7YASA

Hydroxynitrile lyase, low temperature native structure
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
total genus 97
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 7yasA00
1VJ5A 5LKRA 1OCEA 5EHNA 4J03A 1CUVA 4OUKX 1JJFA 2DSNA 4UBKA 2HA5A 3ESCA 3I2JA 1F0NA 1VZ3A 5I9IA 2G5PA 1XKLA 2ZVDA 3AZPA 4N8EA 4CG2A 7YASA 1JJIA 5LZ9A 2WIGA 2ECFA 4IH4A 4L3WA 4X95A 5AKIA 5AKYA 3AILA 3DL7A 4GXNA 5JYCA 4KEAA 5EIAA 3GUUA 4BATA 4OYLA 4Y2JA 1XZGA 3YASA 2Q0XA 4EUSA 5HKAA 4MQMA 2XQJA 3WWOA 2BAGA 3DKRA 1KEZA 2XMRA 3PDCA 2XUPA 4C4ZA 1EK1A 2WG2A 3D3NA 4QDTA 3O9VA 2AJCA 4DNPA 2K2QB 5CMLA 1CUCA 2VT6A 5T4FA 2XMSA 4CG3A 3I2FA 2HDWA 1GZ7A 1TCBA 4H7HA 3E4DA 1AX9A 5JZ9A 3C5VA 5DYYA 1TRHA 1DQYA 3BF7A 4BE9A 1MNAA 1LLFA 2HRQA 2PKYX 1QIJA 3W06A 2G4LA 1Z68A 3OURA 3QVMA 3F67A 3RKSA 2NW6A 3MUNA 1H2WA 5DYTA 1QIIA 1G5FA 5DTIA 5AICA 5EHZA 5AKEA 3D0KA 4Z49A 4U2BA 3ICWA 2WKWA 5AKKA 4NS4A 4EY8A 5DNVA 2GZRA 4QEKA 1LBTA 5CH3A 3HJUA 1H2YA 1M33A 2HFKA 3HABA 3V1LA 3EQ9A 1DX4A 2G5TA 3EIOA 3HI4A 1UOQA 1RYYA 2AJLI 2XMCA 4WCVA 3BJMA 5FP0A 1J1IA 5A7FA 4U2CA 5FKJA 1LZKA 3E0XA 3LS2A 2VTVA 1VA4A 2DHCA 1MX1A 2XUAA 4K2AA 5AJHA 2R8BA 3STXA 5D3ZA 1CRLA 1CUFA 1JT2A 5LIPA 4QE3A 2V9ZA 4AZ3A 1BEEA 2OCGA 4X6UA 1ZI8A 1VXRA 5A71A 3FLBA 4QDOA 4M0MA 3Q0TA 4G9EA 1CVLA 3AINA 4UBOA 1MX5A 5SYMA 3VJMA 1EA5A 4ETWA 3KWJA 4PV7A 5ALGA 5CT8A 1A8SA 2CUTA 2J4CA 4M0EA 1EVQA 3L1JA 4JNCA 4DGQA 4UHBA 3D2AA 2XDWA 3D2BA 2DFPA 3G0DA 1XQWA 5EI5A 4D9JA 3WK7A 1KU6A 2AXEA 2XQIA 3FAKA 2R11A 4BBZA 1YR2A 1GQSA 5J3JA 2WSLA 4UPDA 2ZJFA 5K3DA 1L7RA 1EB9A 2WIKA 1OILA 2H7YA 3KD2A 4UBLA 4KR0A 1LPSA 1HL7A 5FXMA 3TGLA 4K6KA 1CV2A 4MEAA 1O6FA 4BE4A 4V2IA 4CI9A 1E3QA 1TQHA 2HRRA 3DYVA 5HF9A 2DHDA 5BWCA 4N5IX 2XUGA 1K63A 3IDAA 1MAHA 2VJDA 4BCDA 3MGAA 1F6WA 4EY4A 3VVLA 5KWIA 2PU7A 1CUEA 3QM1A 3ANTA 1NX9A 2HADA 2HA2A 1X2EA 3QMWA 4BP8A 4KAFA 2EDCA 3C6BA 3LIIA 5AIAA 5AK4A 4Q1VA 4LYEA 4P93A 1DT3A 5DYWA 4FOLA 3DL4A 1LPNA 3O4JA 2XUJA 4JEIA 5AM0A 3WA7A 3VVMA 2XT0A 2I78A 1CUIA 1EDDA 4KE8A 1P0MA 5KBYA 5HK9A 2Y1KA 4DTCA 2ONCA 4Y2RA 1P0IA 1P0QA 1N8SA 3FNBA 2EEPA 1DU4A 2QS9A 2QXUA 1A88A 1ZD4A 4Y2UA 2V97A 3HZOA 2OAEA 1CUSA 1UXOA 1S8OA 2XLCA 4C01A 3P2MA 5AI8A 4PSDA 3W04A 5AM4A 4KYVA 4X6XA 4I19A 3R3UA 2B20A 4WDRA 2JGMA 4B82A 2XMZA 1FFDA 2LIPA 2WHRA 2PUHA 3H2KA 3VJKA 4I4CA 1CUHA 2P8SA 3RARA 3FSGA 4UHCA 4YASA 1L7QA 4GWLA 4B9EA 2JEYA 1D07A 4G8DA 4LHEA 5AK6A 3H18A 4QWWA 3WK6A 1BCSA 4EZIA 5E4JA 1CLEA 2QJWA 4BAGA 5CH8A 5IVKA 4AMYA 1XRQA 4RE5A 4HXGA 3WK4A 2QKYA 2WHPB 1WB5A 4PNZA 3WI7A 1GPKA 2I3DA 3N0TA 3DEAA 2PX6A 1ZI6A 2VAXA 2HA6A 3RLIA 2PSEA 3E3AA 4AB1A 2Y2UA 3ILSA 4EA6A 1CUAA 2DQZA 2ZJ6A 3GA7A 3I2KA 1QIHA 3HC7A 4KJXA 1ODCA 3CN9A 3ZV7A 2XUHA 3C43A 4W1PA 1G42A 2WILA 2XUIA 5AHXA 1ODTC 3WKBA 4BCCA 3STWA 2XQGA 5ALTA 4ARAA 1CIJA 4PSCA 4UUQA 3G8YA 1WPRA 3SWWA 4UBJA 4DMHA 2ZYIA 5DLPA 4AO8A 2VJAA 3I2HA 1H2ZA 4BAUA 4WJLA 3BF8A 4HXEB 2WLSA 3WLAA 4GDMA 3C70A 4X71A 2PSFA 3AFIA 2BUCA 4J0GA 4FMPA 1A7UA 1YASA 5AOCA 3G7NA 1KU0A 4FNGA 4K6GA 5FDFA 1WM1A 4B0PA 2Z3WA 3BDIA 2B4KA 5ISMA 5ESRA 5JAUA 1XRRA 2B9VA 5ALLA 3F98A 5DNWA 1SFRA 3PF8A 2X76A 2WQZA 2HFJA 4KACA 3SX4A 4BC0A 2WU4A 1Y7HA 3ZWQA 2O2HA 3H1AA 3DYIA 4OB7A 1MU0A 2XB6A 5H3HA 4U2GA 1CEXA 1QLWA 1XZAA 1FFAA 3U0VA 3WK5A 5IKXA 1E8NA 3G0IA 3BDVA 2JGKA 2HIHA 3WKEA 2WIJA 1LPBB 3ZLUA 2CB9A 2WJ4A 1XZMA 2HU8A 2QR5A 4RGYA 3C8HA 1CUYA 1J2EA 1YAJA 1K6EA 1U8EA 2JGIA 1R9MA 2ZYHA 2B61A 2JGEA 4GEGA 2HA7A 4X91A 5CTAA 3G0GA 3FBWA 3N2ZB 3FLAA 1U2EA 3AZQA 1XQYA 4C87A 4WFJA 2ROQA 4GECA 4NZZA 2CKMA 2ACEA 3EQ8A 1AMNA 2GBFA 3WWPA 1TAHA 3V1KA 4QLAA 4E46A 5CT5A 1QONA 4DIUA 1EDEA 1WHTA 3L1IA 1RWQA 3F96A 1W1IA 2RONA 4BDSA 1ZIYA 2VF2A 4ZXFA 5ALNA 2BUAA 3WKCA 2BCEA 3SC2A 4Y9SA 4Y2XA 3KSRA 1YAHA 3QPDA 4B80A 1T2NA 4XJVA 1AURA 3D7RA 1ISPA 1ACLA 5LLSA 4OPMA 3VXKA 1EXWA 3I6MA 1HDEA 1DWOA 3ICVA 2VA9A 1IVYA 3GELA 4XIIA 5I7UA 2VJBA 1R9NA 1UOOA 5ALDA 1QJ4A 4QNNA 1BRTA 5ALOA 4YPVA 4ZGBA 3A70A 1LPAB 1FJ2A 1R3DA 2JEZA 4FHZA 4QA9A 3HEAA 3S8YA 4PO3X 5ALQA 3B3QA 4Y2YA 1XRLA 3I2IA 2QTBA 5C8ZA 5ALYA 4EHBA 2Z5GA 4PQEA 2DCMA 4TPKA 4F0JA 5CT4A 1EDBA 1HQDA 4QDUA 4Y2QA 1BCRA 1QTRA 4MXDA 1CUJA 1XRMA 2O2IA 5ALFA 3M81A 2C4HA 5HQ3A 5JAHA 1ETHA 4B85A 2AJDA 4H7KA 4PSUA 3R3ZA 1I6WA 4Q3OA 5AP9A 3DD5A 5LZ8A 3PF9A 3O4GA 5DWDA 4CIAA 1AQLA 1BU8A 3HSSA 5AM5A 5D7BA 4J0HA 4KRYA 1QIMA 1VOTA 4DYHA 1XLWA 4WY8A 3I1YA 2QT9A 5ALEA 1YS2X 4WDQA 4H7DA 3H19A 4H7IA 2Z3ZA 2J4FA 5HK8A 2E3JA 1AKNA 3DS8A 5LKAA 5AM2A 1CUUA 2QXTA 4LYDA 4F5ZA 5A6VA 4N8DA 1MAAA 2YYSA 3IB3A 3QMMA 2Y6VA 3ZLTA 1TIBA 3S2ZA 1UKCA 5IVIA 5A2GA 4N8SA 1AC5A 4AQDA 4UBNA 2PVSA 1VZ2A 4DMFA 3STVA 4UBMA 4H7EA 1B6GA 1H22A 1GKKA 1N1MA 3MVEA 3OOSA 4UFNA 4UHFA 4LXGA 1A8UA 3IA2A 4F21A 2XMGA 4IO0A 4H7JA 1G66A 3STTA 4B81A 4BRSA 3WWDA 2PSHA 5C81A 1R50A 1CPYA 1PV1A 1C7IA 2XLBA 4EY5A 1K5PA 2FJ0A 3UUEA 3IBTA 3W9UA 5LZ5A 3A6ZA 2XMDA 2PUJA 4M0FA 3OG9A 2W6CX 4HTAA 5EHQA 1G4HA 1QGED 4DMKA 4ZREA 2WJ6A 3DQZA 2XUFA 1U4NA 2VEOA 2PSJA 1GXSA 4G4JA 5LZ2A 2XUDA 2WUEA 4INZA 2CJPA 3K9BA 4X3CA 1VE7A 