2BJHA

Crystal structure of s133a anfaea-ferulic acid complex
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHALGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPADEGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords FERULOYL ESTERASE A
publication title Probing the Determinants of Substrate Specificity of a Feruloyl Esterase, Anfaea, from Aspergillus Niger
pubmed doi rcsb
source organism Aspergillus niger
total genus 92
structure length 260
sequence length 260
chains with identical sequence B, C
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bjhA00
5AKZA 3H1BA 3DCNA 1ZGBA 1DINA 3PI6A 1YASA 2BUAA 3G7NA 1RYYA 2ZJ7A 5JIBA 2G63A 3WZMA 3FCXA 4HXGA 4B85A 1XRQA 1LPSA 4DIUA 1ZI8A 2GBIA 3AUKA 1CR6A 4GEGA 3GROA 2WG1A 2VQ6A 3C5WP 3E4DA 1CPYA 1HKHA 1Q83A 5AIBA 1RP1A 3DEAA 5ALRA 4Q82A 1JMYA 3WKBA 1XZIA 5CT6A 1JMKC 3QH4A 4BVJA 1CLEA 1N5RA 4ARAA 1P0QA 1XRLA 5FV4A 5ALWA 3HZOA 1XZMA 4JEIA 2V97A 4ZI5A 4ZV7A 1W1IA 4G9EA 2RONA 2XUGA 4CG3A 5K3CA 2W22A 2OCKA 1WOMA 4X71A 3IUQA 5K3FA 5LYYA 3O4HA 4LXIA 2BCEA 2CUTA 3F8SA 2ZYHA 4YK7A 2PKYX 5FPQA 5I7UA 3GA7A 1AGYA 5IVKA 4KE6A 5A62A 2QZPA 2HU5A 1SCIA 3HJUA 3WYNA 2WM2A 3WWDA 1CVLA 1W6RA 1UT6A 1YAJA 2RHTA 3ZLUA 2I3DA 2JGKA 1H2YA 1XLVA 3D2AA 3LIPA 2WHPA 2WU4A 3VVMA 3AINA 3EIOA 2OCLA 3EF3A 3KSRA 4AMYA 5KWJA 1QIGA 1EDEA 7YASA 1THGA 4L72A 3BF8A 3KOOA 5C8XA 5FPPA 3ESCA 3R3UA 1X2EA 1TCCA 5IVHA 1YCDA 3UMJA 5CURA 2QUAA 2ZYRA 2WIDA 3PFBA 1ZD2P 3FSGA 5K3DA 3F98A 3WKDA 2DCMA 4JH0A 3WL7A 4UHDA 1ODTC 5A71A 1DT3A 1GKLA 1L7RA 4L0CA 1XQXA 2GBGA 3DL7A 4HTAA 2YH2A 3AIKA 5HCUA 2J4CA 3HXKA 4EUSA 3PUHA 1KU6A 4BBZA 5LZ4A 3OC0A 3O95A 5FOQA 3K6KA 2VT7A 3AJAA 4G4GA 4Y7DA 4GWLA 4DYHA 2WUGA 4UUQA 1HLGA 2B20A 2PUJA 1CUCA 2WUEA 3IURA 4OU4A 3HSSA 1OXMA 3CCCA 4GW3A 4P08A 4B81A 4WDRA 4DNQA 1MN6A 3ESAA 2ZYIA 3PFCA 4EB0A 4BAZA 2VJAA 5JANA 5EIHA 1ISPA 3WIOA 1QE3A 1VZ2A 5JAPA 4C88A 5JZ9A 2LIPA 1XFDA 1QFSA 1XRPA 5LZ8A 2ZSHA 3V1MA 3WZLA 1WHSA 2X76A 2QJWA 3DNMA 1CUSA 5EGNA 2XMRA 1JJFA 1CUZA 2GYUA 4DNFA 1XZEA 2XUHA 1LZLA 1LPPA 4BE9A 4X91A 5JAUA 4MQMA 3U0VA 3VDXA 1TKRA 3LCRA 5T4EA 5ESRA 1T4MA 1VXOA 3PDCA 1CUJA 1EH5A 3QPCA 3T4UA 1CUUA 1DWOA 3FWHA 2HIHA 3GFFA 4QEKA 5FUMA 3EQ9A 3A6ZA 1MX5A 3QZUA 1E89A 5JZBA 5D7BA 4K2AA 4IQ4A 5KREA 4EBBA 1ETHA 4N5IX 4M0MA 1XRNA 1WM1A 4QZVA 5ALYA 4BE4A 5C81A 4U2BA 5AI6A 4JUIA 5KBYA 4EY7A 1XRMA 2B61A 3FYUC 1AUOA 5JASA 2XB6A 2YASA 4MQLA 2VEOA 1VJ5A 5AM1A 1QGED 3AIOA 1J07A 2NW6A 3VXKA 4X7BA 4H7JA 2K2QB 1QIIA 1BS9A 3AZOA 1EDDA 3DJYA 4BYMA 2H7CA 1QOZA 3IULA 1LNSA 4ROTA 4S0XA 1UK7A 1A8SA 3BF7A 5AKEA 3IUJA 4EY8A 2CB9A 4HZGA 4B84A 2QRUA 4AO6A 3HLKA 2DR0A 1ZJ4A 5BOVA 1XZDA 5LIPA 1A88A 4EY6A 4FNGA 5ALJA 4AO8A 3JWEA 2WUDA 2HHAA 4IH9A 5CBKA 4X93A 2IIVA 4W9RA 3G0IA 5LKAA 4BB0A 4U2DA 2X5XA 2WFZA 4M0FA 3PUIA 2ZYSA 1BU8A 3I2GA 2J4FA 3DOIA 3WQHA 5EIEA 4KAFA 4OSEA 3BDIA 5HQ3B 2R8BA 4KAAA 3CXUA 2B9VA 5AM4A 3WA7A 3STUA 4DSZA 1E5TA 4Q1VA 1LPNA 1EI9A 3I6YA 5AKLA 5DNVA 2C5FA 4Q34A 1YAHA 3G9ZA 5AK5A 1UOQA 4X6YA 3RKSA 1VE6A 3IUMA 5E4JA 3M81A 2QMQA 5CMLA 3D3NA 4KR0A 3PICA 1H22A 1UK6A 1UK9A 1QO7A 4QA9A 3OURA 4UFOA 1DU4A 2CKMA 1QIMA 3C43A 3S8YA 1TCBA 4G5XA 4W1PA 3RARA 2XUKA 4G4JA 4FLEA 5ALEA 1EVEA 2VJBA 1G66A 3MUOA 3AILA 2O2HA 1L7AA 3I2JA 5CH3A 5ALKA 5K3AA 3AIMA 5ALSA 5A7HA 2ZVDA 1GGVA 2BAGA 4BP9A 3WWEA 2XUOA 3GELA 1XZHA 4EY5A 3MVEA 4FBMA 3M3DA 3FNBA 1P0MA 1CUVA 4X90A 5SYNA 2OCIA 5ALDA 1ZI6A 2EDCA 1DTEA 5LLSA 5DLPA 3IA2A 4J0GA 1WPRA 1XQWA 4WFIA 2HRRA 4CI9A 1A8UA 2WQZA 3BL8A 1RWQA 5IKXA 1MX1A 1WB6A 3CN9A 4DM7A 1H2WA 5KWIA 1AZWA 4B0PA 4YX9A 1G42A 3G0BA 5HFNA 4G8CA 3QM1A 3DKRA 4UPDA 1G5FA 1XKLA 2ONCA 2XUQA 1XZKA 2J3DA 4AMZA 5CT8A 3QBJA 1EVQA 5DJ5A 4KE9A 4OB8A 4IH1A 2PL5A 3WJ2A 1XZGA 5CXUA 4Z49A 4G8BA 1ZIYA 2I78A 2VTVA 5LZ5A 2RHWA 3WK5A 3BJMA 3PF8A 5AK4A 4C87A 1HDEA 4F5ZA 2XQIA 1LPBB 1F8UA 2XUAA 1CFJA 1QIEA 3I28A 1GKKA 4Y2UA 1F0NA 1EK2A 3N0TA 2GZSA 3W9BA 1E3QA 5JAOA 1HL7A 1XZBA 2JGEA 2VSQA 3K2IA 1H23A 3C8HA 3W2TA 5ALZA 4AX4A 1SCQA 4JNCA 4Q3LA 1JKMA 1QJ4A 4A16A 2WFLB 3AFIA 4KRXA 3WWPA 3BXPA 3Q0TA 2PUHA 5T4HA 2Z8XA 4E14A 1XQYA 2XQKA 1N5MA 4AQDA 1TK3A 3I2FA 2JGLA 1UZAA 5HF9A 1QIKA 3FAKA 1O6GA 4BCBA 4L3WA 1XZFA 2OPHA 4WJLA 3O0DA 1GZ7A 3FVTA 3C5VA 1YS1X 3WKEA 2DHEA 1YR2A 5JYCA 4FBLA 4YPVA 3Q8WA 4Q3OA 2XQJA 1AURA 1Z68A 2BFNA 2HA5A 2XMDA 3R3YA 1YB7A 3WK9A 3H19A 5JZSA 1E8DA 2OQVA 5AO9A 3TJMA 2RAUA 3EBLA 4MJ3A 5AI0A 1HBJA 3QPAA 5BV7A 2GZRA 2Z3WA 3B5EA 1VLQA 2VF2A 2QS9A 4FLMA 4A23A 3FSGD 2HRQA 3DL4A 2PVSA 5IVDA 5CT9A 1SOMA 2HA0A 3C6YA 3H2IA 3QMMA 5AHXA 2VATA 2QR5A 1K5PA 2RGUA 4QLAA 2PSFA 3DDUA 1J2EA 3G02A 4WFKA 5LKRA 4P93A 1UWCA 4QLOA 4BVLA 2C0PA 1CRLA 2WJ4A 1W52X 1QZ3A 4OYYA 4B83A 2BGNA 4XVCA 5IH7A 3KXPA 1IVYA 2C4HA 2H1IA 1E8MA 5ALFA 5ALUA 2HADA 4DTCA 4H18A 1X2BA 4QDTA 4LHEA 1X70A 2OG1A 2Y6UA 2XI4A 2OAGA 1QLWA 2BJHA 4FDMA 5HK8A 3ZV7A 2H9YA 1QTIA 3C6ZA 1JU4A 1R1DA 5BWBA 4U2CA 1LGYA 2FUKA 2DQZA 2PSEA 4MYSA 4UHCA 1DX4A 2JGIA 4LXHA 3E0XA 2AJ8A 2H7XA 2WIKA 3B3QA 5HK9A 3VJMA 3WL8A 4CIAA 2JEZA 2WIGA 4UBNA 1QIHA 1EB9A 3E1GA 1F6WA 4X97A 4H7IA 5AI4A 