2BJHA

Crystal structure of s133a anfaea-ferulic acid complex
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHALGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPADEGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERULOYL ESTERASE A
publication title Probing the Determinants of Substrate Specificity of a Feruloyl Esterase, Anfaea, from Aspergillus Niger
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 92
structure length 260
sequence length 260
chains with identical sequence B, C
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bjhA00
1SCIA 5AI8A 3DD5A 4N8SA 3WWOA 4C89A 2ROQA 4BAUA 1CUDA 1UZAA 2CKMA 3RKSA 1AC5A 2VTVA 1DTEA 2PM8A 3WI7A 3UUEA 2Z8XA 1GPNA 4PQEA 4GI1A 5D3KA 3C8DA 1EINA 4UHBA 3VJLA 4UBJA 3WWPA 5BV7A 3L1HA 4KJXA 2OCGA 3S2ZA 5CBKA 1GPLA 2PSFA 2XMGA 5SYNA 3M83A 3I6MA 2W6CX 2WFZA 3PI6A 4LHEA 2B4KA 5FKJA 1CIJA 3K9BA 1WB5A 1Q84A 1QIKA 3LCRA 4ARAA 4HXFB 1FFEA 3VVLA 1EA5A 4PNZA 4YX9A 5ALWA 2G5PA 1XZMA 7YASA 3A6ZA 2JGKA 3VXKA 5HQ3B 1R4ZA 1JU3A 2X8BA 3CXUA 1JMYA 3GROA 5CT8A 2VEOA 5HK8A 3QITA 1ODSA 1CPYA 5BWCA 5D3ZA 3CN9A 2BKLA 2H7XA 4NMWA 3PF8A 2JEYA 3V1LA 3DLTA 4BTVA 3DKKA 5LYYA 3RARA 4UHFA 3FVRA 5AHXA 1CRLA 4U2EA 3AJAA 4C88A 4Y9SA 2Y2VA 5JIBA 4KAFA 2HM7A 4OPMA 2DR0A 4BB0A 4MQMA 1VA5A 3C43A 1GKLA 5ALIA 4N8DA 1A8QA 1XRPA 4DMHA 1GT6A 1ZD4A 2ACKA 1YS2X 4QWMA 1CUBA 1H22A 3WKBA 3PFCA 2ZJFA 4X97A 3N2ZB 4QLAA 3EF3A 1UK9A 4B9EA 5AKKA 2QXUA 2PL5A 2WFLA 4G4GA 4OU5A 5ALJA 5BWBA 1LPMA 1R1DA 4MXDA 3QM1A 1F0PA 2XMQA 4H7FA 4UHDA 1K63A 3WK7A 1DQZA 3AIMA 2BJHA 1FFDA 2GZRA 3F96A 2BAGA 1QOZA 4KE9A 2DHCA 4P92A 4KAJA 4WFKA 4NVRA 3GBSA 5CXUA 3WL6A 4AO8A 2VT7A 4J0HA 4W1QA 4AO6A 3OM8A 1XZJA 3QPAA 2PSDA 3ANTA 1JJFA 1BN7A 3IDAA 3TGLA 3JW8A 5T4EA 4BVLA 4A5SA 4KYVA 1YASA 4KR0A 1EB9A 1O6FA 2GBIA 4Y2SA 4H7HA 5E4YA 5DYWA 1SC9A 4I19A 1C4XA 3PICA 3U1TA 5JD5A 3IVMA 2B9VA 4P9NA 4TPKA 4ZV7A 1IZ7A 2C0QA 2XMDA 1XZLA 2ZYRA 3I6ZA 3FYUA 4FFWA 4PSUA 5ALSA 3WL5A 4BDTA 3HI4A 5KWJA 3HSSA 1CUYA 1XLWA 1XROA 1B41A 1GPKA 3UUFA 2HFKA 1UKAA 3ZV7A 5AKEA 1L7QA 2V96A 3W2TA 3ESCA 5ALEA 3WWCA 2XI4A 3DYIA 1WPXA 5ALUA 1HPLA 4LYDA 3C5VA 3D4LA 5AKZA 1EX9A 3EQ9A 2XUOA 2QTBA 1CQZA 4FLEA 4AX4A 1WHSA 3WKAA 2XMBA 4MWSA 4DSAA 1QONA 3OOSA 5CH5A 1DINA 5HF8A 1U8EA 5D7BA 2OQIA 3G0BA 3BIWA 2XQJA 4L9AA 1EB8A 2PSJA 5DWDA 1XQYA 1I6WA 1VJ5A 4X94A 3WZLA 5DTJA 3M82A 1YSCA 3IURA 1N8SA 1P0IA 1U65A 2WM2A 4UBMA 1ZIXA 1R9NA 1ETHA 4ZWNA 5AH0A 3TJMA 4B0OA 2JGEA 1W76A 3D2AA 1CR6A 4G8BA 1TKRA 1H23A 5A6VA 3C45A 1L7RA 5ALZA 2C5GA 1H2ZA 1R9MA 2VJDA 4QLOA 2QJWA 4CFSA 3DNMA 5JAOA 2R8BA 1JKMA 1EVEA 1QIJA 4S0XA 1DQYA 3FSGD 1LPBB 4G5XA 2Z8ZA 1O6GA 2GBFA 4W63A 1BRTA 1FFBA 1MPXA 3DL7A 4AO7A 1LBSA 2HA0A 4BC1A 3DYVA 2WLSA 3IUJA 2C7BA 4K6HA 3TRDA 4Y2RA 2BUCA 3TEJA 1QTRA 2XUQA 3R3XA 4EY4A 3STTA 5ALXA 1EHYA 1ZIYA 2LIPA 5EHZA 5HZGA 5K5EA 3A70A 5LIPA 5LZ5A 2WJ4A 3GELA 5AI4A 5H3HA 5AOAA 1QIHA 3HC7A 5LZ8A 1ZGBA 2CMFA 4Y2TA 2HA2A 2JF0A 3H19A 3BIXA 3R3VA 1CUAA 2YASA 4QDUA 4IH1A 4AZ0A 5EGNA 5ALLA 1FFAA 4U2DA 4BBZA 1CV2A 3F67A 2ZYSA 1NU8A 4PF1A 2QRUA 3ESBA 2ORYA 1ZOIA 2GZSA 1W4LA 3FYUB 2Y1KA 3WMRA 4EZIA 2J4FA 3W05A 1F8UA 3B5EA 3F97A 4FLMA 3D2BA 2WUEA 2VF2A 2O2GA 3O95A 4RE5A 3BL8A 3WL7A 1JJBA 3WKDA 1MJ5A 3VJKA 3WQHA 1ZI9A 3IULA 2Z3WA 2PUJA 1HBJA 3T4UA 3LIPA 3PUIA 2RGUA 5HCUA 1EK2A 1DU4A 4WFIA 2JIDA 1CUSA 1HLGA 4J0JA 2OPHA 2HA5A 1LBTA 4EY7A 4X71A 2XMRA 1J2EA 3CCBA 4B7ZA 3ED1A 2JEZA 5IH7A 1FFCA 4ITVA 5LZ2A 2OGSA 4QEKA 4PO3X 4OU4A 4OB7A 4HXEB 2OCIA 5EHXA 3BDVA 3QPCA 1Y7HA 4AMZA 4J0KA 4DGQA 1G5FA 2H7YA 2AXEA 3WJ2A 2HU8A 4BCDA 4FDMA 1HL7A 3N0TA 5ISMA 2Y6UA 5AKJA 4Q3KA 3A2MA 2WU3A 1LPNA 3ZWQA 1UFOA 3OURA 2QM0A 4AN0A 4GHWA 5AKYA 1VE7A 3KWFA 3MGAA 4E46A 1Y7IA 2XDWA 2WSLA 4DM7A 1YB7A 6YASA 2XQKA 4C01A 3HABA 1GQSA 3H17A 4H7JA 2WG0A 3HRHA 5HFNA 1YCDA 1YR2A 2HU5A 1PFQA 1MU0A 3QBJA 4GXNA 5AKGA 1E89A 3A2LA 1UOOA 3NWOA 1EH5A 1VZ3A 3WK5A 3HEAA 5LKRA 1GGVA 1P0MA 5ALTA 1XQXA 2H7CA 4N5HX 2RAUA 5A7HA 4BZZA 4BATA 1J07A 2DQZA 1XQWA 1TK3A 1XZCA 3UMJA 5CT9A 4OD0A 1VLQA 2OAGA 1K6EA 2Y2UA 2C4HA 1ZI8A 3FBWA 3QH4A 4DNFA 4G4JA 3WA7A 3DS8A 1R3DA 1EDDA 1TCBA 4J0DA 5DNWA 3IIIA 3OG9A 4AXBA 2BUBA 1SCQA 2QJRA 2I3DA 4DLNA 3SK0A 4PSDA 4B9AA 4K6GA 2OGTA 5FRDA 3H0CA 2JGMA 5ALOA 2QT9A 3KDAA 5AKIA 1YB6A 5JAHA 5DYTA 2R11A 4H35A 4Y2JA 4DTCA 4OUKX 2BCEA 1ZJ4A 4XVCA 3I2IA 2FX5A 3H2IA 4P93A 3R0VA 4HRXA 5ALKA 3H18A 2G4LA 3A2NA 2GYWA 4G4IA 2CBGA 1E5TA 2O2HA 5A62A 4CG3A 4KEAA 1MN6A 1Q0ZA 4WCVA 3L1JA 1ISPA 2D5LA 4E15A 2JGLA 5C8ZA 1ACJA 2WJ6A 1P0PA 3STYA 2ZSIA 4BAGA 2QS9A 1UWCA 5CTAA 1JT2A 4W9RA 1QE3A 2QZPA 2CJPA 4QE3A 1P0QA 4KRXA 3YASA 3M3DA 1SFRA 1VOTA 1E66A 3CCCA 4H7EA 1SOMA 1K5PA 5EFZA 1WHTA 4C4XA 5LZ9A 4MYSA 4U2BA 4GW3A 4INZA 1X2BA 5CH8A 2JGJA 4QDXA 3D2CA 4B6GA 3W9UA 4X92A 1QFMA 4G8CA 2H9YA 1WCYA 4UBOA 4A23A 2C58A 4EHBA 2WHPA 3C6XA 3NOXA 4NS4A 4QDZA 3F8SA 4BAZA 4BVJA 1ORVA 3E0XA 4F60A 2D0DA 2XB6A 3V1MA 2QXTA 3DOIA 5EHQA 4JYPA 2HRQA 3HZOA 1QLWA 3WKEA 4F5ZA 3D5EA 1XZEA 4FMPA 4RGYA 3DJYA 