4OMUA

Crystal structure of shikimate dehydrogenase (aroe) from pseudomonas putida
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
274
structure length
274
Chain Sequence
b'MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQGSGGNVTVPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVNAGVELAGKRILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFDELGPVVASGFAWLQEPVDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGKEPTPFCQWATKLGAAKVLDGLGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQLARG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate dehydrogenase
molecule tags Oxidoreductase
source organism Pseudomonas putida
publication title Crystal structure of shikimate dehydrogenase (AroE) from Pseudomonas putida
rcsb
total genus 99
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4omuA02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 4omuA01
1IPFA 4PG5A 5TJHA 2VWHA 1OI7A 4L9RA 4CV2A 5ER9A 4FJ0A 5C7IO 4XWYA 3UAGA 1KVRA 1FDTA 1WNTA 4FW8A 3SEFA 1GTMA 2VWQA 1SMKA 4E0BA 3GUCA 4EJ6A 3PZBA 1YGYA 3A4VA 3VHRA 2FWMX 2IRWA 3MJVA 1B2LA 3GH3A 2C2XA 2DPGA 1KVTA 3ZWOA 4Z0TA 1Y9EA 1DOHA 1H6BA 4KMSA 3NRCA 3P2OA 1MP0A 1DRVA 4MIYA 2AHRA 4J2HA 4DL9A 1MFPA 1EEHA 4FIZA 4NFHA 1GEGA 3OJEA 2TMGA 1Y9AA 3ETDA 4FJ2A 5JDCC 3G3EA 2P9CA 1B8VA 1ONNA 4PVDA 1X0VA 2BFAA 5IZCC 3TWOA 4ZHSA 1QXSA 2IZZA 5JYEA 3PEFA 1CQJA 3EZYA 3RJ5A 3PDJA 1ISMA 3A06A 3ON5A 5B4TA 4K26A 3QW2A 3HDYA 3RC2A 5ICMA 3H4VA 3K31A 3K73O 3PWZA 4HUJA 2BFPA 3V1YA 1PS0A 5A9SA 3F4LA 4EEZA 1GPDG 4PZEA 4IM7A 1Y1PA 5ENVA 1CETA 4ZVVA 3SJ7A 5A03A 1EVJA 4XYMA 2Y1EA 1HSOA 1R4NA 4MVJF 5EJ2A 4MINA 1R0KA 1PSDA 1EMDA 1YS4A 2DTEA 4R9RA 2J3HA 3JQ6A 4FQ8A 3GNQA 4MKRA 1VI2A 3HN7A 3VDRA 2D0IA 4FGSA 2Q1SA 5L40A 2Q2WA 3SC4A 1HDZA 3KVOA 1EUCA 1EBUA 5K9ZA 3GHHA 4CLOB 2LDBA 4DIFA 4D79A 5IJZA 1K6IA 1R12A 1WPQA 2X86A 2Y1GA 2ZTMA 4MIOA 4R16A 1XEAA 3AY7A 1SOVA 2HRBA 4IJUA 3O9ZA 4MIEA 1C0PA 3GRPA 3PI7A 5GZ1A 4IINA 3E5RA 3ADPA 1E1KA 1E7YA 1AXEA 2AE1A 3FN4A 5JAQA 1BRMA 4YJDA 4FPXA 3BYZA 4ZD6A 5ITVA 1L7EA 2AEFA 2UUPA 1U1IA 1QMGA 3VTZA 5CDGA 4ALKA 1NR7A 4GL4A 4ALLA 3K92A 3E9QA 4B8ZA 4BO0A 4YAIA 1HSZA 3L07A 4CQMA 3GGGA 4FC7A 1CDOA 1K0UA 2YHIB 3AM4A 5ES3A 2HK7A 4UVGA 4MVJE 1AE1A 1ZO8A 3JSAA 4R5HA 5THQA 2FP4A 3KV3O 5DN9A 4IPTA 1NFFA 2NLOA 5T6BA 3W6UA 4CUJA 2YFQA 1YOVA 1ZIDA 3OJOA 2P91A 1ZCJA 1TI7A 1PTJA 3PHLA 4RV9A 4ZN6A 3KHUA 2GASA 2NSDA 1ENPA 4LISA 2WE7A 3TFQA 3NEPX 5JY6A 3PJDA 5J23A 2EXXA 1SAYA 4RPLA 4XYBA 1O0SA 3RKRA 1H94A 3OA0A 2NACA 2YYYA 4D42A 4MKXA 4G65A 1LRLA 1N9GB 2IEDA 2WDZA 3CEAA 3GPDG 5G0WA 1XG5A 3UGKA 3LC7O 2PZKA 2WYVA 4GX0A 4RLHA 4WEQA 1ZBQA 4MVJP 4BNYA 4AJLA 1Q7GA 3IJRA 3MJSA 4FFPA 2ZB4A 4ND3A 1QV7A 4UUPA 2PGLA 1NHWA 3GLQA 3P19A 4GMFA 4AJJA 3RUFA 2RHCA 4J7CA 5CEFA 5L45A 2CF5A 1AUPA 2AA3A 5JY1A 4I9NA 1D1SA 3ANLA 1UZMA 1Z75A 2AEMA 3GVXA 1HL3A 4E13A 4XJTA 3C24A 2ZB7A 3NT5A 2I3AA 5JXWA 4NPCA 4M86A 4MP6A 1U4SA 4QX6A 2J3KA 4TRJA 3HQ4O 2Y1OA 3ZHZA 4Q3DA 3E9MA 1P1IA 1TT7A 3BTSA 2I99A 5DP1A 1JDJA 5BQFA 4OGWA 7ADHA 2Y05A 3GNSA 3Q9UA 2AEJA 3SLGA 4WLUA 1RM4A 3BTOA 1Z7BA 3HNPA 2OP0A 4F6CA 2J5KA 1CQIA 2VT2A 2VHYA 3L4SO 3ZWVA 4J90A 4BNTA 5ITWA 2CVZA 1JWAB 3RUCA 3WYEA 4YAJA 3AU9A 2H1SA 3QE3A 4YJHA 3ZWMA 4DYVA 1C1DB 4QO8A 5JC8A 1T2AA 2WWRA 3IUSA 3EK2A 1CERA 1PS9A 5G0TA 3ZWXA 4DBZA 1KEPA 1I24A 5TX7A 3LT0A 4N18A 1U5AA 5JLAA 1BDMA 3TN7A 3L9XA 5JCJA 4YRBA 4GVLA 2GF2A 1Q0QA 1HYHA 1E6EA 3GF4A 4IMRA 4A26A 4WEOA 5COAA 1MGOA 2PZMA 3OIFA 3HG7A 4OOEA 4TKLA 1BMDA 2DPHA 3FHLA 4TVOA 1A5ZA 1I0ZA 3BMNB 1U8XX 3TFOA 2FR1A 3K2BA 1T2DA 4H16A 4RDIA 1N92A 4LVCA 4CR7A 1P1FA 2HJRA 1LJ8A 1U5CA 2GZ3A 2O3UA 1PL7A 4B3IA 5A4DA 1GAEO 3MOIA 4BMSA 2C82A 1AHIA 4CM4B 1E3EA 2UV8A 2CNBA 1AN9A 3RSHA 3OM9A 2B5WA 2B0JA 5EQFA 4E5NA 2E49A 1RM0A 2WD7B 2W2KA 3PQFA 4YAGA 2YZ7A 1OC2A 3C7DB 1PJQA 3ZZNA 1ZSVA 3ZNQA 2R00A 1VPDA 5I9MA 2OXIA 1T1RA 1Q7CA 1FDSA 3BMCA 2NQTA 4MP8A 3D1LA 4BQPA 4CR8A 5G0SA 4IS2A 2O3RA 4JP2A 1BSVA 1W73A 4DIBA 3FPCA 1NFQA 3ONFA 5KNLA 2G5CA 3D4PA 3JQGB 4WNCA 3U9LA 4F45A 4WASA 3RUHA 1WZEA 4J7XA 2PNFA 4QT0A 1QKIA 3OBBA 3IJPA 4NU6A 3HB5X 3L6DA 4UUOA 4XA8A 3E6AA 4RCVA 4RVHA 2X7HA 2VYVD 3WSVA 4ZICA 3H9UA 4GKVA 3RIHA 4TQGA 5CDSA 3UF0A 3JD1A 4E32A 1D4FA 5JNLA 3VTFA 4Q3EA 1NVGA 4IJKA 4OSPA 3VAZA 3GFBA 1HLPA 3BMNA 2VNSA 3E9NA 4MOWA 4CM3A 3X2EA 1N7GA 1LQTA 4Z9XA 3DBLB 3F1KA 2B4TO 1PZFA 1ADGA 2C59A 3FNGA 3PIDA 4ZQHA 2FPPA 2WD8A 3GC6A 3INTA 4CLOA 3PGXA 1U28A 3OQBA 4O63O 1NASA 3NAQA 4GWGA 2Y99A 3WGYA 5A9RA 3QWAA 1T24A 5HRUA 4YVFA 1RKXA 3OQ6A 5JCJD 2J3JA 4J43A 1YO6A 4RJTA 1GL3A 1QP8A 2V65A 1T26A 3U62A 1X14A 1H6CA 2QRLA 3N7UA 3FR7A 4Y67A 5AVOA 3DOJA 3KYBA 2XXJA 1SBYA 3B70A 5KIAA 3DO5A 1KS9A 1SB9A 4UVIA 2WTBA 1LSJA 5DOVA 1GZ4A 1DJNA 3G1TA 5TIIA 2OO5A 1OOEA 5A9SB 3FRJA 4TROA 3ANNA 3JD2A 4BNNA 4J49A 4CMIB 1WDKA 3D4NA 1EE9A 1M66A 3IIEA 2W90A 1QRRA 3GPIA 5C37A 3A14A 3NDIA 3RC1A 5G4LA 4RLSA 5IG2A 1LI4A 4P4LA 4R69A 4BGUA 1VRWA 3KTDA 3BMOA 3KXDA 4B8WA 2ZKLA 3KO8A 5JFOA 3RAJA 5K0ZA 4XQEA 4NBTA 3AOGA 1H6AA 3W8EA 2PA3A 2JHFA 4TRNA 3U0BA 2EGHA 2PZLA 2VZ0A 1QYCA 4NR0A 2O7SA 1N1EA 1FJHA 