3KWFA 3WZLA 3CN7A 5EHXA 1VA5A 1LNSA 4X90A 4BZZA 2WUDA 5AI6A 4X92A 5ALIA 3QBJA 3QITA 3DOIA 4Y7DA 2JIDA 3PFBA 4LXIA 2XQFA 3AIOA 4YX9A 2H1IA 5JANA 4NMWA 3L1HA 1IMJA 4KAJA 2OGTA 1JMYA 1OXMA 4UFPA 2WTMA 3A2NA 4BCBA 1QO9A 1ZOIA 4ITVA 2OAGA 2XUOA 2HHAA 4W1RA 3I1IA 1ACJA 2C58A 5ALKA 2GBGA 3D2CA 3CCCA 1FFBA 4A5SA 5JZBA 5K3BA 4H7FA 1WCYA 5FLKA 3DOHA 1QOZA 3C6YA 1XZFA 4W1QA 1W6RA 3FYTA 3BXPA 3IULA 4FFVA 4ZWNA 3WQHA 4HRYA 3IVMA 3C6XA 5LZ4A 2WJ3A 3JW8A 3AUKA 1YA4A 2WHPA 3G9UA 5AOBA 1QTIA 5JAOA 1WPXA 1XZBA 1CQZA 3OTQA 1HBJA 1EX9A 3WA6A 3BIXA 4CIBA 3HYSA 3WYNA 2WU3A 2GYUA 5T4BA 1UT6A 4W1SA 1WB4A 4BAZA 4EY6A 5JD4A 4DNOA 1E66A 4G8BA 2BGRA 3T4UA 2Z8XA 3K2IA 1JU4A 4GI1A 1WOMA 3IURA 4BDTA 4FDMA 4EY7A 3NWOA 2RHTA 1E8DA 3SK0A 1YS1X 4JUIA 1XROA 1UWCA 4HVTA 2XMQA 3JYHA 4FTWA 1W76A 5AK3A 1E89A 5KREA 2PSDA 3IIIA 5E2IA 2X5XA 2FJPA 1LGYA 4X7BA 2DHEA 4U2DA 1QIGA 2VAVA 3AJAA 1CUBA 3RK4A 5IH7A 1X70A 4N5HX 3G9TA 4G8CA 2WHQA 4AZ0A 4Y2VA 1BE0A 1Q83A 2ZJ7A 3EF3A 3V9AA 5JZSA 3BIWA 4DNFA 4EB0A 3ANSA 3Q8WA 1J06A 2O2GA 3C5WP 5C8VA 5ALVA 4AMZA 2H9YA 4BVKA 5ALWA 1MJ5A 2HU5A 3QYJA 3BWXA 3H2IA 1SCKA 4H0CA 4JYMA 1X2BA 4ZRDA 2GZSA 5JIBA 3HXKA 3DNMA 2QM0A 1GGVA 1TCCA 3EQ7A 2UZ0A 1NU6A 1XQVA 4UHHA 6YASA 3HACA 1EH5A 1ZIXA 2WIDA 1MX9A 5T4HA 2OLEA 2RAUA 4E15A 2ES4A 1XZIA 5JD5A 2HA3A 1LPPA 2PBLA 4BRZA 4Y2SA 5AH0A 1VLQA 5AI0A 4OYYA 4WFIA 4J3JA 4C4YA 4PW0A 1NU8A 5LP1A 3AIMA 1PFQA 1QIDA 2HM7A 1CUGA 5YASA 4Q05A 2C7BA 3WWCA 5AOAA 5HQ3B 2WTNA 4OU4A 1SOMA 4GW3A 4L72A 1EVEA 5I8PA 5E4TA 3OM8A 1FFEA 2ACKA 5AK5A 1XZHA 3F8SA 4O08A 5CH5A 4FFWA 3GROA 3QPAA 1ZD5A 3TEJA 5AIBA 3T52A 5HF8A 3PE6A 2JGLA 5AI9A 1BEZA 4LKOA 4HS9A 4FKBA 2VJCA 2VQ6A 2D5LA 4MYSA 5CW2A 5AKZA 1EI9A 1XKTA 1BS9A 4X97A 3IUQA 3FCYA 4C4XA 5ALHA 1R1DA 1ZICA 1YB7A 3O95A 3E1GA 3AIKA 4MJ3A 5CT6A 5AKGA 1XLVA 4BVJA 5FPQA 1ZD3A 1UK9A 2QOEA 1Q0ZA 4DM7A 3D4LA 4Q34A 3M83A 5LZ7A 4HZGA 1A8QA 3HRHA 1THTA 1AUOA 1GQRA 5FOQA 3UMJA 1ODSA 3WL8A 4J0DA 2JGFA 4P9NA 5ALPA 5JARA 2DR0A 5HFAA 4KE6A 1W75A 2WUFA 3DJYA 1K4YA 3C45A 3H2HA 4JH0A 4KE9A 5C8XA 2GYWA 1QFSA 4C88A 4MYDA 3QMVA 4G1FA 5FRDA 4W63A 2IIVA 1UKBA 1HLGA 2O7RA 1HPLA 2GYVA 2JBWA 1E5TA 1ZI9A 1MNQA 3PFCA 4NVRA 4X85A 2OGZA 1ZJ4A 3FCXA 3F9CA 3DDUA 2V96A 5K3CA 3R40A 5HF6A 4AXBA 1UK7A 5IVHA 5A62A 1F0PA 1XQXA 3FYUB 1DWPA 1VXOA 3IUMA 5EIHA 1GPNA 1MTZA 5BOVA 4Y2TA 3LP5A 4CG1A 3M82A 1QIFA 3FYUA 3I6ZA 1DINA 3V1MA 1JI3A 5HF5A 4P92A 3W05A 4TGLA 5K3AA 1O6GA 4J0CA 2XI4A 2QUAA 3R0VA 2J3DA 3R3XA 2H7CA 5ALUA 3ZI7A 5IVDA 2C5FA 4CCYA 1VKHA 3R3YA 4Y2PA 3F97A 2WFLA 1J07A 1HKHA 4G4GA 4BVLA 2ORYA 2ZSIA 4UFOA 1ORVA 1TKRA 5A7HA 3FSGD 2IITA 3I28A 2WFLB 1LBSA 5F4ZA 2ZSHA 3ZPXA 3WK8A 2CMFA 2XE4A 5AI5A 2QVBA 4XX1A 5ALMA 2CZQA 4X00A 3DKKA 3EBLA 5HFNA 3PUHA 5DTJA 5AM3A 4QDXA 3H2JA 3G0CA 3G02A 4X6YA 3V48A 1YCDA 1ZD2P 3O9MA 4K6HA 4J0IA 5CRIA 1XZEA 4UHDA 3DCNA 1CUWA 3UUFA 3NUZA 1Q0RA 4G5XA 3GBSA 1B41A 2VATA 1WHSA 1VE6A 5K3FB 1SC9A 1UOPA 1UK6A 4WFKA 2XUQA 1SCQA 4C89A 5AM1A 2C0PA 1R4ZA 5K3FA 4C6HA 4HRXA 1IZ8A 4TVKA 4ARBA 2HU7A 4ZV7A 3O0DA 1USWA 3FYUC 1MO2A 4DNQA 2YXPX 3C8DA 1JJBA 4BC1A 2HL6A 3A2LA 3NOXA 4IH9A 5LYYA 2BKLA 3WKDA 1N5MA 5E4YA 4H35A 1FFCA 4B84A 2GBIA 4L0CA 2OCKA 1TCAA 1Y37A 4HAIA 4K5QA 3FVTA 5K5EA 1L7AA 4J0KA 1XRPA 4WY5A 4J0JA 1XZKA 1QZ3A 3WIBA 1EINA 3WL5A 2Y6UA 2OCIA 3TRDA 2AJBA 4P08A 3WWEA 5BV7A 5KWJA 3IUJA 4DMCA 4PF1A 5CXXA 1H23A 2AJ8A 5HKBA 5EIEA 3G9ZA 4OU5A 4BP9A 4OB8A 2I03A 3STYA 4E11A 4UHEA 3BL8A 1QIEA 4FLFA 1QO7A 5D6OA 1ZGBA 2H7XA 4U2EA 1N5RA 2PPLA 2OCLA 3ZLVA 2V98A 2PM8A 4IHAA 4AN0A 4QWMA 2JF0A 1F8UA 2RIPA 3RM3A 4FBLA 2OQVA 5ALSA 3H2GA 1IZ7A 2WIFA 3WKAA 2G63A 3WZMA 2RI6A 1K8QA 4A16A 3VKFA 5FPPA 2D0DA 5CXUA 3I2GA 5SYNA 4ZV9A 2WM2A 2XUKA 3C87A 3R3VA 5HCUA 3KDAA 1GKLA 5JD6A 1XZCA 3WJ1A 3U1TA 4MWSA 3VJLA 3W2TA 1QFMA 1C4XA 3LLCA 1IUNA 4KE7A 5CURA 4DLNA 4DSAA 2WFMA 2XQKA 1GT6A 2OXEA 4E14A 3WK9A 3WIOA 5D3KA 4B6GA 3ESDA 3H0CA 2OQIA 4KRXA 1UK8A 4G4IA 4LXHA 4BTVA 4LIPD 3O4IA 4L9AA 4BB0A 4QZVA 4GLBA 2C0QA 1EK2A 5AKHA 1CQWA 3R41A 1QE3A 5JALA 4B83A 1XLUA 1WB6A 3LCRA 2QMQA 4AO7A 3H04A 3H1BA 3VISA 3ESBA 2YASA 4Q3LA 4Q82A 5EFZA 4B7ZA 1IUPA 4W9RA 3X3HA 1H2XA 1T4MA 1LPOA 2BFNA 5CT9A 2GBCA 3A2MA 5ALXA 3H17A 2WUGA 4F60A 2Y2VA 4FLMA 3G0BA 4H77A 1TK3A 1CR6A 2J3QA 4XWGA 4X93A 3AZOA 5T4EA 1EHYA 4XVCA 2QUBA 3MUOA 2PL5A 4OSEA 5AI4A 4IH1A 3JWEA 1UFOA 4BTLA 4DSZA 5DJ5A 1DTEA 1BROA 4A23A 4FLEA 1QIKA 4YK7A 5JASA 1XZDA 2W22A 5ALZA 4OB6A 2X8BA 3KXPA 4OD0A 1R88A 3WL6A 1JFRA 4BYMA 3QPCA 3B12A 3WYDA 2BUBA 2CBGA 3CXUA 1ZGCA 1U65A 1DT5A 1DWQA 1CUDA 1E8MA 1CUZA 3TJMA 4Q3KA 3D59A 3NGMA 3KOOA 4H18A 2QZPA 2Z8ZA 4EBBA 1Y7IA 3G9XA 4GBGA 4S0XA 3B5EA 1ZJ5A 5K3EA 2OG1A 2PU5A 3WL7A 4J7AA 2O7VA 2FUKA 1MT3A 1MPXA 3V1NA 2FX5A 1Q84A 3I6YA 1SCIA 3QZUA 3O4HA 2EDAA 3D5EA 5DNUA 4BZWA 1XRNA 4RPCA 4AX4A 3VDXA 1XZJA 2VSQA 3ESAA 3PUIA 1MN6A 4MQLA 4CCYB 5AKJA 1XFDA 5ALJA 2ZYSA 3GZJA 1PJAA 2OPHA 1JKMA 3BJRA 3IUNA 1DX6A 2XMBA 2IX9A 5AKLA 4RNCA 4X94A 4KAAA 3FLEA 4ZI5A 1UZAA 1CUXA 4FBMA 3FVRA 4I3FA 5JAPA 2QJRA 1JU3A 5C7YA 1UKAA 5A7GA 3R3WA 2VT7A 3FOBA 1YSCA 4HXFB 3PI6A 1JMKC 4MWTA 2BJHA 5AKXA 4JYPA 2YH2A 2WG0A 4UBIA 4B9AA 5BWBA 2C5GA 1P0PA 3WJ2A 4AO6A 5AO9A 3ED1A 1BN6A 4GHWA 4G9GA 5FUMA 4QLOA 1CFJA 3STUA 2RHWA 4OCZA 2BGNA 4U2FA 1ORWA 5ALRA 1EB8A 4AN1A 3OC0A 2I3ZA 1FSSA 4QDZA 3CCBA 5HZGA 1W52X 3M3DA 2DQYA 2RGUA 5CBKA 3GFFA 3FWHA 1XZLA 1THGA 3WMRA 4CCWA 2WG1A 4B0OA 4RE6A 2JGJA 3DLTA 3OPMA 4FWBA 1LPMA 2HA0A 5FV4A 1IUOA 3BE8A 2HA4A 3K6KA 1LZLA 4FNMA 3C6ZA 3QH4A 1RP1A 1AZWA 5EGNA 1C7JA 1W4LA 1YB6A 2ZYRA 5JADA 2CEKA 2OGSA 4ROTA 1GPLA 3PICA 3LIPA 5JATA 1AGYA 1YA8A 4IQ4A 3HLKA 1BN7A 3W9BA 4MEBA 2WFZA 2QRUA 4CFSA 1DQZA