3I1YA 1QO9A 1VXRA 3WKCA 3BXPA 5AM4A 4QWWA 4B82A 1HQDA 2PSEA 1G42A 3I2KA 1MX1A 1QZ3A 5HF5A 4G8DA 1W75A 2QVBA 2W22A 5FPQA 4W1SA 4X95A 1H2YA 4I3FA 4C4YA 5FXMA 1W6RA 5CRIA 4AN1A 1RWQA 2AJ8A 3WZMA 1E8DA 2EDCA 4UHHA 2J3DA 5ALRA 1JJIA 2XUFA 1IMJA 2CEKA 4RNCA 3QVMA 3AIKA 1AGYA 2PKYX 1YAHA 2YYSA 3AFIA 4Q1VA 4Q82A 3LLCA 4AZ3A 3HJUA 4AB1A 2H1IA 4QDTA 3FWHA 3V1KA 2WHQA 4H7IA 2AJBA 3WWDA 2IITA 1THTA 2WIDA 1IVYA 3AILA 3FVTA 5IVKA 3L1IA 3FYTA 3G0CA 3RM3A 5DJ5A 3STVA 4HAIA 2XMSA 2WFMA 1L7AA 1G4HA 2OLEA 4EBBA 1QO7A 4JEIA 2X5XA 4LXIA 1JFRA 4ZREA 5FV4A 5AI5A 4B84A 5FPPA 1FJ2A 3K6KA 1GQRA 5I7UA 4G9GA 2PU5A 2WIKA 4X6UA 1MNAA 4MEAA 1XFDA 2HA7A 4LXHA 4GECA 4ZGBA 4KE6A 4BCCA 4QZVA 5EIAA 1LPOA 1CUGA 2OXEA 4CCYB 5AOCA 1BCSA 4J0IA 1CUFA 2XUJA 2DFPA 3W04A 3PE6A 4FNMA 4UBLA 4Y7DA 4TGLA 1VKHA 2QOEA 1PV1A 2RHTA 1VE6A 2I03A 4W1PA 3Q0TA 4IH9A 1ODTC 5D6OA 2WUDA 4CG2A 1SCKA 4IH4A 5FUMA 4J0GA 4K2AA 1Y37A 1C7JA 4Q3LA 2V98A 1IZ8A 1TQHA 1XRLA 4XX1A 1TCCA 1UK7A 3HYSA 2WHPB 4EY5A 1HKHA 1MTZA 1MAHA 5SYMA 4Q34A 4HRYA 3GZJA 5AM5A 3FSGA 4K6KA 3EBLA 4UBKA 1Q0RA 2ACEA 5EIEA 1XRMA 2GYVA 1DWPA 5KBYA 1ZICA 3NUZA 4QNNA 1QIEA 2XMCA 4FFVA 2AJLI 5AIAA 3BF7A 5FLKA 4EUSA 1DX4A 3VVMA 5KREA 1M33A 3AUKA 1QIIA 1R88A 2WU4A 3FLEA 3BF8A 1EXWA 3ZLTA 4BE9A 5AI6A 5AJHA 5CURA 1N5RA 3STUA 3WJ1A 2V97A 1AQLA 1A7UA 1H2WA 1S8OA 5K3DA 4J7AA 2HA3A 1LPPA 3OTQA 1D07A 3R3UA 1U4NA 1LZLA 3R3ZA 1DT3A 3MUOA 3SC2A 5DTIA 2OCKA 3H2HA 3D7RA 3IBTA 3WK4A 2HDWA 5A7FA 3WYNA 2WIGA 5AKXA 3KXPA 3H04A 4A16A 1X70A 2J3QA 3G0IA 1QIDA 3CN7A 3ZLUA 4P08A 4X91A 5ALDA 2XUGA 4DMCA 3DEAA 4JH0A 1K8QA 4IQ4A 2G63A 4MEBA 1EDEA 1XRQA 5EIHA 3EQ7A 4YPVA 3V9AA 4B80A 3P2MA 4BP8A 5CT6A 4DYHA 3PUHA 1BCRA 2HA6A 4WJLA 5CT4A 1GXSA 1XRNA 1EVQA 1J06A 4ROTA 1UK8A 3VISA 3HXKA 1EI9A 1JU4A 1XRRA 2VAVA 3AZOA 5ESRA 2PU7A 2VQ6A 5A7GA 3V1NA 3FLBA 4B81A 4GDMA 4QA9A 1XZAA 3MUNA 4WY5A 2XUPA 2J4CA 3FYUC 3KOOA 1DX6A 4N5IX 1CUHA 3SWWA 4U2CA 4GEGA 5KWIA 4ZRDA 3E1GA 3QZUA 4UFNA 2RHWA 2FJPA 1UXOA 2OQVA 4QDOA 2WTNA 5C81A 5AK5A 1UOPA 2I78A 5FOQA 4X85A 1E8NA 2VJAA 2PSHA 5A2GA 3C6YA 5ALMA 5AKLA 5K3CA 4NZZA 1CUZA 3VKFA 5AP9A 4FBMA 5EHNA 1CQWA 5I8PA 5DLPA 3FAKA 2QR5A 1A8UA 4X93A 1AURA 1JI3A 1CEXA 2WILA 4CI9A 4H0CA 1LPAB 5E4TA 4PSCA 5DNVA 4Y2QA 2HFJA 4GBGA 1T4MA 3BJRA 4X90A 3HACA 2FUKA 4TVKA 1XKLA 1K4YA 4Y2PA 2DCMA 4HS9A 3ICVA 4DIUA 3KD2A 2DHEA 3I2FA 1OILA 3DKRA 3O9MA 3PFBA 3C5WP 2HU7A 3G9XA 3RLIA 1BS9A 3I6YA 5HFAA 2I3ZA 2O2IA 2K2QB 5JD4A 3STXA 3QYJA 1VA4A 2XLCA 1CUIA 4HTAA 3C6BA 3C70A 3MVEA 3IUQA 1DWQA 5CT5A 4YK7A 5I9IA 5AM3A 1BU8A 2HIHA 1CUCA 3X3HA 3R3YA 5AK3A 1AKNA 1YA8A 4OB6A 1EK1A 4WY8A 2HA4A 5ALQA 1JMKC 4X6XA 1GKKA 2RONA 4C87A 3BDIA 4Z49A 3LS2A 2ZYIA 5HKAA 5HK9A 3ICWA 1CUVA 3O0DA 1N1MA 2ZYHA 2JGIA 5JASA 3R41A 4Q3OA 2YXPX 5T4FA 5T4BA 4HXGA 3T52A 1VZ2A 1ZI6A 4FOLA 3Q8WA 4DNQA 4PV7A 4GWLA 4G1FA 5YASA 2Z3ZA 1CUJA 1H2XA 2ZJ7A 3C8HA 3E3AA 2ZSHA 2V9ZA 2CZQA 5JATA 2Z5GA 1AUOA 3G9ZA 1IUNA 4B0PA 2VJCA 3B3QA 1WOMA 4H7DA 4CCYA 1ZD3A 1BEEA 2BGNA 1MT3A 1X2EA 5LZ7A 5IKXA 1ZGCA 3H2GA 3NGMA 1USWA 1GZ7A 3QMVA 4MJ3A 5JANA 4UUQA 1CUEA 1NX9A 5AKHA 1MNQA 3FCYA 1E3QA 3O4JA 1TAHA 3B12A 4C4ZA 1TCAA 2XQFA 4KACA 5AK6A 2AJCA 5IVHA 2PX6A 5JZ9A 4L72A 3KSRA 3ZLVA 5FDFA 1DT5A 2B20A 3O4IA 2IX9A 2UZ0A 1LZKA 4JYMA 4B85A 5AICA 3GA7A 5K3AA 4OSEA 5FP0A 1ZD2P 3BWXA 4ZI5A 3I2GA 4BDSA 2XMZA 4UBIA 3PDCA 4ZXFA 1AZWA 1YA4A 5E4JA 3S8YA 4D9JA 4KE8A 4X6YA 4UHCA 2C5FA 4BZWA 2WIFA 3RK4A 2OG1A 4FKBA 3FLAA 1MAAA 3O4GA 3STWA 4BYMA 5HF9A 4FHZA 4HZGA 2IIVA 3G0GA 1QIGA 5F4ZA 3IB3A 1QIMA 2XLBA 5ALGA 2AJDA 4OCZA 4U2GA 5EI5A 5K3FB 2WG2A 2VATA 2WQZA 2VT6A 4HVTA 4E14A 1XZIA 1PJAA 1CVLA 2CB9A 5AIBA 2BUAA 3GUUA 3C87A 1F0NA 4KRYA 4BVKA 5JD6A 5JAPA 3R40A 3LP5A 3G9UA 3F98A 4RPCA 1CFJA 3AZQA 3DDUA 4AQDA 1QIFA 4B83A 2ONCA 2CUTA 4WDRA 3WK8A 5C8VA 4W1RA 3AINA 3ZI7A 3G8YA 4LYEA 5JYCA 4GLBA 4U2FA 4Y2XA 2XUHA 4L3WA 2ZVDA 3ESAA 4BTLA 1CUUA 3H1AA 3FCXA 4UBNA 4X7BA 1XQVA 5E2IA 2VAXA 2YH2A 4Y2YA 1LNSA 4ETWA 2EDAA 3QMWA 1MX9A 4BC0A 4BRZA 2PUHA 1KEZA 1ODCA 2WKWA 4CCWA 1TRHA 4WFJA 4PW0A 3G7NA 4I4CA 1XZKA 1KU6A 3I1IA 5JALA 5DYYA 2WJ3A 4BRSA 4EB0A 2X76A 1MX5A 4OYYA 2G5TA 4BCBA 5ALPA 4FTWA 2QUAA 1XZFA 2DHDA 2XUDA 4BE4A 2RI6A 1BE0A 5J3JA 5DNUA 4RE6A 4N8EA 1UOQA 1EDBA 3WYDA 5CXXA 3OC0A 2FJ0A 2WTMA 4XIIA 5CH3A 3M81A 4AMYA 4MYDA 1XLUA 1XKTA 2E3JA 3H2KA 5T4HA 3OPMA 2VA9A 3I2HA 5AOBA 1ORWA 5C7YA 4EA6A 1RP1A 5AI0A 3I2JA 3IUNA 3WIBA 2ES4A 2XUAA 3WL8A 4CIAA 1T2NA 4FBLA 3U0VA 3FNBA 3O9VA 4H7KA 3WIOA 2VJBA 5IVIA 1FSSA 3EQ8A 2OCLA 1WPRA 5ALFA 4J3JA 4LIPD 5CW2A 1KU0A 3BJMA 1QFSA 3QMMA 3DOHA 4O08A 3W06A 3H1BA 3E4DA 3VDXA 5LLSA 4LKOA 5JZSA 2P8SA 4FLFA 1W1IA 2OAEA 3GFFA 5BOVA 3FOBA 3HLKA 4MWTA 4DNOA 2QKYA 3WA6A 4UFPA 1IUPA 3K2IA 4K5QA 4F21A 5HF6A 4UFOA 5ALNA 2XUKA 1A88A 2JGFA 5CMLA 4M0MA 1QGED 5JZBA 2WFLB 4EY8A 4XWGA 3O4HA 1XZHA 2HL6A 4EY6A 1J1IA 4H18A 1R50A 3ILSA 4F0JA 3G02A 1LPSA 4X00A 4WDQA 4M0FA 4UHEA 4X3CA 2WIJA 4L0CA 4BP9A 4DMFA 4CG1A 4OB8A 1NU6A 2HHAA 1MO2A 3WLAA 1LGYA 4Y2VA 2WHRA 5AM2A 