2BJHA

Crystal structure of s133a anfaea-ferulic acid complex
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
b'ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHALGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPADEGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERULOYL ESTERASE A
publication title Probing the Determinants of Substrate Specificity of a Feruloyl Esterase, Anfaea, from Aspergillus Niger
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 92
structure length 260
sequence length 260
chains with identical sequence B, C
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bjhA00
1CR6A 2FJPA 2QVBA 1KU6A 4WDRA 5DYYA 5BWCA 3G0DA 3DLTA 2CKMA 1QTIA 2YXPX 2VATA 1XLVA 3R40A 1VKHA 1GQRA 1LPMA 1N5RA 4ROTA 1TCBA 1QOZA 2PPLA 4OSEA 5CTAA 4CCWA 1IUPA 1TCCA 5DNVA 5ALTA 5CT6A 4BRZA 4UBKA 1LPBB 1HL7A 3WJ2A 2VT7A 3KOOA 3I6ZA 3IUQA 4QEKA 2AJBA 2OCIA 4JYPA 5EI5A 4WY8A 1R1DA 4FDMA 1XRMA 1BEEA 5HFAA 3STXA 4J0DA 4TVKA 3C43A 2I78A 4K2AA 5ALLA 3ZLTA 1YA8A 5CT9A 5LKRA 1ACLA 4EB0A 1N8SA 4UPDA 4J0CA 4EHBA 2XMCA 1YA4A 4Q1VA 4AO7A 1XRRA 4G8CA 3CCCA 3R3XA 4FLEA 4KEAA 3VVLA 3HC7A 1UOQA 1BROA 2OCKA 4W1RA 1QO9A 4H7KA 3D2AA 1CUYA 2HU5A 5ALUA 4DLNA 2OAGA 2ZYIA 2ZYHA 4MEAA 5A71A 5IVKA 2C5GA 3BE8A 4IH1A 5HFNA 2GYVA 2ZSIA 2X8BA 2GBIA 1L7QA 3KWFA 4JUIA 4Y2JA 4CFSA 5EIAA 4DMKA 4J0IA 2GYUA 1CQZA 4LHEA 1XZLA 4RE6A 3DNMA 1BE0A 3QPAA 3C87A 3G0GA 2JGIA 4WFIA 2OG1A 3WKDA 3WIBA 3FOBA 1A8SA 1R9NA 3H2IA 4QDXA 1K63A 4OB7A 4ARBA 3WK5A 1LZLA 2HA5A 2PSEA 1JI3A 3Q0TA 5DYWA 4Y2PA 2AXEA 1H2WA 1XQVA 4RPCA 1CUEA 4MWSA 1AMNA 3AUKA 4Y2XA 3ICWA 3YASA 4B0OA 3QITA 3WWDA 3V1LA 3F8SA 1XZAA 4TGLA 4E11A 2H7XA 4QDUA 1DT5A 4EZIA 3C6ZA 1GPNA 5HK9A 2PKYX 1D07A 2VJAA 1K4YA 1TQHA 1XRNA 4X97A 1HKHA 4DSZA 2G63A 4UHDA 2HADA 2D5LA 3C6BA 1CLEA 1J07A 1ZGCA 2XI4A 3VDXA 1Q84A 1YB6A 4E14A 4X6YA 3EF3A 3LP5A 4AMZA 4CIBA 3ZLUA 3MGAA 3W04A 4MYDA 1Q83A 5FV4A 4J7AA 4JEIA 4HXGA 2PVSA 2V97A 4OPMA 2V98A 1WPRA 1UZAA 5FPPA 5EIHA 5LYYA 5DWDA 2OQVA 2YYSA 1OCEA 4KJXA 3WK8A 2J3QA 1O6GA 2WUDA 2VSQA 5BV7A 5IH7A 3W2TA 3IIIA 4AMYA 4BZZA 4EY7A 1YCDA 4FBMA 1EA5A 2WTMA 3K9BA 1VXRA 1XZCA 1W52X 4IH4A 2AJDA 2ZSHA 4EA6A 4BVLA 5C8ZA 4W1PA 1GPLA 3OURA 4Z49A 3G9UA 3OPMA 5CBKA 4FKBA 5LIPA 2BCEA 2XMSA 1ODTC 2B9VA 1ZD5A 3KSRA 1YSCA 2XUAA 1F0PA 1QGED 5AOCA 3H1AA 4QDOA 3C45A 4HTAA 3ZLVA 5HQ3A 1YS2X 1ZD4A 3QH4A 3IA2A 4C87A 1AKNA 1E8NA 3RM3A 4X00A 1HBJA 5K3AA 4BVJA 5ALQA 1MN6A 4ZREA 4HXEB 1UK7A 3G7NA 1ZJ4A 3HABA 3VXKA 3ZWQA 4HVTA 1CVLA 1T2NA 5AK4A 3ESBA 2XQKA 5LLSA 5KWIA 1PV1A 2JGMA 5K5EA 3FCXA 4UFOA 3B5EA 3WKEA 3R0VA 4INZA 2H7YA 4J0KA 4RNCA 1MAAA 4X6XA 5IVDA 5AI0A 3B3QA 1QLWA 4BCCA 3HSSA 4BRSA 5ALOA 1J1IA 2G5PA 1CUBA 5I8PA 5HF6A 1FFAA 3EQ7A 3R3UA 1E8MA 4BP8A 4QWMA 4BZWA 2I3DA 2H7CA 3ZI7A 4MQLA 1DWPA 2OCGA 3G9ZA 1USWA 3LIIA 4N8EA 1VE6A 2DSNA 3G9TA 1ISPA 5A6VA 4E46A 4N5HX 2DQZA 3FAKA 2Z5GA 4A16A 3AZOA 3QYJA 4BC1A 3H2HA 4UFPA 3WI7A 3O4IA 4HAIA 4GI1A 1XQWA 3AIMA 1SCQA 4GECA 1WCYA 4X7BA 1FFBA 5CT8A 1CEXA 2HFJA 1U2EA 2C0PA 4XJVA 4BP9A 1QZ3A 4KE8A 2CMFA 3C5VA 2X76A 2ROQA 4ZV9A 5HF9A 2QOEA 1UWCA 4X71A 3WWEA 4H35A 3C8DA 2OQIA 1ZIXA 1ORVA 2C58A 3WA6A 3G0CA 5CH8A 3PUHA 4KAJA 4KR0A 5K3CA 1QIIA 1QONA 4U2EA 2WKWA 2CBGA 1IMJA 2WIDA 2XQFA 1AC5A 3ESDA 3T52A 2C7BA 3UUFA 3QMMA 4Q3KA 2O2IA 1GT6A 3STTA 1H2ZA 2C4HA 1THTA 2B61A 5JAHA 1Q0ZA 3DL7A 4B80A 5K3EA 2EEPA 5JASA 5ALIA 5C8VA 3HLKA 3AIOA 1E5TA 1E66A 4PSDA 5FPQA 2HL6A 3D4LA 2GYWA 3BDVA 1CRLA 5A2GA 3D59A 3AZPA 1XLWA 1VOTA 2WHRA 2R8BA 5HF5A 3CCBA 1DINA 4DNFA 4EUSA 5LZ2A 2VEOA 4LIPD 2VAXA 3LIPA 4LKOA 2PBLA 4M0MA 1WPXA 3D5EA 4BTLA 1UT6A 1ZI6A 3BF7A 4UUQA 5HCUA 4PW0A 3VJMA 2CJPA 4U2BA 3O4GA 1P0IA 2OLEA 4CIAA 3FLBA 3H18A 4WCVA 5FUMA 4GBGA 5LZ4A 3BJRA 1PFQA 2HDWA 5AI6A 5JZBA 3W9UA 2FUKA 3FNBA 1XZBA 1YR2A 4CI9A 3I1IA 5SYMA 2WSLA 4GDMA 2W22A 1UKBA 1XKLA 1BN6A 5JALA 3SC2A 5JD6A 3CN7A 2LIPA 1JU4A 4FLMA 4EBBA 4K6HA 5J3JA 4GWLA 1AX9A 2JGJA 2HA3A 2DHCA 4NZZA 2B4KA 5ALHA 3STWA 4G4JA 1W76A 1THGA 2AJLI 2XT0A 2JBWA 1W4LA 1W6RA 5ALVA 3MUOA 1U65A 3DCNA 4BYMA 1MNAA 4B83A 5AJHA 1OXMA 3ZV7A 5H3HA 1UKAA 2DHDA 1U4NA 1QIJA 2BUBA 2FJ0A 3H2GA 2WUFA 4FNMA 3WJ1A 1XKTA 4KAAA 5K3FB 2XMDA 3WK9A 1CIJA 1W1IA 1E8DA 3UUEA 3I2GA 2OGTA 4UBOA 3CXUA 2EDAA 3G0BA 3H04A 3K6KA 5CXUA 1F8UA 3I2HA 3C8HA 4FFWA 5ESRA 2WJ3A 5T4EA 2HA2A 4X93A 3ANSA 3WA7A 1L7AA 3N2ZB 1LPOA 1QIDA 5D3KA 4TPKA 1MO2A 4GLBA 4FWBA 4LYEA 1NU8A 5EHQA 4C6HA 3GUUA 3PF8A 3A2MA 4U2GA 3DOHA 2HA6A 5AI9A 4Q05A 3PI6A 5ALZA 2WIJA 1HPLA 5HF8A 1K8QA 1XZJA 3VJKA 2ACKA 4NVRA 4OYYA 3PF9A 2ECFA 3STVA 4BB0A 2RHTA 4QLAA 2DQYA 2GZRA 5E2IA 2P8SA 5AM0A 1CUHA 4OYLA 5E4JA 4B85A 3I28A 1B6GA 4LXGA 2HU7A 5AKIA 2RAUA 5SYNA 1DTEA 4C4XA 2OGZA 1JKMA 2BFNA 4B0PA 2JEZA 3HYSA 3WL5A 1VJ5A 3VJLA 1L7RA 1DQZA 2ZVDA 2XQGA 4X91A 5ALPA 2X5XA 4A5SA 5C7YA 5FP0A 1CUCA 1UK8A 3TJMA 3PE6A 4NMWA 3STUA 2EDCA 4AX4A 3F67A 2OXEA 1EI9A 2WFLA 4YPVA 2QJRA 1WB6A 4F5ZA 1N1MA 3ZPXA 4UBIA 4KYVA 1YAJA 2CB9A 1TRHA 3I1YA 5JD5A 4QZVA 2QS9A 2HM7A 1KU0A 3RKSA 3DEAA 5JZ9A 4BCBA 4P9NA 3FSGA 4OB8A 7YASA 2WUEA 3FVTA 1XFDA 4CG2A 