chains in the Genus database with same CATH superfamily
2R6HA 3FUVA 1XXHA 3U0BA 2ZWOA 5LKRA 1M2VB 5IM4F 3RUDA 2ZM6B 3JQAD 3RS3A 1K5DA 2NG1A 3LVQE 1QHGA 1WXQA 2FK8A 2WYIA 4Y6PA 2X0DA 2HJGA 4J03A 5B37A 1CUVA 2EFDB 1Y63A 3AKEA 4L5YA 4OUKX 3H6HA 3PWTA 1HWYA 3THOA 4MVWA 1GL9B 3KXDA 4UBKA 5EPUA 4ZTBA 2ZZNA 3ESCA 4B3RB 2W6ZA 4HS4A 1ARZA 4LSMA 1F0NA 3LQRA 1II9A 4K26A 2O50A 5CLLA 2PMWB 1A4RA 1IFXA 2G5PA 1DG3A 3TTXA 3PZRA 1A2QA 1XKLA 2F59A 3C5HA 3AZPA 3EUWA 4JBXA 4JCCA 1D3AA 1I3OA 4N8EA 3SYMA 4CG2A 1EFAA 3JQ6A 1JE1A 1LTKA 5JMOA 1KAEA 1OHHD 4JI4B 4GBJA 4IH4A 3P2IA 5ECYA 4S1WA 4R54A 4L3WA 4RSMA 1NVTA 5HUJA 1ZA2A 3DFUA 1GSIA 1C30B 3IP5A 3L4SO 4INAA 4LZZA 5AKIA 3L4EA 2UZ3A 1EGVB 3E9YA 4O1HA 5HA5A 3RJTA 4XIJA 3D3QA 3RU7A 3FOEC 5AVQA 4G01B 2H17A 4MPPA 5GONA 4HNTA 1KQ3A 3EZXA 1G3IA 5DBHX 4DC9A 5CXQA 1KI8A 4CL8A 4U6QA 3MMXA 2X19A 2D8MA 2V4UA 1SVMA 3R1IA 3GQBA 3D64A 3N8NA 4Y2JA 5DMHA 5BW8A 2X58A 5K8CA 3EGIA 2Y8EA 5JCZA 2XA2A 4YRRA 3NH6A 1SM4A 3LZDA 3SXPA 4CGZA 1Y1PA 2FWRA 1JZQA 4KKXB 4K9OA 3FMGA 4UE3S 3RIEA 5BV0A 3FHTA 4OXNA 2VCEA 4BU1A 4HL6A 3A06A 3F4BA 1P2FA 4WUVA 3NBUA 5D5PA 4CDMA 2WIBA 3F0TA 5JEDA 4MMZB 4RLHA 2TECE 3FYDA 3TQSA 3ZCRA 2VDOB 3WBKA 4C4ZA 2WG2A 2PKQO 3P9XA 4QDTA 3T5AA 3O84A 2ZIFA 1CY8A 1F5SA 3OZCA 1P31A 2BM9A 2G9ZA 4ML3A 2GTPA 4WLVA 4ZO6A 1C8BA 1T3SA 2AJCA 1E96A 3D6JA 4TKZA 3THYA 2CNNA 5DE3A 3GR6A 3ZEAA 2VPZA 1OT3A 2DE0X 4P83A 4DL9A 2B8TA 2ZYVX 3F4LA 4JC5A 1M5RA 5T4FA 3LO5A 1KTIA 3VR4A 3V7NA 3AF1A 5EXTA 1TKAA 1IMOA 5AXCA 3EB9A 2FDRA 5F1PA 4RC9A 1FMJA 2HHHB 1C2YA 4LHVA 3I8XA 3K0BA 1QNLA 2P11A 1S4MA 2FMUA 3E7PA 2ZT7A 4A26A 5ESXA 1DJLA 1L1QA 2PBRA 5AHKA 4Q39A 4N0DA 5LQCA 4JQSA 1TCBA 1X80B 1FK8A 1TUBB 2Y67A 3EVAA 3N74A 4H7HA 3RIGA 2FQXA 1QK3A 3SBEA 1YQDA 2IHBA 3GFOA 3PEVA 4DREA 5JZ9A 3SF8B 3OF3A 3MLEA 3L01A 3EBPA 3EXG2 1A8HA 4I8XA 2CZCA 3M6MD 5WRFA 2Z9BA 5JAMA 4AJKA 1NA5A 3PWZA 1TJ3A 2C3UA 4XUDA 3D6UA 5DBIA 5KQMA 3BICA 2RCNA 1GARA 1K3TA 4AKGA 3V7FA 2NZ2A 4V0SA 1JUDA 4BGDA 5E95A 1YL6A 4BMCA 1ZUD1 5DP2A 4H7PA 4JT9A 3MUNA 5IUJC 3IVAA 5DYTA 4KXQA 1AB5A 2ZJ8A 1EIZA 4C07A 4G0YA 1G5FA 1GKIA 1CEYA 2EFJA 3CFYA 5AICA 3FCAA 1LJ8A 4V0RA 3D0KA 5DWQA 1OZAA 5KSZA 3HXOA 1GQ2A 1Z45A 2H5JA 3HBAA 1E20A 2DFTA 3KFLA 2HMVA 1ISMA 2VWGA 4FMDF 3JVUA 4YAFA 3RHTA 3LKBA 2OA0A 3TRIA 5NLLA 1TEVA 4WOBA 3PS9A 3IP9A 1L7OA 1LBTA 3BBLA 5CH3A 5JDCA 1NE2A 1WDWB 3BAFA 1H2YA 3UTDA 3BZUA 5I9NA 3KCQA 1N1GA 2NV2B 1O03A 2ANCA 3EQ9A 3L43A 3BXZA 3QOYA 4K8RB 4AKTA 5KX5A 1IJKA 2VWHA 3BMXA 4GR9A 3TXXA 1G17A 1RZ3A 2CL5A 2DFKB 1KJIA 3S68A 3MHTA 1QORA 2NU6B 1P6UA 1RXUA 2PXHA 4WCVA 1JQ3A 4YT5A 4OMCA 4DMLA 2YWGA 1E98A 2RAFA 4O2BA 4E0BA 2XMPA 3CJQA 4NARA 4NYJR 3A27A 1ZVQA 4ZO9A 3OEYA 4JP2A 4BNKA 2VXOA 4DDTA 4U2CA 1EX6A 5FKJA 2FUNB 1W4BA 3ZKWB 5LSAA 2X9LA 4M87A 4TT3D 4BMXA 1RYMA 4YHBA 1UDXA 1UH5A 4CTNA 1QB8A 3IRVA 4PE5B 4A5OA 3I72A 2BEWA 1AUQA 2YFHA 3EZFA 4MOWA 1SCAA 5KVQA 1PWEA 1VYTA 4NENA 2OSBA 2DECA 2ETVA 4RH1A 5DLEA 4A2WA 2PKQP 5BT8A 4K2AA 1MX1A 1RI1A 3UANA 4XDZA 1HMYA 4F5DA 4ZI3A 1VLVA 2R8BA 3T0FA 5D3ZA 1W4RA 3EDMA 1H8HA 1CRLA 4LI3X 2QG6A 1UDCA 2C9BA 2E5FA 2YWFA 1LJLA 2OM6A 4PY2A 3THXA 1CUFA 1K3FA 3O75A 4CDRA 4F46A 1JT2A 4O8ZA 5LIPA 1PGOA 3QWHA 4AZ3A 3PNLA 1BEEA 2FEWB 4CEHB 4F5EA 1EM8B 2JJ2D 2WJZB 2IV7A 3GHYA 1W2HA 1BS2A 4U4AA 1B73A 4MQUA 4TUYB 3U6KA 1E99A 2ZYTX 4B40A 5L3QB 4G9EA 2Z95A 1P4GA 3PGJA 4JSTA 3KU4A 1NONA 2VYCA 5EJ7A 2ZUFA 4XD7D 2LKCA 2J32A 4X8MA 1UFQA 2OFXA 3GG9A 1QUFA 2PZJA 2IUYA 3AUFA 3VJMA 2CLLB 3C3MA 2WWHA 5AVWA 5KNBH 2ZATA 1HI9A 1NBEA 1N6HA 1TAUA 5B58T 5ALGA 5CT8A 3W2HA 2UYHA 1H3NA 3O8NA 2YHUA 1CP2A 1HEIA 1ZXXA 2BRUA 1OVMA 2ZG6A 1P3Y1 2CUTA 2NO9A 3O90A 4OREX 1BXRA 2PS9A 4JLVA 4K9NA 1EVQA 1TEHA 2HF2A 4DGQA 2OBNA 4ESEA 1SQFA 1VL6A 3IHWA 4LOJA 4UHBA 1KWGA 1N5LA 1T1JA 2A3NA 3ZWWA 4GE0A 5IBCA 2ATIA 4JKIA 3I39X 5E0OA 1JHVA 1J23A 2QSYA 2DFPA 2VN8A 1PS8A 2WFAA 4ESHA 5KOYA 4DJDC 1NLMA 3G0DA 3L2OB 1GVNB 1GTMA 1IRXA 1XQWA 3SYRA 2GESA 1DG9A 3N0WA 5CDFE 3PGKA 2XT9A 5BRJA 4TLEA 4AULA 3A28A 3U37A 4D9JA 4RF3A 2QLLA 2FEPA 1WCWA 3GZ4A 4YP5A 3E3NA 4LVOA 3WL3A 2AXEA 1Y7LA 2B0JA 2JFYA 3FAKA 5CJ2A 1YVDA 2GCEA 1NFRA 3CNHA 4HNAA 4CBVA 2SCUA 3PC2A 2QF7A 3LHDA 2EC5A 2OZLA 2QTNA 4IM7A 4BBZA 4MKFA 4DSTA 1ZJWA 2ZJFA 3BOSA 4CM9D 4N5MA 3KYJB 3O7MA 1ZVVA 1L7RA 2B30A 1XAIA 5BR8B 2MDTA 2QN2A 3TOCA 4D4KA 1H0RA 4O4IF 2X6TA 3A4YA 3GUYA 4MVJA 2OGUA 2DZDA 3NVDA 4PPYA 5HM8A 4Q02A 