7YASA

Hydroxynitrile lyase, low temperature native structure
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
256
structure length
256
Chain Sequence
b'AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
molecule tags Lyase
source organism Hevea brasiliensis
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
total genus 97
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 7yasA00
3SWWA 3CCBA 3Q8WA 1W4LA 4AO8A 1Q0ZA 3IVMA 1T2NA 4X85A 4DNPA 5K5EA 2RIPA 4I4CA 4B0PA 1C4XA 2XLCA 1K8QA 1P0QA 4BTLA 1W75A 2VQ6A 2XUOA 4BRSA 1CUZA 2XE4A 3QPDA 5T4EA 3DD5A 2OGZA 1CUCA 1ZI9A 1KU6A 4GW3A 3WA7A 3C5WP 2V97A 3H2GA 3MUNA 1J07A 2JGKA 3T52A 2HA7A 2QJWA 1UWCA 1RWQA 1UK9A 1YB6A 2W6CX 2CMFA 1QZ3A 2OQIA 3ZI7A 1YCDA 5E2IA 3SK0A 5DJ5A 5K3FA 2PU5A 3I1IA 4B84A 5AM4A 3PICA 4W63A 3AFIA 3FLAA 1DT3A 3FAKA 2WFZA 2J3QA 4BDSA 5CURA 5DNUA 3IUJA 1LBSA 2HDWA 2H7YA 4Y2VA 4GECA 2OCLA 3B3QA 4B85A 3WMRA 2BUBA 2X8BA 1CUUA 1GKKA 2XMRA 1BEEA 1H2ZA 3N0TA 1UKAA 2GBGA 3GUUA 2YH2A 2PU7A 1HPLA 5IH7A 4ROTA 5AKXA 3A2MA 1MAAA 4UBOA 4RE5A 1XZCA 3G0IA 3H17A 1U4NA 5AK6A 2JGEA 5LZ9A 2RONA 3DYIA 2XUGA 1CR6A 1RP1A 5EIEA 3C8HA 1P0MA 3PFCA 1MJ5A 2QM0A 4WDRA 4DYHA 2G4LA 3FLEA 2WJ6A 2QZPA 2WM2A 5CTAA 3G0BA 2JGLA 2BGNA 1IVYA 4X91A 1BROA 3GA7A 1WCYA 4FHZA 4HXEB 5CT5A 4MJ3A 1MNQA 4F5ZA 4PSUA 1Q83A 3KOOA 1VLQA 1HL7A 1CUWA 1PV1A 4Y2XA 4Y2YA 4KE6A 4P08A 3F98A 4H7FA 2XUQA 1DINA 3AILA 5ALSA 2WHPB 3IA2A 5A62A 4MXDA 3WK7A 5AOCA 3DJYA 3EBLA 1IUPA 1D07A 2XMQA 1EVQA 1QFMA 1YA8A 5IVIA 1MO2A 3BJRA 1E89A 2QJRA 2HRRA 4F21A 4OPMA 1QE3A 3WL5A 5AICA 4Z49A 3O9VA 4BAUA 3ICWA 4BCDA 1QFSA 3WK5A 1YR2A 4RGYA 2R8BA 2GYVA 2BGRA 1QIJA 4H7EA 2C0PA 3QMVA 3ZWQA 1B6GA 1EDEA 1XLUA 5ALUA 1EH5A 4XX1A 4UBIA 1CV2A 4PNZA 4HXGA 1JJIA 3HC7A 1MN6A 1VXRA 2WKWA 4H7JA 1BE0A 1MPXA 5JASA 2XUHA 1K5PA 4BCCA 1DX6A 2RAUA 3F97A 5HZGA 2VF2A 2WFMA 3JWEA 3WK8A 2XDWA 4G9EA 1WOMA 4GXNA 3AUKA 3WZMA 1SOMA 3VDXA 3LS2A 1EB9A 2EDCA 5AO9A 1X2BA 5K3EA 3E1GA 3F67A 3GFFA 5IVKA 1U65A 5FPQA 5EHXA 4DMCA 5FUMA 1ZJ5A 3BDIA 5ALNA 5F4ZA 5JD4A 2W22A 3STWA 4PV7A 4J3JA 1XZLA 3V48A 1T4MA 5HFAA 5JIBA 2DHDA 1BU8A 1ODTC 5DYYA 5HFNA 4OB6A 1K6EA 3OURA 3SC2A 4AN1A 4NZZA 4FDMA 4K5QA 4FOLA 3D2AA 1VZ2A 2B61A 4B6GA 1GZ7A 2HA6A 1AC5A 1FJ2A 4L72A 2CEKA 4C89A 2OCKA 3BJMA 3C6BA 1ZD5A 3WI7A 1GPNA 5K3CA 5AK5A 3FYUC 2XMGA 4MYDA 2QMQA 2QXUA 4BVJA 3NWOA 3QBJA 2H7CA 3KWFA 4DSAA 3DL4A 3DKKA 4U2DA 3IULA 1XRNA 1ZJ4A 1FFAA 3CN9A 2RHTA 4QWMA 7YASA 3QM1A 4BZZA 2O2HA 2OG1A 1YA4A 1F6WA 5JALA 1EINA 5ALFA 1XFDA 5FP0A 1RYYA 2PUHA 4C6HA 5CT9A 3IUQA 2ZJ6A 3LIIA 4EUSA 2PUJA 4AO7A 1LPPA 4X00A 1U2EA 4FNGA 4AZ3A 3H0CA 2VT7A 2PM8A 2IX9A 3ESBA 1Y7HA 1DT5A 1QIHA 5ALXA 1FSSA 1LGYA 2BUCA 3R3ZA 4XWGA 3G9XA 3O9MA 2GYUA 3HABA 5CT8A 1CUXA 1WHSA 2XLBA 1JMKC 4XIIA 2QXTA 1AUOA 1H2YA 1AKNA 5AKIA 1ZI8A 1DWQA 3IDAA 4FLEA 3H1AA 4CIAA 3FNBA 1H2WA 4LXHA 4Q05A 3N2ZB 5HF5A 3M83A 1GPLA 1O6GA 2O2GA 1THGA 2XQGA 4B9EA 4CG2A 2HA5A 3WZLA 4RE6A 2HFJA 4G1FA 5ALWA 1GQSA 3D0KA 1GT6A 4EHBA 2ES4A 2HA0A 4BP9A 1LLFA 2JEZA 2XUJA 3BL8A 2AJBA 2R11A 1XZDA 2DFPA 3FCYA 3IBTA 1AQLA 1CRLA 3ZV7A 4F60A 5EHQA 1FFCA 3STVA 1KEZA 1BS9A 5EI5A 5DWDA 4UHBA 4CG1A 1UOOA 2XMSA 5CW2A 5LZ7A 3PF8A 5AM2A 1CEXA 1PFQA 3G02A 3I2HA 3H18A 2OGSA 1CVLA 1AX9A 4KAJA 1S8OA 3CXUA 1XKTA 4OD0A 1R1DA 3HJUA 5H3HA 5D6OA 1W6RA 4PSDA 3D2BA 4EZIA 2B20A 1Q84A 2QKYA 3GROA 2NW6A 1CUYA 4XVCA 2CKMA 2C5GA 2XMCA 1ODSA 4AQDA 3K6KA 5JD5A 4UFPA 2UZ0A 3F96A 4Q3LA 3H19A 4QDXA 1THTA 3MGAA 1OILA 2OCGA 5AP9A 1EX9A 4LYDA 1VXOA 3WK9A 1GGVA 2XT0A 4AZ0A 1UXOA 3NGMA 5BOVA 3FYUA 1GPKA 2IIVA 3I28A 4MEAA 1SCKA 3DNMA 4EY4A 4WFJA 2FJ0A 3QH4A 3DQZA 3WWPA 4B7ZA 2QS9A 4X90A 2DHEA 4LKOA 5ALMA 4BAGA 1XLVA 3A2NA 3BE8A 5A7GA 3L1IA 2AJCA 1QONA 4ARBA 4C01A 4KE8A 1GQRA 3H2HA 4YPVA 1R9MA 1A8QA 4BDTA 3W04A 1YASA 5I7UA 3K2IA 1G42A 2JF0A 2JGMA 3W2TA 4AXBA 4J7AA 1QIGA 5AKKA 5J3JA 1DTEA 2HRQA 4EY7A 5JYCA 4CFSA 5HKBA 2DSNA 5AKEA 4OB8A 5A2GA 2QT9A 2XUPA 4U2GA 4ZREA 1VJ5A 5AK3A 1WB5A 1C7IA 4UPDA 1I6WA 1OXMA 2C5FA 3O4JA 3QPCA 1P0IA 2OPHA 3GZJA 1EHYA 3QYJA 3HEAA 4G4IA 1QTIA 4QA9A 4DNFA 3C70A 4Y2QA 4Q34A 1H22A 2X5XA 4C87A 4FFWA 5AIAA 1H2XA 1TAHA 2RGUA 3FYTA 1R4ZA 1IUOA 5LLSA 1CUIA 3G0GA 4ZGBA 5CMLA 1ZIXA 1E8MA 5AKGA 4O08A 2WHRA 4Y2SA 1Y7IA 1XRMA 1YB7A 1TK3A 2OAEA 2Y2VA 4HXFB 2OAGA 4X6UA 4UHFA 2VAXA 1AMNA 3KSRA 1MX9A 3ESDA 1JJBA 4J0IA 3HI4A 4ZV7A 3X3HA 2WILA 2D0DA 4IHAA 5AI8A 1P0PA 3RK4A 2PSEA 4QDOA 2AJDA 3DEAA 1QIKA 2EEPA 4BVKA 3VJMA 1CPYA 4H7KA 1XZAA 5HCUA 1TIBA 1M33A 2ZYRA 2XQFA 3F9CA 1L7AA 5JANA 1GXSA 1TCAA 4BZWA 1UK7A 1ZIYA 5D7BA 2PSJA 5I8PA 4I3FA 5JZ9A 5CXUA 2DR0A 3O4GA 1E5TA 4RNCA 1HDEA 4X94A 2XUAA 5EHZA 3D7RA 5JD6A 4X97A 1A88A 1JMYA 3C5VA 5K3BA 5SYNA 2O7RA 1B41A 1E8NA 1JU3A 4G4JA 5AIBA 5CH8A 3VKFA 3PI6A 3CN7A 1GKLA 2XI4A 2WUGA 1UK6A 2WFLA 4BCBA 2WIKA 2VT6A 2LIPA 2VAVA 1HBJA 1TKRA 4BYMA 1R88A 4Q1VA 2AJ8A 1LPAB 2WUDA 3IB3A 1IZ8A 3I2IA 3FYUB 4G4GA 5ALJA 4DM7A 3PDCA 4NS4A 1WB6A 3G9TA 2C7BA 4AMZA 1F0NA 4K6HA 4FLFA 1HKHA 5JARA 1AZWA 4J0DA 3DL7A 1LPSA 3NUZA 5HQ3B 1KU0A 1BN6A 4IQ4A 4LHEA 4YASA 