2CZCA 5HS6A 3F6YA 1GYRA 3EUWA 2VZ8A 5AXCA 4NMHA 1EVIA 5JS6A 1VKOA 4BNIA 4CV0A 1JAYA 2GZ2A 5H81A 4CMCA 1IUKA 3I6QA 4TMFA 1YB4A 4RF4A 3BXXA 3GMDA 3TZ6A 2PY6A 4JGBA 3ST7A 2J5QA 4NBRA 3FNHA 2X22A 2VTEA 3O8QA 3ZCXA 3H5NA 4J1QA 1AHHA 3PDUA 1QORA 1GD1O 3SVTA 3NJ4A 1BWSA 3H9JA 4BGIA 4YWJA 1E3JA 2H5LA 2PGDA 5FYDA 5TSDA 4AICA 1DC6A 1F8GA 4XR4A 2IXBA 5KJEA 2B4RO 4BO3A 4OYRA 5L7TA 2VRCD 4J6FA 3JYPA 3KBOA 2UVDA 2Q1TA 3DTYA 1I2ZA 1MXFA 2X5KO 3VPXA 2Y1FA 3LQFA 2HK8A 3NT2A 1LDYA 4BMNA 4J0FA 3LDHA 4YA6A 1SB8A 1OMOA 5JW6A 1S6YA 1HDRA 3WGIA 3TSCA 4EUFA 1ZK0A 1LEHA 3AUUA 1I32A 1GDHA 1BG6A 1R4MB 3I3OA 1EE2A 3O38A 4J1NA 4E5KA 3V2GA 3AFMA 2IEBA 3KLPX 2ZK7A 1IB6A 4H15A 4CM8B 3DBRA 1GZ3A 1D3AA 2NU9A 1GADO 3OQ1A 5L4NA 3VH3A 3QWFA 2WE8A 3Q0EA 4ND5A 3PRJA 4A5OA 5KVVA 4A10A 3U4IA 1JW9B 1D1TA 4D46A 1MG0A 2YV3A 4XQ9A 1E7RA 4DMLA 1MA0A 3KEOA 1ZSYA 2DTDA 3ROKA 2YFHA 2HO5A 3EVNA 4IQ0A 2PH3A 3FTNA 2B35A 2VN8A 4KQWA 5B37A 4YEDA 1EK5A 2PFGA 3JYNA 2OZPA 5DBIA 3VPGA 3TOXA 1JLLA 1UDCA 3PP8A 5JCXA 3UICA 3ZHYA 4E6PA 3BMQB 4CUZA 4L73A 4N5LA 4CLDA 1PGPA 1WXDA 2WMDA 4PG4A 4CM1A 2HRZA 3GGPA 3ZI0A 1HTBA 4E2XA 4PZDA 3KETA 3ROMA 1HE5A 1P0CA 2HUNA 5ENDA 8ADHA 2JFHA 5FWNA 4GSLA 2YDYA 4UREA 4ZU3A 3PGJA 2OMEA 2E4AA 2ZYGA 1PGJA 2IODA 3D0OA 2NWQA 4WCDA 2XPCA 3P7MA 1Z6ZA 1YH3A 3WGOA 1V3TA 5EN4A 1L7DA 1Q1NA 3AUAA 3W4IA 4AJKA 5KTKA 1GEEA 1VJ1A 3C1TA 5BSHA 4FN4A 1R0LA 1FDWA 3WFIA 1Y8RA 3JQCA 1E7MA 3DZGA 4BO7A 4YT8A 2B37A 3QVXA 1B3RA 3I4FA 2GPTA 4D45A 2PKQO 2AG5A 3X2FA 3WLFA 4WLFA 3F5QA 4CLRA 1J49A 1YQGA 3K5PA 2C29D 3L9WA 4YJFB 1IOLA 3H9GA 3BTVA 1NAIA 2GR9A 1XIVA 2JD2A 1XLTA 3DB2A 3IAHA 2BFOA 5U9CA 3JQ8B 3JQ8A 4G5HA 3ZGYA 3JYQA 1P45A 1B3BA 3KYCB 1AGNA 3AM5A 1G0NA 5KJ1A 4BL5A 2DBZA 1P31A 1QYDA 4ALNA 1ZK4A 5LC1A 5GY7A 4E3ZA 3PYLA 1K89A 3QV1A 3AFNA 3IDSA 5JO9A 3F1LA 4CMJA 2JCVA 2Q2VA 3K8ZA 3Q9NA 2QG4A 3U4DA 3CE6A 4MO2A 1IE3A 2WEKA 2WYWA 5I8ZA 4AJIA 3VDQA 2G76A 3OHSX 4A7PA 1SNYA 3UCXA 1E3IA 1IHXA 3INGA 1ID1A 1PQPA 4UEOA 1IULA 2Q1WA 3C1AA 4ROSA 5HBRA 2AW5A 3C3XA 4IDEA 3FTPA 3ZNPA 4ND2A 1CWUA 1U3UA 1XQ1A 5FF9A 3ZV4A 4YYZA 3DZIA 3SLKA 3V2HA 4KTVE 4JQCA 3WWZA 2PLAA 5JDCA 2C07A 4O5OA 4JJGA 5HM8A 1EVYA 1P33A 1UAGA 3LK7A 3T4EA 3FI9A 1J6UA 3I9MA 4RZIA 4M8SA 5EIOA 2BHLA 4D3FA 1LLUA 2OGUA 3GVHA 3VPFA 2JJYA 3RCBA 1VL6A 2BD0A 1UZLA 1PJ3A 3E8XA 5ILGA 4YQZA 1ZUD1 1NQAO 3C85A 3GDFA 1FXSA 3QSGA 4BB5A 3WMXA 3ZV6A 2O3QA 2FR0A 3PLNA 1Z45A 1F06A 2VUUA 4LVUA 4KUEA 4XD2A 3ZV5A 1O94A 4CQLA 3IS3A 3HFGA 1P74A 4TSKA 1WLYA 2GCGA 1I33A 3DAFA 4LMPA 1Z74A 2O23A 2PD4A 1HDXA 1X7GA 3KSDO 3LSYA 4Q3CA 4LCEA 3O8QB 3GFGA 3D5TA 1B7GO 4HXYA 2HMUA 4CV3A 2DUUA 3MTJA 1V0JA 1E1MA 2CSUA 4L4XA 4D41A 4INAA 4BO8A 1PL6A 2YQ4A 3W1VA 4FC6A 4G81A 1WMBA 5L4SA 2ZB8A 1EVZA 1QR6A 4KP7A 3LC1O 1GY8A 1DC5A 1B16A 3RFTA 3CXRA 5IF3A 4PLGA 1DLIA 2Q50A 2JAHA 4L76A 4OJNA 4IDFA 2E37A 3H2ZA 2Y0DA 4JP3A 2JCXA 1PU2A 1T1SA 2CY0A 3GVPA 1UDBA 5L4LA 1I3LA 2BH9A 1M2WA 5B1YA 1P1JA 2CFCA 1X13A 2D5AA 5TF4A 4BKUA 2PH5A 2CDCA 1KBZA 3JD4A 1C1XA 3D3WB 4M54A 4NU5A 1YQDA 4QTZA 3WTCA 2PK3A 3AOEA 3AU8A 4DPLA 2QZ9A 2YW9A 5C5IA 4CQMB 4URFA 5TRTA 5IAAA 3ITKA 1ENZA 2FZEA 2I9PA 2QRJA 1M76A 3IKVA 4TZTA 3QRWA 1YL7A 5DNAA 3EY4A 3NJ8A 4NFSA 3T7EA 4XZ3A 2NVUA 3IC5A 4WNIA 2ZATA 3WTBA 2A9FA 4YQYA 3WS7A 4HV4A 1OC4A 1I3NA 3MEQA 4BKPA 5JSFA 4IIUA 2NVBA 1UXGA 2NTNA 4YT5A 1BDBA 2EP7A 4Z9YA 1GUYA 1P44A 4RQTA 3MJEA 1PR9A 2NTVA 2HMVA 1IZ0A 1DXYA 3OIDA 4JX8A 3FR8A 5DBGA 2Q4EA 3WJAA 3ENKA 1Y8RB 4GLOA 5F3RA 4GPD1 5BNTA 2AG8A 5CG2A 2C20A 1VSUA 3WOHA 2VNAA 4B4VA 1QLHA 2J6IA 3NTRA 4XCVA 3I5MA 1R4NB 1B8PA 3GVIA 3WXBA 4YCAA 3I6IA 3S55A 1JAXA 3DC2A 5JO0A 1I2CA 4IXWA 1R66A 1SEPA 1V3VA 4GLLA 3Q6IA 2NTJA 4OSOA 1HE4A 4E12A 1VLLA 2QW8A 1C0LA 2GYYA 1P1HA 4CMKA 4XYGA 1OBFO 1J0XO 3RBXA 3SC6A 5IDWA 2WJPA 2ZQZA 1XYGA 3TZKA 3DZFA 3WYCA 5CDYA 2BKAA 5I8WA 4M55A 5EESA 4EITA 1E0DA 5A3JA 1YKFA 2H63A 3IP1A 3FD8A 1DB3A 2P68A 3PYXA 4CM6A 3PQEA 5H82A 4CMHA 5IFLA 1ML3A 3HDJA 1DDOA 2Q99A 4YB8A 1ZEJA 3Q1LA 3CTMA 5TGDA 3ZU2A 1PJ2A 1V9LA 3BHIA 3CKYA 3QQPA 5IDXA 3DR3A 2ZQYA 1B15A 4CM9A 1C1DA 1EBFA 2FPIA 2Z1MA 2NV6A 3O4RA 1HXHA 1JWBB 3DBVO 4WGGA 3VC7A 1H9AA 4PG8A 4YACA 5BSFA 3AI3A 4JROA 3DZHA 1A4IA 1A72A 4OXKA 2O3TA 4EJ0A 1PJCA 5TS3A 3C1OA 4OOFA 3OMLA 4J4TA 3V1UA 3I4CA 4K9DA 1MG5A 3QP9A 3BIOA 2DKNA 3ASUA 3ZN2A 4HFRA 1VSVA 2P2SA 4M87A 5JAIA 1P1RA 2PKQP 2W4QA 3L0DA 3WYBA 3U5TA 1F14A 2HSDA 4YJGA 4DIOA 4MJLA 3HN2A 1J5PA 4MVJD 1NTOA 1X1TA 4LN1A 1T2EA 1EK6A 3SJUA 4U8GA 2IXAA 4A2CA 4K28A 5IDYA 4QUKA 1ADBA 2SCUA 3S2IA 1LBEA 4ZJUA 1PIWA 2P5YA 3M2PA 5JPIA 1S7CA 4YJGB 3FNFA 4QECA 2NNLD 4II3A 3RD5A 2Z95A 2R6JA 3WBFA 5JAMA 1KIFA 1ONPA 4PLHA 1B8UA 3ZW8A 1R15A 3EZLA 4QO7A 3OSUA 4RZHA 3HFSA 6ADHA 3RU7A 5KKAA 2VHWA 2B69A 1YWGO 4BO9A 5DOZA 4AL4A 1I36A 1PGQA 4HFJA 1UP4A 1GUFA 3OFSA 1F0YA 4AG3A 3GHYA 3NDRA 5COBA 4BO6A 3JQ7A 4I08A 1RPNA 3K96A 4IDCA 4EUEA 4U0JA 4FFMA 4XR9A 1NWHA 3TZCA 2BRUA 2O4CA 3QA9A 4PRKA 4BVAA 4YTEA 1Z82A 4ALMA 2G0TA 4YPOA 3OF2A 4WK6A 1XA0A 3PJFA 2AQIA 1ISFA 1YL5A 3Q2IA 1U4OA 1ZJYA 5BNFA 1DHRA 2EWMA 1F12A 3EVTA 2FN7A 3EYWA 4IQ8A 4OXYA 4DGSA 2EP5A 4NQZA 4LW8A 1A4UA 