1NZDA 3EDRA 1NY6A 4J0FA 4OK5A 3TGLA 3U7FB 3IX7A 4UUOA 1O6FA 2J45A 2QX4A 3H7IA 1XO1A 4R2XA 4CI9A 1G60A 1ZP6A 4FZ3A 1TQHA 3RU2A 3A1WA 3PQCA 3ZE7A 4UEKA 1N57A 5MF6A 4YPFA 5HF9A 2DHDA 4AYTA 1PNTA 3E4CA 3S3TA 2R3SA 2XTAA 2B5OA 3C7AA 4LGCA 4PS0A 3REGA 5EJMA 4EZEA 3SZOA 3HU5A 5JSZA 5FUWA 4OHBA 4MITA 2GM3A 4IDCA 1E92A 4YS6A 2EFEB 4YHHB 2QGZA 3MGAA 1YCHA 1XU4A 3MAGA 1F6WA 3EJWA 4TMXA 3PXGA 3VKWA 3ZD6A 3HBFA 3ITNA 1ZWKA 2GJ9A 1CD5A 4ZT3A 2WKSA 4BFLA 4BVAA 5ITSA 5LYJA 2PU7A 1CUEA 2IEBA 1NBME 2I6GA 3R77A 4H1UA 2NUBA 1N8KA 2I99A 3KX2A 3D81A 2AG8A 4Z8YA 2H1CA 1HM5A 5CB4A 2Q5LA 1JR6A 2KW5A 2C9DA 2COUA 4Q4AA 3K6SB 4TZKA 5LQDA 3QMWA 2QN6A 4KO2S 4XGNA 3WGLA 1ECCA 3MOIA 3ID6C 5AIAA 5AK4A 2NTYC 2XZOA 4I4NA 2QM7A 3L8DA 3U5ZB 1J5XA 3ZDZB 2W43A 3I0ZA 3IT1A 3NLLA 3BL5A 4UMEA 2C03A 3ZCXA 1Q44A 5C4IA 3IVGA 1S1MA 2B8WA 5C18A 2W2LD 4UC0A 1U7HA 1SUFA 3B78A 3O4JA 5A5EA 3PGLA 4TKLA 3LUHA 5EL0A 3I92A 3WA7A 3MM4A 3OLQA 3GFSA 3W0LB 2QNIA 1WTCA 1YDFA 4WZ6A 3LVRE 1P0MA 4R1PA 1YRAA 1E9CA 3A9CA 2Y1KA 3FE2A 1DKMA 3ENNA 3L6CA 5IABA 1V9SA 1VSVA 2XNKA 4UCXA 3OX1A 1KFEB 1JJVA 1RJDA 4UUNA 1GEGA 4Y2RA 3TLXA 3ZU6A 5IVPA 1P0IA 3LWZA 4HX2A 3IS3A 4TLLB 1QU3A 2QLNA 3NWPA 4HY3A 4CIDA 4S05A 1SXJD 4Q21A 3TR0A 3ZBTA 5IZCA 3GFGA 1F1BA 4L6AA 2AV6A 2W6NA 4EO7A 1FRFS 3KWLA 5JXHA 2QEQA 5BN4A 3V1YA 3RV4A 1FRQA 1Z8FA 2XPCA 3NXKA 1KEPA 1SUWA 5DNDA 3H8VA 4CODB 4D6YA 5IXSA 2BCJQ 1YMQA 3GJYA 1HTWA 3HZOA 1A4XA 4ED9A 4Y67A 3CBGA 1NC1A 1JR2A 4RPKA 2R84A 1UXOA 4M1MA 5F7ZA 1F4VA 1XZ8A 4BEJA 2G6TA 1G8YA 4MSUA 2IEAA 1I4WA 2ZB4A 3B51X 1SG6A 2ATXA 4TN5A 5AM4A 5KU7A 1H8ED 1FNMA 4JLKA 5DHPA 1NVBA 1LX7A 1YQQA 5FAKA 1MRZA 1GZUA 3MBIA 5DNAA 3V80A 1Z0JA 2Q3EA 1RPAA 1FFXA 3R3UA 4L16A 1CR4A 3I5YA 4FW8A 5G2OA 4B82A 4V0NA 1G20B 5E0KB 2O0KA 4IIYA 3UENA 5JRJA 3C8MA 2AGVA 2LIPA 5B2ZA 5TMEA 5IULC 3H2KA 1ZCZA 4I4CA 1QH0A 3CW9A 2ERYA 3KT3A 1H8EA 3E5NA 3FNQA 4UHCA 1NRJB 1C9JA 1G8AA 1Y7PA 1K6JA 1H2HA 5D84A 3SJBA 1T8WA 1Q2XA 4B9EA 3L9WA 4RZSA 1J90A 1DVRA 3F6SA 1FRVA 1D07A 2GBLA 4TMWA 4G8DA 2ZS8A 4IR7A 4LHEA 1GKUB 1P1IA 3VR4H 4QWWA 5JVDA 2DMRA 2P6NA 2RIRA 2Z8YA 3E9QA 4I81A 4XR4A 1TKBA 2YRWA 3H11B 3WK6A 3HY3A 1SR8A 4RSGA 4B6RA 3K70C 5IDQA 2C2ZA 1W5BA 1Z17A 1C14A 3CUKA 2A67A 5TPZA 2I33A 1SULA 4TMVA 4AG6A 1T13A 3IVRA 3WK4A 1DPGA 1TTQB 2A0KA 2REXB 1M1YE 1BCSB 1FC0A 1Q1GA 3IPCA 1SWWA 1YZYA 4PC3A 1CR1A 1K2VN 4EOGA 5E6RA 1U2DA 1JFTA 1KMHA 1XYGA 1HYBA 2WF5A 3EAFA 3N0TA 4ZT2A 1LRJA 3DAGA 4JVLA 3DEAA 4ID3A 3TLZA 1E6CA 3VOAA 1A98A 1OASA 2FE1A 4BEVA 4LECA 1TU3A 2VAXA 1FU4A 2YW2A 3O82A 2A33A 1PTJA 2PSEA 3R7FA 1JG1A 2Y2UA 3I45A 2G06A 2JIPA 3SYNA 3I2KA 5J4LA 4LHXA 1QIHA 4PBRA 2IU6A 2D2FA 3HC7A 2GO1A 1OA1A 3KM0A 2EJWA 4OH1A 2GDJA 1JG4A 3LHIA 1WCIB 1K92A 5DF1A 1ODCA 3MBKA 3QKWA 3ZV7A 4CKBB 3H9GA 3WL4A 4EYEA 1FVFA 1R0KA 2Z5FA 2WILA 4NFSA 4KTVE 1ODTC 1XHEA 3SDBA 3TZHA 3ZQ4A 1U9IC 3H8SA 4R0MA 1IHOA 3CRRA 3DMPA 1UP6A 1DX9A 5TEVA 5FNVA 5JYBA 3OF2A 2FU5C 2ZQZA 3ND6A 4KC0A 1WXXA 1XTUA 2GXAA 5ALTA 2O7QA 1K3UB 3CRNA 5KYKA 3WLEA 4KR6A 1Z5WA 3SZ3A 4MVJE 4KW7A 3TLJA 2PZ8A 4PZZA 4ZCLA 2IS1A 5A1JA 1U4OA 1GU0A 3O21A 5KQLA 1N5IA 4UU1A 3UA4A 1H0KA 2ID8A 4FYXA 4ZI7A 1FA9A 4KIJA 4NJMB 5A3QA 5JCJD 5KOJA 5L7YA 1NGSA 3VR6D 2IPMA 3KEMA 1W4AA 2J48A 5SY4A 3RAGA 2WT8A 1TD1A 2OGWA 3GPIA 2EXXA 5DLPA 2VJAA 3SSAA 4OM7A 4L2IA 4BAUA 1MMFB 1UKZA 3TGPA 4FW9A 4U8HA 2VH2A 3T7SA 3BF8A 4HFRA 1NJ8A 5EQDA 3LUAA 4M9UA 1UBJS 2MR6A 3PJFA 4EB8A 4GDMA 1PW7A 2P3LA 2YMLA 4ARCA 2B7LA 3RUAA 5I47A 2PSFA 1U63A 1RHQA 1TFRA 2X0JA 1H6DA 2X7JA 2BUCA 2R1ZA 1RXSA 2PJZA 3IAHA 5CPBA 1IG3A 2J6CA 1RADA 1VLZA 1YRHA 2H65A 2J0EA 3MWDB 4OVKA 4R8MA 1T5LA 3K8ZA 3SE0A 3BWDD 2F2TA 3QE3A 2LZ0A 3VR2D 3T3OA 4JYAB 1GYRA 3SKXA 5KAPA 4E3WA 4EG6A 4WNCA 1I7SB 1UJCA 5C1OA 3BGVA 4ZPJA 4AS1A 4OFBA 5H8WA 3K6JA 5IAAA 3GUCA 2R4TA 2O7NA 3F6CA 2HRDA 4B0PA 3AKCA 4PWZA 4F4FA 2JZOA 1LXCA 3DB2A 5ISMA 3L7CA 2B9VA 5C8YA 5CBPB 2WB4A 5J23A 2XB8A 3F98A 4HQRA 1TK2A 3CINA 3MJFA 2A5LA 1NF8A 3QEMB 3B13B 1KEUA 4G0QA 4TL9A 4TWBA 4OK3A 5DNWA 3MEQA 3PF8A 4IOKA 4F6RB 1NKTA 3DJFA 4RMIA 2X76A 3RBAA 3TRKA 1O95D 2HAEA 1K97A 3M6AA 1J49A 3K5IA 3ADOA 1G2QA 4Q5IA 4CT0A 2ZB8A 2I4TA 1SBIA 3OQIB 4R9UC 2HLDA 4EW6A 5DOZA 1SHLA 4P7BA 4DXAA 6ABPA 2JCYA 4JVNA 2WU4A 2F55A 2EQAA 4XARA 3BIFA 1XF9A 2F62A 4NQZA 3Q40A 1KWKA 2OO7A 1KVSA 3L7MA 2D0IA 1SU4A 2O2HA 3A1DA 1UBEA 3HCRA 2V0NA 3DYIA 3AUTA 3ZBUA 2IZZA 1MH1A 2E55A 3JQEA 4LNUB 4YACA 3AK4A 3O4RA 4NK4A 4BV3A 1PD0A 4GYJA 5H3HA 3OEED 2ZZKA 1UJNA 1IJEA 1OR8A 2WQ6A 2HQOA 1L5ZA 2PTHA 4GI3A 1CHNA 1W48A 1PZEA 3RF6A 3Q2KA 4DB2A 3HBJA 2JGDB 1G64A 3VHXB 3C3XA 3KUKA 2PL1A 1Y9DA 4HNRA 4R2IA 3HUTA 5IZCC 1LRLA 4M46A 2H08A 1YZ3A 1PR9A 2YDXA 1M1ZA 3HU3A 3OZSA 2A88A 4GSYA 3OU2A 1M1NA 3FKJA 5D01A 1E3JA 1OU0A 1EM6A 4KQJA 2YBEA 3AYZB 1IC6A 1HQKA 1FVOA 4QBIA 2VQDA 2YRFA 5EMMA 2J7PD 3NIGB 4M36A 3DTTA 2F3TA 3RIYA 1ZD8A 3GU3A 3HBMA 3RW9A 4HNHA 1HGXA 3DDHA 3AFOA 1K6EA 2JGIA 1SH7A 1R9MA 2PLAA 2WI8A 2ZYHA 3QYAA 3ZX4A 5B30A 1HDIA 2AQKA 2ZUSA 1MO4A 1MZVA 4GEGA 3MBOA 3U17A 1HZZC 3R7LA 5EZYA 2LIVA 