2BJHA

Crystal structure of s133a anfaea-ferulic acid complex
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHALGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPADEGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the Determinants of Substrate Specificity of a Feruloyl Esterase, Anfaea, from Aspergillus Niger
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
molecule keywords FERULOYL ESTERASE A
total genus 92
structure length 260
sequence length 260
chains with identical sequence B, C
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bjhA00
4W9RA 2DFPA 1QGED 5ALWA 1K6EA 4Y2YA 3NWOA 3N0TA 2WIJA 4QWWA 1CUXA 4HRXA 5FRDA 1XRLA 4J3JA 1J06A 3UUFA 3ZWQA 1EX9A 4FLFA 2HRQA 4FNGA 5C8VA 2BCEA 2I3ZA 2Y2VA 2XUQA 4QDXA 1P0MA 1JT2A 4YPVA 1P0PA 2G5PA 4BTVA 1DQZA 3PUHA 1YS1X 3QH4A 5JYCA 5DJ5A 3A6ZA 5DYTA 5ISMA 3HRHA 1ZD5A 2B9VA 4HVTA 1HKHA 1MX1A 3M83A 3NOXA 1KEZA 4UHBA 3G0DA 4X71A 1QOZA 2PX6A 3PE6A 3IUMA 4W63A 1CEXA 2ACEA 3AZPA 5AM5A 4X92A 4JYPA 2VJBA 2R11A 4Y9SA 3AFIA 4J0DA 2HL6A 4C89A 3NUZA 4ETWA 3JYHA 2PSFA 1IZ8A 2R8BA 1TKRA 4BC0A 1QIEA 3AINA 3GUUA 4FOLA 1Y7HA 1HL7A 1R1DA 2WTNA 3CCCA 4GLBA 4AN0A 2ACKA 2ZJFA 4B85A 1AX9A 1IVYA 2DHCA 4Y2RA 2QTBA 3X3HA 3G8YA 4X93A 2H7CA 2QUAA 3WL7A 4HRYA 3ILSA 5AHXA 5JZBA 5ALVA 3QVMA 5EGNA 2WG1A 2QOEA 4HAIA 2OCIA 3PFCA 3E0XA 4JH0A 1W4LA 1BN6A 3KOOA 4W1SA 3I2GA 5DWDA 2GYWA 4CI9A 1B41A 1FFBA 2Y1KA 1BU8A 5C8XA 4CCYA 3QITA 2B61A 4W1PA 3IBTA 1X70A 1ZD4A 1RYYA 3I2HA 2V96A 4Y2JA 4BP8A 1QIDA 5IVIA 3AZQA 4BAZA 3V1NA 1W52X 2FX5A 3W9BA 3O9MA 4G8DA 5EFZA 3WJ1A 3EBLA 1UKCA 4INZA 1K8QA 2O2HA 4AMZA 4OB6A 3TGLA 3ESAA 2CEKA 1E3QA 1PFQA 3FYTA 4MJ3A 3GFFA 3OM8A 4Y2PA 4OU4A 4C4ZA 2GBFA 1QJ4A 1W6RA 5LP1A 2HADA 2DR0A 4KE7A 4CG3A 4CFSA 5AOCA 1EHYA 4W1RA 2HA2A 4DMCA 2Y2UA 1A8SA 4B6GA 4H35A 1P0IA 1CUBA 5KBYA 5E4YA 1SCKA 2HU7A 2WJ6A 3JW8A 5I9IA 4ZGBA 4AQDA 4UHEA 4NMWA 5ALOA 5AKHA 2VT7A 2WU3A 3D2BA 4X97A 4EA6A 1DX6A 3OG9A 4O08A 5HKAA 4KAFA 4J0HA 4U2DA 3WWEA 4AO6A 3B12A 2JGKA 4ZRDA 3I28A 3DOIA 3F97A 1DT3A 1TAHA 5AKEA 3IIIA 3FLEA 1IZ7A 2BFNA 5T4BA 3WKDA 5LYYA 1SFRA 2LIPA 3N2ZB 1DWOA 1UT6A 1CUHA 1XKLA 1QTIA 5IKXA 4H7KA 3VISA 2OQVA 4FBMA 3D4LA 3A70A 4C87A 2WFLA 4HS9A 1GKKA 4Q82A 3AZOA 4U2FA 4U2BA 2HU8A 2XMZA 4QDOA 1UK8A 5JIBA 3RKSA 3WIOA 1UKAA 2BGRA 4HTAA 1CVLA 1THTA 3D2CA 5ALHA 3G9ZA 2AJLI 3BIXA 2YYSA 2CKMA 2ZYHA 3HABA 2RHWA 1R9MA 1THGA 1XQXA 3DCNA 1MNAA 4K5QA 2P8SA 5ALDA 2EEPA 4TVKA 2J4FA 5K3FB 1AC5A 1BEEA 5FOQA 2RI6A 3FYUA 3S2ZA 2H9YA 1EI9A 3HSSA 3OPMA 5HF8A 2ZYIA 5FPPA 3IUNA 4WDRA 3PF9A 3DL4A 5FUMA 3IB3A 1WHSA 5AM3A 5HF5A 1DT5A 3WMRA 3D59A 2WTMA 4UBLA 3PICA 2XI4A 1FFEA 4DGQA 1UWCA 2GBCA 4PSDA 5ALQA 3ED1A 4LXHA 2OAEA 5LKAA 4CIBA 1XZMA 5YASA 3EQ8A 2GYVA 1X2BA 5CT6A 2XUOA 5DTIA 1XZHA 2ZJ7A 4G8CA 2WG2A 4CCWA 2WUEA 3EQ7A 5ALSA 1HQDA 4BAGA 2V9ZA 5T4HA 4GW3A 3MVEA 4LIPD 1Y7IA 4CIAA 4PF1A 2XMCA 1JI3A 4OB7A 2QVBA 3QPAA 2QR5A 3B5EA 1UZAA 2OGZA 5FKJA 1PJAA 2AJDA 2QXTA 1Q0RA 1XKTA 1VXRA 5BOVA 2UZ0A 1NU8A 5JASA 1R88A 2HA0A 3DNMA 2PVSA 2C58A 4TGLA 1Q83A 2OCKA 5HK9A 2OLEA 3G0BA 5AKKA 1L7QA 1WB5A 1HPLA 4XWGA 4AXBA 2VJCA 1J2EA 3R40A 3F67A 1SCIA 4W1QA 5JD4A 4U2GA 5ALFA 3ICVA 3KWFA 4PSUA 1YB7A 4QE3A 1UOPA 4ZXFA 5BV7A 2XUIA 1G4HA 4A5SA 4EY5A 3W04A 2HA3A 3HI4A 2XUHA 1EB9A 2C0PA 1W1IA 3RK4A 4B83A 3OC0A 3L1JA 3LIIA 4UHFA 1CFJA 3C70A 2JGFA 4UFOA 4DNPA 1BN7A 2HHAA 2PU7A 2QJRA 3AILA 2XLCA 2WIDA 5E4JA 4DTCA 1YAJA 2YXPX 2DCMA 4BCCA 4BRZA 3C6BA 2XT0A 1LPPA 4QDTA 1AUOA 1XZEA 1ACJA 5EHQA 3I6YA 2WLSA 1ZJ4A 2QMQA 4QDZA 3T4UA 3WWDA 3DKRA 3I2IA 5DLPA 3H2IA 2IX9A 4WY5A 3KWJA 2XQGA 3BJMA 3VVLA 5HKBA 1XQWA 5ALUA 3DYIA 4WJLA 3FYUC 1TCBA 3CCBA 4M0MA 1AGYA 2XMSA 4PNZA 2ROQA 4UBOA 3DS8A 4QZVA 2B20A 3LLCA 5FDFA 1CUDA 2WG0A 1OCEA 1WB4A 1WPRA 3EQ9A 5FP0A 3V1LA 3DL7A 1P0QA 3TRDA 5LZ2A 4B7ZA 5EIEA 3WQHA 1CUVA 5CBKA 3H04A 1E66A 2VAXA 3STTA 4KAAA 4DLNA 1WHTA 5EI5A 1XROA 3A2MA 1I6WA 4IHAA 3C8HA 2WJ3A 3R3VA 4F21A 3OTQA 5C7YA 3WWPA 2WIKA 5AO9A 5CMLA 4ZREA 2WFZA 2OCLA 2RAUA 4OU5A 1LZLA 1YS2X 5EHXA 3V1MA 3C87A 1ZOIA 2WFLB 4MQLA 4MWSA 2O2GA 1ORVA 5H3HA 1VLQA 3PFBA 2YH2A 3H2HA 3KSRA 1CUZA 1CUIA 1ODCA 3STYA 3QPDA 2Z3WA 1FSSA 5A6VA 1Q0ZA 3QZUA 3PUIA 1CRLA 4E15A 4FBLA 2WU4A 4QA9A 2XUDA 4LYEA 2X76A 1H2WA 3FSGD 1HBJA 3FYUB 1XRQA 4Z49A 3SC2A 1J07A 2CJPA 2VA9A 3I6ZA 5JZ9A 1XZIA 3O95A 4UBNA 4C6HA 4B0PA 4BVJA 4DSZA 1R50A 2AJ8A 2J3DA 2XUKA 5CTAA 4Q3LA 3VJLA 1QIJA 1D07A 1LPSA 3UMJA 4KAJA 3WKBA 1UOOA 1EDEA 2Z5GA 4J0CA 5DYWA 5K3BA 1XZLA 1K4YA 2VTVA 1LGYA 1F6WA 4IO0A 1GT6A 3ZI7A 2XUPA 1WM1A 5LZ5A 3FNBA 1R4ZA 2OG1A 2VAVA 2W6CX 3DLTA 3V9AA 1E8NA 3FCXA 1BS9A 2WHPA 1DX4A 3HXKA 2OPHA 1CUWA 4P08A 4ZV9A 3AJAA 4RPCA 2IIVA 3W06A 1YASA 5ESRA 2JGEA 4Y7DA 3F96A 4DSAA 3R3WA 1ETHA 4BDTA 2QKYA 1AZWA 1ZJ5A 1VA4A 1GQRA 1LZKA 4Y2TA 1UKBA 3KXPA 4U2CA 4IQ4A 4G9GA 4QLAA 1XZAA 2X5XA 2XDWA 3I1IA 4GI1A 1E89A 4AZ3A 1QZ3A 3B3QA 4WFIA 3SK0A 4MXDA 1FFDA 3PDCA 2XQFA 2EDCA 4AX4A 1CUCA 4EY4A 3I1YA 2GZSA 3OURA 4L3WA 3O4GA 1K63A 2XUJA 4N5IX 5HK8A 3WL6A 1XZGA 3HC7A 1VA5A 4K2AA 3G0IA 1R9NA 3HACA 3WWCA 3W9UA 1OXMA 2ES4A 