ZDFA 4TZKA 2Z1MA 4I5GA 3BZUA 4HBGA 3OEWA 1NM5A 3F5SA 1RYEA 1ZSYA 2FHSA 3EDMA 1E7QA 5ENDA 4PLZA 3WXBA 3F5QA 3OQBA 1TT5A 1NAIA 4R54A 2QRLA 3MEQA 1IOLA 4RF4A 5KJ1A 4DPLA 1KEUA 3UCFA 1N8KA 2Q45A 3OIDA 3C7AA 4I5EA 3RFXA 4AJNA 4XYBA 3H9UA 4WJZA 3JQGB 1RPNA 4TRMA 2Z5LA 4ZD6A 4M54A 1GQQA 4FFNA 4W7HA 1BXGA 2JAPA 2GSDA 2C5AA 2FZEA 4BQPA 3E6AA 5CDTA 4YAJA 2GRAA 1LSOA 2ZB7A 2ZQYA 3BMOA 4NU6A 3GMDA 2X7HA 4LVUA 1HE5A 1MLDA 2DTXA 3IKVA 4AJ4A 5A04A 3MJCA 3RQSA 8LDHA 1EE2A 1YKFA 2OOSA 2VUUA 3K8ZA 4LCEA 2J5KA 5EPOA 5TT0A 4EUHA 4GX5A 3CUKA 3KSZO 3ZWYA 6LDHA 2Y93A 4HADA 3N58A 2PZLA 1U2DA 4YT4A 4MINA 2JCVA 5A06A 1PQPA 4FC7A 4NJOA 1TI7A 2BGLA 4YJDA 5DBFA 3UF0A 4IQGA 7MDHA 3IP1A 1LDYA 2NU8A 4H7PA 3W6UA 1BG6A 2W4QA 3HNPA 5A3JA 3GHYA 3F1LA 2GERA 3L4BA 4FJ0A 4R3NA 1R12A 3DZJA 4JROA 4GSLA 4U8GA 3T7CA 1U4OA 3BTSA 4KZPA 4HP8A 4OXYA 2OP1A 1DPGA 5GZ1A 2DT5A 3S1LA 3L9WA 3VPFA 1EUZA 2BHLA 4BL5A 1ZJZA 2O3RA 2J3HA 3P2OA 3Q3CA 3OBBA 5TGDA 1GR0A 3F9IA 2X0NA 1GY8A 3PJGA 3GVHA 3CH6A 5CG2A 1NP3A 4E12A 3RD5A 2WWRA 4H15A 4B3HA 1KYQA 3WX0A 4OOFA 5KJCA 2D4AA 4HNGA 3FTNA 5AYVA 5CPFA 5F1OA 5AXAA 4UUOA 4W9NA 4DLAA 1VM6A 1GTMA 5L53A 2OMEA 3I6IA 5U9CA 2AW5A 4IPTA 2J6IA 3K6JA 4RF2A 2WJPA 3UH1A 5TQVA 3R0IA 4IMRA 3JQFC 3W8DA 5EERA 3GN2A 3IJRA 2AMFA 3V2HA 3I4CA 1PGNA 3OA2A 4Y6RA 3KTDA 3ST7A 3MJ4A 1VSVA 1M75A 4E3ZA 2B5WA 3PWKA 2IRWA 2Q50A 4EJ6A 2Y1GA 3GY0A 2PWZA 2E82A 1FK8A 3ZV3A 1NQ5A 5KVVA 4FFPA 1Q7GA 2PH3A 4IDDA 4XR4A 4NFHA 1DC5A 4NR0A 1YWGO 1HKUA 4BNTA 5FFFA 1I01A 2GZ2A 2A4KA 3JD0A 4TVOA 1DJQA 4O5OA 3W8EA 5BQFA 3RFVA 4IDEA 4HXYA 3ROKA 2AQKA 2AQ8A 4YRBA 1Q0LA 3WIDA 4WCFC 4PCVA 4DYVA 1E1KA 1PQUA 2J5RA 1Y9AA 4J16A 1V0JA 5FYDA 1MV8A 2CF5A 2VHXA 4JP3A 5B4VA 2WD7B 1ISHA 3E9NA 4XB1A 4O0LA 3I1JA 1X1TA 3TNLA 4QFDA 2HJSA 1ZK2A 4L73A 1Z73A 1Z7BA 3QA9A 1QYVA 3JQ9C 2CVOA 3OJEA 2EGHA 3I9NA 1ZZEA 3WYEA 3HHPA 3F47A 3HG7A 1BVUA 4TVBA 2NU6A 2BLLA 2YZ7A 3U4HA 5C37A 1M6WA 1NQAO 3MWDB 1V3TA 3RASA 3GHHA 3P19A 1PWZA 1LEHA 3QWAA 3Q2KA 2HCTA 1NBOA 4F3YA 2YDYA 4GQAA 1UXKA 1WPQA 3FSRA 3PXXA 2GR9A 3H8VA 4A7PA 2GO1A 5LDGA 4CM4A 2J8ZA 4ILKA 3AU8A 4FS3A 1PSDA 5EMHA 5KVSA 5EQFA 2Q46A 1Y8RA 7ADHA 4YA6A 3S55A 1GZ6A 1HWYA 1PL7A 1XLTA 3DAFA 3E5MA 3GVIA 4J6FA 4QO8A 3D3WB 2V7PA 4NIMA 2Y1FA 3DEYX 1NXQA 1Y5RA 2YV2A 4ESOA 3GG9A 1T2DA 3IP3A 4Q39A 1EQUA 4PLGA 4XQEA 5ADHA 1P0FA 5LDHA 4KWHA 1H2BA 4IDCA 4E13A 5B4UA 3ZNPA 1I32A 2AA3A 5GMOA 4R1UA 5CDSA 1RM5A 1R4MA 2NNLD 3B1FA 1ZNQO 2Q4BA 4HX5A 4E33A 1P0CA 3I9LA 4Z3KA 4EZBA 4PLHA 3AUTA 1ONNA 3GDOA 3DZGA 3VPXA 3AM3A 3HE3A 4ROSA 2QZ9A 5JDIC 2EIHA 1T4BA 2ZYAA 4NU5A 1P31A 4WNIA 2PA3A 2X5OA 3QVSA 2FP4A 1BHSA 2Q4EA 3JSAA 3JQEA 4Q9NA 1GZ3A 4YEDA 1LLUA 4J1SA 4ZGWA 2BFPA 3BTOA 2CF6A 2J3KA 4GVXA 4AJLA 3CIFA 2I6TA 4CV1A 4ZRNA 3ZWXA 1YH3A 3I9MA 1L7EA 4UEOA 2QRJA 5T8KC 3JD1A 1LX6A 2X5KO 4JJGA 3ASUA 4FC6A 1B8UA 3QP9A 2O4UX 5A02A 5JAIA 1PL8A 3OEYA 1O5IA 1N9GB 5I9MA 4HNHA 2FWMX 2G1UA 2Y0DA 4FOOA 1PS0A 3TFQA 2R2GA 2ZK7A 2JAHA 1XCBA 3JQAA 3EHEA 3TZQA 3WIEA 1J0XO 5HBRA 4L4XA 4FFOA 5JS6A 3KSUA 4XYGA 4RQUA 5FF9A 4DQVA 4WLEA 1MA0A 2FPGA 1G6KA 4JJFA 1D7OA 5B37A 4MVJF 3RKUA 3NUGA 2IDZA 1A27A 4J43A 4RV9A 2CSUA 3QVXA 4IS3A 2H1SA 4TQGA 3DZKA 3TZCA 2Y1DA 3GZ4A 5DCWA 3D5TA 1N7GA 1PZHA 5BR7A 3UVEA 1QR6A 1ADCA 3NGXA 1XEAA 3AM4A 3MOIA 2E6UX 1T26A 4CV0A 2EKLA 2DQ4A 2WE8A 2DPGA 1GDHA 1NR1A 4OGWA 4NJMA 5IXYA 3H2SA 5BSFA 1D4FA 3Q11A 3RWBA 4WECA 3ONFA 4TWRA 5FI3A 4PFJA 3PTZA 5ENVA 3VKVA 3BA1A 3MOGA 1J49A 3M2TA 3ZHYA 3W4JA 1PZGA 2D3TA 1Q0HA 5TNXA 1EVZA 1KVRA 1P1FA 1P1JA 3ZHZA 5IDXA 1FMCA 2H63A 2HK9A 4BNGA 4RF3A 1HDOA 4Y67A 1N2SA 3JYPA 5I8ZA 1VL8A 3DBHB 4PG8A 2XOXA 