4Y2VA 2GBFA 2VJDA 1G66A 3STYA 4L3WA 3T4UA 1DWOA 4X92A 1MJ5A 3IDAA 2QRUA 4FHZA 5FLKA 2ZYSA 1BEZA 1IVYA 4X94A 1MAHA 5AKJA 1WHSA 1TK3A 2OGSA 1CUWA 4Q3LA 4C89A 2AJCA 4ARAA 2Z3WA 3H2KA 1H23A 4M0FA 3WL7A 1BU8A 1JT2A 3WK7A 2WG0A 3BXPA 3O95A 4IO0A 1QIEA 2XQIA 4DM7A 2QXTA 4LXHA 3V48A 4ETWA 4Q82A 5E4TA 3S2ZA 1CUDA 3DS8A 4KE7A 3FYUB 2RONA 2Q0XA 1H2YA 1JJBA 1MTZA 3D0KA 4H7FA 5E4YA 1EDDA 4HS9A 1AURA 4KRYA 1E3QA 3WWOA 1G5FA 1GZ7A 4Y2TA 5LP1A 2XUDA 4QNNA 3D7RA 3DL4A 4F21A 3SX4A 2WILA 1X70A 3LS2A 4XWGA 4OCZA 3P2MA 3BF8A 3WLAA 3W05A 1R9MA 2ES4A 4P08A 1QJ4A 2HRRA 3G9XA 4KACA 1B41A 1WOMA 3BDIA 4QE3A 3VVMA 1BCRA 1T4MA 4AZ0A 5AKXA 5A7FA 1CUUA 2WG1A 1HDEA 3BIWA 1UK9A 4G5XA 1I6WA 3E0XA 5HK8A 1EDBA 3IURA 5LZ9A 3D2CA 1FJ2A 3F98A 3ANTA 2YASA 2VF2A 2G5TA 3WQHA 5K3BA 1CFJA 4EY4A 3ED1A 1Y7IA 3KXPA 4J0JA 4J03A 1CUFA 5FXMA 2JF0A 1IUNA 2V9ZA 2XUHA 5ISMA 2BUCA 2HA0A 4KRXA 3U1TA 1X2BA 4Y2UA 3O4JA 3PICA 1GPKA 3S8YA 4BCDA 3AILA 2C5FA 3JW8A 1E89A 5KBYA 1CUXA 3ESCA 2PX6A 4C01A 2XUIA 2QM0A 4B9EA 2HU8A 1XZGA 5AKEA 3GELA 2IX9A 3D3NA 1RYYA 2WIKA 5EFZA 5AKGA 4Y7DA 1XZIA 1ZJ5A 4KAFA 4OU5A 3HZOA 2DCMA 5LZ5A 4JNCA 3O9MA 3K2IA 4ZWNA 1EK2A 2Z8ZA 2ACEA 3E3AA 2Y6VA 4NS4A 5HKBA 5AK6A 3O9VA 2OAEA 4BBZA 1R50A 4B84A 5JAUA 2WQZA 5HZGA 4QA9A 4BAGA 1IZ7A 2XUPA 3MUNA 5AM5A 5D7BA 5CT5A 3WK4A 3V1MA 2O7VA 1EXWA 3OG9A 4BDTA 2O2GA 5D3ZA 1WHTA 1CUIA 2QXUA 4WFJA 5C8XA 4PV7A 3VISA 2J3DA 2R11A 3WYNA 4H7IA 5AM1A 1LNSA 4PF1A 1F0NA 4L9AA 1QIMA 4UBNA 1RWQA 4DSAA 1XZMA 2VTVA 4BE4A 2WLSA 1GKKA 4K5QA 5CRIA 1BS9A 4WY5A 1SFRA 1NU6A 3I2FA 3FWHA 5F4ZA 4XX1A 4I3FA 1H2XA 4CCYA 3WMRA 3W9BA 4AXBA 1J06A 3C6YA 3L1HA 2XUQA 2XUOA 4YX9A 4UHCA 3DKKA 5ALWA 1DU4A 3WWPA 3SK0A 1XQYA 1IZ8A 1DQYA 3AZQA 4W1SA 2I03A 2HA4A 1LLFA 3EQ8A 2Z8XA 3R3VA 1F6WA 1EINA 1MNQA 2PSHA 1HLGA 5A62A 1YB7A 2XB6A 5A7GA 4U2DA 1PJAA 3DYIA 5T4FA 5EHXA 1JJIA 2IITA 1EDEA 3E1GA 4P93A 4N8SA 3AFIA 5IVIA 4C4YA 4DMHA 4MEBA 5EIEA 5AM3A 1LBSA 2XLCA 1W75A 2DR0A 4F60A 4UHHA 5KREA 1JMKC 2CUTA 3DJYA 1DX6A 4XVCA 2PU7A 2Y6UA 5JATA 4IQ4A 1QE3A 3GA7A 3OM8A 4H7HA 4HRYA 1VZ3A 4GEGA 2Y2VA 3WL8A 2K2QB 5DNWA 1GGVA 3FYTA 4DNQA 3FLEA 3FCYA 3IUNA 2HA7A 4MQMA 1A7UA 5EGNA 2BJHA 5AKHA 5FRDA 4H7JA 1K5PA 3W06A 4DGQA 4H77A 3L1IA 5CMLA 4OD0A 3GFFA 5FDFA 1EK1A 2HFKA 3RARA 1GXSA 3RLIA 3N0TA 3BIXA 4MWTA 5AI5A 2WFLB 3FLAA 1FFDA 5JIBA 1VLQA 2OPHA 3HEAA 2XUKA 2E3JA 4W9RA 3TEJA 2OCLA 2FX5A 2JGLA 2XUFA 4UHEA 5CURA 3OOSA 2BGNA 2GBCA 3G8YA 1LPSA 3KWJA 5AIAA 1GKLA 2WIGA 1XLUA 2ONCA 3E4DA 1ZI8A 1DX4A 1WB4A 3QVMA 3WKAA 3BWXA 3GROA 1DT3A 4QDZA 1LPNA 1AZWA 4AN1A 3AIKA 5AOAA 4FTWA 5T4HA 4UBJA 2I3ZA 2PUHA 4CG3A 2HIHA 4X95A 4J0HA 4G9GA 2CEKA 4AO8A 2QZPA 1QO7A 5JAPA 2WFMA 5IVHA 1XRLA 1UOOA 1FFCA 2DHEA 4QDTA 4MXDA 4DNOA 5AKYA 3GZJA 4DMCA 5JZSA 3HI4A 2VT6A 1CUZA 6YASA 1XQXA 2YH2A 4P92A 4BE9A 4K6GA 5KWJA 4ZRDA 3M3DA 2WJ4A 1ODSA 3I6YA 1CQWA 3IULA 3I2IA 4XIIA 3A2NA 3QM1A 5JARA 1XRPA 1EHYA 3LLCA 3R41A 2JIDA 1ACJA 2PL5A 4EY8A 4KE9A 3WZMA 2WUGA 1QIGA 1A8UA 1U8EA 4IHAA 4X3CA 1SOMA 3G0IA 5DJ5A 4YK7A 2BAGA 5ALJA 4B9AA 1EVEA 5HQ3B 4B7ZA 4EY6A 4K6KA 5AKZA 3DD5A 4V2IA 1EB8A 1MT3A 3O4HA 4FBLA 5LZ8A 4F0JA 3H19A 3LCRA 4FLFA 1NX9A 4H0CA 3PFCA 2WM2A 1H22A 3QPCA 5DTJA 3WKBA 1IUOA 2WJ6A 5AM2A 4ZGBA 2Z3ZA 2ZJFA 1C4XA 2RI6A 3CN9A 2RHWA 5FKJA 4H7DA 4N8DA 4I4CA 2RGUA 1TCAA 1TKRA 5AHXA 1CUAA 2W6CX 4B82A 1AQLA 3IBTA 4Y2YA 5AKKA 3TRDA 5DYTA 1BN7A 4RE5A 3UMJA 4FFVA 3HXKA 2WHQA 4G9EA 4S0XA 3JWEA 1EX9A 4X6UA 4N5IX 2J4FA 4Y2QA 5AKLA 2XMQA 4C88A 2G4LA 3F97A 3O0DA 1UFOA 3WL6A 3IUMA 1P0MA 4DYHA 2WHPA 3D2BA 3G02A 5ALGA 3BJMA 5FOQA 1ZD2P 4GXNA 1VZ2A 5ALYA 3QZUA 1A88A 1LPAB 2QMQA 5LZ7A 5AI4A 4Y2SA 3H1BA 5D6OA 1ETHA 4MJ3A 3Q8WA 4G8BA 1CUSA 3PDCA 4BDSA 1EB9A 3I6MA 5AM4A 2IIVA 2BUAA 4OB6A 4GW3A 1RP1A 1R3DA 5K3FA 3A6ZA 4BC0A 4FNGA 1MX1A 3A70A 2GZSA 1HQDA 2RIPA 4DTCA 2QTBA 1J2EA 4KE6A 4J3JA 4OUKX 2V96A 2C0QA 4O08A 3AJAA 4L72A 1YASA 4BAUA 2O2HA 4HXFB 4PQEA 2BGRA 3H2JA 5JD4A 3M82A 2WU3A 3HRHA 3RK4A 1O6FA 4UHFA 1QTRA 4JYMA 3JYHA 1UKCA 3ESAA 2PU5A 1Z68A 5EHNA 3IB3A 1QIFA 5AK5A 3V1NA 3FYUC 5AI8A 3TGLA 1QIHA 1WB5A 2QT9A 4ZXFA 1SCKA 1ORWA 4IH9A 4ZI5A 5AIBA 1KEZA 1FSSA 3QMVA 5ALDA 4CCYB 4HZGA 1C7IA 2NW6A 1MU0A 1WM1A 1EVQA 1Y7HA 4H7EA 3WKCA 1CPYA 2CZQA 4B6GA 4H18A 4AO6A 1LPPA 2ZYRA 3M81A 1DWQA 4WDQA 3FBWA 3DQZA 5AOBA 5AK3A 4PSCA 2QUAA 5ALSA 1YAHA 3GBSA 1S8OA 1XZKA 1ZIYA 5JAOA 1Q0RA 1CUJA 1MX9A 4ZV7A 2ORYA 2PUJA 5AO9A 4LYDA 5ALFA 3I2JA 3A2LA 3NGMA 1VXOA 1XZHA 3WK6A 4UFNA 3EBLA 4FMPA 4EY5A 3DDUA 4PO3X 5ALEA 4E15A 5DTIA 3QBJA 2XMZA 2QKYA 3C5WP 5EHZA 2H9YA 5JADA 4C4ZA 4AZ3A 3NUZA 3NOXA 4G8DA 2XQJA 1UOPA 3X3HA 3PFBA 5BOVA 1X2EA 3OTQA 2VJCA 5CH5A 2XLBA 4AN0A 1BRTA 1JU3A 3ILSA 3KDAA 5CH3A 4DMFA 4LXIA 4Y2RA 4CG1A 2WFZA 5AICA 3I2KA 3DKRA 3IUJA 3DYVA 4UHBA 3DOIA 5I7UA 5A7HA 5CT4A 2XDWA 1QFSA 1R88A 5K3DA 1M33A 2VAVA 2VQ6A 1G42A 3H0CA 3WYDA 1XZEA 4ITVA 1QFMA 4X90A 2WIFA 4L0CA 4UBLA 3NWOA 1G4HA 1XRQA 2WU4A 1SC9A 2UZ0A 1XROA 2XUJA 3FSGD 1LBTA 1GQSA 1LGYA 3L1JA 4QLOA 4B81A 2D0DA 1AGYA 1FFEA 4PSUA 1UXOA 4YASA 4BVKA 1EH5A 4J0GA 1OILA 2B20A 4PNZA 2QR5A 4W63A 3IVMA 5JANA 