4AB1A 2W6CX 1KU0A 2JGFA 3C6BA 1QIJA 5J3JA 1UXOA 1OCEA 1SCKA 2WG0A 3WWCA 1IUOA 1FFCA 1TCAA 4Y2RA 5EIAA 4KEAA 3W05A 4WY5A 4ARBA 4OB6A 2PU5A 1CUDA 2IX9A 1I6WA 3F67A 2Z3ZA 2PPLA 5AK6A 1ZD4A 5AICA 3WK4A 2HM7A 2HU7A 2UZ0A 1DWQA 4AO7A 5JARA 3IVMA 2YXPX 3KWFA 2QJRA 3ESBA 3ICWA 5AKYA 1K6EA 3QYJA 4BCCA 4LIPD 2XMZA 3HRHA 4ZXFA 2RIPA 3HYSA 1XZJA 4C4ZA 5HF6A 5LZ2A 4DMHA 4RNCA 5A6VA 3H04A 4Y2YA 1CUXA 1EHYA 4C6HA 2HL6A 3I2IA 1W4LA 1YB6A 2B4KA 3ZPXA 2VJDA 5YASA 4EA6A 1WHTA 2HA6A 4UFPA 5JD6A 3R3ZA 2CMFA 4DMCA 4I3FA 5ALQA 2I3ZA 5AOCA 4X94A 3WL6A 1EA5A 4ZREA 4W63A 3ZI7A 3CCBA 2WIFA 4H0CA 4BAGA 2DFPA 1IZ8A 2OGSA 3X3HA 5FXMA 5AK3A 1H2ZA 3WYDA 1NX9A 1Y7IA 4NMWA 2AJBA 2Y2VA 2PM8A 4I4CA 1VA4A 3BIWA 1IZ7A 3OM8A 4NS4A 1ODSA 3LLCA 2XMQA 5ALOA 4PW0A 1VZ3A 3UUFA 4GHWA 3I1IA 4ZWNA 5T4BA 1BEEA 2BUCA 4CCWA 1YA8A 3OPMA 4UHFA 3LIIA 1FFEA 2XDWA 4J0JA 4BVKA 5HFAA 1CUFA 3GZJA 1HQDA 3ZLVA 1TRHA 3G9TA 4RE5A 4CIBA 1AC5A 3DLTA 5DYYA 2HDWA 3D5EA 4EHBA 2OGZA 1GPNA 3H2GA 1TAHA 5E4YA 5HZGA 5E4TA 5T4FA 5EI5A 5AKKA 3R0VA 1CUYA 1QTRA 3O9MA 4HVTA 1Q0RA 3D4LA 1MO2A 1BN7A 1R88A 3EQ8A 2WSLA 3A2NA 2QT9A 3H0CA 5AKIA 1MAAA 1Q84A 2XQGA 4AZ0A 3A2LA 3D7RA 4K6GA 1NU8A 3IIIA 4D9JA 5DYTA 2WHPB 5LP1A 5JD4A 4HXEB 3KDAA 1L7QA 5F4ZA 2WHQA 1GXSA 2PX6A 3JYHA 4B7ZA 1EINA 3C70A 4H35A 4FLFA 1IMJA 3M82A 2G4LA 1J1IA 5ALGA 1ACJA 3PE6A 2QM0A 4B82A 4MXDA 1BE0A 2PBLA 3V1KA 2ACKA 1CEXA 2XLBA 1VKHA 4C89A 1FFAA 1VA5A 1YSCA 2BKLA 3VVLA 3K9BA 5AKGA 3V1LA 4GBGA 3T52A 1XZCA 2OXEA 2XMGA 4CCYB 4RPCA 2AJLI 2Y2UA 4WY8A 5K3EA 4KACA 1ORWA 1CUEA 3C6XA 1CV2A 3D59A 2Y1KA 3R3VA 4C01A 4KYVA 4GLBA 1WPXA 4Y2QA 2JGJA 4TVKA 5ALLA 1MX9A 5DNUA 3H17A 1LLFA 4XX1A 1AX9A 1XZLA 2CBGA 4IO0A 5DYWA 4CFSA 3STWA 1TIBA 3G9XA 4FKBA 3NUZA 1CUBA 5EHZA 3AZQA 1Y37A 2Q0XA 1DQZA 3I2KA 1A7UA 2FJ0A 4F60A 3G0DA 4LYDA 5ALPA 5AKHA 4W1QA 1WB4A 3HACA 4N5HX 1F0PA 4GI1A 5E2IA 1TQHA 5HKAA 3UUEA 1MJ5A 1BROA 2QTBA 3DYIA 4U2EA 3WJ1A 3FYTA 5FP0A 2PU7A 3WA6A 3L1JA 2WJ6A 2GYWA 4YASA 4P92A 1AKNA 3OTQA 5ALMA 3RLIA 4K6HA 4LKOA 3STYA 5FKJA 1IUNA 1Q0ZA 5HF5A 4Y2TA 2CJPA 2AJDA 1K8QA 1EX9A 5CH8A 4BC0A 2OLEA 4OUKX 4PSUA 4XWGA 4CG1A 4X6UA 5CT4A 4PQEA 2JEYA 4X3CA 5BWCA 4JYMA 4MYDA 5LZ9A 3RM3A 5H3HA 2XE4A 3DQZA 2HU8A 4BATA 5AI5A 3I6ZA 4BDTA 5A7FA 1XROA 1THTA 1G4HA 2ZSIA 5ALVA 5AM3A 3D0KA 4BZWA 4OPMA 4H7HA 1XLWA 4P9NA 3R41A 1ZI9A 4DSAA 2HA4A 1XZAA 5AH0A 3S2ZA 5AOAA 4C4YA 4Y2JA 1JFRA 3GBSA 4UBOA 5CXXA 3ANTA 5D3ZA 4A5SA 1ZD5A 4M0EA 4FFVA 2WG2A 4UHHA 1C4XA 1MU0A 2OGTA 3D2BA 3MGAA 5DNWA 3HEAA 3WLAA 1QO9A 1HPLA 4AN0A 3FOBA 5I9IA 2HA7A 4FOLA 4DNOA 1OILA 1LZKA 1P0PA 4QWMA 1XLUA 2V9ZA 3U1TA 3R40A 1CUHA 1WCYA 1R9NA 1BEZA 3DD5A 1N1MA 1UKBA 3ESDA 4GXNA 3STXA 4B6GA 1UK8A 1QFMA 4Y2XA 4XIIA 3ZWQA 4BTVA 3DKKA 3VJLA 3C45A 5CRIA 4BRSA 4Q3KA 2ES4A 1MAHA 5FRDA 2ECFA 2JBWA 1ACLA 3SWWA 4X00A 1FJ2A 1SFRA 2O7VA 2Z8ZA 3QPDA 3C87A 2O7RA 1E8NA 3FLEA 1YS2X 4H7FA 3AZPA 4QDZA 1FSSA 5ALHA 3FLAA 2R11A 4UBLA 4GDMA 4MEBA 2JGMA 3WKCA 4INZA 3BIXA 2HA3A 4TPKA 2WTMA 3G0CA 5EHXA 3QMWA 1QONA 2AXEA 4OD0A 4H7EA 4BP8A 1YA4A 1USWA 1KEZA 2CZQA 5HF8A 3DYVA 4KRYA 4HS9A 4FFWA 3LS2A 2C7BA 1EB8A 1B41A 4O08A 3WK8A 1BCRA 1ORVA 2HA2A 2EEPA 1N8SA 1ZOIA 3IB3A 4PV7A 4PSCA 5HQ3A 1ZICA 1P0IA 2V98A 3WIBA 4TGLA 5D3KA 4FNMA 1U4NA 4H7DA 2V96A 5DTIA 1CUGA 1XRRA 2OQIA 1VXRA 4Q05A 2J3QA 3P2MA 5CT5A 3G0GA 4OU5A 3HI4A 1QIDA 1EDBA 2X8BA 5EHQA 2OAEA 4AN1A 5A2GA 4ITVA 3VISA 4Y2VA 4ETWA 4C4XA 1S8OA 1XKTA 5CTAA 4DMFA 4CCYA 5JADA 5AIAA 2RI6A 4BCDA 4HXFB 4L9AA 3NOXA 1QIFA 5AJHA 4X85A 3MUNA 1MNAA 4QDUA 5AM2A 1C7IA 3FVRA 4BAUA 2DQYA 3R3XA 3V1NA 1AMNA 3W06A 4PNZA 4PSDA 1H2XA 3FYUB 1BN6A 1JT2A 1ZIXA 4MWSA 4HRXA 1LPOA 3SK0A 2C0QA 3O4JA 5C7YA 2O2GA 1FFBA 2G5PA 3EQ7A 3WL5A 2XQFA 3HABA 2DSNA 3BE8A 3V9AA 4JYPA 2CEKA 5FLKA 4N8EA 3A70A 3H2JA 2P8SA 5AKXA 3BDVA 1GQSA 4B9AA 3QMVA 1LPAB 4NZZA 5LZ7A 1JU3A 2BGRA 3I6MA 3FBWA 3H2KA 2AJCA 3FCYA 1ODCA 3DS8A 4BZZA 4FWBA 1MTZA 5JATA 4OB7A 4F0JA 4FMPA 4XJVA 2WJ3A 4WDQA 3B12A 3KWJA 4QNNA 1VE7A 3WK7A 5DTJA 4LXGA 5CW2A 2GBFA 2VAVA 1CQZA 4U2GA 3O4GA 3YASA 2WILA 2XMSA 4DLNA 3G9UA 2E3JA 2H7YA 4MWTA 4W1RA 1Y7HA 2D5LA 5EFZA 4KE8A 2HFKA 4J0DA 1U2EA 2C5GA 1GQRA 4G9GA 4HRYA 3W04A 3TEJA 4KE7A 2WTNA 3CN7A 3V48A 4AZ3A 2VA9A 1U65A 3QVMA 5ALTA 3D2CA 4Y2SA 1DQYA 4BDSA 1CUAA 3WWOA 3GUUA 1EXWA 1JI3A 4OCZA 3L1HA 4GECA 5K3FB 3QITA 3A2MA 3PF9A 1A8QA 4IH4A 5AP9A 5ALXA 2WFLA 4ZV9A 5AI8A 4BRZA 2YYSA 3HC7A 3ANSA 5IVIA 1UFOA 3WKAA 3N2ZB 1ZGCA 4B80A 1GPKA 1PJAA 2XT0A 5JD5A 3M83A 4QWWA 5C8VA 3G8YA 5EHNA 3JW8A 4UBKA 4U2FA 5K5EA 2QXUA 1CUWA 2JF0A 2BUBA 3TGLA 1GPLA 3OG9A 4X6XA 1K4YA 1CUIA 4X95A 3E3AA 3STTA 3I2HA 3IDAA 4X92A 5I8PA 4UBMA 3O4IA 3VKFA 3F9CA 3KD2A 2WUFA 5DWDA 2XMCA 3L1IA 5ALNA 1DX6A 4LYEA 1J06A 1W76A 2QKYA 3SC2A 4BTLA 1MPXA 4K5QA 4OYLA 4UFNA 3WK6A 3H18A 3F97A 4EZIA 2ZJ6A 3O9VA 2OCGA 2PSDA 5AOBA 2PSHA 1R4ZA 1O6FA 3H1AA 2GYVA 2QXTA 5SYMA 4J3JA 2ACEA 2Y6VA 5JALA 1LPMA 3FLBA 2VT6A 1DWPA 3LP5A 4UBIA 4G1FA 5ISMA 1D07A 2WIJA 2I03A 2DHCA 1BRTA 2XUFA 1M33A 3DOHA 5A7GA 4EY4A 2O2IA 1FFDA 4AXBA 4B9EA 4I19A 4UHBA 3C8DA 2VAXA 4IHAA 2XLCA 2WLSA 3WMRA 