4OMUA

Crystal structure of shikimate dehydrogenase (aroe) from pseudomonas putida
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
274
structure length
274
Chain Sequence
MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQGSGGNVTVPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVNAGVELAGKRILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFDELGPVVASGFAWLQEPVDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGKEPTPFCQWATKLGAAKVLDGLGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQLARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of shikimate dehydrogenase (AroE) from Pseudomonas putida
rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords Shikimate dehydrogenase
total genus 99
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4omuA02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 4omuA01
2O50A 4CV0A 3AU9A 3I9JA 4PRLA 3JQEA 5K0ZA 3G17A 3F46A 3L6DA 3WB9A 2CY0A 2PGJA 4DPKA 1QKIA 5L45A 1WDMA 3PK0A 4CPDA 3ITKA 5KVSA 1Y6JA 3AJRA 1LU9A 4IDFA 2YDYA 1LLUA 1ZSYA 3LC1O 1ISHA 4J3FA 5JSFA 4TROA 5JPIA 4R9SA 2YV3A 4WLFA 1WP4A 5JAIA 3IS3A 5JDCA 3MJEA 1PQUA 3H8VA 4DQUA 4FFLA 5JYEA 2VYNA 3ZWOA 1K6IA 3GFGA 3S2EA 3L4SO 4O59O 3ETEA 4ALLA 1ULUA 3Q11A 2EJWA 3N7UA 4XYGA 1A4UA 4I08A 2V6MA 3GVPA 2XOXA 4DREA 4N7RA 5TT0A 4DIFA 4Q39A 4IDCA 1JTVA 2NVUA 1HE4A 2VRCA 4CMBA 2JJYA 5IDXA 3NTQA 4C7KA 2UV8A 1DIHA 1EUCA 5ENVA 1OAAA 2J5QA 1P45A 2O3SA 4IDGA 3RBXA 4URFA 1BRMA 4M8SA 1YQXA 4D79A 2OO5A 4Y9DA 4FD3A 2Q3EA 5JS6A 3RFXA 4DIBA 5AXDA 4NFYA 3C85A 1VJ1A 3CSDA 2OOSA 4K28A 1WDKA 1YS4A 2J3JA 2QG4A 4WUVA 3B1KA 4INAA 1QYVA 5JAMA 3GRPA 3C7DB 4YJFA 3WLEA 2XF8A 4HFJA 4O1MA 2GSDA 3BMQA 3WG9A 2OGUA 3DZGA 1NM5A 3JQ6A 2GZ1A 1R15A 5F3RA 4BVAA 5U1PA 4BV8A 3VC7A 1GCOA 2CNBA 1LQUA 3RUAA 2JL1A 4CUZA 4XB1A 4CMGA 5DULA 3PJFA 1I3KA 4OOEA 1ULSA 1J49A 4E4YA 3R6DA 4EJMA 2GN8A 1OBFO 2VWQA 4EJ6A 3Q9UA 1BTOA 4R16A 1R0KA 3RU9A 3R3JA 4II2A 1TEHA 4MO2A 1ISIA 3DBHB 4BKUA 4XB2A 1C1XB 5TSDA 4GX0A 4UVEA 3DC2A 2O4CA 3M6IA 3DBLB 4PRKA 3UGKA 5A04A 2D0IA 1ZBQA 4GX5A 3BHJA 4MKXA 4RL6A 2EERA 3K5PA 5HS6A 3RC9A 4DWVA 4OJNA 4GX2A 4WE3A 1GDHA 3DZFA 1OC4A 4MJLA 1LI4A 3DHEA 4WK6A 3JQAD 3UKOA 5GZ6A 3ZWMA 1P1JA 1I5RA 1EVZA 3FR8A 3I9KA 4NBUA 4IQ0A 5BNFA 4R54A 5FWNA 2TMDA 3PJEA 3RROA 5ER6A 1PL7A 4CQLB 2D5CA 3GVCA 3GNTA 3TZCA 4DMMA 3OIGA 4IS2A 4QXMA 2R00C 3JQCA 1VRWA 3N58A 1MG0A 3DQPA 3PWKA 1HXHA 2D5AA 1CEQA 2X0RA 4E13A 1FDWA 2Q45A 2B5VA 4EUHA 2O2YA 5EERA 3CEAA 2NU7A 1UP7A 4HP8A 3E5MA 3VTZA 5KVVA 1SOVA 5ILGA 1DC4A 3E03A 3NDJA 3OIDA 2X7HA 1U9JA 1SPXA 2WD7A 3PJGA 1UDAA 4DL9A 5L51A 2ZCUA 3AM4A 3RQSA 2GF2A 1NHGA 1Z75A 3GMDA 3UXYA 4E5YA 3RD5A 1PU2A 4OL9A 2ZYDA 1MUUA 4K6FA 2IZZA 2J3HA 1E3JA 1Q1NA 2OFPA 1JLLA 2OP1A 1E7YA 5G4LA 1XA0A 2W2LD 5DBGA 1Y5MA 2X22A 3MZ0A 4MIEA 5HRUA 3DOJA 4A27A 1DLJA 3WLFA 1QYDA 5CPBA 2I6TA 2NV6A 3AFMA 3RUHA 4YR9A 1E77A 2G0TA 3GOHA 5F21A 1IZ9A 2GDZA 4IDEA 3JQFC 1OOEA 1D7OA 4F6CA 3BHIA 1P9LA 4H15A 3GK3A 1DRVA 4WLVA 4AJLA 1DB3A 1T26A 2YFHA 2Q1SA 4ALJA 5A9TA 3GF4A 4B4OA 4Z3KA 3ROPA 2C2XA 5F5NA 1H93A 3ROQA 3L0DA 2W98A 3WGTA 1JKJA 4Z9YA 1GYQA 5IN4A 4NPCA 4WOKA 2Y93A 4Y98A 1HLDA 5HTOA 3W8EA 5ITWA 1BSVA 1IOLA 1NQTA 1WWKA 3ZCXA 4FFRA 4B4WA 3ZWAA 1YVEI 3D4OA 1HDRA 3Q3CA 3RKRA 4QO7A 2X8LA 1DC5A 1I33A 3ZU4A 1E1NA 4XDZA 1DHRA 3VZSA 4WCFA 1DJNA 1ONPA 3UCXA 3KLPX 2DBVO 4NMHA 1P74A 3DL2A 1T4BA 4O5OA 4AJ2A 2HUNA 5H83A 3GVXA 1IULA 4FFOA 3DO5A 1HDXA 3LDHA 1ZCJA 3AI1A 2FRDA 2QIOA 2Y1FA 3I83A 3VPHA 3ZNNA 4ZQGA 4K9DA 3TL2A 4RPLA 3AUTA 2Y0CA 2CZCA 1PL6A 3G0OA 1PJ3A 4IQGA 1SEPA 3IIEA 4P38A 1GPDG 1N7GA 4ZJUA 5I7VA 1N1EA 4RO0A 2VOEA 3NUGA 3BMCA 3PFFA 3K2EA 3KEQA 1VL8A 1ZSNA 1FMCA 2ZCVA 1QYWA 3GZNB 5IG2A 3CMCO 3WS7A 1T2DA 1JW9B 1W4ZA 5EINA 3RUFA 4DYDA 3U5TA 1RYDA 3GGGA 4D7AA 4KWHA 3A06A 1HETA 4W7IA 3WNVA 3PVZA 5MGBA 1BHSA 1ZUD1 4J43A 3F1LA 3QIVA 1RM0A 1E3WA 4D43A 2NVBA 3OSUA 4AJEA 3P5SA 1BWSA 2YJZA 4IUYA 1JQBA 1NQAO 5JO0A 5DOVA 4HY3A 3T7CA 3SEFA 1WXDA 4KMSA 3MWDB 4XRRA 1LRJA 1GZ4A 5L53A 4MVJA 2A94A 4GL4A 3T4EA 3NDIA 4PLVA 2QX7A 5TS3A 4QECA 4BMVA 4EDFA 1U7TA 3KO8A 1Q0QA 4P4NA 9LDBA 4J1SA 3U4DA 4N54A 4TWRA 1G1AA 5C37A 1R4MA 2AQKA 2QW8A 1C0PA 4JIGA 5FF9A 3MJSA 4BIIA 3M1AA 3ZU2A 1R4NA 3ZV5A 3JYQA 3JQGB 2OMEA 5C5IA 2Q4EA 2ET6A 4JGBA 4CLDA 4XD2A 2P9EA 3JD4A 2ZYAA 5KJFA 2B4RO 2UVDA 3KYDA 1KBZA 4YEDA 1GY8A 2BGKA 5L95A 2NQ8A 4AFNA 1ARZA 4AL4A 4ITUA 2QRKA 2YHIA 2CVZA 3K31A 1XKQA 3NTOA 5MDHA 3LT0A 4TMFA 3RI3A 1ZEMA 1UUFA 3PQFA 4BNUA 1NFFA 3AFNA 1K0UA 3DB2A 1LEHA 3SX2A 4MVJF 2RBEA 1X1TA 2X9GA 1GV1A 4BO6A 2C29D 2PNFA 1V3UA 3EW7A 3GG9A 3I52A 4PG7A 2VUUA 2GUGA 4FBGA 4U0JA 3DTYA 3AOEC 2JD1A 3VOSA 3WJ7A 2WM3A 3MOIA 2HU2A 2J5KA 3I6IA 3NT2A 2VQ3A 5LDGA 3V2UA 4EEXA 3QVSA 2O23A 2VHWA 5ENDA 4E31A 4UUNA 3Q6IA 2GZ2A 3U9LA 3LSYA 1I01A 1BW9B 2PLAA 3E9QA 3HE3A 4KQWA 3INGA 2EGGA 2O3QA 3SC4A 5BNTA 4I1IA 1DAOA 1DJQA 4NBTA 1T2EA 3OBBA 2VNAA 1C3VA 1F17A 2HRZA 2GZ3A 1KC1A 2Y0EA 4BO1A 5TRTA 3IKVA 5JY1A 2WD8A 3QLJA 4CMIB 3HDYA 4AJHA 4L0QA 4FC7A 1P1IA 4IZHA 4J0EA 3HB4X 4Q3NA 1H5QA 5IDYA 2YDXA 3OQ6A 3WQQA 5ES3A 4BO4A 4FC6A 1A5ZA 1QR6A 4MPDA 