4CIBA 1ZD5A 1QJ4A 3KWJA 3ZPXA 4G9EA 1IUOA 5JAUA 2WG1A 2BFNA 3QPDA 2EEPA 2PBLA 3AZPA 1CUXA 3DL4A 1XZDA 1N5MA 4E11A 1WM1A 3IUMA 4JNCA 2PVSA 1YS1X 3I28A 1CLEA 3PF9A 2GYUA 3R3WA 2C0PA 3F9CA 1LLFA 3JWEA 2ZJ6A 5ALYA 5AI9A 5K3EA 1DWOA 3ANSA 4FWBA 4DSZA 1AMNA 1UKBA 3IA2A 5HQ3A 4DMKA 4C6HA 3WWEA 2B61A 4FNGA 1QTIA 1OCEA 1YAJA 3SX4A 1G66A 1OXMA 2GBGA 3LIIA 5ALHA 5LP1A 2VSQA 2RIPA 1B6GA 3EIOA 5AK4A 2OGZA 4J03A 1CUWA 1RYYA 2O7RA 4DNPA 2DSNA 1BN6A 2DQYA 2XT0A 2GBCA 2HADA 1C7IA 4MQLA 5HKBA 2QUBA 1BROA 3D59A 4KE7A 1ACLA 5K3BA 1WB4A 1UK6A 2XQIA 5JARA 4KAAA 1UT6A 3V48A 1TIBA 2Y6VA 3DQZA 1AX9A 4Q05A 5JADA 4JUIA 5AM1A 5AO9A 4UPDA 4J0CA 3W9BA 2PPLA 5A71A 3AIOA 1A8SA 3G0DA 3DCNA 3H2JA 4V2IA 2XUIA 2WUFA 3G9TA 3D3NA 5ALVA 2ECFA 5IVDA 5AM0A 1W52X 5LKAA 2BGRA 1E8MA 4ARBA 4Y2UA 5K3FA 2XQGA 4M0EA 4XJVA 4LXGA 4IO0A 3ESDA 1HDEA 2QMQA 1XZGA 1XLVA 3WK9A 3VJMA 5LZ4A 1UKCA 2JBWA 2O7VA 1XZBA 3WK6A 1BEZA 3D0KA 3JYHA 1F6WA 1Z68A 2WUGA 4H77A 1THGA 1ZJ5A 3BE8A 5C8XA 2XE4A 4OYLA 1U2EA 4ZV9A 4IHAA 2Q0XA 1Q83A 4YASA 1VXOA 3C6ZA 2NW6A 1WB6A 2HRRA
chains in the Genus database with same CATH superfamily
4TM7A 1YO6A 3M70A 1IQRA 1XTQA 2HLNA 3K2EA 4BAUA 3Q40A 2W0SA 1UZAA 5A1TA 3U1VA 4YJGA 4YHHB 4WADA 3QA9A 3UV6A 3T3EA 5KHLB 2VTVA 2H1FA 2ZB3A 4U02A 1DTEA 2FN8A 1JS1X 4KJZA 3WWYA 4AQ7A 2Z8XA 5EERA 2TECE 1P7ZA 1L7MA 3GH3A 4YACA 1BGXT 4H3KB 4UNIA 1ZUNA 4EELA 4TS1A 4BPRA 5E9QA 1PI3A 2MU1A 1EINA 1Z2OX 3BICA 4UHBA 2VYQA 3DOCA 3TKAA 1Z8NA 3FHTA 4YECA 3H9EO 4KVZA 3J81k 2R1ZA 4ILKA 4D9IA 3NVDA 2X3FA 4UTZA 3TSZA 5C5IA 3IP8A 2AQHA 2VOJA 3WRVA 1JBKA 4QPZA 4J7UA 4NP6A 3ONDA 1GPLA 3RJTA 3D1JA 3QMPA 2DWCA 3VPFA 4CM1A 5DV9A 1QF6A 2XMGA 4URFA 1CNFA 1PO7A 1ECBA 1WUYA 3K72B 1Y6RA 4IW3B 2E7ZA 5J2UB 3QXHA 4HGOA 2YXBA 2VF4X 5EP2A 3GW8A 4GSLA 3C4JA 3ZU2A 4C5CA 4HH0A 2QV7A 4LHEA 1QX4A 4GP6A 2QLLA 1PGPA 3CUWA 5E3HA 4CMEC 3U4CA 1FIUA 3H8JA 3ZCTA 5I8ZA 3EBOA 1T5OA 3K9BA 4QTZA 4F4HA 1ORRA 3MYRA 1RTTA 4OG2A 1Q84A 1VGRA 4XYEA 3AH8A 3JYQA 1M2GA 3AR3A 4FXPA 3H87A 3DEHA 4BBJA 5GOZA 3PX2A 1EA5A 4PNZA 3S0JA 3PA6A 1OBVA 2ODBA 2P40A 3RFTA 1ZKMA 1H4SA 3OAAA 2W6QA 3C41J 5DM60 1SELA 4A8HA 2B4TO 4LWPA 1FLAA 1S2MA 2OCBA 3HNRA 1SOWA 3EPHA 1H8HA 2A9JA 2ID9A 1BVRA 3PFHA 4MVJD 3KFXA 1Q2XA 3GB9A 1EVIA 4IV0A 3SS7X 2M6RA 4MVJG 5DGCA 1CYDA 3CGWA 3VXKA 4S04A 3GR6A 3UUGA 2BJWA 1BFDA 2HF9A 3ODGA 1JU3A 1U8YA 2FPSA 4O4HB 4MW1A 2VEOA 3THRA 2JAUA 4LBZA 3FOFC 1QR6A 4Q7KA 4MAFA 4UUBA 4K0RA 4P0TA 5FO1A 5JDCA 1NJGA 4HQ6A 4WGFA 3V2UA 4GLFA 3L6OO 2I1VB 1ZHFA 3NZEA 1JJAA 4IHJF 4Q9AA 5LXTF 3SOPA 4DLZA 5CA0F 4M76B 3U6BA 5EY5B 3IAXA 1LVHA 3R6GA 2JATA 1IN4A 2GCGA 3LO5A 3MGKA 2V9CA 1G6KA 2IHYA 4LJLA 1ODLA 4QQNA 1MORA 1QSGA 4RACA 4KQXA 2A0XA 4P22A 3V1LA 1YH3A 1KI2A 3DLTA 2OKGA 2YR0A 3DKKA 5LYYA 4BTVA 3RARA 3GMTA 4OFWA 4UHFA 3DM5A 3V32A 1XD2A 4UD2A 2QJOA 4D9CA 2IYRA 4P86A 3PNPA 3AETB 2L17A 2PKQO 3O2JA 2QT1A 5C1IA 3Q6IA 4NBWA 5CB4A 4C20A 1GYPA 2CCGA 3L7OA 3FSRA 3OZUA 3VU1A 4C7JA 3L0SA 5K0TA 4C88A 3QNMA 1PL0A 4HFNA 4B75A 1C8BA 4BNDA 4N48A 2R3SA 4GGMX 3TLGB 3RT7A 3SVLA 2NU6A 1U2PA 2NQ8A 1D2HA 5B55A 4MQMA 1P1KA 4C29A 4TZ0A 3ENNA 5FL3A 3VUEA 1KJJA 1FL9A 3BTOA 3R5TA 3THSA 4E5YA 1I13A 1T4GA 1MKYA 2D2FA 4FGZA 2PA0A 4II7A 2RGDA 1XRPA 4KLRA 4YA6A 2UXCB 3GARA 4MW0A 1B4DA 1U1GA 5EXPA 1WR8A 1H22A 3FBTA 3ZWYA 4QXPA 3V1UA 3LA6A 4KN8A 1XCMA 1H05A 1H1LB 1PFWA 2ZJFA 3UKDA 2HWXA 4X97A 1KY2A 1G4AE 1TKBA 1YZFA 2QW0X 4HEHA 1ZCJA 3TK1A 4C07A 1OU4A 3BXZA 2EJWA 1EKXA 5EP4A 3QOWA 4BZPA 3OZBA 1GPJA 3L0OA 3VDMA 2O6LA 4IP0A 2J6BA 4GX0A 1X1RA 2ZVJA 3K1ZA 3RS0A 4OP3A 1R1DA 7AT1A 2AIRA 1CB7A 3R6DA 3KSAC 2P6MA 4GXTA 3D8NA 4LTNA 6GPBA 1NF9A 5KJFA 1ULTA 1BS1A 2PIAA 3PD7A 3MTJA 3QBTA 1YV9A 1K63A 3K20A 5EOVA 5FPHA 3HHPA 5L6LB 4E33A 2QUZA 3U9TA 5ELLA 1UWVA 3PUVA 2E4ZA 3QPUA 4ESEA 3U3MA 2YKGA 4HFMA 3SQMA 4AKEA 4AL4A 5BNWA 1GTRA 4BWYA 1E1MA 1WU8A 3GFVA 1F2UB 1B16A 5DM0A 4DXHA 3JATA 1QGDA 2KBEA 1JDVA 3E3LA 1JB1A 1OFUX 3DZJA 3IP7A 5KU7A 3EVZA 1XZPA 1CD5A 3UWMA 2CL7X 2FRDC 3PWTA 1QK3A 3LPNA 2G9UA 4KQHA 4NVRA 2VJKA 4WFKA 1Y3IA 1XEWY 2B21A 3GBSA 4UZEA 3KQHA 1JHZA 4HN4B 2FX3A 4I5DA 2I80A 3VDQA 4EI2A 1BE1A 2QUHA 3RVJA 1E7SA 3OJ0A 4CLRA 4LQCA 4KSBA 4W1QA 4AO6A 4EF4A 1XZJA 3HH8A 3IYLW 3QPAA 4FYMA 2PSDA 2ZRLA 2NXNA 3ANTA 3CKKA 3IBFA 5F51A 4M1MA 3DD1A 2OHXA 5JNUA 1JJFA 3QLVC 4LYAA 3CR8A 3TTVA 4N41A 3R0ZA 5EQJB 4E2YA 2QZZA 2V0CA 3AI3A 3TLMA 2G25A 3CG4A 5K6AA 1VL2A 4LY6A 4LGMA 3G0HA 4KYVA 4A1FA 2BFWA 2HMVA 2F1KA 4KR0A 1YRLA 2GBIA 1XDBA 3CWQA 1Z2EA 1URPA 2CUZA 3K09C 3R7BA 3VU9B 2SCUB 2G5GX 3EMBA 4LJ9A 2R8YA 1AHIA 1SBHA 2CJYA 2VZLA 5FHQA 1JHVA 3ROGA 3FGNA 3KSMA 1EFVA 1K98A 2FN7A 4H7HA 1XYGA 2ZB7A 3KVRA 2LTAA 3SM3A 1RWWA 4BOYA 5JJCA 1U7WA 4CU2A 2I6GA 5EPEA 5JD5A 4IJWA 1TM5E 3S68A 4QXAA 1Z5ZA 5I48A 1TNDA 2D8MA 3DQPA 3IVMA 3PUZA 1TQ4A 4R68A 5JSUA 4KLNA 4TPKA 2JLXA 4FE4A 1L4MA 1VP3A 4ZV7A 3FYDA 3IV7A 3IBSA 1VQ1A 3IT3A 1PFKA 1GEGA 1Y9JA 1XZLA 2C0QA 3GP5A 3I6ZA 4PQFA 4ZQBA 4F3RA 2JLBA 1Z9BA 4ZJZA 4V1CA 2LBPA 3CZ4A 1A27A 5ALSA 4BDTA 5J5CA 