5AI0A 5BWCA 1QIIA 3ZLVA 1WB6A 4LXIA 1HDEA 3WIBA 1C7IA 2C4HA 3BE8A 3YASA 1O6FA 4LKOA 3C6YA 1XZBA 5JATA 4AN1A 3HLKA 1C4XA 5ALEA 1ZICA 2DSNA 2PKYX 4BAUA 3BF7A 4DNFA 1QE3A 5ALRA 3V1KA 2WHQA 1F8UA 5AI5A 5DYYA 3O4JA 4E11A 4F0JA 4RE6A 4FTWA 1UOQA 1QFSA 1MX9A 2XMDA 3H1AA 3E1GA 3V48A 2O2IA 2WIGA 3QBJA 2O7RA 4WFKA 2WHRA 4MEAA 3R3YA 5AOAA 4I3FA 4DIUA 3GROA 4G4IA 5A2GA 4QNNA 2G5TA 5CRIA 3U0VA 1VOTA 4X3CA 3WKEA 4DMKA 1CUGA 3T52A 2HA6A 4RGYA 4I4CA 4X6YA 3DYVA 4UHHA 5K3CA 4KYVA 4ZI5A 1FFAA 5AKJA 1YSCA 4N8SA 3QMMA 4LXGA 4Y2VA 5AK3A 1EK1A 3LS2A 2GBGA 1DQYA 3MGAA 4G8BA 1O6GA 1H2XA 4Q34A 4PSCA 5I7UA 3K6KA 4EHBA 1X2EA 1Z68A 4GXNA 4NZZA 1Q84A 4HXFB 4EY8A 1XRRA 5KWIA 3F98A 4G5XA 3DD5A 3WKAA 4BYMA 2G63A 1ZI9A 3R3XA 3R3UA 4GWLA 2ZYSA 1JJIA 4AMYA 5CH8A 1XRNA 1ZGCA 3GZJA 4HXGA 4X00A 5ALJA 5LZ7A 1EDDA 2ZYRA 4S0XA 2GYUA 4G9EA 5EHNA 4PO3X 5AP9A 3IDAA 3M81A 4C4XA 2ZSHA 5JANA 2BAGA 1ZD3A 3W05A 2PU5A 3AIOA 3VDXA 1BROA 2HIHA 3IUJA 3ZLTA 1QFMA 3WK7A 1EA5A 4P92A 4ARBA 3CN7A 3WKCA 2QZPA 1IMJA 4X94A 3STVA 2AJCA 3BJRA 4X90A 1S8OA 4KJXA 3ANTA 4WDQA 2BGNA 1EB8A 1GGVA 1YR2A 2VEOA 4QWMA 5IVDA 5A62A 1XZJA 3H2KA 5LZ4A 2AXEA 2J3QA 1CUFA 1R3DA 4G4GA 4X91A 2EDAA 2WFMA 5JAPA 4N8EA 1XZDA 2D5LA 5K3FA 3G02A 4ROTA 3AUKA 2BUAA 4NS4A 1LPBB 1QIMA 2QM0A 5BWBA 1A8QA 2JF0A 1LBSA 4C88A 1LPMA 4K6GA 3Q0TA 2PM8A 1L7RA 3KDAA 4IH9A 3FSGA 4XVCA 3Q8WA 4M0EA 3AIMA 5IVKA 1AMNA 2HA4A 2B4KA 4QDUA 4H7HA 5AH0A 3SX4A 3FLBA 2DHEA 1M33A 1A8UA 3WL5A 1MO2A 4FLEA 4LHEA 3IUQA 4XJVA 4H7EA 1CQZA 5LZ9A 1VXOA 2I03A 2PSEA 4LYDA 3PI6A 1ZI6A 4AO7A 2C7BA 4H77A 3E4DA 4Y2SA 1TCCA 3WL8A 2WUGA 4PV7A 3QM1A 5JAUA 4HZGA 1XZCA 3M82A 1JJBA 5ALNA 3R3ZA 5CURA 3BDIA 2YASA 3G0CA 1DWPA 3P2MA 2XMQA 2VJAA 1MT3A 2V97A 1W76A 4N5HX 3WWOA 5AM4A 1CR6A 2PUHA 5DNVA 4BZWA 2XUAA 2PUJA 3SWWA 3GA7A 5DNUA 1F0PA 1SOMA 4OD0A 4L0CA 4FDMA 1MN6A 1UK7A 2OGTA 3STWA 5ALIA 1CUSA 1J1IA 4UUQA 5ALTA 5JADA 2HA5A 1U8EA 5A71A 1YA8A 3K2IA 1XRMA 2C0QA 5AK5A 4BZZA 1E8DA 1GXSA 4H0CA 3QYJA 3D2AA 4FHZA 5DNWA 3U1TA 5EIAA 4BTLA 4ZV7A 2RONA 4B82A 3C8DA 2VJDA 5T4EA 1A88A 1C7JA 5AJHA 3GELA 4J0IA 3FBWA 3QPCA 1EDBA 3WLAA 1CLEA 4J0JA 4DNOA 1EINA 2JGMA 2H1IA 4MYSA 2XLBA 3O9VA 2DHDA 2G4LA 4KACA 1BCSA 2QUBA 5CT4A 5AKIA 2XMGA 4B80A 3FOBA 3HZOA 2XE4A 4KR0A 4QLOA 1UK6A 4E46A 3STUA 1KU6A 4IH1A 4EUSA 2JEZA 1UK9A 2J4CA 3ZV7A 3D0KA 4OCZA 1PV1A 2ZJ6A 4G1FA 4M0FA 2W22A 5CXUA 4ARAA 2D0DA 3DEAA 7YASA 3S8YA 1JU3A 1JU4A 2OQIA 1XQYA 1CV2A 1ZGBA 4E14A 3WI7A 1YB6A 1N8SA 4TPKA 5FXMA 1H2YA 5DTJA 5ALYA 1W75A 2XUFA 1MJ5A 2BUCA 3O0DA 1H23A 3GBSA 2ECFA 2C5FA 4H7JA 3ZPXA 4FKBA 4JUIA 3F8SA 2AJBA 1VE6A 2WM2A 3C45A 1LPOA 3WZMA 2FJ0A 2RHTA 4MWTA 1LLFA 1G5FA 4KE9A 3WK9A 4BVLA 4J03A 5KREA 3H2GA 2JGLA 5HFAA 2WSLA 5CXXA 4Y2XA 2HRRA 5CW2A 5IVHA 5HF9A 5AICA 1LNSA 5I8PA 4G4JA 5ALGA 5HQ3B 1H22A 1FJ2A 3I6MA 1IUNA 5E4TA 3OOSA 2VATA 4MYDA 3WA6A 4UBMA 1TIBA 2HDWA 1QIFA 4FNMA 4KRXA 1EH5A 1NX9A 1DINA 1U4NA 1XQVA 5CH3A 3C5WP 4YASA 4BC1A 1SC9A 2H7YA 4N8DA 2WUDA 3WZLA 3H0CA 3G9UA 4EB0A 4L9AA 4OB8A 2CB9A 1CPYA 1IUOA 4Q1VA 2QJWA 1GQSA 4OUKX 5K3AA 1TQHA 3FVTA 1T4MA 1JKMA 2QT9A 1MAHA 1LPAB 4GECA 4F60A 1N1MA 2QXUA 4WFJA 5ALZA 1E5TA 4K6KA 2CBGA 5AKGA 1ZI8A 4UHDA 1TCAA 4OYLA 3WYNA 1GZ7A 2WQZA 4EZIA 4GBGA 4P9NA 1MU0A 2GZRA 5D3KA 5LIPA 4UFPA 3EIOA 5D6OA 2XUGA 3L1HA 5CT8A 3IULA 4Q3KA 3VJKA 4H7FA 1KU0A 1WCYA 3DQZA 3DOHA 1SCQA 3DJYA 4IH4A 1GPLA 3DKKA 1YCDA 4Q3OA 2WHPB 3FVRA 5AK4A 2VQ6A 1CUUA 4DNQA 1DTEA 1T2NA 1VZ3A 5C81A 4FMPA 5CT9A 1VKHA 3RLIA 5K3EA 4EBBA 2CUTA 4GEGA 5ALMA 5ALPA 4Y2QA 2ZSIA 5FV4A 5A7GA 3C6ZA 2O7VA 1JJFA 4H7IA 2Z8ZA 1VZ2A 2FJPA 4RE5A 4FFVA 1XZKA 4KE8A 5JAHA 4UBJA 1EVEA 1XLVA 4B0OA 2Z8XA 3HEAA 1BCRA 4JNCA 4PW0A 4JEIA 4OSEA 1QONA 4BB0A 1XLUA 1QIGA 4DYHA 3AIKA 4ITVA 3WYDA 1YAHA 3H17A 4AO8A 3NGMA 4C01A 5ALXA 5K5EA 2RIPA 1ORWA 2BUBA 6YASA 5AKZA 4A16A 2VT6A 4ZWNA 1Y37A 1JMKC 3I2FA 4V2IA 4F5ZA 1GPKA 4BP9A 1ZD2P 1FFCA 1MAAA 3C43A 1QLWA 3E3AA 4DMHA 4FLMA 4AZ0A 4EY7A 4GDMA 3O4HA 4Q05A 3R0VA 3VKFA 5SYNA 4OYYA 3M3DA 1ZIXA 5AKLA 4DMFA 5JALA 4GHWA 3WA7A 2IITA 3IURA 5HZGA 2XQIA 3C6XA 1VJ5A 2JGIA 1N5RA 3VVMA 4CCYB 3MUOA 5FLKA 2CZQA 2DQZA 5C8ZA 1QIKA 5AIAA 5T4FA 5AI4A 2WUFA 3ANSA 3JWEA 1TK3A 1G42A 2NW6A 4QEKA 2OGSA 2HM7A 1AKNA 3H1BA 5D3ZA 1RP1A 3I2KA 3H19A 3PF8A 2I78A 5HCUA 5CT5A 4BATA 4AB1A 3H2JA 4I19A 5K3DA 5JAOA 1XLWA 2HFJA 2JIDA 4RNCA 4MEBA 3C5VA 1XFDA 2VF2A 2Y6UA 1RWQA 5AI9A 1EK2A 4C4YA 3CN9A 3FAKA 5IH7A 1AQLA 2XMBA 4HXEB 1G66A 1GPNA 1MPXA 3QMWA 1CIJA 2OXEA 5EHZA 4FFWA 2DQYA 3H18A 4J0GA 3ESBA 5LLSA 3TEJA 5KWJA 5D7BA 3BF8A 4KE6A 3R41A 2ZVDA 1HLGA 5ALLA 4BBZA 1XRPA 2HA7A 2CMFA 4CG2A 4DM7A 5HQ3A 2BJHA 2HFKA 4U2EA 1WOMA 4K6HA 5AK6A 5A7FA 1K5PA 4B9EA 5AIBA 1VE7A 2PL5A 3IVMA 1L7AA 1JMYA 2Y6VA 3LP5A 3WK5A 5AI6A 3ESCA 3LIPA 4YX9A 2XQKA 2XMRA 3BWXA 4L72A 3RM3A 3ESDA 3WK6A 1E8MA 4FWBA 3RARA 3G9XA 4B81A 4BE9A 1YA4A 4UHCA 4B84A 4X85A 1BEZA 5LKRA 5AM1A 2K2QB 2ONCA 2PBLA 2JGJA 1QO9A 3A2LA 4B9AA 1WPXA 4BVKA 1H2ZA 1AURA 4PQEA 5CH5A 1XZFA 2PSHA 1LBTA 2FUKA 1EXWA 5HF6A 4WY8A 4BDSA 4EY6A 5AKXA 4P93A 3I2JA 4X7BA 5A7HA 5JZSA 4UFNA 5ALKA 3WK4A 