5CEJA 1YKFA 3DBVO 4OM8A 2VWHA 1S6YA 4GWGA 1WPQA 4WASA 4CQMA 4XQGA 5DCUA 3UH1A 4UEJA 5BSFA 4YJFB 4WOJA 3VDRA 4TQGA 2Y05A 1GQYA 1JVSA 1PS8A 4I5GA 3DOCA 3HDQA 4GMFA 4BQRA 3ON5A 2X23A 2HJRA 1ZKMA 3LLVA 3RVDA 3KYCB 1MXFA 3ROKA 4FJ2A 4D0SA 1HF3A 3OA0A 3WYEA 1IYZA 1DSSG 3MTJA 4RQTA 1Q7BA 3KLMX 1E5LA 5L4SA 3DAGA 2WTBA 4LCEA 1SNYA 3L77A 3PHLA 3JQDA 3LC2O 5JW6A 3GUYA 1KEVA 3SBOA 4HV4A 3H2ZA 1KERA 4OKNA 3RU7A 4PFJA 4L4RA 3I3OA 4UVHA 5C7LO 4UUOA 3MCVA 2BGLA 5I9NA 1DIGA 3ZNOA 3O26A 4R3WA 3KTDA 5BSHA 4YQZA 1PX0A 5IN5A 4Z6KA 2FPPA 3KSZO 2UAGA 3NEPX 3CZMA 3D7LA 1MC4A 3VDQA 4YRBA 2NU6A 3OA2A 1TVEA 5KCZA 1E3LA 3OHSX 2EKLA 4RLSA 1R16A 1OMOA 4FJ1A 4WLUA 4EBFA 2CUKA 2TMGA 2EG9A 2NU8A 4ESOA 5IAAA 4KDEA 4OQYA 4C7JA 3ZU5A 3PZBA 1XGKA 3BTVA 4J7CA 4CL3A 3U09A 1CDOA 3GQVA 4D3DA 1YH3A 1I3MA 4ALIA 2NACA 1VI2A 3EUWA 3T7EA 1VJ0A 2PZLA 3VTFA 7MDHA 3I4CA 3D0OA 4JQCA 5CFZA 4L75A 1TXGA 3VH1A 3GPDG 4PIVA 5I7EA 4N5MA 4M54A 4ALKA 3K9QO 1C0KA 4J1TA 2IXAA 3O03A 4XZ3A 3UAGA 4PLWA 3WQRA 3GHYA 5AXCA 1M67A 1YE3A 4H16A 1U4SA 2VYVD 4RGBA 4PVCA 1MC5A 3VKVA 2DVMA 1JKFA 3TJRA 2AMFA 2BH9A 4J4BA 1HKUA 4QSMA 3TL3A 4XYEA 1N5DA 1YONA 3TOZA 4IMPA 4XIJA 5JCJD 3JQGA 3BTOA 1BW9A 1PJCA 1M66A 3DZKA 3K73O 3AM5A 4MKZA 4J2HA 3F5QA 2DFDA 1VL6A 4Y8VA 5JMWA 1NR1A 1B3RA 2IXBA 3F4LA 2HJSA 4RVHA 1R12A 3GDGA 2Z95A 1ADGA 2JAHA 1ZH8A 1JVBA 2NU9A 3B20A 3NRCA 1DIBA 1N92A 3QVXA 1LSOA 1ISJA 5B4VA 4OAQA 5CDSA 1E5QA 1LLCA 2GYYA 4MDHA 3C3XA 4R69A 2X1HA 5LCXA 1EBUA 1YJ8A 4BO2A 2Y0DA 4UEOA 2DTEA 3MWEB 4GGPA 4M89A 2Y66A 1H6CA 3TSCA 6ADHA 1LTHR 1ADFA 2B35A 3HB5X 3GR6A 2P2SA 4CR6A 1X7GA 4E21A 5L4LA 3OFSA 1E3WB 1DC3A 2P5UA 5HA5A 1Z73A 3VVBA 4FSHA 5HM8A 1H6DA 3GRKA 2UUOA 1MB4A 4UUPA 3PIIA 4YRAA 1SBYA 1JAYA 4PLZA 1R4NB 2C0CA 1NP3A 4YXFA 2RHCA 2G82A 4TVOA 1Y81A 1EMDA 3EYWA 5G2OA 1NYTA 2VOJA 3GNSA 2WYWA 1HDZA 2WWRA 2B37A 3B1JA 3QSGA 2DPHA 3TRIA 2XXJA 3WYBA 2VNSA 4BO8A 3F47A 1HE2A 4DC1A 4F46A 3LT1A 3GGOA 1PJBA 1PJLA 2AXQA 4CUKA 3UFXA 5FFFA 1HYHA 3PP8A 1I0ZA 2VUTA 3V2HA 3L9WA 5CDYA 5G4KA 3D3WA 4RV9A 1V3VA 3MOGA 3ZWYA 1TT5B 3HFSA 2Q2VA 3U4IA 4MP6A 1ZIDA 3OP4A 4RPHA 1AXEA 5B4TA 4FFPA 1GFSA 1X7DA 2PKQO 2ZB4A 1VKOA 4BNLA 3I9LA 1GZ6A 1NVMB 3ZNQA 3HWRA 3GZ4A 1VSUA 2OUIA 1P1FA 1ADCA 1BXGB 5T8KA 5EJ2A 3IC5A 2B5WA 4R51A 4UVDA 3OJEA 3SJ7A 4ZVVA 2D59A 2G76A 4E33A 1H94A 4QEDA 2EIHA 1YL5A 1NASA 3WTBA 4BKQA 1RJWA 1FK8A 2B4QA 5A1TA 3PXXA 3BIOA 2CVOA 3FWZA 4YAKA 1NR7A 1YWGO 4ILKA 5IZ4A 2IEDA 4BNYA 4WPGA 2VT3A 1UDBA 5T8KC 4MVJP 3WGQA 2CF5A 2EP7A 2Y99A 4XX0A 1KEPA 2PZJA 3OJLA 3LC7O 1ZSVA 3ZGYA 1NQOA 2RH8A 1NFQA 2I5PO 2PWZA 2VYND 1KEWA 5T67A 1GEGA 1PZFA 2WMDA 4RPJA 1SO8A 4DXHA 3E48A 1KC3A 1YDEA 4HX5A 2NVUB 3OF2A 1F8FA 1E3SA 3T4XA 5JDIC 1ZK2A 5JMPA 2PZMA 1E0DA 1LUAA 2FOIA 4G65A 2Q50A 4BNVA 2RIRA 2BRUA 3ANNA 4I5EA 4B3HA 1WMBA 4RVGA 3D3EA 4TKMA 1HZJA 1UZLA 3RFTA 3ZZNA 3INTA 3CINA 1O89A 3U4CA 4BMSA 4IDBA 4IGFA 2X86A 3WIEA 1QG6A 4NFSA 4QFDA 4BL5A 3QRWA 3EHEA 4KOAA 4CMIA 2JAPA 1BDMA 1U3UA 3DMTA 3PTZA 2FN7A 1AE1A 3I5MA 5ICMA 3COSA 2YW9A 4JJIA 4O6VA 4Z3DA 5DNAA 5TIIA 3HN7A 1UXJA 5F5LA 5TX7A 4J1NA 4P4LA 4EUEA 1I3NA 3RBZA 3ABIA 4J7UA 3FBTA 1Y8RB 3ITDA 3KHUA 1I30A 2RH4A 4D0RA 2I67A 1JU9A 5IF3A 2O3TA 1U5AA 3E6AA 3HG7A 1XCBA 2I99A 3GEGA 3PRJA 1FDTA 4N5NA 3FRJA 4BQPA 2G1UA 2NWQA 3JYPA 1PZGA 3JQ7A 4GQAA 4A2CA 4ZICA 1UR5A 2XXBA 5TC4A 2YHUA 3CKYA 5CPFA 4ZN6A 4OOFA 2HSDA 1FF9A 3GAFA 5I9LA 4Z0HO 1VE9A 3DZIA 2DBQA 4CLRA 3KEOA 4PZDA 3W6UA 1KS9A 4MP8A 1LDMA 4JLWA 4IZIA 4Q9NA 4TZKA 4WCFB 2NUAA 4RF3A 4NK4A 4TRMA 2NVWA 4BMNA 1AXGA 3PPIA 3GPIA 3WMXA 4PLFA 9LDTA 3ZN2A 4DA9A 1R0LA 1GR0A 4KP7A 2X0IA 4YT8A 4LSMA 1E3IA 4HFMA 3O8QA 1YQDA 3H6KA 1E7WA 1NVTA 3GNQA 4GI2A 3VH2A 5KVQA 1E1KA 5K6AC 3H3JA 4PG5A 3RC2A 5COQA 1CRWG 1Y9AA 1U2DA 1HLPA 2AG5A 3B1FA 5KVCA 3GC6A 3RUIA 2OHXA 1Z82A 3UUWA 5BSGA 3O8QB 3H5NA 4C4OA 2I66A 4EI2A 3HQ4O 2EV9A 1EZ4A 1XHLA 2Q1TA 4Z9FA 2Q46A 4YJGB 1YOVA 1T4DA 2FMUA 3DEYX 3DZJA 1KVRA 4BS9A 2ZK7A 4HKTA 1BVRA 3A14A 1ZXLA 3ENKA 3I23A 3QVTA 4ND1A 4RVSA 1U7HA 2Q49A 4U6SA 4OXKA 4CM7A 4U0KA 3S2IA 4OO3A 3MJVA 4G2NA 1SB8A 2YUTA 4BGIA 5T64A 4UVIA 4EGFA 1EUDA 4TZTA 1WAMA 1QRRA 2Q99A 1PIWA 1MG5A 3OQBA 1C1DB 1UXHA 2HO5A 2YZ7A 3Q2KA 4YJHA 4BGUA 4CMAA 5ILOA 3ZHBA 1MXHA 2WDZA 2I76A 3KYBA 3FSRA 2B36A 5T6BA 5BNIA 3H7AA 4XCVA 2O7SA 2VHZA 3DMTC 1QSGA 3WFJA 3JQ9A 2CFCA 3FNFA 4QFCA 1JKIA 4J6FA 4WGGA 4OHUA 3RBVA 2PKQP 2RCYA 5CDUA 2F1KA 5AVOA 2VHXA 1ZJYA 1C14A 2DBRA 2G5CA 3ZWBA 1OC2A 3O9ZA 3C1TA 2FR0A 3PHJA 1LDNA 2E6UX 3AI2A 3AY7A 3ZWPA 2V6FA 2VWGA 3QHAA 1YBAA 4BOYA 4QO8A 4HNHA 1ZW1A 1K89A 3GMSA 2Z5LA 3TN7A 1DXYA 3ZU3A 2A9FA 2J3IA 1DOHA 3GT0A 4YAEA 4E0BA 3RKUA 3S1LA 4I9NA 1FDUA 3D1LA 4AJNA 4ZRMA 1LX6A 4BO5A 3A1NA 3OJ0A 1XU9A 2E49A 1EE2A 3QWAA 4W9NA 1R66A 1Y8RA 4MVJG 4NFHA 4DQVA 1ZK4A 3U62A 2BFMA 4EITA 5G0WA 2ZB3A 3ZWWA 4JP3A 2HAEA 3W8FA 1LRLA 1OZAA 2CDAA 3EC7A 4XDYA 4E3ZA 3DZBA 2OL4A 1WLYA 1PS0A 3DAFA 1U5CA 1IPEA 1GZ3A 4NG5A 2NM0A 1CF2O 4N5LA 1AGNA 4CM8A 8LDHA 4L73A 1KEUA 1RKXA 1PR9A 4PG4A 2Y1GA 3WGZA 1GYPA 2D1YA 3JQ9C 5C7OO 1ONNA 5HBRA 5A03A 5DP1A 1H2BA 1SOWA 2GN6A 4ND3A 1WW8A 4A26A 1ZNQO 2WYVA 2QYSA 3FD8A 