5ALVA 3VJKA 4L9AA 2ZVDA 5LZ5A 4AB1A 4UHEA 4BC0A 5EIHA 4KJXA 1QLWA 1Z68A 5BWBA 1AGYA 3C43A 3V1NA 4QDTA 4EY5A 1Y37A 1LNSA 1EVEA 3R41A 3W05A 1YSCA 3YASA 3TJMA 3A6ZA 3R3YA 4U2EA 4W1PA 4BB0A 3TRDA 5LZ2A 3KXPA 3R3WA 4HZGA 2GBFA 4GI1A 5I9IA 1E8DA 3LLCA 2ROQA 3ZLTA 4WY8A 2BCEA 1JT2A 3OG9A 4DIUA 1JKMA 4UBLA 2PL5A 5AOBA 1G4HA 4QWWA 4UFNA 4WFIA 4KAAA 1CUGA 5ALTA 2XQKA 5ALQA 1YAJA 4P92A 2JGFA 5AI9A 2WIGA 1DQZA 5LKAA 1XRLA 1L7RA 5JAOA 4HRYA 4N8DA 4AN0A 4B82A 2QOEA 2Z8XA 4K6GA 5HF8A 5IVDA 2HFKA 4YK7A 2HL6A 3WL7A 4U2CA 2QUBA 5AM3A 4BAZA 4HS9A 3WWDA 1ODCA 1BEZA 3W9BA 3I1YA 1BRTA 1LPOA 3G8YA 3V9AA 3WWEA 3BXPA 4DLNA 1ACJA 4A16A 5ALHA 2OQVA 1EDDA 4Y2UA 4CCWA 4WY5A 3DYVA 3D59A 1CUVA 3STXA 3C6ZA 3DS8A 3C6XA 2WJ3A 1J06A 5AH0A 4H7HA 1IMJA 2JGJA 1MAHA 2J4CA 5EIAA 1CUEA 1F0PA 3ESAA 3WK6A 4CIBA 3H2KA 3FCXA 2VEOA 3DCNA 2JBWA 2ZJFA 5FV4A 1ZGCA 4KRXA 1QJ4A 3WIBA 5ALLA 3VXKA 1QIEA 2Y1KA 3E0XA 2ZSIA 3H2IA 5T4BA 4BBZA 1EDBA 1LBTA 4GWLA 3C87A 5ALRA 2GYWA 5AKYA 1USWA 3RARA 2PKYX 4UUQA 1OCEA 4MWSA 2WLSA 2BJHA 1ORVA 1BCSA 1QOZA 5ALZA 3ZPXA 1FFBA 5E4YA 5LYYA 3HACA 4WJLA 3U0VA 3ICVA 4Q82A 4W1SA 1SCQA 5AI6A 4J0CA 2ONCA 3PFBA 4JUIA 3R3UA 1F8UA 5DYWA 3VVLA 1CUAA 2ZSHA 2HIHA 4Y2TA 4X3CA 2V98A 4EA6A 4LIPD 1EA5A 1YS2X 4N5HX 1MX1A 3H04A 3ILSA 1SC9A 3ZLUA 5FKJA 3KWJA 5AM5A 4LXIA 3B12A 5ALIA 2ZYSA 2QVBA 3STYA 2CB9A 2WIFA 2WG1A 4MEBA 5A7HA 1ORWA 2ACEA 4FMPA 3PF9A 1LZKA 1ZI6A 1LPBB 4F0JA 5CH5A 4OU4A 1CQWA 5LKRA 4L0CA 2E3JA 4RPCA 5ESRA 3MUOA 1X70A 5C81A 1QIFA 4WDQA 4QZVA 3U1TA 4MQMA 1XRQA 2WU4A 2QR5A 4DGQA 2EDAA 4ETWA 5E4TA 1CLEA 4U2FA 4TVKA 3HSSA 5AI5A 3T4UA 4Q3KA 4EY6A 5SYMA 3E3AA 4DMKA 4P93A 4FKBA 2FJPA 3AJAA 4IH9A 3BIWA 5DYTA 3W06A 2GBCA 2PSDA 1TCCA 5AKZA 5FPPA 1A8SA 2WIJA 5C8ZA 3O0DA 3TEJA 4C4YA 2DCMA 1LPMA 4KR0A 1ZD2P 4KEAA 4Y7DA 4B80A 1XZBA 4UFOA 1FFDA 3C45A 4J03A 5FDFA 4S0XA 2C58A 4B83A 2ECFA 5LZ8A 3OTQA 2HHAA 4QE3A 3EQ8A 1XQXA 1EXWA 4Q3OA 1ETHA 4HVTA 5AKLA 4TPKA 4J0KA 4GEGA 2XUKA 4KRYA 3C8DA 1CFJA 4UHHA 3S2ZA 3I6MA 2PBLA 2WUFA 4FTWA 4QEKA 4CI9A 3C6YA 5DTJA 5KWJA 3IUMA 3AIOA 4JNCA 3O95A 2HADA 4BP8A 1EK2A 2QRUA 4UBMA 1C7JA 1W1IA 3LP5A 2OLEA 1EB8A 2Q0XA 4QNNA 3M82A 2B9VA 2VJBA 2DQZA 1HQDA 1K4YA 4JYMA 2GBIA 4K2AA 1MX5A 4GHWA 5LIPA 3P2MA 4X6YA 4ARAA 1LZLA 3HYSA 4M0FA 2VJAA 1ZOIA 3RKSA 3EQ7A 4OB7A 4C4ZA 1XRPA 2WSLA 5CT4A 3QZUA 4BTVA 4QLAA 3I6ZA 1HLGA 3OPMA 4PO3X 4GDMA 3KDAA 2DQYA 5FLKA 4V2IA 2VJCA 1UFOA 2WHPA 1QO9A 3FBWA 3FOBA 3S8YA 2ORYA 5IKXA 4FLMA 5ALPA 1UK8A 3Q0TA 2IITA 1UOQA 3EIOA 1CQZA 1QIDA 3WJ1A 3O4IA 2O2IA 3JYHA 4CCYB 1U8EA 1VA4A 4MWTA 5LP1A 1XLWA 2WG0A 3GELA 1G5FA 3QVMA 2QUAA 1TQHA 2Z5GA 3EQ9A 1SFRA 4EBBA 1BCRA 2K2QB 2WU3A 4CG3A 1K63A 5HK8A 1FFEA 5D3KA 2RI6A 4H35A 3FSGD 3RM3A 3AZOA 5EHNA 1E3QA 4AMYA 3DKRA 4DMFA 1CUDA 4LXGA 1XQWA 4P9NA 5DLPA 3FWHA 3GBSA 4X71A 3D3NA 1JJFA 2HA4A 2XUFA 4XJVA 5AJHA 4KE7A 1VA5A 1TCBA 1MU0A 3WJ2A 1AURA 4QDZA 5HKAA 1PJAA 2HA3A 1NU6A 3WK4A 4X93A 5LZ4A 3STTA 3V1MA 3WLAA 2BUAA 4DTCA 3L1HA 1DQYA 1VKHA 5CH3A 4TGLA 4EB0A 2WQZA 4N8SA 4OYYA 2ZYHA 5FOQA 3HLKA 4FNMA 1J2EA 5YASA 3AZQA 3D4LA 5BV7A 4J0HA 4OU5A 2VA9A 2WTNA 4ZRDA 1ZD4A 4Y9SA 1CUFA 1VOTA 4X7BA 4HAIA 4HRXA 2GZSA 1QIIA 1WB4A 4IO0A 3STUA 3V1KA 2VTVA 3MVEA 4QDUA 5ALGA 3HZOA 3O4HA 1ZICA 3ED1A 3HXKA 5D3ZA 3I2FA 1R50A 3BF8A 4W1QA 2VATA 2HU5A 3WKAA 3BF7A 2XQIA 1UZAA 2CZQA 5JAHA 3I2GA 5DNVA 1WPXA 2C0QA 1CUJA 2WJ4A 3WKEA 4DMHA 1DX4A 4A23A 1YS1X 1W76A 3ZLVA 1O6FA 2FX5A 4KE9A 1UKCA 4JEIA 5A6VA 1Q0RA 1XQVA 1XRRA 4EY8A 1CUHA 2PX6A 3WKCA 5KBYA 4INZA 5HF6A 3ANSA 3PUIA 4X6XA 2HU8A 1CUBA 4D9JA 2V96A 4IH4A 1VE7A 4ZV9A 5AI0A 3BIXA 4H7IA 3PUHA 4N5IX 2G63A 3G9ZA 2JEYA 2WHQA 3EF3A 1MT3A 1XZHA 2XMDA 1QIMA 3G9UA 5AOAA 3WWOA 4DNOA 3LIPA 2PVSA 3KD2A 1N5RA 3I6YA 2CUTA 5CRIA 5BWCA 5JZBA 3AIKA 3ESCA 4M0EA 2P8SA 1VZ3A 4PQEA 3HRHA 3D5EA 3V1LA 4WCVA 5JAPA 1ZD3A 3RLIA 5JZSA 5AKJA 5EFZA 4W1RA 2Y6VA 4PF1A 4W9RA 3H1BA 2G5PA 4UBJA 1A7UA 2O7VA 4FWBA 3WQHA 5KREA 2B4KA 1XZJA 2BAGA 1BN7A 4KAFA 5K3DA 4WFKA 1DWPA 4ZXFA 1E66A 1W52X 4CCYA 3I2KA 4OYLA 2C4HA 2WTMA 2OCIA 2PPLA 3IUNA 2FUKA 1VE6A 1XZMA 2VSQA 5ALYA 4G8CA 4PSCA 4KACA 3G0CA 2HM7A 2X76A 3IURA 2HA2A 3TGLA 3BDVA 4BATA 3B5EA 2XMBA 1UT6A 4BE9A 4E46A 1CIJA 2H1IA 1SCIA 3UUFA 1JFRA 3A2LA 3FVTA 1J1IA 2OGTA 2I78A 2D5LA 5AK4A 1N5MA 3SX4A 4OCZA 1IUNA 3AZPA 3WL6A 1ZGBA 3AINA 3PE6A 4A5SA 5HQ3A 3WYDA 5C8VA 4BC1A 3H2JA 4J0JA 1XZEA 2BFNA 4H7DA 3VJLA 4BVLA 4OUKX 4IH1A 5ALKA 1ISPA 2WFLB 3W9UA 2Z3ZA 2ACKA 5AI4A 1DU4A 3FVRA 4AO6A 4FFVA 3LCRA 4B0OA 4GLBA 2WG2A 2RHWA 1MTZA 2AJLI 1DWOA 5HF9A 3IIIA 4QLOA 1XZKA 5AM1A 5HK9A 1JI3A 2HU7A 4UBNA 1XQYA 1NX9A 4Y2RA 3DOIA 2QTBA 5K3FB 3R40A 4G5XA 4AX4A 1LPNA 2XUDA 2Z8ZA 5FRDA 4DNQA 4G8BA 1TRHA 1WPRA 5CXXA 2BKLA 2G5TA 4YX9A 4N8EA 2CJPA 3R0VA 2Z3WA 5E4JA 3OM8A 1L7QA 4HTAA 3UUEA 4PW0A 4GBGA 2YXPX 4DSZA 5K3AA 2YYSA 2V9ZA 5AM0A 1QTRA 2GZRA 4K6KA 4C88A 4MQLA 3WA6A 1A8UA 4KYVA 3WWCA 2WIDA 4JH0A 5JADA 2JIDA 2OXEA 3DLTA 3NOXA 1ACLA 2JGIA 3VISA 3QMMA 1IZ7A 1R3DA 3I2JA 4ZI5A 2XQJA 3DOHA 3WKDA 1XZGA 4I19A 5IVHA 4FBLA 2J3DA 3F8SA 3L1JA 2XUIA 2J4FA 2H7XA 