3NBXX 1KK2A 4EAAA 2VHUA 3FLAA 3AZQA 4CKEB 4MQ5A 2BJVA 1F3OA 3P2EA 2GN9A 2YIDA 4EEKA 2ROQA 2AN1A 2OZPA 3HGQA 1VPWA 3SOPA 2GILA 1OWLA 3L7JA 4LVNA 4V0QA 3KPJA 1WWKA 2YDYA 2P2DA 2IIPA 1FYXA 5SZHB 1E6UA 4IXWA 3VX3A 2BP7A 5JMTA 1A69A 3E2MA 1T1SA 2D13A 2VWQA 1Y8QB 3A3PA 3QLVC 3TAUA 3VYSB 4RTMA 3SZLA 1ZD1A 3EQ8A 4DLXA 1G5PA 1XD2B 4OMFG 2FW8A 3KYIB 4LC9A 4DUYB 5BVHA 4HBGA 4J76A 2ADMA 4GO1A 3QLUC 3M0EA 1GPAA 3FPHA 4EVQA 3WLNA 4Q37A 3TW0A 2EBFX 2D5CA 5CT5A 2PYIA 1QONA 4RZ2A 2IEDA 4X1KB 4AU1A 4DIUA 1Y8ZA 1JLRA 2C59A 1EG7A 2CDCA 2ZJ2A 3Q3CA 3R5XA 1XTBA 4GZMA 5T6BA 3TOXA 4NJEB 1TQ2A 4WOJA 4YMUA 3MSCA 5HWSA 1RWQA 2ZI4A 2AFHB 1W1IA 3JQFC 4BDSA 1R10A 1ZIYA 2PGXA 4WA7A 3BFJA 1BMFD 2VF2A 2GWRA 3QV1A 4PPQA 1L5KA 3DTVD 4FNAA 5EQJB 1UEJA 5J58A 2CN1A 4PAQA 1JIKA 2ZBFA 4V0OA 3MS4A 4Y2XA 1I7DA 3QIVA 3KPVA 3UFXB 3FLMA 3U48A 1TGYA 3F5FA 1PL7A 1P45A 1OXUA 4JT4A 1PUJA 1T2NA 2YL2A 4F2WA 4DV3B 2YXEA 4W82A 1OXVA 1E2DA 2CXNA 2JGAA 3D7RA 3RWOA 5JI2E 1VBNA 3T9EA 2XB9A 2YZKA 2P8JA 3FPJA 1V25A 5CVJA 2JFXA 2FWBA 3EMKA 3ORHA 1KZYC 4KJZA 5EMKA 4PCUA 3HB0A 5EJEA 4EF5A 5TEWA 4KPFC 2J3KA 2GFHA 2GHTA 4JUFA 4EATA 1IVYA 2CUNA 2NTEA 2VP3A 3DFZA 3FROA 3K1ZA 4BPBA 1YR6A 1R9NA 2P1ZA 3CQ9A 5AJWA 1VJCA 3UCXA 3A1CA 4DIDA 3HKDB 1HA3A 4BFCA 4F8JA 2KBEA 1PI3A 4YR9A 5LIRA 5E9WA 4KXMA 3GT3A 5IT9A 2HLNA 4YPVA 1T43A 3FD8A 3AR3A 2ILVA 2BHNA 5EJAA 3KQSA 1R3DA 2HIMA 4P1ZA 4BNLA 2AXQA 5M34A 1JJAA 1JA1A 1CJUC 1SPBS 3NV7A 3FMOB 2N9UA 2P7IA 3B3QA 4GI7A 4Y2YA 2JCGA 2V7QA 2V7PA 2D2VA 4A15A 4UPEA 3I2IA 1R0LA 3UKDA 4NZOA 2ZGVA 4HDCA 1EFTA 1V3QE 3M9XA 4Z0HO 3R7BA 3UG6A 2QTBA 5C8ZA 5ALYA 2QVCA 1MO3A 4MYHA 4BNVA 1V7ZA 4BNUA 2VP5A 4PQEA 2BFDA 3SX2A 1FW8A 1N2HA 5AFSA 1U8UA 2H2DA 2AMLA 3A4IA 3NHAA 4KLZA 1DDIA 4IVQA 1O0SA 4OI4A 3AFNA 3PRYA 4RD0A 4UDYX 4F0JA 2J0QA 4Y2QA 4MXDA 4KWIA 1KK1A 1EFPB 3MWEA 1JQEA 4Y6OA 4ZAGA 3TZ6A 3EIFA 2C4HA 3WQSB 3FWKA 1U0OC 1YCGA 1BQEA 1HMPA 2YVQA 3BRCA 3N58A 4XUCA 3NTVA 2EFGA 5HQ3A 1SJ9A 1D04A 3SBDA 5BNWA 3MJRA 1QYCA 5LLDA 4PSUA 3FPCA 3L6RA 4HYQA 3TLKA 2NLOA 3R3ZA 1XEXA 5AUOB 2GCPA 3SXUA 5JAIA 3L18A 4AJPA 4ERXA 3CGWA 2CLKB 5TRTA 4AJHA 3DD5A 1QRSA 1FTNA 3O03A 4LJAA 4CKCA 5T8KA 2V7BA 3HCWA 4REQA 5JNVA 4UTZA 4N18A 4UU8A 5FPHA 1JEOA 2O8EA 1UDAA 3W78A 1UJBA 1Z18A 1VE3A 2E1RA 4IV8A 1AQLA 4MVJM 4HKTA 4MV4A 2PMDA 2VH1A 2NV0A 2FEOA 5KQPA 5MDHA 1AO0A 4EA6A 9MHTA 1CDZA 3HSSA 4MP6A 2QW0X 2V65A 5FTWA 1NXPA 3VFDA 2Z8YM 4CKWB 4Q66C 1SHUX 4RQUA 3HJNA 5A04A 3G0OA 3OJ0A 3JQ7A 4AG3A 3X1DA 1JECA 4KUHA 1KZGB 4EGFA 2R4UA 4ZVOA 4WY8A 2O8NA 3CLUC 5ALEA 4NATA 2OMKA 4EVIA 1SVWA 1UBTS 5JTTA 1DFIA 3HU2A 5F1OA 2RHHA 2K7ZA 4D9KA 2YKGA 1VPVA 3PG5A 3H19A 4H7IA 3EWIA 3PE3A 2X5OA 2J4FA 1G7TA 2XIQA 2HQ1A 3LHKA 4AF6A 5ITZA 2E3JA 1EBFA 2VDKB 4OOEA 5EP1A 5JPIA 4C0XA 2DWUA 1ZNXA 3I9V1 3DS8A 3KT6A 3LX6A 1IN5A 3N0RA 3A3KA 5DV9A 3DGEC 2X42A 5A6VA 2EWMA 1Y5RA 1FFYA 3OIWA 1RYNA 1TLFA 3DBLB 3ZI4A 4US0R 2IRWA 4QPZA 2VL7A 5IJ0A 1L9KA 1E2BA 1V41E 3SZGA 3I5XA 3VDMA 4Y6LA 4XQ9A 2HR1A 4C04A 1YRYE 4EJ2A 2I1LA 1IM8A 4H3HB 5G4KB 4M9CA 2BFCB 3IOEA 5DGXA 1AKRA 5JXGA 2XCSB 1MV8A 2BGIA 2Z4TA 4YUVA 4LHWA 3R7NA 1R6XA 1NG9A 1TIBA 3S2ZA 4HX9A 4BO5A 1JDSA 1UKCA 3ORSA 4AQDA 4OAPA 2H1HA 4DLVA 4I50A 2REBA 3DV0B 1ATZA 5AHRA 4E22A 3VNVA 2ACWA 2V45A 3NEYA 2CDBA 4CEIA 1ITZA 1QGZA 1BWSA 4X3OA 3WTCA 1NE7A 1JF8A 1TIPA 3WBBA 1NOKA 2PA0A 2QD4A 7REQB 4UFNA 2FPSA 1QR6A 2H8GA 1CRWG 2NZXA 4UHFA 2PZMA 4WT7A 3PSAA 3S8MA 1Z4JA 1JN0A 1AQUA 3OZIA 1PZNA 2V0CA 3OZ7A 4IO0A 4PFQA 1F1JA 1Z56C 1NNUA 2Q9CA 1W5FA 3M6WA 4HWRA 3KJIA 2IZ0A 4H7JA 5EIEA 3STTA 1DO2A 1IHYA 1JSRA 1KRXA 3SEAA 1MGOA 2VNKA 3PKZA 5EKSA 5GAJA 4RTSA 5TARA 3A6PC 4RM2A 4TL8A 3WBJA 3LV8A 1CPYA 1PV1A 1KRWA 1PS0A 2JHPA 1K5PA 4L95C 4CV0A 2GJ4A 2W98A 1XGKA 4GOJA 4ZJZA 1QMGA 1PNQA 1UPAA 2I1VB 4GYWA 4KFUA 4V02A 1HY3A 5HQJA 1YZUA 3W9UA 1ZNQO 4DR4B 2XMDA 3L6OO 4Y1EA 3OICA 4FCTA 3KHUA 5A0FA 5CYGA 2E49A 2FHPA 5CCBA 4ZVNA 4IYRA 4BLOA 4YCNA 1T5IA 1M7GA 5AJVB 3X44A 4PRYA 5K51A 4Q24A 1C4KA 4HTAA 1XL0A 1OPRA 1W73A 2AIRA 4HCJA 4JS0A 2VHTA 1GGMA 1E3IA 1NFQA 3C3PA 4ZREA 1PTJC 1EDZA 2GFIA 2PO7A 3BGWA 3ZBQA 4KI0A 4Z2AA 4KWTA 4INOA 3HVRA 3EF0A 3CNOA 3PDHA 3BAZA 4KRGA 1U4NA 4O2RA 4G37A 4AM8A 4M1SA 2A9VA 2PUDA 3EFHA 3OFND 1KMMA 1XCGB 2P9HA 1AKVA 2C42A 1Q6ZA 1ENPA 1QHIA 3DXXA 3C8UA 4G4JA 1KFJB 1YOBA 3L46A 4XX0B 2ZZMA 2WINI 4AK9A 2WF8A 3FSRA 3NR2A 5CPFA 4LOHA 3SJUA 1DCTA 1OAOA 1QCYA 2I8AA 3EDOA 2WT9A 3W3AA 3RG2A 2Z0MA 3B6ZA 4OL0A 4B3XA 1M6WA 3K9BA 4M7PA 4X3CA 3SKYA 3F2IA 4WBNA 1OH6A 2R751 5J4YA 3RFCA 2VT3A 3UH0A 3C5EA 2R2GA 4XSVA 1JWLA 2M9MA 1V1RB 1ODLA 3LRXA 1BMDA 1X9HA 3QNUA 4G26A 1I4TD 2WUDA 4N7MA 4X90A 2Z3VA 5DI3B 5HS6A 2L82A 1QH9A 4AJEA 4X92A 3SDSA 1QKKA 2I54A 2W4MA 5FOVA 2ZRIA 3N75A 2DSTA 2W0MA 3IGFA 4EBFA 1PBNA 3SCZA 4Y7DA 4BQEA 2QRZA 2HWUA 3ISVA 4XDGA 1JKJA 1OFUX 2CWDA 1AKQA 2XOEA 3NHKA 3PB3A 4PGFA 3RVMA 4D5GA 4JLPA 2ZYGA 1PCXA 4OGFA 3R7WB 1YC2A 4LXQA 1RHRA 1J7JA 3OE7A 4YX9A 5G3YA 5JJ5A 3CR7A 3JARB 2V7WA 5BSGA 3F3KA 1TLTA 3WGQA 3L1HA 3R0IA 1KA9H 1YGYA 5BYAA 3I6BA 2IKSA 5EE0A 