4BIIA 1EDZA 4Y6PA 4HADA 1P77A 1M75A 4J4BA 3KSUA 1DIRA 5ILOA 2Q46A 5KWEA 5HTOA 3VKVA 5DCUA 3EMKA 1HZZA 1PGOA 2NVUB 3TPCA 2CDAA 3K2EA 3SX2A 3V8BA 5A5FA 4A73A 4BNZA 2UAGA 4CMBA 3ZNNA 4YT4A 2FOIA 2GGSA 4DWVA 1ISIA 4NBUA 2BGLA 5CAEA 2OUIA 4TZKA 3DBHB 3SXPA 4GH5A 3NTQA 4CM9D 4UVHA 5KJCA 4YBZA 3H3FA 1H6DA 1DFGA 3MOGA 5A9TA 3U49A 4UVDA 3COSA 5L7WA 4GQAA 1JKFA 3O26A 3QJ5A 4UULA 3UCEA 4BHTA 1K2WA 2A4KA 4HX5A 1XHLA 2NU7A 1HF3A 3LT2A 4EBFA 3F47A 3OETA 3AJRA 3RROA 4RVSA 1YOVB 5F1KA 4CLHA 3LYLA 4IMPA 4JBHA 5KOIA 1VL0A 1SZJG 2VZ9A 2I5PO 4OHUA 4K6CA 2BFMA 5EMHA 3W4JA 2JAPA 3DBLA 3A28A 5CEEA 4J9VA 4WOJA 3G1UA 1BGVA 1PZGA 4R1NA 5TC4A 3E18A 4P22A 5CHEA 1DSSG 4IXTA 2HMWA 3LZ6A 4AJPA 1E1LA 3KYCA 4GBJA 4JBIA 4XIYA 3WWYA 3GR6A 1XU9A 1YBMA 4DC1A 2D5CA 1DFIA 2GSDA 1O89A 1ADFA 3QHAA 3DTTA 2AXQA 4EUHA 1YXMA 3D3WA 3RUIA 3LT1A 4EW6A 1DIHA 4AJ2A 4D43A 3QWBA 2AQKA 3WIEA 4YR9A 2FPGA 2V6BA 1V6AA 2VQ3A 3JTMA 3KB6A 4JJFA 1WP4A 2O7QA 4R1UA 4BKQA 3RASA 1MX3A 3CZRA 4HNGA 1B14A 4R1TA 1WZIA 4UVEA 2PD6A 2VTDA 1LDNA 4PGFA 1NPDA 1PL8A 3JQBA 4I1IA 4BNMA 4CMEC 2A94A 4IZIA 3L6OO 4W9NC 4YAKA 5KKCA 4OL9A 1NQOA 1DAPA 1DAOA 4EYEA 3ICPA 1H9BA 2CDBA 2P4HX 4E5MA 2PD3A 3L4BA 4CR6A 2F1KA 4R41A 5GMOA 3GK3A 3TRIA 1RYDA 3Q3CA 2F00A 3MWDB 1UJMA 1HKUA 1D8AA 1DIBA 3BTUA 3F3SA 2OORA 2BELA 4UEJA 2WYUA 1LLCA 4BO5A 2ZCUA 3VOSA 1KY5A 4S1VA 4YJFA 4MVJA 1VJTA 1O9BA 5T5QA 1N7HA 3AOEC 1DRUA 2HMSA 4DRYA 3ORFA 2V6GA 4OXNA 4UAGA 3NDJA 3CMMA 2I65A 4N5NA 1PEDA 1O95A 5FI5A 4DQUA 2DT5A 2IDZA 4QFDA 4NK5A 5AXBA 4EI2A 2D1YA 2D2IA 1PJLA 1YE3A 4B4UA 1WVGA 1YJ8A 3GA0A 4HWKA 1JKIA 2VHZA 4WPGA 1J4AA 3P5SA 2W2KB 4XDZA 5L53A 5L9AA 4H7PA 3PQDA 4UUNA 4EZBA 2HJSA 1UZNA 2QHXA 3E1KA 3LT4A 3PHJA 4R9SA 4EGFA 1RM5A 5IN5A 1LDMA 1ZK3A 3SBOA 3WGHA 2DFDA 5T57A 5T67A 4ZRMA 2WSBA 3PPIA 1ZH8A 4F3YA 1I10A 2HQ1A 4OIMA 5JDIA 4RPHA 3RU9A 4DMMA 1U2GA 3ROPA 1G1AA 4QEDA 2DBRA 2A92A 1AXGA 1BVUA 4PLFA 3P2YA 4FR5A 3DFZA 1VKNA 1E3WA 1E3WB 1ULUA 2CVQA 2Q3EA 3E03A 4J2OA 5JDIC 3WB9A 3PHHA 3RI3A 1LRJA 1RM3A 3LLVA 1ZMTA 4E5PA 5B12A 2X9NA 5DP2A 3IKTA 3WNVA 2J3IA 3CH6A 3V1TC 1IZ9A 1PGNA 3AK4A 2FMUA 5TQVA 3WLEA 3C7CB 3TF5A 1ORRA 4GGPA 1JVBA 5FI3A 1BVRA 5DULA 4B3HA 1JKJA 2GZ1A 2W8ZA 1N8KA 4JN6B 3CZMA 3JQAB 1C3VA 4ALJA 2V6FA 4N7RA 4HNHA 3H5RA 4FFNA 4CJXA 3EC7A 4WE3A 4XIJA 2P9GA 4LRSB 4D3SA 3M6IA 3JQGA 1ISHA 1HDGO 3AI1A 5TNXA 1QYWA 3D7LA 2AQHA 3PJEA 2Y1CA 1ENOA 2P4QA 3KM0A 4D3DA 4XRRA 1F17A 1SOWA 3UCFA 3W6ZA 4ZGWA 1NP3A 2X9GA 3V2UA 2NQ8A 4KWIA 6LDHA 3CMCO 4ALIA 3PIIA 1GPJA 2EIHA 4ZA2A 4GWKA 3HWRA 2EJVA 1Y6JA 5EINA 1E3SA 1U3TA 2QYSA 4P4GA 3FCOA 2JHGA 3TOZA 3IMFA 3U4HA 2LDXA 2BMAA 2D8AA 4ND4A 3OH8A 3RBVA 5HA5A 3H65A 4M1QA 2QX7A 3WDSA 4BKRA 1X15A 1X1EA 1OFGA 1L1FA 4PG7A 2X0IA 1JU9A 1DIGA 1ZW1A 4MDHA 4HY3A 1TB4A 1GCUA 3R3JA 3DL2A 3LVFO 3DHNA 4WLOA 2X4GA 4XX0A 1UXJA 3GOHA 1WDMA 4FOOA 4R5MA 2C7VA 2CF6A 4DPMA 4YT2A 3GQVA 4PLCA 4Y8VA 4CUKA 1VE9A 2VRBA 4FB5A 1MLDA 3TL3A 1MUUA 2VOEA 1UP7A 1Y8QB 3VZRA 3WNQA 3I9JA 1XR3A 3C8MA 4LSWA 1NQTA 4L75A 2AQ8A 4P4NA 4HFMA 2I76A 1LDEA 1PS8A 2W2LD 3ANMA 4H3VA 4DQVA 3MTGA 3ETEA 3AI2A 1U7TA 4IUYA 2Y1DA 1GV1A 1O5IA 4U5QA 3RVDA 1Y8QA 2C54A 3GZNA 1CIVA 2HK9A 9LDBA 3RC7A 1NBOA 3V5NA 3KEQA 4Z9FA 3I9NA 1NVTA 2YHIA 4LK3A 2EV9A 4KOAA 3VH1A 3VPHA 1XELA 4WLNA 2NVWA 2GLXA 2RBEA 3JQBC 4BV9A 5BT9A 3T7CA 4RGBA 1KVSA 1PJBA 2I66A 1XCBA 4W6ZA 1E7QA 2CVOA 2QQ5A 4CODB 5A06A 1W0CA 3JQFA 3NV9A 2R00C 1PWZA 1K6JA 3FSRA 4U0KA 5AQ1A 4B7XA 2C2YA 3QVTA 1A27A 4WECA 2PV7A 1D7OA 5K6AC 1OAAA 1R16A 1IYZA 5T8KC 4DUPA 5L7YA 1GUZA 1B0AA 4GAEA 2RH8A 3H9EO 2C0CA 3GEDA 5KJ6A 1KERA 2DC1A 3HUDA 4GX1A 4JLWA 1TT5A 1DC4A 4KQXA 1ISJA 1WWKA 1YQXA 4KZPA 2TMDA 3GRKA 3IOYA 3D4OA 1SC6A 7MDHA 4WKGA 5TLSA 4BO4A 1HDOA 2XOXA 1UP6A 5CG1A 3UKOA 4ZQBA 4IS3A 3NX4A 4A0SA 4IDDA 3LLSA 5AOVA 2DVMA 3UW3A 1PJTA 4XGNA 4BUCA 4XEHA 4RDHA 2VYNA 1VM6A 3BHJA 4XYEA 4W82A 3RWBA 1IL0A 4B7CA 1BXZA 1LXCA 4U6QA 5BSGA 2O2YA 4DPKA 4BNFA 3D64A 4RPKA 1Q0LA 3H2SA 2D4AA 3GN1A 3IQDB 3MWEB 3R1IA 3BMCB 1NNUA 2FSSA 4FCCA 1XKQA 4HKTA 4Z0PA 3PWKA 1NWCA 2X1HA 5A5EA 3QWHA 3E5MA 1W4ZA 2X0RA 1DRWA 5EERA 3EW7A 4QFCA 1LU9A 4J0EA 1CRWG 3LU1A 3TJRA 2W98A 3GDOA 5FFFA 4WCFC 1H93A 5F5LA 4M89A 1ENYA 1I2BA 2VYND 3B6ZA 2ZIZA 3ICCA 3PVZA 4KUGA 4PG6A 4CM4A 4D0SA 3H9QA 3I9LA 2X5OA 1LQUA 5G2OA 1GYPA 3W8FA 1KEVA 3QVSA 4OH1A 4JJIA 1E3LA 2JD0A 5ADHA 4C7KA 5B4VA 5A04A 3FBGA 4E31A 1NPTO 2G17A 4FDAA 4ONEA 3UHAA 4CLRB 1F8FA 1RJWA 2ZTUA 4YRDA 2B83A 2FY8A 5JE8A 2IYPA 2PR2A 5I7EA 2FRDA 4DREA 4DVJA 2ZJ0A 3GNTA 2GRAA 2YHUA 4XB2A 4FFLA 1LC3A 1VL8A 1E5LA 1NXQA 2O2SA 3UFXA 1W6UA 4GMGA 3UOGA 3DZJA 1UAYA 4IDBA 3DMTC 1GU7A 1ADCA 1TA4A 4AJ4A 1Z73A 3CUKA 2POQX 3KSZO 4I8XA 2H6EA 4FSHA 4BGVA 1M6HA 1O8CA 4EEXA 3WIDA 3WX0A 1GQQA 2R2GA 1X7DA 4PLZA 1YJQA 4E30A 1ZEMA 2QRKA 2PGJA 3IUPA 2FHSA 1MXHA 3PFWO 1MC4A 5JAZA 3NYWA 3O03A 4LGVA 4PLWA 4XB1A 5F21A 1LRKA 1TLTA 1ZNQO 2VUSA 4RQUA 5LDGA 1GR0A 4YAEA 5C3MA 4BMVA 1EUZA 4PLYA 4WUVA 1MB4A 3U4CA 2ZB3A 3PHIA 3IL2A 1QV6A 3K30A 1ZZEA 1NYTA 3HHPA 1P3DA 1W8DA 2W2LA 4Y6SA 1PJ4A 4LCJA 4P38A 1R6DA 2UUOA 4NFYA 3ZU4A 2E48A 3DQPA 2GDZA 1EFKA 1GFSA 5A02A 2ZTVA 