5F4ZA 5JARA 2XB6A 1DU4A 2BKLA 3F9CA 2WKWA 4JYMA 3D7RA 1ZIYA 1IUPA 4J7AA 1A7UA 3TJMA 1ISPA 2HU5A 4H7DA 1TRHA 1ODTC 4WCVA 4UBKA 1MTZA 1UFOA 3G0GA 1LPNA 4X95A 2VSQA 3ICWA 5J3JA 1BRTA 1CUJA 3BXPA 1DWQA 2X8BA 1CUEA 4OPMA 5SYMA 1USWA 3FLAA 2ORYA 3K9BA 4BE4A 3D3NA 2XQJA 3UUEA 1B6GA 5EIHA 2PPLA 2PSJA 3FCYA 2JBWA 2OAGA 1QTRA 3L1IA 1GKLA 4X6XA 3STXA 4D9JA 4CG1A 1CQWA 3LCRA 3ZLUA 3QMVA 2WIFA 1QIHA 3VJMA 4NVRA 2H7XA 2PSDA 3CXUA 4Y2UA 4J0KA 3MUNA 3G9TA 2JEYA 5JD5A 1NU6A 1MX5A 3A2NA 1MNQA 3WJ2A 2WJ4A 1F0NA 2OCGA 1OILA 4XIIA 5HFNA 2WILA 1BE0A 1U2EA 3HJUA 3WK8A 4BCBA 2I3DA 2E3JA 4UBIA 4KRYA 3VXKA 1EVQA 5FPQA 1JFRA 3BDVA 1ODSA 1CUYA 2V98A 1QO7A 4YK7A 2GBIA 3HYSA 1N5MA 2Z3ZA 1ACLA 3FWHA 2C5GA 5LZ8A 2QRUA 4XX1A 5AM2A 4X6UA 3G7NA 2Q0XA 3BIWA 3D5EA 1U65A 5E2IA 4BRSA 3DDUA 4MQMA 5AKYA 5AM0A 1CUAA 4H18A 4A23A 3BL8A 5JD6A 4KEAA 2QS9A 3O4IA 3KD2A 4UPDA 5AI8A 2RGUA 3EF3A 5AOBA 3IA2A 3W2TA 4BCDA 1UXOA
chains in the Genus database with same CATH superfamily
1ADCA 4AP5A 2OHHA 2A0UA 3HCAA 3GFPA 4IQ8A 3WGZA 4JJKA 1C80A 3BD6A 3NWOA 2W6ZA 4QZVA 1P6XA 5FRDA 1S3IA 2PH7A 2EJCA 4S2UA 4TWBA 4YJGA 4ARZA 4R2IA 4A8TA 4KPFC 3ZE6A 2QN6A 3ABOB 2ZG6A 1J06A 1P1RA 4OHXA 4I8IA 1PFUA 2HBYA 1AT1A 3KKOA 4QPNA 5JXHA 3MYRA 4F60A 2CN1A 1EX9A 4FLFA 4ASUD 1D03A 2HRQA 4FNGA 5IKPA 1TJNA 2PUAA 1IULA 3H2SA 1E1DA 2BCEA 3JD2A 2B99A 2F4VB 2I3ZA 1EIZA 3INTA 3B3GA 3F5SA 4X6LA 1A9XA 1UMBB 4P7JA 3JR3A 2H17A 1BKDR 1QHEA 3MCVA 3TINA 3FPGA 4FD3A 1PSZA 2ATXA 1C0EA 3BFPA 4YY3B 3VPHA 3ZU5A 5EJ6A 2BKXA 2XGGA 3O91A 1JT2A 4BEBA 2COKA 4IYRA 1JDUA 1SVMA 3MBKA 4LMPA 3WB0A 2NMVA 5H59A 1X92A 4N1AA 5IBCA 2ID8A 3O4VA 1YFJA 1V7CA 2FCRA 3TBHA 1VPTA 4NZYA 4DZRA 4I55B 2P1ZA 3U39A 3UJDA 4HNAB 1NYLA 2ZETA 1DQZA 1D2RA 3U6BA 3PUHA 1E9BA 1B0PA 1PEYA 2FOIA 5DJ5A 3HCOA 4AJKA 4B71A 1E9SA 3GA0A 2P9EA 2QU8A 1PUIA 3DBHB 4D25A 5DYTA 4GKAA 2YRFA 1D9ZA 3EXIA 3G5LA 2VDWB 2NSJA 3U7QA 3JQPA 3E5RA 2CUZA 3EFBA 3MSXA 4BASA 1W36B 1NJ5A 2XJ9A 3KYJB 1AS3A 1EAMA 2ZB3A 4HVTA 3TR6A 3Q8LA 1XTUA 3IAEA 1XTZA 3QQPA 5GMOA 3T3EA 3QXHA 2L18A 5DM70 2ZCUA 3KD3A 5EJMA 1U1DA 5DNYB 2BSXA 3PQ2A 4OG2A 5JO9A 3QUTA 5G4KA 2PX6A 4FCWA 4WJZA 4UD6A 1NFQA 1D6NA 2FZVA 3CO5A 3QWIA 2EFCB 4W63A 3EWNA 4RNDB 1CEXA 2C4VA 2GN8A 1SKQA 1G2OA 3RVBA 2R5NA 3EEFA 1R00A 5DPMA 3THSA 3AKZA 1CQJA 3QV1A 2YVLA 4C0XA 4YJDA 4JYPA 1DTWB 2ZTSA 3BZWA 3IP8A 1YFKA 1NXQA 4FC7A 1KJ9A 4L5IA 3GLRA 4P2GA 4S1WA 1U9IA 3FI9A 3M1YA 2HL6A 1WL8A 2BBOA 3DSRA 1VYHA 4R3WA 3DW1X 4RFSA 3VKHA 4F85A 1J0DA 2RGBA 3FX2A 3JYHA 4LHYA 2D7DA 1IN4A 3SAJA 3AFHA 3BGIA 4HMQA 3HHEA 4J90A 2GHTA 5ETJA 2IGTA 1UXHA 4BC0A 4FM9A 3R3SA 2JIBA 2QYSA 2HU2A 2XWJI 2YXNA 4RZSA 3AINA 5FLYA 2LUOA 1YZHA 4LRSB 2M6RA 1Q95A 2A0WA 1Y7HA 2CHFA 1QTQA 2PWBA 4ZT5A 3DD1A 2ZJFA 5HX7A 5A9SB 1I0IA 2IU3A 5H4HA 2BFEA 1ANKA 3RSHA 3G8YA 3OCVA 1IZ9A 2H7CA 3OF3A 1A97A 4D82A 1F4LA 1R66A 2O6HA 5DBGA 5AHXA 2PV0A 3BMQA 3WLQA 5JZBA 1FDOA 2B2CA 2RHBA 4KWEA 3U5ZB 1PJBA 2H6EA 4ZKEA 3RKRA 5A0TA 4DADA 1GUBA 4TTRA 5ITZB 2XECA 1UFVA 5JCJD 4Z7OB 2INGX 1SG6A 3R1IA 5DI3B 2R87A 3TOXA 2J30A 3WQSB 5M7EA 4CKEA 2EJWA 1YJ8A 2HNBA 3OX4A 4J43A 5KWVA 1M6YA 1YC5A 1KJZA 1COZA 1NQXA 1QBKC 4P8RA 1N2SA 3BRCA 4NZOA 2IHKA 5DX8A 2RB4A 3CWQA 1MHTA 3I2GA 2GYWA 1CXZA 4RVSA 3DM9B 4ZU1X 4NJOA 1IZYA 2W6OA 1ZRMA 1IEVA 2JIPA 4N3NA 4WLUA 1GPBA 5FUWA 3DPSA 2BGGA 5KDDA 2AI1A 5D86A 1BU8A 4M2LA 4Z9FA 5C8XA 2A4MA 2NP7A 2J9YB 1SPBS 1Q0SA 1T8WA 1ZHFA 3LHSA 3NANA 4UPEA 2DBRA 4HX9A 1W94A 4CGZA 2OGUA 3JASA 1B3RA 3W5UA 2BFFB 1GGHA 4RZQA 2CCKA 1O94C 4JP8A 4LGYA 3JARB 4EITA 1TC1A 4NE9A 1VECA 1J2TA 1JUDA 1BMFA 2XNDD 4MS4B 4GG1A 1E3TA 1DS6A 1ZAYA 3ZG6A 4Z4CA 4GMDA 2HMUA 5C80A 3W9BA 2FX5A 2WF9A 4N6OA 3E2PA 1K08A 2O0KA 3ELYA 5TQVA 1DJQA 4JV5B 1V5FA 5E0KB 4KRGA 3AP2A 1E18A 3P4UA 3PNLA 3WJ1A 2BFDA 3DVQX 2UYOA 5CB4A 4W9NA 2OENG 1AKYA 3I30X 4RKRA 4F8YA 4AQYB 2J48A 1Q7EA 2O2HA 2X4LA 2IY8A 3CLVA 2ZE7A 4NBRA 4B45A 3ZBTA 1RLTA 1MQ8B 2JW5A 4L0DA 2NXWA 2JLCA 5DE3A 2HQ1A 2I33A 3C3KA 5H83A 2MYUA 4CV2A 5EJ8A 4S04A 1E3QA 3PFKA 5KO2A 2P2GA 3GUVA 4MJ3A 4LZNA 2C42A 3HJAA 3KR2A 3OM8A 4HWOA 2VTKA 3TK1A 2NTYC 4UTOA 5AW7A 2GXUA 2A5JA 4NG5A 1HE3A 3KNZA 4ZYXA 1RR6A 2BBSA 5LWHA 3GLFB 1WDMA 1QGZA 3T0GA 4BKOA 4LK3A 1RE0A 1Z22A 3KXLA 4HDQB 5AOCA 1B16A 1PDWA 4YUAA 3M5CA 5H70A 1C8LA 1Z0IA 2WK1A 2XZTA 3TSWA 1EVZA 3Q6NA 4DMCA 3JAMA 4B6GA 1I5OA 2ZBUA 4P5DA 1W30A 3CSUA 3OT1B 2XHZA 4PYOA 1J39A 2OM2A 2XGMA 2PWYA 3IP9A 4LX8A 5BPHA 4PG6A 3L8ZA 4EY7A 5EMJA 1XMQB 2XCUA 4MI9A 3V8EA 5CDGA 1SCKA 2HU7A 2WJ6A 3V8QA 5KOJA 1VKOA 3SSMA 1SXJB 3JW8A 4RLSA 2NU8B 3ZWAA 1PNVA 1AA9A 4E5KA 5I9IA 1N2JA 2B83A 2D8AA 3IPLA 5DISB 4IXDA 2IYTA 2Z4SA 3M6VA 2R1VB 4LN1A 4LJRA 5ES4B 2BRUC 1YGYA 1GRRA 4FHFA 3R0IA 2JIZD 2VT7A 2YOHA 4EJSB 5JSUA 1NYRA 2IUTA 2QD3A 4X97A 1NRIA 1T5DX 3VPAA 3GJ0A 2R44A 1W34A 2EQ5A 4BO1A 3DWIA 3PQ5A 3HZRA 1E2HA 4BUCA 4U2DA 3WWEA 3IVAA 121PA 3B12A 4S1PA 1NFRA 3L01A 4OHFA 4RD6A 3DZKA 2OO5A 4JP5A 2QPLA 5D1HA 2XXJA 3HO8A 3S70A 1IYZA 1TAHA 1Y1QA 2O8BB 1CZKA 4MTCA 4DR6B 4OK3A 3AR9A 2F9MA 1SUAA 4BNUA 2BFNA 4URYR 3COPA 1TGYA 1MW9X 4RV5A 4TWIA 3UMMA 1VKZA 