1G66A 4ITVA 1XZIA 2CBGA 2I03A 3M81A 3QITA 4BRZA 3OOSA 4Y2JA 3DDUA 1X2EA 3WKBA 4UBKA 5AKHA 1EK1A 3R3XA 4L3WA 4X92A 1QO7A 4M0MA 2PSHA 1WM1A 3JW8A 4H77A 2I3ZA 4B81A 4E14A 3R3VA 5C7YA 1XZFA 4FBMA 3BWXA 5ALDA 4J0GA 3VVMA 3FSGA 1QGED 3G0DA 1NU8A 4E15A 1CUSA 5ISMA 4MYSA 5A7FA 3M3DA 4UHCA 4LYEA 3QMWA 4C4XA 1N1MA 1R9NA 3K9BA 1JU4A 4X95A 5EGNA 3CCCA 1H23A 2AXEA 2XB6A 1XKLA 5FXMA 2VJDA 4JYPA 5AHXA 5T4FA 3E4DA 1UOPA 4Y2PA 4ZWNA 4NVRA 2WUEA 1EI9A 4OSEA 3WIOA 4BE4A 5CT6A 2H9YA 1N8SA 4G8DA 3WYNA 2ZJ7A 3D2CA 4UHDA 3WL8A 5JAUA 3A70A 3G7NA 1YAHA 2I3DA 3UMJA 3AIMA 4NMWA 5ALOA 5A71A 5T4HA 4H0CA 2DHCA 5CBKA 2YASA 3OC0A 3ANTA 3QPAA 2PSFA 2ZYIA 5ALEA 5JATA 1WHTA 2Y6UA 5KWIA 3FLBA 1UKBA 4H18A 4B9AA 2Y2UA 2XMZA 1XROA 5DNWA 4U2BA 6YASA 4G9GA 5DTIA 4E11A 5C8XA 1MNAA
chains in the Genus database with same CATH superfamily
3CCBA 4W6QA 5AUPB 2ZG6A 1P9RA 4QYXA 1ZR4A 3BT7A 1W4LA 4WN9B 1NT2A 2A9QA 4AO8A 2VCHA 3RDPA 3LXRA 4Q7LA 1Z07A 4DCJA 3QG5A 2PXXA 5F1KA 5LUBA 3OPYA 1WXIA 3DWEX 3OE7A 1T2NA 3CNEA 1JX6A 4DNPA 1CZOA 1A9RA 2SECE 3TS1A 3LI2A 2WMOB 2JFYA 2CB0A 2CFRA 3UMFA 4AUEA 3L7IA 1F6BA 5KSPA 3TOVA 2IF2A 3X0DA 4FDTA 4Y1RB 4IFTA 5T8KA 4B0PA 4EATA 2XLCA 5CG1A 4CM4B 1ONSA 1LNZA 2D8MA 2XJ4A 2H51A 3MJ4A 4FNOA 4HL6A 5AW7A 2V9PA 1TCUA 1E4EA 3BDAA 3LX4A 4MI9A 2W6IA 3FBGA 1CUZA 1D1SA 1M6WA 2RHOA 1J2YA 3I9MA 3O6VA 1ECLA 2FN4A 5DYNA 3OA2A 3SJ7A 3TJRA 5KTKA 4MQFA 3J7AC 4KGDA 1KU6A 1NW5A 1XWFA 5K8VA 4K6MA 1ZH6A 2ZIEA 4IBOA 5IAGA 2A0FA 3CRW1 3HKBA 2WMDA 1TFRA 3WA7A 3C5WP 3AB7A 5J1TB 3WMFA 1MXHA 1JBEA 3CE6A 3FJOA 5T3UA 4NBTA 2AUNA 5I48A 4EG3A 2IYQA 3MUNA 1Z56C 1J07A 2HC9A 1YOVB 2JGKA 4Q3CA 1HKUA 2HA7A 5CNIA 3T52A 1IH8A 3IP1A 1UWCA 4BQEA 4G2NA 5DASA 5CDSA 1YB6A 2JG3A 1K4KA 1E2GA 4DUZB 4ZTZB 3NRBA 1HZZC 1KFJB 1LD3A 1MO4A 3DQQA 4WLNA 1QZ3A 5CJPA 1DAIA 1GPMA 1I6MA 5EC8A 4DV5B 3OJ0A 4WHMA 5IXSA 4JOBA 2VTDA 5C7LO 2HLDD 4MQFB 3PBKA 3L02A 2Q2OA 4RK7A 3UUWA 3ZJYA 4FOPA 3I1IA 3NHPA 3O0TA 3HCAA 4N5DA 4WH0A 5B3JA 4LG1A 4QXPA 4XVHA 2JLYA 3ER6A 2E6KA 2R47A 4D0GA 1O4VA 2HF7A 2VKTA 1TC1A 3GPDG 5JSFA 1SOVA 1G0OA 1GAQA 1NXXA 5IDXA 3PEYA 4YMWA 5MF6A 2I4OA 3AR7A 3L6EA 4YGYA 4O02B 5D1NA 4LJ7A 5CURA 4LWOA 6REQA 5DNUA 3UAOA 5EXTA 1L7XA 1JTFA 2NXCA 4D9NA 4CMKA 3I9V1 1E94E 1AZTA 1Z8HA 1KSFX 4QUHA 4D02A 1Z5ZA 4E5SA 2QLNA 1VBFA 2H48A 3X43A 2WF5A 4G1UC 3HCEA 3I8XA 4J43A 1ZH2A 2XEDA 4Y2VA 4GECA 1CB7A 3VKUA 1YU9A 4JIGA 3AFMA 4AKSA 3LPMA 1OB2A 3DCYA 5ELMA 1ZN9A 2G9RA 4HDRB 2XZLA 1SG0A 1TVCA 3B3AA 1NJ1A 3FSJX 3ITKA 3L8EA 1R9GA 2XMRA 1TYDE 4IIJF 1N1GA 2Z58A 1I4OA 2BEUA 4IG4A 4MQ4A 4QYMA 3P2JA 5TV2A 1SELA 5G2OA 1HLPA 1Q1AA 4H6PA 1JEYA 4FS3A 2QX4A 2R25B 2GF0A 2O2EA 2PU7A 4ZO9A 1PR4A 3EXFB 1Q17A 4M89A 4LRXA 3TNYA 5IH7A 3A2MA 1LA2A 3C7CB 4KDFA 2XYQA 3TKAA 3TGPA 1MDBA 4FBGA 1XZCA 3ND6A 4R2XA 1TF2A 3GGCA 4BV8A 2JEOA 1FS6A 5AR1A 4PG4A 4YRQA 4OLBA 2JI6A 1ZGGA 1JDVA 2FWMX 3VGPA 3OFSA 3VHQA 2H11A 3ZKAA 1YMUA 2COUA 3N8GA 4HMQA 7MDHA 3W7AA 4NBUA 1P75A 3PT9A 4W9NC 1CK4A 1A04A 1SPBS 3U7JA 3HB9A 5KMGA 2IH5A 4XVUA 2G9ZA 1PV4A 3T0FA 4GLLA 1D04A 2ZWVA 4WDRA 4KQCA 3N3AC 3QYPA 4ZK6A 5LC1A 4IPTA 5CDHA 1SQ6A 3FLEA 4NONA 3WGIA 2WJ6A 1NV9A 3DMTA 3JQGA 1I3OA 4RDHA 3FDIA 2AYZA 3DFMA 3OZSA 5PNTA 3U31A 4CF4A 5JY6A 2ATEA 1MGPA 2VDWA 2RDMA 2VXYA 4LRUA 1XMPA 3RIHA 3EZ7A 3P0RA 2J9ZB 4F6CA 2J31A 4J76A 1IY0A 3OLXA 2Q1TA 3K5IA 2HDNB 1IBRA 1GG8A 3OM9A 5IMSA 1SCUA 2ZPUA 4C76A 1I1NA 1JLHA 1RXUA 1KBZA 1WCYA 3JV7A 4HXEB 4ATNA 1CR1A 2ZXFA 3GRCA 4LJSA 3W4KA 4M0DA 4F5ZA 1ST3A 2JVKA 4PSUA 2XNKA 4BFXA 1U7HA 1J5EB 1Q83A 3ZWBA 3LKZA 4DV0B 3PUWA 1PWYE 4FOTA 4XIYA 3U16A 2EFJA 4NXNB 4P80A 5F23A 1CUWA 4MW6A 3MBIA 4MKIA 1MDFA 1NXQA 5EWJB 4Y2XA 3ZQKA 3JYOA 1YTLA 5EKDA 4P08A 5F1PA 4O1MA 1DINA 2WHPB 4M0CA 5CXSA 2H4XA 2NU9A 1L9KA 2P3SA 1RWWA 2DWCA 2OFOA 5JNWA 1LDMA 2J5KA 2J09A 3AEUA 3FZYA 2PXHA 1T0IA 1SGWA 1ZQ1A 2XOEA 4D9EA 2EW1A 1RZRD 4M49A 4QX6A 2E4YA 1UMBB 3PCTA 4M7RA 1IHUA 1A5BB 1GPYA 1QFMA 5IVIA 1N3YA 2GPWA 1PG5A 3MT9A 4X92A 2WUVA 3TRKA 3GZTB 2R4UA 2GEFA 4Q19A 4YV7A 4EMTA 1T2CA 1J0CA 1L5RA 5DLYA 3ZDFA 2Q2QA 4MAAA 5CFNA 1H1LA 4JFAA 3NM6B 1QHEA 4ND6A 4F21A 2WF8A 1BMFD 4OPMA 1NOIA 1RI4A 2D0IA 2G7MC 3KHTA 4RTOA 3BTSA 3C3CA 1R6BX 2B8TA 3OMWA 3JVIA 3NTVA 3QKSA 1DJNA 4IGEA 7ABPA 3U09A 1HYBA 2BHRA 3KQQA 4UU7A 1YRBA 3PXCX 1QFSA 4IEFB 3SHWA 1WW3A 1V3QE 2R8BA 4G1BA 3KBOA 3VUEA 3IOYA 1WZNA 5CM8B 5BNFA 3RRZA 4AKEA 1IXZA 3L8HA 1NPTO 2P6RA 4LNUB 1XLTC 2PBFA 5JI3E 1YO6A 1QHIA 1C4KA 1FYVA 3L2OB 4H7EA 2CFTA 3MUEA 3HU2A 3QE4A 4IVPA 2NYVA 1XLUA 4GX5A 5IULC 4F11A 2PGLA 4ENQA 4EFDA 2PFGA 3MBOA 4TXNA 3G7UA 1DAGA 3DNPA 1F2DA 3NKLA 1DLJA 1G60A 1NLZA 3O8QA 4MWZA 3S2YA 2WWRA 3SYKA 1E2PA 1GAEO 5BYKA 5I7FA 1M1ZA 4PSAA 1UXJA 2WKWA 2X1MA 3HYLA 2ODAA 3EZLA 3RFVA 1MPXA 4G24A 4BCCA 1K5PA 4JN6B 1DX6A 2QE7A 2RAUA 2POCA 3D6AA 1WRBA 1BDMA 2GWHA 1T9GR 4IJ6A 2YYAA 4EG1A 4OG2A 3UMBA 1DCKA 4RK0A 2E21A 2YCLA 4URUR 1J99A 5TVKA 5DI9A 3TLXA 4RTQA 1KPHA 2J5BA 4GWGA 4W7IA 1IY9A 3LX6A 3JWEA 4J49A 4R0NA 5GVRA 4AG6A 2WHYA 3AP3A 4FEYA 4EQ6A 3IQGX 1QOPB 1GA1A 2ERYA 4IXTA 2AK2A 3WHLA 3JD4A 3N75A 