4OO3A 4IS2A 4QT0A 2UDPA 2X8LA 1NVGA 1IPEA 4RVHA 1F12A 5L3ZA 1GUFA 2IZZA 3LYLA 1BW9A 3F6YA 3STHA 3DMYA 3RU9A 1E7SA 2O3TA 4CLXA 1JAYA 2Q2VA 3BTVA 4BNUA 5CDUA 3OIGA 3VPGA 5JY6A 4RJTA 3QE3A 4G81A 4B8ZA 2X0JA 1BDMA 1HDYA 5JLAA 1T1RA 3ZH2A 4BO5A 3MWEB 4CLEA 3KOUA 1DFGA 2JJYA 4NI5A 1ENOA 5G0WA 4YWJA 4XQGA 1YQXA 3IUPA 4YRAA 1P1KA 4O59O 3HUDA 1QV6A 5F1KA 4L4SA 3A1NA 3IKTA 5B12A 3PGXA 5J23A 1G1AA 3PJFA 3MTGA 3AOGA 3L6DA 1CEQA 4BO4A 4D46A 2NVWA 1N7HA 3F1KA 2PD3A 4G5HA 2BI8A 1IE3A 5JY1A 3KB6A 3JQDA 2P4HX 4BO0A 4XZ3A 4YJGA 3JQBA 1EMDA 5JDCC 5H81A 4Z6KA 4IGFA 2O3QA 3PWSA 3DZHA 2FY8A 4NG5A 2I3AA 4OM8A 3DBRA 4N5NA 4DRYA 1JWBB 4IIVA 2BELA 3DBLB 5EN4A 4E5YA 2XPCA 1J5PA 1MC4A 5ILOA 3ITKA 2P91A 2ZB8A 3ENKA 2C59A 3JQ8A 2NU7A 2OFPA 5U4QA 1I36A 4CMEC 3TSCA 2QW8A 4CQLB 1B26A 2AEMA 5ITWA 3E18A 2X6TA 2VNAA 5JXWA 1AGNA 1X14A 1ADBA 5L51A 3I4FA 4I8XA 4MIEA 3RUFA 4CMJA 3NTRA 4JGBA 3PJDA 3PHJA 4BNMA 3VOSA 2QIOA 4MP3A 2JKVA 2NM0A 5A03A 2HRBA 2PGJA 3WQRA 1BXKA 4MVJA 2E4AA 2B4QA 2F00A 4AFNA 3WLFA 4J1TA 1JA9A 3CSDA 1E7MA 1HETA 4NBTA 4CV2A 3T4XA 3WWYA 4IDFA 1C1XA 4AJKA 5I7VA 2PV7A 2W2KB 4JCOA 1EQ2A 3KYCB 4TMFA 1I2CA 3NX4A 1N92A 2XXBA 1X7GA 4CLHA 1UXGA 3MJSA 4HFJA 1KS9A 3D4NA 3H4VA 4Q3AA 3I9OA 3TRIA 3QSGA 4L4RA 1EE9A 1LQUA 2I5PO 4Y9DA 1LXCA 2QYTA 4J0EA 2X22A 4YJFA 4CMCA 1YONA 1CF2O 4BB6A 4UVHA 2OZPA 3RAJA 4K26A 3BYZA 4PVCA 4Q3EA 2BFOA 4BQRA 1ARZA 2HMSA 2B83A 1YDWA 3O8QB 4MP6A 1KC1A 3VAZA 2Y66A 3WNQA 4AJEA 3JYQA 1NTOA 1ONPA 2JD0A 3EY4A 2YHIA 3H3FA 1HDXA 1PGQA 1B3BA 2QG4A 4FIZA 1U5AA 4ONEA 5MGBA 3HDYA 4DIOA 3EGOA 3JQ7A 1OFGA 1A71A 2Q49A 3E48A 1GQ2A 3E5RA 3L0DA 1Q0QA 1NQOA 1DSSG 2HJRA 4MIOA 1WW8A 4FR5A 4D79A 4R01A 5T64A 1MFPA 2P9EA 3INRA 5T5QA 3WQQA 3ZWVA 5C3MA 1M67A 5CG1A 1EDOA 2NVUB 1AE1A 5H83A 2W8ZA 3WQSB 4B3IA 1GEEA 1VL6A 3QV1A 4J1QA 1C0IA 2WM3A 1TLTA 3C1TA 4J3FA 5DCYA 4RF5A 1GZ4A 4BV8A 4CLOB 2NSDA 2NTVA 3F46A 4BNXA 1H6DA 1KVUA 1KY4A 5F21A 1Y8QA 2IZ1A 2YV1A 2O2SA 2F1KA 2Y1CA 1PU2A 4MIYA 4AJHA 4DPKA 3JTMA 3NT2A 3AY7A 5DP1A 2ZATA 3GNSA 3IUSA 3UGKA 1D8AA 4BIIA 3COSA 1LI4A 5COAA 1P1IA 1UUFA 1WZEA 2BFMA 2UUPA 4R1TA 4Q3DA 1PL6A 1V9LA 3EC7A 2UV8A 1NHGA 1P74A 3NV9A 4KDEA 1RKXA 4RPHA 1AN9A 1DHTA 4LRTB 5JDCA 2HUNA 1UXHA 3EYWA 2UUOA 2D0IA 4PG6A 3PZBA 3V1UA 5DNAA 1SO8A 4Q3NA 1VRWA 3QWFA 4LVCA 2WMDA 3GDGA 4LSMA 1ZUD1 3SVTA 5JCJA 5IXSA 2VT3A 1VE9A 3ROPA 3C3XA 2Q3EA 4FGSA 1F8FA 3AJRA 1LDMA 3W1VA 2NWQA 5IF3A 4IGEA 3I23A 2NUAA 1CQIA 2HRZA 1QRRA 5DF1A 4OL9A 5TS3A 4M55A 3TOXA 1DHRA 2CDAA 4O6VA 3LT1A 4FD3A 4CM1A 1UH5A 3X2EA 2FMUA 2R00A 1D1TA 2I99A 4JK3A 1YL7A 4WLVA 4LRSB 4M8SA 2IE0A 1A4IA 4UUMA 1KOLA 1EFLA 4NFYA 4YR9A 2P68A 4MDHA 2GN9A 4YRDA 3LT4A 1YE3A 3KRTA 2YFHA 4YTEA 1DBVO 4WPGA 4E5MA 2IODA 2OGUA 2YY7A 2ZB4A 1OAAA 3VH2A 3C1OA 4I9UA 4AJOA 1K5HA 5JO9A 1FDSA 5L9AA 1H6BA 1YOVB 5DP2A 1J6UA 1U8XX 1R37A 3WWZA 1IHYA 5IZCA 5H82A 2Y99A 4RVSA 4XJSA 1TXGA 3GVPA 2BGMA 3INGA 4KP7A 4ZRMA 2Z95A 3LSYA 4R69A 3QVTA 4B4UA 1KC3A 5CHEA 2EKQA 1SEPA 1ULSA 3PEFA 2PY6A 4M49A 1DAOA 2E49A 4OKNA 3FI9A 4BO9A 3UXYA 3QW2A 4DMMA 1DEHA 1R6DA 2DBRA 1ZFNA 1ADGA 1PGJA 3H9EO 3HZZA 3O03A 3S2FA 3GEGA 5GY7A 3RJ5A 4D0SA 1DDOA 3CMMA 3DR3A 2D5CA 4AL4A 4K1LA 1F0YA 4W7IA 3C85A 5K0ZA 1C14A 4BUCA 1GV0A 1TT5B 4YYZA 2Q99A 4DGSA 4IQ0A 4PG5A 2P5YA 5GZ3A 1TEHA 1C1DA 1ZBQA 2Q1TA 3KBOA 4GPD1 2PLAA 4JN6B 2WDZA 4HFNA 1SB8A 3DB2A 3F4BA 4NBVA 1BXGB 3UICA 1CQJA 3W6ZA 2X9NA 3JYOA 5AVOA 3TL2A 1WDLA 1HSOA 1T4DA 1ZXLA 2Q1UA 3BMOB 3D4OA 4PLTA 3LC7O 4NZ9A 3WTCA 4IY1A 4BNNA 3HQ4O 4CM5A 4CM3A 3RKRA 4GKVA 4BNKA 1T2FA 1DIBA 3IAHA 3GQVA 5K9ZA 1WDKA 2X23A 4J4HA 5A05A 3DOOA 3WGIA 2G82A 3NT5A 4KTTE 