2IITA 2Z5GA 1JJIA 5C8ZA 4F21A 1T2NA 2WKWA 4DGQA 1UKCA 3ILSA 4N8SA 2PSJA 1UKAA 3STVA 5FDFA 4G4IA 4J7AA 4Y2PA 2WHRA 4KAJA 4KJXA 3W9UA 1LBTA 4N8DA 1MT3A 2C58A 1EK1A 4QDOA 3ED1A 3H2HA 5AKJA 3R3WA 1U8EA 6YASA 5AM5A 1PV1A 2QOEA 4ZGBA 4W1SA 2ORYA 2XUDA 3NGMA 4RE6A 1AQLA 1R9MA 4WCVA 5ALIA 3RK4A 3WI7A 3ZLTA 1SC9A 2QUBA 1E66A 2G5TA 5K3BA 5HKBA 3IBTA 5JAHA 1K63A 5AM0A 4E46A 3TRDA 4H7KA 4E15A 4H77A 4ZRDA 2WFMA 1BCSA 2XUIA 1IUPA 4K6KA 3BJRA 2D0DA 4UBJA 4QE3A 4J0CA 1XQVA 4J0KA 3ICVA 5D6OA 2ZJFA 4NVRA 3NWOA 4Y9SA 3SX4A 1MNQA 4MEAA 2XUPA 4V2IA 4J0IA 2EDAA 1W75A 1LBSA 1UOPA 2QVBA 1R3DA 3BWXA 5CH5A 1PFQA 2GBCA 1R50A 4BC1A 2FJPA 1ZJ5A 1B6GA 4G8DA 3I1YA 4DNPA 1JJBA 3OOSA 1VOTA 1NU6A 4QDXA 4UHEA 4CG2A 4FHZA 4RGYA 4FTWA 2XUJA 1UOOA 4B0OA 2FX5A 3F96A 2WU3A 3FYUA 2XMBA 4PF1A 1WB5A 4HAIA 4J03A 2HFJA 2DHDA 1CIJA 1ZD3A 1C7JA 2VJCA 5AI9A 4PO3X 1CQWA 4E11A 3VJKA 4J0HA 1GT6A 3IUNA 2ROQA 4WFJA 4DMKA 1DT5A 2JIDA
chains in the Genus database with same CATH superfamily
1JR3E 4HXYA 4OP3A 1APBA 1QFXA 2ZIEA 2QG9A 1DINA 5ELXA 2YN4A 2IZOA 4OHMA 1P4SA 4LQLA 4DA0A 1YQQA 1O0SA 3TLAA 2HWYA 1EP2B 1J99A 2ZJ7A 2FG5A 4G65A 2OXFA 1UPCA 3WZMA 1UT5A 3QF7A 2I4RA 5G53C 2XVMA 1DAPA 4BE7B 1BNCA 5KTSA 2D0IA 4HXGA 3JZDA 3SJCA 2ZIAA 4LNUB 4Q3NA 2I6SA 4KGXA 1I2MA 1XRQA 4RTRA 4KLZA 5CLGA 3HVUA 5BN5B 2Q9BA 3W2FA 3JQ6A 4TKMA 2JLZA 2BY4A 1MRNA 5HILA 1K3UB 2GBIA 4PYKA 3AUKA 5LXTF 3N2KA 1T9GR 4GEGA 4LC9A 4YIHA 5LOVA 1WEKA 1YQDA 4L76A 1Y5RA 4RK0A 1KETA 2HT1A 2HJHA 2BJWA 2Q28A 1A1SA 3C5WP 3MS7A 4KQ2A 4QUDA 5EQDA 2PFKA 4RV4A 1Q83A 1RP1A 2J9FA 2VZEA 4Q18A 1JVNA 4BWFB 3WKBA 3GQBA 1XA3A 4AF6A 2ZIGA 3O8NA 2JIZA 1E20A 1JMKC 3QH4A 3AESA 4K6FA 5D3MB 5KTKA 1Q1NA 2OM6A 4XM2A 2LW7A 1OXUA 4M21A 4NCXA 4BVJA 4EATA 1CLEA 4M9QA 2EKPA 3RC2A 2J9YB 1ST3A 1P0QA 1C0LA 2JFBA 3RD5A 4B4VA 5FWNA 3VHRA 2FPXA 1T2AA 2WV9A 4YYZA 2R8RA 5H5JA 1I6KA 3WMXA 2V97A 1KZHA 5HP4A 5G0SA 2B4TO 5CX1B 4QPJC 4ZV7A 4GOOD 4X8HA 2GK3A 3AUYA 2AMVA 3EXIB 1LI4A 3L7NA 3NJ8A 3OD5A 1KWGA 2ZR8A 4JLPA 1KEUA 1E2FA 4NG4A 1PJTA 2EHDA 2N42A 4B17A 5DHQA 5AD1A 4ECEA 4K8RB 1G0NA 2CXRA 1NZFA 4HEQA 4X6LA 4UTXA 5T6BA 3TMYA 3PQCA 2HCFA 4P22A 4HDKA 5DK4A 1ZGAA 3UJCA 1RI5A 2FKAA 1PV4A 5KO2A 3B8EA 2PH1A 1USGA 2C29D 2OCKA 1WOMA 3Q15C 2OYCA 3K70D 3IUQA 1J97A 1BKYA 1ZYUA 3BXZA 3S2FA 4AZVA 1EM6A 1RC1A 3E15A 4ENUA 2Y67A 2QRKA 4ALIA 3VVCA 3M49A 4ZI2A 4DDVA 1T6NA 3G5UA 3PL1A 4DZTA 4P3NA 3F8SA 4Z0HO 3OU7A 4EYQA 3VX3A 3U1VA 1Y1KE 5JC1A 3RTBA 1MB3A 2OZLB 2ZJ2A 1KI9A 3A9VA 4TUYB 5ENDA 4D2IA 5B2ZA 1DKUA 1OA1A 1M5UA 1FB5A 1XVAA 1S3FA 2OKGA 2PMCA 3AR9A 3MAAC 4BN0A 4EPWA 1NNEA 4DWVA 3A58B 3MRTA 2C4MA 1F14A 5KTNA 5DLEA 3HBFA 3WGZA 2AZMA 5HMLA 4EPTA 4BB5A 3FZYA 4JA2A 2ODBA 2HDHA 4IDBA 5HM6A 2WM2A 1YDHA 3QVVA 1CVLA 3DE6X 4RENA 1W6RA 5AXBA 9ABPA 3KVYA 4UD2A 1R12A 5DV9A 4LF8B 1GCIA 1JDPA 1NTOA 1YAJA 5K0TA 5E6UB 3T54A 2R6FA 5KJFA 2IOHA 2GO7A 2JGKA 1H2YA 3QRWA 4D41A 4UE2A 4RSHA 4ZJYA 3HEMA 3G79A 2AFIE 4REQA 8OHMA 1CQJA 3NRJA 1PHRA 3KSRA 1ENZA 4AMYA 5BW5A 3CVOA 4Z2AA 1Z25A 2R6ZA 5K0CA 1OREA 1RAIA 1W85B 2Q49A 3IAS1 1YVDA 3KUUA 1R15A 1PJLA 4W5JA 1EDEA 1THGA 4HNTA 3NRBA 2JK1A 1XWIA 3M6AA 5TMPA 4OI2A 1HE1C 1SVKA 1NXWA 1UBMS 2H29A 2ZE6A 3OLWA 4WY2A 1MV5A 1KJNA 4D6XA 2H06A 4HGOA 1WIWA 4UEWA 4WAUA 5H59A 5C8XA 2V7PA 3AH8A 3B6KA 5ERYA 5GWXA 2ECKA 3AT1A 1TUGA 5LA6B 1TECE 4Z4CA 4LV5B 1GITA 1YCDA 3RV4A 5IVHA 1IY0A 4RHCA 1IPHA 3O74A 1NF3A 2IPNA 4NV1A 3V34A 3LGSA 1QQ5A 4G0ZA 1JDTA 1XELA 3FETA 2ZYRA 4RY2A 4YJ3B 1JHAA 4R8KA 3WLLA 5EWMB 2WIDA 5KYXB 4RKYA 1MH9A 3EEIA 3FSGA 2F8TA 1JG1A 1X1BA 4QJBA 3W4IA 3W5UA 3TUIC 1OFGA 1P4AA 3WGIA 1U1GA 2AR0A 3ZBUA 1HZZA 4FGLA 3WL7A 5IWAB 1X1QA 2DMRA 2FZLA 3HTXA 1XTIA 1Z39A 4I9GA 4IUDS 3THYA 1ODJA 1MC8A 4UU1A 3HXKA 3VU9B 2QVCA 3ZDBA 3PUHA 2ZAGA 2QGZA 2P9GA 4DEYA 1VI6A 4BNMA 4KWEA 5AK0A 3OFNA 3GLFB 2P1ZA 1G8SA 1M1XB 2WWVD 2P5SA 1ZMOA 2P5YA 3ECAA 4DCSA 2GD6A 1EUQA 4BN4A 4JODA 4IGAA 3B1FA 4WKCA 2W6QA 5AVTA 3VPCA 1KPHA 2LCIA 1YS7A 2E4UA 2XGSA 3TOZA 5A5FA 3AI3A 3WAGA 3ZDQA 2HMVA 5JO0A 1F2TA 2VTDA 821PA 2KJQA 5IP5A 3V7UA 4IMIB 1E5VA 1JQBA 1T3ZA 3N87A 2CJFA 1JQAA 1P9LA 3UH0A 3AM4A 3WO0A 2E5LB 4L73A 4S05A 2W58A 1GFWA 4ZZ1A 3AXSA 2I29A 2O0JA 2IYLD 3ZWDA 2NZXA 4MPTA 2XHZA 1KIAA 4KPYA 1W1UA 1BRMA 2NVWA 3BWMA 3H5OA 3L1VA 4HWOA 3RBZA 4D43A 5AHOA 1BX0A 3HSSA 3K73O 4R69A 4GW3A 1Y48E 4AWAA 3GDWA 2DWOA 4ZOCA 2H5LA 3UJPA 4A3SA 3B9PA 1ZUIA 3SXUA 5BSEA 3BIOA 4PYJA 2Q5FA 1KFEB 2FX3A 3THOA 1BD4A 2LR0A 4D8WA 4LOHA 3IBFA 3I9NA 1LDNA 3KZKA 3M2PA 2NU8B 2E6KA 2VAMA 1K66A 4UXHA 2B99A 4CT4B 5G41A 4BAZA 4CTNA 2OYSA 3RUDA 2XUZA 4DYDA 3QSYA 3VH4A 2JLUA 1R8YA 4KSBA 3RUHA 1KIMA 1YQ9A 4Q66C 3UAOA 3TF5A 1B16A 1JQJC 2HWUA 1KMNA 4C88A 1CULC 1JZQA 1SIUA 2FKNA 4X1KA 1KTIA 4V3BA 3B9RA 2RK4A 3E7FA 3L43A 3KQUA 4TYWA 2IODA 2B3DA 1KRXA 2XTZA 1XRPA 4G36A 4AJLA 2Q4EA 2YWXA 3LE8A 4EFMA 3C8MA 3DZIA 2PLFA 1RXYA 1NFFA 2C9ZA 2EX0A 5F7ZA 4JI5B 4BU0A 5I4BA 2ZSHA 4MQUA 4LJ7A 2NUAA 3WZLA 1WHSA 3HH8A 2AZTA 4IQGA 1U28A 1U7UA 1QKKA 1UL1X 3A26A 4LTDA 4Q48A 1YDWA 1E4OA 2GD1O 5FUXA 1R0KA 2P9YA 1JJFA 3AFGA 1U0OC 4P4NA 1H2BA 3QEMA 