1M8FA 4GGOA 4GP6A 5BMVF 4LUCA 3M6UA 1DEXA 5JRJA 2LIPA 1XVTA 2P9BA 3N2ZB 4XLLA 2AMLA 4D96A 4NCXA 1OI2A 4ZYUA 3RVKA 3A4TA 1X1CA 1VLZA 2D1SA 1TM7E 2CL0X 1NXOA 4H7KA 5JSYA 2OQVA 3DE7X 4FBMA 4ND6A 3GNLA 2QSYA 2CNOA 2PQMA 4CIVA 1N2CE 2D0IA 3QEMA 3P2YA 2Q07A 4O4HA 2VH5R 3RTDA 3RHFA 4C87A 4ZK2A 2IP4A 3K0CC 2WWRA 1OR8A 2C2BA 2Y0BA 1YOVA 1K97A 3T99A 1IQRA 1GKKA 1BA3A 1IEQA 1CK4A 1M2WA 3R7NA 3MJSA 2VHXA 4KQMA 2JLWA 3IT0A 3LM8A 4WAUA 4BMXA 5JH7A 5TDHA 2HU8A 2W71A 4LJLA 2H4HA 1CRWG 3LCUA 4FOTA 4PZEA 3GT4A 3W77A 1QF7A 4DDTA 1BJRE 2KS6A 4Y2GA 1V2GA 5CLHA 2G3YA 2FSSA 3IAAA 3K0KA 1PJ8A 4FKMA 1CEEA 1HFJA 4KDRA 5K4HA 1UKAA 3BJEA 5BYJA 1OWLA 1G8HA 1RRPA 1TYBE 2HCRA 2H2FA 2D7CA 2NUPB 4M1EA 5ALHA 4F3NA 2X41A 4Y6OA 3WGKA 2V6JA 3NU1A 4TMXA 4V0ME 4D4LA 2CKMA 2RHJA 3EZ9A 1RXSA 1KQOA 4YMHA 4RJJA 4KZPA 4PGHA 5C7OO 2JDIA 2YX1A 2ZYHA 4KOEC 1JECA 2A59A 1JEOA 1VHJA 2JPDA 1V8OA 3L7CA 2CYCA 1V26A 5A5DA 1XL1A 1JQ5A 4QGGA 1N32B 1THGA 3DCNA 4K5QA 2O8FA 2P8SA 5CNIA 9ATCA 3PYXA 2EEPA 2GBLA 3PQ8A 4ND1A 2J4FA 3NDPA 4KPEC 3AWIA 3KLPX 4AG5A 3PUJA 5AW3A 2RI6A 2N9UA 4YVFA 3VHQA 2MSKA 1PL7A 3AQIA 4PYQA 2H9YA 3BTVA 2O7SA 2OFWA 4RORA 3HSKA 4DYDA 5JS8A 3I0NA 4YWJA 1MV8A 3MERA 5CCXA 3QHPA 2C83A 2GI4A 2ZYIA 1QOPB 3Q4GA 4WXPA 5BVGA 1UBKS 2ZK7A 3A9VA 1TQ2A 2AH5A 2QB5A 3AY0A 4RDHA 2IYVA 3CEHA 3AYXB 4AROA 1EG7A 4GP7A 5IUJC 3C74A 3O84A 2WWVD 4H4CA 5GV8A 1R6XA 3G13A 3LDAA 3NOOA 1Q22A 2RKBA 2R97A 2F9FA 4C3OB 1NY6A 2WTMA 3E1SA 2DC1A 2D3TA 4LVUA 4DV3B 1EXDA 1J21A 4ZGBA 2Z9BA 3FKJA 1S1MA 4P81A 5EZYF 1ADYA 4XXHA 5ICMA 2PX2A 1T4BA 2OZPA 4IEEA 4OXXA 3VOSA 4EGJA 5LKAA 3QSYA 1JHAA 5KYUB 1HYQA 3OUZA 3GAZA 4TL8A 4FEYA 3AP3A 3QJGA 5EWMA 2EGGA 4FXPA 5KS2A 1NVFA 1YJCA 1E5XA 1ZWKA 1X2BA 2WNIA 2ZOSA 3ASUA 3BJZA 4UDXX 4HWSA 2XUOA 5FPYA 5BYBA 3UWDA 5C1DA 2F17A 3K1TA 2ZJ7A 1M2OA 3P19A 3DBLA 4G8CA 4RAQA 3TECE 1A1VA 4G25A 1TCVA 5JH7F 3V4SA 1WMAA 1E9RA 2QG9A 3CZ5A 2E4WA 2LDBA 3USZA 3ZWMA 4UUBA 3FOZA 1T1EA 2ZVQX 4WNYA 4CF5A 4C0BA 1B14A 2ILVA 1OX4B 2I7XA 3RROA 4TLLB 5B58C 3S2UA 4OMFG 1H4SA 2FI1A 3TCKA 3IR7A 5B3AA 4YRTA 1ZG3A 4Z4QA 3AR2A 2BFMA 4AL4A 3U16A 4EIWA 4XD7A 2HPVA 2XRMA 3LX8A 1VL2A 4CQMB 4M0KA 4W6QA 3SX0A 3WIVA 2PMCA 3OZXA 4FS8A 4HKTA 5L95A 4AYTA 2I2AA 1R8XA 2WTEA 3IALA 1PFVA 4G63A 5FKJA 4G4SO 2PAFA 1GUFA 4E03A 1SC4A 1LV7A 4LBVA 5LMZA 1QCYA 3SKVA 5A0VA 1W0KA 1CYDA 2AIRA 4NMMA 3HUDA 4DBLC 1VXRA 1T36B 1WETA 2NYAA 1QX3A 2PNFA 2QK4A 3DC2A 4FI3F 5ITSA 3GLUA 4FEEA 1VCIA 1VC2A 2X0RA 3CH5A 4J94A 5EJ2A 3RJ9A 3TH5A 3UO8B 1R88A 1AUXA 1UXJA 4W8HA 2D06A 2OKGA 3E4CA 2W2NA 1QG2A 2APJA 3DE6X 1RI3A 2PH3A 2PVSA 3GFVA 3KKMA 3JALA 2O5RA 3W3ZB 3G1WA 1KOJA 5JVDB 3KAQA 2Y76A 3NTXA 4R8MA 2OCKA 3BXOA 3O3CA 3SYLA 4CODB 1X1RA 3BWVA 5AXCA 4MVJG 2BKUA 4HBGA 1Q7GA 1UH5A 3NTRA 1Z0UA 4QG7A 4PLWA 1WLSA 5AKKA 1KO4A 1P5ZB 1L7QA 3EC7A 2G82A 3ECSA 1OWNA 4BRUA 5BYKA 1WB5A 3BAZA 4HX5A 4L74A 1DG3A 3RRZA 5DI9A 3F9IA 5CG2A 5DBOA 4C14A 1J2EA 3TXAA 5JNWA 2QQ0A 4GOND 3EIFA 2UYYA 1SCIA 3ETCA 4LSGA 3U4AA 3SJUA 5JD4A 5CB8A 1TEVA 3KWFA 2AUTA 3LX5A 5J5AA 4N9QA 1AN0A 3S1AB 5J4KA 3KSUA 3Q3GE 2W98A 2XXAA 3QX9A 3MRXA 3TLBA 5D7NA 1RYBA 4I8DA 2F2TA 3L9XA 3MTIA 2AHOA 4JLWA 4YCAA 4BNIA 3LRPA 1G4HA 1APBA 1DKPA 4A5SA 3L8GA 5KQPA 4IZ6A 2KLHA 2WTAA 2B6NA 4KX3A 3NBKA 4EY5A 4P5EA 2J59A 3W04A 3IQEA 3VC2A 1H6CA 1DADA 1JILA 4EJFA 1M0SA 4EMUA 1WQ3A 2Y9MB 2C0PA 3GRUA 1W1IA 4LI3X 2CD7A 5FWAA 3WDKA 3WADA 2BMWA 3B9BA 1JF8A 2PMWB 2P6UA 2VDLB 3RK4A 4GI7A 4B83A 5C31A 4P31A 1KPIA 2OK7A 3LIIA 4J1TA 4I3GA 4TS3A 1K68A 3C70A 2QT0A 3WGYA 5B5SA 1SQGA 4UFOA 5A5FA 5K8VA 4IFTA 1BN7A 3AILA 4DCMA 1MABA 5BXYA 4I9NA 4A7PA 2WIDA 3DZJA 5E4JA 1GFZA 4GWKA 2I1QA 1SU8A 1LRJA 1JIJA 4WNCA 5CXSA 2YXPX 2DCMA 4AP9A 4BRZA 4PS0A 3BMQB 2I62A 1TECE 2JANA 1Z0JA 3IRUA 3A4VA 1LPPA 4DIDA 1QMPA 1CW2B 5E9AA 4CQNA 1AHHA 2C5SA 2WTXA 2C95A 1NUQA 1Y1TA 2RG7A 3MT0A 3U7RA 1NC3A 1ACJA 3Q12A 3IQDB 5CK5A 1IN6A 3KAPA 2W6MA 3DWEX 4LZLA 2QM8A 3VHLB 1KR5A 4QHTA 3ZHBA 4ZVTA 3ZD6A 1EFUA 4CM8B 2B1RA 2GF2A 1HYGA 221PA 3M3PA 1FOEB 2AFRA 2C4KA 1PR0A 4E5DA 1DAFA 2Z56A 2DXIA 3A9WA 4WBXC 5GVRA 3U4MA 4EEZA 5H02A 1KEPA 4DV2B 2O8NA 3L5OA 3ZD7A 3B3JA 4QOFA 3OCJA 5DBIA 3T1OA 4UDYX 5AVYA 4N40A 4KGXA 4U6NA 4Y6GB 1R0SA 2Q7XA 2X8WA 4FGJA 1J90A 3W5DA 2RIRA 2R1UA 4L85A 5CVDA 3BJMA 1AV6A 2AB0A 2GGSA 2ZYDA 3H65A 1IY9A 1ZPDA 3N8HA 4H59A 4K03A 4MPJA 2NG1A 3R0QA 1D7AA 1IOWA 4IMPA 2KI5A 1HE8B 1T3ZA 4ZIRB 4RTMA 4IW3B 4M36A 4TYPA 4ZALA 3PX2A 5AW2A 3FYUC 1IJFA 1G3MA 1POWA 4LRTB 1TCBA 4EKYA 4YJ2F 3CCBA 1V0JA 1ORTA 2CL6X 4HQLA 1MKYA 1AGYA 3SXUB 2H11A 3ZCPA 3KZVA 5EZYA 2ZS7A 4ERXA 5JMWA 1SXJA 3QW2A 3ZH9B 2EX0A 4UHKA 4WZBB 4K9KA 2GPYA 3BSFA 3PFGA 4G0YA 4GDFA 5LOVA 4DA4A 3TG2A 1O5TA 2IOQA 1JZTA 3L1UA 2WG0A 3IKVA 9LDBA 3DMTA 4QUIA 5E1OA 3VPFA 1P61B 1NUHA 2EKBA 3P9SA 1WPRA 2ECPA 3EQ9A 1N34B 5C8YF 4E09A 3GMSA 5F2OA 1TRKA 2AK3A 2O6LA 2QL5A 4WGFA 4II3A 3ABQB 2PN1A 2OD7A 5LZ2A 3ZLJA 1M6VB 1EWYA 2B7BA 1P1IA 1EVJA 1T26A 3I92A 3UENA 3SM9A 5EIEA 3WBKA 4B2IA 3HM9A 5LQUA 3WQHA 3G2MA 4IILA 3X1KA 2GBPA 2UZ1B 2D1RA 4K9PA 4F06A 5CBKA 1KEEB 1E66A 2NNWB 2VAXA 2Y4OA 4BX2A 4KAAA 