4MINA 4E5NA 5AQ1A 4RCVA 5EIOA 2JFFA 2VRBA 4AJJA 4B8ZA 3F4BA 3AOEA 2AG8A 3WQSB 4ZD6A 2J3KA 1VJTA 3DR3A 4ALNA 5DCWA 1IZ0A 5JC1A 2ZQZA 1PZEA 3BMOB 3VVCA 1QLHA 5DT9A 3IJPA 4RF4A 4ONEA 1KETA 3QWFA 1LXCA 3NDRA 4PLTA 4R68A 2JCYA 2VYVA 3H9EO 1CYDA 1EE9A 4ROSA 3DHYA 3G1TA 5DZSA 1HYEA 2PGDA 3QV1A 3SLGA 4CM5A 1LSUA 4NK5A 1D4FA 4M49A 1RPNA 2W4QA 2FZWA 3GDFA 4U7WA 2Y1DA 4R1UA 2LDBA 1XU7A 2B0JA 4UAGA 2Z1MA 3V1YA 5K6AA 3A28A 2UDPA 4B7CA 1BXGA 3VZQA 4DBVO 2AEMA 3FPCA 3HNPA 1HE5A 2EHDA 4PLGA 3NAQA 5CDTA 1W0CA 3WBFA 3JD3A 3STHA 1YRLA 2X0JA 3FNEA 3DTTA 3IP1A 1EFKA 3AU8A 3LYLA 1LC0A 3BTSA 4J4TA 2D3TA 4NHEA 5DOZA 4JBGA 2VUSA 2UYYA 5FI3A 2R2GA 2IZ0A 4TSKA 3RASA 3TWOA 3WXBA 1ZMOA 1PWZA 1CQJA 3PI7A 5B1YA 4CLOB 5A05A 1UZMA 3SC6A 3TF5A 3K8ZA 1K6XA 2AHRA 1B2LA 1VM6A 4XRGA 4WEOA 4DPMA 2UUPA 3PLRA 4MP3A 2FR8A 4W82A 2HDHA 3SLKA 2R6JA 3VPGA 1P3DA 5TGDA 5CAEA 1P77A 4CM3A 5A9RA 5KKCA 1IL0A 1DFHA 4U5QA 1YO6A 1F06A 3D5QA 4DBZA 4YDRA 4LK3A 1B7GO 7ADHA 2P9CA 1KIFA 4NJMA 4OXNA 5T5QA 4M55A 3FPLA 4BNZA 4CL8A 3VH3A 3WSVA 4CR7A 2X0NA 3W6ZA 3KB6A 2BFOA 2G17A 1T25A 5KJEA 3D4NA 1I2CA 4O63O 3KSDO 1WZEA 1SC6A 2E48A 1PZHA 3JQ8A 3ZDFA 2AE2A 1B16A 4XIYA 1XG5A 3QWIA 2X5KO 3RIHA 4D46A 1YOVB 4BO3A 2JFGA 3IUSA 4CM1A 1E7SA 4MKRA 4XYBA 2EKQA 3KETA 1X15A 3DAPA 2V7PA 4I8XA 3EZLA 4L74A 4YRDA 4E5PA 1ZZEA 3ASUA 3NJ4A 1YL6A 4WCFC 4TRRA 3ROMA 5JNLA 3W4IA 2B69A 1VSVA 4GKVA 3O38A 4GBJA 4UULA 1M75A 4GGOA 4I5DA 1P0CA 1MV8A 1R37A 1ENOA 2WE8A 2JKVA 3E8XA 2DKNA 3E5RA 1DFGA 3JYOA 3PHGA 3AWDA 3HDJA 1NWCA 1YB5A 1XWFA 2C59A 3ZWNA 2Q2QA 1KVSA 3UVEA 2JD0A 1H2HA 2X4GA 3JQAA 3INRA 2GASA 4A03A 4K1LA 4Y6PA 5IXYA 3DFZA 3DMYA 4PG6A 4XQEA 1V9LA 1Z74A 3PGJA 1EK5A 3EVTA 3HJAA 4OXYA 3OQ1A 4B3JA 3H9JA 1PGQA 4QTZA 4BB6A 1BGVA 2DPGA 3OJOA 1P0FA 2IE0A 3D64A 1UZNA 2FPIA 4E2ZA 5I7FA 2RHRA 4BGEA 1ZO8A 5EPOA 1WMAA 2PGLA 4LRSB 3V1TC 1OFGA 1GL3A 4L4XA 2R00A 1YGYA 3LF1A 3PEFA 3H3FA 4K6CA 1EK6A 4IGEA 1ISGA 3RUCA 1DRUA 1Y8QB 3GLQA 4RPKA 1HDCA 3UW3A 3VH4A 4LVCA 3DBHA 3E82A 2NTJA 4GLLA 3MEQA 5JAZA 3HN2A 1BMDA 1ENPA 4YAJA 4OH1A 4YPOA 1DIRA 2ZB8A 2GNAA 1EVYA 3QW2A 4YJDA 1Y9EA 3ONEA 2GRAA 3DHNA 4NQZA 3NT5A 3VAZA 4CUJA 3IMFA 3LZ6A 3FR7A 1O0SA 3L07A 1PJTA 4EZBA 2P68A 4W4TA 2BHLA 5IJZA 1NPYA 2EW2A 3QVOA 4I5FA 3TNLA 4YT5A 3AY6A 5G0TA 1K5HA 4KTTE 4Y67A 1C1DA 3CH6A 3JQBA 1M6HA 1XQ6A 3RC1A 2Y1CA 1YB4A 5HWSA 1IHXA 1O6ZA 3LLSA 3ZWCA 1SAYA 1Q7CA 2X9VA 3GN1A 1V8BA 5A4DA 1S7CA 5IFLA 4PCVA 1NNUA 3WMWA 4B7UA 3QA9A 4IDDA 4NBRA 4GVLA 1PSDA 5C3MA 4Q3CA 1ZVMA 4WEQA 2BGMA 2OXIA 3Q0EA 3BAZA 2GCGA 4DGSA 3A9WA 3KBOA 8ADHA 1IE3A 1IHYA 1B26A 3GVHA 4H3VA 1E3EA 4HNGA 4BO0A 3CIFA 2WE7A 1PQWA 4FN4A 1ORRA 3Q2IA 3VHRA 1R4MB 4XYLA 3ASVA 3LT2A 5JDCC 3RSHA 1ZK1A 4YBZA 5JCJA 2VN8A 4GPD1 3KYCA 1GUYA 1ENZA 1UP4A 4Q3AA 5ER9A 1YL7A 4I9UA 3GEMA 4KDFA 2RAFA 3KYDB 2EF1A 4BNWA 1X14A 2GN4A 4JK3A 4FOOA 3WIDA 4HFRA 4I9HA 3QE3A 2BLLA 3WOHA 4FQ8A 5G0UA 4Y6RA 1KY5A 5TJ9A 3D3WB 2QYTA 2YFQA 3DZHA 3LVFO 4FDAA 4XQCA 5COBA 1UXKA 3C1OA 1J6UA 3PHIA 3X2EA 3GH3A 4FGSA 1YQGA 1G0NA 3VPXA 1NWHA 5TT1A 4X54A 4AJKA 5JY6A 3ZWVA 5F1PA 3PIDA 2IYPA 1RM4A 3EDMA 4JBHA 1GAEO 4TRJA 2BI8A 3F1KA 3MTGA 3ZV6A 1H6BA 4ZQHA 3PYLA 4R5MA 4WCDA 2GR9A 4LRTB 1Y8QA 4XQ9A 4HWKA 2B83A 4BHTA 4WKGA 3L4BA 2IYOA 2NTNA 1ZXBA 1A7KA 4KZPA 2J5RA 5IXSA 3BMCB 2DTDA 1DBVO 1Q2XA 3PWSA 4HUJA 5L9AA 3WSWA 3IUPA 4N18A 4ZQEA 3CE6A 3QJ5A 2EEZA 1C0LA 3S8MA 1MLDA 1QP8A 1PS9A 1E6UA 1O9BA 1AHHA 4M86A 4A73A 5FYDA 2Y67A 1I24A 5AYVA 2PH5A 5TJHA 1PJSA 3OICA 1E7QA 3C7AA 4CV2A 2W2KB 2NNLD 4LSWA 4M87A 2WD7B 5G0SA 3VKUA 4WLEA 1QV6A 1B14A 2WJPA 2C5AA 4XYMA 4MIOA 3U4HA 4PN3A 2POQX 4ZHSA 4OMUA 1I10A 2D2IA 4J9VA 4J49A 4RDHA 4YQYA 3OECA 2YV1A 5CG1A 2HK9A 4LMRA 2DFVA 3TQHA 1XQ1A 1U28A 2YYYA 3GGPA 2DLDA 1T1SA 2FR1A 4NI5A 3QWHA 3ZW9A 1HWYA 3PYMA 5JC8A 2PA3A 1ONOA 3TOXA 5BR7A 4RVDA 4CJXA 3ADPA 1NAIA 1P1HA 2H63A 4UVGA 4YWJA 1EQ2A 4AJ4A 3L9XA 4LISA 1HTBA 1LRKA 4XA8A 2GD1O 3B6ZA 3NTRA 3BYZA 2VTDA 5CG2A 1DHTA 1PJQA 1TT7A 4JCOA 3ANLA 2VHVA 2O4UX 4J1QA 4OKIA 2NTVA 3HDHA 5EQFA 4CQMD 3DBRB 3OIFA 1D8AA 3GA0A 2DQ4A 2X6TA 4QT0A 5JLAA 1K3TA 2I3GA 1SB9A 5CEFA 4GAEA 1R6DA 1T2FA 2H5LA 3ZW8A 3W8DA 3KZVA 4CMCA 4E5MA 1UAYA 4Q3DA 1BDBA 3QQPA 5JDIA 4U8GA 1K2WA 5U4QA 3EK2A 4A7PA 4XWYA 4WNCA 4GH5A 3FNHA 3WGHA 4CMJA 4FCCA 5TLSA 2ZIZA 3R0IA 5H82A 2P4HX 2QRJA 4DIOA 1DDOA 2OZPA 4E5KA 3H9QA 5EESA 1GPJA 1LSJA 1N1GA 5THKA 4CMEC 2JD2A 4CLEA 1LDYA 1B8PA 1JDJA 4KUHA 3UICA 3Q9NA 3S2FA 4D3FA 1SCUA 1XYGA 2DU8A 3BZUA 2AA3A 1V3TA 2Q1UA 5B4UA 1W6UA 3IKTA 3GAZA 3MJCA 1E7MA 3W1VA 4HXYA 4WLNA 4TKLA 1CIVA 5DDIP 5L40A 1A4IA 1QYCA 3JD0A 3RJ5A 1ZK3A 4ZU3A 4YT4A 3TZHA 3TZQA 5T57A 1DPGA 3LT4A 1E1LA 1NAHA 2HMVA 2O3UA 3IDSA 1DO8A 3P19A 4JROA 3WR5A 3GN2A 3C7CB 4OSPA 4RZHA 4D41A 1MFZA 4R5HA 2P9GA 3WBBA 2X9NA 4CM4A 2D8AA 2VZ0A 2IODA 4S3MA 4ZRNA 1XEAA 1DLIA 4FR5A 1C0IA 3ZHXA 6LDHA 1VLLA 3IP3A 1PGJA 2Q1WA 2ZYGA 1HEUA 4B79A 1QYXA 2YHIB 4WECA 1Y7TA 3ENNA 4E30A 4CLRB 1ML3A 5A5FA 4BNFA 4CQLA 1UXIA 5IDWA 4AJ1A 4IXWA 4R1NA 4FGWA 4R4JA 5JE8A 4LVUA 1K6JA 1FJHA 1GUZA 2PK3A 1TA4A 2WSBA 3K6JA 4R1TA 4PG8A 2W8ZA 4KUGA 4BNTA 3PWZA 5A9SA 1D3AA 4BNXA 