1YRLA 3BHMA 2O50A 4TWRA 3S2GA 5G0VA 1HDYA 2Q45A 1CEQA 3DMTA 4R4JA 4IQGA 3WQSB 4DTIA 3ROQA 4Z3DA 1GV0A 2RIRA 1EZ4A 3E48A 4FOSA 1T4DA 2O48X 3WJ7A 4XQCA 3WGTA 2OOSA 3TNLA 1TVEA 3GG2A 3TZQA 5I7SA 3WR5A 3DXFA 3QVOA 3B1JA 5AXAA 4BGEA 5IZ4A 1LA2A 3A1NA 2X6TA 2OHXA 1UH5A 3U3XA 4MVJM 5ER6A 4YRAA 1Q2XA 4KUHA 1DIAA 1LUAA 4EJMA 3PTZA 1DBVO 4BS9A 1KVQA 1JVSA 4R68A 2YUTA 4N5MA 1YBAA 2JFFA 4FJ1A 4RO0A 3RQSA 4TRRA 1TEHA 1T4BA 4MKZA 2HAEA 1PWXA 3ONEA 4Z6KA 2P5UA 3GG9A 4IGEA 4J1TA 4OQZA 1I3KA 4E21A 1FDVA 2DUWA 2CMDA 3G0OA 2EHDA 3CPSA 4AJ1A 4F46A 1E92A 3JV7A 1B26A 3NUGA 4B4OA 2O4UX 4FD3A 4CPDA 2EW2A 1U3VA 4FS3A 3LF1A 4MVJI 3RFXA 3D3EA 4IDGA 4IBOA 3GAFA 2X23A 4XGKA 3HJAA 3KUXA 3GEGA 3JQAD 2X5JO 4BNJA 1R4MA 4DC0A 1T2CA 2XXBA 1C0IA 3VVCA 2RCYA 4E2ZA 3GAZA 3N74A 3ULKA 1ARZA 3Q11A 8LDHA 3H6KA 5KCZA 2VT3A 3QWIA 4I5FA 3ABIA 4BNHA 5CFZA 3MJCA 4BOYA 2ZJ1A 3N58A 3CIFA 4WLEA 3ZU3A 3FF4A 3ONDA 3DHYA 3WG9A 3ZNOA 4NI5A 2EKLA 3LC2O 4IDAA 5JC1A 1E6WA 2D59A 4DA9A 3OA2A 5IXYA 3D5QA 1DFHA 3BMOB 3I1JA 2GN6A 1E1NA 1HLDA 4ZQEA 3INRA 4J1SA 4O59O 1VJ0A 2WD7A 4CMGA 1GZ6A 1EFLA 1KEWA 2ILTA 3ZWBA 1KVUA 1NVMB 4I9UA 4Q9NA 4DYDA 3GVCA 4BNXA 2JD1A 2Y93A 1NX6A 2O3JA 4L8VA 3UUWA 3UH1A 4PLPA 1BXGB 2VOJA 3PZRA 4KDFA 5GZ6A 1BW9B 1P9LA 5BR7A 3F5SA 1HYEA 4NNJA 1LLDA 3ZWCA 5EQDA 4RORA 5KJFA 3NTOA 5MGBA 4WOKA 4RPJA 1HE3A 3WSWA 4PRLA 1UR5A 3ZWPA 3BA1A 5DZSA 2P9EA 3KOUA 1DPGA 1WMAA 1OZAA 1ZVMA 4RF3A 4TKMA 2DBVO 3I83A 4DLBA 1ZFNA 3FBTA 4PFJA 4XKJA 2Y68A 1K3TA 2Q49A 3DOOA 4OO3A 3VZPA 1P1KA 2GUGA 1JA9A 1N2SA 4GX5A 4KWHA 3I9OA 5AYVA 3WGGA 1SPXA 3IP3A 2X9VA 3K9QO 4O0LA 3HE3A 2BI8A 3UVEA 3GT0A 3OICA 1E7WA 1UUFA 5HS4A 4BKOA 1LX6A 4PVCA 3WICA 2AMFA 3TZHA 4PCVA 4O6VA 4W99A 1A7KA 1HWYA 1DLJA 1UXIA 2GN9A 2DFVA 3TDKA 3RUAA 1HETA 4OKNA 2BGMA 4AJNA 5K6AA 1LDBA 4E2WA 1M67A 1GQYA 1XDWA 3DOCA 3OJ0A 4I5EA 4PLTA 3KYDB 2GD1O 3ZDFA 1MFZA 2X58A 3H7AA 3JD0A 4M49A 1SCUA 1O6ZA 1NPYA 4A27A 1ZJZA 4GVXA 1NM5A 2X8LA 3GGOA 1YL6A 1EUDA 3AY3A 3F46A 4B3JA 2QZZA 2DAPA 4YJHB 4DBVO 5FEUA 2QYTA 4Y9DA 4CL3A 3AWDA 4I9HA 4I5GA 2X0JA 3ZWAA 1Z7EA 3QVWA 2EERA 1ZXLA 2YY7A 4NH4A 1ZMOA 4R3WA 1KYQA 3GZ4A 2JFGA 1MV8A 3BMQA 5CEJA 4PN3A 4UUMA 5JMWA 4UEKA 1N9GA 2OL4A 5JBIA 3GN2A 3NT4A 4J9UE 3HDQA 3B1KA 2NU8A 5CDTA 9LDTA 4TVBA 2DQ4A 4MVJH 3K6JA 2PKRA 3UN1A 3ZV3A 1KC3A 2FZWA 4NJMA 1H2BA 4L74A 1TT5B 4GX2A 3AUSA 2RAFA 2C7GA 1QYVA 5I7VA 3OECA 4D7AA 5DF1A 3EHEA 3F4BA 3S2FA 1K5HA 4C4OA 3VH4A 3U09A 4JCOA 3M2TA 1XQ6A 3HDHA 4ILKA 4BO1A 5DBFA 1YBVA 4OMUA 1HEUA 2ZTLA 4GSKA 2CUKA 1E5QA 3JD3A 5EPOA 4IGFA 1U2DA 3EGOA 4WCFA 3DEYX 5THKA 5JYDA 2ZYAA 3VPSA 4D0RA 3G49A 4R01A 4Z3KA 1Y7TA 1HE2A 2JKVA 3STHA 4CV1A 1MC5A 1CJCA 1C0KA 1SO8A 4GGOA 4OAQA 4OQYA 4NHEA 2EKPA 4IJVA 4RVUA 1PZHA 5U1PA 4NBVA 4ZQGA 1V3UA 1PZEA 1Y81A 1LDGA 3KYDA 3PHGA 5G4KB 3ZWNA 1R0SA 4GKBA 4MP3A 1G0OA 2EJWA 3HZZA 1HT0A 2RH4A 2VRCA 3R3SA 1ZK2A 4XRGA 2DU8A 3WBBA 4XJSA 4E33A 2FR8A 1I5RA 4Q3AA 4J4HA 3JQEA 2IZ1A 1ZKMA 3RJ9A 1GQ2A 4BNLA 5JMPA 2B4QA 1EDOA 1KETA 3H3JA 5L51A 2Q4BA 2X0NA 4NDNE 3M1AA 5L3ZA 5B4UA 1V8BA 5I9LA 3OP4A 3PXXA 1LC0A 3L6EA 1A7AA 2IZ0A 5COQA 2QIOA 3OIGA 4JXKA 4B4WA 5BNIA 2NADA 3GZNB 4BO2A 1H0KA 4B7UA 1C14A 2PWZA 3L77A 4Q3NA 3E82A 2BI7A 3HSKA 4CQMD 1QYXA 4RVDA 3FNEA 4J16A 1KY4A 4NJOA 1V35A 2AE2A 1NR1A 4NJMB 2DBQA 1DC3A 4QQRA 3NGLA 3JYLA 3HB4X 3B20A 1NQ5A 3HADA 4XQGA 3ZHBA 1LSOA 3BAZA 4LMRA 4F6LA 4YXFA 4N54A 1PQUA 4Y6RA 4PLVA 3ZHXA 2C5EA 4HP8A 4R3NA 1PJSA 5C7LO 4J91A 3KZVA 3CSDA 4QXMA 2WM3A 4E4YA 4WCFB 4YDRA 1A71A 1BXGA 5KVQA 4OM8A 2NU6A 4NK4A 1ZSNA 4CMIA 5IN4A 4IJWA 3R6DA 1FF9A 1YB5A 1HYGA 5F5NA 2HDHA 2YV2A 4L4SA 3ZW9A 3AUTA 3VVBA 1JQBA 4FFRA 4II2A 2GO1A 1LLQA 1FMCA 3PJGA 3WQQA 2Q1UA 3I9KA 4L4RA 2XF8A 5F1OA 4Z0HO 4JBGA 3GY0A 1RWBA 2BF7A 5A3VA 1Q7BA 4DLAA 1GYQA 5T8KA 1I8TA 3GMSA 3ZWYA 3MZ0A 1Y5MA 5CDUA 1T2FA 3L4BC 4W4TA 4NG5A 4RVFA 1FK8A 2OBNA 3PLRA 2EGGA 3DONA 5CP8A 3S2EA 3ETGA 3RFVA 3F9IA 4OKIA 3VH2A 3WFJA 5GZ3A 1LTHR 1WDLA 3DFUA 1ONOA 2HKIA 1U3WA 4KDEA 4X54A 3S8MA 3VZQA 4DLLA 4W7HA 2RHRA 4BNGA 1IPEA 1PX0A 3B1FA 2Y0EA 2XAAA 4JK3A 3GDGA 1U8FO 2ZYDA 1HZJA 3M1LA 2VYVA 1A9ZA 2C5AA 4BNWA 4GI2A 2VWGA 1YVEI 3ZH2A 2CD9A 1KEUA 3WQRA 1YONA 3ZWWA 1U9JA 4CMEA 4W7IA 1DO8A 4B79A 1G6KA 3ASVA 4J3FA 4K6FA 5BSEA 2UYYA 1NFRA 4RVGA 1P0FA 1XU7A 4ZQFA 1YB1A 3GUYA 3DZKA 3S1LA 1T25A 5DCWA 4O1MA 2V6MA 4U7WA 4XDYA 2IE0A 2UDPA 3I52A 2VUTA 4DQXA 1SEVA 5KVSA 2EW8A 2GERA 3TQHA 3AW9A 4E5YA 2DLDA 2Y0CA 4BB6A 1QLJA 1DEHA 5CPFA 3JQFC 2V7PA 3OJLA 1X0XA 5DDIP 3DZBA 4G2NA 2Z5LA 1A9YA 1XSEA 4L0QA 4RF2A 5ICSA 2GNAA 3JCZA 4ESOA 5T64A 3PYMA 4I5DA 3RUEA 3DBRB 3MCVA 1X7HA 4R51A 2DM6A 1LNQA 5KVCA 5F1PA 2B5VA 1LSSA 4MPDA 1I01A 2HLPA 3C7AA 5MDHA 2FSVA 1JTVA 2VHVA 1H5QA 1NHGA 1VC2A 1XWFA 2E82A 4MVJG 4FBGA 1R37A 2HMTA 1ZK1A 3GEMA 2VCYA 1XGKA 4RF5A 2GN4A 3KRTA 4LRTB 2YQ5A 1DJQA 3ITDA 2PTGA 2OFPA 4AJHA 4BNVA 3JYOA 3MJ4A 4E2YA 4ID9A 5U4QA 1YDWA 5TT0A 4RL6A 2Y67A 4NBWA 5CPBA 3H5AA 3FPLA 1GCOA 5G4KA 5A1TA 4IZHA 4XYLA 1KC1A 4WLVA 4ND1A 4W9NA 4HFNA 3Q2KA 3VKUA 1ULSA 2Q2QA 5H83A 1Q0HA 2NUAA 3AM3A 1EQ2A 1BW9A 1H2HA 2J8ZA 5IXSA 4A03A 4BNKA 1KOLA 4P8RA 3QIVA 3NKLA 3DAPA 2EEZA 