2PRSA 3C6QA 4DNFA 2KX7A 5GMOA 3IPYA 1L5YA 3Q87B 2C5BA 3PDHA 1T8PA 1XCLA 3QV2A 1F38A 1LPPA 3UWSA 2O0MA 4UJ3A 4FGKA 5EJ5A 3AF5A 4D9BA 4HLQB 1RQ2A 5LR6A 1X7ZA 5EXPA 1BGXT 4HDMB 2QAGA 4L5IA 1ARZA 1W87A 4YROA 1W47A 4BEBA 3COWA 4IVRA 1UIRA 2C7OA 2EZ9A 3ZCXA 3CRMA 1XMQB 2E85A 5FUVA 3HJGA 4O3FA 2DFVA 5KOJB 2C88A 3IAM1 2J4DA 1DEAA 3LCRA 3M5PA 3P9XA 3UN1A 3BWEA 5ESRA 2DLDA 3KYBA 3Q4GA 1VG1A 1YCHA 2VYFA 1LEHA 1ULHA 2KYRA 2CL6X 4JOBA 1GEGA 3RBAA 3T3OA 1JQ3A 4MVCA 1SZCA 4MYHA 5JJCA 2HIHA 2AQ8A 4IV0A 5FUMA 2XBMA 3QZUA 4ZTBA 3UMVA 5JZBA 4HWRA 2DECA 3FPKA 2G6BA 4L8YA 5EN4A 4C30A 4IQ4A 3IEUA 2GESA 5KREA 2VIIA 2JPDA 2XKBA 1TT7A 3D54D 4JVLA 2ZT5A 5BRAA 5EXXA 1BKDR 3AF2A 3D9QX 4RUKA 4JI2B 3BFJA 3BRSA 4BLVA 4YRDA 3TB4A 1ONBA 3VYWA 1BMFA 1LDMA 2BF7A 4U2BA 4J49A 5BYJA 5LDDC 2PEZA 3L6DA 4JUIA 1E1MA 3EEBA 1ZCJA 2FN7A 4LV8B 1G8JA 5IBRA 1RPTA 4R71A 2R1VA 1AUOA 2REOA 1KJZA 2ZI5A 5CJJA 3UCXA 5B7NA 521PA 5JASA 4KO2S 3PQDA 1QSGA 4MQLA 3RC8A 2VEOA 3ZQJA 3TLCA 3EK2A 5AM1A 3HR4A 1VJ1A 1PRYA 2CFTA 1M10A 2DBZA 3KCQA 1KY2A 3AIOA 1QMGA 3C3EA 3OM9A 3WIVA 5GJCA 4F6RB 1ND5A 1WW3A 4I4TF 5AJZA 3A27A 3EN0A 4Q1BA 2EAUA 3PPXA 3NEJA 1XHLA 4X7BA 2W6MA 5EYPA 4QGAA 4NU0A 4QBFA 3X1YA 1T1GA 2FSFA 4RVSA 4A0QA 2NAFA 1EFRD 3M6FA 4Q3CA 3V42A 4EAAA 4R0MA 3KB6A 3NVDA 2BR5A 2FVXA 3RSHA 3IMGA 3MJHA 5I7HA 1SXQA 2VDWA 1RWXA 1NUAA 1E1QA 1JPNA 1K0UA 2CVFA 2QLTA 3OJCA 3VSAA 3EE6A 2PR7A 1R00A 3HSKA 1KI6B 3WDKA 3U6BA 1KEEB 4JQZA 2H3EA 5KEIA 4ROTA 1OFIA 2OFFA 3BCSA 3S55A 3CVUA 1UK7A 1A8SA 4JFRA 3IUJA 4XKJA 3CF4A 3TZCA 5DW3A 1R16A 2W11A 2CB9A 2PCJA 4NF2A 4C0BA 2IL1A 4GC9A 1SR8A 4OQPA 1RE1A 3V55A 3NEPX 4B84A 4RHEA 1Z56C 3VHXA 3FX2A 3DVSX 5LQAA 4QGBA 5EHNA 1VMAA 2OMEA 2BL4A 3CW2A 2E82A 4JL5A 4S0ZA 2AC4A 1ZJ4A 1Z07A 2OE2A 3NBKA 4JX9A 1M8JA 3VYRB 2W0MA 2HNBA 1E2UA 1I7DA 4E3WA 2DUJA 3IT0A 4V39A 1A88A 5E6RB 1RAEA 4R1UA 5BURA 4EFNA 5LIPA 3PQ4A 1YS6A 4LRXA 2AWOA 4P7BA 3ISVA 2I6QA 3GAFA 1U8XX 1QZUA 3MRVA 5HJEA 1T34A 1Z6AA 3AHEA 3JWEA 1NVTA 1SHLA 1I5EA 2YFQA 2WUDA 4GX2A 4GPIB 3HCWA 3RYCA 1E1KA 4KYIB 1FNBA 2WU8A 5BVHB 3N2GB 4K9LA 2WOJA 2PHZA 5CBKA 1LF5A 2NU9A 1L3BA 2A84A 1VTKA 4W9RA 4E4YA 3G0IA 2Q5QA 3UK0A 3GH1A 3ZZMA 2CXQA 5LNK1 4NJEA 4BB0A 4LE1A 4U2DA 3OZGA 2LKCA 1T6XA 4LYFA 4UPVA 4RV5A 2IS6A 5SZJA 3F71A 4H60A 3NNSA 3FFTA 1YS9A 2J4FA 3I2GA 4RACA 1HEUA 2A92A 3UK1A 4LMRA 1OVMA 3FR7A 2V7UA 2QLNA 3DKVA 5TDHA 3ZLJA 3J7AC 4FEEA 2QAJA 3BDIA 4KW7A 4ZFNA 4XWKA 5JDCA 1RAFA 2NZ2A 4RVHA 2O2ZA 2AZDA 1JR3A 3LLMA 4MWOA 2YR0A 3FYCA 1RSZA 5DW0A 1J2YA 1YJBA 3GIWA 3PRKE 4IGEA 4IZIA 3ND9A 5SZIA 4K86A 4CKBB 4RZSA 1A9YA 2IQ5A 2JFHA 5F12A 1PR0A 5FNVA 3CB2A 1EX1A 2B5VA 5AM4A 3AEQA 5L3RA 4E88A 4MUJA 4HLUC 1RKVA 5K4AA 3AI7A 2W6OA 4D4HA 3RAJA 4RBNA 1EJ6A 3WA7A 1QB7A 1VB3A 4M0PA 1XZPA 5IN5A 5DX1A 3STUA 1CY7A 2EATA 4MWEA 3JWHA 2FOXA 2MHCA 4NAHA 3F3YA 3IPLA 3Q1LA 4JUBA 5HKKD 1KY4A 2R1UA 4HOYA 5L95A 5AKLA 2J5KA 3BJEA 3P2KA 5DWQA 2VDNB 2ZP1A 3DDCA 2QL6A 1JAIA 2NVUA 4Q34A 4UAUA 4XGKA 3I37X 4B3SB 1HFWA 2WVGA 1MRZA 3RKSA 5COQA 3D6FA 1M1ZA 1R6DA 1W2WB 5KI6A 4B1FA 3TD9A 4DMRA 2GM9A 3EDRA 1KVTA 3Q3CA 3GLKA 2F64A 4RD0A 2CLKB 3T0FA 3KELA 1WL8A 1Q77A 3FRHA 2GTIA 3O2QB 5IUKC 1D4ZA 3F73A 1UK6A 4C5AA 4H3HB 4J75A 3OEHA 1XJCA 1QO7A 1GNRA 2CXXA 3O8LA 4GI7A 3PTZA 1T9CA 1IXRC 3R7FA 4J1NA 4I14A 1E1RD 2FCAA 4I46A 4UREA 4M1QA 3RM3A 3N58A 3W1WA 3WO1A 4YDQA 5K05A 1PE0A 1TCBA 4EECA 3ZZ0A 1KK3A 1W30A 1G9XA 4FT2A 2ZYAA 4CHTA 2QHXA 3PT9A 5FI0B 3VC3A 2YMMA 1RTKA 1LX7A 5J58A 4UDNA 3WTCA 3GPCA 3QWBA 1TM7E 3FHOA 3S1AB 1MAWA 1IOZA 3ET4A 1AMOA 2YNMA 3BB3A 1FP4A 3O4RA 3ONDA 1KEPA 3P0IA 2A9OA 4IWNA 4JSTA 3IHKA 2I2BA 4KREA 4YWHA 4I1VA 3RRJA 1NLUA 3IQEA 1D4FA 1XVTA 1GGHA 1H0KA 4D8VA 1M6YA 5KDOA 2P7HA 3UJ7A 3BXXA 1Y33E 1PJCA 3OE7D 3TXAA 4BNTA 3F6CA 4U7DA 5EHIA 2IRWA 2OHJA 5JH7F 2W2QA 3RUAA 3JSXA 1DBVO 4KU4A 1IOLA 3FUXA 2YWDA 4XTRA 2PKQO 3RREA 5ABPA 3GGDA 4XW2A 4M60A 3FDIA 2BKXA 4EJ0A 5A7HA 1YBAA 2BAGA 3ZU6A 2ZI6A 1BMTA 3KTAB 5AW1A 1W49A 2G0TA 3PJRA 3WLEA 2R62A 3UMMA 2CFOA 1NA5A 4E94A 5TPZA 3FNBA 4DRZA 1OX4A 3M33A 4U6SA 1IWOA 3NCHA 1P0MA 1G6Q1 2B4QA 2XE6A 3CUYA 1TIPA 4U7HA 2B30A 3O8OB 1XCGB 3QVTA 5ALDA 1YL5A 1XPRA 2EDCA 2HSZA 4TS9A 2N3ZA 1KTVA 4XQCA 1N3LA 1Z5PA 3R7NA 3EGVA 1YCGA 4KMSA 1Z7YA 4AJNA 5KNBH 5KWSA 3JQGA 4NY1A 1WHTB 3NGLA 1BS2A 4FSHA 4GYYA 2GBLC 3JWGA 3KSZO 5DNCA 2V6JA 1MTOA 2ZJ0A 3I83A 4GZ6A 2C1XA 5CFRA 1RWQA 3TS1A 3CLUD 1XDZA 2XGOA 1MX1A 3I8SA 1RIIA 1UXKA 2YV2A 1WB6A 4L3VA 3TOVA 5CCBA 2E7ZA 1SPBS 2Y1XA 4L5AA 3BRQA 3ZWOA 2PBZA 1EX6A 3MHPA 1Q0QA 3OKCA 1RYDA 4TTRA 4GG1A 1G42A 2ZG6A 5HIIA 2ZSFA 4PLVA 2O8CB 2YZNA 1C4WA 2Y4NA 2I8CA 4GM1A 1D2GA 1KZ6A 4JSRA 4G0PA 3VTKA 4MZDA 1PEDA 4MW6A 3LXXA 3RVOA 1C1HA 1XKLA 3RVNA 1WO8A 3DWFA 2Y3IA 3H5VA 4WNAB 3EYAA 3KTOA 1XCOA 4BPRA 1ID1A 4Y8VA 3NT2A 2ANBA 1NURA 1UBTS 3Q9UA 4KPUA 4P1ZA 2HJVA 3O83A 3IBYA 3W8EA 4KZPA 5EZSA 5F98A 3QBJA 3I5UA 4REOA 3MSCA 2Y77A 1AKVA 1XZNA 2PL5A 1TKBA 3DAPA 1BO6A 1WQ1R 3I92A 2AMJA 1G64A 3EFOB 3HP1A 4G8BA 4ND6A 2ZUTA 1HNZB 1UBJS 4CMIA 4E2XA 5C53B 1X1CA 5HEKA 3FDZA 3KDPA 3M1LA 4LPKA 4GP6A 5G0TA 2IEYA 3L8EA 3WK5A 