4MVJD 4RVUA 1WNTA 2EJVA 4KTVE 4FB5A 1Z7EA 3JV7A 4A10A 4AG3A 1QLJA 3K2BA 3G79A 1P33A 1DEHA 1LSSA 2NADA 1NBOA 3KUXA 4LCJA 4LW8A 5A9SB 1XSEA 1ID1A 1LDEA 3M2PA 4CMKA 1FXSA 3TZ6A 1X7HA 4R9RA 2FSSA 5IZCC 4YB8A 3OEWA 3VPSA 5A5EA 1RYEA 3E18A 5EN4A 4M1QA 3FHLA 5DCYA 4BO9A 4NJMB 3AUAA 1DRWA 4FW8A 3U3XA 1EDOA 2C7GA 2JCVA 5KKAA 5IDQA 1B8UA 4BO7A 1CWUA 1E92A 1YDWA 2EKPA 2HKIA 2YQ5A 4BNHA 1I2BA 5KJCA 3VPFA 2FHSA 3BA1A 1GADO 2ZQYA 4BNMA 1BXZA 4CV1A 2ZJ0A 1GV0A 2HK8A 2X5JO 4IBOA 3UF0A 1GEEA 2GGSA 4IINA 1TB4A 2FY8A 5THQA 3PHHA 3B70A 2B4TO 2AQHA 2J8ZA 1A7AA 2J6IA 3I9OA 1GQQA 2QRLA 2VHYA 4QUKA 5AOVA 2Q4BA 2DUWA 3DFUA 4YAGA 4MVJM 2EP5A 1I8TA 4B8WA 4EW6A 2E4AA 1I3LA 4F6LA 3QP9A 4YACA 1A9YA 2OORA 1LLQA 2XPCA 4D42A 3WGIA 1IPFA 1U4OA 1XELA 2PFGA 3G3EA 3S55A 3P2YA 4P8RA 5JXWA 5L7TA 3WNQA 4R3NA 3G49A 3JQAB 1ISMA 2XAAA 1XR3A 5C7IO 3U49A 2PD4A 1HZZA 3HADA 3WJAA 1VC2A 4J9UE 4RDIA 5TQVA 4YCAA 1A27A 5I8ZA 4L4SA 1M2WA 1NFRA 4EYEA 2JHFA 4RVFA 1NQ5A 3RWBA 1B0AA 5ADHA 4JJFA 3SXPA 3U0BA 4AJIA 1GTMA 5JO9A 1PJ4A 2BD0A 2H1SA 1PTJA 2I65A 4A0SA 4PLPA 3H65A 1NX6A 3H9UA 3HFGA 2W2LA 2ILTA 3GDOA 1MX3A 1LJ8A 2VZ8A 3HUDA 5BSEA 2FZEA 1CERA 3GVIA 2HMUA 3I9NA 3TFQA 4NU6A 4XR9A 4YA6A 3CUKA 3H5AA 5EL0A 1T24A 1E7RA 5JAQA 3OMLA 3SVTA 3S2GA 4MIYA 3IL2A 3ZV3A 1ZFNA 1AUPA 2EW8A 3JSAA 3UCFA 1U8XX 1A9ZA 1J0XO 2IDZA 2Y1EA 5BT9A 1GU7A 4CLOA 2Z1NA 1KVUA 4GSKA 4IY1A 5A3JA 3A4VA 4MOWA 1PJ2A 4NBWA 5L7WA 3ZV4A 4YAIA 4RQUA 3R1IA 3FI9A 1L1FA 4LMPA 5EMHA 1VKNA 4CR8A 3FNGA 1JWBB 1HYGA 1PQPA 2CVQA 4GSLA 1QMGA 1LQTA 4Q3EA 5DN9A 3M2TA 4WJZA 1HDYA 2PY6A 1HE3A 3FTPA 4NJOA 5BQFA 4F45A 1V35A 1IUKA 2OBNA 3EMKA 1DFIA 3IOYA 4CODB 3V1UA 2DAPA 3F5SA 5JCXA 3OH8A 3TZKA 1AN9A 3MJ4A 3WWYA 4DC0A 4XJTA 5H81A 3I4FA 4JBIA 2C82A 3V5NA 3KV3O 4G81A 4FJ0A 4XR4A 5GY7A 1N7HA 2QZZA 3WFIA 1KYQA 1UXGA 1I32A 1NVGA 2DT5A 5A3VA 1H6AA 4WLOA 1U3VA 3K96A 4CV3A 4RLHA 3NX4A 3NYWA 2I9PA 3PQDA 4DRYA 1MGOA 4G5HA 3DBLA 4CM9A 1EQUA 2GO1A 2H9IA 1X0VA 1O95A 1LC3A 1U1IA 4MVJH 1A71A 3JD2A 4FIZA 3ZHYA 1DIAA 2CD9A 1EVIA 4HFNA 4AJPA 2HRBA 2W2KA 2LDXA 3DONA 1G6KA 5I9MA 3NGXA 1U8FO 3RFVA 5A06A 3DXFA 2FPGA 3QVWA 1LDGA 2O3JA 4FOSA 4DQXA 4DVJA 2O7QA 3WX0A 1E6WA 1H9BA 4ALMA 3ANMA 3ONDA 5KJ6A 4DMLA 1NPDA 2DBZA 1O94A 1H9AA 2C07A 3BXXA 1KVQA 3AI3A 4W99A 1XLTA 4ND5A 4J90A 2VTEA 3GG2A 1MA0A 1GYRA 1Q0HA 3C24A 3CPSA 3Q1LA 3EZYA 3JCZA 4ND4A 2W90A 4JXKA 4JJGA 1KOLA 3ZWXA 1T2CA 1F0YA 1PR3A 3EAGA 3HZZA 3BMNA 4DLBA 3PDUA 3WGYA 4D45A 2A92A 2EWMA 4J16A 4IJVA 2X5OA 4B4VA 1PL8A 4W7HA 4ZQFA 4YT2A 4J0FA 4J2OA 3RCBA 1VPDA 5L3ZA 3WICA 3ORFA 2C5EA 2JCXA 1O5IA 3C8MA 3E1KA 1TI7A 1LDBA 3QWBA 4IM7A 1WDLA 1X13A 2WYUA 3RUEA 4XGKA 2DTXA 4BNNA 3JTMA 3FWNA 3VZPA 3H2SA 5GZ1A 1L7EA 5DF1A 5K9ZA 4PLHA 1N8KA 4NDNE 4O0LA 2ZKLA 5CEEA 4IPTA 3ADOA 2BELA 2O48X 3PJDA 3E9MA 5J23A 4XEHA 3IQDB 1F8GA 2D4AA 4CM9D 3GEDA 1EEHA 3QY9A 1JA9A 3JD1A 2PH3A 4E32A 3K92A 1UDCA 4UEKA 5CDGA 1YB1A 4MVJI 3KVOA 2P91A 4D44A 4IJKA 1Q0LA 4CLHA 1E1MA 3DWFA 1Z6ZA 1BXKA 3PGXA 4YTEA 4H7PA 2AQ8A 1OI7A 1HSZA 4L9RA 4EUFA 1BG6A 5AXBA 4D3SA 2QZ9A 5I8WA 1NTOA 4XGIA 1GUFA 4U6QA 1N2SA 3GZNA 2HMSA 3DOOA 3FN4A 4LN1A 4BV9A 3DBRA 4NR0A 4PGFA 5DBIA 1I2ZA 4JP2A 3H4VA 4ZGWA 3GFBA 1TLTA 1P31A 3AOGA 2BFAA 1U2GA 4IDAA 3H9GA 3JYLA 1HDGO 1ZMTA 2CMDA 4B3IA 3NGLA 5GZ3A 2O2SA 1U3TA 3L6OO 3CZRA 5CP8A 4XJSA 3G1UA 2AEJA 5TNXA 2FSVA 4BNJA 3JQFA 4PLCA 3KXDA 5KTKA 3EGOA 1UJMA 3NKLA 2V6BA 2PTGA 5ICSA 1KY4A 4B7XA 2ZJ1A 5KJ1A 5FI5A 2JHGA 3FCOA 2GN9A 3CMMA 4EJ0A 2E37A 2P4QA 4PVDA 1B15A 1P1RA 2QHXA 1N9GB 2BFPA 4MVJE 4BKRA 5JYDA 2NQTA 2PR2A 1PGNA 4OYRA 2I3AA 2FP4A 2V65A 2ZTLA 4KQXA 5KOIA 3BTUA 3PQEA 2BI7A 2Y1OA 1KVTA 2CDCA 3RC7A 1PGPA 2HMWA 4EEZA 3OJFA 4E12A 1GD1O 5F1KA 3OM9A 3KRTA 1ENYA 2AEFA 1BVUA 2YY7A 3V2GA 3PFWO 2IZ1A 2VCYA 4CQMB 2Q2WA 3ULKA 2H6EA 4TRNA 5I7SA 4FS3A 1W8DA 5L7YA 4RZIA 3SJUA 5DP2A 4NZ9A 4ZQBA 4K26A 5COAA 1P1KA 3NT4A 3MJTA 1YJQA 4NBVA 3TFOA 2OP0A 2ZTUA 1GQ2A 5LC1A 3BMNB 5B12A 3JQ7B 2PKRA 2ZATA 2O3RA 2ZB7A 3DDNA 4IIVA 2HK7A 4LGVA 3WYCA 4OGWA 4DYVA 2YQ4A 2ZTVA 1YBVA 3OEYA 3IAHA 4BKPA 3ZNPA 3ZH2A 4Y6SA 4J4HA 4UREA 3BHMA 1JAXA 3IJRA 1T1RA 5IZCA 3AW9A 3H5RA 1R0SA 1Y1PA 2AW5A 4S1VA 4JX8A 4CMEA 2HQ1A 3HHPA 3L6EA 3PDJA 4E2XA 5FEUA 3GHHA 4PLYA 3AUSA 4II3A 1M76A 4RORA 4B4UA 1F12A 4R1SA 3GY0A 3ETGA 4TVBA 4IS3A 4AJOA 1ADBA 2CSUA 3P7MA 1N9GA 2X58A 1HSOA 3ONFA 1PEDA 1XDWA 2YV2A 1A72A 2CF6A 2E82A 1T2AA 2AQIA 3X2FA 3BMQB 2PV7A 1LA2A 4J91A 4BUCA 1FDSA 1Z7BA 1J4AA 3F3SA 4P22A 1YXMA 4A5OA 1X1EA 4CLXA 3JQ8B 4E6PA 3L4BC 2NLOA 3I6QA 3LF2A 1UP6A 3ST7A 2GERA 2JFHA 4CM4B 4DLAA 1WVGA 4OIMA 1HDOA 4NIMA 5CHEA 1JWAB 3F6YA 4ID9A 5KIAA 2BF7A 2PZKA 5A02A 4XKJA 3PLNA 4BNIA 5ITVA 3EVNA 1HRDA 3WGGA 4OQZA 3W4KA 4Q3BA 1B8VA 1PGOA 1DAPA 5LDHA 1W73A 4IJUA 4GKBA 4RJTA 3PYXA 1HT0A 1VL0A 1SZJG 1EUZA 4RF2A 3O4RA 1V0JA 3RAJA 3TPCA 5KNLA 3CXRA 1AHIA 2C2YA 1C1XA 4FFNA 4IJWA 1ZEJA 5DBFA 4NNJA 3LK7A 3WWZA 1YBMA 1ZK0A 4GX1A 3FBGA 2A35A 1ISFA 3NJ8A 1XIVA 2EXXA 2QQ5A 1NXQA 3W4JA 5JBIA 4DLLA 1PWXA 4W9NC 2SCUA 3V8BA 4R41A 2VT2A 1CETA 1I36A 4KUEA 2P5YA 3JYNA 4IMRA 1NHWA 1X0XA 4DPLA 3E9NA 5B37A 5EQDA 4AICA 3JQBC 4R01A 