5B58T 3UT6A 1TE2A 1UOEA 2NYRA 4QTYA 1P31A 4KXXA 1YD7A 2C2KA 4IHAA 3IC5A 5IAKA 1A4UA 2ARKA 4JEMA 1HDYA 3L5KA 4FMDB 5C4GB 3WLJA 3P4YA 4ISBA 3R3VA 1I3LA 1H6BA 4HI0E 1DBIA 2NX2A 2OORA 1G3RA 4INOA 9LDTA 1G2IA 5IANA 1N36B 3ZE1B 2B3DA 2VHTA 3EMBA 3KE9A 2AEJA 1RBQA 2WIKA 4JBNA 5CMLA 5KYVA 2WA2A 4MI6A 3KHUA 1MR3F 3W8RA 2WFZA 2OCLA 1Y5LA 5B6JA 1G5HA 4V0NA 2MTBA 3MT8A 4JKIA 3HN7A 4U2KA 2WMYA 5DASA 5CIWA 3VGPA 1V43A 1V6SA 5EERA 4HDKA 4C22A 3AG5A 1NV9A 4OHMA 4ECEA 3FBGA 4X1OA 4H0FA 2A94A 1DRWA 4YPOA 3FPKA 2FEKA 2VAMA 2X6RA 4RHUA 4JBYA 3V2IA 3MWEB 4NEHB 2W2XA 3RUCA 3RK1A 4YCCA 4AKEA 2P67A 3RUFA 1S4QA 2ZAYA 3OLZA 5GJBA 2B98A 1LVGA 4UCQA 5A3VA 4JDUA 4JMLA 5B37A 3NUGA 4GOLD 4Y7CA 2UVQA 2MYNA 1QH8A 3OAAA 4RTLA 1KZHA 4P54A 3A3NA 3CW9A 1SQ0A 3KSRA 4K3UA 2IV2X 1HOXA 2AOWA 2ZLBA 4NPHA 4V39A 1YACA 2HMTA 1CUIA 5DSZA 4Q4HA 4OI0A 1OPXA 3C85A 1TM2A 3OCCA 1J2RA 3LLVA 3HO6A 1MVOA 3N74A 2YUTA 4FCTA 1XTVA 2P2NA 3R7AA 1N77A 2XNSA 4DJAA 2XVMA 4OQYA 2J3EA 4CKYA 4QLBA 3JQAA 3FJYA 3T7SA 5A6VA 1Q0ZA 4IVQA 1Z25A 3Q3HA 3T7JA 4MGKR 3EB9A 1Q2UA 1MB2A 2G5CA 4RY8A 1ZK3A 3D9QX 4HD8A 2EJVA 4GC5A 2WU0A 3T5DA 3VYTB 1AJEA 3OI7A 1YMVA 4UE3S 4JI6B 4D9FA 1DC8A 1YJQA 3I9MA 3L0YA 4P3NA 1B6RA 1KYXA 4DL9A 3CUVA 4WK2B 3LQYA 1KZ4A 1JAHA 1HBJA 3KQPA 4LJ4A 4JLKA 1XDGA 2AKYA 4FFBA 3WLKX 5J2UB 2P9ZA 1Y4SA 2RBGA 3Q98A 1IOLA 1XZIA 4YALA 1K92A 5JNUA 5F35A 3TL3A 2QIPA 3MAJA 2BTQB 1ZUHA 1R0KA 1KI7A 2B35A 5JH7B 2XCSB 1CY0A 4TVOA 2J3DA 3EGDB 4GPEA 2YWEA 4L15A 4JB2A 2BR3A 4QUJA 1WUKS 4I7EA 4JC8A 4Z0TA 5JXWA 1BH2A 3TNFA 3NHAA 2IXAA 4ZKDA 4KAJA 4XSGA 5IJWA 2PZFA 2Y8EA 3R0ZA 2Y0CA 1Z34A 1KC3A 1IUKA 3ANNA 4R3UC 2D3WA 2XWBF 5DYWA 3A0RB 3H1TA 1KH3A 1TZ2A 3ML1A 4ZD6A 5IZ4A 5E7IA 1MDFA 3PWSA 1BD3A 1QBGA 2IYQA 2YZNA 3AM1A 2GAIA 4B3FX 4LZZA 1F6WA 2QTVA 1GT6A 1CIPA 3ZI7A 2R66A 1UXKA 4OM8A 5EQTA 3TSOA 3QPVA 5LZ5A 5K0SA 1HYHA 1KKUA 3E70C 2OE2A 2A0FA 2W6CX 3DONA 5TF0A 1IAVA 3D6UA 4JEHA 2V7PA 2HBRA 1T3LA 4ENRA 4WW0A 3VO1A 2QQ5A 1TT5A 4ISCA 3WQRA 2IHNA 1PDVA 4RL4A 2RE8A 1XXHB 2B2XA 4FE7A 1N78A 3KK0A 3PNSA 1QAQA 4IFEA 3QKRA 3ASVA 5KTRA 4DIFA 2WNHA 3SMQA 1UDXA 5TGTA 1BS9A 3DO6A 1Z5UA 3W1EA 1GGMA 1J22A 1FBNA 5B6PA 3REOA 5IAAA 3U44B 2IYZA 1DX4A 4RF2A 4YAOA 4ZZ1A 2JFZA 4Z1OA 3HXKA 4QU8A 3W5SA 1PYGA 2J46A 4D6PA 4F84A 3LGXA 4GNRA 1R3UA 3ESQA 1ODLA 1G20A 1YRBA 4ZJUA 1CEQA 2YXDA 4RM2A 1NWHA 3SLRA 4AZVA 4MO2A 4NJEA 1YIAA 2IHBA 3OPYB 4QUBA 4Y7DA 4QJBA 1ADFA 2H1VA 3EMVA 3F96A 4TYQA 3GXOA 4DSAA 1NJFA 2JHAA 1P45A 3PXXA 1W93A 5E1BA 1JG7A 4DBZA 3OPVA 1SUDA 3RNOA 1XDWA 1KVSA 4GMGA 2XB8A 4R83A 3UAOA 4BU1A 4B48A 1WMSA 2E1PA 5HGJA 3RYFB 1NHGA 3ZTYA 5KYTA 4A8PA 3OX3A 5L7YA 1GQRA 1D0IA 1LZKA 3HA3A 4WCDA 2WJGA 5LDDC 4UM7A 3WVNA 5THQA 5DSTA 4F6RB 3IDZA 4EHNA 5MFZA 4PO1A 3NETA 3IYLW 3S40A 1I6MA 5CDSA 2I6UA 2XDWA 1PGQA 1JSZA 2DMRA 4C7XA 1QZ3A 2CDAA 2ODBA 2OB2A 3FPFA 5JAMA 4MLDA 3B3QA 3UPUA 2QZ9A 4LBZA 4IICA 3GWZA 4QUGA 1U1EA 2H16A 2HCJB 2IOFK 4KGVA 2JBAA 1VJRA 3N75A 4EY4A 1PJ2A 3CUYA 4C2AA 1AF4A 1O94D 4LECA 4ZZ3A 3ND6A 5LYJA 3HCWA 2AXPA 2P9YA 3KJGA 3AVXA 3GWGA 3GFTA 4TKUB 3VPDA 4W5TA 1M9NA 4S3MA 4PN3A 5IT9A 4ALKA 2H06A 1BHSA 2XXAB 3AQ4A 4PAWA 2W8ZA 4RJLA 3RC2A 4N5IX 1CS0B 1XZGA 2HDOA 2PLRA 1QRUA 3U1VA 3M49A 4JUFA 1FFSA 2W8BB 4BYGA 8MHTA 1H42A 1TUGA 4IV8A 2Z57A 3CMMA 2YWRA 2RGAA 4GX1A 4DT1A 3EZ6A 3QKTA 4KWCA 1HR0B 1I2AA 2BC9A 4GX5A 3N1UA 2IW1A 1R9NA 3FF4A 3HACA 3OU2A 3FNHA 3HGQA 4HY3A 2NPFA 3W9UA 1DNPA 1PL8A 4P3YA 3GMTA 4UQOA 3RR2A 1TQDA 4ER3A 1RXIA 2K7ZA 3AV3A 3OE7D 4X1KA 3ZLVA 4K9LA 1WB6A 1H8EA 1Z73A 1EUZA 3PC8C 1XE3A 2EFYA 1C7IA 4PHHA 2G5GX 3TQIA 2OZLA 3O6VA 1BYIA 1VHWA 4N6GA 4RVFA 2H5EA 3SEAA 4TVSA 3C3EA 3OMXA 5DFAA 4BP3A 4G23A 3FCCA 3TCNA 2AF3C 2QJTA 4MUXA 1NQAO 5I7OA 5FTLA 3WDSA 4MLZA 1HDRA 4BO3A 5FQNA 3H1EA 3MUEA 4CKCB 4NEQA 1E94E 5ALEA 4IHJA 3QWFA 3ENWA 3OMLA 2XNKA 1QH1B 3NBFA 5TS2A 2HR1A 1CEYA 3FMVA 2FKAA 3ADKA 2HLPA 4XEHA 3TBKA 4BAUA 2E21A 1MQ9A 2R7MA 4DLPA 4LJSA 1L7EA 2KB0A 4K0RA 5ALRA 3V1KA 2IX3A 5CLFA 2BP7B 1QC5B 2VF4X 2WHQA 2YV1A 1X14A 3AR7A 3TB6A 3VNRA 3F6RA 1DCFA 3LJKA 3JQAD 1RJDA 3COZA 5JT1A 4WOPA 4LF6B 5JMPA 4RE6A 3VSBA 4R81A 2Z2XA 4MUHA 2JFGA 5JSQA 1MX9A 3H1AA 1IH8A 2LDXA 1PT9A 2C5BA 2NO1A 1H8ED 3E1GA 4G36A 4ZN6A 3QNUA 4MYCA 3HNPA 2XZOA 1B8OA 4RD1A 2A88A 5H9WA 1Z56C 4Z8XA 3WYCA 1E98A 4WNAA 4POAA 2WHRA 1WZUA 2Z0MA 2V8OA 3NC0C 5LJIA 2J07A 4RSRA 4GOOD 4I2VA 4RPGA 1MH1A 5REQA 5E6SA 5DHTA 2HK7A 2PZEA 2WZDA 3GROA 3NVDA 4G4IA 1Q57A 5LA6B 1KETA 3EUEA 4I3HA 4TKVB 3W6NA 2F1JA 2BMVA 3BZUA 1NOIA 5DSXA 5JPIA 2WPDD 3DXYA 3JQ9A 3WFZA 4BGIA 4X65B 1W2GA 5CRIA 1L8OA 3U0VA 3G7SA 2HJ9A 1ULHA 2PV7A 4RK5A 3PNVA 4X3CA 2WUVA 4ESHA 3OA0A 2GHQA 3ILVA 2RHDA 1ZM3A 4Z0NA 4GSYA 3MEQA 2G77B 3L0ZA 2Q9BA 5CM9C 1Z36A 3PKJA 3I34X 5HCNA 4I4CA 2J0EA 1S89A 2EKZA 3UQZA 4X6YA 3L6RA 3RAJA 3DYVA 3GEDA 5K3CA 1GNTA 4JN6B 3IE1A 1GGFA 5JSZB 4NE7A 4DV0B 1SXPA 1HDOA 2RGNC 1L4GA 1INLA 1FFAA 3Q2IA 3G79A 2Z1NA 4N8SA 4CEHA 4BUJA 3EWAA 3GJRA 2X23A 3PXAA 2PGDA 5AK3A 3JWJA 5D3MB 4U8HA 3D4NA 1JKIA 3IUEA 4U02A 2FFBA 3L1KA 3WNBA 1CF2O 3ZNPA 5BP7A 2FU5C 5F3WB 3U4QB 3WLTA 3OZVA 