1BCSA 2JGKA 4HRXA 5BWBA 1CUVA 2PSDA 3EQ9A 3FYUA 4WJLA 5DLPA 1Y37A 4U2CA 5AH0A 1ZICA 2AJ8A 3PUIA 1JJFA 2PSFA 1TAHA 2XMRA 2H1IA 4G4IA 3U0VA 4G1FA 4FOLA 1C7JA 4RGYA 1N5MA 2XMGA 2O7RA 4I19A 5ALRA 3M83A 3SWWA 2HRQA 2ZJ7A 4Y9SA 5DNUA 4QWWA 5ALKA 1ZOIA 3VKFA 1VA4A 4A23A 2HHAA 3AINA 5YASA 4JH0A 2QJWA 4Q3OA 2VA9A 3KD2A 1P0QA 5ALMA 2QUBA 3BL8A 1YS1X 4U2FA 4BATA 4MYSA 3WZLA 4UBMA 1MX5A 5CXXA 1MPXA 5C81A 2XUGA 3C6XA 1A8QA 4AQDA 1VE7A 2JGEA 3ICVA 3V1KA 2XMBA 5AP9A 3H17A 5T4BA 4G4GA 3QMWA 2GBGA 2PSJA 4BAZA 2DFPA 5LKAA 1CUGA 2JEYA 4BTVA 2J4CA 1SCIA 1VA5A 3OC0A 3MVEA 4D9JA 3R3YA 4AB1A 1ZGBA 5HKAA 2PM8A 1ZD3A 1XZFA 4DNPA 1UK6A 1ZI9A 1AUOA 2VJBA 4OU4A 1JFRA 1K6EA 3F96A 1TIBA 1XZDA 1ODCA 3R3WA 2Y1KA 5ALNA 4M0EA 5ALXA 1JMYA 3V9AA 3WIOA 5IKXA 1QIKA 4WFKA 1LZKA 4DIUA 4GHWA 2Y2UA 3FVRA 4X85A 3WWCA 5JYCA 3EIOA 3HJUA 2BKLA 3F9CA 2WTNA 3B12A 1P0PA 5I9IA 1CV2A 1R4ZA 2JGFA 5CW2A 4Q34A 2ZJ6A 3R3ZA 3QPDA 3C70A 2WHPB 2XE4A 2WG2A 4W1QA 3HACA
chains in the Genus database with same CATH superfamily
3T54A 2AZMA 2ONYA 3FPEA 3LSYA 4H60A 3WDKA 2CW5A 4ITRC 4Z2AA 2PX4A 5DYYA 4MVJI 1KSHA 1L4BA 1NQAO 5KDLA 5HP4A 1YB5A 2RKBA 4C06A 1RQ7A 4TWJA 1RM0A 4EYKA 5BR7A 1P0CA 4M36A 4BMDA 4NG5A 3FOZA 2P9HA 3O3MB 4F72A 1UANA 2X2FA 3DMNA 3OQ1A 4K9NA 4Z4GA 1GRVA 3U39A 1GGNA 2YL2A 2XZDA 3H9UA 1VDMA 3NVMB 3V7YA 1QRTA 4L78A 4ROTA 2FHSA 1LTQA 3SZGA 3BXEA 4UVHA 1XPUA 1VYHA 3UUGA 3MJEA 4K9SA 3ORYA 3ECCA 1QYCA 5H16A 5CTAA 2WU0A 1KDRA 1IUPA 1H0SA 2QG6A 3PJFA 2DWCA 1E0JA 1R12A 5ALTA 4JIMA 4EIWA 2BFBA 3JZDA 3OJLA 3OKCA 2Q6LA 3GA0A 3BS4A 1LBQA 4DV1B 2ERCA 1IHDA 1GTZA 3NIDB 3QTLA 2PUEA 3R0XA 4J43A 1X3LA 1HL7A 1MQ9A 4KDRA 5DXFA 5ED0A 2A7QA 3NUGA 3T12A 2FEMA 2W83A 4AURA 4Y6GB 1DDIA 3T1HB 1CP2A 4L8LA 4XASA 4F4FA 1LS1A 3LUGA 4BMSA 1SC1A 2JHGA 1CWUA 3D4OA 3UOAB 1GNLA 3FI0A 5A0TA 5F2OA 4Z9AA 1EWRA 1R1DA 4WY8A 3Q85A 3I09A 1JLLB 5EMMA 5J2TB 2WAMA 1QHGA 5H9VA 1YZYA 3AYZB 4RZ2A 5ENVA 4LDPA 5HFAA 3PSAA 3STXA 3WGYA 3S81A 3AWDA 1NNI1 4WINA 1A72A 2I9KA 4TVKA 5E7JA 2HJHA 5LA6F 1P31A 5GOZA 2ORVA 5HG0A 3UK1A 4NX2A 4M38A 5K8CA 1WRBA 1URPA 3ASYA 3C43A 1TVKA 2I78A 3HZZA 3MNFA 3O7MA 4N0PA 1LSOA 2EWMA 1L9XA 1I4WA 2RHMA 1M10A 2WPDD 2YJTD 3Q0IA 4JOSA 4JEUA 3EUWA 4NYJR 2IHTA 1ZUHA 4TQAA 3TCKA 5HGXA 1H5NA 2JZNA 1T9BA 3T35A 3F4KA 1YZNA 3RVJA 3N0WA 1Y6GA 4D3DA 4RWZA 4XW2A 5HJ7A 4D2IA 4P33A 1GEGA 4E94A 4EHBA 2Z2ZA 1K7SN 3B1JA 4MV7A 3GPLA 1S7CA 3H8VA 1KDPA 4XDHA 3J81A 1TZKA 1KPIA 3REQB 3ADKA 3PEYA 2AF3C 3W77A 1A4RA 3CO5A 2O7NA 4J7UA 1P2UA 2DYKA 3MJFA 3R3XA 4FLEA 4ZRMA 1Q16A 2Z8YM 3M8KA 5ELMA 5G2OA 5HRCA 3VAAA 3SR4A 2X7XA 3JALB 3O0TA 2R6R1 3GIDA 1VSUA 2OCKA 4YO8A 1QYRA 4LXXA 3I72A 4RD0A 1WSBA 4WNYA 1IWBB 1EAMA 1BG6A 2ZZNA 1OWLA 4S35A 2J48A 3ZC3A 3FY4A 3EGOA 2AMVA 1P5RA 1K4KA 3DAOA 3HYLA 1ZUWA 2OAGA 2X58A 3EGVA 2FQYA 3WXBA 5IVKA 1RXIA 3D4IA 3PT9A 3BE8A 1T1RA 2GYVA 1N2GA 3K71B 3CX6A 4JT9A 5HKKD 3KLBA 5HDQA 1UXIA 2CMKA 2HK7A 4FD2A 4HH3C 5LD2B 4XUGB 4C2UA 5FWDA 2G0TA 4NAHA 3L5OA 3C0KA 4DJAA 2IS2A 3JVDA 1XV5A 3FNIA 3DBVO 2REOA 1J9ZA 1RLJA 1SKBA 4GYYA 5M04A 4V39A 4MINA 4U3JA 4ECEA 3KT3A 3G17A 3E58A 4CFSA 4DMKA 1JUDA 1L0BA 2C96A 2Y93A 2JCSA 2X6RA 1B16A 1WXHA 1QB8A 1SD5A 3IT1A 4FOSA 3V3TA 3PITA 4F86A 4Y9DA 1ZA1A 2YZ7A 5FV7A 4LHEA 4OV6B 1XZLA 3SC4A 3WAKA 4LVNA 1YR1A 4AY3A 3W5IA 2D62A 1QFYA 1XDZA 2ETXA 4RA6A 3UO8B 4B43A 4JROA 1OBOA 3ONWA 4UTXA 1YQ9A 2PLAA 5IU6A 2YV3A 3WGOA 1GAEO 5KTNA 3FMIA 2Q28A 4BKPA 4EG1A 1G8JA 1HY3A 2ZSUA 3FPBA 4ZEMA 2ZUFA 1BAPA 3DGEC 2QW8A 4NBLA 3WLSA 8ATCA 1NNEA 1U3TA 5TARA 3D2LA 1DXHA 3U3MA 1XD9A 4D9BA 4OHWA 4G23A 1A8SA 3NHBA 2X2PA 2DFKB 2XTMA 1E9AA 1TMYA 4B5LA 4KOEC 4I3GA 3AR6A 1PDWA 3A3OA 2BP7B 2QRNA 1JDPA 4FNAA 4ARBA 2FCAA 2JH3A 2JZOA 2DERA 3HDYA 3UNXA 4ND8B 5A9SA 4PYJA 3F6EX 3WO1A 1ZRSA 4PZDA 1IHOA 3PHHA 3Q0TA 1BXRA 4C0KA 2WMNB 2W2OA 5IARA 5C8YA 2NU9B 4RPCA 2GI4A 1ENOA 3T7TA 1NHGA 4MWSA 1X8JA 1AMNA 3CV3A 3GMSA 1XLTA 2ZRIA 2IUYA 1JG2A 1H1LA 4LJKA 2G1AA 4FD3A 5L45A 3YASA 1QH8B 3NYIA 2HBYA 5MHTA 4JLUA 3Q5DA 4N39A 3LGSA 3V1LA 3GJ8A 4Q93A 1W93A 1XQ9A 2H7XA 5E9JA 3WMEA 4IMIB 4RNDB 4D3ZA 2Y05A 2GM4A 3L8FA 3C6ZA 4EZIA 1KRXA 5D85A 3X2FA 4MIEA 4M8KA 2VKTA 3HSKA 5F64A 2QU8A 4BO3A 5KTRA 3RBXA 3NC1C 4FIZA 1D07A 1D4OA 1HDOA 3TR6A 3LVQE 4JR1A 1OR8A 1XRNA 2W4MA 3FBTA 3G59A 1BS2A 1DZIA 1HKHA 1CERA 2O5VA 4Q02A 4CM4A 3K9FC 4DSZA 2OV1A 1R0RE 3EXHB 4NPAA 4B45A 2OZLA 5SYAA 1MO4A 1IJKA 2X3FA 3H7AA 1GSAA 3P7MA 3WGUA 1ZVVA 3ELUA 4E14A 4EA9A 2NU6B 3EF3A 1PR0A 4AMZA 4CIBA 2J9GA 2VHQA 1RI4A 1JDBB 4Z4CA 2V59A 1U5AA 1Q83A 1O57A 1ZSYA 3H9JA 1IQ0A 1JPVA 2A5LA 1A9RA 4G5QA 2C88A 5I4IA 1Y3AA 4KXLA 1MEJA 2YN2A 2ZXUA 2OHHA 1SZCA 4CFZA 1BE6A 4JEIA 3PC2A 5J4HA 2LCIA 3BMXA 1PZMA 2A9PA 2V97A 2BIFA 4M7WA 4YCNA 2BN4A 3DT6A 3O7WA 4QO8A 4LYFA 2NU8A 1ONNA 2O3QA 4EJ6A 3GNLA 4CG0A 1OROA 4HWTA 4NE9A 2MSLA 3DVAB 4C7JA 3K3PA 5LYYA 1UH5A 2YYSA 1OCEA 3P97A 4TSKA 2CE2X 5E2AA 4Z0TA 4PQRA 4XDZA 1BXKA 2JCXA 2NSDA 2P1RA 1Z5OA 1O6GA 4Y1RA 4EG0A 1JWLA 3GZTB 5TF0A 2BKEA 2QF7A 3MWDB 4H08A 3DZDA 3F5FA 2P77A 1RWMA 1U3GA 4TTIA 3FHTA 3IIIA 1XGKA 2F59A 3OSUA 4AMYA 5TIIA 4LGCA 4BZZA 