3CB4A 3O9ZA 1SZCA 1WJGA 4GXNA 4V0QA 5L45A 2VYND 4JA0A 3TNDA 4K6CA 1QFXA 3G2PA 2R2AA 1DTSA 5H5JA 3UVEA 3U19A 2RIRA 3O8BA 2BKVA 4X45A 5LBTA 1RHJA 1XRJA 4C0BA 4JVNA 3TLKA 2JLWA 4OQLA 1RWNA 2PWAA 2XUZA 3R4VA 1NZDA 4BN5A 3DAHA 1ZONA 4IJWA 1UQRA 5AO9A 2BEKA 5F76A 1ELOA 2BDEA 4WK4B 2PDAA 2IEBA 3ADBA 1MIOA 3EGIA 4WINA 5LOVF 5FORA 1X1SA 5CVUA 3DFKA 3F67A 4Z0TA 3TM5A 2D3TA 3CH6A 3B13B 1NC3A 2XYVA 5IVKA 1RQXA 1U65A 3OZRA 4ZEVA 4LY6A 4RW0A 2BZ0A 4IQ0A 3VTFA 5JSHA 4IOMA 5HQTA 1N25A 4FWIB 2VJLA 3EVZA 3MN1A 1KGDA 3GY0A 3KZCA 4BV9A 3Q3GE 5BRJA 5EHXA 3WWZA 3X1YA 1JEOA 5FTMA 3BDIA 1GZ6A 4ISCA 1UL1X 3M6LA 3TQIA 2QIPA 3VHRA 5A06A 1B74A 5DXFA 5C8YB 3PFIA 1XEXA 2FLWA 3STWA 1KOLA 2CLDX 3ORHA 4EH1A 2W6ID 3TXYA 4XVQA 1P7CA 2I6GA 4F12A 1Y34E 1FYXA 4GPBA 5KTOA 1T4MA 1ZQ9A 4RGBA 1YOVA 4Z9YA 5JIBA 3R8XA 1G8KA 4X54A 1LK5A 1ODTC 1Z8FA 4LXUA 2JFNA 5DYYA 1U8FO 1I7NA 1W6UA 2OV8A 3AJEA 2YJ3A 5FFNA 3NHSA 3IXQA 4D25A 5JECA 3UGKA 2HX1A 3K1AA 4TKMA 2IE8A 1N9ZA 2YL2A 2ESRA 1F5NA 4KGXA 2PPVA 3CE9A 4OL9A 3ZI0A 3OURA 1AA9A 1XZQA 4FUQA 5EA2A 1WLSA 4NZZA 3WLQA 3EPHA 1OXSC 3K0KA 4GMGA 4XCXA 1XBTA 4TTSA 4CQLB 3G79A 3VVCA 3ZIDA 4K7JA 1NWCA 4AM8A 3BGOS 4L5IA 3A1EA 5TJHA 4XLTA 1GZ7A 1U2QA 3RYCB 5K4AA 1ODJA 3S2SA 4ZVSA 2YN2A 2W71A 4MJ7A 4Z4EA 1AC5A 2UYCA 1DFHA 2F1RA 4JDPA 1NMZA 2VFAA 1QO0A 4BVFA 2C2HA 3GGSA 3KYCA 1JLLA 3MCUA 4Z5XA 2FUNB 2VH2A 3C6BA 1Z6YA 2I8AA 4QATA 4Z2YA 3PUVA 4A5OA 2VUIB 4UTNA 3T1NA 1N34B 1GFIA 3DMTC 4JIMA 3WI7A 5BSWA 2C2ZA 1FNDA 2A1UB 2D5AA 2XMGA 3DOUA 1JLRA 3G8BA 3Q7IA 4NPCA 4NOLA 1LDYA 2R00C 4K2HA 2OY0A 3GN1A 2H7CA 4S2UA 4L4ZA 2ZYDA 3PD7A 3NH9A 4RV5A 1EA7A 3FDZB 5CIWA 1FRVA 1TO2E 4XFJA 2ZRLA 5IKMA 2IL1A 3IULA 2OM2A 1MTOA 2JD0A 1PJ2A 1S8FA 1XU9A 4DBLC 1NTOA 2VHYA 2R87A 4KI7A 4Q1AA 3TI7A 4BGUA 5CBPB 1FFAA 1NASA 4MR7B 5EKTA 1OASA 2XAUA 2YW2A 4JOQA 4LF5B 2YXEA 1H2RS 2D0OB 4KH1A 4MEJA 1KI1A 2I80A 4U3JA 2H4FA 3RKUA 1SM4A 3ABSB 3C15C 5DGXA 5C35A 3G5TA 1SIBE 3NGXA 4BZZA 4UKDA 7YASA 3KDSE 4RD4A 8GPBA 5MGNA 3PUKA 3SBDA 2OG1A 1OFUA 2PH1A 2BYTA 3L7NA 3OX2A 3KJIA 3MMPA 4I3HA 3UAXA 5HM6A 1HQCA 5ALFA 2JI9A 4R41A 3WYAA 4TUYF 2GSWA 5FP0A 4Q9JA 4TTVA 5KTTA 2PUHA 4HAVA 5MN4A 5CCXA 4Z1MD 4M0LA 1Z0DA 1BFDA 3P9PA 1C0LA 1NQ5A 3PJEA 4FGZA 4ZAYA 1KYIA 4YMUA 5IWCA 2GCEA 5CT9A 1P9WA 4PZAA 3AW9A 4H3SA 3PR2B 1J2RA 4R8KA 4MARA 2AOVA 4QUIA 1SBZA 1KKMA 4I9FA 3RS4A 2Y1OA 3F9RA 5ULLA 1IXYA 3W2FA 3IBSA 1OKKD 2PUJA 4XQ0A 4NE7A 2R4QA 2HOQA 2TS1A 3Q7EA 4AZ3A 4FNGA 3H0CA 4UVEA 2HHCA 3N3BC 3FIUA 3WRYA 4S24A 1BJTA 1YZYA 2IZ0A 2PM8A 4L27A 1Z2OX 3TMYA 1AMOA 4MWBA 2NPOA 3ESBA 3OHSX 3JQAB 1GSHA 4QBFA 3NAGA 3TIIA 3P4YA 3B82A 1SB9A 3H5VA 3WVNA 3OQNA 1QU2A 5A6SB 1I0IA 1FSSA 1V9LA 2BUCA 5G0TA 3R3ZA 3W1VA 3FA2A 4XWGA 2P6OA 4QPCA 1E0JA 1ZJJA 3KIPA 4C7JA 3O9MA 2NXJA 2PZLA 4ZMBA 3DT6A 6NULA 3KAQA 1IZYA 3F6SA 3COJA 4TMKA 3L1KA 1TB4A 4WKOA 4IRUB 1Z75A 3HA7A 3PKIA 3QEOA 4K26A 4NHEA 3TRJA 5KKNB 2W6OA 1KO8A 1GN9A 1JMKC 4DLVA 1MRSA 1C3JA 1NKTA 4OI4A 1P8JA 2QXTA 1ZUIA 2PD6A 4C3UA 1CP2A 1SZDA 4NYMQ 3KX2A 4B3TB 2YIDA 2YNMD 4ZVOA 5A9SA 1UBRS 1STOA 1SUIA 1ZI8A 3IO5A 4JODA 5ICSA 1DWQA 2AGVA 2E4AA 1US8B 3IDAA 1QYVA 1ZSVA 1TZKA 3OZBA 5JPIA 1PJ3A 1LC3A 4RL6A 2Q9CA 3Q7RA 2PGIA 2M6SA 4WZBE 3RS3A 5C9ZA 3JQFC 1J90A 3IOCA 3AXSA 5HRUA 2IHKA 3GFBA 1AHNA 3MELA 3IIEA 1J24A 3M5PA 4B73A 3K4QA 3WL3A 2C92A 4L8VA 3WYEA 1U7ZA 4UVGA 4MIKA 5DLDA 2V7XA 3NBFA 5JMWA 1OYVA 2R1VA 4UVDA 4KSBA 3EXAA 5CB4F 4KQKA 3T5BA 1G8YA 1QZZA 1H8ED 4RD3A 1OIVA 1YIDA 3WZLA 4K81B 5DK6A 3HJTA 3TZKA 4NR0A 1KBQA 3BZBA 1CRQA 4D4GA 5EUBA 4F9TA 1E6UA 4Q4AB 3KEGA 1RAEA 2FCRA 4TLMB 2P40A 1HYGA 4ZA2A 1M6YA 3T5TA 1GT6A 2VP3A 1Z34A 3ZOKA 5CG2A 4EHBA 4DIFA 3RO7A 2A67A 1EHIA 2GM5A 2I2XB 4PYRA 4F8YA 2FEOA 4Y98A 4M83A 4COOA 1NQOA 1OE0A 3S8MA 2JEZA 3R76A 4BBJA 1VFNA 5C46F 2MTBA 5DGDA 3JZAA 4NG5A 1RI3A 1XZDA 3K1YA 3BUSA 4BXOB 1WS6A 2B21A 5KVSA 1SKUA 2GPAA 5C5DA 1XU4A 3L82B 4FYMA 2YY6A 1FZTA 1Z5WA 2V8OA 4NK5A 4TTPA 3HJFA 1W46A 1RRCA 2IX3A 3IB6A 1I7DA 2VQ3A 3BXZA 1FFCA 5FWXB 2HYDA 3TW4A 5EMMA 4RTSA 4FQ7A 3UCFA 2NO0A 1E9SA 3M3HA 1DAEA 5FLYA 3UXYA 2OHJA 1FLAA 1YV9A 3H7AA 4A82A 4JC0A 3STVA 4FFSA 5EPEA 4V0SA 1EUQA 4NU5A 2IEYA 3PNMA 4YRBA 1KEZA 3ZDXB 1BS9A 1EWYA 4PZ0A 4M6WB 3UQYS 1UAYA 4XPIA 5H8WA 3Q4GA 1PT6A 1UOOA 1VGVA 3ROPA 1ZK4A 1ZL2A 2AE2A 2HBZA 4KLZA 3E9DA 1R8YA 4TLAA 5EYPB 1QKIA 4N0DA 1T3LA 2OKCA 5FBVB 2K7ZA 1E9FA 4OK5A 2ZJYA 2W83A 3CUUA 1RQPA 1TZ2A 1WDLA 3GR6A 3UA3A 4AF8A 2A58A 1ODFA 1CVLA 3TM4A 3CXUA 3TR6A 4OHFA 1R1DA 4MB2A 2QUJA 2OR3A 3H83A 3HJUA 5FWDA 2GCNA 1E0AA 3VC7A 1O94C 1G21B 5KDLA 4NZ9A 1WXDA 3JZMA 2C2GA 2DY1A 3QE0A 4KR9A 3WB1A 1W6RA 3C5EA 4G3XA 3UPDA 1H9AA 1AN9A 2ZJBA 2FMTA 1DOZA 1JHOA 2B20A 3BXOA 1Q84A 2G28A 1K6MA 4ONEA 5ADUS 2VC2B 3UWKA 1CUYA 2M6RA 3N5CA 3OQ1A 4QOHA 3S6JA 1GFWA 1VE3A 4FYIA 2PQ2A 1T24A 3CUKA 4B48A 1BQEA 2CKMA 2C5GA 2GO1A 2XMCA 4PCVA 4D0SA 2DC1A 4NCKA 4AQDA 1ZIDA 3OTOB 3NHFA 1YXMA 4UFPA 1TADA 2Q29A 4Q3LA 3H19A 1GGKA 2VPXA 1ZUNA 4WLOA 2NOAA 1NDQA 2JD1A 5AVSA 2QQGA 2GN6A 3BOSA 1NKVA 5AP9A 3G2HA 2PQ6A 4KOAA 4RWZA 4MA0A 1BCRB 2PWPA 3AESB 