3RUDA 2DAPA 3ZI0A 3GUCA 5TF4A 4BO1A 4CR8A 2NVBA 1EVIA 4XDYA 1C0LA 2VWQA 1HDRA 2D8AA 4F46A 1U3WA 4ZN6A 1ZSNA 4BGEA 1LLCA 5A3VA 2ET6A 3AUAA 1CWUA 4QEDA 2JL1A 5JSFA 1ZCJA 3DAGA 2ILTA 4DLBA 5HS4A 1LRJA 5L4NA 1H2HA 4UVIA 3ZNOA 3P7MA 3JQGA 2WD8A 4XYEA 4L0QA 1VJ0A 1A7AA 4NBRA 4UREA 4Z0PA 3HFSA 1EK6A 1HEUA 5CDYA 1X0VA 4WLOA 3P2YA 3ROQA 2EF1A 2DU8A 3EZLA 5TIIA 3WJAA 3AY3A 5ILGA 3I9KA 3DTYA 1NVTA 1ZXBA 2FSSA 4OSOA 4R5HA 4JXKA 3GNTA 4BMVA 3AU9A 2Y68A 4Z9FA 3UUWA 5AXCA 4RVDA 3C7CB 2DKNA 3AY6A 3GGOA 3FR8A 3ZHBA 3GRKA 3H9QA 4II3A 1PTJA 3UKOA 4W99A 4Z0TA 3HWRA 1CRWG 1O9BA 1AXGA 1DIGA 1W4ZA 4YJHA 3VTFA 1GYPA 5JFOA 1R15A 2EW8A 2RAFA 3U9LA 4MO2A 2AXQA 3NJ4A 4TSKA 3N74A 4RPJA 3C8MA 3U3XA 2CY0A 2HMVA 1ZK3A 3BMNB 2EEZA 3M6IA 3G1UA 1ULUA 9LDTA 2YYYA 4MVJE 5DBIA 2JCYA 3VZQA 4D3FA 1JW9B 4W4TA 4PLCA 1NFRA 5JYDA 1O8CA 4Y6PA 3PP8A 1WNTA 4UUPA 3PHIA 1A4UA 2PGLA 4GSKA 3PQEA 3VTZA 3Q0EA 2LDXA 4NBWA 1CYDA 3KEQA 3RSHA 5T67A 4EJ0A 4BKOA 5C7IO 4FGWA 4L74A 4U6QA 2V65A 3DO5A 1DIRA 4LK3A 3WMXA 3SXPA 1A72A 2H6EA 3EAGA 4YQZA 3QLJA 2HAEA 3DZFA 3PLRA 1Z75A 3BIOA 4DREA 3PLNA 4BGIA 4UVEA 4BO2A 3DC2A 1E7YA 1NHWA 2FPIA 2X5JO 5JCXA 4A26A 1QV7A 1E1NA 3CTMA 1JWAB 2DLDA 3L77A 3FPCA 4GLOA 3JYNA 4GI2A 4E32A 2FR0A 4MKZA 1ID1A 1I30A 5EESA 5JYEA 1HSZA 1X13A 3ZWWA 2VT2A 5KKCA 1LUAA 1WP4A 1U3VA 1WZIA 3RUAA 4DTIA 4ALNA 3FNEA 1DFIA 1EUDA 1M6HA 3GLQA 3U49A 4OKIA 2VYVD 1I3LA 4W6ZA 3OETA 3LK7A 4CUJA 1A7KA 2VYVA 5KVQA 1SBYA 4KWIA 4BMNA 4YAKA 4CM8B 3D3EA 2CFCA 1YQGA 1DXYA 1C0KA 3DHYA 3GEMA 4ALJA 2I76A 5IN4A 3WNVA 2VRCD 2OORA 2DUWA 1LLQA 4BNZA 3BXXA 1Y8RB 2VRCA 3MZ0A 3VPSA 3AUUA 3WS7A 1EK5A 5F5LA 4DC0A 5JC1A 4RDHA 1LLDA 2X9GA 1OZAA 1E7RA 3PQFA 3KVOA 5CPBA 4MKRA 5JBIA 1WXDA 2NACA 1GYQA 1BRMA 1S7CA 3ONEA 1P33A 2C29D 4K28A 2CVZA 3U5TA 3LQFA 3LT2A 4WNCA 4GBJA 3I3OA 4IXTA 4DQUA 1TA4A 2C82A 1S6YA 4CMHA 1KERA 3TDKA 1Y7TA 4BO7A 3WGQA 3QJ5A 4GX2A 1R4MB 4KOAA 1UAGA 4CQMD 3TQHA 4AG3A 3KYDA 3GEDA 8ADHA 5IDWA 4CQMA 1I2ZA 2HO5A 3C1AA 5AQ1A 1NASA 1ISMA 2VUSA 4DYDA 2G5CA 2C7VA 3OQ1A 4TRNA 4O63O 1OMOA 4CL3A 3TZHA 4WASA 4KUGA 3RUHA 4LISA 2AEJA 2ZB3A 4OHUA 2JD1A 5G0SA 3V8BA 3DOJA 2CVQA 1C0PA 3R3SA 1JVSA 4XQ9A 2WYUA 4QTZA 2OBYA 3ZU3A 1ENZA 1Y81A 5JAZA 1HE4A 1YL6A 3EK2A 2C0CA 4IBOA 3O9ZA 3D3WA 1XIVA 4OOEA 3WLEA 2EJWA 4CPDA 1EZ4A 1QKIA 2VZ8A 4N5MA 4BGUA 2IYPA 2HMTA 1RWBA 3SEFA 2QHXA 2HMUA 3DTTA 4QXMA 4E2YA 2H5LA 2Y0CA 4AJ2A 2YQ4A 3H6KA 1SEVA 1UXIA 5G0UA 4IDAA 3JQFA 3ANNA 3E1KA 2C54A 2HDHA 3KETA 3ZV5A 4A10A 4NH4A 4P38A 1NNUA 4G65A 2BD0A
chains in the Genus database with same CATH superfamily
5H7XA 4BIMA 2O20A 2PTGA 4BVGA 3QENA 4N5HX 4Q9HA 2ZIZA 3ON5A 3PQDA 4PX2A 1DTEA 2YIMA 3AL0C 3TG8A 2CVHA 1BXZA 3MSXA 4KAJA 4C2TA 1XPOA 4ED9A 4ETWA 2UXCB 4TROA 3HVJA 2KB0A 4URUR 5LC1A 4NCHA 4BNHA 3DMRA 3HZOA 3R0JA 5I9NA 4RL6A 2ZRMA 5F7ZA 4QLOA 1OYWA 2QRMA 3N7UA 5IAAA 5JROA 1N0HA 4NJMB 1GNRA 1L9KA 3FLBA 5A2GA 4GOJA 5I7OA 3TEFA 1I7SB 2PKQP 1U7TA 1GAXA 4F8JA 1I4TD 4ENTA 1HTTA 5B7PA 5IX8A 5D6OA 1B76A 2GPSA 2ZXFA 1YDEA 2HEIA 2QM0A 3PR3A 3PT9A 3FETA 4PCLA 4WEQA 5EIOA 4ITUA 4LIPD 3WJ7A 1Q15A 1QP8A 2P3LA 3S8MA 3EVDA 3PHGA 4RHUA 4DV3B 4BTVA 5A7HA 4UTPA 1TB4A 3AVWA 1RQPA 2WP0A 5DHQA 2YJGA 4EGFA 3CLVA 1XNHA 5A5FA 2IZ0A 3M70A 4RSHA 1WU7A 4C3OB 4EHFA 2MSNA 1MNAA 3QNMA 3BWEA 2BFEA 5E2BA 2O3UA 1PJQA 3LECA 3WICA 5JARA 4OQYA 4DB2A 4B1FA 4ZCLA 2QSYA 4F60A 1N1EA 5DIZA 1GUDA 4CFYA 1N2EA 4OGFA 1BW9B 5D6NA 4BZWA 2OZEA 5LNK6 1VB5A 4ZJPA 1L4FA 1U3DA 1ZCBA 3DBVO 4X1YB 5AHOA 2YV3A 2HJ9A 1CUIA 3DWIA 2EFYA 1WSDA 1BMTA 3WRXC 1X39A 3B1JA 1CDOA 2HQ1A 2XQKA 1AGXA 3VUEA 3CLRC 3FWKA 3V2GA 3U4QB 1BS1A 4FKMA 4DLTA 