5FA8A 4H3KB 1Y9JA 4HEQA 5EP1A 3OOYA 1D1PA 1GA4A 1T2CA 1ZJYA 4J6EA 5TY0A 3WYBA 2OFOA 3GFBA 2WTMA 4DG8A 1TQ4A 5FTMA 4ND4A 4B3DA 4UU0A 1VXRA 2R1VA 4JP1A 4ID3A 5K8TA 3SSNA 5IAKA 2AJDA 1M1YB 2Q4EA 4ONEA 2PRSA 1K4MA 1YR8A 4Y1FA 5C8ZA 3LUJA 4PAMA 1T5SA 1CVIA 2P0AA 3LUBA 1JAYA 4U7HA 3TI7A 3KUXA 2NUAB 1GQ2A 2NNWB 3LT5A 3T0GA 2XMSA 1ODTC 2BHRA 4IIJB 1OZAA 4IEFB 1ZD5A 3R7LA 4DF3A 1M1YE 4DSUA 1N5LA 1RSZA 2QRKA 4KREA 3KSRA 4EJSB 2IXEA 1H0RA 4KUHA 2WA1A 5KOJB 2X8LA 2AFIA 1Y5MA 3TQFA 5FOVA 2QPOA 3W6PA 4LBYA 1B0ZA 2XUAA 1S96A 2II6A 1X7ZA 3H1AA 3WOVA 4QDOA 4D9EA 2JLWA 4QFBA 3K4PA 1BJTA 1JAZA 1JI0A 4AL4A 3GZNB 4HTAA 3ZLVA 1WVIA 4ZVSA 1WMEA 1D6JA 4ZAWA 4DLLA 5HQ3A 3QH4A 2V0GA 3AM1A 1AKNA 2BPOA 2NAFA 1COZA 2VNHA 3BRWD 4X24A 2DPGA 4X00A 5K3AA 3BMCA 2YIVX 3R5HA 1CU1A 2WVHA 4IV0A 5ALQA 2NTJA 4HXEB 2P9QA 2ETVA 1NGSA 3T06B 4F4UA 4YRAA 2VDRB 2BVNA 3UXMA 1R7RA 1W88A 4ZJPA 3TDKA 4R3NA 4B79A 4FZJA 4N3AA 4D4MA 4B3GA 3ZI4A 2HCTA 3UK7A 3I45A 1F8GA 2AIRA 3VXKA 4UNRA 4AECA 5A3JA 1DAKA 1E20A 4TTPA 2AC7A 2XVMA 3N07A 4JQOA 5C1BA 3AR7A 5CB4F 4G6ZA 2VDUE 1ZEJA 4BNGA 3I6BA 3QX8A 5DW3A 1T2NA 2QZ9A 1D4ZA 1P5ZB 5AK4A 5GADl 2I2XB 2JJ2D 3A1TA 4XSHA 4BX0A 3SHOA 5KWIA 3ADCA 5HE9A 1IAQA 1PV1A 2JGMA 4HTFA 4FINA 1IIRA 2YCBA 2JIZD 3BA1A 3CX7A 4IJUA 4OJNA 4JOQA 5JVDA 2CLCX 1YJCA 4DZTA 2AYYA 4J0KA 4MUXA 3UXYA 3N2IA 4XJTA 1CP3A 3SXPA 3FIJA 4MRVA 4X6XA 4ISBA 4DRXA 5IVDA 3VZDA 5LDDC 2HN9A 5JJLA 1AD2A 2N42A 3DTVA 2EKZA 1M8GA 4MVJA 1DOAA 4URHA 4L02A 2V7PA 3CVWA 1Z9BA 2V9CA 1G8YA 4OHUA 1HE3A 4KLAA 1T29A 3D4NA 4US2R 3ND6A 4PR0A 5FPKA 1D2MA 2ZIVB 3FPKA 3IODA 4ALNA 4DCPA 3HJBA 1F8FA 4CF6A 5BMVF 3L9WA 4GX1A 4JI4B 2PUGA 1HYEA 5ER6A 1OXVA 1B8NA 3R3UA 3SSAA 4B7AA 4CT0A 3DG9A 2WD7A 4EWLA 2MT9A 2OBXA 1F5SA 1OH7A 3GFSA 1N0UA 3DUWA 1RP7A 4ZIRA 2HC9A 3E81A 4JXXA 2C2HA 2Q2QA 4M9SA 1KZ9A 1IM2A 4WUTA 2OCGA 3IV7A 4LPKA 4TMKA 4LJ9A 3IBCA 2YY5A 3S5JA 1X92A 5ENDA 1VE6A 4E13A 1SU4A 3ZCVA 5DNAA 3BEDA 3ETNA 4URUR 3OH8A 4N5DA 4P7BA 4PX9A 3KEGA 4U9HS 1NRJB 3PHLA 2QY9A 3H1EA 4Y67A 4G1MB 5JJ5A 1EUDA 1ZW6A 5BSMA 3K2BA 3CHYA 4A16A 4GUDA 4RPLA 4DJJA 4U7DA 2GR9A 3AZOA 3MS4A 2W6ID 2YV1A 4ZU1X 1E2JA 4RETA 4TMZA 1RRKA 1K89A 2R7AA 5BNIA 1OC2A 3IBGA 3C14C 4CM9A 1VPWA 3M33A 3ACCA 1YU9A 1UPBA 2J9FB 2Z9CA 2EAUA 1BHQ1 2PMWB 1P45A 4HPWA 4HPJB 5I9MA 3O4IA 1DMRA 3WI7A 4DIFA 4UFPA 3ZE2B 3NDRA 3LZ6A 1Z4PX 1YGPA 2HZ7A 3AF0A 5DLEA 3TRKA 4CKBB 1Y8QA 4IXDA 4HFRA 4RCYA 4U02A 4G2NA 2ZB8A 4GECA 3F49S 4O5OA 1QYIA 4NCKA 4DCOA 1JTEA 2FPPB 4XYLA 4J9VA 5LR6A 3WMFA 2FXVA 2J3HA 1BFKA 1GPH1 1CYDA 3JXEA 4MDEA 1U2EA 3AETB 2PXCA 4DLKA 4LF9B 5TDHA 1HKUA 3EVGA 3TPZA 3VQTA 4C0XA 2B1RA 2C0PA 4XJVA 5IDVA 4B4VA 3FFTA 5CFZA 3TR0A 2PL3A 1MAVA 2CMFA 2GAJA 3CR7A 1DCTA 1KQOA 1VHTA 1J2RA 4C7BA 4EPTA 2BHTA 5C32A 4QUBA 4X8LA 4X71A 3WWEA 3U61B 4H35A 3ZWAA 1G64A 5C46F 1CEEA 1BXZA 1ORVA 1PFYA 1Q0UA 3MLBA 4FMCB 4XKJA 1RXVA 1LK5A 4NJMA 1QS0B 4IYRA 1SKYB 3PUHA 4LF5B 1G7SA 4KNWA 4OQLA 4YRRA 1P7YA 5EJ7A 2VJNA 1QIIA 2PX2A 4JY7A 5G4KB 2GYYA 1GCAA 2O1XA 3H83A 4NBRA 2O19A 4K2HA 3OF5A 3A9UA 3AVPA 4IDCA 1IMJA 3D7LA 1NKTA 2ZRDA 3DE1X 1WIWA 2BM8A 1NN5A 2XQFA 1C3XA 1H0HA 2ZUTA 3S2GA 3AGPA 2YNMD 3C15C 3IAS1 3A14A 3M6LA 4FKZA 3T52A 4BWVA 1L5RA 4Q3KA 1JSZA 1RLMA 1E9FA 1NRWA 1WTCA 1BMDA 3RI3A 3MWLA 2VFAA 4PYMA 4O4HA 4XZ3A 5JAIA 4NP6A 1THTA 3GLIE 1DHTA 2GPSA 1GPBA 3DTTA 3FTNA 2A9RA 4D3SA 2X0RA 1IVSA 1FLDA 2H0QA 4XX0B 5AVTA 4PZLA 3KHKA 1BWPA 1XN4A 2RK6A 2WAXA 2Z2IA 2KMLA 2Z95A 3GH1A 4WN9B 4B80A 5JASA 4NOMA 2REQA 1X1EA 1XUOA 2AZTA 3B13B 3AIOA 4WBNB 5B55A 2EOAA 4ER0A 4TKZA 1NR5A 2BMFA 2JIBA 4EVSA 3EEFA 4OMUA 1N6RA 4ARSA 1K6IA 2JK0A 1W34A 1ZCZA 2HL6A 3KYBA 4PG6A 3SQXA 1RFLA 2AOTB 2GYWA 2JKZA 3BDVA 3F5MA 3K0AB 4WKNA 4I4TF 5A2GA 1C3VA 5KTYA 1EXNA 1HTBA 4W9NA 3AZPA 1T36B 4RFVA 4PFSA 1FDSA 1XLWA 2PZ8A 4W5NA 4N6GA 3ZI0A 2R8BA 4CM1A 1PHRA 1MA3A 3G1TA 4XQ0A 5HF5A 5AVYA 4Y7CA 4J2TA 4MI6A 4EGAA 3HG7A 3MAJA 2E5FA 4WZAA 4B74A 5LZ2A 5K01A 2JIOA 4N03A 5T8KC 4BJ5A 2B4AA 5E3HA 3DAFA 1L5MA 3LIPA 4WIAA 1DC6A 1V3TA 2DJ5A 4GMHA 5ESDA 4RK1A 3AR8A 4BO6A 1OSNA 1BGWA 2C04A 4CPDA 5JIBA 2B82A 3NCTA 2HHJA 3FTEA 3UG6A 3ILHA 4YCJA 3NHRA 4HLUC 2D13A 3W3AA 4UQPA 4UU1A 3PNQA 4ZOQI 1OASA 3GLFB 1JDJA 2O20A 3RSGA 3ZXUB 4BTLA 4EI9A 1LX7A 3RDPA 1N2SA 3WQSB 5F35A 4PCAA 4LY3A 1RDFA 2H54A 2BMDA 2AVDA 4XUDA 2FUG1 1G3RA 4OP3A 3IQHX 2M32A 3LD9A 3AOEA 1T9GR 3GY0A 4JB8A 2YMMA 3M1LA 4GF5A 3ANXA 3KYDA 1W0KA 1LV7A 3O4GA 3HVIA 3ORFA 4WVFA 4GVPA 2QSZA 4XIJA 4GC9A 5FD8A 1PSDA 3BT7A 4WCVA 5FUMA 1M2OA 1P1RA 3E15A 3S2EA 4YJDA 4CIXA 2QN1A 1T1IA 1X7YB 4P1ZA 3AJDA 3EC7A 2COKA 3WGZA 4RC9A 2XWSA 5BV0A 1GA6A 1AK2A 3KELA 1LTHR 1FTQA 2J59A 3MBOA 1VCMA 2QY6A 5IUKC 4HJXA 3AERA 4YCDA 3FPJA 3IPYA 3E61A 1BH2A 1N4DA 4HGZA 3S8EA 1Q6YA 1EFVA 2VK8A 3KOWA 3L02A 3R7WB 4FSXA 4CI9A 1O94A 3OZFA 1OQAA 1KYTA 1DKUA 3BK7A 3PUKA 3W4IA 1HZZA 1LSUA 2C2YA 3GP5A 1U5BA 5JD6A 4CQNA 5BQ3A 4DJFC 1V6AA 2X14A 3PEWA 4TTVA 4Q6BA 1EFRA 4C0JA 2EL7A 4Z4HA 3KTOA 3LQ2A 2AKAB 2QW1A 1PR1A 5CVJA 1FS5A 5EUQB 3VPFA 3ZWKA 3ER9A 1HNXB 5FHQA 2HBRA 3QVSA 4YP0A 5DPMA 1H42A 2GK3A 2Y71A 4DB2A 4FB4A 