5JAQA 2JJ8A 3V8NA 4A8PA 1NLMA 4M8IA 1R0YA 5TQJA 5KNBD 4TLEA 3PDIB 5LP6C 3B8EA 2X1HA 3D4BA 2AW5A 1VG1A 4G36A 2CUZA 4XEUA 4B45A 3RU7A 3FZNA 3TQCA 1WX1A 3GMDA 4B2PA 4DPMA 2AE1A 3Q9LA 4F3CA 4I1PA 3MD0A 5HOEA 2IIVA 3UBTA 1CQIA 1Z39A 3I28A 3SZLA 3ESYA 1NNEA 4Z53A 2AFIA 3MS4A 4E12A 1YT5A 1X80A 1AUXA 1XQ6A 2YS6A 3QH4A 4HNGA 4YBZA 1GTZA 1Y3FE 2O3TA 4B7ZA 3RLFA 1BKSB 1V4BA 2YVKA 1TD1A 3A2NA 2YWFA 4V3CA 1L3BA 1KKLA 2BBWA 1G98A 2WOJA 1EWRA 3T41A 2ZATA 4GU5A 5CAEB 2WQ7A 1N6HA 2YV5A 3ETJA 4WNAA 1QONA 2B8JA 3AFHA 1IY2A 1KR5A 1RBZA 3OM0A 3LSTA 4LWQA 3NETA 4AZ0B 2BT4A 4YPVA 1X1CA 4FS8A 4RVCA 3GG2A 1TA9A 4ITUA 1A8QA 4DJDC 5I7UA 2ISCA 1XA4A 3EODA 2CDBA 4M98A 1JHVA 4HX9A 1CDEA 2CL6X 2VXCA 3LSYA 4R5MA 3RREA 3VSBA 4YCSA 3F4LA 4XJTA 1FS5A 2ACVA 4C05A 2X40A 1JH8A 4A6XA 4CR8A 2HMSA 3VR6D 3W2TA 2B4AA 1VJ1A 3IAAA 3IDSA 2ADMA 1M6VB 1IB6A 1GRVA 1SVSA 3W4JA 3TCXB 1F8XA 3ZE2B 1UXIA 3INRA 3N8NA 3PEEA 2AR0A 3BB4A 4KIFA 4M9XA 3TW6A 4AXBA 4TQ9A 4CT5A 1RLMA 5CYOA 2WTXA 1L5HB 3LDAA 5AKKA 5HMLA 1LRLA 4A3SA 4CV3A 5KJ6A 1VJGA 1RPZA 1H5QA 2HRQA 2E55A 3ZHUA 2ZSUA 1WMBA 3H5AA 3ABIA 3SFTA 5JYCA 2AFVA 3JAKB 4XE5A 2ONKA 3WGKA 2Z5FA 1N4DA 4EELA 1DS6A 1TEXA 3H11B 3B6IA 2FEKA 1YCFA 3P9ZA 2QY6A 3V2HA 1UDRA 3CLRD 3D1VA 1B0PA 1MAVA 3B3FA 3COZA 4J7UA 4LECA 4ZJPA 4Z4GA 2FK8A 4Y18A 4PVDA 4YMSA 5ESXA 2RKOA 5FTKA 3DT8A 2ZI7A 1YUBA 3T61A 3OQMA 3OKPA 4B6RA 4BBAA 4CNBA 3BGSA 4PZUA 2DWPA 1C7IA 1W4AA 2ADOA 3LDGA 4Z1MA 4DBVO 2PVCA 1V9SA 3LUKA 1I6WA 3E9YA 4XDGA 3X2FA 2GTPA 2PN1A 1P9NA 3BTUA 4RVHA 4TSRA 4ER6A 3ISVA 1NW6A 5HJ7A 4NYIQ 4RHYA 3O5AA 1MQSA 4WEOA 1V1JA 5CA1B 5DN6A 1P80A 5DOVA 4RLHA 1T1SA 1C1DA 2G67A 2V1XA 2W6PA 3L1VA 4Y9RA 3QYJA 3ROKA 4DQUA 3HEAA 3WNQA 3F78A 3CZPA 4MUGA 4K9RA 1Q1ZA 4DZZA 1WXGA 4KC0A 2P30A 4QOEA 4DNFA 2DETA 3KAPA 3R7LA 4Y2QA 4C5AA 4PFJA 4UQLA 3GF4A 5JVDF 5C8DA 4G0PA 1K7XB 4LRWA 1KE2A 3UO8B 4II3A 2M1XA 4B4OA 3OP1A 3KG2A 2X5XA 2YOFA 3N07A 2BRUA 5KVCA 3C6QA 5EXPA 2IXTA 1CFZA 3JQPA 1FNNA 1MENA 2HXSA 4PLFA 4TL8A 1S2DA 3BGWA 3AT1A 3H5LA 3KELA 4F46A 3W9YA 3QFFA 3M5WA 3L8YA 3RSGA 3VR5H 5IASA 2FLKA 4M1WA 3L49A 1R4ZA 5E1BA 1EWQA 2EZ9A 2R65A 3AI7A 3JASA 1E2HA 1WXHA 2P2SA 4WOBA 1JSXA 4HNRA 2APJA 4M7PA 1GZDA 5DF1A 4YONB 4A26A 1T2FA 2H1OA 3LT5A 5L3QB 3Q2KA 2X9QA 4M0PA 3KAKA 4ZGBA 2FOXA 2PAAA 1QHNA 4DJFC 2CMDA 2Z5VA 4CMHA 3FZEA 1XVIA 4FN4A 2H4HA 1TFUA 2FWPA 3WYCA 3LBIA 4LWZA 5I7AA 3M5CA 1KQGA 1Z38A 3E53A 5ARCA 4BO7A 1PQUA 2HB6A 4MQBA 2LGJA 4RFSA 1XRMA 3R3SA 1DRWA 1TK3A 3PA8A 3W5DA 2Y2VA 1M2GA 4HXFB 5HTOA 1BH2A 5CVJA 3U7EB 1P8AA 2TECE 3FIJA 2Z9BA 2R60A 4DDKA 4UHFA 3GT0A 5B1YA 4CM8B 3VNRA 4TWZA 2OZEA 5FUXA 3ZVLA 5DO9A 4OBBA 1BZYA 5HGJA 2KE5A 4J0IA 2ZAGA 3HI4A 5ECDA 2QSYA 4PZLA 5EE0A 3X3HA 1TUGA 4NYJQ 1ZMXA 3L0DA 2WILA 1TF7A 3B3GA 3BK2A 4LE0A 3VUFA 2G8LA 4XWOA 1OIXA 1SHTX 1YKGA 3QX7A 5KI6A 4P4SA 3TSCA 2BGMA 1TYZA 3V4FA 1P0PA 3CTPA 1IXSB 3L77A 1QF7A 2IUEA 1P5HA 3DVAA 4LBWA 4M3NA 2DUNA 4MMZB 3IBFA 4RV9A 3A37A 3FTQA 1NC1A 4NATA 2DMRA 1QIKA 4ZAWA 4HR7A 4R2KA 3HRKA 4UE6A 5KYUA 1ZSYA 3RADC 1KQFA 1XNRB 1FMCA 4HH1A 4MGZR 4JI0B 2ZUEA 1A3CA 3JALA 3KK0A 4PX3A 1PTKA 5AJUA 5FPSA 4F6RA 3LQFA 1S9HA 4M76B 2XQFA 2A1IA 1L7AA 1MO6A 2UVDA 3OTGA 1NF8A 1KOFA 4BZWA 1RE0A 5EKUA 5JMTA 1UK7A 2XOKA 4CYMA 1TYAE 1JG1A 3E9NA 3FFTA 2ZIXA 1KS9A 2Q0QA 4D26A 4A36A 1WXXA 4UEKA 3CPEA 1H8HA 3PG5A 5TDHA 2DX7A 3T3HA 3PC4A 4RNCA 3T1QA 3RVJA 5HA5A 1UUFA 5TPWB 1MOQA 4C08A 5AVYA 3A3PA 3MB5A 4IF6A 4AIRA 5JD6A 3PZRA 2EFCB 4N41A 3P27A 3F6RA 1W5TA 4KWTA 4R9VA 1H6AA 2X8JB 2Y1EA 5FA8A 2GBPA 1R7RA 2QRGA 3J7TA 5LLDA 4K8RB 1YZNA 2IOYA 2NADA 3COWA 1PFYA 1UQTA 4FMDF 4NYJR 2H57A 5FBRB 5LMZA 1JU3A 1O03A 1JALA 3D8RA 4LNHA 1ZR2A 5B30A 1QHSA 4L73A 5CH8A 3SIPA 4EUNA 2YCBA 3OCYA 3VKFA 2MSKA 2QRZA 2H2GA 1L1FA 1GYPA 4J6FA 1DO2A 1K8XB 1QGUB 3VI3B 2VPWA 1GRCA 1KVSA 8ATCA 4URXR 3PI6A 1JE0A 2Z2JA 5FTWA 4PZ9A 1NW9B 3BE4A 4FGLA 4HD8A 5ADVA 3NV7A 1IVSA 4ZQHA 1GKLA 3L6UA 5TMEA 1JECA 1U7WA 2WUGA 4A73A 4EA9A 1CZKA 1R64A 1PVVA 3HNOA 4DIBA 3QNMA 2KBEA 4KIGA 1YCGA 3GBPA 3ZU2A 5E3HA 1JG6A 1VDZA 4NJEB 2FZKA 1AKTA 4BCBA 2XVXA 1E2MA 2ZIZA 4BQPA 3TD9A 2LIPA 3LV8A 1YJXA 1E69A 5CK5A 4Z3KA 3KSAC 2XA1A 1HBJA 2D5IA 3PUYA 3DR3A 2X0FA 1TKRA 1ZM3A 2NVUA 4U0JA 3T1HB 1G5TA 1M54A 2BPOA 2YZNA 4DB2A 2O1EA 4GOKA 4JKYA 1NJSA 4B4KA 4LJRA 1U2DC 2CDNA 3MERA 1ACMA 2AJ8A 2QVYX 4LQLA 2WUDA 4ZOCA 4DLKA 4RAQA 2P9QA 2AWOA 5E6RA 1P2DA 3KOYA 3R5SA 4PNPA 3P19A 3W9SA 1Q6ZA 1X3SA 4MPJA 4FUTA 3WBBA 5TMPA 3H2YA 4XYLA 2WW8A 4QFBA 1T4CA 4CM4A 3F3KA 2R7NA 5JDIA 2ANBA 1PVOA 3RF6A 3OX1A 1T8SA 3ITDA 3OBBA 1IONA 1E4EB 2O14A 2QSUA 4JBLA 5G1OA 2OSVA 4KN9S 5LNK1 2EGUA 3HY3A 3TB6A 1LJLA 5IP5A 2XSZD 5HQ3B 3NUZA 4Z7JA 5HYVA 4X7PA 3FPGA 5CYPA 1NE7A 4XUEA 2H92A 1UDCA 5ALVA 1FCJA 4HGYA 3PHJA 3Q6NA 1CC1S 3KYIB 5EJ9A 1Y3DE 2XF2A 5I7VA 2MIIA 3AY3A 3M6UA 4XM0A 1Y5MA 3RJTA 4UHEA 1P2UA 3T3MB 4Q3EA 3CZ9A 3NHMA 4P3PA 3JQ7B 2QVZX 2ZQYA 4HGRA 4JZKA 5B1DA 1WL8A 1BHO1 3JYLA 1II8B 1AGYA 2IYWA 3C43A 2WA2A 5I5EA 3JX9A 3PQ2A 1HDGO 4BBPA 4EY5A 3GUYA 3IT1A 3M6FA 2DFKB 1JDPA 2EU8A 3HDVA 4INPA 3VSDA 1T9ZA 3IO3A 