3HI4A 3MHPA 4NBVA 3JD0A 4FKZA 1CUYA 1OGYA 3COYA 3W7VA 4V1CI 4RAQA 2D74A 2JLZA 3K7EA 5HE8A 2BOVA 1MTOA 1A3CA 3KHUA 5TPZD 4I6EA 4DCGA 2HK7A 4Y6QA 2JFXA 3IVCA 2IXDA 5A5EA 1BQEA 4DKJA 4JOQA 4F12A 4LJ5A 5EHIA 2OBXA 5HZHA 3UUFA 4TVSA 4X1YB 3P4YA 5I3ZA 4RTOA 1O77A 1JDJA 3PHIA 4Y18A 1SCJA 3ZV7A 3H4VA 2CK3A 4E51A 3WYBA 5AKEA 3PWSA 3BK7A 3Q2OA 1MDFA 1UC5B 3WGUA 1BVHA 1PVOA 4MWOA 1E3JA 4Z9FA 1GTG1 3OESA 1PWXA 3AEUA 4PZUA 5ALEA 1SQ6A 3I8OA 5K7SA 3DYIA 3PD1A 1QP7A 2QVGA 2ZSFA 1IIRA 3N70A 5ALUA 1KJQA 5ES4B 3ZI0A 4LYDA 3JWJA 2H52A 3RNLA 3PGLA 3K32A 3D4LA 3W6UA 1EVZA 3CPJB 4B6PA 1UDWA 2OG2A 4PGGA 1HX7A 2ZBPA 4BNFA 4YJHA 4JLMA 1RXSA 1C29B 4XIFA 4DG9A 4LFAB 2B7CA 3Q98A 2OA0A 3WMGA 4D6XA 2ZE7A 1CQZA 3OQMA 5AW7A 4AX4A 3S3TA 4U4AA 2XMBA 4ZALA 4A8JA 1WXFA 3I45A 5IYZF 4V0OA 5K45A 4HGQA 2ZT6A 3RC8A 2IHTA 2HREA 4OYRA 1TXGA 1GHTA 3OCZA 1N7HA 1QONA 3ADDA 3OOSA 5CH5A 4F3TA 5HF8A 1NN1A 2X0IA 3KPWA 3U7FB 3EBPA 3FMVA 4DL9A 1E9BA 3RWOA 3FR8A 1R7RA 2PGOA 3CZRA 3QFTA 4PC1A 1I6WA 2PMWB 3M4JA 2HN9A 1MV5A 3PXCX 2V54A 1QOQB 2XTAA 1RJ9A 1EUYA 2PT9A 3EE6A 2JHAA 2NUAB 3TZEA 4R2JA 2JLSA 3IURA 1VJ1A 3PYLA 1GUYA 1ZK4A 3CS3A 3KD3A 2BFEB 2DX7A 4FJ0A 4MV8A 3C2QA 4U3JB 2CL6X 1PEAA 4UBMA 4ZCPA 4DQDA 1VG1A 3DSRA 3ESXA 4KIUA 2OCAA 4E22A 2DH6A 4IGAA 2W9XA 3K9NA 2PCJA 4B0OA 3UIEA 1Y9EA 1E2FA 1U2RA 3HXLA 2VNSA 2JH3A 4HH1A 5PGMA 2Y1XA 1ZK0A 2J4DA 4TQGA 5I4IA 2V0GA 3EXG2 2O2SA 4BJ1A 4GUDA 4YCAA 2P9YA 4XTCS 3D2AA 4C7XA 2DFDA 1CR6A 4KR7A 2WJIA 4K3VA 3UNXA 1BXZA 4XB1A 4YUAA 1NI3A 3PXUA 1HXHA 2QA5A 2JGDA 1H23A 3F5QA 4PCLA 5CHEA 2ZJ4A 3ZNQA 5BXYA 2JD1A 1UODA 1WHTB 3PFIA 2G6TA 1QYIA 1KMQA 5ALZA 2C5GA 1DIRA 5ESDA 5TPWB 1ZL2A 2VCYA 2F1RA 3M6VA 3EJ6A 3MMXA 3PTZA 4JQCA 4MIEA 4OXKA 1X42A 5HTKA 1D8AA 3GA0A 3WY9A 2PQ6A 3IODA 4LJ4A 1WVGA 1GITA 4OFXA 4QLOA 2E49A 1Z0DA 1M10A 1JWBB 2WWIA 2X9QA 4Z5XA 1RBMA 2I0FA 1JIKA 2YIVX 1HY3A 2P67A 3DKIA 1XAGA 4G0QA 4JNKA 3CZMA 3EDOA 4JX8A 3TG2A 3O03A 4MCIA 5DM1A 3CHYA 1FU7A 1DQYA 5EVJA 5LMUB 1P5ZB 1AV7A 1PWHA 2EKDA 3KYDA 4C0KA 2IYSA 2QLJA 1REQB 5KTKA 3UOWA 3TQOA 2CZCA 3L7JA 2AYZA 3K0FB 4RPLA 3UG6A 4RWEA 4XAQA 5C3MA 3V8RA 4O8ZA 1D2AA 2HWKA 1DARA 3BRWA 3ANMA 2AQIA 3MINA 1L7VC 4KDEA 4DG8A 3THYA 1F20A 2H57A 1RM4A 4UMDA 5BN3A 3A4MA 1VKJA 4AUEA 4EI9A 1MB0A 4BNGA 3CT4A 2OC4A 5TF4A 2X19A 4Q3CA 4MUBA 4YCCA 2YY5A 2CLMB 1LBSA 4MHSA 1YQUA 1ZUWA 4JUAA 5JTTA 2C7OA 4BC1A 1TQ2A 1BXRA 1OLSA 2VRCD 4M0PA 3ZBTA 4RQBA 1DRJA 2X3UA 3RIXA 3MQFA 4CYMA 2QN8A 2ONYA 3NBKA 4G5SA 1G19A 3P7MA 2JFQA 3CLSC 3N3AC 5FAXA 2AZDA 1EPUA 1S3GA 1KTVA 4GG1A 1ORHA 4F2WA 3ZGOA 3TEJA 3WLFA 1HWYA 2Q5EA 3OZWA 3ELBA 3W8FA 1LLQA 4FWIB 5H82A 1K92A 5JDCC 4HSGA 4PCVA 1DB3A 2ZT8A 1EWTA 3CONA 1LI4A 1NOJA 2OE2A 4HYYA 2IU0A 2ECKA 5ALXA 3DTVD 3L7KA 3EJWA 4A8PA 2UYCA 5ER6A 1VRWA 4BB6A 4JLOA 1H9AA 2P2CA 2PWBA 4LNUA 5M34A 1Z0SA 3FTDA 4HTFB 1WF3A 3ZN2A 2XBUA 5EJ2A 1B2LA 1QGOA 4TTVA 5JSZB 5KYWA 1PAUA 5LZ5A 2WJ4A 4ZYZA 4CT0A 5IFLA 2HJRA 5H3HA 2EKPA 4C03A 2J3LA 2WMDA 1YMQA 5TQ2B 1ELOA 3HC7A 3T5PA 4L4XA 4F4IA 3EDCA 3IO5A 3ZWPA 1MOPA 2B9EA 1XKQA 1RW4A 2E4XA 1RAHA 4MUNA 4NCXA 4O2LA 2XGGA 3E9RA 3BIXA 4C0WA 4TKVA 2GM9A 3N2LA 1F5NA 2G06A 3U13A 3LY8A 4BFWA 2HK9A 3KSZO 3X1YA 2ZJYA 1FDRA 5HCNA 4AWAA 5B36A 2Q7DA 1ZYUA 1W96A 2DC1A 3EEOA 4K26A 3D6VA 1FFAA 3PRJA 4D99A 2BFOA 1YVUA 2AG0A 3NBFA 4RMNA 5SZIA 4F2PA 2MT9A 3CFYA 4WVLA 3L8FA 2AOWA 4FD3A 4ZU3A 2OESA 2OVFA 4GVPA 1PWYE 4P5EA 4F04A 2QRUA 4PHFA 3ESBA 2YVLA 5IFKA 4AKSA 2ORYA 2NXJA 3H83A 3IGFA 1YT5A 4RKRA 3W2HA 2ZUCA 3BB3A 4N76A 2LCQA 3HFJA 3RTCA 4V0KA 4EFLA 2VTBB 2R00A 4MIOA 5KYYA 1KYYA 2QY6A 3NAGA 4EFDA 1VMIA 5DBIA 4BMDA 2OHFA 2J4FA 4M9SA 1X0XA 3W5IA 3A27A 1F8UA 3B5EA 4N6OA 2WTBA 2XCIA 3DCIA 4KX3A 5EPOA 3ZJTA 4FLMA 4UZFA 3VDRA 2FEMA 3X1WA 2R68A 1JJ7A 3HO6A 5G53C 1UFVA 4X61A 3EVNA 4QXRA 4EFMA 1O87A 2NUTB 4BFXA 1CP3A 3MN1A 2C54A 1OQAA 1BHJA 1RZ3A 3N6VA 3TFOA 2YV5A 3S8EA 1Q7TA 2NVUA 3WKDA 3ZBQA 1MJ5A 2JI4A 2N46A 1C1DB 1CP2A 1ZI9A 4LQDA 4N0PA 5JZOA 2AI1A 2HEGA 1HBJA 2Z3WA 3IBCA 4J75A 3RRZA 2KS6A 2ZWAA 3WLOA 3VU8A 3PUIA 2IWHA 1NIJA 5HCUA 3FDIA 5J59A 1E3LA 3I4FA 3GT7A 3LUPA 3E7PA 4MPPA 5CFMA 3OPXA 3VYWA 4OEHA 2HA5A 4YFVA 4Z54A 1O97D 4TTPA 2EAUA 3V8NA 3MCAA 1C7QA 4EY7A 1C30B 2XMRA 1QCYA 5TQVA 3U09A 5IDXA 1RP7A 2I7XA 1J2EA 4X24A 2BBWA 1OFGA 4TTSA 1SUWA 2WVAA 4WLFA 3FGOA 5COQA 2ONJA 3OFNA 3K5WA 3ZQ6A 6LDHA 5JH7B 4ZCQA 4EGCB 1Y6GA 4Z9XA 3PT9A 2HHLA 4E2XA 4LRSB 3A05A 1NP3A 1FFCA 3G5AA 4JLSA 2XE6A 3DGEC 3QWAA 4ITVA 4L6CA 4I4NA 4EW2A 2JJMA 3ORQA 5LZ2A 1GNVA 2BP7A 4QEKA 1Q0QA 1DCFA 3JQGA 3VHRA 3CVYA 4P80A 4TLDA 2Q45A 3ILYA 4F3CA 1Z15A 5LUAA 2VYNA 3OZSA 3TO5A 4NYMR 4DCCA 5BURA 1E58A 1NVFA 1P9WA 3UC5A 4EHAA 1Y7HA 3TTSA 4AMZA 1ECLA 4MRNA 3TNLA 3ZE2B 2YV4A 2ZUVA 1ISRA 4I5IA 2I2CA 1AKTA 2ZK7A 4J0KA 4R8LA 1G5FA 2VT3A 2QZ9A 3IOMA 3PNLA 4M1KA 4DRXB 4FNAA 4RZHA 3D1VA 2Z83A 2P91A 1Z07A 3CX7A 3M5CA 4RA9A 4B76A 4BCDA 1HL7A 5AUQA 4CETA 5HIKA 4MVJE 1G6OA 5IT0A 1BOFA 3K9FC 2O8DA 3K71B 2XUZA 4WK4B 3QVLA 4Q3KA 3IPAA 4ALKA 1MO5A 2WU3A 2QP4A 3A2MA 4DBLC 