2AB0A 4QU5A 4PONA 2XOKD 4RXTA 5TXGA 1U0EA 1RJGA 1V4VA 4KUHA 4M9XA 3V97A 5IS2A 1KU6A 4H4EA 1S7GA 4L8VA 4DSUA 3J81A 3MS7A 3A1EA 5JTUA 1ZGCA 3V48A 3I5YA 2CCKA 1O6GA 2JLYA 3LG2A 4XQCA 1A5ZA 1NVFA 1IUPA 1R5JA 2JJ8A 1T1GA 4R8KA 1ZLYA 4DSZA 3ZWOA 5NLLA 4IGIA 3N2ZB 3IHLA 4EA8A 4LXHA 2HLPA 4WVFA 2BTQA 3NI2A 2AX3A 4YHBA 2A86A 4EP1A 3G89A 1RCFA 1CZOA 3AUSA 3LCRA 3IEVA 2H2DA 2W0MA 4RD4A 4XVQA 1TJNA 2X4GA 4ZQGA 1E2IA 4P4LA 1V48A 1ZESA 5L45A 1DC7A 3K0AB 2V74B 3VSBA 5EE9A 4ZO6A 2NUPA 4CL8A 5TPWB 2A0WA 1ZJ4A 4XRRA 2Q3BA 4FCWA 1RWQA 2RGAA 4K9RA 2YZKA 3AEKB 4RZHA 5LYJA 4CLRA 2FSIA 2W98A 1KYXA 2OG2A 3AOEC 2OBXA 1SU4A 3L4KA 3HRKA 1XMQB 2Y67A 1M2JA 1TVEA 2DM6A 1NVVQ 3BMQA 3C5CA 3CEJA 4XSVA 4NJEA 4EYGA 1ZR2A 4FOPA 5G2OA 1EFPB 2ZUCA 3D0OA 3LX5A 2HF9A 4QYIB 1L7RA 5JDIA 3IOEA 1JDSA 1G63A 4IFTA 1RRFA 1Q12A 3PITA 5KO2A 1AKQA 4M0DA 4PPYA 2VHEA 4K9QA 3AVOA 3TL3A 1BX1A 4DILA 5EVCA 3BWMA 3QF4B 3HVRA 1Z17A 5DK6A 4RS4A 4HGRA 3QHAA 2Y71A 1MG5A 1G5TA 2WFAA 4FNAA 2WAMA 3HY4A 3OJ0A 1G21A 4PX5A 1XJ0A 5F52A 1FFXB 3NOXA 1MO4A 4UUAA 4XEUA 4RGQA 1K9VF 2HA6A 2VPTA 4W9MC 1F2UB 1CR2A 2BDUA 4R8LA 1R2QA 5DIFA 1TMOA 4DWOA 2BM1A 2LWIA 5ED0A 1QIMA 2QX8A 5A1TA 2ZYWX 2FRXA 2A5JA 4RA6A 1EWQA 4EWLA 3PTLA 1ENYA 4R1NA 4MS1B 1NBMD 1HFEL 1MQ9A 4ZDKA 3EA5A 1DBPA 1T36A 3IHTA 1M1NA 3O4RA 3OTIA 1YBVA 1QPGA 2ZRBA 4BNYA 1HYBA 3F0TA 4PLFA 4E21A 1P0PA 3GJQA 4E3WA 2AOXA 5CEFA 3HFJA 2JH3A 4QYTA 3WOVA 4I66A 2CXUA 3HJBA 1NVWQ 3A37A 3PWZA 2W2MA 4PINA 2H2HA 5JNSA 4Q4DA 1R5OA 4M87A 3UJ8A 2W4IA 4IILA 3GJ0A 4E2ZA 1IJKA 1PJLA 2PZMA 2C07A 2RKOA 4YCAA 3WK7A 3L0YA 3ZX4A 4AMZA 4Y2YA 3LV8A 2X6RA 3GMSA 4AYWA 4AY5A 3A9CA 3K3PA 4ZEXA 5GIOE 2WVGA 2ZSKA 4ZANA 3NP9A 3AZPA 3KR1A 5AP9A 4ESVA 1PZMA 1DC4A 4M9CA 2AJLI 4KXVA 4Q1FA 2XF8A 1I5OA 1SPBS 3S70A 3FKQA 4IQ8A 3SLGA 2F59A 1W46A 4XTCS 2DSTA 3QU2A 1Q5PA 4DLSA 3SQMA 1ZIYA 3TZ6A 1I4DD 1I2AA 2EZ8A 1V5FA 1CXZA 2PJZA 2GVDC 4EJ2A 1SQGA 4ENRA 3E9CA 1ZGGA 2OD7A 4IH9A 2V7UA 4NNOA 1DRVA 1MO2A 1NZFA 1RRKA 2K2QB 3IMFA 5FOVA 3VOTA 1G9TA 3RHFA 5EIXA 4JBLA 1SKMA 4M83A 2QTBA 2W48A 4GR5A 5DT2A 3STYA 4E5UA 2FPWA 3UMFA 1QHFA 3FTEA 2XNKA 3NBAA 3BKWA 4A15A 4HGNA 3TR6A 2R7AA 1AKTA 3VC2A 2DG2A 2W2KA 2RJNA 3KYCA 1L5OA 5CDGA 5K3EA 3RHSA 4ZYZA 4WWHA 4YAIA 1U5BB 3FWZA 1B2LA 4MR7B 2VSNA 4TQUS 4G85A 3A1FA 3KM0A 1WG8A 4YACA 1YJAA 1Q74A 3HB7A 4RJIA 2FQXA 1U7XA 3CR7A 5EZQA 2DUNA 4P5EA 2C3PA 2CZQA 2GM5A 2BHNA 4LI3X 4UULA 2V0CA 3DHWC 3EIFA 1HZJA 3A6PC 1THZA 3EEYA 4OU5A 2PNFA 2P9CA 3A28A 4O08A 4PG7A 4BGVA 5LUAA 1LSJA 2C1ZA 1V35A 3QI7A 1L7PA 1FRFS 2VAWA 2N42A 4IDPA 4QUKA 3PUYA 2C42A 5K3SA 3OAAD 1QX4A 3GL9A 1VSBA 1XZDA 2J31A 4I2NA 4EJFA 5CT9A 1KH3A 3H8WA 3RS3A 3Q6MA 1Y1KE 2H18A 2BBTA 3LSTA 1M33A 4KX5A 2FEPA 3FVTA 4NVRA 5D85A 3RFFA 4J4TA 5T6BA 4AUMA 5A4KA 4P22A 4B7UA 5KDOA 1USUA 1G1MA 1JTVA 2Z2KA 1I0ZA 3KOYA 4RKRA 1T5SA 4NV1A 5BVGB 3CN7A 4G5QA 3Q0TA 4DAOA 2WHEA 1YVRA 4NEGA 4CG3A 3FRHA 4CNQA 4JVNA 4DA0A 1WV1A 4PG4A 3REGA 1TQ4A 2R7KA 2PDAA 1I13A 4PXAA 5GV8A 4E2FA 3FPFA 4X95A 3KOXA 3T9AA 2ID9A 1RPTA 4ND3A 1NQWA 3GT3A 4R16A 1NVKA 1MO3A 3ETGA 1N5KA 5FR2A 3V34A 3VU0A 1FU4A 3N86A 4HDNB 1W4AA 1JYSA 1RQ2A 2GYYA 4F04A 3TKLA 3UJHA 4D0LB 4YMLA 2NUAB 5LU8A 3K0FA 1JS1X 4NG4A 3RB8A 1B8OA 2VTVA 2ZBDA 3G9TA 2HFJA 1DT5A 4CIXA 2IHZA 3CZQA 3UMCA 1G3RA 2BCJQ 4G86A 2CMFA 1HYEA 1UEJA 2XUDA 2R65A 4K9OA 4MEAA 3Q2IA 4PZCA 3FRJA 4KV9A 1Y7PA 2HB6A 3DKKA 3I0MA 4RBNA 3OFSA 1U8YA 1UFRA 4GX0A 4WTOA 3PXBA 3FHLA 2FJUA 4I1IA 1JDUA 2BMAA 3EZ9A 2ZTLA 3P94A 4Y30A 3UIEA 4EJMA 4KITB 3O2QB 2HHJA 2QRVB 1RR6A 1U2DC 3WB0A 3WWEA 1W1IA 3DE5X 4HPXB 3X2FA 1MC5A 1YC5A 2YS7A 2D2IA 3I37X 5CVJA 2JARA 