3L84A 1KDVA 3AONB 4AJJA 3I52A 4GMFA 4GOXA 4IDQA 1VJTA 2NUPB 4K6HA 3Q3CA 2ASVA 4Y9UA 3W2GA 5C1PA 3MC1A 5IZCC 1YFKA 3EZXA 4BO5A 4F3CA 4A27A 4CM8A 2HA3A 2FPRA 1K3FA 2FLVA 5GJCA 1E0SA 2I2AA 1Z5PA 1K92A 4RUKA 3ST7A 3MTQA 2DEUA 5CDGA 3T1YB 1Q74A 1PK8A 4R0NA 1XMQB 4REQA 1ADYA 1RKUA 1FMJA 1X1QA 2NVOA 3C24A 5KQRA 5HIMA 3RVQA 4E5VA 2VHZA 4BOYA 3OCUA 2V1UA 2XCTB 4MKHA 1W76A 1NJFA 2JARA 4OHVA 4BMCA 5T3YA 1UIRA 2FRDA 2Q8PA 2PA3A 1OXBB 2YHAA 3L6RA 4TLEA 2JBWA 4FYXA 1JS1X 4JI5B 1W4LA 1I33A 1RAAA 3QX3A 3MUOA 1K8RA 2W2KA 1N9GB 3DUFB 3KC2A 2H2HA 2OKCA 3HDTA 4JJ4A 3EGCA 4UM7A 4FFNA 1JKFA 2JLVA 1R0CA 1ZUNA 3D6MA 5B53A 4PYRA 4AMVA 5E95A 4NPCA 4AJPA 1OXMA 1FLVA 3HN2A 2FPIB 2YN0A 3M6IA 5KQMA 3EVTA 3LCUA 3EIXA 5IC6A 1FZTA 1KP9A 1R5NA 1BVYF 3QWFA 4RMGA 3UHFA 5C52B 2B4YA 3EIWA 4JNKA 2KWIA 5G0TA 2ZAYA 3I64A 1M2VA 2Q41A 4DLPA 2ZM6B 4KPYA 3DKIA 1JBQA 2QBYB 2J67A 1U4NA 1P2FA 1UMBB 5G0UA 3DO6A 2VHUA 3QKTA 2FJ0A 1CRZA 1N0WA 1WXGA 3H2GA 1E4YA 4FNMA 4LKRA 3WJ1A 4FW8A 3URMA 4W9MC 5L3RA 5KHLB 4JI7B 2IS1A 3I73A 2VP0A 4S2EA 3FYSA 4MV8A 4G5OA 4NEGA 4C08A 4DDVA 1P44A 3F6YA 3OLQA 2PJRA 3KUKA 4OQXA 1T4DA 3WK9A 4EGSA 2BLLA 1KVSA 1W35A 2F4NA 3HEMA 1B7GO 3KQHA 1M8PA 3D6VA 1IXKA 3D6JA 4UBOA 4DW8A 1VLMA 2YWGA 3GAAA 1C0IA 5C1IA 2DR3A 4GQAA 1OLUB 3TZKA 5HW0A 5HZMA 2D2XA 4KQGA 4E2FA 3LKDA 3NTOA 3HR7A 3BHNA 4PRYA 5IJAA 4MUHA 4ID9A 1MO5A 2BR5A 1KI2A 2ZAIA 1C30A 3W2HA 1VHJA 4F3TA 2MINB 3O92A 4D4KA 5CG1A 4GP7A 2WJ3A 1AV6A 1NUQA 4I5IA 4C0BA 1YOVB 1ISHA 3EXEB 5FOUA 3WMXA 5DTEA 1LSSA 4C7XA 3FFXA 221PA 3N2ZB 3PQDA 4FR0A 1ZCJA 2BZ1A 5LCXA 2HMYB 1SK9A 3DOOA 4TPKA 4MQBA 1FMFA 5C1DA 2XAAA 3F0TA 2ZTHA 1NU8A 1XMVA 1XO1A 2BTEA 1VL1A 5DHSA 1OBCA 2H92A 2Y0EA 3HE3A 1I01A 2OV3A 5DW0A 3G2MA 3SXJA 3W8RA 3ZBQA 3HGQA 4MTCA 2OG2A 3GEMA 1YRYE 1AQ6A 4MAFA 3UK2A 1RRFA 3DGFC 1SKAA 3RRFA 4J4BA 3KU1A 1XPOA 4HY3A 4IXWA 1U31A 2ZUVA 2ZBEA 1HH4A 2DTXA 2E18A 1PNOA 2P0YA 3V55A 3R8XA 1GDTA 3COWA 3A2MA 5CW1A 1PG5A 1XL0A 3IAAA 3TUZC 5BRJA 2PANA 5EY5B 1SOUA 3FG9A 1N5IA 3VKVA 3JSXA 3QFFA 4Q05A 3NOOA 5AI9A 1RBMA 3WQBA 3ZZ1A 4L5YA 1PX0A 4TYPA 2IOYA 1KYZA 1MAUA 3MCVA 1UQRA 2FKNA 2C2OA 1YXMA 2QAJA 4IWNA 3B6JA 1HPLA 4CUKA 4ZVLA 2H2DA 2QVCA 2PK3A 4FGZA 4F2WA 1IBCA 2B7BA 1N7GA 4AWAA 4RH3A 1XZJA 1YVPA 3CRZA 3ZVNA 4QOSA 4R2XA 4NVRA 2EEZA 3RC1A 1Q2XA 2ECFA 1NLUA 4TSFA 4QLAA 4D9MA 5KOIA 1LSJA 1X80B 2DUUA 1O0SA 2DF8A 2DQYA 1I5RA 1NONA 2F9MA 3UWSA 3I62A 3KS9A 2QTVA 5AYVA 5E2IA 2P8SA 5HBGA 5FT9A 3TL2A 4BNNA 4DUGD 2C7OA 5BXYA 2NVUA 1J0CA 1H9CA 1ZM4A 4OYLA 3QU4A 1K08A 2FR0A 1YQDA 3H4IA 2IP4A 4KQFA 2ZJ0A 1P5HA 1PR2A 2LZ0A 5JJKA 2HF2A 1MB0A 4XUEA 2Q0HA 4BFXA 1K6XA 3MS2A 1AKMA 3BILA 4WXYB 3GMTA 1WCXA 4B6OA 1HUQA 2FSIA 2AL7A 5SYNA 1DTEA 2P1DA 4C4XA 3I53A 3H1PA 3QQPA 1EE9A 3QXJA 3RS5A 3T3OA 2BFNA 4R9RA 1SUBA 5E6UA 3WXMA 1XAJA 2HT1A 3EXG2 3TM5A 1HZJA 1CZKA 1FDWA 5JNTA 1E3WB 3WL5A 2IFTA 3SLRA 1YH3A 1ISFA 1KQFA 3B2QA 1ULBA 4U0KA 3KQKA 2H4ZA 3FNRA 1DQZA 3OJOA 2VK1A 4NU8X 4PS0A 4C0AC 1FYFA 1KXZA 2GCPA 2JGAA 2XQGA 4FDAA 4KQ6A 3C1AA 4YRNA 5FBVB 5ITZA 1DAIA 2B99A 4R1MA 4BQEA 5DULA 4RPKA 5LD2C 1C4KA 1GN8A 3QJ5A 5DIFA 4A5SA 2IV2X 4O59O 3TM4A 3DW1X 1ENZA 1OV4A 4LXUA 3PE6A 3ND9A 3DV0A 3JWPA 3R5XA 4IGAA 4JWKA 4PLTA 4B3BA 3NVAA 2ZAOA 2P9YA 3GFVA 4V0KA 3STUA 2EDCA 4F6LA 4AX4A 1ZU4A 3TCXB 1XXHB 4R05A 5LU8A 3CBQA 1PNQA 3EFEA 3KRTA 2ZIZA 3FCAA 3OWXA 4FK8A 4JHXA 1P3DA 3SIWA 3ZN2A 4O2RA 4F5ZA 3BIOA 1N1MA 5HQTA 1OX5A 4D9NA 1C81A 2NYUA 3IIJA 1QP8A 2ANCA 3CNBA 1JHMA 4KYVA 3IDZA 4TYMA 3M6MD 2OYSA 5EJ9A 3NGXA 3OJ0A 1TRHA 2XCLA 2Y76A 3N8DA 3HXOA 1XXHE 4R7TA 1RXEA 4JLBA 1XN1A 1XVUA 3KR1A 4PGHA 1Z4OA 3R0IA 2Q9BA 2YXDA 3CKYA 2BEVB 3U7JA 1N5OX 1TT7A 3PYXA 4FE4A 3VJRA 3R6TA 5LOVF 1CZUA 4YT4A 1KU0A 1ND6A 4RQUA 4BZQA 3UT5A 3DEAA 5A5DA 5JZ9A 5ARBA 3VR4D 3FSRA 2NTYC 3ZJTA 4CKWA 3HBNA 3G5UA 4TS4A 4LXTA 3VH2A 5KJCA 3A1WA 3C3JA 3D6AA 3E9RA 1ZMRA 5FOTA 1P74A 5FPTA 2WRZA 4F8JA 1DV2A 2WUEA 1ZG3A 2HHCA 1XFDA 3RBVA 3IL2A 4PINA 1G66A 3IIMA 3TLGB 4DWWA 4WEQA 1IMOA 2J5RA 1DWOA 1U8YA 2IW3A 2PWYA 2DR2A 1DPFA 2PT6A 3DAYA 3WGKA 3FB1A 3E23A 4FHZA 3LVFO 5FLKA 1Z8HA 4EJFA 5BSHA 3ZUGA 4C29A 1E5QA 3B1XA 2Q3LA 3TSCA 4FHGA 5EERA 3CF4G 5DNCA 4J4HA 1I3KA 3GT7A 4RK4A 5JPDA 3JPWA 1TK3A 2BJWA 2AQKA 3S1AB 2OGSA 5JFTA 3VSEA 3QVJA 4BV3A 1NF3A 2WT9A 3DR5A 3EBPA 5ABPA 3D3QA 4KWHA 1NFRA 3F1KA 3K16A 3FTCA 1Q20A 1U7PA 4PQGA 1QANA 5KVVA 4GOKA 1J25A 2QSYA 1NR7A 3N28A 4NC9A 4R8MA 3ORHA 3WL7A 1A9QA 4DV3B 1Y8ZA 1L8LA 1JT2A 4FDLA 1F17A 4KIJA 2ZJ5A 521PA 2EQ5A 3WK7A 2WG0A 5K0ZA 5CCBA 5NLLA 5IVPA 3RYCB 2HRCA 2C5AA 1SQ0A 2IV3A 1M7HA 2CV1A 3QEMB 2C7PA 2G67A 4RL6A 4UM8B 2D4HA 1UQTA 3EXHC 1AHIA 2I4MA 4DM7A 3ASUA 3FRJA 1BDIA 3ROXA 4LXHA 1YJAA 4ARZB 3V48A 3N2EA 2VDKB 3K9WA 4BUJA 3A1VA 2C97A 3OM9A 3FCUB 3OIDA 1N1DA 2ZGVA 3QVWA 4I14A 2IL1A 3MGGA 4BO9A 1CUDA 4CQLA 1O6BA 2QYHA 4TMYA 3IAFA 3VUEA 1HI9A 1L7OA 1JDBC 1E3EA 3FNEA 3T0FA 3VA7A 5DU2A 2G82A 2Q0XA 1WF3A 2NUBA 1IJBA 1TEXA 1WSAA 2QWXA 4LYYA 3AY7A 3FTQA 4AZVA 2VTKA 3RAGA 3AR4A 2K4MA 4A6DA 3E9CA 1X7GA 3DFIA 2E4WA 5E4YA 2KLHA 3DNFA 2NYRA 2VZEA 3BL5A 5DOZA 3NKFA 4TN1A 3COSA 1E3QA 4PC6A 