3W05A 3TVYA 3IR7A 1YSCA 4RHUA 4GXQA 4MUEA 1CP3A 4R3UC 1GGEA 4YRLA 4B5LA 1OA0A 1UC5B 4FYYA 3K0AB 1WPGA 4TSFA 1FEZA 1P18A 5EOVA 1P81A 3ULKA 1RXVA 1A8HA 2FEAA 1CG6A 4L4SA 4NBSA 4ZN6A 5JQGA 4L3VA 2CJWB 4IDBA 5KMGB 1D8TA 2MMCA 5LZ2A 1D6SA 4MCJA 4COKA 4QPJC 4RK6A 3H11A 4KUEA 5HZMA 2OENG 3BL5A 3DV0A 5EMJA 2GBFA 3FGZA 3X2SA 1CJUC 3P2YA 5AVRA 3HU5A 5A4MS 4D4KA 3QXJA 3RC9A 4D1YA 4RFLA 2GHRA 2ROQA 4OXKA 3RG2A 1HTTA 1X77A 4O25A 5COBA 4WY8A 4YRAA 3ETEA 3I92A 4GR5A 3DBVO 4WMLA 1RADA 5AJXA 1RZ3A 1BJRE 4L5CA 5E6SA 1PJLA 2NAPA 2GH1A 2CHQA 3HJHA 4LZZA 1G4HA 3IOMA 1R5JA 1L4LA 1Q3KA 2EG9A 1C41A 2NSLA 3EFEA 4WFIA 2IUFA 4KAAA 4UMDA 2OV4A 2B92A 3EC1A 3E4CA 3F2IA 3KOUA 5HCIA 3IPCA 4DA9A 2WSSD 1YQUA 2XQKA 4JJ8A 3GARA 1YAJA 4AJ1A 1DCTA 1Z6QA 2ZZNA 1GCIA 4NV1A 5BYJA 2CV2A 4UEOA 2JGFA 4Q16A 5AI9A 3DZFA 4YJ3A 5GOZA 1JAZA 3WGMA 1YFLA 4YUYA 4CLEA 4JQOA 4OF4A 4XWWA 3IHWA 1DQZA 1F1BA 2OZPA 3QK7A 1Q0QA 1QHGA 3T7TA 4BNNA 1XRLA 3TOZA 1SKBA 5COAA 1S3GA 4FEEA 4HRYA 4EX6A 5JAOA 2Z6UA 2CHEA 3S68A 16PKA 1L1EA 3HM9A 1SCBA 1E58A 1Y89A 4UAVA 1VLJA 5KHAA 5JLJA 4AJHA 3CX7A 2YHIB 2CWWA 1DEAA 1I0ZA 3ONEA 1WNFA 3BXGA 4RZIA 4HG2A 1ETUA 5E2BA 1TA4A 1U9IA 4O6VA 2Z8XA 3UJ6A 4IY1A 3WSVA 1SG9A 4K6GA 1Y3BE 4KV7A 4PLVA 3CLKA 2B4YA 5BV2P 1IPFA 4Q6BA 5ESDA 2XTAA 5HF8A 2A5FA 4P7BA 5IVDA 5E2AA 2HFKA 5BQOA 4BQSA 2B1RA 1B3RA 5FUYA 3B60A 1EMDA 5LOVA 2VRNA 4HBGA 3PX7A 3UQZA 1E2FA 5J2UF 1P2SA 3GGPA 3GN2A 4BJHB 4CM9D 1C8VB 1KXZA 1X39A 4EAQA 5B4VA 5J40A 4XI9A 4HS9A 4TMZA 3ANYB 3GCGA 3CLTD 1XD2B 3AU9A 3ZVKA 2G76A 2GK6A 5GMOA 4B6EA 5FOUA 2FG5A 2JJYA 4YDQA 3W9BA 5EN4A 4CM8A 3EVDA 4M7WA 1IN7A 1XVVA 3IJEB 1A2OA 4V24A 3IIMA 3JRNA 3K1ZA 2H31A 1OLSB 3FW1A 3KE9A 1CEEA 2OLKA 1PTJA 1Y1KE 2HMVA 1Q21A 3V2UA 3W8NA 3V9AA 2OO5A 1F48A 2P75A 1W5BA 2QRVB 3LQRA 3WWEA 3GRVA 4CMIA 3BXPA 1K0FA 2HRBA 3DVAB 4F4CA 1S1MA 4XM1A 2GXAA 2CCGA 5LD2C 1P6QA 2R6JA 5C7IO 4URYR 1NTRA 3DB2A 5DCLA 4OREX 4H6WA 3DVLA 4E5UA 1GUBA 4JBXA 3WS7A 3KLNA 3SF0A 3U9TA 3USES 2WHXA 2XXAB 3QVLA 3RK0A 2HWXA 2RSLA 1Z6AA 5AVOA 4AZTA 1S0UA 1DAFA 1J7JA 3ZNNA 1L4YA 2Z2XA 1RWOA 1NR1A 2R96A 4DT1A 4G5GA 4I2VA 2QTWB 4GKAA 1FLNA 1XTIA 1J22A 1K08A 3DS8A 4P2GA 4M1MA 3CKKA 4C3VA 5G3ZA 3C6XA 4N4AA 5J58A 1J0BA 3DZIA 2AG0A 3WTCA 2V65A 2ZRQA 3D4OA 3L18A 5A02A 2OM6A 1Y9EA 1F0KA 1KMHB 2P1RA 2QTFA 3IX7A 1KI6A 4CN9A 3HP7A 2IJGX 3KZVA 3QWHA 2BV3A 2VDUE 4J0QA 4RJJA 1A4RA 2YY5A 2QX6A 3FCXA 3QKSB 3O3NB 3PJDA 2O0JA 3E61A 4LEIA 2QB5A 2E82A 4XQGA 5IDYA 2JBWA 2FNAA 3LVRE 4DV7B 5FV4A 4LC0A 4QT0A 2ZAIA 2ZRFA 3QENA 5CJJA 3QPWA 1Z6TA 4XDZA 1OWPA 3IP9A 3GLHE 3IV7A 3VXKA 1GNSA 1G7RA 3AG5A 3E0XA 4LJKA 1A1VA 1MIOB 3ZQJA 1P1JA 5FAXA 4AN4A 4BBZA 1T3TA 3J81k 4RTNA 3X1MA 2GK7A 1LBTA 4GZMA 3GJ4A 1RKXA 4MR8B 1Q92A 3C87A 9ABPA 5AKYA 5B4UA 3RARA 2FETA 1SVOA 5C37A 2WM8A 4MWSA 2VXOA 4NEGA 3C8UA 3RSFA 1VMIA 2H3HA 2BJHA 2C9BA 4KW7A 4HC4A 3FH0A 3K4PA 4CL2A 3ILVA 1ODIA 1AF4A 1XEWY 3LUPA 1FFBA 4IKOA 3E70C 3IIJA 4NWIA 1KH2A 1VL6A 1F6DA 2MYNA 4S1OA 4E08A 3IT2A 3EEBA 4FGKA 3EAGA 1DC7A 4IRMA 4C20A 4LFAB 1WPQA 4W1SA 2RGNA 2ZE7A 3PYMA 5GONA 1Q16A 1XK7A 3U49A 2QTGA 5K51A 5JJIA 1WBJB 2ONCA 4JUIA 2FX3A 2YV4A 1PR5A 3QUAA 4GQBA 4OBWA 4CW7A 3HYTA 3NTLA 2NU7A 5DBEX 2XMPA 5DYWA 1VI6A 2C7PA 1L5YA 1Y3IA 4XZ3A 2ZSHA 4J0FA 3KV3O 1Y80A 3AIIA 4PXYA 1NVGA 2HIHA 2OQ2A 3DDCA 3ZXSA 3SJBA 4DCCA 3S55A 3AF6A 4Y2TA 4HZIA 1OXKB 2EG5A 3GEPA 1MJFA 1N6OA 1EXNA 4LIPD 2YZMA 4R68A 4U7TB 4JP2A 4UDXX 4ZAGA 3U26A 3ZNQA 1EP1B 4C03A 1LVGA 2G09A 2DY0A 2OXCA 2WRZA 3TLBA 2Z2YA 4EG0A 3ZLUA 4YUAA 3ZYCA 4HGZA 4LHWA 3KWJA 2ZRIA 4GI5A 4LXIA 4UTXA 2EP8A 1JKFA 3KYCB 3QKRA 4NNPA 9GPBA 1ZGHA 4K8OA 2X8AA 1DXHA 3FG9A 4I1RA 1GUFA 4LRTB 2VQEB 1O0BA 3PJRA 4CLXA 4D74A 2BMAA 3ND8A 3ZBQA 3MUFA 1PQ4A 3GJ3A 3FOAA 4KNWA 4KXLA 3VJRA 2D2EA 2WIFA 2WG1A 2XWBF 4ENWA 4UPVA 1E63A 4MVJM 1PLJA 4RDCA 3S44A 3TOCA 4JJKA 2RH9B 4I5FA 5B7GA 1RJWA 3PF9A 3GLUA 3NYIA 5A4KA 2XBMA 4DB4A 3BVPA 3QI7A 1U3CA 4J6EA 1ZCZA 3LO5A 2CLMB 3TF5A 5LKRA 2QZJA 1SQ5A 5HIIA 3GOQA 3SBXA 4XR4A 1Y63A 1BHQ1 1BKYA 4RGQA 1HXHA 3L0YA 4RPCA 2MSDB 3PWZA 1XALA 1KZ6A 1T15A 5ESRA 5BUCA 5CB4B 4FGJA 2AA3A 3U6KA 3GMSA 1CJMA 1M2OB 3F3SA 1CRWG 2VPQA 4IQFA 5C81A 4F92B 3OIFA 2P9FA 4JU9A 1PCXA 2FPKA 2RGNC 4LV6A 1QGZA 2CE7A 1D0SA 1YD7A 3I72A 4IQGA 1Z6XA 2EW2A 2WYVA 4AC9A 4CQLA 4MQMA 1NR5A 1XRQA 1ZUWA 2E6UX 2PKEA 1Z5PA 1TO6A 4AJLA 3QUBA 1V8OA 1VL2A 4IIDA 1BMDA 1VCMA 1N2BA 2FFBA 3HSSA 1W5EA 5BR4A 3LUGA 2A78A 1WQ1R 1O8BA 4Q3KA 3GJTA 3COPA 4UEQA 2IU0A 1D5CA 3E3AA 3S5JA 3RNOA 1YGPA 2J6HA 2FJPA 3DBRB 1I9GA 3RAFC 1G20E 3BIWA 2DPGA 1OC4A 1NUUA 4QJBA 1NMQA 3LT1A 2ZDGA 5LVAA 3JQQA 3ZD6A 2O8EA 2JLXA 2PSDA 4LOKA 1DXOA 2QQEA 4AZWA 1PW5A 4Q15A 5K99A 1I1OA 3L7CA 3R6DA 4W4TA 5FPPA 4M9QA 1A8SA 2QT0A 4GP9A 4OJMX 4QYIA 5C8ZA 1FJGB 1RM0A 1SUCA 3SR4A 3BRQA 2DCMA 2IEDA 1H85A 2WAAA 1LPMA 3HUFA 3LOUA 4PINA 1YZ3A 4KEAA 4QTTB 1TKAA 1NG1A 4IJ5A 3NUQA 2HZ7A 3FLMA 3M89A 4Y7DA 3SG0A 2F90A 3FCSB 2FMKA 1XZBA 2X15A 1IWPB 5F3RA 3TTWA 4PGMA 2F3RA 2JH9A 3FF1A 3OQPA 3SHVA 4BNJA 2F4VB 2B0JA 2YRWA 1LJ8A 1RXWA 2A33A 2C2YA 1UFVA 3KT0A 3KUXA 