4ZMSA 5HRAA 1IN4A 1PL7A 3I09A 2GAIA 4N0EA 4NP6A 4DZZA 4LX8A 3R3JA 3V1TC 3ZU3A 5FULA 1VSVA 1W4CA 2JI7A 5JCZA 3NHRA 5DNAA 4CR6A 1SZPA 4AZ3B 3FIJA 4MQ6A 3BD7A 3OEED 4R1LA 4ZOAA 4CDMA 1XD8A 2RHLA 1THMA 3IJ5A 3LF2A 4O0MA 4W6ZA 1FTWA 3VO2A 1G7TA 4LN1A 3OSUA 5JCJA 4BYGA 4F9FA 4WZAB 3SF0A 1JDNA 1GKKA 3PGKA 1CS0A 1T2FA 5D6NA 2WFAA 3I5XA 4CMEA 5EMNA 3D2LA 3RF6A 3D4OA 4C3UA 2NQ2C 5LQNA 3FOFC 3R44A 4JP2A 1FYEA 1C3EA 2B9EA 4LSGA 1XZBA 2JGEA 4YAUA 2VSQA 2EZTA 2VRNA 3K2IA 3W6NA 1PAUA 4N49A 2BBSA 3LECA 5K6AC 2CYBA 3IQHX 1Q7TA 3OCCA 3R5HA 4QFBA 4XWYA 3RU2A 3U7GA 2VQFB 3OIDA 2H2DA 1SCQA 4A27A 5F2EA 4ZYTA 2VDVE 3SQWA 1QJ4A 1Y5LA 4KX5A 4YMWA 3M6XA 1NMXA 1IULA 1I3MA 3DDWA 3Q3HA 4BRWA 2BE9A 1SBHA 3D4IA 3WC4A 3PXUA 2WABA 3KYDA 3BXPA 2MMCA 4MS4A 1K7SN 1SHUX 1WSAA 2WWXA 4C78A 5I6DA 4N3CA 2YV5A 2VT2A 2WVHA 4MRRA 3LYUA 2Z8XA 2IXFA 3FSEA 3MOGA 2ZIXB 1QCCA 5FADA 3JY6A 1N5MA 4YO7A 5TS3A 2I7XA 3A6HA 3GC6A 5DOVA 4WLOA 3TX6A 3UA4A 1T0UA 2JGLA 4EJSC 5G40A 2AA3A 5F1KA 4DLKA 2EG9A 5K51A 2BKVA 2ZT7A 1XPOA 2JB9A 4Z1MD 4FONA 4V1CB 3ZVRA 1TZ2A 1JEAA 4YRJA 2B8EA 3PHIA 5IAAA 5F3RA 1U8ZA 1NBHA 2QTHA 4AIRA 3EPLA 4NS1A 3UGJA 5DN6D 5KTRA 3BPSA 3UUWA 4LJ4A 1F1BA 2XSZA 4BQQA 4EHLA 4TWIA 5JI2E 3FVTA 2RKBA 3C5VA 4LDJA 1I3OA 5L4NA 3WKEA 4TKVB 2QL5A 4HYEA 1N6KA 2DHEA 2CUZA 2C5AA 2X5NA 2FCRA 2YQ4A 3CRZA 2VZ9A 4XYGA 5CLHA 1YR2A 3LP8A 2Y27A 4NESA 4IEEA 5JT1A 2PMBA 3FNHA 1OIXA 3QUAA 4O29A 1L4MA 4Q3OA 5DM4A 1TK9A 2CMHA 5KJCA 5FTMA 5LL6P 5IWCA 1G8FA 3ZIAA 2PQ6A 1J6UA 1OYWA 2HIMA 3HUTA 1E3WB 2CCKA 3BKWA 5E8RA 1MXFA 5IEBA 3NYRA 2EP5A 5H02A 4N5LA 4D3ZA 4Q4JA 4BXOB 1M1YE 1PJ2A 1PP4A 4OATA 3VDQA 1L2TA 2ATIA 1TFUA 5M34A 1E8DA 5K2MA 3QE9Y 4RY8A 1MC5A 3UAGA 4JYBA 4RVDA 4DR2B 1HF3A 3L0YA 1OIVA 4ZKDA 5IBPA 1D0SA 2IHBA 1YOBA 2O3RA 4OBWA 2GCPA 4M8NE 1AS0A 4U00A 3R20A 2IHZA 5F2KA 3ASUA 2DOKA 4LCBA 4WKPA 2ZJZA 4LQDA 4MTCA 2V1UA 2RGRA 2Z3WA 2A5DA 3B5EA 2A9FA 2MYUA 2PAAA 3I42A 5C51B 2VNSA 2VWPA 2VF2A 2CF5A 4I50F 3KYCB 4N5DA 4ZTZB 4FLMA 1S2GA 5LMUB 1DLIA 2G80A 3RVPA 3JQ9A 3OWOA 2IS1A 1SCAA 2HRQA 3H16A 1DAGA 4E32A 4L51A 1PZEA 3I73A 2MTBA 4FYIA 5IMBA 4H7PA 1Z35A 5IVDA 1KFJB 1HV8A 4CV3A 4OGKA 2H4FA 3D8RA 5CT9A 3C6YA 3ANLA 4KAXA 5KDDA 1E1DA 3N6XA 1TYAE 4DCUA 1K8YB 3OJ0A 1AE1A 2BCJQ 2K87A 3ZYCA 1IBCA 1LTQA 3INRA 1GLGA 1T5TA 1K5PA 5AVKA 1ECLA 1J8VA 1XU7A 1YE8A 4TQ9A 1G63A 2EX1A 2ZJ8A 4W6QA 2HXSA 3SQMA 2XYRA 5FL7A 3DGEC 3K35A 2VHCA 2SECE 3UMSA 1J2EA 3EISA 4BNXA 4YP0A 1CY6A 1AG9A 5LKRA 4P93A 1EE1A 1RHMA 3QW4B 4CDRA 4D5EA 5IK2D 3UT0A 3HFJA 1AHHA 3M9WA 4KMOA 3FNIA 4KN8A 4Q39A 4EHFA 3Q3JB 5CA0B 3TQRA 1X9HA 3K05A 5TY0A 4URHA 2PGDA 5A4IS 5IH7A 5THXA 4YMVA 1Z3IX 1STOA 1Z4PX 3L8GA 2ZZMA 1U3TA 1AU9A 3U17A 4JYZA 1GTL1 1EZZA 2XQVA 4DJAA 4DW8A 4P4LA 4II7A 2ZRIA 3ZD6A 4LZWA 4B7XA 4FINA 3ONNA 4YMLA 2AKAB 3OZWA 1K08A 1KI4A 1EGVB 5CDSA 3DNPA 4TMFA 5ALFA 1WLSA 2GCGA 2XBLA 5ALUA 4NZPA 1CEYA 3QLJA 2IGBA 1U2QA 4LF9B 5JFTA 1X2BA 3IAAA 1UBEA 2Y1FA 3NASA 1ESNA 3GJ3A 4MW7A 5F1YA 5DLDA 1OX6A 3SXJA 4M55A 1X70A 4J16A 1G8GA 3CZCA 3ME5A 3ZDYB 1NXOA 3HKCB 3QYAA 5A4JA 1XLTC 1R37A 2K2WA 1XK7A 3T7IA 3IILA 4HQ0A 1XV5A 2ZJBA 1TGVA 2JHPA 5CM8B 3RVQA 1M2KA 5BMVB 1CIVA 1QLWA 1X7YA 3K0FA 3VMMA 3K8ZA 1ULTA 1U2DA 1KOLA 3RQSA 1QQ6A 3L6EA 5HK8A 3NDJA 3K9GA 1G21E 2QSZA 1GPWB 1ISRA 4FS3A 2B2CA 3Q11A 4MDHA 2PO7A 2JIBA 1A9PA 4L2IA 1E5LA 1R74A 1NWHA 2BGTA 5KYYA 3UCEA 2X0FA 1TTPB 3W90A 4KH0A 3ZHTA 1PJZA 2QE7A 3R3HA 2Y1OA 1NGSA 1V1MA 1ZMRA 2PSEA 2BEUB 3DO5A 3B48A 3FKSA 4KLAA 4MYSA 3R7WA 3U40A 4CL2A 1USUA 4E22A 3OJWA 2PWBA 3GLVA 4XI9A 1PEYA 2V4MA 2CBXA 3Q5DA 4LXHA 2E2WA 2AJ8A 2A1TR 3HJAA 4I5IA 4FHEA 3CWQA 5AUOB 2XW6A 2X8AA 4G1BA 4OQDA 4PANA 1KVQA 3ABIA 3ONFA 2P9FA 4QAQA 1YXMA 4V0NA 2H7XA 1W73A 3I9OA 3LW8A 4UM5A 4EZBA 1J9EA 2CLIB 2QTVA 4UHKA 3MG9A 1IXSB 2YFHA 2CLCX 1TQ8A 4XVQA 3ANYB 5JS2A 4BUCA 2C7RA 1TT5A 3ZNQA 2NO4A 5IG2A 1NBEA 1DO0A 3C1TA 3DNFA 3MMPA 4JUDX 1II8A 1UZLA 1U3WA 3C3KA 2O8FB 3A4TA 4UBNA 2BMWA 4Z3KA 3QUTA 1Q6ZA 4F5WA 1TZKA 3ABRB 4WINA 3HY6A 3DD1A 4WKNA 4TLAA 3U7IA 2JLCA 1DJNA 1DWUA 1N2OA 4PYLA 2WJVA 4DMUB 1QF7A 4RH1A 3K6SB 5AI4A 3ZLBA 1ZRMA 1JH9A 1KXZA 3C3BA 1TCVA 1D4AA 2JGFA 2YW9A 3DBHA 2M2IA 3C5HA 3C6BA 4HZUA 3BMCA 5GY7A 4QM7A 1W7AA 2JGAA 5CGZA 5HUJA 2H07A 3PPYA 4YQEA 1M66A 4EABA 1Y1PA 2QTGA 5A5DA 5CDGA 1KEEA 1U9CA 3WWCA 2IW3A 4R8MA 1FFCA 3U61B 1TCAA 2NXWA 5EIAA 1JKFA 4QT0A 3WMWA 1I3CA 2PA0A 4MIEA 4TTAA 1B2RA 5JCXA 2GDJA 4TXJA 3K15A 3HJCA 4G0YA 1CUDA 1RQXA 5FI3A 4JJGA 3F67A 3K1AA 5EE9A 1PFYA 3T0IA 2C9BA 4FFMA 2VBFA 1WMBA 4JZKA 5AK6A 4PG4A 4MJXA 2BISA 1CJCA 5AICA 1W581 4EKDA 1DWQA 2QLMA 1YHNA 2FPIA 1ZBQA 1PZMA 3IVMA 2ZKIA 3QOWA 3GJ4A 1C30A 1C3JA 1FIUA 1SHKA 3ICWA 3MUFA 3N39C 1J24A 1Q3KA 3SBXA 4MVWA 1K1EA 3UT5B 1T5HX 4LRTB 5BNFA 1U3CA 4ND2A 2XMZA 4ZYUA 4FQ5A 5GONA 3DCIA 1X8KA 2P3SA 2TMDA 4PHFA 3HYSA 1JDBC 4J8PA 3UHOA 2QQFA 3NHUA 2E4XA 4DVJA 5ITZA 5MN5A 1UC4B 4DIDA 2LCQA 2F55A 4HNAA 3VYTB 1U0NA 3TLMA 1R6VA 3FNQA 2FW0A 3NORA 4C4ZA 4NL4H 4IRMA 3R6GA 1PF7E 3G23A 1YO6A 5D2CA 4B6QA 1Y5IA 2QV0A 2D62A 3H04A 4W5QA 1NFRA 1YWGO 4FMCB 4E13A 5JTUA 1L5ZA 1EHYA 