1MFPA 5F1OA 3ICPA 3K30A 3WGOA 2HMTA 3AY3A 3OETA 4P4GA 4XGNA 4Z0TA 2VRCD 3CTMA 2DUUA 1F14A 1O8CA 1H0KA 1RM5A 2C7VA 4GVXA 5HS4A 1UH5A 4OSOA 1EFLA 1CJCA 4ND2A 2DC1A 3F9IA 4F3YA 1P44A 2ZTMA 2BMAA 3UHAA 1RM3A 2EGHA 3KM0A 4CM8B 3GUCA 4GWKA 4BGVA 1RWBA 1U3WA 2NSDA 3R3SA 5G4KB 3UN1A 2IRWA 4PZCA 1IB6A 1LLDA 2FWMX 2C54A 3NV9A 2CDBA 1Q7GA 3BMOA 2V6GA 3LQFA 4IXTA 4L8VA 5AXAA 3ICCA 4Z0PA 1J5PA 2Y68A 3ZHZA 4E2WA 4YYZA 4WNIA 3FF4A 1GCUA 1ZJZA 4KWIA 4JN6B 2DM6A 4YVFA 1Z45A 4RPGA 1EBFA 4IQ8A 4E2YA 3AM3A 3C1AA 4QQRA 4CMHA 5JFOA 3UOGA 4BNKA 1E6EA 3D5TA 4YJGA 4BB5A 1M6WA 2BKAA 4DTIA 1SMKA 4W6ZA 5G0VA 3I9MA 1Y5RA 2GLXA 2GPTA 2A4KA 2C20A 4HADA 4DUPA 3AK4A 3ETDA 1D1TA 2IEBA 2VZ9A 2HLPA 3D4PA 1SEVA 3LU1A 3HSKA 1L7DA 2HCTA 1LBEA 4CM6A 3RJ9A 3P2OA 5KWEA 2VWPA 3PZRA 4NH4A 3I1JA 1LNQA 4FFMA 3M1LA 1WZIA 1UAGA 4L76A 3KOUA 4BNGA 3ZI0A 2AE1A 4RF5A 1NPTO 5TF4A 3UCEA 1DC6A 1B3BA 2PD3A 5U9CA 1HL3A 3N74A 1IY8A 3AUUA 2F00A 3TDKA 4J7XA 1QORA 1EVJA 4HBGA 4YJHB 4JNKA 1MP0A 1QXSA 4BKOA 1CQIA 4PZEA 4IIUA 5L4NA 2PD6A 4ZA2A 3FTNA 1QV7A 1JN0A 2WEKA 3WTCA 3RUDA 1V6AA 1G0OA 3EY4A 4Z9XA 1TT5A 3VZRA 4AVYA 4FPXA 4QX6A 1EDZA 2OBYA 4NU5A 4UUMA 4GLOA 5GMOA 1FDVA 3KSUA 1D1SA 3WDSA 4GMGA
chains in the Genus database with same CATH superfamily
2O50A 2J46A 2O1SA 3NBFA 2IH2A 4EHLA 1FFAA 3LWDA 2VHUA 3JQEA 1KYXA 1L5RA 1FYDA 2R7NA 4HEA6 1OXMA 2MSNA 1WDMA 3SBDA 1W9HA 1ZBDA 3ITKA 4XWGA 3P71T 2H17A 2ZT6A 4DV2B 2PL3A 3G0HA 2I54A 2YDYA 1R5NA 1MIHA 1Q1ZA 2OLJA 3MT0A 5JSFA 3V3KA 1JQ5A 1UDXA 2WFZA 2B4AA 4CHTA 3FRIA 3ROFA 5JAIA 5CFRA 4MMZB 4ZJPA 3PQ3A 4FFLA 4V0OA 2QMUA 3UB4A 5DX0A 3ZWOA 2ZUBA 1KAGA 1VE7A 4LOKA 4O4LF 2OOKA 1DV2A 1I4WA 3F49S 3O73A 4Y6GB 5ALLA 4RTSA 3L4SO 4ZT5A 4B6OA 3AR2A 4F2WA 3OE5A 1FFHA 1H66A 1SCAA 1TU3A 4I08A 1P5ZB 1WSBA 3O7MA 3GVPA 4O2RA 2ZIUB 1YHZA 2XOXA 2W58A 2IBSA 4UM5A 1K4KA 4U6NA 4KHPB 4U7GA 2NVUA 2XTNA 3RFCA 1FFXA 2B1JA 1GA1A 3WRYC 1TOAA 5A3QA 3MXOA 3QEJA 4JU9A 4PQYA 2YFYA 4CMBA 3NOQA 2ZIXA 4C7KA 4EA6A 1DIHA 4ZOQI 4US2R 4UNQA 4OQMA 1NSYA 4JC4A 3CY6A 1RXEA 1J09A 4R9UC 1YVUA 1KK0A 3I62A 5HK9A 1BEEA 1RI3A 3DULA 1Z5PA 1DG9A 2ZT8A 1P4JA 3EFBA 3IVRA 5JS6A 2OBFA 4HAOA 5GVSA 2VPZA 1X7YB 3S8EA 1VJ1A 2OOSA 4JASB 3GRVA 4MTCA 4HLCA 4OHFA 3DLAA 3EPJA 4GI1A 4LIPD 3ZLVA 3C87A 3WGMA 4JP5A 1MF7A 3L6CA 1F3OA 3C7DB 4YJFA 2HEGA 3RB8A 2JIBA 4IZ6A 1MC8A 3KAKA 2OGUA 3DZGA 1NM5A 2O8NA 4DJJA 5C1BA 2Z4TA 5FA8A 5LIPA 1GCOA 2CNBA 2E18A 4KVZA 3VKWA 5BMVA 3E9EA 1KZ7B 1LQUA 4LXIA 3RUAA 3ED1A 4CMGA 4ZVQA 1LWNA 2GWRA 3LKBA 4NG4A 3CLRC 4E4YA 2CHFA 3GA5A 1CVLA 1CZKA 2GN8A 2RGDA 3OTGA 4F6RB 1SK9A 3K72B 4D8TA 2Z57A 4M88A 4RIFA 4Y0AA 1X1AA 3WLJA 4KE7A 1QDUA 3NVMB 3WZMA 3H42B 3L7CA 2QX8A 4DKJA 1R0KA 3DF7A 4BMPB 3S2UA 1TEHA 1ISIA 4Q16A 2JLSA 4XB2A 1AKRA 1SKUA 5TSDA 4YLGA 1L4LA 5A04A 2QP3A 3UIEA 4X94A 1KNQA 1SBIA 1NJ5A 2D2FA 3UPDA 3UA3A 4PYLA 3K5PA 1QGED 4KIFA 2J0UA 2NU6B 1CXZA 4OXXA 4UJ3A 2QVXX 2OZKA 4QELA 4MEBA 1M2NA 1XKXA 4XGRA 1N6KA 3P2KA 4CEIB 1J20A 1TO2E 3SE0A 3ZWMA 5IT9A 1I5RA 2VAMA 1WCIA 1LVGA 4IEFB 4UKDA 3TNYA 3KPVA 4R0MA 4RADA 1H4VB 1XHFA 1Y1TA 1WOMA 1YOBA 4NBUA 5CLGA 3A2NA 3PJEA 5K5EA 1UIMA 3EZ9A 3G2LA 5TXGA 3KYIB 2WJIA 2X3FA 1YZFA 3V55A 1AKNA 2D5CA 2QGFA 3GVCA 3TZCA 5E3JA 3OIGA 4EX7A 1UBNA 1QCZA 4G1MB 1JQAA 3F6EX 3ZXIA 1VRWA 2J0VA 4MICA 3N58A 3ITNA 1GG8A 2AFHE 2V55B 3A6LA 1HXHA 4E13A 3SY8A 2AC2A 4NEQA 4IFEA 4IZOA 1ZXXA 4DCUA 1XZEA 1L5MA 5TVGA 3SJCA 2HBYA 3G89A 2B5VA 2Q3DA 4XTCS 4EUHA 1Z25A 4DSTA 2JI4A 2JEOA 1KGSA 2NU7A 1VKJA 4ID3A 1KTVA 1UWVA 4ZVUA 1H4SA 4YMTA 3KL2A 4Z5XA 1JMYA 1B6RA 5IYZA 1U9JA 1YDHA 1ZVQA 4TTIA 4LC9A 1IRIA 4HCJA 4QVIA 2NPOA 3O31A 2A9KA 2A57A 1KFBB 1NHGA 1Z75A 3UXYA 3SS8A 4E6EA 5E6UB 2JLXA 1KL7A 3Q3IA 4EF6A 4F5ZA 2JS7A 1RXUA 3MILA 4X66B 4FN5A 4OQEA 2J3HA 5KHAA 3H7IA 4I6JA 3SPXA 4S04A 2G36A 1U2GC 1M2JA 5DM60 1E7YA 1XA0A 1N2ZA 1ZAYA 2ZU6A 3Q41A 4FNMA 4URZR 5B36A 3I5AA 2OSBA 3MTIA 5A71A 2LE0A 1E94E 1Q17A 3FJ1A 4BEJA 1QYDA 1UKAA 2CHEA 2FZ4A 3QYAA 1F2VA 1T6XA 1IBRA 3RUHA 1E77A 3E35A 5EGSA 3K0AB 1Z5VA 5KMGB 1WUYA 4Q1DA 2BYTA 5GM1A 4RTKA 2NSYA 4F6CA 3W6NA 1P9LA 2QLFA 3GK3A 4Q66C 1WDTA 3K4HA 4H6VA 3O2QB 5CA1F 2P0AA 2IP2A 1UFRA 2AC7A 4EIWA 3V9PA 3X1MA 2YFHA 2JEZA 3BCRA 3KFXA 1JAHA 4KBFA 4AUKA 2EJTA 3GFRA 4ZWNA 5JQWA 1C9KA 4Q93A 1N1MA 3GGJA 1KDTA 2OFOA 3OZXA 2CHUA 2PEYA 3L0DA 3WGTA 1C3JA 2VBGA 3R0JA 2VPTA 3ZOKA 4OSEA 1NXVA 1YDMA 4EKNB 5JAPA 1DX4A 1EK1A 2E4WA 4WOKA 2DQSA 4UPVA 5HTOA 2XNDA 2VKTA 4G3XA 4I4TA 3HHEA 3HV0A 2HF9A 3WOVA 1NQTA 2OGWA 3ORRA 3WO0A 1YVEI 4GT1A 2YV5A 3RKRA 1DQZA 2WU3A 4QO7A 4BJ3A 2YYZA 3KR0A 2OM6A 1I33A 1UMDB 2VEOA 1E1NA 3ZD7A 5AJXA 4WI1A 4NOJA 1U7PA 2DBVO 4NMHA 1P74A 3E8SA 4TTJA 1TC1A 1NC3A 2V5AA 4MV8A 5UKDA 3VR5D 3ZVKA 4OA8A 4XDHA 4AJ2A 4I4TB 1M54A 1JVNA 1MRNA 2PRIA 5H83A 1X70A 1QKJA 3BSFA 3CG4A 4YGYA 3STTA 4UXIA 1ZCJA 1VDMA 3AI1A 2QIOA 1K0FA 2Y1FA 3I83A 3ZNNA 1XP8A 1IAQA 3HL0A 3SDSA 2DERA 2P69A 2VH1A 4JMLA 1XKTA 1OZGA 1ZX1A 3AUTA 3OESA 4KO8A 4M9UA 4EWLA 4Z4IA 2XZDA 4Q3KA 4UZFA 1ABBA 2Q21A 4IQGA 2I9KA 4L8GA 2YS7A 3TW0A 3WRWA 3NAMA 5KSWB 2FDRA 4KRGA 4ZJUA 5BMVF 4JYAB 3PRHA 4R2JA 1LPSA 4Q1VA 1TO6A 2B1QA 