3FWNA 2I67A 3EAGA 4CM8A 3DBHA 4IY1A 3DWFA 4Y98A 1LSUA 3W8DA 1N1GA 4ZRNA 5A05A 5AXDA 1HRDA 5IDQA 2J5RA 4RPGA 3VZSA 2OBYA 4PZCA 4D44A 4CMAA 3OEYA 1U7HA 3BZUA 1QSGA 3CINA 3JQAA 4ITUA 2EF1A 2G1UA 4AJEA 2E6UX 3RBZA 2H9IA 4LSMA 2B36A 3RUDA 5DCYA 1C1XB 3AY6A 3FWZA 3I23A 1NAHA 2YJZA 1N5DA 2IYOA 4PIVA 4KTTE 4R1SA 4C7JA 3PWSA 4TRMA 3MJTA 1QG6A 4BQRA 3ADOA 1UXHA 2ET6A 3T4XA 1CF2O 3KLMX 1UDAA 3DDNA 5C7OO 5TT1A 1BXKA 2EG9A 1WW8A 1ZXBA 2G82A 4FGWA 2I3GA 2JL1A 4FFOA 3DMYA 3UXYA 4AVYA 3QLJA 4CM7A 1WAMA 3DHEA 1E77A 1TXGA 5DT9A 4U6SA 4J7UA 2ZCVA 4R54A 3G79A 4JNKA 5LCXA 3JQ7B 1ISGA 1IHYA 5I7FA 3H8VA 2BLLA 3RKUA 1CYDA 5L95A 2Z1NA 2HCTA 1UXKA 2Y66A 2YDXA 4HBGA 4Q39A 4EDFA 4JIGA 2GN8A 4Q3BA 4S3MA 5I9NA 2YV1A 1HDCA 3TL2A 2O3SA 3WMWA 2OP1A 4AFNA 1JN0A 1RYEA 1DHTA 1EQUA 5TJ9A 4AJOA 4BNUA 3WGZA 3R0IA 4XGIA 2JCYA 4BV8A 3G17A 4NZ9A 3ZU5A 3OEWA 3PFFA 1E7SA 4CQLB 5G0UA 1I30A 1IY8A 4IIVA 2EKQA 3JQ9C 3ENNA 4QSMA 2A35A 4WJZA 2VHXA 4CLXA 1E6UA 1Y5RA 2D3TA 1FDUA 2BGKA 4DXHA 2HU2A 1PQWA 2VWPA 3OJFA 3W4KA 3NGXA 1PR3A 1YDEA 3WGQA 2PZJA 1K6XA 3RC9A 3QY9A 4CLEA 2NM0A 3LF2A 5HWSA 3JQ9A 5EL0A 3EDMA 4CL8A 4CM5A 3JQDA 4K1LA 5LDHA 1M6WA 2I6TA 2DTXA 4NIMA 1BHSA 5IZCA 3DAGA 1I3MA 3A9WA 1BTOA 3PK0A
chains in the Genus database with same CATH superfamily
1L7XA 1Q0RA 3CU5A 5ERYA 4X97A 5TJHA 2G28A 3PQ8A 2HEGA 2QMZA 3AF3A 3GRZA 3T3GA 5LWHA 2IP2A 2D7CA 4GUAA 4RK1A 5C7IO 3CCCA 3SHFA 2HIAA 4WNAA 1LVGA 5EOVA 3KSRA 3OCXA 1J06A 3ETCA 3QTBA 1JHQA 4E0BA 4Z4HA 5JMOA 3SDBA 3GUCA 4ML3A 1E3TA 1YGYA 5BUQA 2FWMX 3MJFA 5DLDA 3BVPA 5KYXB 2LV8A 2WVAA 5CNIA 2C2XA 2DPGA 5FTLA 2Q8PA 4RGVA 1A9XB 1GR1A 4BTVA 4P7KA 2IPNA 3ZCTA 1AT1A 4KXNA 5ALEA 1FU8A 2HHLA 4Z0TA 1G3QA 2QTHA 1DOHA 4V0QA 5CJPA 1H6BA 2QN7A 3NRCA 2GD0A 1MP0A 3NTLA 1DRVA 1QNFA 1RMTA 2A9JA 2FKAA 3T34A 4DZRA 4Q9JA 3E2MA 1JYSA 3EXHA 4WH0A 2XWBF 4JOQA 4AQYB 2ZPUA 4FJ2A 4GECA 5JYEA 1BFDA 2W2OA 1CX9B 1QXSA 1K3UB 3LTEA 4R8MA 3TWOA 4BMXA 2ZUDA 3WHIA 2XZPA 2DZDA 3RJ5A 3PDJA 3TSYA 4B3CA 5JANA 2R6ZA 4BJ5A 1AZSC 1ISMA 5B4TA 4OHFA 5LBUA 3RC2A 1RBZA 3H4VA 2X77A 1GSOA 3K31A 2J41A 2BFPA 3D0QA 3PWZA 4A92A 1PS0A 3D81A 3F4LA 2OHJA 4LQCA 4EW2A 4KPFC 1EUDB 2VNJA 2Y1EA 5EJ2A 5K03A 2AFRA 1H8HA 1Q3TA 1R0KA 3JZIA 5AM0A 4X95A 3SZRA 1XD2B 1PSDA 5REQB 2J3HA 2QM8A 3H9BA 3A3PA 4G1UC 5FWDA 3G0CA 1KPGA 2WFZA 2B2CA 2Q1SA 4G63A 5FO1A 3IVMA 1N2GA 4IL5A 3NBZC 5IBRA 5L40A 2AVNA 2W6NA 1GTZA 2Q2WA 3EXG2 3DZDA 1L7AA 3ONVA 2R7NA 4TXJA 3PJRA 3KVOA 1EUCA 4CLOB 3LBFA 1O4WA 4DQDA 2LDBA 4K87A 1RWXA 4W1PA 4DIFA 1JJBA 1XJQA 4D79A 5IJZA 1DAHA 3CVVA 2WAMA 1U3CA 1NONA 1X7XB 2NAFA 3AY7A 3FZGA 4JBNA 4L8LA 4AMUA 3ICVA 1UKAA 3O9ZA 1U9CA 4U3JA 2CEKA 3IKJA 4HF7A 4C0BA 1FP1D 3C97A 4RZ3A 2JAOA 1KJIA 2ODAA 3GRRA 3ITNA 3PUJA 1E1KA 1E7YA 1AXEA 2AE1A 2VL7A 5MFZA 2GJ8A 2FX3A 3EVFA 5KQRA 2H7YA 1L7EA 4HYQA 4ILEA 2J31A 2FWNA 2KQUA 4ALLA 3K92A 1F0PA 5SYAA 1R0YA 3B3GA 4CKCB 4RS3A 1XKXA 1S8NA 4HRAA 2XSZD 3GGGA 4JSTA 4QRIA 1ZYUA 2PPVA 2YHIB 3SGLA 3E8SA 4BYGA 2YXBA 1CR0A 2R4QA 1OJ7A 1AE1A 1R6VA 3JSAA 1QIHA 4R5HA 5B64A 3WGKA 1CUVA 1GU0A 4XPZA 4E1AA 4TLAA 3UJ7A 2AD5A 1AQLA 4MYDA 4ZAZA 5T6BA 3W06A 3W6UA 4CUJA 4V0OA 1YOVA 1ZIDA 5FTJA 4F7WA 5B55A 1ZCJA 2VXCA 4LNUA 4P5PA 3GT4A 4PNHA 1QZXA 4NMXB 1ENPA 1YNOA 2Q9UA 3BXHA 5BV0A 1Q22A 1IXYA 1MX1A 1OFHA 3TLEA 1L7PA 2QAGA 3F3KA 3HA5A 5KTNA 1FFSA 3NUQA 5ISMA 2EXXA 2IUSA 1SAYA 2QTCA 4NCJA 1E0SA 2C5FA 3AESA 3N8GA 4RPLA 5DI9A 3EZGA 4IZOA 4FHZA 5ALFA 3OA0A 2NACA 2YYYA 3E27A 5DI3B 5JXJA 4NARA 3M82A 1VXOA 2JFOA 3WB1A 2IEDA 1KO1A 2JIBA 4US1R 3UGKA 5BXQC 2M6SA 3LC7O 2WYVA 4JLSA 3QITA 1EXVA 1DQYA 2ETXA 4BNYA 4YHBA 2BFWA 3IJRA 1T8RA 3PXDA 4ND3A 4J3NA 3T12A 1ZCZA 2JGDA 2PGLA 2VFAA 4FQ5A 3USZA 1JQKA 1NHWA 1GT91 1A77A 2BMWA 2WHXA 1QH1B 5HZHA 3KQVA 4E22A 2JLSA 4BMOB 3SY8A 3Q72A 3IP6A 1N5RA 1VL2A 2ZS9A 1ZOSA 3HMKA 4AUEA 5L45A 2CF5A 1AUPA 1H4VB 2VIIA 1KJYA 4EY3A 3V2IA 3JU3A 5LZ7A 2AEMA 1N2CA 3A6LA 1LD3A 2KWIA 4Q01A 3E4CA 2ZB7A 1L7VC 1P73A 1ZCAA 1IRIA 2I3AA 2N46A 3A4YA 4HDNB 4PM4A 4TV9F 3VKGA 3O0DA 1ECJA 2OCKA 4KK4A 2FR8C 2G5TA 2YJ4A 3HQ4O 1TA0A 1Q0ZA 2EEPA 4TT8A 1TT7A 2OV8A 4UM9D 2AF3C 3ROGA 4C29A 4WZBA 4W9MC 2HJHA 1PDVA 1SKQA 4MKIA 5BQFA 2Y2UA 3NRBA 2OD9A 3CC8A 2Y05A 2A30A 2G25A 5GJWC 4MQFB 1F9AA 1WCYA 2WU3A 4NAVA 1VTKA 1RM4A 1SD1A 1L4LA 3QFSA 3HNPA 2PLNA 1NOKA 2ZJAA 1M1UA 3R2JA 4L95C 5CYOA 1CQIA 2D4HA 2J67A 3F7OA 2VHYA 2WV7A 2YRFA 1TZ2A 2H1CA 4ENUA 4BNTA 4Q1BA 1ABFA 5E6SA 2B6HA 1WUJS 3CPHA 1MBZA 3TNJA 3WRYA 1ZRSA 4IR7A 4AKTA 5ITWA 1JWAB 2GT1A 3RUCA 3TTUA 4YAJA 3G7NA 3I8OA 3IJEB 3QE3A 4BUZA 4E1VA 4ARCA 1LNSA 4HH3C 2GZHA 4R71A 3K9CA 1PS9A 3FWPA 1P6UA 1N5KA 1R6AA 2RC5A 3R7DA 2FJ0A 5TX7A 1U5AA 5JLAA 4C4SA 1K0FA 3R0XA 2ZOSA 1J39A 3T0GA 4BZXA 4RKEA 2YBEA 1F51E 2XEXA 1HYHA 4KWCA 5K09A 3U19A 4PPGA 5IC4A 3GF4A 4B6FA 2EFGA 2JI7A 4WEOA 5CCDA 2D2XA 1QG0A 4F21A 3FNIA 2XRMA 3CNBA 1QPBA 4DTCA 4DG8A 4JDPA 1U1CA 1VECA 3CKKA 3PDIB 4MQUA 5EIHA 3AO0B 4JYMA 1PWHA 2IHBA 1GRQA 2XT6A 3HPRA 2YR0A 1VE5A 3T4UA 2JGJA 5KSZA 1ZN7A 2I7VA 3A10A 1XMOB 2NX2A 3TFOA 4KIJA 5F5XA 2HPAA 4MV0A 4XUGB 3SCZA 3K2BA 1T2DA 1JF8A 4H16A 2K7FA 1GJRA 4Z3OA 1N92A 1T0PA 