4IXDA 3D6TB 1Y9JA 3H84A 2BRUA 1ZAKA 2Q6VA 5IG2A 3OCVA 4EPXA 2Z8XA 4TZ6A 1RMYA 5AVXA 3DTVD 4WESB 2O8EB 2DT8A 2H5EA 5AW0A 1V1MA 3TX6A 1YS1X 4NLLA 1CR1A 3D0RA 5AH0A 1N0IA 1X8KA 2O14A 2CVFA 3AMVA 5I8WA 4MS3A 4R9RA 1A88A 3KL4A 5BRAA 3HWSA 4FXOA 1MJFA 3EISA 3PFFA 4KO3S 3BF7A 1QQ7A 4WY8A 3EVEA 2ZUWA 4HTAA 5E4YA 4M8KA 1GGKA 2DBQA 3E3LA 1E2LA 4LXQA 1OA0A 2V6GA 3JZMA 2G40A 5F4BA 1YZUA 4HV4A 3SVZA 2Q5LA 3HR8A 4XOUA 1B16A 3RAEC 2Y1KA 4WZBA 4BX2A 5ALOA 2QTLA 4BMPB 4XFDA 9ABPA 2F43A 1W30A 4BLPA 4C7VA 4UTNA 2ZPUA 4X84A 4ZZIA 1N6PA 1Z5WA 1GNTA 3NS7A 5CB8A 5JQGB 4EQ6B 1UFVA 2Z6VA 4D9CA 1YHYA 2QTGA 4CMIA 2F8SA 1BFUA 2FDXA 2FRVA 3BXGA 3L7IA 2CN1A 1DEAA 4LJ5A 2AI2A 5BSWA 4WN9B 4HXEB 1TE2A 1JIUA 5H5JA 1XGKA 1L6IA 1XO1A 2AK3A 1O94C 4PSDA 4E03A 3A04A 2QP3A 4X64B 4LHWA 3NCHA 1OWPA 4J07A 3FROA 2H9IA 3V32A 1R5NA 2WIGA 3KU1A 1R27A 4ZQHA 3KZVA 1M73E 3LP5A 4JEMA 4RX1A 4XIFA 5GGYA 4BUJA 3HXKA 5ALPA 3V3TA 2J32A 5BNFA 1CY2A 4WKGA 1UAAA 2O0MA 3AESB 1YDMA 2Z0MA 4NBUA 4MUAA 4PW0A 2C9DA 4B4WA 3ZW9A 1CQJB 2WZCA 5LPNA 5HYVA 2A2ZA 2QU8A 1EVLA 1V1JA 3EEBA 2Q2NA 1CP3A 4FJ2A 3GVXA 2GAAA 4BDSA 2R2AA 3K92A 4RTRA 1WHSB 1JXAA 1YZQA 1IBKB 4UBIA 1Y6JA 3TOVA 2VDLB 4OXIA 5EY5B 3QEAZ 4Y9SA 2QQ0A 1KFKB 4PZAA 4BVBA 1PZEA 5LKRA 5K3CA 1I33A 2DJ5A 2F17A 2OHOA 1OBVA 3X1DA 1GITA 2R86A 3T7JA 5JADA 3OECA 3G68A 1A96A 5I01A 4DT1A 2NZYA 1Y1TA 2G9RA 4J16C 4PQGA 2XT0A 2ZU6A 4QC2A 1NI5A 1P1BA 1AIPA 4YAFA 5AVZA 3NEJA 4ZMBA 1I5EA 2DWPA 1LQTA 1LSUA 1ZSVA 2H1WA 3F3MA 3ELYA 3NGMA 4YMIA 5JMPA 3ANMA 1RM4A 3IP7A 4MR9A 3ZGXA 3BWYA 4Z9XA 2B9VA 3UMRA 1PR3A 3DL7A 2R4UA 2VL7A 2V6FA 2WAXA 4DQLA 1T3SA 3R4VA 4P3OA 3UTDA 1IN4A 2FPSA 3B9BA 5EIWA 3FKJA 3TLKA 3VNVA 5JS8A 5K5EA 1X8LA 2PQ2A 3IEPA 3MELA 1QVRA 3A4IA 1KPHA 3GGDA 1S2MA 1G8HA 5KTNA 3H5AA 3LYAA 2C61A 1N5DA 1CIVA 1PI3A 1HLFA 4DM7A 1W85B 3I0ZA 5REQA 3BHNA 4EF5A 2WKWA 1SD5A 4CMBA 3K70B 1GA1A 2WLSA 1T4MA 1A9RA 1Q92A 3FCAA 1OWNA 5JISA 3OE1A 4DV5B 1W76A 3VPHA 2P7IA 4RHCA 3NBUA 2AI3A 3LPDA 5G40A 1QTNA 1XAHA 2VXOA 1PKEA 3KHTA 1XFAA 3E8SA 2YFQA 3PIIA 4KNWA 4LWQA 3UV3A 4DBZA 1WKBA 4G9EA 1RAAA 4KYTA 4UBOA 2BF7A 2FFJA 4UC0A 1P7WA 3L7JA 3DEFA 3BSYA 4EECA 2BI7A 1YR3A 1YZKA 2RDMA 2FGJA 1VCIA 1Z39A 2OZKA 3F2IA 1YK1A 4X93A 3I1IA 3T7KA 1KQPA 3H9JA 3RS2A 2AZMA 2YYSA 4GP6A 4DOMA 1QDEA 3AFOA 4D9MA 4OHZA 4FBLA 4YUXA 2PS9A 4NSNA 4ZVKA 4BX0A 4YX9A 2ZWAA 4WOJA 2ADFA 4D5EA 3VDMA 2IXAA 2VH1A 2G8NA 3ZJ4A 4LDZA 1UM9B 3FYCA 1F9AA 4LDQA 4G0XA 4RJJA 1IZ9A 4IMIB 3MT9A 2IK8A 2HA0A 3DDNA 3UAVA 5JQWA 1EX6A 1HGXA 4UHHA 1Z4QA 4RMNA 3L9XA 5EC8A 3Q85A 1GEGA 3R75A 4DMRA 5DGCA 1G6HA 5AI6A 4XFJA 3K70C 1ZN9A 1CUWA 3AJAA 1CJVC 4H2DA 2QTVB 4QDTA 1O9HA 2RGNA 4JOSA 4WACA 4IAOA 2IBSA 1NF2A 3URKA 3B1ZA 1QG2A 3CKYA 1O95A 4LY0A 3NKVA 2RGDA 2E6KA 3HKCA 2FWRA 3D8BA 4GM1A 2NLOA 4QUBA 1D1PA 1VG9B 2G9UA 3L79A 4OAQA 4F7WA 3WWDA 3I5XA 2WINI 1ULHA 4XB2A 4Z3DA 4FBMA 3CLSD 4AXBA 1WDMA 3EQ2A 1E2MA 4OLJA 4F6LA 2BGIA 4LTDA 4BVAA 4DS3A 4OB6A 4LF7B 1USWA 3QPUA 5AW2A 1L4EA 4X91A 2CDNA 3WHIA 2FW1A 1LK5A 1QF9A 2NYAA 2CGEA 3E7XA 1NR5A 4D9KA 1XXHA 5C1PA 1GUZA 3CCCA 5KYYB 1GL3A 5F77A 1X7YB 3KXPA 4U7GA 3A4TA 1DWUA 1BJKA 1DRUA 1Z16A 1QR2A 1EG2A 1CQPA 2XHEA 3IQZA 4U3JB 2ZUBA 4RTKA 1TUBA 3LLVA 4YT5A 2CJYA 2EV9A 1EUDB 3FFAA 4JJEA 4Q82A 5C53B 2Q5CA 4CKWA 3LF1A 2A0FA 2XLBA 3SC4A 2ZUEA 3KXIA 1SQ6A 3QTTA 3G8YA 1IULA 1E4YA 3AONB 1A7JA 4RLQA 4UNPA 2QENA 2WVJA 3A6JA 3FZYA 4NU8X 1AMOA 2JHFA 1Q44A 2NU6B 4W5TA 3H1GA 4YO7A 4AMVA 1RBZA 2FW6A 4CV3A 5KU7A 3EFBA 3ASVA 5KNCA 3G49A 1CETA 2WDPA 3UHAA 4XGRA 3EIQA 1VKHA 2YC2C 3PGMA 4OA8A 1MC1A 2FCAA 4QPDA 4BWVA 5CB4B 3V8MA 2RHWA 3IO5A 1FDTA 4TPKA 1QLJA 