3BE5A 4UNNA 1K27A 3H13A 5AXAA 5IUKC 3CPHA 3NWPA 2A86A 1NVBA 1FVXA 1XV5A 4IRXA 2QM0A 2XR1A 4NONA 2NU9B 1CR1A 2Q7OE 1GTVA 4GHWA 1DG9A 1VE7A 4DJFC 1SKQA 3EY9A 3JVDA 1LJLA 1JFLA 3GN1A 4JVNA 1MGOA 4M1ZA 5ILOA 3N87A 3EXEB 1AK1A 1ND5A 2BKXA 5EG5A 4DM7A 4HNQA 3EISA 1MO3A 1YB7A 4IINA 1IN8A 1KDTA 1FVHA 5M5BA 1PJTA 1KI6A 1MJFA 5J2UF 2PNJA 3QFFA 6YASA 3JALB 5HKLA 4NBUA 1YE8A 4OQEA 1RXEA 2BH9A 4QQFA 3K70C 4KUEA 3C3PA 4N49A 1GQSA 1QH8A 2BLLA 3SYLA 3I5YA 2XCQA 4CEIA 1CS0B 3U1BA 1T8YA 4JENA 1QQ6A 3B53X 1EX7A 2ZBGA 1UFKA 1I4TD 1XAJA 3W6NA 3DMFA 2WDPA 4CDRA 5FEUA 2EFCB 2EJVA 3LKZA 4QJ5A 2A1UB 5HFNA 2C9MA 2EFDB 1T1EA 1WXQA 2PTGA 2HU5A 1DJNA 3FKSD 1KQOA 3ZKAA 3CZAA 1M6HA 3PCRB 4PHHA 3ZVRA 2F62A 1KR2A 4FK8A 2GLTA 1FP4B 3TN7A 1UOOA 2ZUDA 3EH2A 1EH5A 1J21A 2WVHA 4XARA 2ANCA 3F6PA 4Q7JB 4FHCA 2ENWA 5IMBA 5TARA 4A8JC 3C7AA 2DF8A 2I8LA 1NGSA 2DWOA 3K6RA 2PT7A 2I55A 3ZK7A 3AF1A 2EARA 1NUQA 1FQJA 1GGVA 1H42A 1SHZA 4XD7D 2E4WA 1P0MA 1TVCA 2R84A 3O8QB 5ALTA 2DBQA 3GFQA 5BRJA 4C7BA 2Y1FA 2H7CA 2J3HA 2RAUA 1II8B 1MO4A 3FNHA 5A7HA 1ODFA 4RSRA 3F4KA 2OZPA 2VWHA 3FVQA 3O6VA 5KC9A 1U9IA 5D8DA 2IP1A 4IXNA 2X86A 5DLEA 4BY9E 4KQWA 1M8JA 3HN6A 2QMUA 1H2RS 2VFAA 1XQWA 3UXHA 1N5LA 3VPAA 4FDVA 2Q4TA 3KZXA 1TK3A 3ZUGA 3UMJA 3R77A 4BV8A 3R09A 2WA1A 4QXQA 1K6EA 3OSZA 1DPFA 3QYPA 2CF5A 4PXSA 2VKTA 3G82C 1ZI8A 3KLOA 1D09A 1V9LA 4WASA 3ZXUB 4B46A 4EITA 4W5RA 3GLIB 1GUFA 3QH4A 3OWOA 1NHWA 3DBRA 4G4JA 4HGYA 2M9MA 1SHJA 5I3CA 3WA7A 3ON5A 3CUKA 5I7EA 5JPIA 1USGA 2ERCA 2WPDD 1EFUA 3HJAA 1Z6XA 2BLNA 2P2DA 4F3NA 2FSPA 4BGIA 1QWSA 2I7TA 5DNWA 3VPCA 1LY1A 4AJIA 3IIIA 5C80A 1T8WA 2FP4B 3GMIA 5L3RA 1TT5B 2EL7A 3DNFA 1SCQA 2ID4A 4PYLA 1L5GB 3UQZA 4G9BA 1NW3A 2I3DA 3OJOA 3T38A 1SIUA 1YC5A 2Q3LA 3VHLB 4PSDA 1T0HB 4TZ6A 4LRWA 1Q3KA 4LOHA 3AHDA 3DDNA 2NSLA 4MMZB 4US1R 2I62A 1J8YF 4G1UC 1KP2A 1L3BA 4MS3B 1FS6A 1MB3A 1GRNA 2G1UA 1P9LA 2LRHA 1IXRC 1RQ7A 3UBMA 2QYHA 3AF4A 1I7LA 3KBOA 5BVHA 3GLQA 4JJGA 3RYIA 5F23A 4RK5A 3O8BA 3IS3A 3EC7A 1KAQA 3L7NA 4M0KA 4PO9A 2G0AA 5JAHA 4HLNA 3W5DA 4BX2A 2H0RA 4H15A 4O0MA 2OY0A 3NTXA 3WOHA 1ZJ4A 3OTHA 4DTCA 3WGHA 2AEMA 5A03A 2JFOA 2G5CA 1GA1A 2ZI5A 3O0TA 3HA2A 2JLYA 1H0SA 2GK4A 5I9SA 2BFDA 1Y1KE 1YBFA 1ZLXA 1NW9B 3D0RA 4HRXA 4HQNA 4IZOA 4D2IA 3Q8MA 1N0IA 3ZZTA 3ICPA 5JQWA 3H18A 1AF7A 3VZRA 4D3ZA 3DB2A 1JYFA 4LK2A 5D86A 4B4UA 2GAJA 4UNRA 3FNRA 5HMLA 5C8YA 4ARVA 4KH1A 4KLAA 4G4IA 4MUFA 3P0RA 3QEJA 4YJDA 2WM9B 3TNDA 2VBFA 2E5FA 3FWNA 3TI7A 1XPUA 4B71A 1E0SA 1DJMA 2RGNC 1ISPA 4MK4A 2LVBA 3HWWA 2JGLA 3QOXA 3A7EA 5LP6F 1YULA 4DCTA 3GNQA 1ETUA 4N3CA 2B8JA 1Z33A 3A14A 3EVDA 4KNWA 5D3MA 4PTLA 4PYKA 3WDSA 1EESA 1NPDA 3A3YA 4YT8A 4MVJA 4RD2A 1FFWA 1TRKA 3GLKA 1RD4A 5E3JA 1L5ZA 4O1IA 1EU1A 3LBAA 1JIUA 4F6RA 4KYTA 2GDJA 3SSOA 1UJCA 4W9RA 4WE3A 4L5YA 5LDGA 2P6RA 4P58A 5CB6A 2QMOA 1O3YA 2QZPA 4M38A 4QE3A 4KBFA 4MVJI 4QO7A 1J42A 5IDYA 3P20A 4TL9A 3DMPA 1GZ4A 1OWNA 3M3DA 4RZIA 1ZSYA 3EULA 2X9NA 3L1UA 1UBSB 3KV1A 5F35A 1ST3A 2B8TA 3BWEA 3UPTA 3I9LA 1SOMA 4JC8A 4OQNA 4BFTA 3H9JA 3IP3A 2GI4A 5C1PA 5K8JB 2NO6A 2ZUEA 3KS9A 2IHNA 2BDTA 5A4JA 3NM5A 1U02A 2QVCA 4CRWB 4ZOCA 1LFDB 2D00A 4X84A 3KQNA 3GPBA 4BRUA 4CT5A 3ZWOA 5JRDS 3GGDA 4YUWA 3KXDA 4GW3A 4HVAA 4MRSA 4RHUA 1UMBA 4QELA 5LDDC 5CH8A 1ORIA 1DKNA 3SZGA 2X0FA 2ZM5A 4RF4A 2B5VA 1EHCA 2OLJA 2CDBA 2VJYA 3D2CA 4WLUA 3W9UA 4A7PA 4CF5A 1P5RA 4MWBA 1RXYA 2IS2A 2H3HA 3AV0B 5H4GA 5HIAA 1KC1A 2VJNA 1N4DA 4MRMA 4A6XA 4BNHA 1RHMA 2OHIA 1E20A 3PGJA 4G84A 2GEKA 2ZE6A 3TIGA 1P75A 5CEEA 1U6JA 4NXMB 3ZWWA 4F85A 3VSAA 5KUTA 1TYDE 2QLNA 2WB2A 4R1NA 4KPEC 4BVJA 4DR3B 3IKVA 3E0XA 3WZ2A 4F60A 5HW0A 1ESNA 3L0DA 3T7SA 3LTEA 4HNSA 3PYXA 4BXOA 4R51A 2FWNA 1ZNXA 2QXTA 2FZ5A 5FR2A 3O73A 1C9EA 2XF2A 2YOGA 4FC7A 1BHQ1 5G0TA 4BN4A 3ZJUA 3DOIA 4PR0A 1SPXA 1WE2A 2WV7A 1ZN2A 5JYBA 1W1WA 1FYVA 2OGUA 2UVQA 4MUEA 1YDEA 3SEZA 1I2ZA 2QTRA 1SKAA 2IS1A 5EWMA 2A30A 1IYZA 2HRQA 2FPOA 3RO7A 5LQUA 3HZOA 4AECA 2O5VA 2V6IA 4P3XA 2A57A 4EM6A 4F5ZA 1UBHS 2K6GA 3TLEA 4QQRA 4FMPA 1J1UA 1H9CA 1S2NA 2G7ZA 2B4QA 3IQZA 5ITZB 2B0CA 3V2IA 2ACWA 2H8KA 3F78A 4QODA 4F71A 3K5HA 2X0RA 1MG0A 4FDTA 1QO9A 4EYOA 3Q7TA 1XA4A 2ZUSA 2EL9A 3K4QA 1FYXA 4Z7NB 3HGTA 1Q15A 2R8ZA 3HB0A 3KKZA 2Q3EA 4L50A 4KFUA 2C9CA 3IPCA 4HX5A 3KEGA 1QAOA 4KHZA 3SXUB 4B82A 4EOGA 3CBQA 3NORA 1ZBDA 2PUFA 5TGTA 1C8KA 2PVCA 3IMGA 2PSEA 1HE2A 2XKBA 1VFNA 3UHAA 1MX1A 2CYCA 1KDPA 2X4IA 4DDUA 2NG1A 2WP0A 2RCNA 4EUKA 1MRSA 4Y9DA 4IMRA 4C4SA 4EB8A 2UYOA 1SHKA 3FNIA 1JA1A 3G8BA 1VL6A 4FSDA 4G8DA 1IXYA 1XZQA 1QFZA 3ZWDA 3VSCA 4B43A 2HCFA 3VX4A 3GHHA 2VJMA 3IKJA 4QD3A 2DECA 4BASA 4Q1AA 5IT4A 4C2UA 2D5AA 4L8YA 1E4YA 3B7WA 2V03A 4OBXA 5B3LA 3PTAA 1ZK3A 4JAVC 2GESA 2PR7A 3JQ7B 5DI3A 3RS7A 3DLAA 4GSYA 2W4QA 4XB6B 4UHHA 1DCTA 4YB8A 3D8SA 2W8BB 2EKZA 1YS6A 2BD0A 4HQFA 1HQYE 3G3EA 4MPDA 3VSEA 3TQSA 3H5IA 3NTVA 2REXB 2B78A 2HPZA 3PWKA 4R71A 1NBOA 1W36B 3GVHA 4HDRB 4LXXA 4ZAZA 1VI6A 1YE5A 3GT3A 2XIJA 1C3XA 3RC9A 1XEXB 1B8NA 1KJIA 1TEHA 1UBMS 3WMEA 4G01B 2R4UA 2FCRA 3GJQA 