3GLRA 1T36B 1YQEA 2QD1A 1BX0A 2HQOA 2HJRA 2A4MA 2GPSA 2J3EA 2MIIA 5D01A 5JH7F 1D09A 2OM2A 1AHIA 3A4IA 1E3EA 4FKBA 4HX2A 2QTMA 2QENA 1Y1RA 1BAPA 4LWQA 5J1TB 2B5WA 3IAS1 4FOTA 1PKEA 4UNNA 5EQFA 2WINI 4E5NA 1B42A 3L1UA 5HCNA 3W6OA 4YUZA 3ZDCA 3AYZB 3L6UA 4NF2A 1S3IA 2WD7B 3DEJA 3OIUA 3WL5A 2C97A 2H2HA 3EVZA 2ASVA 2HQBA 4S0XA 1IONA 3SF0A 2XVAA 4YAGA 3C7DB 1DP4A 3CG4A 2YWJA 1M6VB 2OV6A 4L50A 1GTG1 2I6SA 2WM9B 4UJ5A 1FDSA 4H3HB 3BMCA 4MGYR 1YU6A 3C5VA 3GJYA 4MP8A 3D1LA 1YT5A 1TOAA 4CR8A 1MHPA 4GT1A 4IS2A 5G0SA 5AI5A 1KY2A 1XCOA 5JU6A 3NJRA 4DIBA 4XWKA 3ONFA 1OXUA 4QAJA 3DCIA 3R20A 3JAKA 5KNDA 3JQGB 5REQA 1E2FA 1MTOA 5CH8A 4ZO4A 4DY6A 1L1QA 4J7XA 1H2YA 2HJWA 3KUUA 3E3AA 5KNCD 5GIOE 1QKIA 1C9KA 1AO0A 2GHTA 4MKHA 4NU6A 5TV2A 4XA8A 2C3YA 4KGVA 5B1IA 4RVHA 5HRAA 5LIPA 1OYOA 3EA0A 4ZICA 2IF0A 1XMXA 3DVSX 1VLVA 4HN9A 4KGXA 4Q4JA 2F9LA 5GQSA 1YB6A 3EASA 4E32A 2M6KA 5KOJA 1D4FA 1JI0A 3LM8A 4RHYA 3O4FA 5F7ZA 1NVGA 4IJKA 2JLBA 1W85A 3W7BA 1JECA 2CLMB 4ZO8A 2DY1A 1GNPA 4MOWA 4BRUA 4CM3A 1B23P 1L5OA 1LQTA 1N7GA 3AI7A 3D7KA 3L7CA 4Z9XA 3HEAA 5FIUA 1W4BA 2FPPA 3INTA 2J9XB 4Z8YA 4DNXA 3LX8A 4Y9RA 1E9DA 4F9GA 2Q6OA 5KYNA 4O63O 1NASA 1RRVA 1KA9H 3EY9A 1WB4A 4HDRA 5A9RA 1UANA 1T24A 2W6MA 4PXSA 1G5QA 5K8IA 3OQ6A 5JCJD 2J3JA 3KXLA 6PFKA 2QTVB 4MS3B 2GBLA 2BR4A 1XX6A 1R74A 4RJTA 4NDZA 3HJUA 4L3OA 1N3YA 1H6CA 5E6UB 3U62A 5BMOA 1XK7A 1XRPA 4V1CB 4AI6A 3O8DA 1U28C 4Y67A 5AVOA 3EDCA 3DOJA 5L6LB 2CFTA 3RG8A 1AXRA 1Y4DE 3B70A 3DO5A 1WBDA 1KS9A 1SB9A 1EK1A 1DJNA 3G1TA 2A33A 2GEJA 4TTIA 1OOEA 2ZI4A 3H16A 2AJ8A 1TW3A 3LMKA 3H2KA 3IP9A 3V4LA 4L7QA 2OV3A 5C4GB 4CMIB 4BNNA 3O0TA 3VO2A 3H5LA 3WBJA 1C3LA 1GKYA 2RI6A 3D4NA 4LYJA 4IILA 3AFHA 3FJYA 1CJSA 1U0GA 1QRRA 5ARBA 5K6TA 2BZSA 5CTAA 5BWBA 5J40A 5CJ2A 5I7HA 4F5EA 2XWPA 4JUDX 2H5EA 3H11A 1LI4A 2Q7DA 2B8JA 4BGUA 4ZI2A 1PYOA 4KKXB 2O1EA 3EXG1 4IZ6A 5A3SA 3NGMA 1DELA 1FRVA 2BLNA 2YCBA 2C0QA 3KO8A 2RGNC 5E4FA 3M9LA 3IR5A 1C41A 3AEKB 3EUAA 4XQEA 4DLXA 4GC9A 1BJTA 3W8EA 3UNXA 5FTNA 4AW9A 3O90A 4TMXA 5KWIA 2TYSB 4B3MB 3DEZA 4B87A 3CF2A 1DKUA 3AILA 1Z07A 3EIUA 4NR0A 3ZH9B 1QIKA 1FJHA 1SU6A 2CZCA 2ZDGA 3LDFA 2QZPA 3F6YA 2HF2A 4PZZA 4XCQA 1GYRA 4D0GA 2XQGA 2IUFA 3K8QA 4Y1FA 1P2GA 1EVIA 3R41A 3FETA 4LDZA 4QBFA 4BNIA 4OD0A 4X9XA 1YDGA 2XXAB 3E2IA 5FV7A 5H81A 3MF4A 4TMFA 4MGIR 5IARA 1ESDA 4COKA 3GMDA 3TZ6A 1AO3A 2Y9MB 2G6BA 2PY6A 4JGBA 1KIMA 1RCFA 2K6GA 2Z8XA 1GQOA 1T5BA 4RJJA 1T91A 2WD9A 3ZCXA 1QTIA 3H5NA 2E6KA 2Z3WA 1WZCA 4R81A 3OFND 5BN4A 1W0JA 3NJ4A 3H9JA 3FFTA 3DCYA 3DMPA 5TSDA 1KU0A 1F8GA 2VNIA 2IXBA 4OI4A 1U80A 2NSJA 2Q6TA 2P9JA 2E55A 1CUHA 2FQ1A 1JDTA 2Z08A 3E3NA 3KDAA 1T8PA 3Q3GE 4Q15A 3A4NA 4J6FA 2LVBA 3JYPA 2UVDA 3GEIA 2Q1TA 5HQTA 1QRSA 2GBCA 2EARA 1ZD8A 5I45A 3AVOA 4IDOA 1K5DA 1A1SA 1BQ4A 1NC3A 1UM8A 3DLAA 3M6WA 4LNUB 1A8QA 1LK5A 2FPXA 2ZB2A 1ZY2A 5AVZA 1LDYA 3C14C 4BMNA 1GARA 4WBXC 2QM7A 3KLOA 4B6GA 4OGGA 5EJFA 4J0FA 3LDHA 3VBEA 5A5VA 4GZ5A 2XA1A 3SQMA 5DHFA 1J9EA 3KPJA 4UCQA 4EUFA 5IANA 2ILVA 2XCIA 2PBZA 1LEHA 1OWMA 1FMTA 1T5TA 2PGNA 2V59A 4NU8X 3ZDDA 4HQKA 4ISBA 5TQ0A 3X43A 1I32A 1R4MB 1GCGA 3Q40A 3O38A 1Z36A 2JKYA 4ZC8A 1QFZA 3H6GA 5EMKA 4XVUA 2XMDA 3FMFA 3SHQA 4G0QA 2VDVE 4H15A 2I8CA 2VNKA 3UMBA 4CM8B 8MHTA 1RMQA 3KVVA 4QOHA 2XXAA 3HVIA 2R96A 2BCGY 3VH3A 1OR8A 2JH8A 3PUWA 3PRJA 3S99A 3B3AA 1J5XA 7AT1A 5AVXA 2HYIC 3VPAA 4PTZA 1D1TA 1H1DA 1JW9B 1ZN8A 3C43A 4W5WA 4YRPA 3REQB 1E7RA 4ENWA 4ABTA 3U1VA 2AS0A 2CW5A 3K5HA 4HUQA 3I2KA 2ENWA 3O8BA 4KJZA 1V8ZA 2F6RA 4KI7A 4RENA 5IHXA 2LCFA 4N82A 2IYXA 1RFGE 4PWYA 1USVA 2RAVA 3FUUA 1QO0A 2BEUA 3LRXA 4IHJB 4LF9B 4S0ZA 4MGKR 3A3YA 3NUZA 2PM8A 4QG7A 1JAIA 1JFLA 1KO8A 2XUJA 2OZKA 3D8BA 4LY9A 2OO3A 2C2BA 4KHPB 3O2QB 4L57A 1BD3A 1XD2A 2XNDD 5JCXA 1SVWA 3UICA 3ZHYA 2GFIA 2HV9A 3E58A 4N5LA 3ZLBA 3E70C 2WNHA 5DT2A 4CLDA 4CKZA 5KOHA 5KNBD 4QUGA 1PGPA 4CM1A 3CNEA 1NVFA 5ERXA 5KSWB 3ROMA 2IYZA 5ENDA 4DRXA 1FP2A 4LVCA 3CG0A 3WDLA 2AFIA 9ATCA 3SF8A 3D02A 5KNDD 5FI0B 1PGJA 2RHHA 1MO4A 4WCDA 1M2VA 4URYR 5DTJA 4AJKA 3AUAA 4J16C 4NS1A 5ALYA 4DSZA 3BIFA 1KQNA 2I2BA 4F5WA 1IATA 3T5PA 3V7YA 1MQAA 3M34A 2YJTD 1ESCA 3FYHA 5CCBA 1E7MA 4JU9A 1IZ8A 1WXQA 2D62A 3QVXA 3VC2A 4YT8A 1CUJA 4KQFA 3CLHA 3FX2A 2GPTA 4EX7A 3GJXC 4X64B 4BLWA 1KK3A 3P4XA 3JXEA 4HMOA 4V03A 1WRBA 4WLFA 4L0MA 3L8CA 1VZ2A 4KO4S 3E7XA 3FJ1A 2JEYA 3K5PA 3L9WA 1U63A 2C9OA 4Z1MD 4Y6OA 1IQPA 1ESNA 1NQWA 1IOLA 3MINA 1T9DA 3DP9A 3H04A 5EEGA 3RYHB 2YUIA 3BTVA 5C4MA 5TMDA 2JD2A 1Z4NA 2BE9A 4ZGBA 1JNYA 1N0UA 3JQ8B 4QYMA 4RL4A 1WUYA 1YZNA 2JCSA 1U2DC 4C05A 4ATNA 2BVNA 2BIFA 3KYCB 4EG6A 1WCV1 4YR7A 5HDBB 1G0NA 4OQXA 1P4JA 4A6DA 2DBZA 5F7XA 4E5DA 1PZMA 3K9FC 2WWXA 5FWXA 4RMIA 4Q1CA 2VJNA 4DJFC 2FG6C 4W8HA 1K89A 3JAKB 1JG2A 1U2SA 3FW1A 1FTNA 2J0UA 2WJJA 4LRQA 3AFNA 3IDSA 5H59A 3SJZA 4EY7A 1YJXA 3USCS 1CS0A 4CMJA 4H1WA 4FOPA 1CK4A 3LPLA 2VBCA 1ZLXA 2BBWA 4U7TB 2O07A 1N4AA 3K8ZA 3Q9NA 5AW5A 2VPIA 3PE4A 5KINB 1HFKA 1Q0UA 2QU8A 1UFRA 2HHAA 2IV2X 4RKRA 1IHXA 1W5SA 4M0EA 1TKAA 3WGUA 1FLNA 2D5BA 4D92A 1Y0BA 1TVKA 3LBNA 4UEOA 4Y2UA 1QTRA 1TQ4A 4L5YA 4ROSA 1XNJA 3B3FA 3V4ZA 4QVIA 2P75A 3VO1A 2FPKA 