4KQCA 3SYMA 4NK4A 4OQZA 1QYWA 3N6VA 3ED1A 3D3JA 4YVFA 1T1EA 1DJNA 4ZCSA 2ST1A 1ZJJA 3PFHA 1TM1E 2HT6A 4G01B 4UNNA 4D4MA 4M0UA 3H2YA 2ADOA 2N3ZA 4K0RA 1BYIA 1ZW1A 4LGMA 3DZCA 1LH0A 3VUFA 1TVCA 4ML3A 2VDKB 2DPYA 2OFFA 3RK4A 1E1RA 2Z04A 4MWTA 1YJBA 4PIVA 1PJ3A 3VSEA 2AEFA 1CUYA 3KQYA 1LQ2A 4LGCA 4PTLA 1YR1A 1ZNWA 2IUSA 2ZRGA 3DMDA 4ZVRA 3USZA 3GLKA 3U3DA 2YJTD 1QKKA 3KYDB 5SY4A 4OYRA 2JJQA 4HG2A 2QRGA 1VHWA 2GLXA 4NYJQ 5LOVA 3IDFA 4QVGA 1TMGE 1DLIA 3IJ5A 4OIMA 2E4ZA 4CM8A 3U13A 1UXJA 1R88A 1Y4ZA 4Y2GA 1FRVA 1T5HX 2HSDA 3V4LA 2OFWA 3LZCA 4HS9A 4X00A 2JLQA 1TOAA 1JEQA 3ABSB 3FSGD 4TRRA 5KWEA 4TKMA 3FOZA 5JNUA 1ST2A 4H31A 1W5EA 3ZU5A 2JF0A 1IFXA 4C4OA 1E1MA 4L5IA 1BKYA 3QYJA 1DUVG 4M36A 1T8SA 5HQTA 4KHZA 1CFZA 4MW9A 4BN5A 2P67A 1DKLA 3DNPA 5LXTA 1GRCA 4OTZA 4MV1A 3H3JA 4UBKA 1CYEA 4AF6A 2XE6A 4ND5A 1U2QA 3ITEA 1JALA 2PZKA 3P4YA 1ZRMA 1ZRSA 3PWTA 3PKZA 4O4HF 3OY7A 1Z45A 1SC6A 1SVMA 2VP2A 3CJTA 5DI3A 5LP6F 3RVJA 2R3SA 2TMYA 3K0BA 4XPZA 4L5JA 1LS1A 4BFYA 5BNTA 1DJOA 4I5FA 3OEED 1NXWA 4L5AA 3INTA 3CVYA 4XD2A 2YIJA 4M9QA 5HJ7A 2P78A 1XTVA 2C4TA 3FOAA 3KSMA 4A9AA 1YULA 4HAXA 2ZQ5A 4LYJA 5EL0A 4LFAB 1LY1A 2DC1A 2Y0PA 2VNJA 3CLUD 1Y48E 5BT9A 5KYTA 4UHDA 3HJFA 4HRXA 1GT6A 4ZQEA 3HDHA 2NO6A 1X9IA 4QPZA 1UADA 3H2JA 2BKAA 4HFMA 4JP2A 4ZJUA 4AO6A 2HUPA 3CR3C 3QMMA 2A4MA 4Q7QA 3DHEA 3AYXB 1ZO8A 1MTZA 4F2PA 3VR6A 2QLLA 3ET4A 1RU3A 7GPBA 2TRSB 4IIEA 3PG5A 2VZ0A 4B2YA 1DZ3A 1KI8A 4X90A 3TO5A 5DU2A 3QVOA 4IUYA 1J70A 3ZKAA 1LBEA 5BN4A 3AINA 4U02A 3GVCA 1YVUA 2GCEA 4P3XA 3I39X 2AFHE 4TYWA 1VI2A 1H05A 4MVJH 4V0OA 2D59A 1EWKA 4QGGA 1O97C 1E6UA 4R68A 4Q3BA 4B3DA 2YX1A 4CKEB 2OV2A 2VYND 4ALLA 2HEGA 2XB6A 1XU7A 1IM5A 1I10A 1PS8A 2H1HA 3F67A 4MV5A 5AK0A 1BRTA 4RH0A 3A4MA 1Y1QA 3A14A 5TVGA 3RIHA 4UFPA 4X66B 1MHTA 3IAXA 3E7FA 4ZK6A 3DP9A 1M1XB 1KA9H 1YMVA 2IELA 4NY1A 5ITVA 3B13B 4XH9B 1I1OA 2VHVA 3LF2A 4KLZA 4K6FA 1ES9A 1H66A 3K0EA 3BQMB 2IP1A 3F97A 4PLVA 2ID8A 4Y1RA 4YRTA 3BGDA 3SD7A 3SZ3A 4BN4A 2J3DA 3ZVMA 1TJ4A 2CNWA 5L6LB 2OBLA 4A4DA 1MX9A 2JFFA 1TF2A 5FBLB 3RSGA 4FJ1A 1SKBA 5ESXA 3PJEA 3PT5A 1U6KA 1I1NA 1Q2XA 3C3MA 4QDUA 4BVEA 4WBNF 3U4DA 2YHSA 4CQJA 1J5XA 4KEAA 3TVTA 3VH4A 2WYHA 3JALB 2I4MA 3SQWA 2LVBA 2GEDA 3OPQA 4FXPA 1QUFA 3WYFA 4P36A 3ETEA 1YZHA 1V95A 5KOHB 1YQTA 2JGEA 1JKMA 1HRKA 2XAAA 1C8BA 1IDN1 1M7HA 2O0JA 2NTNA 2XB4A 3NBYC 5JZOA 8GPBA 4NCAA 1CRQA 3U2QA 2G28A 1YZFA 2LGJA 2NV6A 4R3UC 5FJIA 5KHAA 2OXIA 2J0QA 3NLLA 5CM8B 1UBKS 1ZI9A 4RH3A 5L7YA 1PT5A 3FYUB 2HLDD 4NECA 2EX0A 2O2DA 2NQTA 1UC9A 2H06A 5BR4A 3P2JA 4LBWA 1QZ3A 3OU6A 5F33A 2ZRHA 4ER7A 3PXUA 4MNTA 2G25A 2ECOA 2HV8A 2QTNA 3HU1A 1MD9A 1WVGA 1WXXA 2H4WA 3LUHA 3UMYA 5DX1A 1F1BA 5JAMA 1DKMA 5FIUA 3RVKA 1UP7A 3LUGA 2VF4X 1D6MA 2PWBA 5TJHA 4BVHA 4JI0B 2PQ0A 4MW4A 4MYRA 2CSXA 4AIRA 2CHUA 1TX4B 2P3QA 5ES3A 1NTRA 1HYHA 1UK9A 2RHCA 4W5NA 3A36A 3ZZUA 3LC0A 4PYJA 4UFOA 3K1AB 1JQ3A 5TMEA 4IO1A 3U4QA 1SG9A 2WZQA 3LBFA 2ZREA 4BWYA 4E14A 9ATCA 2ERYA 2EX4A 4LJ8A 1Z5GA 1O89A 1X9HA 4DIDA 1FXWF 4B7CA 3FCYA 3WGYA 4Y1EA 4UM8B 1Y9EA 2BMWA 4LVOA 5FWYB 5LD2B 1QLHA 1BVRA 1CLUA 1SCAA 3GUVA 4N8SA 4PQFA 4KVAA 1NSFA 1P75A 3SNKA 5EMLA 3GPDG 5KBYA 2QXYA 4YAUA 4DSTA 1PD1A 1ZUHA 4M6WB 2Q7OE 3FTPA 2PZJA 1CVIA 2P69A 4I46A 4ARZB 3U5ZB 2ZTUA 1IONA 1W0JD 1EEHA 1Y1RA 1YK0A 2AJBA 5B1DA 3WLIA 2MINB 1XZGA 1KZ1A 1Y63A 2VTKA 1PHRA 2ZQZA 3EIWA 3LBHA 4FCCA 5CX4A 5B3AA 4AMGA 5F2OA 2HO4A 2NPFA 1VJGA 3TPZA 1XN1A 3ICPA 4Q4JA 4WDRA 1W35A 1XSEA 4FYXA 3ML1A 4LMRA 4N7JA 4OKSA 1WL8A 3ZDXB 2ISQA 2Z4SA 5KSWB 2J3EA 3I6BA 4V24A 3PPVA 5E1DA 1QF7A 2BDEA 5FEUA 3R7WB 2ZYSA 4C7JA 3EB9A 5JE8A 5JCOC 2XZTA 