4BUJA 1S9HA 4C6HA 3K9FC 3CVXA 1KQPA 2WU1A 5C52B 3EPHA 1NT4A 3MLEA 1DS6A 2VJDA 3K0KA 2NO7A 4JB3A 4OY3A 4X8MA 1L4HA 3VNBA 1EGAA 1G2QA 1KMHA 1SH7A 2OC9A 2YHSA 4JMPA 1QCDA 4LS3A 5KYTA 1AK9A 1GZ5A 1PU2A 4L8WB 4NARA 3GZNB 3IDFA 3PFKA 4QBIA 3UAVA 1HYEA 4CMJA 5JD6A 4I3FA 3OF5A 1JLLB 3IT2A 4Q6WA 3WL6A 5IT0A 2WA2A 4W63A 1SD2A 4RORA 3KPYA 2OPBA 4JI6B 3CCBA 4DT1B 2X4DA 1AY0A 3KSAC 1L5VA 2BFPA 1Y3HA 3CV3A 2IWRA 5CR9A 1UFVA 4QO7A 8LDHA 3PITA 4GSLA 3T5MA 2Z57A 4JLUA 2CLMB 2GBPA 3FYDA 2FEXA 1Z8NA 1Y9JA 4IINA 3B6IA 1OZGA 3NU1A 3IODA 5GIOE 4CM7A 4BFXA 4EB6A 2I87A 3JYPA 1EAYA 4ZV4A 2Z6VA 1Y7IA 5C9ZA 2JBAA 1NW3A 5AJVB 1X15A 1U2GA 4QC2A 4RV9A 3T1HB 1ULAA 1KYIA 2W2PA 3G2IA 3OPYA 2C9YA 1VKRA 1M6WA 4ZVPA 3BIWA 3A6DA 1QH0A 3RAFC 3TFWA 2QSUA 3LLCA 1FTSA 4XTCS 1D04A 4M8SA 3GLIB 5ALOA 2VXCA 1I2CA 1JZTA 3A11A 1QVZA 4GHWA 3I1IA 5T4BA 1NX6A 3N2IA 3NI2A 2ZATA 4DLSA 4NMHA 1TNDA 1BEEA 1TM2A 2BUCA 2BRUA 2R68A 2A8YA 2QP9X 2VUSA 2XA1A 2HLNA 4IRXA 4BX2A 4CCWA 4UJ5A 2YVUA 1RD4A 3N0VA 2FRVA 3FB1A 1C7ZA 1P8JA 3F5QA 1AVTA 3MSXA 4KN5A 4QARA 2XCTB 1EAMA 3P9SA 1ZNYA 2P4SA 1EKXA 3Q7IA 1AKYA 3WOVA 1WV0A 1FFEA 3ZEIA 4BNZA 4TL8A 4C08A 1Y3FE 1L5HB 4FDVA 1C8VB 1UFKA 4X3OA 2A58A 1NVDA 4U8HA 2VHTA 1PZXA 3QPBA 5EXDA 3EWAA 4S1TA 4P0QB 5IF9A 1J8QA 2PKCA 4NEQA 1ONPA 3R4VA 5FLEX 4ADSG 1IZZA 3VR5H 4CIBA 3CJTA 5KYWB 1GKUB 3LNTA 1AC5A 3TEFA 4YLGA 4LWZA 1FRQA 4O25A 1Z2CA 1A5AB 3LD9A 4OHUA 3S0JA 3ZZUA 4AJHA 5K8JB 4NCNA 1HNWB 3DTVA 1FRNA 3LWZA 1P1HA 3MCTA 4GMHA 3EVZA 3ZUPA 3BC1A 4XPZA 2OG2A 1E3TA 3JQ7A 5KNBD 1U0BB 3RUIA 4YCNA 2FPRA 1JR4A 4UFPA 1FNSA 1BU5A 2WNIA 1QP4A 5SV2A 3MBIA 1GU7A 5E4TA 4GH5A 5T4FA 1P9RA 2F43B 2HZBA 5EQTA 3SIWA 2VPWA 5JNTA 2E5FA 1E0DA 4TTSA 3LLSA 3R0VA 3MIZA 4QVKA 1QTRA 3NUQA 4Y6QA 2Z5VA 5ERGB 3O9MA 2F2TA 1Q0RA 1P1FA 5FB3A 1HMYA 3JD3A 4LJ6A 4URUR 1BN7A 4JXKA 1R88A 1WCWA 3PFIA 1P1KA 5B12A 5HS4A 3OIGA 3H11B 1KK2A 2C2WA 3KJNA 3RS4A 3IXLA 4DAOA 2Q1TA 4LNUA 2FEOA 1VMIA 1EFPB 2I1QA 3C4VA 1K0FA 1X14A 3U4DA 3ZWWA 1P1BA 2OBXA 2YZMA 3EMBA 2GWRA 2XQGA 1KQOA 2CLLB 3LBAA 3P9KA 3PSAA 5BN5A 1NF8A 4JJEA 1QZXA 1OXKB 2O14A 1M2EA 2GCNA 4NRDA 5H4HA 1V16B 1TEVA 3D7RA 3LOPA 1NU8A 2DUMA 1W5AA 1Y42X 3H9GA 3EZNA 4WUTA 3U48A 2WHPB 2X9NA 2ZSEA 3A3YA 1OLUA 3NC4A 4GUDA 4PYIA 4QDJA 3TZEA 2P2NA 4AL4A 5LP1A 1ZHOA 3EIEA 5LQDA 5FTNA 3O38A 1KYYA 2P4HX 1L7QA 1P8AA 3KDAA 5F4ZA 4B3JA 2UZ3A 2GHTA 2FMKA 5HHTA 1NQVA 5D3MA 4OGLA 1KDRA 5ELLA 1UAAA 3EBOA 4PLCA 3ZE8A 2XBUA 4H35A 1O54A 1V41E 5PGMA 4Z54A 1IMJA 1BWPA 1UOEA 2HGSA 2HREA 5JOQA 2IYSA 5B2EA 2CYAA 2EXXA 3MILA 4ALKA 1TF5A 4J7CA 3BTOA 3DHVA 3L0OA 4MQBA 5CX1A 4BWVA 4L8VA 1CJVC 1TU3A 1UBKS 4IF6A 3EXIA 1XEAA 2OBFA 4MXDA 4UM7A 1OHHA 5THQA 4LMBA 2ZTHA 3A1VA 4D5GA 5CDFE 2HSDA 2NSLA 4YMIA 3HXMA 1ZUWA 3JD2A 3JTMA 4KXVA 2JJ1D 2POQX 3NBFA 4Q3DA 4TT8A 1PSDA 1P31A 3KOZA 3PUXA 4R8LA 3RODA 1ACMA 1FFAA 3JX9A 3MZ0A 1QHEA 2ATCA 3I4FA 2PZFA 2XE7A 4HSEA 1ADYA 2H7VA 1VA5A 1YSCA 3BH6A 3MWDB 2LGJA 2YBDA 1W9HA 3FVVA 3ER8A 2Q4RA 1OI7A 4B44A 1SA0A 1GUFA 3M8KA 4CEJB 1EQ2A 4GBGA 4CM5A 4DB2A 3I72A 2V5AA 3BSYA 1RC8A 3P2YA 4X0EA 2VQ3A 4EYEA 5JHHB 2IYEA 3VR5A 4IIXA 1QG2A 3KXKA 4HAVA 1S01A 3HM2A 3LLUA 4RPCA 3X1WA 3KPJA 5KNCD 3S70A 2NSHA 1MQ9A 2J6IA 1BA2A 2OZLA 3N8IA 1I1OA 3HBLA 3JQEA 1TU4A 2ILTA 2J87A 2QSJA 1SC3A 5C4MA 4MVJE 5CLJA 3TFOA 2V7QA 1IE3A 4Y9DA 4ISBA 5TSDA 3BJIC 1FF9A 3OIWA 3AXTA 2Q46A 1VPEA 3CRW1 4E21A 5E7QA 1Y6RA 1XF1A 4EEZA 1DC3A 1MLDA 3KP1A 2FE1A 2V03A 3F1KA 4DL9A 1RLMA 3H17A 1C14A 4TV9F 1XI2A 3B78A 4QGFA 2IYNA 5DGDA 4ZODA 3GCXA 1GQQA 4YXFA 2YRXA 1LRKA 1LLFA 2IXBA 5JVDB 1C4OA 1EU1A 3MCWA 5IASA 2B98A 1OGJA 1E0SA 1X39A 3BXFA 1FBTA 5C3UA 4MCJA 1XZLA 3WWZA 4IJUA 4FZJA 1BJTA 5CLQA 5DTEA 2Y4OA 1U5AA 4EEXA 4MW5A 1PR3A 1W85A 3AHDA 3R6LA 3CEHA 2SCUA 4LZOA 3D8TA 4IDCA 2H8GA 4K6OA 4TOIA 1GG2A 3RRYA 4FKBA 2ORVA 3H1EA 1DTWB 1YZUA 1JR2A 3KLMX 5EHZA 3RU9A 3ZY2A 5DNYB 2BI7A 1U0LA 1TW3A 4RK1A 4GL2A 1IBLB 3IPXA 4WQMA 5LA6A 1L1EA 5I7RA 3NP7A 4BO5A 5CXSA 2JGRA 1N0IA 1ZH4A 3G0DA 3OY7A 1YRBA 4TKUB 3N59A 4TLBA 5A0FA 1HFEL 1L4GA 4YJ3A 3MWEB 3A9RA 2P3QA 3TNDA 1E9CA 2FV8A 5EWMA 3LFTA 5KYXA 3D4BA 1ZJZA 4MJLA 3G5TA 2BYTA 5E2IA 3DUFA 1QQ7A 2Z04A 3QKSB 1EZ1A 5HKAA 4BUZA 3ETHA 3B7WA 2QY6A 1MOZA 1ZH2A 3I34X 5JEEA 4PG6A 4Q7KA 2ZW9A 4O3MA 4NIMA 4OBEA 4AP5A 3W5IA 1BROA 2QTBA 3DYIA 4Z4QA 3FYTA 3IUBA 3TZBA 5LMZA 3WA6A 3IP5A 1Y34E 3L1JA 3OM0A 2IBSA 3CLKA 4PXYA 4N76A 3PC2A 4KIJA 2C2OA 3KAKA 3EIHA 5F21A 4LYAA 1V39A 3VU9A 2GN6A 2ZUSA 3GW8A 3STYA 3BGDA 3ZY5A 2JFQA 3GLFA 1OU0A 1SHJA 2D5CA 2W6NA 3KPVA 3N74A 3V4FA 4D4KA 3E9RA 3ZJ4A 1K89A 1Y4DE 2QN7A 2BH2A 5ESDA 3GFTA 4LVNA 3MMNA 1DFHA 4GQAA 3MJ4A 2L18A 4P5PA 4XWGA 2G04A 1IM8A 1KDVA 1DIBA 5DXAA 2J1LA 2DJIA 5CT4A 1LCIA 3RC9A 3ZV4A 4BLOA 1OH8A 1X9GA 4JP3A 3QJGA 4E1BA 3RVBA 2YTZA 1JKJB 3OWXA 3GLGE 5K99A 4EHJA 4EMUA 4G1CA 4X3CA 2I54A 5DEIA 5BWCA 1UBUS 1L8AA 3L7IA 4Q9HA 5KKNB 5DHFA 5LQMA 4D1YA 2VDQB 1I9GA 3HV0A 4LRQA 1J0DA 3O21A 3G2NA 2CSUA 1YOVB 3RUEA 2V6IA 1F2UB 3L0SA 3SC3A 2VSYA 3KQSA 4JWTA 3TTUA 4G0XA 4JDPA 3I6ZA 4BDTA 3RU7A 3IJRA 3M4XA 4JENA 2H0QA 2BBOA 3ORHA 1C8KA 1THTA 4RY9A 