5CB0A 1G20E 1C29B 2JHCA 2WNHA 4QBFA 3TNFA 1G0NA 3HB5X 2IP1A 1HH4A 2EJUA 3EQZA 1TM2A 1Z8HA 4TTRA 4E33A 3PQ4A 4EL5A 3A2NA 3CLRD 3HB7A 2GO7A 4N1AA 2C2HA 3GRZA 3RS8A 3LYHA 2VZLA 3WQQA 1FX0B 2REQB 2UUPA 5CA0A 1NMSA 1TZ2A 2GHIA 1FVXA 2OAGA 3BMOB 4ETNA 5LMCA 1FP7A 2YYAA 2IPAB 1BHSA 1IE3A 1XLTC 4QOGA 4ASUA 2XTNA 2AZDA 3QTBA 4TS3A 1N3LA 4MVJD 3NI2A 1Y6GA 3CTPA 5DX1A 5KYWA 3UHFA 1EWRA 1W0KA 4G67A 3GJ7A 2N47A 1HNNA 3L07A 3QUAA 2XSZD 4LHSA 2BIFA 2R60A 2P6UA 4R3WA 1XVLA 3CCCA 4N5DA 3NRJA 3O4FA 4H1HA 4ZVKA 1WCYA 3I9FA 3PD1A 3AL2A 3QU9A 5CFOA 1M9NA 2B2XA 2XITA 3C6KA 4LQLA 2GAJA 4KH0A 1QOZA 1NYQA 1XZFA 2N75A 4KN8A 1ZK2A 1L5QA 2AMJA 2NO5A 3ET4A 5F73A 3T5PA 4JLNA 2GAIA 4RF5A 3BXPA 2OQRA 3IULA 3R5SA 4X63A 4CW7A 4FFVA 4GU5A 1F8GA 3AP2A 4JA0A 1CRZA 4F92B 3VPXA 2Q2QA 2J3JA 2R66A 3Q7TA 5B57C 4OGLA 3L8ZA 1RLMA 1XEWY 1XE3A 2KM1A 3JW8A 4ZAZA 4ZI2A 4WN9A 2JGRA 1YA4A 3BGIA 4HSEA 6Q21A 1Z2DA 2GXUA 1PYOA 3H5TA 1YFJA 1TPZA 2FSSA 3G9UA 1ZCFA 5AOBA 4AC9A 5KOHB 1VKNA 2D06A 1J9ZA 2ZWVA 1WPXA 3G2QA 3OTHA 3IDSA 1XZBA 2J85A 3PU6A 3VYTB 4XRGA 3LGSA 1GTVA 4CU5A 1EX1A 1I5OA 2MIIA 4MIKA 1J8YF 1NI5A 5JC8A 4IDHA 3GP8A 2BRUC 3ZQUA 4QGBA 3OZXA 4ABTA 4RK4A 1E9VA 3BIXA 4ACBA 3U26A 4B3HA 2ISCA 2O4UX 3W6NA 2WWYA 3IILA 2JLWA 3AHDA 2Q2NA 1HL3A 1JQJC 1TW2A 2QI9F 2ZETA 5TF4A 4EY6A 4D8WA 1CZOA 3IP7A 3AVWA 1WVGA 2GSDA 1E1DA 2OUKA 4DNOA 1V35A 2H2HA 3EZ2A 3FH0A 3KDPA 1O77A 1VBFA 2BGRA 2I7DA 3ABSB 1RLIA 4GWKA 4YJHB 3C14C 4NBLA 5BRNA 3K2IA 3BHMA 1KZ4A 1RQLA 3WNZA 1QNFA 3I09A 3IURA 2H1OA 1A1VA 3KETA 2ZRCA 4JI8B 4FDMA 2FSFA 5TV2A 3CG0A 2XGSA 3NWOA 5EP2A 5C5DA 1H2AS 5BMVA 5KINB 3THYB 2WE8A 2ODAA 2FKAA 1A2KC 1GUYA 1LWOA 3DLIA 3ZZMA 4ZVMA 1E6KA 2MMCA 1GRQA 5B36A 2RHOA 1G6OA 4FWTA 1YUMA 3LFTA 3RYHB 2OFOA 3GJ3A 5JCJA 4WADA 3VTKA 3TPFA 4DDKA 2UZ4A 4BFXA 5KEIA 1RM0A 4GOLD 2NO1A 3IIIA 2BZ1A 3IODA 4D1YA 4RVSA 4FEAA 2HJSA 1T8TA 3IVCA 4OHMA 2X5XA 2X8JA 4JASB 4BKPA 2NO0A 1UBFA 3HVUA 4O2BF 1VJGA 2DHEA 3RUPA 1TAGA 1TUBA 5FOSA 1A9TA 4QFBA 3EA0A 2GJKA 1PR0A 2WVHA 2PKRA 2VAVA 3MJCA 3AJAA 1F9AA 3KQWA 1P5JA 1X1CA 4DLUA 1Y33E 2RGAA 3QHPA 4D3SA 1JNYA 1GTRA 1JJ7A 2QN9A 4MUJA 1EBUA 2PWBA 1A7JA 3NQ41 2ZQYA 4FFBB 3HJCA 3VPHA 4OJYA 4N5HX 4G8CA 1KI4A 4KXXA 4Z9AA 3WHPA 1P3DA 2NUTA 2QX9A 2DVMA 3LVFO 4Y2VA 2AKAB 1BE0A 4FR5A 2R8PA 5KYUA 2ZJ7A 3RLFA 5BW5A 3K96A 3BIWA 2HZ7A 3OJFA 3Q8WA 1J06A 4ZMBA 3TR6A 3ZHOA 1Z5PA 3OEHD 2YS6A 1R0WA 4WNAA 4GXTA 2NO6A 1F48A 4D97A 1AD2A 1D7AA 1PJ4A 3SG0A 4TZ0A 4BVKA 2AOTB 4GZ5A 3CVOA 4C0LA 5MGBA 3AVVA 4DXHA 5HKOA 3BWXA 2BJWA 2PANA 2QN8A 3R3JA 1WBBA 2C8KA 1E9BA 1KI7A 1NQXA 1X2BA 1NF3A 2HWWA 2FN4A 1XEAA 1AK2A 3GNLA 4HB3A 4O1MA 1U5AA 4W6QA 5DBOA 1P1FA 2Q3CA 1YFKA 4L15A 1ND5A 4DDWA 1Z28A 5DCLA 3HXKA 5JIBA 4EG5A 4WLEA 1Z0ZA 1LLQA 3ANXA 5ED4A 2YJGA 2QM0A 4GM4A 1LI4A 4NPCA 3HN2A 1LF5A 3ZJTA 2JLZA 2I6SA 2JH3A 1KYZA 1X9GA 1JPJA 2UV8A 2Q99A 3FNFA 4JLSA 4OAQA 1KEEA 5LMUB 3WSVA 4QSHA 3AWIA 4GLFA 5CBPA 4PC2A 3SHWA 4LK3A 4PAMA 3DDOA 1SCUB 3LQKA 1ADBA 2JFPA 2QQ5A 3S7ZA 1QRUA 6YASA 3N3BC 1RU3A 1ISJA 4B31A 2OHOA 2CBXA 4J4BA 5E8JA 5KAMA 2WIDA 3RU3A 4IHJB 2OLEA 4RPGA 3IAS1 3PUVA 1QVAA 4PPGA 3DBHA 1N77A 4NBWA 2XCQA 4GPEA 3DMTC 2CFRA 2NU6A 4LAFA 5I9LA 2VO1A 5F4BA 3G82C 1SZDA 1CSEE 4ZVQA 4IXNA 2OCDA 1EFDN 4JCOA 1N3IA 3COZA 2VWPA 4LMBA 3U4QA 4LZAA 4OY3A 4NX2A 1VLQA 1XVAA 5HEKA 4F56A 4N5LA 5EZSA 1NAHA 3BJZA 3ESXA 1OB5A 3UJBA 4JZKA 3T4EA 4WFIA 1XMQB 2CDAA 3A6HA 1XTVA 2IUTA 1Q3HA 4Q7KA 2LCQA 1AXRA 4C4YA 4IEEA 5J1SB 1NU8A 1OBHA 4O3MA 4X9XA 1HF3A 4P4GA 3RRZA 3UAZA 1U9JA 2DU8A 5J40A 3I04A 4E4TA 5IC6A 4EHAA 1GA6A 4DAOA 4D43A 2QJOA 4JBLA 2Q21A 3S40A 1SELA 2GPBA 2QUKA 4Q01A 3A6JA 4D9EA 1N4AA 3QI2A 2FPIB 3PYMA 2C7BA 2Q9UA 3BIOA 3RAJA 4DHWA 5AOAA 4IGKA 4IICA 1JLHA 2WTNA 2ZEJA 4IF4A 5CNJA 4ZGGA 1OI3A 2NZYA 3QVGB 4G4SO 4AN4A 4YR7A 2B4RO 3BD9A 4GW3A 4RENA 2JH8A 5E4TA 4KK3A 4EDFA 1IK4A 1POWA 4TTQA 4TUYA 5BYJA 1GVHA 2ACKA 3LY7A 2KMLA 3UJ3X 4CF4A 1I13A 4NWIA 3U7GA 3HJRA 4OKNA 3QX3A 1B0PA 3D1JA 3V6MA 1JHUA 3AY7A 4ZYVA 2IEYA 5CH5A 5TGTA 2DTDA 1KXJA 1T4CA 4IINA 1CY1A 2RGBA 1XNRB 3ELBA 3RUEA 3V8EA 2NADA 1LEHA 2JRLA 2Z08A 3DMRA 1ZD5A 3CIFA 2ZULA 3R6GA 3IERA 2H4HA 4RAQA 4IDDA 4JLBA 4G1EB 3L7IA 2Q45A 3WSTA 3GJTA 3A4TA 4PAGA 1RIIA 2JGLA 4LJ9A 1T5HX 1U3CA 4MUIA 3E9EA 4C4SA 5AI9A 4D9IA 4HVAA 2CD9A 1X1EA 1NVWQ 2CE7A 2Z1MA 3I6IA 2Z57A 5LL6P 5BORA 4F5WA 2HK9A 1P1JA 1RWNA 3LRTA 1DLJA 3Q1KA 2VJCA 3CE6A 2AFIA 3O8DA 4L4ZA 4NE7A 3IR5A 2JFQA 1WMEA 3WFZA 2DKFA 2DQSA 4IJVA 3FOCA 4XCVA 5CW2A 5B7QA 1D6SA 1Z33A 2PJRA 1VL1A 1Q1QA 3MW8A 3QVOA 4JQYA 3T3HA 3V2HA 2G1JA 2WYHA 4JYCA 4X97A 2GNPA 2RG1A 3IUQA 3ETNA 2FR8A 2AUNA 1YZNA 5ALHA 5GVSA 1CB7A 3ZHQA 3KTDA 3V7UA 1ZICA 5FULA 2ET6A 2SCUB 4EYSA 4E6PA 4YGXB 3GRFA 2XR1A 1XCOA 4UMFA 1SUIA 1C9YA 1PLKA 3AIKA 3TH5A 4MJ3A 1CJCA 2QLJA 2ECPA 3FUWA 3M3PA 4BKMA 1BOFA 3VBCA 5AKGA 4GYYA 3IEMA 1G2IA 3BTVA 5FPQA 4LWPA 3KELA 2JGNA 3DL2A 5A6SB 2R2AA 3EZGA 2YV2A 2LR0A 1E4EB 4FM9A 3FPKA 4MYUA 4I1UA 1TU4A 3B9QA 2UYGA 5EG5A 4YUYA 2FUEA 5HXAA 4U9HS 1X74A 1ONSA 4P34A 2VUHB 5I5EA 3OHMA 4FFRA 