3AY0A 4IDEA 4KFRA 3GYBA 1CWUA 1U3UA 1T5OA 4ND2A 4PRYA 2K4MA 5FF9A 4EG8A 5IABA 4KTVE 2AI3A 1T6BY 5FLXA 2ANCA 4FX2A 3RYTC 1Y7HA 5JDCA 2G3YA 2PMWB 2ZGVA 4LECA 1OCEA 2FGKA 3GQBB 4JJGA 4P08A 3NRJA 3FRIA 1TE2A 2X1LA 4KN8A 5ERGB 5CVTA 3IPRA 3DQZA 1Z4MA 3IUEA 4MUXA 1AF7A 4DCVA 1ZX1A 1MQSA 1UAGA 3AQ4A 3E35A 4KQ2A 3I9MA 3LFUA 1G9XA 3E22A 4RZIA 3FGPA 2BHLA 4D3FA 3DS8A 4G6ZA 1T9HA 2OGUA 1M8JA 2VEOA 2SKDA 3F9CA 1XTSA 4JVLA 4M9UA 3RCBA 1UZLA 2WTMA 4OIFA 3WK7A 1V39A 4AZSA 3W7VA 4D2IA 4DILA 3PNMA 4BFCA 1AOXA 1W52X 5ILGA 1DDIA 4ARSA 2BSAA 1HQKA 3WVNA 3C85A 4WAUA 3Q7IA 5FRDA 3PNOA 3WMXA 3HXLA 4AECA 1C9EA 1EP1B 2GXSA 2QP9X 3UXHA 5IEJA 4B3GA 3BJMA 1ODSA 3SM9A 1GDTA 3MCZA 1Z45A 3R09A 1F06A 2V58A 2VUUA 1GO2A 5BSTA 2B61A 4KUEA 4BVJA 5CHYA 2MR6A 1O94A 3TI9A 5JEEA 4QTUB 2G4CA 2XCTB 2GCGA 1I33A 3GFRA 3MLEA 4EW3A 1XPRA 5DWQA 4DQ0A 1N9ZA 4BB0A 2QN9A 1ZH6A 2ACWA 5GOTA 3H0KA 4EG4A 2XKKA 2FKNA 5D5QA 3ESAA 3HJRA 3G0IA 1VSTA 3L7DA 3LP6A 4UHJA 1M1XB 1PR6A 1A96A 4X45A 1V9CA 4MW5A 2FN8A 1T4CB 4P4SB 1KP3A 1NVXQ 1V0JA 3AETA 1D5WA 1ZIXA 2CSUA 2HADA 1U6KA 3NNNA 1KSGA 3M5PA 4G4GA 4L4XA 3TCXB 1Z12A 4GXTA 3HLYA 1O7JA 1XMJA 4K03A 5EJ7A 1RYBA 3EMVA 5L4SA 3PVCA 4FZ3A 3N5CA 5JWHA 5LLSA 3TNYA 4CIAA 4KP7A 4YCLA 5FBQB 1DC5A 1VFPA 4URVR 1B16A 3RFTA 1DWUA 1UPAA 4XARA 2R5FA 4HZUA 1W36C 4UDYX 3W1EA 4LI0A 4DBLC 3GLFB 1AUVA 2PXHA 3ZGVA 3KAPA 1WU8A 4IDFA 1V43A 1QGUB 4ND7A 4EP1A 2Y0DA 3HBNA 1JMVA 3ZLTA 1V41E 4IGAA 5HMMA 3UJ9A 2CY0A 3VMMA 1UDBA 2GD6A 3N2LA 2BH9A 2EIXA 4HO1X 3KHKA 5E9QA 1X13A 3ZX4A 2QMEA 4YRIA 2Z0MA 2XB9A 1ABEA 3WLIA 3FPEA 1QHSA 1SM4A 3WMRA 2BV3A 3V7WA 1RQXA 4FR0A 4KIWA 2IOYA 3WTCA 3ZZMA 2Z5FA 2ZS8A 4EENA 4CQMB 2VLBA 4ZVOA 5TRTA 5IAAA 3B13B 4Q6BA 4MVWA 3V4OA 1S1CA 3LUHA 1DL5A 1DMRA 1XRJA 1DTWB 2G8LA 2ZIUB 3NCHA 1WB9A 3SZGA 2I9PA 2YY5A 1M76A 3IKVA 4OREX 2IL1A 3VAAA 3VSCA 3QRWA 3S5UA 1NX9A 2O6LA 3DYIA 5JBNA 2PXAA 3KDPA 1Y80A 2Q28A 1OXMA 1Z8DA 1XMSA 4XZ3A 2NVUA 3IGFA 3TKAA 3AQIA 3WTBA 3UWDA 1A2BA 3V33A 2CLDX 3CHYA 4Z4QA 1KRXA 4HV4A 3L5KA 5CD1A 3ELBA 1OC4A 1T34A 2JJ2D 1BJKA 3D31A 3JQPA 4IIUA 3UMRA 2BGRA 2V98A 3HGTA 1X9IA 3OCJA 3A6EA 3MFYA 1OFVA 5BQOA 5A4KA 2AGVA 2PGIA 3WZMA 3TGLA 3IHWA 3V55A 2HA6A 3AR9A 1GUYA 2AOWA 3FDJA 4RQTA 2QYHA 4KAJA 5G1OA 4EHNA 4ZI5A 3ZCUA 3IQEA 4DARA 1DXYA 3OIDA 1Y1QA 2QD3A 5K7SA 2GJ9A 4HLDA 4RZQA 3WRYC 3DAHA 1BHO1 1TJYA 1B6TA 2PH7A 3PNQA 4FZRA 4QASA 1CUXA 1TF2A 5LMUB 5JS1A 3VI3B 4P33A 5CXUA 2OILA 3D5EA 5CG2A 3AFOA 5FHQA 3AEXA 1GKLA 3WOHA 4G36A 3RPEA 1AKRA 5IW8A 4AKIA 4B4VA 2J6IA 3H2HA 1LPOA 3HJGA 4PY2A 2C9MA 3I5MA 1ZI8A 4XCVA 1B8PA 5DWDA 2QR3A 3M3DA 2BR3A 1JEOA 3WXBA 3AKCA 4LWZA 1QRUA 1JAXA 3EG9A 1PT7A 1KJWA 2ZRPA 4FINA 2PUJA 3B6MA 5K3EA 2CJPA 1S1MA 5AKKA 4LJKA 4IP0A 1R66A 1DXOA 4GLLA 1JG6A 2C2OA 3Q6IA 2NTJA 3HU2A 4KSBA 2AG0A 5JC1A 5SV2A 2VSYA 4X8OA 2RHLA 2Z5VA 3E9CA 1VLLA 2QW8A 3LYHA 3OZAA 4JAVC 4ZYXA 2UVPA 4RPCA 1M2OB 1P1HA 3L6RA 4CMKA 2ODNA 5IDWA 3D2AA 1WEHA 3H4IA 3AJ8A 5DGCA 1L5GB 5CDYA 1EX7A 4D8YA 1ZXXA 5I8WA 3KL4A 3TSWA 4M55A 1J21A 4DT1A 1Z2CA 3U56A 3DTVD 2H63A 4CM6A 2HA3A 1DB3A 1KO7A 1I7SB 3PQEA 4CMHA 4OHKA 3KWLA 3HDJA 3R0JA 2JLYA 1UMDB 3VKFA 5D5PA 3R5TA 1ZEJA 3BJRA 4YB8A 5TGDA 3PQCA 3PD1A 2P6PA 4QVKA 3SSNA 4BPRA 3CKYA 3EFHA 5EVCA 5TARA 1NMXA 1QIFA 4JWKA 5IDXA 4FFBB 1QRAA 4G5OA 6ABPA 4MS4B 2ZQYA 5CA0F 5LYJB 4O4LA 1C1DA 2NV6A 1K63A 2Z1MA 1HXHA 1H66A 1E9FA 2XDWA 4PG8A 3I04M 4JROA 1E2HA 2WUWE 2WZCA 3DZHA 3VVLA 1V25A 2O3TA 3NXKA 4PHHA 4EJ0A 3IP8A 2GXQA 2J1LA 1ZBDA 2R1TB 2X7JA 4NC9A 1H2WA 4LXXA 2G67A 3EXIB 4Y2TA 4QREA 2Y0PA 1Y3CE 1MO2A 1MG5A 1WHTA 2HNKA 2XD9A 3LGXA 3RWOA 1TVKB 1TYAE 4AUKA 5I3ZA 3GFQA 3IB3A 1VSVA 3LP5A 3PB3A 4M87A 4RJ2A 3THSA 5JAIA 1YDHA 4UXIA 4TTJA 1NP6A 4GR4A 2FUG6 2P8JA 3BE8A 4DIOA 3C5WP 3HYRA 3ZPXA 3HN2A 3JZMA 3L8MA 3VPCA 3R74A 4MVJD 4D99A 1T0JB 3VYWA 4TZ6A 5FTKA 2QTAA 1VOTA 4HYTA 4LF7B 3CR7A 5E1BA 2WU8A 1QYRA 2AW3A 3A58B 3L5OA 4W9RA 3RR2A 1NT4A 2WWWA 4PX5A 3RT7A 2R5WA 1ADBA 4YAUA 2HMYB 4W5JA 4YC7A 3IDAA 4I46A 4F38A 5JPIA 4EHJA 1XQWA 1X8LA 2GVNA 1ZOPA 3EWIA 2RIPA 3DAYA 1C30B 2FRDC 3G0BA 4II3A 4PC6A 3TGWA 2I91A 3CLSC 3L7YA 2W00A 4PQRA 3KR1A 4IIJA 4KLAA 3QLTA 5IVDA 3B85A 4HVCA 2XUKA 5LXTA 1ONPA 2G9NA 2P2GA 3NHLA 1CUYA 4HAUA 1R15A 3BSYA 1T6ZA 3EZLA 3OSUA 4MW2A 3ROTA 5L6MB 4PTYA 1YFJA 5BWMA 3QUCA 2P35A 1MC8A 4QXRA 3DEFA 5AM1A 5EGNA 4WRRA 3RU7A 4TZ0A 3RYHA 2VHWA 5CURA 4JYZA 1I7DA 1DJLA 5B58T 1QFJA 1I36A 4OHCA 2QXTA 2NTYC 3R9KA 4AL4A 1GUFA 2AN1A 3OFSA 1QIJA 2WTXA 5LXTB 3CH7A 1GRRA 5COBA 1K3FA 2VAVA 4LJ8A 4IJMA 2G08A 3EUEA 2VTBA 2OQ2A 4U0JA 1BROA 2C2ZA 2I55A 3K4QA 1XE3A 4FFMA 4NEGA 3SS8A 2OR3A 4Z51A 5CDHA 3KC2A 1Z0UA 4FNOA 4RLFA 4ENTA 4O3MA 4BVAA 5KWSA 2PVCA 1XCGB 4N39A 1QHIA 1ZR4A 2I22A 3SIRA 3WA6A 1G8KA 5G53C 3N3BC 1Z5WA 1Z82A 3D8NA 3KTAB 2NU7B 4MI1A 2FJPA 3OF2A 4Y7CA 1XA0A 3Q12A 4ZEXA 1ISFA 1HOTA 2CHQA 1U4OA 3KD3A 5BNFA 4FB4A 1ECCA 1EH5A 1RLIA 3N28A 5LZ2A 3RVBA 2CYCA 3L1JA 4NQZA 4IWXA 2IKQA 1A4UA 3RIXA 4BIIA 2R8BA 4Y6PA 4YV7A 5LNK6 1VJ5A 4D57A 5ILOA 3KE8A 2DBYA 2GN0A 5KWEA 2HU8A 2RARA 5K6RA 3G2JA 4EFKA 1L4YA 2Z6AA 3EOBI 1CUEA 1PGOA 2JI4A 3EXEB 1PJZA 1WUTA 2CDAA 3RHSA 