3GD5A 1G5FA 1ETUA 4QTZA 1PGPA 1G8HA 3HWWA 3WWOA 5IF3A 4TX1A 2ZITA 4MQ5A 1PQUA 4OMDA 5IH3A 3T94A 3A2KA 3RYTC 4YDHB 3SFZA 1L7VC 3D7RA 3LQ4A 3DL4A 3HUUA 1UKVY 2OBYA 3IHLA 2DBYA 4KB5A 3LCMA 4QYIB 2WILA 3SX4A 5LFAA 3I61A 3V00A 1NW4A 3C48A 4ZAYA 3ZXSA 2IBSA 3OIFA 5IT0A 3AHIA 2B2NA 4QGHA 4XWGA 4P5DA 3REGA 3EPHA 4KPUB 4OCZA 4QUJA 1G38A 1VL2A 1D03A 1ZSVA 2E1PA 2OL4A 5BYAA 3SU8A 2GX6A 3BF8A 4MCAA 1PP4A 1R6AA 2ORIA 1CNMA 3DWGA 1HM5A 3LY7A 4NK4A 3A9CA 3M2TA 4H4CA 3KQNA 3QP9A 2ZBDA 1S89A 1Z8NA 2FR8A 3RSQA 3MYRA 4R83A 3H75A 1K6MA 3H5RA 2C84A 2WJVA 4JSTA 4ML3A 3VVMA 1C3OA 1T4MA 3EA4A 1W5FA 1E2MA 1NYRA 3L04A 3L8DA 3M49A 3K5PA 2R751 2PD6A 3BIWA 3VR1A 4E2XA 1UK9A 2UAGA 4I6EA 3T3EA 1Y80A 5AHWA 5DWQA 4AJ1A 2V7UA 4Q9IA 3TOXA 5KYUB 2C8VA 1GTL1 1Y3HA 5LZ9A 3HZRA 2XA1A 3D2CA 2GN2A 3THOA 3F98A 4WRRA 1Q7CA 4P80A 2ZI6A 3T99A 4EJSC 1W5EA 4O8CA 1KTVA 1SUFA 3I92A 2GUWA 4KQMA 5BT9A 5C35A 1O0BA 4LRUA 2OGUA 1UJBA 3TNDA 2Z5FA 2ZRHA 5ICCA 5CLLA 4FDVA 3NTUA 3P2IA 4G5RA 4J91A 3EFOA 4OQFA 3NG1A 2NOAA 1WXXA 4K9LA 2YHBA 3NT4A 4P2GA 4DZRA 4B76A 5CD9A 3FF1A 2JLAA 1R6DA 3WLQA 3F7MA 3MD9A 4D6XA 1NX6A 3ESQA 3OP1A 3PGA1 5TVGA 5I51A 2X1HA 1P4HA 5J23A 3PJRA 2EYUA 3WL3A 2FH5B 3ZZTA 4IIVA 3HL0A 5DP2A 3VI4B 3WLEA 2O8NA 1UINA 4RS3A 4HNRA 421PA 1SVOA 3I9KA 4HRAA 4YUWA 1FTGA 1XMPA 3ZBPA 2HA0A 3N2YA 3PL5A 5SZHB 4EYQA 4KXUA 4CMEC 1WB9A 1J21A 4Y2UA 1PX2A 4CL2A 5JRJA 1GWNA 1Z45A 1NAHA 1YQTA 2Y0BA 4MKGA 4B8ZA 2J33A 3OSZA 4E4RA 2O57A 4UDNA 1CRPA 1YL6A 1KTIA 4XSVA 2CSXA 2RHLA 4AZTA 1TPYA 5KBYA 2VJMB 5CFMA 3ESCA 3DBLA 1F9EA 2RHJA 4MA4A 8OHMA 4XFDA 3PUVA 1UZLA 4MP6A 1VJ0A 3PPWA 2HMWA 5JV5A 3U26A 2VPTA 3U9LA 2KE5A 3Q3JB 4N5MA 4ZO7A 2XYPA 1LQTA 4NIMA 5L3QA 1MRNA 2QM0A 5HJ5A 1GL9B 1NP6A 1SN7A 2ZTLA 1ZUD1 4IKPA 5D01A 1CB0A 4KXYA 4EPRA 3V8QA 5AR1A 3HYRA 2QTTA 1AGXA 5AMXA 1GA1A 4V0ME 2BZSA 3W6OA 3GELA 2VHVA 4MR9B 4Q4HA 4DUZB 2IX9A 3D5TA 5LMZA 4RQBA 1JKJA 4OLAA 4H27A 2IUUA 2WIKA 2PS3A 6Q21A 3I4CA 3VAYA 1O58A 4XPIA 3V4VB 5KS2A 4MUFA 4PLVA 3RYHB 2AUMA 5AKGA 3L0DA 4Y7DA 2OC4A 1C41A 5DGCA 3JQGA 3DV2A 3FCEA 4MV1A 4AULA 5I7RA 4OU5A 1O5OA 1DARA 1Y4AE 3GRCA 4KN8A 5BUQA 1U1FA 1R9GA 4TKLA 4TKVB 4ZOEA 4YAIA 3KZXA 1YK1A 4JAVC 4X61A 2C98A 4E5DA 1WMSA 3WDLA 2R8ZA 4LHZA 5JNSA 3K2IA 4REOA 1JB9A 4KG7A 2UYHA 5D7NA 2OWEA 4K9QA 5LBUA 2V3VA 2P9CA 1VG9B 2V9PA 1JPNA 2Z8ZA 1P9RA 2N1BA 3EB9A 4TV9A 3OPYB 4H1UA 2MTBA 1QTNA 1FX0B 1NI3A 1GYRA 4FGUA 2Q8QA 1N5DA 2FRVA 4RTMA 2P30A 2QQGA 3AW9A 4U7WA 5EQJB 4LJYA 4XLLA 1D1SA 5GOTA 1RJFA 3PG5A 1U3DA 5AQ1A 3DHEA 1Q0SA 1X15A 2F48A 5K0JA 4CLXA 1UBLS 4QYWA 3LLUA 2VTDA 4YCMA 3VSCA 4L5CA 3QFRA 4ZYZA 2I76A 3HP4A 4HEHA 5D7BA 1V6SA 3HLTA 5CT5A 2RG7A 3DEYX 2IS6A 4TVOA 3PFWO 1BSVA 4Y1EA 3BXZA 1EFUA 2BZGA 3OG9A 5EEGA 4BDTA 4QQ8A 1DC4A 3T9BA 2C9CA 3G2NA 3IEIA 4WK4B 3UJ3X 4WD3A 4TS3A 1NW6A 2DULA 4PZAA 4HGOA 1FFGA 4Q03A 1W9HA 2M1XA 2VHYA 3NATA 3WBBA 1UMCA 4QYMA 4XQEA 3LDUA 3EODA 3HXTA 5CCDA 3DDWA 1VHLA 3KT0A 3EG5A 3H8SA 4JV5B 4CTOA 1WZCA 4ACBA 5BR4A 3OJEA 2I8AA 3CA8A 2JNWA 1NNUA 4GWKA 1B1CA 3W7AA 4C5BA 3BXOA 3JSAA 4RACA 2XKKA 5KWEA 2WY2D 2LPMA 1LI4A 1AN0A 2PE5A 1OYWA 2BFBB 4Y8VA 1ZD1A 1E1MA 4OO3A 2XVZA 1KARA 4OQEA 4OMFG 4OA8A 1RWQA 5EWLB 4O33A 1L5QA 4FT4A 8GPBA 1TI7A 1XZMA 3Q8XB 4GBED 1L1EA 5A3VA 4K9DA 5CRIA 4PLZA 3QWBA 2RBEA 2R44A 2PKEA 1NF9A 4GBMA 3KB2A 3PB3A 4PHFA 4WY5A 4Z4QA 1E77A 1NU6A 2QL9A 1WOYA 4Z5XA 1NOKA 4YREA 3RWMB 4CIWA 3FWHA 4M1EA 4P3KA 5F4ZA 4I3FA 2HXGA 1H2XA 1HNWB 4UATA 4DQLA 2PEZA 2ZBQA 3FXAA 1AQUA 1C9KA 1EBBA 2PWPA 2YV4A 2VNKA 3QYAA 2ISCA 2QD5A 3KPYA 1I32A 3VR4H 3TIVA 4EVIA 1XAGA 3EQZA 1M1NA 1TVKB 2XUQA 1CR4A 5KDDA 2C2BA 3MTBA 3MINA 4UHCA 5ALWA 5H81A 1DU4A 2JKYA 1ZM7A 2AG8A 4ESEA 1TJ5A 1QP0A 4BPBA 4IAOA 3SK0A 6LDHA 3ZZNA 2JJ1A 1G9TA 3AZQA 4W1SA 1NMEA 1Y1PA 2I03A 1LLFA 1QOPB 3EQ8A 4A1OA 1N5KA 3E05A 3GWZA 5EJEA 4JQSA 5KTKA 3FYHA 3RS8A 2I67A 3R3VA 1F6WA 1E4OA 1JHQA 3FPGA 2PSHA 5DN9A 5C8YF 1ZVQA 2EWWA 5JQGA 1YB7A 1JFSA 4N49A 3JQ8A 3M4ZA 2XB6A 4Q1DA 2E7ZA 4U2DA 1S2IA 3GVCA 3K0CC 3O47A 2SCUA 4PTLA 1GNPA 4DXAA 1GNRA 2F6RA 1KI3A 2QUZA 4TVBA 3RIXA 1HYQA 1UMKA 1V8OA 4MGZR 4EGQA 2YQ5A 3QPWA 3QKRB 3WQRA 4M1YA 3LQFA 1NI4B 2CF6A 2P67A 2I8LA 4U4AA 4BNWA 4F3YA 2JI4A 3IUJA 5T4FA 1E7SA 4X1OA 1SEPA 3RRJA 3AHGA 2QA5A 3CS3A 5EHXA 2VCEA 4CETA 3GLGA 3HBAA 1YQWA 3ZE1B 2QL7A 2DB3A 1JV2B 1FFWA 2JD0A 3ICPA 3K20A 2N46A 4HVAA 1BKYA 2KBEA 3E1GA 2AX4A 2BLNA 3GU3A 3N7AA 3BGWA 1DBRA 2A3NA 4JB2A 1G8KA 4N8SA 4UDOA 5I47A 3A4YA 3HXPA 2C2WA 2M6SA 3F5DA 3PENA 5TT0A 9LDTA 3CMCO 5AM3A 3O8QA 5JSKA 3AHDA 1IUKA 1E79A 3MK31 4IILA 3GRYA 1JKXA 5JNWA 1YRAA 2XBLA 4HDNA 4RTRA 3TPCA 5TS3A 1XCBA 2CWWA 3VV2A 2OBLA 4BMOB 5KC8A 3GYGA 5FCDA 5I7OA 1NP3A 2CUTA 3QKSA 1QCDA 2HMUA 2Y6UA 4FT2A 4R2HA 4HLDA 4MROA 2NPIA 3A1NA 3IHTA 1EBUA 3BWVA 4C20A 2XIQA 3OM8A 2YXBA 1FUKA 1FDOA 3ICOA 4AWXA 1XD8A 2IPAB 4HMOA 1P2SA 4DPLA 2AW5A 2W0MA 5DNWA 3FYTA 3BB4A 1TK2A 4HX9A 3ND5A 4BU1A 1JFTA 2ZJ3A 1NBOA 4F8EA 4HNAA 5B1YA 1JHUA 1SRRA 3IUNA 3UB2A 1YL7A 2HA7A 2VN8A 2Y1DA 2J4DA 2ECQA 2R3SA 3GK3A 1TT5B 1ZUIA 1ZZEA 1R6TA 1L5VA 2C4NA 4UXIA 2D1YA 4ZCQA 3ZHUA 4ETMA 2PR7A 