4IDFA 4DMMA 4Z7QB 2BTQA 2GTHA 1GA6A 1JN0A 2G9RA 1NVMB 5ARDA 4JGIA 3VMFA 4D0SA 3CNEA 1G2QA 1NUUA 2J5BA 1V95A 3NUQA 3SDSA 4BNZA 1D9XA 4DCSA 3HA5A 1QORA 2YC2C 4RPKA 1FA9A 3AI7A 1N6NA 4ZVPA 1QNFA 4DDMA 3DT8A 1OI7A 1XBTA 1YZQA 2AC2A 2BEUB 3L4SO 3BULA 3LO8A 3ZZ0A 3DEZA 1ZW6A 4GPAA 1XTTA 3K15A 3FWHA 4WW0A 2F8LA 3HFGA 4WZBB 2JDID 3VR5H 1A8PA 3LHFA 4HLQB 1XGKA 1UPCA 3CUVA 3RK0A 4DQVA 4LPKA 1GTMA 4XCQA 3RRBA 1IHXA 4YDHB 5TPZA 1Z5GA 2WIDA 5DHPA 3AILA 4XWOA 1R12A 3E70C 3H4IA 4IXMA 3IEUA 4MNTA 1DXHA 1D6JA 3AT1A 4I1SA 3BC1A 4OBWA 3DBHA 2PJZA 3LX8A 3DWEX 1QAMA 5A0FA 4RM2A 4JIGA 1USUA 4HNAB 3MTDA 4K6CA 3MXOA 1CDEA 1MGPA 4TXJA 3LQRA 1GCIA 4TUYB 3TMAA 3LUAA 1A4IA 2C84A 3TZLA 2BC9A 2GFIA 1PL7A 1W88B 3AIIA 4R7TA 1ECJA 3VV2A 4Y1FA 3M49A 3HEBA 3QX9A 3MGGA 4QGSA 1EP3B 1K6IA 2ZZKA 4IYJA 2EP8A 3C3WA 4XRRA 2NU7A 2WWRA 4H9GA 4Z86A 2RC5A 3GZ4A 1HDCA 4JEIA 4MKHA 5HGXA 2X5XA 3SS8A 4FFDA 3QEBZ 3T1NA 4B31A 3HXOA 1I9GA 2JIBA 4RJIA 4INPA 5JU6A 1U80A 4B84A 1X94A 4JOCA 1IBKB 3EXFA 2YYYA 2XKAA 2RAVA 1RVV1 1G4UR 1H5NA 2Z56A 4ITRC 4L9SA 1K0FA 4M1WA 1H6DA 3RODA 2YVKA 4BEVA 3FCCA 1U9IC 1N6OA 1W2HA 5FNVB 4DFDA 1BDMA 4G9GA 4BLOA 3PNBA 1LNQA 1MNAA 4QQ8A 2XADA 1XFDA 1UJ5A 4MEAA 5AVUA 2OXRA 3T3MB 2HA7A 3JQEA 3LFUA 1C1HA 4LXHA 1GQOA 1PD1A 1KP3A 1OI2A 2IOHA 2X42A 4GECA 4UAVA 5GV8A 1WQ3A 3JCZA 4ZGBA 6NULA 4CEHA 4EHNA 2PFKA 2EZ4A 4IDDA 1LPOA 4IIJB 2X40A 4GSKA 4UU7A 3FNGA 4I50B 2FWBA 4F06A 4Z3KA 5EIXA 2F7SA 4IIDA 2HD4A 3HJGA 4FNMA 4JLDA 3W04A 1ZK1A 3H1FA 4BFZA 4R40A 4F4DA 2NVOA 3WK7A 1N5KA 4Z2AA 1UBLS 2QL6A 1TT7A 1HDYA 2Z09A 2W2KB 3LCUA 5TEWA 3S2UA 4D0NA 4GAEA 1P3JA 5CDUA 3VR4H 4MCHA 1WU7A 2QOEA 4WZAA 2FWRA 1GNPA 3OY2A 4XR4A 3RVLA 2FSHA 1XZNA 4O0LA 4PAQA 2AHRA 1JA9A 4ZQIA 4UPVA 1GFZA 4B6SA 5KVSA 1UC8A 2AT1A 3BZUA 5CFQA 2FW0A 3SKYA 4MR9A 4Q4JA 4WQMA 5LA6F 2UDPA 2MSWA 2VHUA 3LQFA 3T5MA 4J16A 1RPJA 1NJ6A 3WB9A 5F9MA 3PRHA 4HOYA 4NFLA 3UW1A 1Y37A 2BFBB 1N3LA 1K0UA 5IULC 1K8RA 4Q3LA 2V98A 5FI5A 5JJ5A 1RWBA 2ZWVA 4XGIA 1Y4ZA 2PNFA 3E82A 4RLHA 3SJ7A 1D7OA 4B3GA 3II6X 4ZI7A 4BJ5A 3VKUA 1SWVA 4XX1A 5CVVA 3NVMB 4E08A 3UMVA 1E9VA 2JS7A 4HDSB 4HWKA 2WHPB 2IHKA 2WWGA 3FBGA 3H5OA 1W4ZA 5B3JA 3HXPA 1YU9A 4MHOA 3UFXB 1WEHA 1Y4DE 3T5BA 1E2UA 4RV5A 4K6KA 1R5BA 5FWDA 1YFJA 3EBLA 3GCDA 3DVRX 4XX0A 5EIEA 5CX4A 2H2FA 2KSQA 5J1SB 1WY5A 4DBVO 1TYAE 3WG9A 5KBYA 3NUZA 4DILA 1T10A 3W2IA 2NXWA 3EASA 3RUDA 3M9XA 4HWTA 3UCFA 4W9MC 2V7EA 1KORA 2I6FA 1XA3A 2ZDGA 2G72A 3Q3VA 4FFVA 4L4RA 1CKEA 1MC4A 4C7MA 2QHXA 4MTCA 1W48A 2QTCA 1R4MA 2QQ5A 5FLKA 2O2XA 1U3VA 2GM3A 5B5SA 3F3MA 3T7TA 3WAGA 1TZJA 3I5UA 1V16B 3OT1B 4WLOA 5KOJB 1DX4A 1N2HA 1QZXA 4TX1A 4Z2YA 2VRCA 3G85A 1RLJA 2JJ1D 1XF9A 1N2CB 5F7JA 2V7PA 3A3KA 3QKSA 5JCZA 4FEYA 1CJTC 2VJPA 1O54A 2QNBA 1R88A 3WYFA 3OJCA 1OIXA 5KQPA 2HSGA 2B7BA 1V96A 4GKAA 4ND2A 1EUCA 2X23A 4CMAA 1EGHA 1YIDA 3D64A 4ZMRA 5COAA 3BF8A 3ZE1B 1EXWA 5JH7F 4DR2B 3NAMA 5C32A 3HK2A 4E5PA 3ADKA 1H6AA 3F3KA 2I3AA 3DTVA 2OHVA 3RSOA 3M4ZA 5CM2Z 3MAGA 4LX8A 2XDQB 3LPLA 1N5RA 1BO6A 3HU2A 4D1YA 4DSUA 3RSCA 1M6VB 1T9GR 1Y8RA 3EDRA 3PC3A 3LF2A 5ERGB 4HZIA 1H2WA 2OGWA 2PCLA 1H6BA 2Z2KA 3ME5A 4L8GA 4CIXA 1LK7A 1OYYA 3A58B 1OGJA 3GO4A 3KVYA 3IMKA 3OTQA 3R3UA 2BGGA 4E70A 1B8VA 2GPJA 2UXDB 1Z29A 4PLZA 4GRAA 2J0SA 1JFFA 5CK5A 2I34A 4LC0A 2OCKA 1QYWA 2XJ4A 1CF2O 1KA9H 3N2YA 3RTBA 3WQQA 3F3SA 1KBOA 1T4CB 2HDWA 5A7FA 1JZTA 2HQRA 1A8HA 2GM5A 3OTWA 2Z57A 5AKXA 4ZYWA 1B0ZA 4CQLA 4F9FA 1SD5A 3H04A 1PQ4A 5L6MB 3H2ZA 2WWWA 2ODWA 1JLMA 3IDQA 1RM0A 2YHIA 2J3QA 4G67A 2GEFA 1Y1QA 3OE5A 1RQRA 2YFHA 3RK1A 2A0FA 3LT0A 4EO9A 1SR8A 2P3OA 3QY0A 4UOZA 1H4QA 1ZISA 1NFQA 5FWYB 2B7LA 4FONA 4FN5A 2IH5A 4X91A 3KQOA 1P5HA 5DULA 4DCUA 4YAGA 3JRNA 4MYTA 1R0KA 5KZMB 4J4HA 4DQLA 1L8QA 2ICAA 3MT8A 3OPVA 4JH0A 5FI1B 5CVUA 2G1KA 1AKYA 1JB9A 2H4HA 4DV3B 1XVTA 2C5AA 1Z7EA 1GGMA 1TJNA 2VKQA 2G63A 1UUFA 4NBKA 3ZXYA 1PFVA 1ESCA 3RCBA 2RKWA 1EDEA 4XJXA 5EIHA 4DYVA 2I33A 4MVWA 3EXIB 4HB2A 2H65A 4FSHA 2GM4A 4UD6A 4BZXA 3A2KA 2GF0A 3RYCB 1FYFA 3HDYA 1MAUA 3JTEA 3AY3A 3EQ7A 3KALA 5SY4A 4YUVA 3NNSA 1JSXA 2CDNA 5CNJA 1TTQB 4OQMA 2Z4RA 1GNQA 2CNOA 3QJGA 3JAKA 3P2MA 2X6RA 4RGQA 3Q15C 1NP7A 2QT0A 3AR4A 1MEJA 4HQKA 3LLUA 3SIWA 2ZSUA 2WJZB 2Z43A 1KFCB 4MI3A 4CZ2A 4P53A 3FRHA 1Y1PA 2FR8A 5E6SB 1G0OA 3GAZA 5HYVA 3JASB 4JUBA 4N5LA 3E27A 2WTUA 1GXSA 3IVAA 2DEUA 3GGJA 2XSZD 3WICA 2O3RA 5DNAA 4ROTA 1S9DA 1Y7LA 3NV9A 4RVGA 3KDSE 4OQ4A 1HT3A 3T0GA 5CD9A 4B73A 3UMFA 3VKHA 4D9KA 3GK3A 5F1KA 4LA4A 1EI9A 1JU4A 1BXKA 1XRRA 4S2EA 2VAVA 2VI5A 1KO1A 3AZOA 4HDKA 3NRCA 4YWHA 4BFVA 4FFLA 3LQQA 3DXXA 4GC9A 1XMOB 3A3PA 2WKRA 3QUQA 1ZH0A 4LX0A 5DT2A 5T64A 3KWLA 1YRWA 3F73A 2PS3A 1Y9AA 1WETA 4UNSA 2R97A 4ND5A 1JDTA 5EE3A 4GDMA 3ZHBA 4B81A 5IDQA 1KMCA 1XZAA 1DC4A 2O14A 4BEJA 2Q4RA 4JITA 2E85A 4DCNA 3DO8A 4WY5A 1KDYA 4P38A 3PQCA 5IAOA 2VUUA 1V1RA 1H4VB 1Y1RA 2J4CA 2XUPA 3FFBA 3FYUC 5FBQB 1L5FA 5BNZA 2D0PB 1HNNA 1EBUA 3HUEA 1KFEB 3VYRB 3NXSA 2O3SA 3MRSA 3KC2A 5KWIA 2HK8A 4BVFA 1WDTA 2QAIA 3NYRA 4ZOLA 2YNMD 5KWEA 2CXTA 