3WWZA 3L84A 3ZU4A 1KVUA 3GCXA 1QP0A 3SFVA 4TL7A 3G5MA 1V0JA 3OE4A 1KARA 2QDKA 4HJRA 2WW8A 5JY1A 2PT6A 2PTGA 4N3GA 3UMJA 4COKA 2B83A 3R0XA 4K9SA 3UKJA 4BKUA 2NT4A 5CLFA 4DV5B 3OM0A 4RCYA 3CLHA 1B76A 1N25A 4EMSA 2QTMA 4DPMA 3BREA 1KAOA 1L6RA 3SR3A 4UTRA 4Y0NA 4GMHA 5JARA 3UB3A 2QN3A 4KO1S 2K7FA 4ISBA 2XDQA 1YRQA 1E9EA 1DIOB 2VSNA 5HFAA 3EPPA 1Y4UA 5FEMA 1A71A 4FILA 4ZT7A 3X1XA 3PIDA 1QYDA 3R5TA 2CFCA 4L85A 1IBKB 2XJ4A 5IASA 3GLUA 1VCMA 2C5BA 3H2HA 1TVCA 1A96A 1V95A 4HRVA 3IXMA 3UMFA 3V4PB 4IJWA 3ZN2A 2QBYB 5CGZA 1J0XO 5CB4B 4NICA 5F7XA 3WQRA 1L6IA 1U98A 1Z7BA 3N6VA 1I0IA 3PQ6A 5DBGA 2NP7A 2AL7A 4C4AA 5KHOC 3ILVA 5EUBA 5LU9A 4EUNA 1N2CA 2HK6A 2IEIA 4QJBA 3ODGA 5CD1A 3R5KA 4QHTA 5COAA 3R9IA 4G0UA 4ETIA 5JECA 1XHFA 2B3TA 1W34A 2B99A 2I6XA 1RQNA 3F5DA 4NAVA 2O0HA 4C7OA 2C78A 4QAQA 2QP4A 1AS2A 2GYVA 3DONA 2JBWA 1DRVA 1E5TA 4HADA 1R6VA 4D0NA 2AF4C 2Q8PA 1ZI9A 1MNQA 2JIZA 3DFIA 3LI2A 3R0JA 1UZMA 4J2HA 4J6EA 3RTCA 1U04A 9LDTA 1O7JA 2O8CB 1FXUA 3CW2A 1KH1A 3GB9A 2NNLD 4NVRA 3NDJA 4X85A 2OGZA 2BHLA 3H0EA 3OT1A 4EQ6B 1ZJ4A 5BNTA 1FDSA 4J07A 4EG1A 5HZMA 5KYGA 5AR1A 2GEKA 2HF7A 2YQ5A 3QW2A 4E21A 1XWFA 3OPYI 1ABBA 3N8DA 2VF4X 1KO4A 1V8PA 2PMBA 3MXOA 5JAQA 1G9SA 2GX6A 1E1LA 3JATB 5E1DA 1U1GA 4KQEA 4J7XA 3L8FA 3WLLA 4KR9A 5EQFA 1PK9A 2AN4A 1YMVA 4QRIA 3DTYA 1MTZA 4WL0A 4M9SA 3E7DA 5BN4B 5BOVA 5LOVA 4MUGA 3HJFA 1QHFA 2J9ZB 2GASA 2WZDA 2XTJA 1KDYA 4QXAA 4CG1A 3M82A 4PZAA 5BXYA 3HI6A 2GJAA 4IDFA 3FYUA 2JIOA 5DXJA 3QEOA 1JI3A 3PIIA 4OSPA 2H92A 3NP9A 2C97A 2X6RA 1EJBA 1PDVA 3K9GA 4BUJA 3W05A 3E15A 3VC3A 3LXUX 4OHWA 5BW4A 5HJ7A 1USIA 5GY7A 2W4QA 3IUBA 3IDOA 3AVYA 1YA6A 5HVNA 2R48A 2DFVA 1UIMA 3R3XA 3D8BA 5ALUA 1KI6A 4QBTA 5IVDA 3RADC 3E8MA 3MF4A 2MYTA 1U7ZA 2C5FA 3Q88A 3EVDA 2OBMA 3A9SA 1L1RA 1Y1LA 3USES 1FTYA 1CEQA 2V58A 2CXQA 3WGTA 4NY1A 2AT1A 4Y6SA 4LHYA 3L4BC 5ULLA 3ZQJA 3GOHA 4JZYA 5E6UB 1XPUA 1Q0UA 2P2SA 3R6WA 2BTEA 1JLMA 2AOVA 4IIFA 2EATA 1T3ZA 4P4SB 4ERNA 3ONDA 3L0OA 4R7GA 1AMUA 1BGXT 4UU0A 2IVZA 1K0FA 3ZIUA 1QTQA 3A26A 3FHOA 4TS4A 5SY6A 2BISA 1URPA 1R2QA 2GD1O 4N6GA 2TSYB 1TKRA 2WRZA 4N7JA 3FSGD 5CDGA 3FPGA 2XBMA 3I28A 4UHJA 1UXGA 4LYGA 5A0TA 3H9QA 3WY9A 3WYFA 1E77A 2CXUA 4YQZA 5HTKA 1PJBA 2ZKLA 4HAOA 2VHJA 4W9NC 5BN5B 2JHGA 4RKFA 3G2KA 5EUMA 1OBFO 2HTFA 2B1RA 2E4AA 3TSWA 1GL6A 4M4SA 3T1VA 2IHJA 3EIWA 3DG9A 4KPEC 3HP4A 1KYVA 3FDFA 5AI5A 4XX1A 5A9RA 1YACA 1VPTA 3PIRA 4LRUA 3AJEA 3DKKA 4HPXB 3PUHA 4OXQA 4EKEA 4OMDA 2IBTA 2ZE8A 4CGYA 5AM3A 1IG0A 3D43A 3NM5A 4IRMA 2BGLA 3LKVA 4K6FA 1NN5A 2BTQB 3E5RA 4CTOA 5CDUA 1NXQA 3QVTA 6GPBA 4IFTA 3F8TA 3T5MA 4D3DA 3INRA 2HXGA 4X6YA 2V4ZA 2GEVA 3V48A 1ZD2P 3M2PA 1UEIA 2PKEA 3V7YA 8LDHA 1X7YB 2BWJA 1YJXA 2OBBA 2JA1A 2QSJA 1JEYB 3EMVA 4UHDA 2X8LA 2J41A 3VH4A 1KNQA 1Q95A 1Q0RA 2Q3HA 4P32A 2J31A 3EH2A 4DCOA 4MB2A 5G1PA 3COYA 2JIQA 2FSUA 2BEVA 1ZC4A 4N0QA 5K8UA 4BVHA 1J2UA 1IJBA 3L0IB 5IAGA 3P0IA 4G5OA 4S2UA 1SC9A 5K3FB 2BM8A 2IODA 3K05A 5JE8A 1Z6PA 1KY4A 4FMDB 3RRXA 1ESNA 4UU7A 5EXXA 4MR7A 3K5PA 4KXNA 4J7CA 2H0AA 1KR5A 4C89A 2ZSEA 5G4LA 2J67A 4EG3A 1ZISA 4M83A 2GEFA 4ZAXA 1BDIA 4NJMA 2Q4EA 5JU6A 4HRXA 3WGYA 1EP3B 2V59A 5H0IA 3EXIB 1Y1QA 5DZSA 1C3VA 5K45A 1Q20A 2IKQA 4MTCA 2XTMA 4IGIA 3O8LA 1RRMA 4RKEA 5GP1A 4ZKDA 1I7QB 1FYEA 2WTUA 3O0DA 1VPEA 2BL4A 3H9CA 1TJ5A 4V0LA 1B23P 4FR0A 3DHWC 5LXTF 1Q3KA 5IDVA 2CMKA 3FYUC 4DR3B 1Z4KA 1S3SA 2OPBA 4QICA 4OBBA 3WYEA 3EGWA 4DCJA 3E0QA 4F3KA 3WB0A 1KERA 1R7RA 3EXEB 1DMRA 1G8HA 1KH2A 3KQTA 4OHZA 1Z0SA 4ZICA 1GOTA 2HWYA 5BWNA 5MGNA 4A8PA 1KPIA 4CR7A 2V6IA 4JEHA 3KP1A 4DBLC 1KDRA 2JBAB 3NOXA 4RZIA 3EHEA 1NDUA 2I1QA 2FZKA 2JHAA 5JDIC 2CHQA 1YS6A 1VLHA 4X1YB 4IDAA 2Q0HA 3JZFA 3RKUA 1Q92A 2BM1A 4CM8B 5KYYB 1UM9B 5AVXA 4W5NA 1SNYA 5JW6A 1T6XA 1Z5GA 2OILA 4NCIA 2LCFA 1IN6A 4F9FA 4B84A 2RH8A 2XOKD 3VH2A 2JIMA 2RHJA 2YJ4A 4A73A 4OGGA 4C21A 2OCKA 2OC4A 1QCDA 1RYHA 4CUJA 5C8YB 1Y37A 1Y7TA 4YV7A 3QU4A 2IH5A 2R1TB 2E7ZA 4X1IB 5K5EA 4A6XA 1PYGA 2CKDA 4QL3A 1PT7A 4WY5A 4M22A 4KSBA 4XJXA 1CG6A 2X41A 4J0JA 1G5RA 3ANYB 2C57A 4N03A 4L7QA 1Z7GA 1EA7A 1EINA 2A5YB 4G0MA 3WIBA 3WL5A 1NLZA 4HP8A 1XIVA 1CDDA 1ZL2A 3MT8A 2I4RA 4I5EA 5AJZA 2VRCA 1G6HA 4GKKB 1RMQA 4W5TA 3OQBA 2I8CA 3UC5A 3BSYA 4RKWA 2DP4E 1D9XA 2WOOA 3ZDCA 2ZQ5A 5G02A 4PYRA 3IUJA 3LTEA 1ZK3A 2VPYA 4QOHA 4J8PA 1GZVA 2FY8A 1PV2A 1XZQA 2AJ8A 3NUQA 3C3EA 3HVKA 4KGDA 4LG1A 2CHUA 1NZFA 1YR3A 4QQ8A 1M2VA 1Z73A 5FPSA 4BP9A 1X77A 3HKEA 3H1TA 3LU1A 4NBNA 2BBOA 4BLQA 4CN9A 5C5CA 3HZRA 4YDSA 4HQFA 5K03A 2HSDA 4PTZA 3TQOA 5KSPA 1NBHA 2O2DA 1UWVA 3N8GA 4RQTA 2A4KA 4JJ8A 2IP4A 3TMYA 7GPBA 4DABA 2X4LA 3LC1O 4A7PA 1ZGBA 3KLMX 3F71A 1E62A 2E9SA 4N76A 2PPLA 4MQFA 5C52B 4Z9BA 1W36D 3ADKA 5JAZA 5JCPA 1M1NB 2IU0A 3LUPA 5DLQC 5JBNA 4UTOA 3A05A 5EKUA 5EE5B 3IIEA 2JLYA 1F8UA 3K1JA 2XRZA 1JTEA 2O0MA 3P96A 3RM3A 4AKEA 1UXJA 2F6RA 2FN9A 3TZKA 1WW8A 3P4UA 1N0WA 3ILHA 4GMFA 5FX2A 3NC1C 4BX3A 3T99A 4HEJA 1KIAA 3P97A 1IZ7A 4B6FA 1NVGA 1P62B 2WIFA 4NHEA 5JJKA 4GG1A 4DIKA 1JHZA 3JYPA 1WD5A 3L8GA 1Y42X 1XSEA 2ZWMA 3A4LA 1FLDA 1G21A 