1EQAA 3K94A 1DE0A 4M0LA 4KN6A 2ODTX 1FMCA 3OOEA 2R66A 3EW9A 3G2IA 4HNAA 1OB2A 4CDRA 1QYWA 4M1OA 4QOGA 4RK5A 2ZTHA 3IVAA 3WS7A 1BN6A 1XB2A 1GP2A 1JW9B 1NXSA 2X1MA 3UJCA 3D3NA 3PC8A 1X38A 3U5TA 3TTUA 1RYDA 2ZXFA 1OZ0A 2XCIA 5KSPA 1M5TA 1L4KA 3UGJA 3PVZA 5MGBA 1BHSA 1ZUD1 4X45A 5BURA 1L5YA 2HREA 1I1NA 1L4EA 2QVLA 3G0CA 3SM3A 5KO2A 2CSXA 2AD1A 1QCDA 4D43A 1MIOA 3P0IA 4ETMA 3SVZA 1T2NA 5BMOA 1EP2B 3KKKA 1NE7A 4LCBA 4AJEA 3TZEA 1BWSA 4IUYA 4F92B 5JO0A 5HP4A 3IXLA 4JYBA 4GIBA 1X6VA 4XASA 4XEUA 2Z6QA 3G8AA 3QX7A 4Z4GA 2J0QA 3VI3B 4QGHA 3T7CA 5KMGA 3N0WA 2J85A 3MWDB 5K8CA 3OWHA 2GM5A 3JYHA 3LZDA 3U4QA 4MVJA 3TKAA 4DWOA 4LZPA 2J7PA 2A94A 1D1PA 2OCDA 2C96A 2O9JA 2OQVA 5A0VA 1OU0A 1KSJA 1VLJA 2V9CA 3T1QA 2QXUA 3NDIA 3LHDA 4PLVA 5F2EA 2LIVA 2ZUCA 4QECA 3VVMA 3T9DA 1V6SA 4YAOA 4BVJA 2YY5A 3HCDA 3OCCA 4LF5B 4N54A 1L7VC 3AT1A 2QW8A 5H3HA 4GRDA 1SRRA 3EDYA 5FF9A 3W1WA 4KVAA 4R0NA 4BIIA 3M1AA 2IS1A 3DQQA 3ZU2A 1P7VA 1A8IA 2FSUA 3QLTA 1R4NA 3N53A 3ZV5A 4D3YA 1Q1GA 1V1JA 1JDTA 2A9RA 5C5IA 5D2CA 2Q4EA 4LHVA 4A6EA 1LPOA 4YEDA 1XV5A 4FXPA 2NQ8A 3IHWA 2DFKB 2Z08A 3NCHA 1O6FA 4G2TA 1K7SN 4RLFA 2B2CA 1PDWA 2CVZA 2QRKA 4R8RA 2ZZKA 1W25A 4JBXA 2P7IA 3HCEA 4YO7A 5JSZA 1D7AA 1AJEA 3OLYA 1UUFA 2C3YA 3IODA 3FNRA 1PE0A 3OC6A 1K0UA 4ARVA 2VJYA 4KNYA 1RDFA 1KDPA 3IEKA 1QKKA 3OPMA 3E9ZA 1ORDA 3VSAA 1J0AA 3ZE1B 3COVA 4Q7JB 3EW7A 4KO4S 4F8EA 3EWSA 3GG9A 1U3CA 3R7LA 3DFMA 3S4YA 4KLZA 2GUGA 4FBGA 4EP1A 3SHOA 4UPDA 2RARA 1A95A 4JZYA 4AJ9A 2J08A 1EG2A 3IKLA 2NG1A 3MOIA 4YXWA 4BLTA 1G21E 4G6ZA 2EFDB 1LF0A 1G9TA 2JAOA 2O23A 3QVSA 4GOOD 4O08A 5ENDA 4E31A 1FPQA 2VP3A 5BV8A 1RWXA 4MXDA 5FI1B 2I55A 1Z9BA 3U9LA 3S1SA 4QVGA 1KQ3A 3GFTA 4QDJA 1XDZA 5HDQA 5SYAA 2O8CA 3KQLA 2EGGA 3OFNA 5HKAA 5LFAA 1Y6GA 1N2JA 1RWMA 1UMKA 2QV0A 1EWKA 2ODAA 1DJQA 3F78A 2CLLB 3OBBA 3AF2A 5DGIA 1AKMA 1SUIA 4CGYA 4WN3A 4Y0VA 1VJDA 1BOOA 3M49A 5TRTA 3UT5B 3QLJA 5HBGA 3ZY4A 4E1VA 1L5VA 1Q15A 4CWAA 5SZHB 3LCCA 3SOPA 5EMNA 4NU0A 1LCIA 3Q72A 3QUBA 2C7BA 5CW1A 3FTDA 4MULA 2BFFB 3OG9A 3T3HA 1P3JA 2FQYA 1U2ZA 2G28A 2V4UA 3WQQA 1Z56C 1MAVA 2YJNA 1ZCAA 3F4KA 2QROA 1TZ2A 1TYEB 2QR2A 3DVLA 2B2NA 3RQIA 5F2KA 1TZMA 5LP6A 1M72A 1NNLA 1QR6A 1X9GA 4LVNA 4WTOA 3EMDA 5FTNA 3MW8A 2NVOA 5BP7A 3DCNA 4XQGA 5DCUA 2ZWAA 2ODWA 4UEJA 5DTQA 3N8IA 2Q3MA 1YFZA 2AFRA 1N3LA 3C97A 4FK8A 2XOKA 4BRUA 2DJIA 3QOWA 1BN7A 1TVKA 3SYRA 4G0PA 2ZSEA 4MRMA 4FI3C 1BWPA 3V1MA 4FYHA 2C78A 1VHJA 3TTTA 1X1DA 3LLVA 4PAOA 2G4LA 4IOLA 3PUYA 3RVDA 2GEVA 3E53A 3DDSA 1HF3A 3OA0A 5B1HA 5LP6B 3W05A 1Q7BA 1Z5NA 4DQ0A 4TMVA 1NVKA 4EF4A 3L77A 2CBZA 3PEYA 3IUQA 2Z9DA 1NVWQ 1PP4A 1RTTA 1Z0FA 2O6LA 5F73A 3GUYA 5JW6A 2Z04A 3AX6A 3SBOA 4HV4A 1I1HA 1XTRA 3OM8A 5ERGB 2BKEA 2F1OA 4PFJA 4EMUA 2L0XA 3W5CA 2IV3A 4QNMA 1SKBA 5DGXA 4JOBA 1E2UA 3MCVA 2BGLA 4HDNB 5I9NA 2XWSA 2GM9A 3G6WA 3JW8A 3D6VA 1P7CA 2LIPA 3SKVA 4R3WA 3KTDA 5BSHA 1RXWA 1NSFA 1G7RA 1FP6A 2FPPA 4IXMA 3SZLA 5HMMA 5IAKA 4LOAA 1E60A 3EZNA 2H1IA 5IBQA 3A70A 3VDQA 3VMFA 3OA2A 5EP3A 4O4JA 1XCGB 5REQB 4QU0A 4PZZA 4FJ1A 4FW9A 4EBFA 1OXKB 2B7BA 4LYYA 2CUKA 2WWVD 4CKXA 1LBQA 3NONA 3ZS9A 4ESOA 1N32B 4P31A 2VRWA 4XVQA 1E64A 3PZBA 3ZU5A 1T5IA 2I33A 1WXGA 2GAJA 5EP2A 4L22A 3N6VA 1VDZA 1PO7A 1FJGB 3RKSA 4IMJB 3UT0A 4ALIA 2ZDGA 3GRUA 4TTTS 3ODPA 4N76A 3BS4A 3T7EA 3VTFA 2FR8C 2ZSAA 4BQOA 5D7BA 5CFZA 5I7WA 4L75A 1HORA 5JCOA 5D3MA 3U3OA 3GPDG 3AEYA 1HFEL 3AFOA 2XUKA 3K9QO 1J24A 3QFCA 4IRUB 4YC7A 1GQRA 1TK9A 1CFZA 1TNDA 1ZD9A 4K87A 5MFZA 1W0JA 2VT6A 4MS4B 1K06A 2ATEA 2I0FA 4PLWA 3GHYA 3HY3A 5FPPA 4DSNA 3QXSA 2Y4NA 1O08A 1YE3A 4NYMQ 4Z7QB 5C18A 1H3EA 2JLWA 3MVEA 4KXFB 4PVCA 5EMMA 3ZI4A 3KJXA 3X1DA 2OCIA 5IFKA 4ENVA 2QD4A 2DVMA 1E79D 1V3QE 5L8VA 1T8WA 4J4BA 3PUZA 3R3HA 1ZL0A 2KBFA 1CQIB 1YONA 4MUIA 4RA6A 1NT4A 4XIJA 1Z17A 5JCJD 1F0PA 5HZKA 4IW3B 2QG6A 4Q4AA 1M66A 2WVHA 2IPAB 2IOHA 3V1LA 4DNFA 5JH7B 1RVV1 3AI7A 2DFDA 3F5MA 3QLEA 3HA2A 4H31A 1NR1A 1ZIOA 2AUMA 2ZAYA 2IXBA 3L8ZA 2ZSJA 3F4LA 1OH6A 1R12A 4CL2A 1UBLS 1ZG3A 4AM8A 1AB6A 4WK4B 1LK0A 2C9BA 3ADDA 3OEHA 1QTRA 1JVBA 2ZRNA 3GCGA 1XMIA 2C2WA 4HO1X 1SUPA 3HVHA 3IH5A 5MN4A 4QM7A 4HVAA 3W9YA 2E0IA 3QVXA 1DMSA 1B8NA 4UEWA 1HG0A 1SPBS 4N9QA 3GLIA 1ISJA 3Q7QA 4O8ZA 1CYEA 2I6FA 3DBIA 4OAQA 3MWDA 3L8HA 4ML3A 4WACA 1NF3A 2GYYA 3IAAA 1P91A 2AZXA 4YBRA 4MDHA 1TA0A 1IY2A 3C3XA 3L7OA 1EBUA 2H92A 2OM2A 1XRMA 2Y0DA 3T9FA 2DTEA 4OLAA 3MWEB 3SX4A 5BVHB 4B48A 4KQFA 3BVPA 1SRQA 1ADFA 2XZPA 4U9HS 3VAYA 6ADHA 2WP0A 1FVOA 2P40A 2GBGA 3EULA 1E3WB 2XNSA 3LPCA 3OPXA 4M21A 1DC3A 4NCKA 4TXJA 1Z73A 4V39A 5J2TF 1Z4QA 2JLYA 5HM8A 1NKSA 2C9YA 3GRKA 3X1YA 3FXAA 1FSGA 4NAHA 1L7NA 2GFQA 1JAYA 1NUPA 2FRXA 1G5TA 1R4NB 2C0CA 5B2FA 2IZ5A 5ILQA 5K3OA 4YXFA 4L7VA 5BW4A 1ULZA 3VV2A 3MWEA 3S2YA 1JBKA 1AGXA 1P17A 4AC9A 3GNSA 3ZXXA 3FVWA 5EJ7A 4MLDA 4PSKA 4CW7A 3B1JA 5EVJA 5AVTA 1IQUA 2VYCA 5HKOA 3ZIDA 2QN7A 3QOYA 2XXJA 2WU1A 1HE2A 3LT1A 5IVKA 1UPXA 2EDAA 3ZZTA 1MB9A 5BWOA 3IUEA 2C57A 2GO7A 3M0EA 4LI0A 4RTQA 2HU7A 2ZUFA 3BJEA 3P9PA 4GKAA 1P7ZA 4PO3X 2Y1LA 2PA0A 4B3XA 2YC4C 3WLKX 3C8ZA 1MO4A 4RV9A 3T3GA 3ZWYA 1UOOA 1TT5B 1DCMA 3HFSA 1Z2NX 3KKZA 4JSTA 