3W06A 1SZPA 4DGQA 1UPCA 1JF8A 3L1IA 5BN3A 4BXOB 2W7TA 3O82A 3OTHA 2FSVA 4L7VA 4XPZA 4YUAA 5AUOB 1N2CB 2ZR9A 2PTGA 1KKLA 1MEEA 2EF1A 2G3YA 4PIPA 2H57A 4GZ5A 1EEXB 3D81A 1EK1A 2EP7A 3GJRA 1GXSA 3KTAA 5FFMA 3LXUX 3N8IA 3N0TA 3LSTA 3OTGA 4BLOA 1PN3A 1FP6A 3K9QO 1Z82A 4MVJD 3SZUA 5AI5A 1E63A 5A9SB 1V4NA 4QATA 1Z4JA 1FFDA 1SQ6A 2HSZA 1VBKA 2P3OA 4KP7A 2V45A 2OPHA 2EVWX 2Q5LA 4FNOA 2R8YA 3H99A 4W9RA 3TEJA 5J2UB 4XVHA 2VF8A 5K8IA 2JGLA 4P3XA 1AUPA 3GEEA 1JLHA 4XLZA 5UKDA 4UHEA 4D79A 3L2OB 4X60A 5CDUA 4WKCA 1AV7A 1TF5A 2J0EA 1K7CA 1E9EA 1SHTX 1ZH6A 1Z83A 2I6TA 3LFHA 5KTOA 1U0JA 4ZOLB 5LQCA 3EEBA 1Z0SA 4HP8A 3UH0A 3IP1A 3GVPA 1NVEA 2XOXA 4S1OA 3TNLA 5KMGA 5LYJF 2EP8A 1ECLA 3TCNA 2BI7A 3PGMA 1XDUA 3E4DA 4UVEA 2SKCA 3O5AA 4HNQA 4CKZA 2G1PA 1A9ZA 1GFWA 3BJZA 1IRXA 3PC4A 4A15A 5EOVA 4KPGA 2D1FA 4LJ4A 3UHJA 1PJZA 1Z0ZA 4QODA 3L93A 1AZWA 1ZNWA 3TLJA 4P6VF 3LWBA 3IMKA 5AOAA 4G0XA 4IUBS 4QGBA 4UCXA 5T4HA 1C2TA 2HWYA 5B1SA 5IXSA 2QGZA 3A3PA 5BSEA 1IFXA 3UY4A 4CG3A 1XEXA 2GGSA 1QYWA 4X95A 1ZR4A 4CM9D 2FPSA 2XY4A 4BB5A 3AY3A 3VNRA 2HNAA 2EJWA 2WT8A 4AF7A 1WHSB 2A84A 2O7QA 3JQ7A 4NDNE 5BN1A 1KFJB 1UEXC 5JAPA 2WFMA 5H3CA 3ANMA 2D00A 1ZY2A 4JX8A 4FXOA 3T7CA 3UXEA 1C7RA 1DB3A 1ZKDA 3A9RA 5IDXA 3F2IA 2XKAA 2DHEA 3LHFA 3PFIA 4R3UC 1AGPA 3M1IA 2HGZA 2NSLA 2XVXA 4MXDA 3SJZA 4DNOA 4FZRA 1B42A 3ROKA 1G18A 1U7DA 4XI9A 5AOVA 1KYVA 3KJQA 3TXAA 3TG2A 1N6KA 2OOKA 3P9CA 4KKVA 4KVZA 3E84A 4W4TA 3VR0A 9ABPA 5JZSA 1X19A 4GGMX 4N40A 5A0VA 3ZG6A 6YASA 1TNDA 5DM0A 5AQEA 3MBIA 4P92A 5CLJA 5EYPA 1E7YA 4LJAA 4BE9A 5H8WA 3LF1A 3LCVB 4H31A 2FXIA 3HV0A 4X3PA 1YACA 3TEFA 5KWJA 1CNEA 1JBKA 1AU9A 2XX3A 3E82A 4EYEA 4FWTA 1J7KA 3OJXA 3WJ7A 5FI1B 1A69A 4GR9A 4R6XA 5IWAB 3FIUA 1Q22A 3RIHA 3HCDA 1JWBB 3B3AA 2FDXA 3V4LA 1ODSA 2B5OA 2H5LA 2VHXA 3HO6A 1CQWA 1HETA 3N0XA 4I36A 1G20A 3I2IA 3V4RA 2GLXA 4XIIA 1JR2A 3PPYA 1QYDA 1U0RA 3GA5A 5FWXA 4RIHA 4PTZA 1LI5A 3OHPA 2FMFA 1XDBA 1YMQA 1I24A 3KJIA 3HCCA 5JARA 1H93A 2R1VB 5CYPA 4ZYVA 3IR6A 5CFNA 5L51A 2CSUA 5C5DA 4B3SB 1DAOA 2ODNA 1BMTA 1E2DA 1GUZA 1ACJA 4AICA 1ODIA 4G0ZA 1W2HA 1ISRA 3Q3HA 4QBHA 4QTTB 3A6KA 1VI6A 1LWOA 4POAA 3K96A 3OFVA 1P1KA 1QPBA 5F5NA 4YRPA 4A0SA 2V7XA 2UZAA 4KE9A 3WZMA 2WUGA 1GL7A 1GIAA 3FNQA 5C5CA 3NDIA 1W4CA 1A8UA 4O02B 3W7VA 3ADPA 1U8EA 3O83A 1OU0A 3FNGA 1V7PC 1NY6A 4NJEB 3BGOS 1O0CA 4CKEA 3JYNA 3VOBA 4RCVA 2IF0A 3IMCA 4PXSA 2RAVA 5KVQA 1B6RA 2IDJA 1FNMA 1XL1A 2AZ4A 5JSZB 2AFIB 1N0VC 4KO1S 3A3KA 1MC8A 2GJKA 3IMGA 3BQ9A 3OFNA 1ITZA 1G3QA 2V6MA 2QNRA 1YI8A 4XCVA 3RVPA 4YMGA 4RLQA 1TUGA 2BAGA 1X7ZB 4I50F 5CYOA 4RJTA 1TYZA 1WETA 2QPTA 2YWHA 2JFVA 2V3WA 4B3JA 3SQOA 3U37A 1CEQA 1VB3A 2F1HA 5HQ3B 1DCMA 5EMHA 1ZH2A 5E8JA 3CWZA 2AFIE 3C4JA 3RQIA 5KKCA 4IWYA 3BMCB 5AKZA 4AZ0B 1E6EA 1M6HA 1TZJA 3MRXA 3IUSA 3VOTA 3W5SA 5ADVA 2FUCA 5I7VA 1H4SA 2IEAA 1O08A 3DD5A 1L5HB 1O89A 4ZRNA 4YCCA 3BKWA 4ISCA 4Q01A 5LZ8A 1I7LA 1MORA 1L4KA 1ZCAA 4G81A 4PN7A 4FFRA 4F0JA 4JVLA 4ENWA 5ICEA 5ELXA 1YQGA 2CDNA 2QGFA 1R4MA 3LCRA 3M4JA 3OFKA 1NX9A 2GRJA 3GQBA 3MHPA 4FLFA 1E2QA 3TK1A 4DA9A 1CY7A 4YCLA 2GEBA 5BR8B 4WKPA 5DV9A 1SUDA 4HDSA 1U1DA 1JLMA 3D4BA 4IMPA 1R8JA 1TMGE 4LAFA 1Q7GA 5JSHA 2Z3ZA 2GB4A 2ZVJA 5LBIA 4QZVA 2YJ5A 3L8MA 4G56A 5JVDB 1NXXA 4JC0A 2B5WA 4WECA 3WLJA 1SXJA 1V8FA 3DDHA 3E18A 2G0NA 4IL5A 5FKJA 2AFRA 3BTUA 4HGYA 5EXXA 4PE5B 4R1OA 4CF7A 1W0KD 1XP5A 2RMKA 4MW1A 3CPEA 3DZCA 3U4DA 4CHGA 5IAAA 1FVOA 5H4HA 5CVUA 1FTYA 4ALLA 2XGJA 1TKRA 5LN1A 3TW8A 3DTVB 1GHTA 4CUZA 1SC4A 1WKCA 3C7DB 5GIOE 2QD2A 5GGYA 1DNPA 1E4EA 2C31A 3FZGA 3OBIA 3IBTA 4Y2YA 3AKDA 1R0LA 1B0UA 4MKIA 2RCYA 3I37X 2OYCA 3GLQA 1UBSB 1VSBA 3IFSA 1U7WA 3F3KA 4KWCA 1G16A 2OCBA 1OT3A 1GKUB 4MVJE 3FZEA 1O94D 1R0YA 1Q1EA 2J4FA 2WD7B 2WSSA 4KGDA 5BOSA 3CTMA 4KCGA 4X62B 4YAKA 3K6JA 4ZIRB 4X1KA 5GZ1A 5DSZA 1VPTA 3FRHA 1XNRB 2AOUB 3VKHA 2IVZA 2ZBPA 5DK4A 4EGJA 4ZDKA 1GUYA 4D0RA 3NTLA 1DIGA 4BUCA 5BWMA 2IYFA 2KS6A 2D06A 2C5EA 4RVFA 3MOGA 5DCWA 3KETA 1EWKA 3G02A 5H02A 1B3BA 2PV7A 1RXSA 2E6KA 4JP8A 3T7IA 4A0HA 1DEHA 2JI6A 4GXNA 1E1YA 1HDZA 4Q1EA 1EUDB 1AQYA 4A10A 3U2QA 2R7NA 2WM9B 1P2BA 3A36A 3GNSA 3X2EA 4JVMA 1VPEA 2OHGA 3KAQA 3H1BA 2VKQA 4PAGA 3D8UA 3L7CA 1C80A 2Q2WA 5AVOA 4G8BA 2PMDA 2CC2A 1FP4A 2YQ4A 2DXIA 1FRVA 3ETLA 2QRJA 1E2KA 4WL0A 5EUBA 3IP5A 1QHFA 2ZSEA 1L9KA 3EZ9A 3I6MA 3PDHA 3L7OA 4N01A 3WV4A 4WZBA 5LMUB 5F52A 4CQJA 1T26A 2YMPA 4I6JA 5TPWB 3FGOA 1XF9A 3KEQA 3INYA 4GLFA 3MGBA 1FJHA 1NVBA 1R3DA 1L7EA 4ZEOA 1G291 5K3FA 4J6FA 4BC0A 3SD7A 1VE1A 2BDTA 2E4XA 4FNGA 5KTPA 4AM8A 4TS9A 3CUVA 1IJFA 3UJNA 4HGRA 2BCGY 4CGYA 1SCAA 2GZSA 4Q3BA 1UKYA 3KXLA 4ZYLA 5AHKA 2BBTA 2QIPA 3JQ6A 3QPUA 1OMOA 4DS3A 4KQJA 1A7KA 1AS0A 3CLSD 3EUAA 3PUYA 1J2EA 1SBZA 2QN2A 3UA4A 3W0LB 4YT2A 3R6LA 4YJ3A 5LXTA 2BH2A 3LCCA 4AUKA 3ZIUA 3N2NA 3KSAC 2ZRAA 2O0LA 3IRVA 3LP6A 4M21A 3WADA 4KGZA 1JQJC 1VCIA 4NJMB 3KB8A 3FOCA 4FW9A 2V96A 2ZB3A 2IY7A 3QUAA 2C0QA 4OUKX 4PC1A 4G5HA 4Q4DA 4YBZA 3THXB 2GN9A 3DM9B 1CQIB 1XTQA 4G84A 4BAUA 3FLMA 4M1WA 3Q2IA 1GFIA 1KSFX 4DV2B 3SDSA 3BORA 5BNZA 4HT3B 3KEMA 5CDFA 3RFVA 1PT6A 3TMYA 2QN7A 3WZ2A 