2IXAA 1O94A 2FW9A 3BKXA 3HCFA 3HQ4O 1NJ5A 4Q39A 1UM9B 4AURA 1GJRA 3IO3A 4AS1A 4MMYB 1UXOA 2AFIB 3R5SA 1HH4A 5C81A 1F6DA 4KNVA 1LSJA 4L4SA 3OM1A 1TX4B 2AG8A 4CDNA 3UGQA 1WUKS 3G8DA 3AWIA 3NNDA 3HWRA 5CYPA 2VYVD 1NXTA 2L19A 4N01A 1RPZA 1AH2A 2VJAA 1KYZA 5F12A 5ANRB 1D2CA 4L5CA 3SQNA 3NALA 2QR2A 4I46A 4K2HA 4NZZA 3ZHZA 2G67A 4ZK6A 4QEDA 4KYUA 4NE7A 4FYPA 5C1OA 1NNSA 5MFPA 3VKFA 3KAKA 2D06A 5AVTA 1JKJA 3NH9A 3EXHC 1X8JA 3GLSA 5TE9A 2DE0X 1POXA 2X13A 4AIIA 2MHCA 4FBMA 3IEMA 5JBNA 1P4HA 3ESRA 3NEPX 3FAKA 4L5BA 1R4AA 1A8UA 3LZCA 4X93A 2F1HA 3ZYZA 3LUBA 1E63A 1AURA 1JI3A 1CEXA 1NHGA 4QJ4A 1EHIA 2WILA 5FD8A 5GGXA 3UK1A 3O92A 4XWAA 3B9PA 2BZSA 4H0CA 4A82A 1BQ4A 3WMFA 1T9GS 2GMWA 2I8AA 3OOYA 1KI3A 5TGZA 4GBGA 3BJRA 4UREA 3ICEA 2FSSA 2AGVA 4TVKA 1P91A 1SXJD 1NBEA 1ZMRA 1GKIA 2J46A 1AZTA 2A5DA 4QOSA 3ICVA 3MJFA 4XD7A 5AUNB 5TC4A 1TYCA 2NZ2A 3AM3A 1MMFB 2UYQA 4FW8A 2PXAA 4Q19A 4Z8YA 4Y0AA 1M6NA 5F2EA 4XOUA 3EPLA 3ZU4A 1KOGA 1U8UA 1L5OA 5K0BA 2O4UX 3PXBA 4E21A 1OJLA 5SY9A 4BJ3A 1GL7A 1E9RA 4LRUA 3PFBA 3JZMA 2X1MA 5JI3E 3E6AA 1GZUA 1YR9A 4GM1A 1RZRA 3SSMA 5UKDA 3FSEA 2I3ZA 2QENA 4JFAA 3UT5A 1XXHB 2XB9A 1SIBE 1Q74A 5DVZA 1P5JA 3ZE6A 4Q1BA 1NQAO 4N40A 2VXYA 3KYJB 3STXA 1QH9A 3KJNA 4QYIA 1JMVA 3GRRA 3MGBA 4J94A 3NUGA 4MW5A 4N65A 3ROZA 9ATCA 4LF7B 3R9IA 2OM2A 2NU8B 1M2WA 5KKAA 3C6BA 1D0IA 2GK6A 3EIHA 2QRQA 2MYNA 3DO5A 3IUQA 3RWMB 4UTNA 1Z6YA 1ZXLA 3GGSA 3PFWO 1E2PA 4PG7A 5I9IA 2XE8A 5AM3A 5E6RA 2R1UA 3RJ5A 2P6UA 5DTMA 5CFRA 2HIHA 3DDOA 5DO9A 4XASA 4ENTA 4EARA 4Q5IA 1S89A 1S7CA 3N75A 4RJKA 5B1SA 3GVCA 4A9AA 4BQIA 2HXSA 4PG4A 4HH3C 3O8OB 4P3OA 1GU1A 1PU2A 5KTRA 4AKGA 4L08A 3D7KA 1M5TA 1YA8A 4OB6A 5TB5A 4IEIA 4P1ZA 4ARSA 1QRUA 4D8XA 4WD3A 4BNMA 5IAKA 2HA4A 2HBQA 5JE8A 2UZAA 1AQJA 3RU3A 3JQAD 4K05A 4L5IA 5EE0A 1O6CA 3B3JA 4X65B 5KMGA 4ZT4A 3FROA 3DTNA 1BYIA 2NO0A 3MMPA 3B5IA 3BFVA 4BLTA 4JWTA 2RDMA 1W19A 5B3JC 3A6PC 2MINA 1JPJA 4HWOA 3UHPA 4KW7A 3HB1A 1OWLA 4FHDA 3AESA 3BG5A 3PI7A 3O0DA 1KEUA 1N1MA 3E2IA 4REQA 4ZRMA 4TS9A 3MOSA 3GV0A 4L3VA 4R0NA 4EF5A 2VHYA 2ZRQA 4H6WA 2TMGA 4LHXA 4CMGA 2AR0A 2FZWA 2YWCA 3OFVA 3T52A 1ZW1A 1HYGA 4OLHA 3Q8WA 1SBTA 5G1OA 4AYTA 1AMOA 4PV7A 5K3OA 5KTYA 3DBOB 3MMZA 4JI8B 4GWLA 4M7PA 5DHAA 5F77A 1CUJA 2OHGA 1LV7A 3L1VA 2TMDA 2VXOA 1UL1X 1X9HA 4AZSA 1KJNA 1GLGA 3E5RA 5ICSA 1KH3A 3AX6A 4MJLA 3PB3A 3G9ZA 4BMZA 6Q21A 1OPRA 3L0YA 4ZICA 4P33A 1TQDA 2EX1A 2FXVA 2PJDA 3BWMA 4CM4B 1WUHS 4XEUA 1KMHB 4I9FA 4H7DA 4MJXA 3CW2A 1OV6A 4PIMA 3HM9A 2VDWA 3GLGE 2FI1A 4B4WA 3CX4A 2D1QA 2J67A 2H4YA 2I99A 4E03A 4BMYA 3BCHA 2DETA 1MT3A 4WOKA 1P9OA 2R4TA 4JB0A 1L5YA 2I65A 2YXDA 2B69A 1G8PA 5LZ7A 3VOSA 5IKXA 3PQ4A 2FE1A 5JAZA 1GAXA 3ER6A 1JDBB 3Q3JB 4OQLA 3F2VA 3H2GA 5IF9A 3VNBA 3G49A 3ND9A 5J2TA 4IDGA 2GB4A 1GZ7A 2WAMA 4KWIA 3QMVA 4FU0A 1JEAA 5FOXA 1NDUA 4KXNA 4EB3A 4UUQA 4UQOA 2RK3A 3NHFA 1DV2A 4EO7A 4UTRA 3FCYA 1J24A 2V6BA 2Y9MB 4EGQA 2VL7A 3O4FA 3H6KA 1E3QA 3PT5A 3W5UA 3WIVA 1SG6A 1GRRA 4GDFA 4C3VA 2BRUC 1ZO8A 4M3NA 1T8SA 1V6SA 2CJWA 2CVOA 2H5EA 2W6JD 5A5GA 4LF8B 2KB0A 1BCRB 3G88A 3WIEA 3PUYA 1KEPA 3AEZA 4BEBA 1OX6A 1I1NA 1QGAA 2ATCA 2ZVQX 4JA2A 5I51A 2XQFA 4KACA 2CUKA 1XJQA 1COWA 4M83A 5AVZA 3FOEC 1R6TA 2DRIA 4XPIB 2AJCA 3SXPA 1XD8A 3MA0A 1SOUA 3I5AA 3RS9A 2PX6A 2H11A 2VTDA 3BKWA 5JMWA 1IZZA 2ZS8A 1QKIA 1JVSA 4RH3A 2QN1A 3RVRA 3ZLVA 1HEYA 2OM6A 2GBPA 2WSMA 4H1VA 1EK6A 5FDFA 1E7QA 2CE7A 4M1TA 1E3EA 1RYBA 2A33A 1W9MA 3O4IA 2FWIA 2IX9A 4ZEOA 1KEWA 1ZRSA 4KN5A 1YRAA 4JJ7A 4ACAA 1P19A 2CV0A 3W1VA 1HT1E 2IW3A 5I7WA 3I42A 5EJMA 4KV7A 2I6XA 3IOCA 1TF2A 4DBZA 2JJQA 5AICA 2CLKB 3QLEA 2BR3A 3CZ9A 2C31A 3PNKA 1KJYA 4GX5A 4C21A 1H3EA 4HCJA 3SF0A 3IRUA 2P2SA 3I2GA 2HHJA 1OMOA 2XWPA 4UDOA 4A27A 4BDSA 5CA1F 3FVWA 1N5JA 2XMZA 3HPRA 4PZLA 2JHFA 2ZS9A 1E6WA 1NBAA 4GGPA 4P4NA 5MN5A 3A6DA 2GEDA 1FW8A 1YQGA 2G6BA 4LW8A 4OHPA 5COBA 1YA4A 4DXDA 1OLUA 3QPBA 4X1IA 1JKIA 4FUTA 4K9SA 2E48A 1KJ8A 3AJ9A 2VP6A 3SYMA 5A5DA 5AVWA 2FDRA 2AYXA 4LHZA 4R16A 3WP1B 1DC5A 2VZEA 4D82A 2GPSA 2HR1A 1JDNA 4DJTA 1PDWA 2D59A 2ISQA 3RK4A 4YRBA 1NBME 5A9SA 2C2HA 4D4MA 2P9ZA 1ZC4A 4YMLA 1Z28A 2W93A 3O4GA 5IH3A 5ERXA 5L3ZA 4GNKA 4L02A 4FHZA 1C9JA 4PNHA 1YI1A 4QJ3A 3B1FA 1RKBA 2Q3FA 3DV9A 3CRZA 2FQQA 1GPMA 3E4CA 3EAQA 3MTGA 3BSYA 4OUDA 3D3JA 1I1HA 1QHNA 2NOAA 1IBCA 4ARZA 1QGUB 1QIMA 5FWNA 4NV3A 1N75A 1JPUA 1O97C 5ALGA 4BNLA 4EUHA 1IJKA 3GNLA 1XTIA 2WMOB 4L2IB 4PSAA 1AIPA 2FR8C 1SVNA 2HIGA 4KQ9A 4M9UA 5FNVF 2VATA 3E9QA 421PA 3BCUA 4CTOA 5JHHB 3G0OA 3CW8X 4OP1A 3LX6A 1XR3A 5CDFE 4HVTA 2IV2X 1WS6A 2ZB8A 1L2TA 5BY2A 1SZCA 1M8GA 2O50A 3URKA 2CB9A 3A6HA 1FMLA 2WEKA 2XA9A 5A6SB 3FOWA 1Y9DA 1A5TA 4YRAA 3QLTA 1TVMA 4LRYA 3UZUA 3GEEA 3BTUA 3B8EA 2F3UA 4OX9B 2O3QA 4I50F 3DBVO 1KZ4A 2BMVA 4S12A 3AEYA 2NV0A 2CWDA 5AW8A 2NZVG 5EJ6A 2X6QA 3GPCA 1N0WA 4JJFA 4O3FA 3BRCA 3C8UA 1G8FA 1GZDA 3MUEA 4OXQA 2C07A 3R0IA 4PCUA 1TLFA 4X63A 4U7TB 2JFGA 2XRZA 2RH9B 2AD5A 3OX1A 5JAPA 1T36B 4EVQA 3A37A 2Z2IA 4MVCA 4PHGA 2WF7A 1LBIA 4UPEA 4F3YA 2UKDA 4RPCA 