1I4OA 3MGKA 1GT6A 1Y48E 5BR1A 3DYIA 3OP4A 2EW1A 1CTQA 1Q20A 3AVPA 4JLNA 1PR4A 3JRNA 1IJKA 3UYKA 2PGOA 2QX6A 1EHCA 3EFHA 4CL0A 4RMHA 4EKDA 5B2EA 3ADBA 2ZB4A 4D3XA 3LUKA 1VKOA 4GW3A 3I9LA 2GNOA 1XXHB 4RHUA 4RUKA 5EI5A 3HWRA 3TH5A 1NT2A 1VSUA 2FW0A 2Z9CA 3GZ4A 2H06A 2RJNA 2Z83A 3K1TA 4JC0A 4J7AA 4BLSA 3W3AA 4KFCA 1YD7A 2ZAGA 1WXEA 2OV3A 3RJZA 4U00A 2B5WA 3D5EA 1TADA 4ZVVA 1FLAA 3MK31 2EIHA 1YL5A 1MKYA 3LPNA 4BKQA 1N2GA 3T1HB 3PXXA 3K53A 4XI9A 1ZA2A 2CVOA 1UBJS 3CJRA 2E1PA 4ZFNA 1Z18A 3QOXA 4Q7LA 3ZQ6A 1NLZA 5KQRA 2VT3A 1DBWA 4OUKX 1Z5ZA 4OUDA 2FW1A 1UDBA 5T8KC 4MNTA 4JNCA 1HQKA 2IPOA 1S5PA 2PZJA 1AM4D 1ZICA 2I5PO 2QI9F 3BUSA 4K40A 2VYND 4EFMA 3NORA 1GEGA 1PZFA 2WG1A 2WMDA 3A3NA 1U1FA 3FCXA 3M34A 3OJCA 1CEYA 4ZAGA 2IHZA 2VHQA 3EEFA 5J58A 3EJWA 3M1YA 4A0RA 1N7JA 2R4UA 3AP3A 3ISJA 5C8YF 3AVVA 1KAEA 3REOA 5HGXA 1F8FA 3LPAA 1VL5A 2A9JA 3T4XA 4MS3B 4V0RA 1DOZA 2FOIA 1E0DA 4G65A 1VKHA 2Q50A 2YWDA 3Q12A 5C32A 1ESMA 4QUBA 1V1MB 2YOHA 2IEAA 3ZR4B 5I8PA 4ESVA 4HN4B 2XA9A 4PPYA 3UG7A 5I4KA 4I5EA 3FVRA 1WMBA 2VNHA 1RWWA 1P2SA 2J9XB 3D3EA 2FEMA 5K3CA 4EG0A 4ZTZB 2X2PA 4N12A 4CBVA 4HLDA 4BMSA 3WIEA 2X86A 2ABWA 5EWLA 2QTWB 3KVVA 4UHKA 1NA5A 1EVKA 3QRWA 1MDFA 1NBIA 4KXLA 1TQ6A 2O20A 2JAPA 3ZDXB 1V4BA 1NIPA 3DMTA 3PTZA 4H27A 1AE1A 4G5GA 5CLQA 3C5VA 4BLUA 2D13A 4V0MA 4JJIA 3GJYA 4IIDA 5DNAA 1IXYA 2L19A 1GVNB 1UXJA 3TLGB 5TX7A 2OFFA 1SVSA 1RYZA 3CHYA 3FLMA 1H85A 3DT9A 1NZDA 3ITDA 3AHIA 2OZVA 4XPIB 1W4RA 5AR1A 3E6AA 2X8AA 1CDDA 1RBMA 2YV4A 3LO8A 4EPYA 3GEGA 1RRGA 1FXWA 4YH1A 1ANKA 1AQYA 1ZA1A 1FDTA 3DE3X 4HQNA 4WH0A 4KQHA 3TTXA 3ZGXA 4C0AC 1V48A 3RS7A 16PKA 1TUEA 3KXKA 3L6BA 4GQAA 4ZICA 1R8YA 4A8JA 1TKBA 2ZT7A 5D86A 3CKYA 1MOPA 1VMAA 1ESNA 2WTMA 2ZE6A 4X1OA 2HSDA 4FEEA 1WS6A 4N3BA 4Z0HO 4CI9A 4E11A 3L7AA 3CW9A 1E1QA 3L7YA 2DBQA 1J97A 2P9BA 1Z8FA 3KEOA 4L07A 3W6UA 2ZJBA 4F9TA 4AMBA 3SS9X 1K7FB 1Y7IA 4GOXA 2O8VA 1KJZA 5DO9A 3PDCA 3RVPA 2HMYB 4E15A 1OZHA 5LA6F 2VT7A 4LV5B 3IXQA 5CX4A 3TGPA 2IKSA 1G9XA 4X91A 1U2DC 2JKZA 1AXGA 1NLYA 1NMYA 2VZEA 2QD2A 1XCPA 3WMXA 5GJWC 1ORHA 4WZZA 3ZN2A 2OCPA 2PIAA 3P1JA 4MROA 3WAJA 1KI6B 3IELA 3KJFA 4BQQA 2X0IA 2BHRA 4LSMA 1JNYA 4BFXA 4HFMA 2QS9A 2RGEA 4HGOA 1W4AA 1C41A 1JEDA 2KJQA 2G1KA 2P8SA 1E7WA 1NVTA 3CM0A 2R87A 3GNQA 3ORQA 4YRQA 2ZJOA 1E1KA 1ELOA 1F5NA 4MQ5A 5KVQA 1JH9A 2K6GA 1YS6A 4PG5A 3RC2A 4CVNA 2A5LA 1Y9AA 1TAQA 1HLPA 4KN5A 2RHJA 3F6SA 3MBKA 4LYDA 1UWCA 1Y4UA 3B1FA 4RNDB 5ALOA 5KVCA 3D7SA 3GC6A 2OHXA 1Z82A 1W8IA 4LHWA 4Q12A 4AULA 4OQFA 4FT2A 3QPCA 2KB0A 1Q21A 3VC2A 4C4OA 4EI2A 1D0VA 1PT5A 4PBTA 2QVCA 4DA8A 1XHLA 4Z9FA 1A9SA 2YIJA 4HD8A 4DIEA 5I5EA 4YJGB 3G6KA 1CUXA 1C29B 1T4DA 2FMUA 3AEXA 3IHLA 4GR4A 1KVRA 4BS9A 1XROA 2ZK7A 4RKQA 1Z68A 2L2QA 3A14A 3HACA 3ENKA 3I23A 4J0GA 5IEBA 4PF1A 4L02A 3QH4A 4LJAA 4U6SA 4UASA 5ICCA 4R8LA 3LYAA 1ZQ1A 4IJ6A 3KWFA 4O0MA 2XTJA 4CM7A 3S0JA 1S1MA 3MJVA 2SKDA 1SB8A 1EIWA 4EGFA 2R84A 3G1WA 4UVIA 4TZTA 2YRXA 4YRKA 8MHTA 5AM4A 1QRRA 1Y8AA 2Q99A 3BL6A 1YRAA 2YJ5A 1W36D 1KO4A 1UXHA 4L15A 4LJSA 4XFDA 4RH0A 2YZ7A 4LQLA 4YJHA 1FZTA 2A9OA 3ZHBA 1RZVA 2C0QA 2I76A 1C7QA 2ZVQX 3LUBA 5IBRA 3FSRA 3A1CA 3EXEB 3HKCB 1GGNA 3H7AA 3QNUA 4Z99A 1A69A 2VHZA 5T6BA 5HVNA 4LEIA 1J2EA 1VTKA 1QQ5A 5KSZA 2R44A 2FWPA 1B1AA 3DMPA 1S89A 4Q4HA 5D51S 2AZ4A 3WFJA 3THXB 2G06A 2I71A 5HF6A 1QPBA 4FFWA 4MCJA 3NALA 3NYQA 2GHTA 2RGAA 3AIIA 1ACMA 3TI9A 3EYAA 5CB4B 4MUBA 1P2VA 3DXXA 4A2PA 5K0GA 2XCQA 2G5CA 1IEXA 2WVGA 1OC2A 3O9ZA 4F72A 3S2ZA 2VSNA 3C1TA 5BUQA 4HSGA 2FR0A 2CVPA 3S40A 3PHBE 3DKKA 1ECJA 4NYJR 4HAIA 3I76A 5J4HA 1GZ7A 3R3VA 2V6FA 4L78A 3WDKA 2FZCA 2VQFB 1DG1G 3HVKA 5F64A 5HJEA 4U2KA 2VAWA 5LYJA 1MEEA 3T1OA 1TCCA 3RODA 3PC7A 4DS3A 1W4CA 4YP6A 5FLEX 4CN9A 4NE2A 3DD1A 1VPEA 3OTOB 2GEUA 3C5WP 2Q4DA 4YAEA 4E0BA 4UMEA 4GSYA 4I9NA 1IVYA 3D1LA 1XP5A 5JMOA 3M9LA 5AKJA 4AJNA 1ZN7A 3A1NA 4C3UA 1Y1SA 3MS2A 2XB6A 1XU9A 3QWAA 1EE2A 4I6EA 5BWNA 2COUA 4W9NA 4B35A 1R66A 1Y8RA 3LD9A 5T4BA 2XUPA 1G5IA 3PQ4A 5G0WA 2QVGA 4OK3A 4QNRA 4AMYA 3H75A 3ZWWA 5E2AA 3LTNC 3BXOA 4LYHA 1NRIA 1LRLA 3PKIA 1ES9A 3MGGA 5H1YA 4YUZA 1TIKA 3KALA 1C9MA 2XWQA 1JE1A 2DX7A 4NSNA 1X77A 2ODQA 2ZW9A 3M7IA 3T1YB 4QULA 4FOPA 4IAOA 7GPBA 4ZVRA 1WLYA 3CNNA 2PFKA 4B6EA 3SSOA 2Z3VA 2A1UB 5HEKA 3KDPA 1Z7YA 5JECA 3EDCA 5JWOA 1KEUA 3MWKA 1B4DA 4E70A 1AURA 1PR9A 4U02A 1VQ1A 1PX2A 3GBPA 5A03A 4DHEA 1H2BA 1PWYE 2BW0A 5C7YA 5FNVA 3O8RA 1TJ5A 1WW8A 2FEWB 4KR0A 4ZYZA 1U8ZA 4A26A 2QYSA 4N65A 4EFNA 4WBNB 4E5NA 5AQ1A 1FEZA 1X1BA 2BMDA 2RGCA 2JFFA 3QKRB 4QBGB 4RCVA 4F56A 3T1TA 4PV7A 4KREA 2IYQA 4KE6A 3HKBB 2BEWB 3L41A 4YCLA 2VAVA 3SFVA 4UE3S 2O8CB 3DR3A 3TYXA 1KJNA 3KK0A 3M3PA 4RD4A 1BMTA 1U2SA 1L5WA 2YJ4A 3PC8C 3Q2OA 5DYTA 1ZGBA 4NRDA 4DV7B 4KSBA 5JC1A 1AQ6A 2D74A 1QLHA 1KMHA 3DV0A 3VVCA 5CHYA 1XMQB 1FTWA 3IOCA 1PYDA 2G1AA 3O91A 3B9RA 1VJGA 4C0HA 1KETA 1LXCA 1YBFA 3FKSA 5AHWA 3R9XB 1RLUA 2JCYA 5EZQA 3OLVA 3H9EO 2PSDA 3L18A 3ZY2A 4ROSA 4N5HX 3DHYA 2F8TA 4JLOA 4OK5A 3L8YA 3D6AA 2C31A 4RPCA 1XTJA 2PUHA 3PPWA 1D4FA 5KDLA 2TECE 2W4QA 2XMPA 4LGMA 2OYRA 3G2MA 4QODA 3TLZA 5TMPA 4DDWA 1W34A 4RFSA 4R84A 1P7YA 1RU3A 2BSXA 