3ROEA 2GD1O 3G8BA 3A4VA 3CVWA 4OK5A 5ICSA 2A7XA 4WZAA 3M4NA 4L0MA 1CDZA 4HTFA 2YJ6A 4PVDA 2H2IA 4G0MA 1YRQA 2NTYC 4M1ZA 4RIGA 5EUBA 4JYZA 3KEOA 2CLLB 3BHMA 1EFPA 1MAUA 2DHQA 4MWDA 4YI5A 4YXWA 2WU1A 1DWPA 3OPMA 3PXGA 4RTQA 2QN2A 2OLKA 3KHSA 3WLQA 3QVGB 4EY3A 3VU1A 3QF4A 1G17A 1JR3E 2EGGA 1E0DA 4OJYA 5BSKA 4X3OA 4CM9D 4E30A 4F5DA 3L4SO 1Z3IX 1VLVA 2I66A 2BH9A 3DYBA 4WXYB 5DHTA 1CW2B 3V1YA 3UK7A 4ZO7A 3BZWA 4GWGA 1FFXA 4UCQA 5F5XA 2Y2UA 3UW3A 1UBUS 2G4LA 1U7HA 3FDZA 3KR0A 5BNZA 1XZPA 2FJPA 2FETA 1F2UA 4IRUB 2DFTA 3RVMA 4AUKA 1WVMA 5IH3A 1E3SA 2HPVA 3TW0A 3WQHA 4C5AA 1K66A 3R0XA 3RS9A 5AO9A 5DGDA 1UKBA 1TZKA 3PDUA 5DKFA 4WE3A 4BJ3A 4DLPA 1KZ6A 3HN2A 3ZU6A 4C3UA 1EP1B 4MS1A 4ZPJA 2RAVA 1U0JA 2RGRA 3LTNC 2B35A 2GTPA 4AZWA 1MNQA 3Q9NA 3VHRA 4FB5A 4OU4A 5D3MA 3VHXB 5EJ4A 1FCJA 3T7EA 1EGMB 1WXHA 5J2TA 1YR7A 4RHFA 1R8JA 2G04A 2O8CA 3VMMA 4C7XA 4TTTS 5AJHA 2QLBA 2O3SA 2WI8A 2VHQA 1K86A 1QIDA 1ZGHA 5BSUA 3SE0A 1CLEA 4R71A 4HKTA 1M8KA 2ZSFA 5TY0A 3RYHA 3CPEA 3QKUA 5BSMA 1U28C 2A1IA 1N4DA 1KSGA 1WNFA 3MBKA 3T7TA 4I4CA 1I80A 5K3DA 2VA9A 2O48X 1RIIA 5JVDF 1H93A 2JGIA 1O4WA 2OGZA 4MGKR 1MV5A 4KSBA 5DYIA 3II6X 2ZE5A 4AZ0A 4RTNA 4JP8A 1NOIA 4Q4HB 3EVTA 4GQBA 2H4HA 3FB4A 4B9EA 1USGA 5I9BA 5L3ZA 1BMDA 1L4YA 2CKMA 4QTUB 4QJIA 4QBHA 4RZ2A 2VHCA 1ZMTA 2P0EA 3A27A 3EQZA 3P20A 3IAS1 4JJIA 2ODPA 4X1KB 3V9PA 2K87A 2C96A 5A4FS 3QLVA 4RVNA 2FN7A 2BH2A 2CLEB 1HZZC 4LQCA 5TPZD 3I5MA 4XGNA 3RSOA 4BP3A 2JEZA 3GH3A 4JLBA 1XZJA 2YICA 4KE6A 3W77A 5AXBA 5HRAA 4JBGA 1JSLA 1UC4B 3BX1A 2SHKA 5K3AA 1UMCB 4IL5A 4HVCA 5JCZA 1S3GA 1UF9A 2FUKA 2QU7A 2G08A 4D97A 4EHJA 1KWGA 3RG2A 3IC5A 4OHWA 3GR6A 4KO1S 3L43A 4YV2A 4HGPA 3CB2A 1LPMA 4MR7A 3CB4A 1ZONA 4PSKA 3N3BC 4OMCA 5EJAA 4B80A 3BB1A 3ZU2A 1PBNA 3GJZA 1PGPA 5ELXA 1W48A 3B6EA 5AUPB 4HR7A 1G66A 3BA6A 3HDVA 3MD0A 3OJOA 4RKWA 4GH5A 1POXA 2A0UA 1JUDA 1N5LA 4IZHA 2XBMA 3PFIA 2UKDA 2WIJA 2WSMA 1T0PA 3NM5A 3RUCA 4AJJA 2NVUA 5AVJA 4BRSA 5NULA 4C0QC 1UDAA 3OBIA 1SUCA 3E9RA 1PX0A 2IXBA 4I1OA 3A2NA 1PAUA 1KVQA 2H5JA 4YCMA 2IYYA 5M34A 3F90A 4TS4A 1ZNZA 3EBOA 3QVVA 4I9HA 5L7TA 1KS2A 4D3ZA 1ESZA 3ZWNA 4FGJA 5MHTA 4MYSA 4WHMA 4ALMA 3D2CA 5AM4A 1M34B 3IXMA 1HDCA 4FP9A 1K7FB 3WHLA 1XKQA 2PUAA 3CN9A 4HQ6A 5EMKA 3R7AA 1EK0A 1W47A 3FNQA 5BVGA 1BFDA 3WYBA 4QDKA 3T5DA 2W0SA 3K30A 4P33A 4BO6A 4F3RA 5J4LA 2E87A 3CX7A 2I22A 5MN4A 4JLMA 1SUWA 2ZVQX 5LQMA 3EZXA 1ZUIA 3I1YA 5IJAA 3TXXA 4A5SA 1FS4A 3DTVB 1W2WB 4DV7B 4AKGA 4D43A 1OLXB 3SM9A 3HADA 5JWHA 4EFKA 1HK7A 3WADA 4BFTA 1CY4A 3LUAA 4ZOQI 4HDNA 1K88A 4OHYA 3IP6A 4OQMA 4IEIA 5ALMA 2JIOA 2A59A 2JLAA 4GPTA 5KTOA 5KX5B 4B3CA 3E1SA 5EE3A 2E4UA 1SUPA 1LTQA 2FKNA 2AG8A 2XNCA 1UZLA 3OU2A 4GMGA 5DHFA 5C5IA 1R16A 4PCUA 4DXAA 2IY9A 2QUAA 2V7BA 4GW3A 4I4NA 1X0XA 3LZ6A 3PCRB 4YRCA 1BFKA 2WB4A 3F98A 5A6SA 5EUMA 3KJZA 1PUIA 5DH9A 2YQ5A 3QHQA 1UT6A 3RQIA 3KLPX 3HN6A 1JQLB 4RFVA 2V6JA 2Q7XA 1EFVB 2ODTX 3HVIA 1X15A 1EBUA 4G1BA 5DW0A 4Z9YA 3VKFA 3G3EA 1F14A 2WW8A 3I34X 4HUQB 2YWFA 3I2KA 1E77A 2OEPA 1B14A 4UW9A 3T4PA 3SZLA 4U1RA 4FIDA 1SIOA 1UJNA 1N3LA 4I50F 5C9ZA 1OI7A 2XCIA 1KMHA 3OICA 5E4TA 16PKA 5EJFA 4BJ5A 5ALSA 2NTJA 4WESA 5CCXA 2HHAA 2O8EA 2AXPA 4RAQA 4MWGA 1F3OA 1KY3A 1V3UA 2G9QA 4G1MB 2E37A 3EUFA 1YZTA 3AJ9A 5AVSA 1HH4A 4K6GA 2HQSA 3UT5A 3X1KA 1R18A 2R68A 5K45A 3RSLA 2ZP1A 5H4GA 4N9QA 4QM7A 5H3HA 4JJ8A 3KXDA 4HQKA 1OVGA 5AM0A 5GJBA 1Z6ZA 4EPRA 1JFTA 4OJTA 5K3OA 2PXHA 4HX2A 3CZAA 3OEHA 1VYVA 3V5NA 2BTOA 2B4AA 1B41A 3CONA 1L3BA 1P2BA 1J8FA 4DV4B 1M6YA 1KE2A 2BEWB 4HD8A 4DNQA 4XIGS 5JQGA 1G8MA 4MHOA 4UMFA 3KQHA 4OUKX 1PF7E 2R85A 4DE5A 2BZ1A 2LIVA 3GB9A 3VHQA 