3F3YA 3FCOA 3ZGVA 3BGDA 4IJMA 3T1VA 4EHBA 4XYLA 1SHTX 1Z68A 4WWHA 5TJHA 5LR6A 1SPXA 4GXNA 4GYKA 1H5NA 4R1QA 1Q84A 5CM2Z 5KNDA 3Q3VA 4HXFB 4DA9A 4ZDIA 2WI8A 3QJYA 1XTIA 1FU4A 3AEQB 1F7UA 2Q29A 2W6QA 3OOHA 4NU6A 4IMRA 4R2LA 3SOZA 2DU8A 1ZIPA 3ORFA 4REOA 4FD2A 2HX1A 3DMHA 2O2DA 1BDIA 1ZI9A 1SUBA 2WJVA 5KSPA 2BSQA 2KLBA 3B82A 4NENB 2XTNA 4GWLA 2O5CA 4XUDA 4E1AA 5LOVB 3ONFA 4I1UA 3MRVA 1EXVA 2ZRCA 5CH8A 3NGXA 2Z6UA 1TZMA 1ZGCA 1DAMA 1RAHA 1HLFA 3CVXA 3KPJA 4ZDWA 1E3EA 5JEEA 1QKJA 2G9UA 3EAGA 4MS1B 1NOJA 2VNHA 3ZZ1A 4XIGS 3KPVA 4EUHA 2ZI9A 1QKIA 2BEVB 1Z45A 4RW0A 1CZHA 3LMKA 4MEJA 3PHJA 4D9IA 4CL3A 4ITRC 1T6YA 3WRXA 3GPBA 5ED0A 1YR7A 5L3RA 4ND8B 1Y8ZA 4A0HA 4HAYA 1P73A 3QUCA 3RFUA 2O8BA 2PR7A 2Q5HA 4PO3X 3DL0A 5EHNA 1R4NA 3QXGA 2NZ2A 4L8YA 4LSZA 1EX6A 4GYWA 4ZAGA 1V7ZA 3TZEA 2XVYA 2OBBA 5J4LA 3RAFC 1QF9A 2OV1A 3B53X 4C4XA 2W7TA 5EPUA 4D4KA 1R4MB 5C2JB 2JLVA 2NQTA 2XA1A 4ASUA 4R1NA 2JJ2A 3D6NB 4BXOB 1TW3A 1QGUB 2QNBA 3LC7O 3DMFA 4IDOA 1ZD3A 3W05A 2C88A 2ISQA 5BW5A 3AIOA 4WFQA 3VDXA 2JLBA 3ZNNA 3VOAA 1BAPA 1K0UA 3AVUA 2I65A 3REQA 5JJCA 1QFMA 1N8NA 2QTRA 4OJQA 6GPBA 2GEJA 3EY9A 1UC5B 2I29A 1WKBA 1VMKA 4PHTA 2CLHB 3CN7A 1DXOA 2LIVA 4N7MA 4BMVA 1R8QA 2V7VA 1N6PA 2ZJ5A 3PSHA 1YK0A 1EP1B 2M32A 4ZOEA 5BSWA 2AJCA 5IJAA 2ODEA 1RLMA 1FQKA 1LKZA 4X90A 1YVPA 2JJQA 5EFZA 3U7JA 3E27A 3U4IA 4Z9BA 1UM9B 3ANTA 1NAIA 2OD9A 4LOIA 1W19A 1NM5A 2BGNA 1N2ZA 4WH0A 1FC0A 4Q0MA 2X13A 5E6SB 3THOA 1J2JA 1GGVA 1Y6JA 3QPBA 3IIJA 5IYZF 1FQJA 1K4MA 1E1RA 3D7MA 3PGA1 4PX2A 4F4FA 3AVWA 3DDWA 1PT6A 3P52A 4R9SA 1KBQA 2H5JA 4GLFA 5JCOA 3ZHSA 3EDMA 1YCGA 5IVDA 1K8YB 3G5UA 1XZJA 2E37A 3FMOB 3H2KA 3QPWA 1HEUA 3G49A 2C9MA 2AXEA 5JCZA 1JLLA 3NBXX 4MKGA 4C04A 3EG9B 2VDJA 1CUFA 4KKVA 3TZHA 4AT1A 3FE2A 4L7VA 1O5IA 3KSMA 3MINA 1ECPA 1VIDA 5JAPA 5HRAA 1XWIA 2CSUA 3IL2A 4N8EA 3TN7A 3FYCA 3CZMA 1SXHA 1R6BX 1DBVO 5F76A 4CYMA 4REMA 1LTKA 4MW1A 3WXMA 4RV9A 2YC4C 3G02A 5K3FA 4EKNB 4EA8A 1ISSA 3MWJA 5HTOA 1LPBB 1V25A 4LEIA 1JTVA 2QM0A 1CY2A 2IGBA 1T91A 3CA8A 1E2QA 1MJNA 3R44A 4OQQA 1A8QA 3LWNA 2Y71A 4ARIA 3IDQA 1Y9DA 2EG5A 4BO7A 2V0NA 4LZWA 1IVSA 4RDIA 3R3JA 2NUAA 3ZI0A 5JYEA 4ZDJA 5JEDA 1JFLA 1L5FA 1VMEA 5EP2A 3DXXA 3U3OA 3GPLA 4Z1MA 2PM8A 3DT6A 5FNVB 1U90A 4KQXA 2PKCA 3EGDA 1L7RA 4PY2A 4CKBB 3L7NA 1G20B 2G07A 4ZT7A 3E9YA 5CJ2A 4QAJA 2B30A 1CF4A 5BR8B 1JQ3A 1JEYA 2I1WA 3FDZA 2P6NA 3GRCA 1ST2A 2BTOA 2B69A 3N2GA 4I99A 5IAGA 5IVKA 1E2IA 5AESA 2JFHA 2WAAA 5ITVA 3W7AA 3U56A 1LDNA 3IRVA 3S28A 3FHTA 3LKDA 3ZX4A 2YBEA 3MJFA 2X0IA 4E33A 4EVRA 5KC9A 2A7XA 2ZB7A 3ABIA 4FNOA 1F2VA 1K4KA 1S2NA 2C9BA 5E7QA 3SR0A 2OCXA 3C2QA 3CRNA 4LY0A 3GI1A 3VU0A 5E2BA 1OFUX 1DCMA 3SYRA 1TOAA 3AUJB 4HNSA 2JI6A 2PUTA 1QHFA 1SAYA 1IK6A 3WL5A 1CWUA 4KNVA 4GEKA 4GZLA 4EAQA 4N01A 1GAJA 3L6DA 3DR3A 4C0KA 3BM5A 4OFWA 1U3FA 5LD2B 1NBAA 2ZI3A 3Q8XB 3HM2A 4H7EA 3MGGA 1UKEA 3IAHA 5T3UA 5TIIA 1G4UR 1UDRA 1NNLA 1VXOA 4MW7A 2I03A 4JGGA 2VO1A 4XDGA 1H0RA 3OTWA 4PLZA 1V9CA 1ZI6A 3PHLA 4H77A 4MVXA 2ORWA 1PQWA 1NBEA 2DB3A 1UPUA 1SZDA 1ZEMA 4X84A 3CH4B 4EHFA 1P4HA 3E81A 4QBIA 3CRMA 2CMKA 3DNPA 1AQJA 3QM1A 4OAOA 3FGPA 1NVGA 1FP7A 3M82A 4KLRA 1VBMA 1YDEA 3A0UA 5MGBA 2DUWA 3BDIA 4GP9A 4DG9A 1ZITA 2X77A 4M8KA 3NVKI 2PJUA 1W96A 4N7JA 4Q7JB 4GGPA 2EL7A 1FNCA 1T6XA 4C1NA 3M4NA 3ZKWA 1EQAA 5L3ZA 4BJ3A 5IWCA 1QP4A 1MT3A 5AM4A 4TLBA 3DHWC 4LXYA 2PUHA 4G1MB 1XMXA 4FN5A 3THXA 4G26A 4BZWA 3TGPA 2NZVG 3LBYA 4JI3B 2P78A 5DYNA 4PM4A 1T3SA 2JHGA 2XB9A 1UDBA 1NTRA 4V02A 3TIXB 5LPNA 3SWWA 4I0WB 4CXMA 1ND6A 1XVLA 5EIFA 1K6XA 1N25A 3WY9A 4JYBA 4UE6A 1GCAA 3WDMA 1R9JA 1EAYA 1CU1A 2JS7A 1VHTA 2QRVB 2QRGA 4FI3C 3U17A 4DCUA 1D0VA 5ILGA 2G9RA 3KSDO 1IY1A 1F0PA 4HO1X 4OD0A 2Q1SA 1BVUA 4BFVA 4ID9A 1UK7A 1Z4PX 2D0PB 2J0UB 2BSAA 5F7OA 3JATB 2IDJA 2IPOA 5ALIA 1DSSG 2PXCA 3CUEF 1Z6YA 1BWRA 4INPA 1IWPB 2B34A 1GZVA 1C7EA 4G8JA 3KE8A 5ANRB 3TTSA 3H6HA 2ZBFA 4RCZA 1XDZA 1YA8A 2VTDA 3EZXA 3FTQA 4FQ8A 4KQCA 3K2IA 2RAPA 4HLUA 3JZIA 4LG1A 5AK5A 5FI1B 4AS2A 1DJMA 1GXSA 4ZRMA 3BIJA 1I10A 4LDAA 1JQBA 1DFHA 4KXQA 5BRNA 2MYTA 4BQEA 4CKXA 2AT1A 2GA9A 2XKBA 3D2AA 4HDAA 1HFWA 1OF1A 3DM5A 1NP7A 2LGJA 4K9MA 3KHSA 5DNWA 2P9TA 2CJWB 4M1ZA 4R2MA 4XVHA 5ENDA 4NCBA 3GEPA 3Q5DA 3NWJA 1XXHA 1GRQA 1VP9A 1XLTC 1EFRA 3MMPA 4NIMA 5EIAA 1Y3IA 5CA0F 1IXYA 2V59A 4I8XA 2GPAA 5BQXA 5JAIA 4L4RA 3RHSA 1YQDA 2V74B 4UPVA 5CA0A 4RTSA 2ATVA 1HNXB 3VNUA 1Q21A 4EO9A 2YJ4A 3WLPA 4PVDA 1WTCA 4JU8A 4LDQA 3JQBA 2YBDA 4DS3A 4ETIA 3DDSA 3A04A 5CLLA 2EJUA 4TKVA 3PDJA 2YJTD 4HBZA 2CJFA 1R8JA 3OIGA 4RK6A 2I7TA 2QI9F 2C9OA 3EULA 3H3XA 1E77A 3K16A 4J0JA 3TI9A 4EO4A 1UBHS 1GZ5A 4F2HA 1RACA 3L0CA 1TO1E 2ZDQA 2OHJA 1SG9A 2PFKA 3B1JA 3COVA 1KMMA 3F2VA 2JGMA 3OIFA 4WXEA 3VC1A 3ZZNA 4EYEA 4H3KB 1GO2A 1RYNA 2AUMA 3H7AA 2XHEA 4URVR 3ANYB 2I6FA 2O3RA 3DOCA 1PVOA 5LVAA 1B74A 1CR1A 2GCOB 2VPWA 4HOYA 1K7SN 3R09A 4ZI2A 4MKFA 5KNBH 1A7AA 1HL3A 4MPTA 2WE8A 3CLSC 2EEZA 5TE9A 1CFZA 1XAHA 4MNTA 4LZPA 3GJQA 1K86A 4RH3A 1MG0A 3RRXA 4AG3A 2XYQA 1UK6A 3G2PA 4OSOA 5DHPA 1J70A 3TIIA 2R8ZA 4EJ0A 1I2MA 1PEKE 3FFAA 3LUHA 3EXHC 4I1IA 2IEAA 4GL2A 