1QMPA 4Z2YA 4EFKA 5CNMA 1KPGA 4M9CA 1D2AA 2NO6A 1FFGA 1JLKA 1O95C 3MQFA 4FYXA 4IR7A 1SVUA 1G4HA 2ONZA 1KDTA 1R0LA 3ZD9A 2DWUA 5I7VA 1E5DA 5EIFA 5B1EA 5ALVA 4L02A 1WZ2A 2BT4A 2VYVD 4YP1A 5FUWA 2JK0A 3HI6A 2ZFUA 4UTNA 4Z51A 2W6ID 1I4LD 3N0XA 4H7HA 5G4LA 1FFHA 3R41A 5HRCA 5JS6A 4C2AA 4P0TA 4WXYB 1W8IA 4K05A 1ZI9A 2IXEA 3EMDA 1CX9B 4YAIA 1K6XA 2GKOA 4FMDF 4XDZA 3T3PB 1KHHA 5FJJA 4TT3A 3FZEA 3S2UA 4DSAA 1NPDA 1XZAA 5IX8A 5DOZA 1MIOB 1U6KA 2E37A 5AOAA 1JSRA 5B64A 1NG9A 2ISCA 1E5QA 1JLHA 2FPGB 4K2HA 1E4YA 4A6XA 2NP6A 3A1TA 1PLLA 2ZTLA 1JFRA 1KZ1A 4B4OA 4RGQA 1CK4A 1J39A 1D2CA 4UBOA 4Y1GA 5CBPA 4XLLA 1ZNXA 2PV0A 621PA 1ABFA 1E3SA 4REQB 5LM3A 4HDMA 1YR7A 4DLXA 4RD1A 5IVPA 4J4HA 1AK1A 5JLJA 2OLKA 2OGTA 3DLAA 4TWZA 3GCDA 3H99A 3WYGA 3EA0A 3HCNA 4OAPA 1QO9A 1HPLA 5KOJA 3AKZA 3DUWA 3WLQA 1IB0A 2FB9A 4CV0A 2CLEB 5C5IA 3HDVA 3G13A 3N2NA 3RF7A 4DKJA 3CG4A 1P0PA 1AGPA 4C0LA 5C8YF 1EESA 2XNKA 3R40A 3DZJA 1JEDA 3VO1A 4Z9XA 5CFMA 1R9NA 1N2XA 1NKSA 1U2ZA 1N1MA 1PDVA 2HK7A 3O90A 3OZVA 4NBKA 5EPUA 4F9TA 1ST2A 1L5SA 1UKBA 2QL9A 5BMOA 3CF0A 4UCFA 3STXA 1UK8A 1U1CA 2ZM5A 4S04A 1OAOA 3TLBA 3NBUA 1GPUA 3TI9A 3UAZA 3DKKA 1EK6A 2FEWB 3L8FA 10MHA 1M34E 1Y81A 1FC0A 3FMGA 2X6QA 1J0XO 1XNHA 4Z3OA 2CW5A 2ZAYA 5F52A 2JCBA 1FOEB 4AJ1A 3VZCA 2PXXA 3AOEA 4UPEA 5ILOA 1TAQA 1ZINA 1DFIA 1F3OA 5HDBB 1X8JA 4YUZA 2BZ1A 2OM2A 2XCLA 2KBFA 1OLXB 1WP9A 3DF7A 2FFQA 2AD1A 3FBTA 4RJ2A 1ZA1A 2X0KA 5EZYA 4CF7A 2WIAA 3VOSA 4F38A 5CYFA 1U7XA 4LA4A 3UZUA 3MRXA 4HTFB 2X5JO 4X00A 4QTYA 4CKCB 2VF7A 4AMUA 3RSQA 8AT1A 4F6RA 2F8SA 1ZO8A 2WYWA 2C59A 1VPWA 5F5LA 1MX3A 3O92A 4LJSA 1URPA 4BU1A 4QOHA 1DJQA 4REMA 5JXJA 1C9DB 3FG9A 3VU3A 2K7FA 3AZPA 2AR9A 2AUNA 4LJKA 4F4DA 3O94A 4AKIA 4QDZA 2W6JD 2PRJA 2BHTA 5AW8A 2G40A 1SRRA 4JLSA 3QA9A 3IOYA 3LNCA 5LBIA 3BGWA 2ST1A 1KI6A 5U9CA 2CDAA 3FB4A 4QRDA 1YZQA 2C3PA 2X9LA 4I3GA 3KEOA 5D86A 5FJIA 2P2GA 13PKA 3V1YA 4UBLA 2EP7A 1YT5A 3IP1A 1VRCA 3CZ4A 4F8EA 3U4HA 4GDMA 5AESA 2ODQA 3CJRA 5E0KB 2BGWA 1BEUB 3TPZA 4PLWA 1OBHA 1GADO 1NM5C 3P9QA 2QM8A 4MV1A 3B89A 3V7WA 1X42A 2BHLA 3EF0A 4TPKA 1PGJA 4QTUB 2E4AA 2JZCA 2RKWA 4D56A 4PVDA 5EHXA 2QI9C 2IE8A 4HG2A 3SFVA 3QMWA 2DFTA 1Y0BA 1JLSA 3BX1A 5FWDA 4J6FA 3V4PB 4EG7A 5JO9A 1ILEA 2BELA 4Q12A 1LRJA 1MB2A 3B6ZA 4P6VF 5I7SA 3R0XA 1YA4A 2NM0A 4JN6B 5E6RA 1K75A 5I9NA 1MJFA 4BV8A 4F84A 4CT5A 3EXFA 1KEZA 1ISGA 5H8WA 4RLQA 3UMFA 3UOAB 3Q7PA 5KQSA 3C3XA 1ZFNA 3E2IA 3JRNA 5FI1B 4HDQB 2G1AA 4H15A 1HQYE 3HZZA 1P6QA 3LYAA 2PX8A 3IQDB 4HS9A 1KKLA 3N2GA 4FFWA 3ETGA 1COWD 4JJAA 3SR0A 1QPZA 2QLFA 2LDBA 2A5GA 1EVYA 2EBUA 3E6AA 3GLRA 1RYBA 2C7BA 1YTLA 2X8JA 1Z88A 5LQKA 3WB1A 1TF7A 3KAPA 1EB8A 4O2AB 1BCRA 3AJ9A 1YHYA 4DYVA 1Y7LA 4PC6A 2CSXA 3KOYA 2EEPA 2J5QA 2X22A 5C35A 3I0ZA 5FX2A 2UV8A 4G2NA 2WF6A 1L0BA 4CUJA 1UBRS 4JJZA 4HO1X 3WP1B 3WLMA 4BMDA 3CTMA 4MVJD 2B3TA 3L8DA 1ADCA 1J5EB 4AY2A 1ZICA 1P0IA 1G3IA 3ZR4B 2G1UA 5EAIA 1SC4A 2J41A 3CR8A 4RZHA 1VJRA 4J91A 5JE8A 5FR1A 1HDOA 1RHRA 2GERA 1U4NA 4QBHA 4BO8A 3ZWAA 4EGJA 1W0CA 4ALMA 5HIKA 1KP3A 1QM5A 3L4EA 4CKBA 4D6YA 2VF5X 4HMPA 4L5CA 2PXAA 5MN6A 3MD0A 5L51A 5JU6A 3UWKA 3AKDA 2G1PA 4RGBA 3TIIA 5DTIA 1A27A 2QW0X 2AEEA 1VXRA 2OQIA 3A28A 3C98A 3NTQA 4IYJA 4NZMA 4QXPA 5CT5A 4Y9RA 2ZWAA 2OO5C 1DLJA 1NP6A 1T5OA 3ZV6A 2W37A 4OQZA 4XH9B 2BGLA 2GM5A 3HI4A 3RYHB 3VKUA 4CE6A 1NBAA 1M5TA 1IBMB 4FYMA 3MB5A 3WMEA 1I3NA 3C6KA 1HC7A 1KJJA 3WMFA 1CDEA 4K9KA 1DUIA 3CEPB 1V48A 1HWYA 3LKVA 4INOA 3VH2A 4B2PA 1XRJA 2D2XA 4Q7MB 1CJUC 2ID7A 3A1CA 3KWLA 4FZVA 3NDRA 5EC8A 3VOAA 3UKDA 3AJRA 1TPZA 2AUTA 3BCRA 1ELOA 1S8OA 2F9MA 2Q5IA 3RIGA 3RNLA 4MIKA 4F1KA 3MA0A 1QX3A 2HY7A 3IP3A 4WK6A 4DMFA 1JB1A 4A03A 4N1AA 4QM6A 1JALA 1GUZA 2VDOB 4BCDA 2JLQA 4QU9A 5DPMA 2P6PA 3RC1A 3V2UA 2KMLA 1G17A 2AV6A 5CK4A 5GIPE 4U9UA 2NG1A 1G16A 1OB2A 4ZALA 5B4TA 4ER5A 4K87A 1MVLA 5AM2A 3AVOA 4HDOB 1FS4A 1S2MA 4XYLA 3WAKA 4AUNA 3W7AA 3T5CA 2BFCB 4DMLA 9GPBA 3F6EX 3HXOA 3L4BA 3RIXA 1SUFA 1H2AS 3EMKA 2Y0CA 4GP9A 1Z4NA 3A3OA 4N9WA 3S1AA 3V1NA 4DDTA 3LY8A 4CZ2A 1LFAA 3TD6A 1U99A 4FU0A 4BB6A 2JL1A 3Q72A 4PNZA 4PSDA 5JD3A 5FLXA 1B7GO 2B8TA 2IY9A 2WT9A 4K9MA 1QTQA 3AM1A 3U4IA 4NXNB 5E9QA 4DR3B 3M4YA 3QUBA 3QOYA 1D09A 1A04A 1IY8A 1DEHA 2AI3A 2KLHA 1O6CA 3V4VB 5BSTA 1KO5A 5TPWB 1ZU4A 2I76A 2UU9B 3Q10A 4C5BA 1T4BA 2CLDX 2MYNA 2ET6A 4C7BA 1MDBA 2F1JA 4UNIA 4XYEA 4QQ8A 5JCOA 4B47A 5CLFA 5IPFA 1WETA 5CB8A 5JMPA 1H69A 3WL5A 2UYHA 2H9IA 2XQFA 1ZNZA 4KN9S 2DSNA 4LHZA 3R8FA 1XAHA 4FSDA 3F1LA 5EZ6B 3V9AA 3KCNA 1F0KA 4OBXA 3GJXC 3U3ZA 3NAMA 2CV0A 3DT8A 1CT9A 3W5CA 2QX7A 1NUUA 5L3VA 3ZW7A 1ZUNB 5KVCA 1HLPA 2EKBA 4U0JA 3S44A 5F2OA 2EQBA 1TMOA 1Z29A 3ZTYA 4B7AA 4AQYB 1JWLA 1NRXA 1ZHFA 2F90A 1Q15A 1RI4A 3PJEA 3O8OA 2ZUEA 2I71A 3QYFA 1GQSA 2EBHX 3CTPA 3ZU2A 1SEPA 1YFLA 2BGUA 1ZS9A 2GWHA 5IM4F 1D6SA 2JCSA 3BHIA 1KSHA 3EXHA 4EAQA 3AR7A 2W8BB 1SPXA 1TJNA 3LUCA 2WJYA 2SKCA 3FBWA 5C31A 3TE7A 1C3VA 4WN9B 1Q1BA 2AZ4A 2ZPUA 2ZQZA 3MT8A 2DU8A 1NQOA 5FOVA 4DE5A 3DS8A 4MV3A 4LMAA 2ALJA 4KIGA 1GRRA 4QTXA 3OSZA 2I33A 4P38A 1E6MA 2ENUA 2ZSBA 4XJVA 1MZVA 2VN8A 3AIIA 1U7OA 1UC5B 