1UBRS 1VGQA 3KU4A 5CPFA 2V65A 4EELA 5CA1F 5KZMB 2DLCX 5JD4A 4HWGA 2R1TA 3M82A 4HN9A 1UAAA 4K8RB 2I91A 3HCAA 2R2AA 1PJBA 5K8UA 5HFJA 4JLKA 4N3NA 4F45A 1KJYA 2CCGA 1O54A 3QI2A 4ZQGA 4L0QA 2HW8A 1KZ6A 1NLMA 1M9NA 4JYMA 4MVJH 2Z8YA 4RXMA 5JTTA 1A1VA 3MGKA 4E2YA 4ZODA 3PXBA 1C8BA 1ZM3A 2ZDGA 3CEPB 3H5AA 4O4HB 5EXDA 3TIIA 2R4TA 2GARA 2F17A 3BEOA 1QIFA 5CP8A 4P82A 2MIIA 2NPOA 5B30A 4NBKA 3TGLA 3VZPA 3MERA 1O6ZA 4C43A 4DA6A 1ZGHA 2QTZA 2QT9A 3CLRD 2F9LA 4NMHA 1GKIA 3IP6A 1WXFA 2REQB 2PO5A 4MUAA 3ODPA 1T6YA 1KSJA 3DWEX 1FSSA 2WNHA 4WAUA 4C3OB 4HAOA 4CCYB 2C1ZA 1OPXA 1Y3IA 2A14A 3CX8A 3I04M 4WOCA 1BDMA 3IALA 1B15A 4XYEA 5AW4A 3A9SA 1IY2A 4KWTA 2NW6A 2Q46A 1DJPA 2ZBVA 2RI0A 5EIOA 4EF5A 2DPHA 3TD9A 3FCOA 1EVQA 3AX6A 2IZ1A 3C5CA 5MN6A 1E6CA 1IHPA 2ZIAA 4YYEA 3OOJA 3LY9A 4AJEA 1PFKA 4M3NA 4A2WA 1BX3A 4GX2A 4LX8A 4YS6A 4WZAB 1Y8RB 2DQ4A 2AH5A 4IDAA 4KVGA 1CDZA 1SBCA 3RO7A 5KSWB 3CKMA 3QA3E 4JWTA 3IBYA 4NXNB 3VZRA 1ZK3A 4RKFA 2OYRA 2MSDB 1C4WA 4FOOA 4MI9A 5LQSA 3TRFA 3UV6A 4JI3B 2YOGA 1UFRA 4CJXA 2ZYRA 4GX0A 2CMDA 1F5NA 3ZVKA 2POQX 2WC1A 1U4OA 4WZAE 5DM4A 3NHZA 4UDYX 3S2YA 5DT2A 3A1CA 4KLNA 3OD1A 1U0OC 1NLYA 3CNLA 4FMCF 3V4PB 4QPCA 5AK3A 3UGKA 2QUAA 5ALSA 5KO2A 4DGSA 3P9PA 1WXDA 3VU1A 1EUYA 4FVTA 4NBVA 3LUCA 3KYDB 3DL2A 1QKKA 1ECBA 4L15A 1XZKA 4NABA 4OJQA 3VYTB 4P35A 1E94E 1ZIYA 1XZPA 4L76A 4I3HA 4TSFD 4DIMA 4E1AA 5JAOA 1OUMA 1MEOA 1M2OB 2X9QA 4M46A 1CUJA 5JDIA 4J94A 2V7TA 5ARDA 4ZV7A 4BQNA 5IBRA 2BEUA 2GPWA 4UU7A 1D3AA 5TMEA 4BGDA 1VE9A 4QM6A 3A2LA 2A33A 1DLJA 4PGFA 3NGMA 1VXOA 3LZDA 1XZHA 3Q3EA 2FUG6 4RV9A 5D00A 3WHIA 1NJ8A 4CW7A 1WZIA 4DV7B 1SB8A 4GU5A 5EZSA 3CEMA 1JIUA 1EFVB 1U28A 3GX1A 4KFTA 4HNVA 3QU7A 4E15A 1U81A 3KALA 3G2QA 4QRDA 1E6WA 4JXZA 3W2FA 4DUYB 4CV2A 4TWIA 3H5OA 5B2FA 3FPCA 2UUCB 3GF4A 3HY4A 4CMJA 4A0FA 2O8CB 4N9WA 1UT5A 3HU1A 1OYOA 3HBJA 4XM1A 1DKLA 1WW2A 4MAMA 4D4JA 4ZZ1A 5IJWA 4ZALA 3KP1A 3K2EA 1W5TA 7MHTA 1IBRA 2QRGA 1UOPA 2M6LA 2RGNA 4M8IA 4FR2A 4S1NA 5MGBA 1ZVJA 4CF3A 4ZQIA 1LFAA 1SXPA 4QBTA 5BOVA 2KM1A 2Q6OA 4RX1A 2CD9A 4XTCS 4E5SA 3AEKB 5CH5A 2IH4A 4BGVA 1DDOA 1CW2B 1ECPA 1XVIA 1JU3A 2O2ZA 3ANNA 5COQA 4XUCA 2ZPAA 3CIFA 2NG1A 2BSXA 2WF5A 3AB7A 1H85A 1TW3A 2HF7A 3QE0A 1A97A 1BWSA 4WNAA 3BFPA 3FPSA 3HDVA 3LC7O 1NVTA 4NZNA 4MUKA 2IU0A 1CIPA 1D5WA 3M6UA 5A7HA 1L7BA 5CT4A 4YYZA 3DBIA 2ODWA 1VCNA 4EVRA 2YWFA 1NM5C 2QI9F 1R88A 1TTPB 2O14A 3H7IA 3KO8A 4NESA 1LUAA 4UTZA 4PONA 3RUFA 4CMAA 2W2KB 2XGGA 2YRFA 4YY3B 1W4BA 1YS7A 3H0CA 2QZSA 4B4DA 1ZUNB 1OWPA 3W5JA 2AN3A 1Z6GA 4H6XA 3FTPA 2QVYX 3IKMB 3ZDYB 3HVKA 4X90A 5J4YA 2BEKA 2JVKA 4UM9D 3NWOA 1KE1A 1MC1A 1HE8B 1YKFA 4W82A 1DBVO 2EF0A 5HZKA 3NMUF 2IYPA 2P9EA 2CLSA 2DECA 2GAAA 1B00A 3WFZA 4A82A 1EJBA 5K3OA 1QQAA 2IZOA 1M2VB 3AXSA 4MVJG 3PHGA 2QMUA 1Q1GA 1KVQA 2VJKA 3NUQA 4QLOA 4B81A 2BFEA 1FFEA 2R6ZA 2AD1A 1G3IA 1T9AA 1UDWA 3AFHA 1LLUA 1Q14A 1DZ3A 2EP5A 2GRUA 3IILA 1NUAA 1KNXA 4WWHA 2IH2A 1N1EA 1TM2A 3FDFA 1AKTA 3L4BA 4K88A 3TB4A 4XOUA 2QR5A 1L3CA 2IPXA 4POOA 4TLAA 4W63A 5TJHA 3U7QB 3U4HA 3IVMA 5BQXA 3FUVA 2QN6A 4D9HA 1ZXXA 2EGHA 1IK6A 1U5CA 2CXNA 2JGKA 1PGNA 2QSUA 3JARB 3KXDA 3BRSA 3F7OA 4ZO9A 1U80A 4XWWA 2ZBGA 2BMVA 3IQZA 4LBVA 1GPWB 2Z5VA 2A0XA 5J5CA 2X1MA 3FYUA 1PDVA 3N2GA 3IJEB 4LDAA 1D9XA 1JQKA 1OIXA 3D9QX 1EAYA 1JALA 4TN5A 4AJ2A 1CRQA 5GP1A 3PUIA 4O1HA 5IAOA 3OZSA 1Y4ZA 3NOQA 5FQNA 1NI5A 4K05A 3TFQA 4BRUA 2PSFA 3MWEA 3QELA 1T1EA 1TAHA 3KDPA 1Z0IA 4G1FA 4FIDA 2F4VB 2XDAA 5BMOA 2DKFA 3EN0A 2XMGA 1C30B 4I19A 3VZBA 1CDDA 5TS2A 2AX3A 1M6VA 5AW2A 3CSDA 3NV9A 2OBNA 2C7QA 5JBQA 1CE8A 1KI1A 3ETEA 1U2DA 3BVPA 3M83A 4LCBA 5H83A 1QDUA 2COUA 2ZJ7A 1Y5RA 3KQMA 4WOBA 4ZANA 4WLUA 4KXVA 4C6RA 2MDTA 4OTZA 2IUTA 4P3NA 5P21A 1ZMBA 4MSUA 1UT8A 4W8HA 1T10A 3VKFA 4A23A 3QOXA 2G36A 3ISTA 2OO7A 1A9PA 3CRNA 1PVVA 2EJCA 4IOLA 4M1SA 3KOZA 4BGEA 1L7MA 2PFSA 1V3UA 3ZWXA 2YRXA 1RMYA 2QJWA 4K1XA 4MRRA 4PZ9A 3CURA 3MCZA 1I7NA 1BO6A 1Z38A 5B3JC 3KD2A 1P0QA 4PYQA 1V9SA 1YJQA 4NKRA 1Y82A 3PUZA 5KVSA 1KJJA 4XGRA 3B5IA 3Q8LA 1YS1X 1H1TA 4AKSA 1EFPB 5EPEA 1R4AA 2OBMA 3SJCA 3FBGA 2IYLD 3CW2A 1XVVA 3KKMA 1O8BA 5D6NA 3B6MA 3RYIB 2QN3A 4CCAA 2QG9A 3KSDO 3O4RA 1EVZA 1SBQA 4LQLA 4N1AA 2ZB7A 1WUYA 1YRBA 5FO0A 2H1WA 3K70D 3KZOA 3PUWA 2NACA 3C6XA 2EFGA 4YC7A 4MVJP 3TUJC 2BJVA 3UAVA 2JRLA 5IAJA 1PG0A 1H9BA 3A06A 1NMYA 4EHFA 4R9SA 5BUSA 1DJNA 1SUAA 1N75A 1VHWA 4DLZA 3SE0A 1ZC4A 3UWPA 2J09A 2WTUA 4MRAA 4G4GA 2WNIA 4B48A 1B2LA 1GU0A 1WA5A 3K1AB 4Y6QA 3UB3A 4BNJA 2OLKA 1YZVA 2V7QA 3RTAA 3TR5A 2IU4A 2QTVB 4WBXC 2AUTA 3ZY6A 2W4QA 1KYIA 1Z5UA 1ODLA 3LBAA 4BTVA 1ZJWA 2GZHA 4NYMQ 1X9GA 2J4CA 2BEJA 4BB6A 1PL6A 4I99A 1T8YA 2H65A 1T35A 2HY7A 1YR9A 1VLJA 3MVEA 5F12A 2VNJA 2P27A 5TQ2A 1BHO1 4TWRA 5EKSA 3OQ6A 3KQYA 4D8UA 2I2WA 5D84A 1AE1A 4ZCMA 4RDIA 3T7SA 2ICAA 3ZCRA 4EKDA 4YROA 3M4YA 3PQ4A 3E7XA 1KE2A 2R4QA 2J32A 3BTOA 5D1NA 3I01M 1DFIA 5CCXA 3OZIA 3CZMA 4EJ2A 3TX6A 2C1EA 1NL3A 2DUMA 4IIXA 4EHJA 5HKAA 2GO7A 2JJ8A 3WLKX 1NLZA 1QF9A 3CRVA 5H80A 4LSMA 4N7RA 4EPXA 1XTJA 1SUWA 3KQSA 2AJTA 1CCWA 1PIWA 3BZWA 5U1PA 4FGSA 2Z08A 4IUCS 3OZ7A 1JSCA 4B09A 2IDMA