3MA0A 2YHUA 4K9KA 4ENVA 2Z5FA 3H17A 4LOAA 4XPIA 2GI4A 1OAOC 3IOYA 4I6EA 4WN9A 4EMUA 3JRNA 4NENB 5DBEX 3TLMA 4IKOA 3VU8A 3EH2A 5DM60 3O4IA 4RK4A 1UWLA 3SJCA 3L05A 4EQZA 3B85A 3DE1X 1HORA 1E62A 2NZVG 3GD7A 1PEAA 2WAYA 1IXKA 2QJRA 4HLQB 1Q83A 5KNCH 3V80A 5BYBA 3T54A 5EJ6A 3EDMA 1E7QA 4BAZA 3KZMA 4PLZA 5ENDA 2ATVA 1K7XB 4WL0A 3OQBA 1QH1B 2R79A 4RF4A 4D56A 5KJ1A 3C6QA 4H7EA 3UCFA 3BJEA 3OIDA 3IVCA 2SNIE 2DQYA 3P97A 1WV0A 3RREA 3PNQA 2FX5A 4RA9B 4XARA 3UG6A 2GN1A 5CXXA 3HDGA 3L6BA 3QLTA 1R0YA 4U9HS 3VYUB 4FFNA 5IWAB 1M5RA 3ZHCA 4E22A 1R0XA 2WF9A 5D3QA 1GGMA 1M2VA 2AHOA 4PSUA 3SLRA 3AERA 4KQ2A 3TH5A 2X7JA 2D8MA 4UM5A 2WQZA 3KSAC 3GFOA 2H9AA 3VZBA 1E63A 1I2MA 2GRAA 2ZQYA 3DUWA 4P4UA 5JHHB 1DQPA 5JYBA 4LVUA 3OIUA 4UJ5A 1PWEA 3S29A 5A04A 3TR5A 3RPEA 3CVXA 3MJCA 3OMXA 2G09A 3I62A 2B30A 1L4MA 2J5KA 4FX5A 1JB1A 4JLAA 4GX5A 4LCEA 4RETA 5A0FA 5TT0A 1E9EA 5LZ7A 4AC9A 4DIKA 3VTKA 4KPYA 4ZEVA 3KSZO 3QFFA 5EWMA 1RAEA 6LDHA 4HADA 5SICE 3KV1A 3IFSA 1YUMA 2QUIA 4B46A 4YT4A 4QEKA 2GESA 4LC0A 4MI9A 1R4ZA 4P2GA 3ZLUA 2PUWA 4KHPB 3EXHC 5DBFA 4I99A 4ZJYA 4DY6A 1JR6A 2XAUA 2QTMA 3SPXA 1G7TA 3ENVA 3HO8A 4ZDJA 1VJDA 2PYZA 2E4YA 3OPNA 1A76A 1XDGA 1W93A 3GAAA 3HL0A 4BMDA 4DF3A 3A2KA 1E5TA 3ETNA 1GWNA 2FHPA 3NCTA 3FSJX 1U4OA 2R25B 3HCWA 3ZGVA 1BCSB 1T5OA 1SIWA 2CLIB 4HP8A 4Z3OA 5T4HA 2DT5A 3D59A 4G8DA 2PX2A 2FW7A 2BHLA 1ZJZA 2CLHB 2O3RA 2V98A 1WA5A 3DXYA 3IAM6 3ZCQA 5TGDA 2Q1XA 5GONF 4O0MA 1D03A 1JR3D 1GRVA 1HEIA 3B36A 4I1SA 3SIPA 3EEOA 1IQUA 3EGVA 2XVYA 2QV0A 1NP3A 2AI1A 2YJ3A 3NHZA 3SDBA 2HCBA 3O2JA 4RMIA 3UJDA 5JS1A 1KJYA 3JVIA 3WX0A 5A0VA 2QE7A 2Q9AA 2DP4E 5AYVA 4DC9A 4MJXA 2AJTA 4OHRA 3BRQA 4BEBA 4W9NA 1CUGA 2O7NA 1VM6A 2DYKA 3WYGA 4DLAA 2EL7A 3Q8WA 4A0QA 4N82A 3FUTA 1QRSA 1JSCA 1RYYA 4GE3A 4RF2A 3H04A 2HBRA 3R0IA 4IMRA 4NWIA 1C7RA 3A25A 2JIZA 3L1KA 1Z8DA 3GN2A 3OFJA 1V7PC 4XW2A 3V2HA 1OASA 5MFZA 1JFFB 1EUYA 2PSHA 2ODQA 3MJ4A 2DF8A 1SC1A 1Z4MA 2ZE8A 3HJUA 4GEGA 4LE0A 1XROA 2X8JA 3NWJA 4YFYA 5KTTA 1B42A 4Q7JB 3BT7A 3LDUA 2ZI6A 4IVRA 3COZA 4RM2A 4XQ0A 4G2TA 3VR6H 4YJ2F 1ZM3A 4QGBA 3BXFA 5CYPA 3W5VA 2Y1GA 1Y3DE 3SYRA 1FK8A 3UMVA 2GPAA 5KVVA 4V0RA 3K72B 1Q7GA 2PH3A 4IDDA 4XR4A 1A50B 3IB6A 2YWJA 4G0NA 4QFBA 1Q95A 2ES4A 1YWGO 1HKUA 2OO3A 2I33A 4G4SO 4DJDC 4Y9RA 2C2OA 2R62A 1CF4A 1Z0FA 3DFMA 2QUKA 4O5OA 1V8ZA 5JJIA 1SD1A 1BS9A 1M9NA 1IY0A 2DRIA 1K5DA 2WWVD 3RFVA 3W8EA 1E2HA 3UJCA 4QVIA 4HXYA 2AQ8A 2BWJA 2QP4A 3WIDA 5CFOA 1OILA 1KJQA 2DQKA 1E1KA 1G9SA 1M5UA 2H51A 3C87A 3OFKA 1V0JA 4WVLA 3RAGA 2CF5A 3I73A 5B4VA 1X7YA 2ZT5A 2OB2A 3HGTA 1GKLA 4NBNA 3SOZA 1ISHA 2XVMA 4G6ZA 3E9NA 3TLEA 1ORVA 4OMDA 4XB1A 4BZPA 2XUGA 5JXIA 2PX4A 3R77A 5H80A 3I1JA 1DU4A 1PFGA 3OHMA 3LVQE 1XEFA 2WU4A 1WUKS 2HSGA 1EIWA 3D3QA 4RQBA 1ECBA 2XGGA 2JCBA 4MRMA 1BMFA 2B8EA 1ZKDA 2QVBA 2CVOA 3OJEA 5IAEA 4RXUA 1KK0A 4NC9A 4AP5A 3O1HB 4AKIA 4R2HA 4O4IA 2A5FA 1OZHA 2NU6A 2XNHA 1GR1A 1NXXA 2H16A 2QI9C 3ANXA 2W6ID 3LQRA 3NANA 4AKEA 1M6WA 3MWDB 5BMVB 5KKNB 1M83A 1N6LA 2DY1A 1N8NA 1N6IA 1MR3F 2C8JA 3P19A 2WNSA 4IO0A 4MRPA 1Z0JA 3Q2KA 2IEAA 2HCTA 5BYAA 2HYIC 3IJEB 3KJQA 4DR5B 5C4MA 1W49A 3DQQA 3PXXA 2Q1YA 3H8VA 4QBKA 4Y2TA 3ZXIA 4F5EA 1SCIA 1PSDA 1HBJA 3FA2A 7ADHA 1M1UA 2Q6IA 3UATA 3FTQA 4MUEA 2II6A 3UGQA 3IEKA 3QELB 3V4RA 2OLEA 4I1VA 1GZ6A 3THXA 3AF3A 3DAFA 4QO8A 1SQ0A 3PBKA 1KGDA 2WU0A 3D3WB 3QVMA 3F73A 4F8EA 2Y1FA 2JB9A 2HQRA 3L40A 1DPFA 2ZIWB 1Y5RA 1PCXA 2YV2A 5F3WB 3ORRA 1T2DA 3KQPA 5BUQA 2O8BB 1U98A 2PRJA 2X3YA 4KWHA 3VR3A 3RJTA 2QZSA 4HWOA 4FHGA 5B4UA 1D2MA 1I32A 2Z2JA 3L7OA 3R0VA 3ZYZA 5C18A 3S8EA 4EY8A 1JAHA 1RP1A 3B1FA 3Q3HA 4Y7DA 4B76A 2Q4BA 4JUDX