2B0JA 2P30A 1QLWA 2G4CA 4DCVA 1MVLA 1TUBA 3T38A 5B5SA 3A28A 4ZREA 3IEXA 5EJIA 5GADl 5TDHA 2IZOA 4O4HB 4PIMA 5BO5A 4DBVO 1NBWB 1I2DA 2AEMA 1E2LA 2IHYA 3HNPA 2EHDA 3A8TA 1YAHA 1ZJ6A 3Q8XB 3C8HA 4NCIA 3R8FA 1UJ5A 5EKSA 2VPIA 2R1ZA 2X0JA 3E7WA 3FNEA 1Z0JA 3RNLA 4OQPA 3THOA 3IP1A 1BKYA 1GLNA 1KJ8A 1S9DA 1EFKA 2OCLA 3LYLA 3MQ2A 1OILA 2PL1A 5KB3A 4NHEA 2D3TA 4ZK2A 5DOZA 2AR9A 4JBGA 3E58A 2UYYA 5KNCD 4W8GA 3H2JA 5FI3A 3EPHA 2PX5A 1E4OA 3E5HA 3RASA 5JCPA 4KK3A 1ZMOA 5F52A 2PUDA 1CQJA 2R3SA 1O96B 3B2EA 1XEWY 3QPBA 2DHEA 5FPSA 3IBYA 4E22A 4YP0A 5A05A 2V03A 5CM2Z 3OBIA 1UZMA 5KYVA 4WWHA 5TB5A 4EFLA 3FDXA 2E5WA 4LZNA 3TF5A 1RZRA 4E09A 4WEOA 4ATNA 4DPMA 3N76A 4MP3A 3TS1A 4R9VA 4W82A 1J9ZA 1ZVKA 2Q5LA 4XVRA 2HDHA 2D0DA 2I4TA 2ST1A 3OPYB 5DI3B 3KUCA 3SLKA 4U1RA 5BORA 4O4JF 1EKXA 3OM1A 1P3DA 4MYUA 1DEKA 3PXAA 5A9RA 2QMHA 1OLUA 2XTAA 3NTVA 4XARA 5HPYB 1SZDA 2JLZA 2HW8A 4M0CA 5AKLA 3EGVA 3HP1A 3IPAA 4LK3A 4KMMA 4MJXA 4ZDIA 2ZUTA 2P9CA 4NJMA 7ADHA 3FPLA 1T35A 3VH3A 3IAS6 1L4UA 4CR7A 4EY7A 5BYKA 2X4IA 3KB6A 1RYNA 1QZ3A 1T25A 4G0VA 1OT3A 1QPZA 3KS9A 4DB2A 3CN9A 3KSDO 3ZDFA 3A6PC 2AE2A 1B16A 1NY5A 1TMGE 2ERXA 1XG5A 1P6QA 3EZXA 3FNIA 1XYVA 1Y98A 2IZ7A 2V9PA 2CMKA 1FYWA 3RIHA 4D46A 3Q3VA 3IUSA 3GP8A 2C2MA 4XYBA 3I6MA 1US8A 1XVLA 2EKQA 2YASA 2EJBA 1NQUA 1X15A 1Y9JA 2J4CA 3DAPA 4J3JA 4I8XA 1VCOA 2JFUA 3EZLA 3JAKA 1EM8A 4L74A 3RRNA 4KH0A 4RVNA 1IBKB 1YL6A 4HDRB 1R6XA 3D0QA 4XUEA 2C2HA 3O38A 2QRMA 1JJ7A 1GGMA 1TM3E 3EIQA 4YWHA 4RJKA 3KZMA 1P0CA 4HQKA 2W0SA 1R37A 3BWDD 1LZKA 1IONA 2VH5R 5K0LA 4YJ3A 3V80A 2Q7XA 1Y89A 2W9XA 3S3TA 4AY2A 3AWDA 1GPBA 1XWFA 3ZWNA 2DH5A 2HDWA 2OO3A 4R2WA 5H59A 5EUMA 4BC1A 1KVSA 3UVEA 5L3QA 4I3FA 4DY6A 1YCDA 2HU5A 2DSNA 2X4GA 3JQAA 1KI9A 1U7WA 1VLQA 4Q24A 5DX8A 4ER3A 5HSGA 5TQJA 3FFWA 4EI8A 4YLYA 1UBTS 5JT1A 3TL6A 2F3QA 3DFZA 1KRWA 1MH9A 2G80A 4LC1A 2C9DA 4PG6A 4UZEA 5KYKA 2X42A 3DNMA 4YCJA 2GPWA 4QRHA 1M0TA 1GSOA 1R8QA 3D7RA 3EVTA 1DAGA 4TTSA 5C2JB 4GPEA 3A3YA 1WEHA 3OQ1A 3H9JA 5DXFA 2HQOA 4B3JA 2CXUA 3HDTA 5KWJA 4BTEA 1J8MF 2Y0BA 4QTZA 1SGWA 4G1BA 2P67A 2Z8YM 1BGVA 1BS1A 3A32A 1P0FA 2E4XA 4KQEA 3UK6A 4NNOA 1G64A 4DM4A 1UZNA 2FPIA 2PUAA 1KI2A 1KI8A 1CY0A 3O1IC 1SKQA 3K71B 3EY9A 2WF7A 3FAZA 4M98A 1BH6A 2WI8A 3DV9A 4WZBE 5D1HA 1S1CA 1EK0A 1GL3A 2A5FA 1YGYA 2NOAA 3MTBA 1U90A 1B43A 1P3Y1 3BZWA 3FGZA 5DHUA 4BATA 1UJCA 3E7FA 3RUCA 1DRUA 4GFDA 4C4AA 1WEKA 1SVLA 2K2WA 1PKXA 4K9QA 1MQSA 2NV0A 2ZVJA 4LVCA 5CFNA 4B75A 4YR7A 2WQ7A 2H31A 2JF0A 3E82A 3QZUA 4GLLA 2BEVB 5JAZA 1PFWA 4CMEA 5EG5A 2M6SA 3WY9A 4ZU6X 4YAJA 4JUIA 4DQLA 1EESA 1IJBA 1DKLA 2NXJA 1Q0RA 4YPOA 1DDGA 2QLNA 1DIRA 4UEQA 3DVQX 1Y9EA 3HZHA 4CF6A 4ZVSA 4AYTA 1BHQ1 4HUTA 4NQZA 5CFPA 4CUJA 4MGIR 3T4UA 2IBTA 2EGUA 1TF5A 1TMOA 4F5YA 3IMFA 4L5CA 5ERYA 3FR7A 3N1UA 3U7IA 1UIRA 4C07A 5ALTA 2BHLA 4AKSA 1H0HA 5JTUA 3TO5A 1ECLA 3OP1A 4G5QA 4C43A 3P2JA 3TNLA 1PL0A 2JCSA 5LIRA 3GA7A 3K3PA 4CCYA 2R62A 3DBOB 5HE9A 5KOJA 4KTTE 4OLFA 4Y67A 3MCWA 2DF8A 2H5JA 3JQBA 3R5KA 1M6HA 2J09A 4FGKA 3P94A 2WY2D 2JFPA 2A88A 2WTAA 2IHUA 2X41A 5IWCA 1Y63A 4C7MA 5CLFA 1MJGM 2VHTA 3GDWA 1F5SA 5TEVA 1P5FA 2WMNB 1DAFA 1SAYA 2WZBA 2ODEA 2P41A 4QKQA 2EKDA 3PCXA 3T7TA 2BP7B 1F1JA 1NULA 3D6JA 3QVLA 1HV8A 3NEYA 4NBRA 5B58C 5JQGA 4QDTA 4P9NA 2R47A 3GZJA 4WKOA 1E1CA 4P3XA 1ND5A 3Q0EA 1NQWA 3BAZA 1HR0B 5ICFA 4DGSA 3SQLA 5HJ2A 4EKIA 1JSCA 1P7WA 4OP3A 2H4WA 3JPYA 4TSFD 4PNZA 1QVVA 2FUG6 5FQNA 2ZLBA 1P2DA 1YC5A 3DDHA 1VB3A 421PA 2L18A 1J5XA 2ACKA 2ZWOA 3Q2IA 1AF4A 4RAOA 4RABA 4JITA 3TIIA 2P65A 1NBHA 3HCWA 4G9BA 1T3LA 3ASVA 2CCGA 3B78A 2VPXA 1GL7A 3KU4A 3RSHA 3VZDA 2VN8A 3BJZA 1H8ED 1UP4A 3FDJA 3KYCA 3P2MA 4GMDA 4GPD1 4XSVA 3I3SR 4DBLE 4LUCA 1YL7A 5LQSA 1JFSA 3H6HA 4KDFA 5INTA 3U37A 1IJEA 4H7KA 2XB9A 2WKSA 3I2HA 3O4HA 2C04A 3SHQA 4YRIA 1F6DA 2P0YA 5IC4A 2XADA 3LBHA 3K7EA 3KOXA 1Y3AA 5G0UA 3B48A 3M82A 4Y6RA 5TJ9A 4WFIA 1ZZGA 3W77A 5J47A 3ZJ4A 1E2IA 4UMFA 4XLTA 2NSLA 3BICA 3HGMA 4OD0A 1K3FA 5CCXA 3GH3A 2DLNA 3DUWA 1SWVA 2VF4X 3IPCA 4JVSB 1G0NA 1GFWA 1NXPA 2CB9A 3PDHA 3QKWA 2MSLA 2VRNA 2WIJA 1YCFA 2Q8QA 4GYWA 4CT5A 3THWA 1L4MA 4R9NA 3IX7A 4GWLA 1JEAA 2E4ZA 4RKRA 2BCJQ 4GEKA 3T3IA 4EGJA 3EGCA 4MJ3A 2RGGA 5EZYF 3RVOA 2JAQA 3PYLA 4EGAA 1TEVA 2YOFA 3I4LA 3TMAA 4WCDA 4YMGA 2UXCB 5LQJA 1ZISA 2GR9A 4F91B 2EX0A 2O8BB 1FPMA 3QU7A 4D3ZA 3KETA 3TQSA 3AJEA 2R7MA 4D82A 3PGVA 1KQGA 2HB6A 4R2KA 4WKGA 3L4BA 5HKKA 1IQRA 1OXXK 2NTNA 3HYTA 4KZPA 3T54A 2ZG6A 3H9BA 1DBVO 1B6TA 1OIVA 2CXNA 1GCGA 3S6JA 3HCPA 1ZHOA 3ACDA 1QNLA 2F4NA 4V24A 1PS9A 2XZOA 1PR0A 1E6UA 2J6CA 3IHKA 1QIHA 3K9NA 3QTBA 5GWXA 5KI6A 4HDCA 3RWOA 2BFNA 2IPNA 3SFZA 4D4HA 1SFRA 1O3YA 3HFJA 4UTZA 2AD5A 4B31A 1CNFA 5HQ3A 4L9WA 1VE3A 2H51A 3B6EA 3AR6A 3OZEA 4QPDA 3VHQA 3CEJA 4RSHA 4YRRA 3PLAE 1T3HA 1JTEA 4D6XA 3BXEA 4L7QA 1VE5A 2GBFA 1XC7A 2OCYC 1XAHA 1JPJA 2POQX 1R3UA 4LY6A 1AN0A 1IDN1 1R64A 2F2TA 4JIMA 3FRHA 4CFZA 4J49A 3EEYA 2OO5C 4FINA 2QRPA 4HMPA 3R7SA 5JDIA 2DFVA 1RE0A 4ZHQB 1XQ1A 2GTIA 3GGPA 2DLDA 2X9LA 4FDTA 4MR9B 4H7FA 1JGTA 1TO1E 1YDGA 3QWHA 4HH1A 3COZA 3M4JA 1ZH0A 2PA3A 1ONOA 5IKOA 3I8OA 3IP6A 4ER6A 1BX1A 1CULC