2FA9A 2ZIVB 4AZ3B 2JLZA 2PUBA 2QYOA 1TMGE 1U3WA 2H1SA 3AX6A 3GHYA 3FFTA 4FSXA 4I14A 2A1UA 1BA2A 1G8MA 3KEOA 4MPRA 4QHSA 1PKEA 2Y1EA 5AW5A 4Q16A 1DIHA 1A9PA 3D7NA 4ARSA 2IBMA 4YRQA 4KXLA 2IHJA 2X8JA 2RB5A 3CLUD 4U7HA 1PV1A 3MC1A 3IQIX 5F12A 4GD3Q 4ZAYA 3LBFA 2BONA 1W2WB 2QUKA 3HJCA 4G1FA 4JKYA 5DBEX 1RJWA 2CF5A 4TKUA 3O5AA 4FDAA 1NI4A 4PBSA 5DCYA 4RJKA 1E6WA 2Q5JA 5CFRA 4MRPA 3UJNA 5IM4A 5KSZA 2D0DA 2PFSA 4NRDA 4NY1A 3USES 2OHIA 3G2IA 2A3RA 2XMPA 3ISVA 4JVMA 1UMCB 1ECBA 2Z08A 1JU4A 4KYIB 4GXQA 5IT4A 2HIGA 2HMSA 2Q4OA 4QGHA 2BHRA 3I73A 3K1YA 3LD9A 4E14A 1W36C 2ERCA 1PR3A 3CEJA 5AQEA 3F5DA 2ZT6A 3PWZA 4GYJA 5FBWB 4WLVA 4WZAA 2QTMA 2I8CA 2OV2A 4LVCA 4YA6A 3R20A 4TXMA 4UUAA 1THZA 1A2OA 4MS3A 4X45A 3GJ5A 4N41A 3GFOA 1WUJS 1W75A 2XUFA 3KXDA 4YB8A 3F2IA 4BV9A 3AIIA 3EE6A 4NONA 4CM4B 1MC1A 3EVNA 2YW2A 1RRFA 5M5BA 3UPDA 3L4JA 4UNRA 4MKRA 3CGGA 2P2CA 4GE0A 2H5IA 4ZO9A 3I53A 3EUAA 3VYSB 1H23A 3GBSA 1E1NA 4NF2A 1MRZA 1YKSA 1XQ6A 2ZRDA 3CG4A 5I8WA 3PHHA 4YMLA 2IEBA 3CFYA 2A9FA 3JSXA 4E21A 1LU9A 4IDDA 2ZVPX 2C77A 5EJ9A 1ZH0A 2GZ1A 2POCA 2FWIA 2WM2A 3C45A 5TLSA 1SBYA 2QUZA 4FR2A 1DIAA 3RBXA 2WP0A 1I3CA 4OMUA 3A4MA 2RHTA 4MX8A 2IS4A 4MWTA 3IOYA 5I4KA 2FK8A 1RI2A 3EZLA 3WGQA 4BLVA 1RZRA 1PQYA 3QNMA 2BFCA 3GZNB 4QXPA 1VSTA 3OD1A 4M7PA 4BNMA 1Y3HA 1NBHA 4Y2XA 5CXXA 1XPRA 3WDLA 4DSOA 1KL7A 5CW2A 4BNHA 5I8PA 1UBMS 1AKQA 3N8DA 3OIDA 1TADA 4G4JA 4IIDA 1C8KA 4D8WA 1G8AA 3RS2A 1U6KA 1DV2A 2HY7A 3OLWA 4FT2A 2PVPA 2O2ZA 1DRUA 2V9CA 4FUQA 5E4TA 5JDCC 4TZKA 3KZMA 3QSGA 3U0BA 4IIVA 3BHNA 2N46A 4CEJB 1QR6A 1TIBA 4MCAA 4GZMA 3MXOA 3OY2A 2YHIB 5KQSA 4KRXA 3BC1A 5HBRA 2JAWA 2MR6A 1H3EA 1WCIA 4RZXA 3EHEA 1DRKA 4GWGA 4EBFA 3TQHA 5DM4A 1RC1A 1XQVA 1YBHA 4QUKA 4R7ZA 1L4KA 4ZP1A 3UHFA 3H9BA 4GRAA 4J7CA 3DPIA 4X8OA 4D02A 4BC1A 3A1SA 3JPYA 2H7YA 4NAVA 5JYBA 1IM8A 4URXR 2BM8A 1XHFA 5KYYA 1DJLA 3JQDA 3CPEA 3WZLA 3H0CA 1M8GA 3AUTA 3SDZA 1XV5A 3LHIA 1RXVA 4LHZA 2CB9A 2I76A 4OEHA 5CXQA 2ZRFA 1QAMA 3UV3A 5JWRA 3REQB 2GDZA 3H5AA 2WAYA 4UMFA 1JQAA 4A8JB 1I3OA 4EUFA 4WOCA 4CIWA 4EHKA 2QJWA 2FK7A 3E3MA 5JSZA 2ZT7A 3T41A 2JLRA 1N2XA 5BNWA 3BDAA 4M83A 2OECA 2FGKA 2QT9A 4US2R 2Z5FA 2BFBA 5JZMA 2DG2A 1KI6A 5AHKA 3H7IA 2WPDA 4EKGA 1RXEA 1PSDA 1ZMTA 3WIUA 4RSHA 4ENPA 4QOJA 5GOZA 2AMVA 2SKDA 1K6JA 2H54A 3N07A 1AMUA 1G21A 3RV3A 2CBGA 3H5IA 1VYUA 1ZI8A 3FRHA 3D8BA 3H5RA 4M6WA 5CEEA 2WT4A 3AGPA 4S0ZA 3RSFA 4BQSA 4UHDA 1LXCA 1VP3A 2UUCB 4XM2A 1D2NA 4KR7A 5KTYA 1XWWA 1TCAA 4LJ9A 2VSOA 3FTCA 4OYLA 4ZT6A 5IAJA 1WY7A 4HNGA 2PR2A 4Y6QA 1STOA 5KTKA 4E5YA 1GZ7A 1II8A 1M1ZA 1M75A 2FW8A 2WQZA 3PXEA 4P0QB 1AHIA 4JELA 4GBED 1DAOA 1MU0A 2QW1A 3C7KA 4QVGA 3TLAA 2OKCA 4CDRA 1PUXA 4E4TA 4UFPA 5D6OA 1O97C 2WC1A 4NR0A 1PD0A 1S7CA 1GNPA 2GEFA 1P5FA 4AKTA 4ALNA 1Z7GA 4OI1A 5CT8A 4JSRA 1XDDA 2XVAA 2O1SA 3BSWA 1VGRA 3FGNA 3ZDDA 1K8RA 4QU5A 1JFFA 4Q3KA 4BBJA 1Z2PX 4QG3A 2TSYB 3ZH2A 3EC1A 2TMGA 4KQKA 1KU0A 1QPBA 1ZNYA 2EZTA 4YQZA 3ESZA 3HKEA 1YI1A 3Q6IA 4UZEA 2M6KA 3EW7A 3NIDB 1M83A 4IJVA 4HLQB 4NU8X 2G25A 1YCDA 2P9QA 2VSNA 4Q3OA 3FVRA 1A04A 3OJFA 3E18A 3KXIA 4NMXB 5KU7A 1EWVA 5AK4A 1G5IA 3BQNB 4DNQA 2AZDA 3H13A 1T2NA 1O0CA 5C81A 2R8EA 1OASA 2P9CA 1OHHA 2O0LA 2II6A 2FMKA 3MWGA 5CT9A 1FDVA 3TDKA 1NUAA 4W5JA 4XYGA 4BLUA 1NULA 3CX6A 5AJTA 2ZXFA 2C2YA 3EZ7A 5KAPA 3Q0IA 4F1WA 1KAQA 1YZYA 3IUSA 1UEIA 3L7IA 3NBMA 1JEYB 2G04A 3O1HB 5F52A 3H9UA 1GZ4A 2WF7A 4Y2QA 4BHTA 3T95A 1KC1A 4ROSA 5A7GA 1RAAA 1NKSA 2QV7A 2VH2A 4G0NA 4F3RA 5L40A 2ZEJA 1QB8A 2FPKA 1VJ0A 1D1PA 1ZCJA 1J6UA 1DUSA 1IHPA 2PS9A 2Y93A 4ACAA 2DY1A 4R1UA 5JAHA 4UBJA 3CB2A 2ZJ0A 4HNAA 4YRRA 1L5KA 4NOMA 4F2DA 5C5IA 5CFLA 1G6KA 4RJIA 1SQFA 3SVTA 4J0FA 4PYLA 2Z8XA 1XYVA 2ANCA 3VC3A 2X6TA 5DMHA 2VI5A 1E9VA 2A30A 5A4IS 3IMGA 5LJLA 4JEIA 4LFAB 2C04A 2BTEA 1QONA 4IZHA 1T8RA 5IWAB 2E6UX 1RM0A 4NABA 4R2JA 1E6EA 3ASZA 4DB4A 4J4TA 3LSYA 3OWOA 4BLPA 1ISGA 1CY7A 1NUSA 2IXDA 2QRNA 3BWMA 4HPWA 5JLAA 1Y8CA 4E7OA 5AD1A 3G85A 3V34A 2QIOA 3O38A 4O4LF 5KUTA 2G1PA 2O19A 2UV8A 3SIRA 1QHHB 3ZJ5A 4F97A 3P9NA 3PCXA 3CQ9A 3ENQA 2ACWA 3NGMA 1HZZA 4F45A 1HWYA 3INYA 2BHTA 3IXMA 3VI3B 3DZHA 1PRYA 4L1KA 3JWGA 1FFHA 3ZY2A 4MKIA 3ZXSA 2HF7A 5ALXA 2LE0A 1CF9A 1NDHA 3H75A 3IUPA 1EFPB 2OHGA 3RABA 1M2EA 1MVLA 3M4YA 4J16A 1ZA1A 5AKZA 3HU2A 1E2PA 4AJ1A 4MQ4A 2J6CA 3KZCA 4OA8A 1D2GA 1I0ZA 1K7XB 1QVAA 4Q15A 4ZWNA 4QTTB 5BT8A 1FYEA 3W2GA 1JMKC 3D8RA 4ND7A 3I2FA 4PZ9A 4MRVA 4DUZB 3ZVKA 1I4OA 2ATEA 4V2IA 1DUIA 1WDTA 2J9XB 2PCJA 3WGVA 1AKUA 3AR6A 3OFKA 1FXWA 1LDEA 2ZI5A 2XYHA 4XW2A 2W37A 5TMPA 1GNVA 4QTXA 3WRYA 3HBNA 3T34A 1FFCA 2AQIA 4NDZA 2PX5A 3V1UA 2EFHB 2CHEA 5FNVA 2OLJA 3WJ7A 4CKBA 4YRBA 5ADVA 4DMHA 1ZK4A 2R6AA 4AZ0A 1ZVKA 3RIGA 4L57A 4YUXA 3AJ8A 4E30A 2IXEA 4RQTA 4BGVA 1DPFA 4MVJF 2NXNA 3GLVA 4OUDA 4WECA 2G67A 1POXA 3R5SA 2JH8A 4OYYA 2DRIA 4AIIA 4PPNA 1I7PA 3DLCA 2GUWA 2V0CA 2XV1A 3GJYA 2V3CC 3ZXYA 3DC7A 2H2DA 5JV5A 1C1DB 4MP8A 1FPMA 2XQIA 1JPUA 5IJ0A 3TR0A 1Z39A 2CY0A 4TL7A 4MDHA 2HMYB 4L08A 5TNXA 3EXEB 3FWPA 2K4MA 3VVMA 4EUEA 4A8JC 5CLGA 1RWXA 4II2A 3RVPA 4CCYB 3QVOA 1JX6A 1U9IC 3NHYA 3W5JA 5JQGA 1SHLA 