4NBWA 1U90A 3RT1A 2VQSA 2J30A 2ZWOA 1E6EA 4Q0MA 4QE3A 7REQA 3FPAA 4ERNA 2AT1A 4DSOA 4AJNA 3I52A 4E51A 4DDWA 3RROA 2E9SA 3W8DA 3R1IA 1T5IA 5C8YF 1CY6A 5GPBA 3DLHA 4TYWA 2W98A 3FYSA 4KGVA 3IBCA 4XOIA 3IEUA 1UF9A 2NU8B 2I2DA 4DG8A 4RA9B 4GEGA 5F7ZA 4R2IA 2XUKA 3ID6C 1FP6A 3NHAA 3TKLA 5E38A 4A2CA 2JLQA 3Q1LA 1SKMA 3C8DA 3LCVB 3UHOA 3DAFA 2CNOA 4E3ZA 1ORTA 4IEEA 2PMEA 3I6MA 3HYNA 4MRMB 5BUZA 1Z36A 1Q0PA 4FTWA 4QEKA 3P9RA 1OTYA 4GM4A 4J94A 3RGWS 1W1WA 3KKLA 3M6AA 1NF3A 4JNCA 2QUZA 2O4CA 4PO1A 3SYLA 5CDYA 1FYFA 4UBMA 1EUZA 3OD5A 3RCBA 3V7WA 1ND6A 1W1IA 3B1VA 1VE1A 3CNOA 3IFSA 3LP5A 5TX7A 1GZ5A 2P9TA 1AU9A 4B3GA 4QNNA 2C77A 2VJBA 2O5RA 4CF7A 5HOQA 5EG5A 3FFBA 4W5WA 1S4QA 4G1EB 4G81A 1KZ9A 3ZZTA 3GQBB 4UDYX 4HVLA 3F5SA 3C3EA 4MRMA 1A69A 3RTEA 5EJ7A 1UEJA 3MCVA 3I39X 1ZX1A 4DKJA 1U6JA 3DTVA 1L7DA 2NXWA 3EISA 2J48A 2PUCA 1DPGA 1SUBA 2XZPA 1KDVA 4JI8B 4GS5A 2JFZA 1NATA 1J8VA 3NFRA 3ZYZA 2HZBA 4LISA 1IFXA 1EQUA 4O3MA 5ED4A 2NPIA 3RKSA 1UDBA 1W0CA 2J33A 4FHGA 1WVMA 3GMTA 2WSLA 4TRRA 2QGNA 5FL7A 1VJDA 3K0BA 5CLLA 3HSYA 1NURA 1IYZA 3TBFA 5B1HA 4QLAA 3GLVA 1GQ2A 2YZ2A 4ZI3A 4M8NE 3R7BA 3I30X 3UEOA 3ZJVA 1O5OA 2MSNA 3GGOA 3GUHA 1JDZA 4WX2B 3TNLA 3KVVA 1D09A 2VLBA 2BZSA 4GDMA 3QSYA 1E2UA 3EZYA 5HR5A 2DQYA 2YOGA 5K2OA 1FQJA 1Y6FA 2CNWD 1QRTA 3KWLA 2C97A 3KVOA 4CIWA 1IEWA 2HSZA 2IELA 4L4YA 4MVJE 3S8YA 2HQBA 3OF2A 3ECSA 4H0FA 1KFKB 1EFDN 2EQAA 4GRIA 4J1SA 3VR4D 2OEPA 2EJVA 4UHJA 3VR5D 3Q0TA 1LCIA 2I9KA 2IITA 2PEZA 2XE8A 1JQAA 2W37A 5AW6A 5KYKA 2O8BA 1M6NA 1SVLA 2SKCA 1C9KA 1CQZA 1SNYA 3AO0B 3ZCRA 2CHFA 4CM3A 1ONOA 2WWWA 3W3AA 1U8EA 3H1PA 3N7TA 3LXUX 3Q8KA 1V8PA 2E4WA 1NVKA 1EPUA 1U11A 3LFUA 2QN7A 2Y67A 5EERA 2OZKA 4G0XA 2WG0A 1UBKS 2CVZA 1G5FA 1U7TA 2QUAA 4LVUA 1UBJS 4QSHA 5CYFA 5FPHA 4IIHA 5FYQA 4HNTA 1CXZA 4O2AA 4RKYA 4M1TA 4GMFA 3F5QA 3VGJA 5JJLA 4ODIA 3BMNB 2OBNA 1SFRA 3ICCA 4PAWA 4QVGA 2GKOA 1VP9A 1FFGA 4UCFA 5EPOA 1RJFA 3KPUA 4ZIRB 5K0CA 3L8ZA 4MRAA 1BCRA 1UPTA 4KIUA 4ZVRA 5BXQC 4WNCA 4N6OA 2K2QB 4QBIA 3DWFA 4R2WA 3SHTA 2GHQA 4XPIB 3VPXA 5DNEA 2RHBA 1QNFA 4UUBA 5BR1A 1K63A 2J6CA 3NIBA 3CZ4A 3AC0A 4D8XA 2ZM5A 3FSGD 1JIXA 3AZOA 1FL9A 1WV1A 3LT0A 4G5FA 4YUZA 1E3QA 4QJ4A 4XIFA 3DKRA 3HKDB 4TQGA 4AMYA 3IC5A 4DMFA 2JCGA 3ZKWB 2IYOA 2QLFA 5DZSA 1S3FA 2FG7C 3DV2A 4X71A 5IDVA 3W8EA 3IMCA 4DC9A 4DWJA 1JJFA 2VNJA 3TZCA 4ABTA 2I22A 5AJHA 1Z74A 1VCNA 1X7WA 2O7NA 1VA5A 1TRKA 1PRYA 2BMWA 1KAHA 4IO1A 4EW2A 1TCBA 3HJCA 4EYSA 2JB9A 3GUCA 4PC6A 5F7XA 2OCXA 2OMKA 3EAQA 2ZRBA 3HJBA 3KZXA 2X0DA 3TE6A 1L4FA 3WGTA 1ZD8A 4QOFA 4ZU6X 4X1OA 2ID9A 3ZS8A 1C7RA 1IZ0A 1Q57A 2E48A 2OOKA 4BLTA 4EYKA 2JGDB 3MGGA 1G8HA 2CD9A 3ACDA 1KVUA 5ES3A 3SLRA 3SOPA 3HKDA 4IFIA 4CGYA 5L3VA 4IUCS 2HD4A 1FRQA 1RI2A 4LQ4A 5CYGA 4DVGA 1E3LA 1MB4A 3L07A 3GLSA 5LXTF 1ZBQA 2PJDA 3EBOA 4M1EA 4BX9A 2PS3A 1Z5OA 1VHTA 5ETJA 2E18A 4NX2A 3STTA 5AVTA 3OMXA 2VK4A 1FW8A 1ZH4A 2C4NA 1DADA 2C00A 4QUKA 5K20A 1DQYA 3C3PA 3L4EA 4AYTA 2LNDA 3NDPA 1U31A 3MRXA 4EM6A 1C7FA 4B74A 2CXTA 4KMSA 4KH0A 3RC1A 4BNMA 2JW5A 2HWWA 2VN8A 5YASA 2D2VA 3VZSA 4CG0A 1YDWA 1XCOA 5CLGA 5E7IA 1Z8DA 5AWFC 3TAUA 2WVAA 4MW9A 2XHZA 5HKKA 2XWPA 1PLKA 5CCBA 1BW9A 1Q2XA 1GR0A 4Y6PA 1AUVA 1TM3E 3ZTTA 4OIMA 3M6VA 3DQPA 3C1AA 5AQ1A 1U9ZA 1Q15A 2GZSA 3SF8B 1GU7A 4RESA 2VTVA 1TJ3A 2NUPB 4OAOA 3WGQA 5LLTA 4NE2A 1F3OA 2FFJA 5IHXA 2A5LA 1HDIA 2H1CA 5DRTA 3K1AB 2M98A 2F9LA 4Q24A 4NE9A 4TMYA 4DE5A 3O4HA 4MDEA 421PA 4TXHA 4GG1A 3LL7A 1ZICA 2XE7A 2Q27A 2GFHA 4HAYA 3WFIA 4C7OA 1DI0A 3QFHA 4ND4A 1DARA 2QL6A 4MVJG 1MC4A 1KWKA 4W1QA 5JNLA 1CNMA 2HU5A 2B1QA 3WHKA 3WKAA 1UZUA 1RP7A 2JKZA 2XQIA 4MPRA 3TL3A 2CZQA 5GTDA 2W43A 1U3WA 3BQNB 1GSIA 3I2GA 1NHGA 3QVGB 4FX5A 3B89A 2J3HA 4EDFA 4CBVA 4DDMA 3NS7A 4GMDA 1FVHA 3WQBA 3T3NA 2AUMA 4IDGA 3K0EA 1KAQA 4MVJA 1TIPA 4BNTA 1TJ4A 4RFVA 3RW9A 1NBWB 3IV6A 4X7RA 4YJKA 5A4JA 3X1DA 1KDPA 3KHSA 5IBRA 5HKOA 3QXSA 5B6IA 3OM1A 4CT0A 3ZLVA 1SHJA 5JZMA 3R0JA 5E0KB 5G4LA 3HVRA 1O6FA 1YDFA 2O3RA 3N87A 3WQSB 2FX5A 4NU6A 4F4FA 1HRKA 1OPRA 1ZZEA 4BFVA 1F2UA 1JQJC 5A6VA 4BX3A 5HX7A 4RETA 2GFQA 1CCWA 1Q0RA 4MB6A 3T94A 2MOKA 4BL5A 3KC2A 1WB9A 4ESOA 1Q1BA 2WJVA 3LBHA 3U62A 3WYFA 3UFXA 1NBMD 3ZK7A 4NJOA 5KBYA 4INZA 4CTOA 4KWEA 4GMKA 5HFJA 2VF8A 2D00A 3PUIA 4QBHA 3QQ5A 4LY3A 1BX0A 4INJA 2HU8A 4B40A 3T5GA 4X1KB 2HCBA 3EG9A 2CLFB 3ZWKA 2IODA 1VE7A 1RWKA 4ZV9A 1QFYA 1SKAA 1VHDA 2DHQA 2VP9A 3GFOA 3Q9UA 2H5LA 1XZ8A 2GCIA 3KUDA 4H7IA 3RNLA 3GQVA 4YMLA 1EESA 1NI3A 5BSUA 2TMYA 2ZGVA 4DUGA 2JA2A 5AHRA 2HIAA 2GRJA 4Y6LA 3RODA 1Y5IA 5ICCA 4D2IA 5I9NA 2FHSA 2C3YA 4QYSA 4NCIA 5FI5A 2YJZA 1THMA 1AHPA 1NY6A 2REOA 2YFQA 2YS7A 1IBCA 3A14A 4KKVA 3E18A 3K5HA 3RFXA 3C8ZA 4OFWA 8OHMA 1PGOA 1JEDA 3GT4A 4H4CA 1R3UA 1YE5A 4YV1A 2X9LA 4DNOA 2PVSA 3GQBA 3VYWA 4NJMB 4FWTA 1N5RA 1Z3IX 3UB3A 3AIKA 5JDIC 1N9GA 2W2LD 1F20A 3LKBA 2DTEA 2A6PA 1FQKA 4KXXA 2JIZD 4R6XA 3DONA 1KXJA 4PQEA 4TMXA 2Y0CA 3HRHA 4UCQA 2Q5JA 1Y81A 5DXAA 4D9CA 1O54A 3AYXB 1X8LA 4WCVA 3QBVA 3UWMA 4EPXA 1L4GA 2XTMA 4XKJA 2ILVA 1SXPA 7MHTA 4V3BA 1ZD3A 1DUVG 2DFDA 4KVZA 5AESA 4ICIA 1E6MA 1DPFA 