1Q77A 4EJSA 4C2UA 2RI6A 4V38A 1Z82A 2PX3A 1AH2A 3U60B 4CCSA 1GIAA 4RZUA 2QNRA 3ZR4B 5L8VA 3FFWA 4PVDA 4YWHA 1ZG3A 3VKFA 1E1QA 2D0DA 3H42B 1IBSA 2IJGX 1X7ZA 1K6MA 3KUDA 3NHPA 3LNCA 4OATA 2Q6IA 2QRNA 4TLBA 3WP0A 2PUBA 2ISQA 4QM6A 3GEDA 1VG0B 4QLBA 2VP2A 3SIWA 2EYUA 3EIHA 3KG2A 3NT2A 3OD1A 4XIFA 4AMUA 1E59A 5IDXA 1ZKDA 3K71B 3TFWA 1AO3A 1SIBE 1JLSA 4JJEA 4EWLA 4RVGA 1FJGB 4XCXA 1P4RA 3K8QA 5FJJA 3KDAA 3KQNA 4R31A 5JD6A 3QJGA 1GZ3A 3D8HA 4MCAA 5BVHB 3U19A 3KSBC 3JQBC 1HFJA 2XQVA 2JVKA 1P72A 4HGOA 3AESA 4MWSA 3VHLB 1NVFA 3VJLA 2BLLA 3E82A 5KPJA 3W2TA 4LFAB 4JR1A 3MMZA 4ZYTA 5CX1B 1X6VA 1IUNA 4B2PA 5IKPA 4MNTA 2GFQA 2WFMA 3G1UA 5JNWA 4D4HA 2PGIA 1VFPA 4JR0A 2OXEA 4B74A 1E1QD 2BOVA 2EP7A 1CQJB 1E69A 221PA 4J49A 1CTQA 3KKPA 3HYRA 2CHVA 3TSZA 4LK2A 4HDAA 3C3CA 1M7HA 2R6CA 4Q3DA 1SKBA 3ESDA 2Y76A 2A5JA 2OQIA 3SVTA 1TO6A 3AQIA 2HRCA 5EC8A 2P5TB 1TYAE 4O4LB 5M5BA 2RHBA 1Z0KA 4OSOA 4G4IA 5K05A 1V16A 3TQCA 3ZWVA 3EEBA 3IKLA 4BTVA 1HT0A 4BO4A 1SA0B 1N5OX 4QZVA 1E0JA 4EGQA 1ZITA 1P7CA 1DQPA 1GPMA 4NZNA 1WHTB 4M6WB 5LP6C 4CPDA 1X19A 1BHO1 5JALA 1KQNA 1VKJA 4IS3A 2DM6A 4B83A 2XA9A 2YHSA 4YP6A 2BM0A 4E12A 1AY0A 4I2NA 5K8TA 1L4KA 3LCRA 2QMQA 1ZCAA 4EFMA 1ZN8A 3T1QA 3KK0A 1T2EA 3A4MA 2CYBA 2VH5R 2Z1NA 2EGGA 2QN7A 3K9WA 4DR6B 4B2YA 2Y1GA 2PGOA 5K0GA 5C5EA 2IVFA 1O5IA 1JAZA 3HKDA 4QNMA 2J59A 1E7RA 3ZE8A 2Q5JA 2MMGA 3DMDA 2VNSA 3OX3A 1A04A 4PINA 3IKMB 3KR9A 5J9FA 5L3VA 1P1HA 2P2LA 4I5IA 1WNTA 3HBNA 2ZIGA 3ER6A 5G0SA 1RYZA 4RXMA 1E4VA 1RRFA 3ZOZA 4CR6A 2E5LB 4UTNA 1EZZA 1T4MA 2Q50A 4MVJG 2PO5A 3AC0A 4H6PA 1GNTA 3T7JA 4NRDA 4Y6QA 2I2XB 4YJGA 3OZAA 5ALXA 2R6AA 2WUGA 4RHYA 5I9MA 3SC6A 1RI2A 3ZYZA 4BQOA 1NQ5A 1BX1A 2Y2VA 3CJTA 3I34X 4FEYA 1MZPA 1JEQB 3B2EA 4LF9B 1YL7A 2RJOA 1PO7A 4H77A 2BF7A 1SUBA 3B5JA 4S2EA 5GVRA 3LZ6A 2RI0A 4GEKA 4QEDA 3EVGA 2Q7DA 4WZBE 1AF4A 4HATA 2Z58A 5T4EA 1EHYA 4PIMA 5REQA 3ZNQA 3ZOKA 5FWNA 2WWGA 2H1VA 2MYPA 1RZRD 1TJPB 2OAQ1 4BQIA 4R2LA 1NWCA 4OQZA 1RXWA 1OJ7A 1UFOA 4P36A 1BW9A 3KO8A 3CV3A 3R5JA 1J70A 2A1TS 5DJ5A 3VC2A 2W4IA 2RAPA 2O8VA 4A23A 4FLEA 2J5QA 4HN4B 1Y9EA 1T9DA 3E9MA 3Q3VA 3W7VA 3CE9A 4YK7A 3HY4A 5EJIA 1TZJA 1NXSA 2L69A 4O6VA 4FZVA 4OB6A 1TKCA 3DEZA 4JJGA 2C2KA 3OFSA 5EESA 3TQFA 4CKCB 5CP8A 1DAHA 1F4PA 4TWAA 1N2JA 4E5SA 4REQB 3KXPA 2EARA 721PA 3E27A 2O8EB 1P18A 3WL6A 4ZHQF 5HGXA 3ZDRA 3ZGVA 4BYMA 3QPCA 2FW0A 3VUEA 4UQLA 4RTOA 2ASEA 3B12A 4LY3A 3FOFC 4KUEA 3IDQA 3WYDA 4NCAA 4CKWA 4TL6A 4L4RA 2Y1WA 1GR1A 1JR4A 4ZCSA 1UBSB 3V8RA 1FVHA 2ZSFA 2A0YA 3IPYA 3OFKA 3KZOA 5JRZA 2ZOSA 4RPHA 1IXYA 1D1QA 2GR9A 2Q1XA 2ECOA 3GK3A 4N9WA 4XW2A 3SM3A 1CUDA 4I6EA 1ML4A 4M53A 4ZOLB 1HURA 2EP5A 3FI9A 3HYTA 1E8MA 3QGMA 3ZHRA 2I6TA 3OZEA 1YBHA 2OHGA 4Q3KA 5EIBD 5IBQA 2YJ3A 1LDNA 4AUEA 4U8GA 1TQDA 1C3JA 2QXYA 1Q7EA 4WE3A 5EE3A 1F2TB 5BW6B 4IDPA 1VRVA 3SU8A 3TX6A 4CQLB 4CUZA 2ZTVA 2QZPA 4CL2A 2CNOA 3G9XA 4GBGA 4S0XA 1FDUA 1QDLB 2W2VA 1OREA 3JWJA 2FCRA 2R1VB 2VJYA 2OG1A 5K3EA 1SBCA 2PU5A 5FNZA 2E37A 1D2GA 2WV7A 1TK9A 1Q1EA 1NI4A 3Q11A 3R9XB 2BFCA 1ZKMA 2IT1A 3V1NA 1LH0A 3DZHA 1Q84A 3CZ4A 4YH1A 1XVVA 2IE0A 5D8DA 4AJ1A 4DWVA 1SCIA 5J1TB 3VHRA 4BMPB 4PHCA 4B3CA 2BEUA 1DTWB 3D5EA 1REQA 1E2LA 4JBHA 1EP1B 4I50B 3EFOB 3HJBA 1DP4A 3WGGA 1RPNA 2AQHA 3EODA 3KNZA 4BV8A 4I1VA 4YLYA 3WMGA 3FTFA 1XRNA 5CDSA 5JPDA 3TM5A 1B8OA 4AWXA 5E4FA 2H4WA 2HNBA 3LQYA 1XZJA 1CDEA 2VSQA 4X7PA 5H9VA 4CDNA 3NP7A 3OOYA 5JS7A 2XWJI 4YFVA 3IT3A 2WICA 6NULA 3L40A 1OY1A 3K35A 1KQPA 4CN8A 2MSNA 4HH0A 4CCYB 1J56A 1MVOA 4MKRA 1QZZA 1R5OA 2Q3JA 3D4IA 3OOEA 1C5KA 2AE2A 3I0MA 3AUXA 3ZDEA 1WV1A 3LL4A 4C03A 2WMOB 4F4CA 4G6ZA 1NRWA 1DLIA 1LBEA 2R7KA 1Z4NA 5JSQA 4QG7A 3S4YA 4EHJA 5H80A 4V1CI 5KCZA 4NMLA 1AS0A 4GKJB 3BJRA 2A9FA 2HBYA 5F2NA 3L4KA 1DBRA 1O8CA 2AH5A 3IEIA 1KBZA 2IX9A 2PL3A 4NLLA 1NV8A 4UNPA 5A9SB 4X0EA 3KBOA 4JLJA 1K27A 3INGA 1H66A 4GMKA 2G72A 3FLEA 2GA8A 3G2IA 2A7QA 1MO5A 4H3SA 2FRVA 3IEXA 4ZI5A 2IYXA 2PLWA 2WWFA 1Z4IA 3L8EA 1K86A 4HLCA 3QJYA 1KP2A 3MCTA 2VFAA 1G5QA 1RYFA 1XEFA 2XYPA 3KKKA 4CLOB 5TIIA 3ELUA 1JEEA 2GF9A 4P4LA 1YKGA 3QA9A 4WZZA 1GTG1 1I36A 2VF5X 4FUTA 4L8LA 2QLFA 2A14A 4NZMA 1K6XA 3LBIA 5JAPA 3HGTA 3KQMA 3QI7A 4G56A 2QD5A 3NUGA 2VT7A 5LDHA 1E1RA 3LVBA 4GKVA 4UJ5A 3C8ZA 3TRHA 3ZE6A 2FXVA 2NQTA 2XZLA 2ZYDA 2E21A 3IH5A 4JP3A 4KODA 1H0HA 1YVRA 1B8PA 2H1SA 3BWMA 3TTVA 4LPKA 3X1MA 1TQ8A 3HUFA 4GSLA 4HXFB 4XFKA 5H3LA 3T3GA 3CRMA 1XJ0A 4RTPA 3RAFC 4AICA 3KYBA 1JXMA 1L1EA 1VDMA 1VPLA 4JYPA 3OIUA 4O5OA 2GI4A 3G68A 3MXTA 5GOZA 4WBNB 3PGXA 3WJ2A 1ZHHA 3MMPA 3CKKA 5AO9A 3ED1A 2R6ZA 3RPEA 5FUMA 3F1LA 5EYPB 4Q9HA 2REOA 1Y8CA 1D1SA 5DTEA 2A9QA 3W79A 3WYGA 1RT9A 5DI3A 4ZVLA 1DIHA 4Y2GA 1EB8A 1EVYA 4AL4A 3GUHA 3KJFA 1Q7TA 1FDRA 4FZ5A 3OC0A 3BH7A 3QEJA 1V4BA 3PK0A 3TUZC 3MILA 3GEGA 4CU2A 4G09A 1W52X 2DHRA 3OETA 2G70A 2Y05A 3PC8C 4OI2A 2IYSA 3F47A 4QC2A 5EFOA 4HGQA 1CU1A 1YZGA 4DY4A 2ZBRA 4UAUA 3KZNA 5CBKA 2NSHA 4MVXA 4ENVA 3KT0A 4WZBB 1BA2A 3MGCA 2NYUA 5AVTA 1RWVA 2YV5A 4C2TA 3BORA 4CRWB 2GT1A 1ZN7A 3Q10A 3TFQA 4WQMA 1Z2OX 4QELA 2B94A 3O7WA