2K7FA 4TS4A 5FLKA 1OBVA 1Z75A 5I7SA 1E9DA 4B3HA 2CZQA 2C4WA 5FA5A 4DMUB 1NVTA 5ENZA 3QKUA 1A2BA 1HTWA 1QIKA 2CXUA 5CFPA 4IKOA 3AEKB 3SFTA 2DECA 2I0FA 2VDPB 1P9WA 3IT1A 3QA9A 4KV9A 3ROMA 1KSHA 3MS7A 2YQ5A 3JVVA 4CV0A 2ADMA 5DNDA 4DWJA 3KEGA 1M2HA 1TK3A 1MIOA 5DHFA 3TXYA 4PN7A 5LXTA 3CURA 1G42A 3PVZA 1CZRA 1N57A 4C05A 2I2DA 1Z6GA 4HZUA 2YDYA 4BO6A 5FPKA 4DA6A 4XJTA 2RGDA 5F21A 3OBIA 1GCOA 2I78A 1PR4A 2G4CA 4MYRA 3NOVA 1GKIA 2AFIE 3GGOA 3A1FA 4RTQA 1YBAA 4IWNA 4C08A 1T0HB 1OT3A 1Z0KA 2YJ5A 3ILXA 5BSKA 2B5OA 2C92A 3KZ1E 4BATA 3DUFA 4AB1A 5MGNA 2GTHA 2XCLA 3H2JA 4J6EA 2A33A 4U7GA 5K0NA 4BPRA 2I4IA 4KK3A 4CEHB 4EHLA 2Q9AA 1G5PA 2KJQA 3KWLA 2EBHX 5LQAA 2RH8A 4KC0A 3TPCA 2HFJA 2BFWA 3WYAA 1A5ZA 4XUGB 3QEKA 3KKEA 1ESCA 2JIDA 4UAGA 1A0OA 2FWAA 1D2CA 5JCXA 3EH2A 2CXHA 3ZOKA 1XFDA 4D9HA 4ZJYA 2VF2A 3IO3A 3ROFA 1X7HA 3BB3A 2FKNA 3ND9A 2I3BA 3ZWBA 5B57C 4EW6A 2OTCA 4RHYA 4LQDA 2HRZA 4JOQA 3FAKA 3IJPA 3VR4D 4ND3A 4RMHA 1EWQA 4CKEB 1MB9A 2C1XA 2VK2A 3QMWA 1JFSA 5A5VA 1I51A 2OXEA 3AEQA 5EHZA 2E6KA 2IYXA 5KPJA 5F9MA 4JDPA 3DMTC 2VQDA 5THKA 1JHQA 2HSEA 1WIWA 3ESBA 2DPXA 3PUYA 1UIMA 4HADA 5LLSA 3S2YA 3T3NA 5D7BA 3BF8A 2PBFA 1GPMA 3HJGA 4AF7A 5A6SA 1Y9AA 2PX0A 1G16A 1XDUA 3ZS9A 5B2FA 3EEIA 3MD0A 1PKXA 4A26A 3ELDA 3IP1A 1SXJC 2DF8A 3OCYA 3VFDA 2HH9A 4AJJA 3ENNA 4ZZ0A 4Z8YA 4BBZA 2HJSA 5EAIA 2GPSA 3EVZA 3ORSA 4U2EA 4Z99A 4HDRA 3FSRA 3OZUA 4XASA 4ESOA 2RHRA 3O47A 4M49A 1U7DA 2PL5A 4B79A 1W5BA 4UXIA 4FT4A 1RNLA 4B73A 4WEOA 1O87A 5AI6A 3HWSA 3LBIA 1RKUA 2JFFA 1L7OA 3IBGA 4DJJA 4AQDA 1P8AA 4PPQA 4AQ7A 2XQKA 1DAPA 3BWXA 4B35A 3BGOS 3RM3A 3ESDA 2FQWA 5MN4A 3TI7A 4HJXA 3ROPA 1E8MA 2BFEB 1ODIA 1R4MA 3QOWA 4O59O 4H6WA 3RFCA 2VCEA 5AHWA 3H5TA 3QUAA 2OWEA 4JB8A 4DIOA 3OFND 4QKQA 1I0LA 4IQ0A 1HTBA 1W9MA 3L7OA 5H81A 1NPDA 2FOXA 5DGCA 2ZWMA 2CB0A 3GFRA 4GT1A 4L4ZA 1BEZA 4WLNA 4PZCA 1P19A 3S2FA 1YVDA 3ZX5A 4CDGA 3PTLA 3AUXA 1MENA 1KVTA 2YMMA 2DWUA 1H5UA 2OD2A 1EJ2A 2AN9A 2EQAA 4C7KA 5A3JA 1ZW1A 2K2QB 1XELA 4LDZA 3LUGA 4ARVA 3ONVA 5JISA 5IDQA 3HFGA 2ONCA 3B6IA 1KEUA 4F4CA 3JYPA 5KHAA 1BCSB 4C29A 4QXAA 2WT9A 1ZN7A 1U02A 2NTNA 3PP8A 4IIBA 5C3UA 4CLOA 4B9AA 1UKZA 3OPYI 4MYHA 5G0UA 2FWRA 1LC3A 1B6SA 2PGJA 3M9XA 4R2XA 3MIIA 4R40A 3WLHA 4P53A 2O14A 3NHPA 3GD7A 1H2ZA 3UA4A 4Y30A 3R74A 4IZIA 4RH1A 4HVLA 2X2PA 1OZGA 2A84A 3B52X 4R1MA 4J1TC 4EPVA 2O8DB 4Z0HO 1L8LA 1LBTA 4IUYA 4OLJA 3PCRB 5LB4A 1WY5A 2A1UB 4JWKA 5AKXA 3L6EA 2JAUA 3C0KA 3IAM6 1SCUA 1Y42X 2NZJA 4BO9A 5KB3A 4YDHB 4ZIRA 2D4AA 1LJ8A 2PKQO 3QOXA 4YRCA 4X7BA 4ZFNA 1HNZB 4CEJA 1OH7A 1E0AA 2NUPA 2XBUA 1NLUA 1T5TA 4UD2A 4RSMA 5BNTA 5ALKA 4GUAA 2B1IA 3ND7A 1K8ZB 2BFOA 1T4CA 2Q7DA 1YE8A 3F9CA 1GLNA 1MB0A 1G8KA 2B78A 4UM5A 1BXKA 3NHSA 3AR4A 3F8TA 4KQIA 2EWWA 3CX8A 4MKXA 1SBIA 1IY0A 1YMQA 3TJMA 5FR1A 4ND4A 2HU5A 5K8JB 1UM8A 4KYUA 4P6VF 4KMMA 4HAUA 4EPYA 1Z2OX 1P1JA 2OYSA 3D4BA 1QYRA 3MHTA 1GNLA 1DPGA 3G0GA 4E51A 3PE3A 3C3BA 4L5AA 2M6LA 3RSCA 2ZWOA 3LVQE 5EWLB 3TDNA 4QM6A 1DB3A 3BXPA 2BMJA 3NYRA 1DWQA 1PAUA 3MJDA 4I1VA 2C1EA 4ZVUA 3VX3A 1IWOA 1L4LA 1WP4A 1M6VA 4OPMA 4P0PB 1USWA 3M9LA 4R84A 1VKJA 1QPZA 2ORYA 1G1AA 1N3IA 2YWFA 4R9VA 5H82A 1W1WA 2J08A 4RETA 1FS6A 5DRYA 1VI2A 5E4FA 5SICE 2QGFA 3EGWA 2IQIA 4V0SA 1KEEA 4M9ZA 1DC5A 5EIHA 5EXSA 2JBWA 5F9HA 1GUDA 2OAGA 4OKIA 3VNAA 3L1VA 4ZPJA 3HY4A 1LC0A 4LYYA 1FJGB 1TFRA 1M2KA 1BXGB 2CDBA 3K7EA 1KEVA 3F9RA 3FROA 1XGKA 3TKYA 2Z6AA 1CQWA 1JEDA 1YKFA 1CJKC 3WX0A 2C3PA 2XSZA 3QMVA 2QVCA 4OMCA 3ZLUA 2WIFA 4K46A 3ZY3A 1QRDA 3VSAA 2NU8A 4N18A 2BFPA 2PTGA 1TNDA 2QGZA 5BN5B 4NVRA 3VJMA 5IVPA 5JBQA 2E5FA 4C0LA 3EZ2A 4Y2UA 2AG6A 2GZHA 4PLYA 4YRMA 4Q6WA 4G81A 5FOUA 3L6UA 5JTTA 1OLSB 3IEXA 3OQ1A 4PFQA 2FPRA 2ZBPA 3NG1A 2YWBA 2FPXA 1P3JA 1L0BA 3ZW7A 1NLMA 2PRKA 2GJ8A 1I7NA 1WXQA 2RGGA 1UBEA 2IY9A 2KBEA 2W93A 3PNMA 4L16A 4RYLA 1XEFA 5DOVA 3SXPA 3F6PA 2CMHA 4FCCA 4KDEA 4JXXA 1CZOA 2B5VA 4UDOA 3A2NA 4FYPA 4K05A 5C5EA 1ONOA 3PIRA 3E35A 1MNQA 4RA6B 2PH1A 4O02B 4DA7A 1RQPA 3WJ2A 3HSYA 3U09A 2BKVA 2IKSA 4BJ1A 4F3YA 1GEEA 1P5HA 3N5KA 5EJEA 2OCGA 3TB4A 3FUTA 4EQZA 4XIIA 3AR8A 5HFNA 4KQ1A 4XB2A 5FO0A 4COKA 2HGSA 4EFMA 1KEWA 4PQYA 2PJRA 2BISA 3HMKA 2EZ4A 2HO4A 3HJBA 4HYTA 1GPUA 3FTDA 1CE8A 4WZZA 3WLNA 4QPCA 4U7DA 2CVQA 4PICA 3MTBA 4CMAA 1XXLA 3VR4H 1JLHA 2NU9A 4BVBA 1P2UA 3GEMA 1RAIA 2E3JA 1NI5A 5EZQA 4ETMA 3FXAA 5I7RA 1LW7A 3DWGA 1ISHA 4PBRA 1AGRA 2PO7A 4KRYA 2AYZA 1MRNA 1TKBA 1OBCA 2WT8A 4UEJA 3MSCA 2Y9PB 5D87A 3SHWA 4BNGA 4EA9A 1EDOA 1HKUA 1Z62A 1NVAA 4QOHA 5BUCA 3DEFA 5FPQA 1TZJA 2CCGA 1XJCA 2JVIA 2QZJA 7MHTA 1S96A 4X61A 3CONA 3LXXA 5K0JA 1DBPA 1PWHA 4RZ3A 4DQLA 2AE2A 1LJUA 3D54D 3HYSA 3LU1A 4GMHA 1AQ6A 2LPMA 2VHVA 2YXEA 2VN8A 3HS3A 4MUAA 1KDZA 3Q7PA 2W2KB 3DTNA 3ELBA 2UYCA 4KXVA 1CQPA 1P2DA 2P4EA 3GEIA 1SIUA 4B74A 2UXBB 3R5FA 3BE5A 2NWQA 4R68A 1A2KC 2DFKB 3THRA 2XCTB 4XX1A 1OFUA 3HCDA 3WYBA 1K2WA 1IXKA 2Q0XA 3A9CA 1TAQA 3CNHA 3CE9A 4ENWA 1QO0A 1Q0QA 1VG0B 3ONDA 2I71A 3T5PA 2E4AA 2OZEA 3DTVA 1PQUA 4NU5A 4D0SA 5C5CA 2F55A 3GJTA 3MUFA 2NVUB 1JVSA 1W49A 5AM0A 3D1LA 3MJEA 4BJHB 1Q0TA 4ARCA 3C6KA 4X8HA 4A23A