1DXQA 3GWZA 2C4KA 3B5JA 2H1VA 3CW9A 1YMQA 4R1QA 4O4HF 2TYSB 1UJ5A 1P5RA 1LDGA 2PGJA 4MIOA 5JZSA 2IVZA 5TGTA 1GTL1 4FMCB 3GRFA 4W1RA 2GJ8A 5JNVA 2Y6VA 1U7OA 2P67A 2B25A 3C1OA 3I62A 1QFZA 4R4JA 4ZTBA 3Q9NA 5KNDH 5HKLA 1Z29A 3OEED 1EJ2A 4LJAA 5I45A 1AV7A 3GFSA 1R2QA 1LWNA 2L42A 3UATA 2B4KA 2R8PA 1T2EA 3LNTA 3DZKA 2WNIA 1WMSA 4C0WA 1UEXC 1QCCA 3SN6A 2OHOA 3E2PA 2KSQA 2FMIA 4OHKA 3BMQB 4YJ2B 3TTYA 5F73A 3T9EA 2RJNA 1DWPA 1RNLA 1JDUA 1X3LA 3KKEA 4ZXFA 1NLFA 4L76A 2LCQA 3T9AA 3A2KA 4JT2A 1N32B 821PA 3NWJA 3FOCA 2C99A 3TRFA 1XO1A 4OYLA 3QW4B 1S6YA 4P5DA 4Q3DA 5JDCC 4DEVA 2AXPA 1KH1A 3VAYA 5IEJA 2JLSA 4JLAA 3T5PA 2FUKA 2B7CA 4QXQA 5CCDA 3TLEA 1GDTA 2UXCB 1Z0JA 2ID8A 1PZFA 1LV8A 3C5HA 3I1JA 1U04A 4L5YA 4NTZA 3BJEA 1G20A 4LOJA 5BSRA 3L79A 2WJHA 4QGSA 4KACA 3G0CA 1TKCA 3GT3A 4A8JB 2OUKA 2HA2A 3FKSA 1YL6A 3I58A 3MOSA 3BDVA 1INLA 1VYUA 5ENDA 1FB5A 4KXUA 2GGSA 1X87A 1UFRA 1X9HA 2I2WA 4IDHA 4Q02A 5FHQA 2JFXA 2DUUA 2PWYA 3RF7A 1RPNA 3QLUC 1CIJA 4FI3C 3M9LA 4HZUB 2H1IA 4D8TA 3UUFA 2IU4A 1J49A 1JLKA 2FW7A 4CLRA 4JXXA 4WA8A 2QJFA 4ZFNA 5KOIA 4MR9A 4RYDA 1SCAA 1KPIA 4CTJA 5JXGA 3PXBA 4B7CA 1I2AA 1OT5A 5BMOA 5DNAA 3UMGA 5LNK6 1NIJA 3F7NA 1N5MA 2QMZA 5J2UB 2D06A 2L0XA 2HY7A 4ZVPA 4QASA 5I9TA 3SX4A 3VO9A 4DGSA 4DLYA 4FXOA 4Q01A 5BP7A 4V1CI 3D3KA 2B1GA 2P4UA 3BIJA 4LF4B 1PX0A 3EZ9A 1E9AA 4OHPA 1AHIA 3TW0A 2WE8A 3JQRA 3ZU3A 3OF5A 3A1SA 4JLJA 2ETXA 1J8YF 4DLBA 3AINA 4W9NA 5HEKA 3SXUA 3PTZA 4A5SA 2O7QA 4CQMD 2GJKA 1TU0A 2WJIA 5FI0B 1QS0A 3HCDA 4MRRA 5B37A 4ZEWA 4ALLA 4D79A 2WA1A 4GF5A 5ELXA 3FNQA 4J0JA 2CLEB 1L5WA 3BFPA 4L51A 4R2JA 5IT4A 3Q3EA 5K0BA 4NXMB 3U9LA 4MRPA 2BN4A 4GSLA 1PFWA 1L7OA 1UMCA 3DVRX 4EKDA 4ZT3A 5AW0A 5HIMA 2ZWPA 5ALKA 2JGNA 1ISPA 2HDHA 1NOJA 1CQIB 2X0KA 1NPDA 3A4YA 1JYEA 5COQA 2AK3A 4X8OA 4LXTA 4BKOA 3PPIA 3PRHA 4TQAA 4U7JA 4F1WA 5J2TA 1X80B 3FVRA 1B8OA 3IE0A 4BS9A 3JSXA 4C4OA 5EZYA 5SZKB 2FE1A 1OI3A 4GL2A 1TKBA 5CFOA 1VLHA 4HQLA 3T95A 4LGVA 4RMGA 3AOEA 1OGYA 3QTTA 2FPXA 1ZD1A 3PRYA 4DIEA 3ONDA 3B6KA 3QU7A 4EOGA 3ZLBA 4PYJA 3SNHA 1MTZA 3CVJA 3F6EX 2ZITA 1XTKA 2JGAA 2PV0A 3H8WA 3V4OA 3WO1A 4N54A 3RBVA 4DHWA 4UE3S 1NHWA 1K3UB 1T9HA 1ENOA 3RS9A 1GARA 4IV0A 4PRKA 5HF9A 3IIIA 4QLOA 3QVXA 1XZKA 2JD2A 1RCUA 1ZLYA 3ER9A 2A9FA 3IMKA 3OLCX 4YGXB 4IW3B 4ZU1X 2CXXA 2E37A 4HQKA 4TKZA 4AG5A 4W8OA 1XQYA 1YFKA 4MGEA 4FW8A 2N75A 1CERA 1TAQA 2C4WA 2JJ2A 1MJNA 3H3FA 4X5OA 5E9WA 3R9KA 4KXYA 4D3XA 1V8FA 4Q3AA 2OUIA 2W2OA 3R40A 3CBQA 2EFYA 2G1JA 2YRFA 3BRCA 3QJ5A 5JI2E 4UATA 1LPNA 2ZTVA 2Z8ZA 3ZS9A 2FWAA 1ID1A 1TUIA 4ECEA 5LCXA 2N1MA 3ROZA 4JLWA 4DNQA 4NI5A 5I7WA 2X1VA 1WPRA 2KWIA 4KPFC 1RACA 1GAWA 1O87A 3D3EA 3CF4A 1U0HC 1FP4B 5DMHA 4ECAA 1S2IA 2BKLA 2Y4NA 4ZANA 4J3FA 5DP1A 1LNQA 2C5SA 2Z3WA 2FPIA 3OZXA 1U3TA 2RGCA 1X8XA 2PX3A 4YJ3B 4Q9NA 3WSTA 4ZKDA 1ZRSA 3NVMB 3UUEA 2W8BA 1E5DA 3BSSA 3CNBA 4RXUA 1EFRD 4S1WA 3KEQA 4DSZA 3VTZA 5AM0A 3DWIA 1QV7A 2BH9A 3GAFA 3CSSA 4K6KA 5DMXA 2HQRA 4B32A 4NARA 3WA6A 3OIUA 1O0SA 1JEJA 2PMBA 4K1XA 3WWCA 1PLLA 2WIDA 4DLAA 2I3AA 4OQQA 4RU1A 1SUPA 2CYAA 2YHUA 4UNNA 3I5YA 4FJ0A 4UMEA 4XSGA 1J0XO 2OXEA 3C98A 1KAOA 2X7XA 3DLTA 3MWFA 1RLIA 3HXMA 4LF6B 4UULA 4IG9A 2NVBA 1G1MA 3BYZA 3F71A 3GJ0A 2BHLA 3LRPA 3FROA 4D8YA 4K9LA 1JMVA 3VMFA 1N0UA 3I2JA 4ZI5A 3AUFA 1NVVQ 3DOHA 2GPJA 2YVLA 3K20A 4FFDA 1TT5B 3DMDA 4OP1A 2GLTA 4PLCA 4I19A 5IVHA 1JNYA 1MQ9A 2CNKA 1S89A 3HPRA 3MFQA 3TQQA 1PX2A 1T0PA 5BN3B 2XUIA 1QCDA 5CPBA 1G66A 1R8JA 2HHHB 3ZE8A 4ITVA 1XZIA 1J42A 4HYQA 1MG0A 1FDSA 2FFHA 3P45A 4MICA 3ZHOA 1PFKA 1TUEA 1JFTA 1JHPA 1P2FA 2VDWB 2Z3VA 3QOXA 4P53A 2ZI5A 2NTJA 3C2QA 4LOAA 1EK1A 1MEEA 3IELA 3CBGA 2QTLA 3PQCA 4L3WA 1QO7A 1NVTA 2BZ1A 2UYGA 2WSIA 1WM1A 2V7QD 3BMOB 4M0MA 1W29A 1EBBA 4CDMA 1T2DA 4IIFA 1P0FA 4YDHB 2EZTA 1FDWA 4NMLA 3VNQA 4FFLA 3B6MA 1PJ8A 4C29A 5A5VA 5I47A 4MPDA 3LECA 2J6IA 4YO8A 1C9MA 3BA6A 2P2LA 2JLZA 5FNVF 3H84A 3VYTB 3AL0C 4YNBA 4JCCA 3E8XA 1XN1A 1I3LA 4DM4A 1EUYA 3GK3A 1K9VF 4P84A 4UEWA 1KRWA 3AGPA 2KLHA 3S40A 1R0KA 4W5QA 3FTDA 5ALDA 3DZBA 1TMKA 4D46A 1RWBA 3P9YA 1A9ZA 4KITB 4EG8A 2DLCX 4KO8A 2GXUA 4DQ0A 1I24A 1NU8A 4D5EA 2PMCA 3E5HA 4QT4A 5ISMA 2A5GA 2FPGA 2X77A 5HDBB 4AUMA 3QLUA 3BMCB 5A7FA 3PLRA 1J09A 2L17A 3K5PA 4C4XA 4OJYA 2A30A 1N1MA 4PLZA 3WLFA 1TZJA 3A4MA 3OECA 5LA6B 4M0KA 1LK0A 4UQPA 3DAPA 4GX2A 4KBYA 3LWNA 5H81A 5L40A 4JASB 1H23A 2AXEA 3T5AA 1PR9A 3I5AA 1SIOA 1IHXA 1OTXA 2E85A 1C1XB 3ZBTA 4PX2A 2DLNA 1AG9A 4A6DA 1L4EA 4JYPA 5FOXA 1BFUA 4YAJA 5KWSA 4PWYA 1EG7A 3H7IA 3BMQA 2JRCA 4YJ2A 5T4FA 2A0YA 1J56A 2J6BA 4IHJB 4EO9A 4W5RA 5KX5A 2QD2A 4AX8A 4QU9A 3ZDBA 3Q2OA 2WUEA 3PNKA 1GR1A 1EI9A 4OSEA 2A0XA 4B76A 2DWUA 3WIOA 4P3OA 1G2IA 1TMYA 1DO0A 1SQFA 3GX1A 4BE4A 3LQ1A 1H0HA 5CT6A 2HV9A 1ZDMA 1ABEA 4LUCA 1M2VA 2H9YA 2ZBRA 3CUVA 1N8SA 1W30A 3DEHA 4G8DA 3WLRA 1PDWA 5CPFA 3WYNA 1WDTA 4DT1B 3WC4A 1PDVA 2CDCA 3IQWA 2PFKA 4LGYA 4YXWA 4DXDA 3I61A 1Z2PX 2RFLA 1G18A 3KR2A 1XC7A 4QFCA 3RIEA 4C7BA 2H8GA 5FTJA 1WEKA 2ZI4A 1ONNA 1E99A 2IYPA 2SCUA 1AK9A 2EBWA 3A70A 5GJWC 5JAUA 2C07A 3PR3A 4WWHA 3OLQA 3SSOA 1U8YA 2PCJA