1UADA 3JZAA 2O54A 3PC3A 4EZEA 4EJ2A 3O8CA 2HSEA 2O8CA 3OPXA 1ENYA 3UFBA 1KI1A 1J0BA 1I10A 3W9SA 5LVAA 4LOKA 3VPGA 1VE7A 5JXHA 2FHSA 4MVJF 3EIUA 3JQDA 1GUAA 3Q3IA 3WK7A 4G3XA 1PNOA 5CW2A 1C7EA 4WNAA 3ZIDA 3KR9A 1HTWA 2B0JA 3O4GA 4U2GA 3YASA 1IHPA 1HK7A 2XY4A 4DCOA 2ZXUA 3BWBA 2XVYA 3DE7X 4OMDA 1HE5A 3IJPA 4EGQA 3L05A 4EGCB 2C84A 3GT3A 4NFSA 5M29A 4W1RA 1XEWY 2I8LA 3E3OA 3DVQX 5L3ZA 1IJEA 3PC6A 2B8NA 4ARUA 5K9ZA 4XM1A 3JQ8A 3DWIA 2BHNA 3DO8A 1Y3CE 3H87A 4Y7CA 3LFHA 4X60A 2WJWA 2Q07A 2QNIA 3B6JA 1JDZA 2ZBEA 4M6WB 5EFZA 2G17A 4J0DA 2I2DA 2FDXA 1JEQA 1GQ2A 1U2EA 4HRYA 1GQRA 3W04A 5B57C 3INNA 1QP0A 4UUAA 5E9JA 4A91A 4Q47A 1CB0A 1VBKA 1VSBA 3CLRC 3CN7A 3V48A 4AZ3A 2ECOA 4YCLA 2BGGA 4IIDA 1H42A 4MRAA 3UG6A 2XTJA 3KAJA 4O1HA 3D2CA 4WTOA 3WV5A 3ZX5A 4DLAA 4K8OA 2O8BB 3A37A 1DQYA 4WZAA 3W4JA 5IAOA 3A4MA 2P78A 2HPAA 4BDSA 4DWOA 3Q6IA 1E79A 4OQEA 1CUAA 4AU1A 3MTGA 3WWOA 1X7GA 2OHHA 1MPTA 2RH9B 3TUJC 5KIAA 4ERNA 1EXWA 3I5AA 3KZMA 2QE6A 4HQKA 1P1JA 1ZGGA 4CLRB 3P9CA 2LNDA 4TYPA 4BKQA 2OB2A 4CPDA 1EK0A 4H59A 4KXWA 1ZPDA 4Q1DA 1M7GA 3BKXA 4RGVA 1Q0TA 1UP6A 2RGEA 3AO0B 4YFVA 1KYXA 2OOKA 3F0TA 3PF9A 1FNDA 4IH4A 1PSWA 3A4LA 4PYRA 1V37A 1A1VA 1HKUA 2P9QA 4ARVA 3GWGA 5IVIA 2V7XA 2VHXA 1CCWA 1SG9A 2Z8YM 3CJQA 1U2PA 4KQJA 3R8XA 4D44A 3CBQA 1RM3A 3WKAA 4C9BA 4B2IA 2B25A 2FFAA 4O8ZA 3D6MA 4IS2A 1PJAA 1SBZA 1U6JA 3TZQA 4DY4A 1CB7A 5JD5A 4OKIA 5HTOA 5AVQA 5KNDD 1T3LA 1EFVB 1HDCA 2XOKD 4QWWA 2PH7A 5FTWA 3O1LA 2G88A 4ZRMA 4V1CA 3OT1B 1R4MB 2IEDA 2BTQB 3FOZA 1J0AA 3PJDA 5I9MA 5UKDA 4QQFA 4U2FA 1T9KA 5CW1A 1CJSA 1T0HB 3H9EO 3OUZA 1V26A 5KINB 1RXVA 1K98A 3L77A 4ZCLA 1Z2OX 1XTPA 4AW9A 1PT8A 1T8WA 2PD6A 4MV0A 4EA7A 2QTWB 1CUIA 5A9SA 3R6DA 1FP7A 3E3AA 4FOOA 2EZ8A 1R0WA 2IA5A 4MDEA 4X92A 3D7MA 4YJFA 1V7PC 1YK0A 1U31A 2H9AA 3O4IA 3PBKA 3F9CA 1T6YA 3D3JA 3GFGA 2A0UA 1WY5A 2FA9A 2WUFA 3B1VA 4NE2A 5DWDA 1CRQA 5BT9A 3SQDA 4A8JB 3HO6A 1E3WA 2FR1A 2FZCA 3JR3A 4P3OA 4XEUA 3L1IA 3TOSA 2G1KA 4LYEA 3VR6D 4A5OA 3C5EA 2QKYA 4M1WA 4C7XA 1V3TA 4BXOA 1MC4A 3CT4A 4G5FA 3C3MA 4HAYA 4MNTA 3L1KA 3QLUA 4TVSA 4ACAA 3WK6A 1BXRB 4PSAA 3H18A 3CX8A 2VJOA 2VS1A 3RVDA 2P6NA 3VGPA 2ZJ6A 2XH8A 1P44A 3AR4A 2OCGA 4KXNA 1BH2A 1J5PA 2PSHA 4NENA 2J31A 1SU7A 3AM5A 3BAZA 3GD7A 2HAEA 2FWRA 3ZE0B 3H1AA 1WCV1 2GYVA 4FN5A 3MK31 4RWEA 1EIWA 3EIFA 1HEYA 2PGLA 4CM9D 1JJ7A 1YUNA 1LPMA 3DEIA 1RI2A 3KYCA 4A82A 1TM5E 4QDKA 3ZGLA 4UBIA 4P0PB 4BLQA 5JS1A 1WLYA 3MJDA 4WV3A 4J07A 2E55A 4W5TA 1Z6YA 2EGHA 4G1FA 4J76A 4ID3A 4ZARA 4MKGA 2BI8A 4OOEA 3A32A 2ZVJA 3ER6A 4CTMA 4F7WA 3ILYA 2I55A 2OXIA 4M1YA 4M36A 3DW3X 2RBGA 2DHCA 3WR5A 3D7NA 4ZU6X 1TQ2A 2IF2A 4ONEA 4RLHA 2Y1LA 1M34A 4B9EA 1UJMA 2YDYA 2W4QA 3FSRA 3O3NB 1KBQA 3C8DA 3GFOA 1LQTA 1BS1A 3FCUB 2W93A 3GPBA 3IEKA 3UO8B 4IHAA 1QK4A 3JTEA 2ZBPA 5GOZA 2VHEA 4FS8A 4WBNB 4LK3A 4BV2A 3V46A 5KC9A 4OH7A 1BDIA 1YBVA 3VC1A 1NQWA 1EVKA 1TVMA 3UGKA 5JDIA 3V9PA 1M6NA 1ZXLA 3RCBA 2ZYUX 4KODA 3T35A 3H4IA 1G7CA 3Q6NA 4HMQA 3HHEA 3M9LA 5CA0A 1J8DA 4DGQA 4Q4AB 4XJTA 3CKYA 1W59A 3ILSA 3PG5A 5AVVA 5DM70 1VE9A 2PSJA 2E21A 2PS0A 4MIYA 4RS4A 5JY1A 3AVVA 4TXNA 4DQKA 3GFRA 1JE1A 1FEZA 1ZAKA 5FDFA 3AY0A 1KYZA 2XCUA 3EUFA 4J7AA 1H05A 4X7PA 1F4PA 4U7PB 3JU3A 3ZHRA 1VLMA 3U4CA 4Y2PA 2J09A 2WHRA 3WB9A 4KJXA 2X0DA 4N8DA 2PL1A 1MT3A 4I55A 2QMUA 1D6NA 3I6BA 4JOCA 4NBWA 1Q2XA 2AN3A 2VFAA 4L0QA 2OCDA 4IXNA 3ED1A 5HKOA 1ZUD1 1JEJA 1P0FA 4A0SA 1U8EA 4PSVA 1F9AA 3HKCA 4KDFA 1BQ3A 5AM5A 2BP7B 2J3EA 2WI8A 4P4TA 5B1YA 5KX5F 1GTSA 2IHUA 2NIPA 4HDSB 5BMVA 2H85A 3O82A 3V4ZA 2JFYA 1GIAA 2DKNA 1I1HA 4JBXA 3M1AA 2H57A 4W1SA 1XB2A 3DZ8A 1U90A 2NTEA 2YMPA 1C9MA 3KOXA 1AQLA 4IHJB 3D4PA 1FMJA 4LK2A 1NAIA 2V3WA 4XGIA 5GGYA 2DEUA 4RHUA 4GWGA 3MTDA 2ZWVA 4Q15A 4DIEA 1E63A 2R7MA 1OT3A 1ZL0A 2Q4OA 4NNJA 4WJKB 1RZVA 1NJ5A 2AWNA 1K63A 4R9NA 4Y6LA 1VFNA 2BEUA 2D4HA 3LFUA 3TE6A 2MR6A 3P94A 4LXUA 4H7KA 4B6RA 1WMSA 5HZHA 1LSOA 4EYSA 2CXTA 5HKKA 1IHUA 2C92A 2FPMA 2GKSA 2WFMA 2ZWIA 4LE0A 2XUIA 1IUPA 1NVXQ 1O3YA 2GS9A 3HGTA 3TQQA 4YYEA 1GA4A 1XALA 1SCBA 2ZU0C 3ZV3A 4I55F 4XFJA 4YUXA 4I8DA 3KLOA 4RCZA 3WGYA 3KKQA 4WXMA 1XQVA 3BMQB 2O8VA 2UUCB 2FMFA 3ICVA 4D0GA 5D6OA 2P6MA 4NVRA 3IIKA 1E2PA 1M2JA 3UENA 5BMVF 3L4SO 1N1DA 5H0IA 4F72A 3CWCA 1JA0A 1KJIA 2XUPA 1DQRA 1PZHA 2DY0A 4RKEA 4V2IA 4F4IA 3ZD7A 1Z15A 4ZCTA 2O8FA 4CEHB 2FSPA 2NUBA 4YP7A 1UOPA 1RP7A 2YIJA 4Q1FA 2X19A 3BWXA 3H7AA 4KXXA 1KOFA 1UDBA 2PZ8A 2RI0A 4IV8A 3AF4A 1FDVA 4IXTA 3K6SA 2QIOA 1MFPA 1OUMA 1O4WA 3NATA 4F3YA 1R50A 5D5QA 2D1RA 2F17A 3FWPA 4JUFA 4M98A 5KAPA 5KJEA 2X5OA 4HQLA 4AKGA 4E5MA 2UUBB 2PWPA 4G8DA 5JXWA 1JJBA 2FQWA 2HPVA 3TN7A 3WLOA 1ZCFA 1Q1ZA 5JG7A 4QDXA 4UHEA 4CG2A 3S27A 3P9PA 3CNQS 4PFSA 1HSZA 4FHZA 4L27A 2Y1CA 4CQMD 3LPDA 1UOOA 1FXUA 2J48A 4KQHA 4EF6A 3OE7A 4B0OA 1Z63A 1EE2A 1Z2AA 1P2GA 3CEAA 2BSQA 1JEEA 4MKIA 3FYUA 2XMBA 4XDGA 1PGPA 1YULA 4PF1A 1SXPA 4KR2A 1WB5A 4DLWA 2WMOB 1H85A 2G70A 4KMMA 2FDRA 2RB4A 4MLPA 2JDID 4F2HA 2ATEA 5IS2A 2Z9CA 3OCWA 2FSUA 5HOQA 4LZJA 4AFNA 1E7SA 1C7JA 2XRZA 1EFKA 1KDPA 1FMLA 1RLOA 1T25A 3JAWA 3NC0C 4YDRA 3EVBA 5AI9A 3T4EA 1GAWA 5EMLA