1UWLA 2IDJA 3V8BA 3EHDA 3HYCA 3PFHA 4CMBA 5B30A 1OILA 2IT1A 4YT4A 4M53A 4FLFA 4L5CA 2FN3A 3NALA 4CF3A 1NBMA 2OUIA 4OQMA 3RVOA 3QXSA 4B7ZA 3DBHB 4ARVA 3CZ4A 3MHPA 2X7XA 1E2BA 1R7RA 2ZXFA 4Q9LA 1ZVJA 3UK0A 4CM9D 2PX0A 2CJWB 2IUYA 4UVHA 4I1RA 3BK2A 4YBZA 3CX4A 4CRWB 1LZKA 1Q0SA 5A9TA 3W5VA 5AW8A 1GGKA 1KI7A 2RB4A 4GQAA 3R7SA 2W2XA 3KQHA 1PX2A 3O26A 2V7QA 1Q3KA 3LKDA 1KXJA 3IAS6 3C3WA 4I7EA 4LZPA 4RHFA 1K2WA 2A4KA 1LJLA 4BX0A 3HFJA 3FFAA 1HF3A 2QN8A 5CTJA 2WIDA 3S7TA 4BX8A 1W4RA 5HW0A 5IC6A 4EBFA 2ZJYA 4BFYA 1J7JA 3AJRA 1UMBB 4QBIA 1YOVB 1D6MA 3GROA 2Z6UA 4IMPA 2A2ZA 5D7NA 3K35A 2VZ9A 3A6DA 3JRXA 4OHUA 5EMHA 3W4JA 2QRZA 1F38A 4WOJA 2WT9A 3OY7A 4YMTA 1U8YA 4I1SA 1PZGA 3W1WA 3RC8A 3PHBE 1DSSG 4IXTA 2HMWA 3BM5A 3FZEA 1JNXX 3ILSA 5HKKD 2CCJA 2WF9A 1RRPA 3R7LA 2VYQA 3DPIA 3IQIX 3PUYA 4L2IB 4DV3B 5FOUA 2DLCX 4REOA 2KE5A 1AQ6A 4D6XA 1U9IC 3DTTA 1J5EB 4XCXA 3AHJA 1LVHA 4BLPA 2AJCA 4KYUA 5EUCA 3T5AA 5JS2A 1C5KA 1X70A 4UUQA 4B84A 3THYB 3K6SB 4NZPA 3WIEA 4BVEA 3VNAA 1ZWLA 3CF4A 3PC8A 4RCZA 3OZCA 4EM6A 2EQ5A 3BRWA 1WP4A 2O7QA 3R3VA 4GP6A 2DQZA 2SHKA 4QU9A 1WZIA 1QCYA 2OGTA 3ZQ4A 3ICOA 1OI3A 5BSKA 2B8WA 3N0TA 4QICA 4ZT2A 2PD6A 1LDNA 2V03A 1V16A 2Z6VA 3JQBA 4KYVA 4P83A 2VP3A 1BZYA 3NNDA 4CHTA 2DH5A 4CMEC 3OUZA 4W9NC 4YAKA 1GTJ1 5KKCA 4OL9A 5JVDA 1DAOA 3HO1A 3SFZA 4IRMA 5AJVB 2Z9DA 2CDBA 2X19A 2E89A 3RRMA 3S40A 2BAGA 3L4BA 3WP1B 3T1TA 1WMSA 5GAJA 5FAKA 4LHYA 5GMOA 2WSLA 5F77A 4UFPA 1RYDA 1KP9A 4QUAA 2M6RA 4YIKA 2F00A 1X42A 1UJMA 1HKUA 1C2YA 3E9DA 1FQOA 3HACA 2OBLA 2PRIA 4UEJA 4UM9B 1U8EA 5I7WA 2PYZA 3O8OA 4GPBA 4M9CA 5AHXA 1SK9A 4BBJA 3IEMA 2FPMA 4XQ0A 1NRIA 1U0OC 1FBTA 2DT8A 1KYIA 2H54A 1EP9A 4PCLA 4Z9AA 3SIXA 4PSVA 2PLFA 5F51A 2MINB 4ZRDA 1P0MA 3GFOA 3D0KA 1W6RA 5T5QA 1MT0A 1XPUA 3CLTD 1DRUA 3ODPA 1RKBA 2HMSA 3D8SA 4JVOA 3MOSA 3AHHA 3QF4A 4PGHA 1Y9JA 4K1XA 1EWQA 3OOYA 1HL7A 3NDJA 1EUQA 3CSUA 3CMMA 4PQGA 2I3ZA 1ZJ4A 1KJ8A 1MJGA 1RWNA 5JCZA 4TWIA 3BX1A 2DT5A 2IDZA 4EI2A 1SD5A 4TT3A 1AS0A 2O19A 4OAOA 2WJ4A 1PJLA 3UGQA 4B4UA 1WVGA 1YJ8A 1JKIA 2VHZA 3G2PA 3H1PA 2ZWAA 3R44A 2XI4A 2GX6A 3CUSA 3P5SA 3R3ZA 3FYDA 5HIAA 4AYTA 4H7PA 3E53A 3PQDA 4F2DA 5L53A 5E95A 4RHXA 1S2GA 1SWWA 2QT9A 4Q4HB 1UZNA 2QMOA 4WK2B 5DBEX 3FNBA 4D9NA 3E1KA 5K8LA 2EW1A 1THTA 1KI9A 3KEGA 2XYVA 4FKMA 4FMCF 2IU4A 5TY0A 4JYPA 3AVWA 2ONCA 5IN5A 4Z2AA 1LDMA 2MSLA 2XTZA 3ND9A 4G0MA 3MAAC 4B3RB 3DL4A 2HDWA 3NTUA 3SBOA 1NMYA 2DFDA 3ND8A 3WGHA 1P2FA 5C80A 3G1WA 5IUNC 3K0AA 2JANA 5T57A 5T67A 4DAEA 1FFDA 2DECA 4ZRMA 1GA4A 4LE2A 5UKDA 4LDJA 4EHHA 5IM4A 1NG9A 3CVOA 3SC2A 3TUIC 3ZWQA 3RT9A 4JC4A 4OIMA 3D3KA 4TMYA 1U2GA 3PRHA 3ROPA 3BWYA 5EJ6A 2ISCA 1CRPA 3QVKA 3LWBA 3JATB 4YREA 3WIVA 4NG4A 4QEDA 5ALTA 5GWXA 5I6DA 2PVSA 2UXCB 1MPXA 4RXTA 1CRQA 1W8IA 5AMXA 4QOSA 1Q6YA 1UOPA 3PDWA 3CIOA 4R2KA 5GADl 1EX6A 2ESRA 2ZJOA 3OESA 3LUPA 3WV5A 1AGYA 1DOAA 2V7XA 3PCTA 3EMBA 3C6BA 4DFDA 5CT8A 2JGKA 4BLRA 3FCYA 5FDFA 4GYJA 5J43A 2WK1A 2PKCA 4DT1B 4R6WA 4Z9BA 1RM3A 2P9BA 3LLVA 4UAVA 2M9MA 2X9NA 2ZYSA 3N5KA 3RV4A 4EA6A 3HCEA 4I1PA 2W2TA 3QF4B 5LA6B 3AK4A 3DMHA 3QLVC 5TQVA 3WLEA 3MTBA 3K8OE 1ORRA 4GGPA 4QUIA 4B3HA 1YRWA 2GZ1A 4JN6B 1VG9B 3JARA 4PC1A 5DIZA 1L9XA 3MT8A 4HEQA 1ZRNA 3B78A 5C32A 5CBKA 3J7TA 3PQ7A 3U44A 1ACMA 2WZQA 4X7RA 1GXSA 4N7RA 1FSFA 1ZD3A 3AW8A 4D5GA 1T36A 5JATA 2CXOA 2WSYB 3LG2A 4CEHB 1FTWA 2WOOA 1A5AB 2I2WA 3EC7A 4QOEA 1C3JA 4QARA 3T5GA 2HDNB 5AM2A 2REOA 4JBLA 5IJXA 2GPJA 5HQ3B 3AI1A 3UAZA 2MOKA 3D7LA 4EY5A 4XVCA 1JH9A 2AQHA 2YMPA 1Z47A 2FA9A 5B3JC 1JHUA 4JI0B 4FVTA 4Z86A 4OBEA 3UCFA 3W6ZA 5H02A 4ZGWA 2X9GA 2XW6A 4CCYA 1C9NA 1IPHA 1GN8A 5LQSA 1EM8B 1RAEA 2DQYA 3OPYB 4XAQA 2GBLC 4EL5A 3W9YA 4JDUA 2GSWA 4DMGA 1GPJA 3RYCA 3LJKA 4KXLA 4AIIA 4FI3C 5ALKA 4YMGA 4Y1RB 5EINA 1QIGA 1UBSB 5NLLA 4P4GA 1SBCA 4JXJA 4MA4A 4KMOA 3BBPA 4PHGA 3ZHRA 2WU4A 3N76A 4FE4A 3RVPA 1LWOA 1QH8B 1YUNA 4MQEB 4ND4A 1CIJA 3LCJA 3OZTA 1ICIA 3FBWA 4HEJA 4IG4A 3WDSA 1PFKA 1X15A 2XAUA 3H97A 4MLCA 1L1FA 4DLVA 3U31A 5JAUA 3OQNA 2QX4A 1DIGA 4M1SA 3WK4A 3RHTA 1CDZA 4FK8A 3EQ9A 4MUBA 1Z0ZA 3KJNA 1MORA 3R3JA 4I5IA 4NYIR 1E5DA 1ZN2A 2ZG6A 1Y8ZA 4IEEA 3NBQA 3N2YA 5DBOA 2EWWA 1UZAA 4YT2A 4K8RB 3T7SA 3L6BA 4CUKA 1FFGA 1VE9A 4FB5A 5F33A 1M5UA 4D4MA 3RSGA 1Y8QB 2VF2A 3VZRA 4O2BF 2ZE5A 1NZJA 1NYQA 1W0KD 2GTIA 1NQTA 3C8MA 3TOCA 2DR2A 4L75A 4WA7A 3LY8A 4HFMA 3T7KA 5CGZA 4HQ0A 5IVPA 2W2LD 3ANMA 1IXZA 2EHJA 3OWHA 3MTGA 5GP1A 3CZPA 4BP8A 4IUYA 4OFZA 1EFVA 4IO1A 2WYIA 1PJRA 1JBEA 3DP7A 1Y8QA 4OMDA 1BS1A 3WNCA 3GZNA 3U4QA 5HSGA 1UOOA 2PAAA 1MAVA 3NO4A 9LDBA 3RC7A 2HTEA 1P6XA 2XJ4A 3K1ZA 2ZJ6A 4Q37A 5LUBA 3OAAD 2J0QA 2CJWA 1Y48E 5HEKA 2BZ0A 3TVTA 1D4OA 2FJUA 2XWQA 3U1TA 4E15A 4KOAA 3VH1A 3VPHA 2C7OA 1MB9A 3MNFA 2HH9A 4OTZA 2PUWA 2C9ZA 4IWYA 1V1MA 5BT9A 1RI2A 1UBJS 2I66A 4RV9A 4RK5A 4KV7A 4W6ZA 2GCPA 1E7QA 2Z2ZA 2VUHB 2CVOA 4DLUA 1TRKA 2E3JA 3MUNA 3OTGA 2JH9A 1PWZA 1I14A 1K6JA 3FSRA 2Z58A 1CJKC 1XNHA 4YGXB 2M6LA 1K4KA 2ACVA 2BMFA 3QVTA 1A27A 4BZWA 1L4BA 4FFBA 3MTQA 4R2JA 4XSHA 1IYZA 1HZZC 1QO0D 4HI0E 5L7YA 5BYKA 2IKSA 4F56A 4GAEA 4IDHA 4W5HA 5JROA 4YQEA 3SICE 3H9EO 4XFKA 2DC1A 4HNQA 4KQXA