3MNFA 3DDUA 1M2JA 3LZDA 3TIXB 4UXJA 2H85A 2QZSA 2AKAB 3RUPA 3ZCXA 5KSOA 1JIXA 4OHRA 2CXXA 3WK8A 4DAEA 5JNLA 3F47A 4NNPA 5DP2A 4KL8S 3ZY3A 4D7AA 5JAMA 3M2TA 1O94C 1SIOA 2JPDA 5GM2A 4WACA 3SC6A 3I37X 821PA 1A8IA 2Q99A 2P5SA 3BMNB 3L6UA 2GAAA 4K9PA 2QTHA 4GLBA 3MJSA 3B1WA 1SUIA 2E0IA 1IAVA 2G76A 1EAYA 2Y27A 3F7MA 1I3NA 4KMRA 3UOGA 4DADA 1OD6A 5JMPA 4DJEC 4BTLA 4DT1B 2RG7A 3W0LB 1Y5LA 2JDIA 3KQUA 4IDHA 3KLPX 3VX3A 2QEQA 1TA4A 2WAAA 3FCXA 4DR4B 1YNSA 1Z2CA 4TZTA 3UXYA 2Z04A 2CKDA 3GFTA 1ZQ1A 2EERA 3VR6D 4IUBS 5P8WA 3V4FA 2Q5IA 3J7TA 1JHPA 4MWEA 2ZYAA 1QFJA 1LJ8A 4XWYA 4AJ2A 2JLAA 4FFMA 3NANA 3RH0A 4MAMA 3Q3HA 1KEZA 5DHRA 2WKWA 4NYJQ 1ZMXA 3OKPA 2AYYA 1TRHA 1WBBA 4PW0A 1JEQA 5EUMA 2AVDA 5CDHA 4CKEB 3N76A 1ZNWA 1J23A 3F7TA 1P0FA 3EGDA 5I9NA 4CGYA 1KU6A 3BGIA 3I1IA 3L1KA 3IUEA 2MTBA 3C6MA 3RJ9A 3RIMA 5JALA 3A9VA 3QLUA 4RV4A 2BV3A 2OAQ1 3AG5A 3UW3A 4K9MA 1QH1B 2A2ZA 4DDTA 1FNDA 1OY1A 3CJRA 3LH5A 4ER5A 1UBGA 5KHAA 5FAKA 2WKSA 4KDCA 3C7TA 4BCBA 3G2PA 3BHNA 4LJKA 4JYAB 1I5EA 2QYOA 4NEGA 4B4DA 1G5RA 1WO8A 5IX8A 3F0TA 1N3IA 4LZJA 1ABFA 4G5HA 2SKEA 4W8HA 1U7ZA 1KSFX 1QBKC 2ZCVA 2ZBFA 2C2WA 1A97A 5K0NA 4B3JA 5CNKA 5DHQA 4GS5A 4IVNA 4LBVA 4O2BA 5ENVA 3LQYA 1WP4A 1MEEA 3X43A 3EZ2A 2PRYA 4QUIA 5K0CA 4JBWA 4G37A 3OC0A 4OL9A 1FFXA 1EWKA 1Z25A 3IIMA 1P7CA 2EGHA 4S1VA 1AK2A 1CY2A 5K3SA 4XIIA 1B3RA 2ZOSA 3DJFA 2H54A 5IBQA 2C2XA 3TW6A 2ZTSA 4C7OA 9ABPA 4C0HA 1E9FA 2IGBA 3HADA 4C4OA 1V41E 3QVGA 4OI0A 1CZNA 2DGDA 3NRJA 3TPFA 3WWZA 1VECA 5KJCA 1UPTA 1XLUA 2PUWA 4AJLA 3O3MB 4ETIA 3H2KA 1ZGJA 3T54A 3W7AA 1XQ9A 1JAYA 1DP4A 2BT4A 3HDQA 2DUMA 3E7FA 2W11A 4TTJA 5A4MS 1XUOA 3F5DA 2YC4C 1IG3A 1DUIA 1OFIA 1ORWA 3JZIA 5AOBA 1YDFA 4IMJB 2NYVA 2ONZA 3M6IA 1RP1A 4P54A 2RH5A 3N7AA 3T5DA 3VPHA 3ZIAD 3IUNA 3WIBA 3LU1A 3W5CA 4OLJA 1JGTA 1IPEA 4QL3A 1V4NA 3LL7A 3GP3A 2Q1UA 2QN7A 2YZNA 4QOGA 4Z4CA 3TVDA 4PN7A 2H5LA 1UBUS 1LSSA 3MWLA 1NLZA 3QKWA 4GE3A 4Y6PA 3S1AA 4PN3A 1FTWA 1RBYA 4EW1A 1XEAA 2QPLA 3B7GA 4B2LA 2ID7A 4P4SB 3ER8A 1VPVA 1ZM3A 5JT1A 1K4KA 3A32A 5AVRA 4IRMA 2Z5VA 3PVSA 4G81A 5DH9A 2DTXA 3REFA 4RY8A 4DGSA 2J9GA 3PLRA 1TO6A 1P8JA 1WCWA 5CDFA 2V6MA 2IWRA 1CE8A 5F5LA 2OHHA 1AGNA 4EMBA 3OLZA 1NBIA 3AUTA 1NUAA 3FG9A 3KVOA 4MA4A 2GZHA 5JXIA 1HQKA 3ES9A 1X1BA 2WJYA 2A0YA 1FYEA 3EVEA 3AK4A 3AJ8A 3KTAB 2YWJA 3OE1A 3EGXB 3TGPA 4N54A 3VDXA 3DP7A 2PAFA 4YMWA 1EG2A 4LKOA 2QTTA 4QUAA 3K9LA 3AU9A 4ARUA 3ONNA 3MLAA 2WDZA 4F7DA 4WBNA 2B35A 3NB0A 5DTQA 1Q6ZA 5BOVA 4B3DA 4MWTA 3KQYA 2QKYA 5AHKA 5I7AA 1XVIA 1IUPA 1ISGA 1V11B 3NBMA 4LDQA 4UFPA 2HSEA 3HKDB 4JB2A 4WCDA 3JR3A 1OPXA 5FPTA 3INRA 4QPDA 1A88A 3ASVA 5B58C 5BPFA 3UGJA 2B2NA 4MV0A 3WSWA 1P31A 1NJSA 1KSJA 1GZSA 2EQAA 3FGZA 3L0IB 4M0MA 4RK4A 2CSXA 5AR1A 2KE5A 2VDKB 4LOIA 1MW8X 3ILHA 3FIUA 1J00A 1KF0A 1U0EA 2H2GA 1XLTA 3SYTA 4XWGA 4EPXA 1OW3B 1N6HA 2FE4A 2K2WA 3SBXA 1UFRA 3QG5A 3IEKA 4MCJA 2PZKA 5KSWB 2I1LA 3E9EA 4IZ6A 4KIFA 5FTJA 3DFIA 5CAEB 3C1AA 3IQHX 2UYGA 1XTSA 2DMRA 4HZUA 1QG0A 2QMHA 4MUHA 4FGUA 1BA3A 4YI3A 4YJ3B 4P34A 3ZXSA 3LY9A 5CNIA 1SUSA 1U3CA 4BNXA 2VQEB 2CHUA 1LPSA 1F3OA 3L40A 4LQLA 1J8MF 4M0FA 4UHEA 1NBHA 2YVAA 2J0VA 3ADPA 2W4MA 4D4HA 4X3CA 1UPFA 2WIJA 1LCIA 1L4BA 2VAMA 4FZ5A 4ZO9A 3H84A 2DWUA 3GUCA 1LLCA 3N28A 2F3SA 2SICE 3B1VA 4RA6B 5JNVA 2QRZA 4UZSA 1WBJB 2O7SA 3BXGA 2ECQA 1SXJE 3ZE9A 2OXTA 2OILA 3ZVKA 4MDYA 3NBUA 4ZEVA 3H5VA 2HHAA 3UPDA 1X39A 3FDXA 1LGYA 5D01A 3TNFA 1O96A 1UXHA 2V7VA 3WLAA 4CIBA 3LT1A 2QQEA 1O5IA 4QNRA 4BKOA 5BWMA 1ZD5A 1QJ4A 3X1XA 3ZPXA 2FEXA 2GN0A 3PPXA 4FEAA 1DELA 3R5JA 4PE5B 4A15A 3M33A 5LFAA 1HF3A 4GRIA 4ZQFA 4L8FA 3TW0A 2V7XA 1WD5A 1QHSA 2JBAB 4EO4A 1CUXA 1XZDA 1GG9A 1T8PA 4XYMA 5C8DA 1DV1A 1E94E 2AN9A 3PCXA 3DAYA 4ZOQI 4OIMA 4ENUA 5CDYA 3I61A 1Y6QA 5J4KA 3S1SA 2RHJA 3AOGA 3R3JA 4H3HB 1VCOA 3W4IA 2X9LA 2IE8A 3B82A 3I28A 4H6XA 1YB4A 2KBFA 3A9WA 3LE8A 4AMGA 2J85A 5THXA 2YZ7A 5FBVB 1HR0B 1QUFA 1U7OA 1ZM4A 4JI0B 3I2YX 3QFHA 5JS1A 2P9FA 3BEOA 2WNSA 3LM8A 4X45A 5BT8A 2BELA 3AF2A 3B2QA 3BMQA 1LLFA 1SUCA 4NPCA 5HWSA 1E3DA 2ZJ6A 4RXMA 1H0RA 5AVYA 5JXJA 2BONA 1RS0A 5G4KB 4EA7A 2GA9A 5K3EA 5SICE 4EPYA 1DWOA 4G85A 2KPOA 1EIZA 4Q48A 5EKXA 1KSHA 4A2QA 3N8IA 4U1RA 1CU1A 5IJXA 1XWIA 2JGRA 2J9ZB 5I8WA 4UATA 1DSSG 3TOSA 1KEEA 1J2TA 1TMKA 2XVXA 4PC2A 3EGCA 4V0RA 3ZHOA 4C6HA 1ZIPA 3WWEA 2B61A 2JC3A 4FNGA 3AUUA 3AFOA 3NO4A 5TV2A 4BN0A 1GDTA 4YAJA 7ABPA 2ERXA 3B9RA 4CIWA 5LYJF 3WGVA 2IUTA 3GF4A 3V8EA 5CG2A 2GN8A 5IPFA 3ZKWB 3E22A 4WBSA 3QVJA 3U37A 3TTWA 4YMVA 2R79A 2ODEA 5IEBA 1KZ1A 3SZLA 4CGZA 3KIPA 1RABA 3RT9A 5AW6A 3V7NA 3SQWA 1YMVA 3GJ4A 4LOKA 3DH0A 4ERXA 4DUZB 2XSZA 4BECA 4GLJA 2JIPA 4IMPA 1RYYA 2H9AA 2E82A 3CISA 3GUZA 2N47A 3LAWA 3G2QA 4DLXA 4DNPA 3WLJA 3GFOA 1PZNA 3IH5A 3VBEA 1KFBB 4ZVNA 4Q1EA 5CM8B 2AF4C 2Y0EA 5HKBA 3KUUA 1QU3A 3RUFA 1BROA 4B44A 2GPNA 2ZRCA 1DJQA 2PLAA 1OYWA 3D59A 4RD1A 3WQBA 2PMFA 3N9IA 4IO1A 5H80A 4AT1A 1C81A 1ACLA 5K3BA 1L8XA 3PUXA 2XQIA 1ZWLA 3HJHA 1M7GA 1WQ1R 4KAAA 3WNBA 4ZZ3A 3BWCA 3ETLA 2C29D 1TIBA 4MUGA 2Y6VA 2NLOA 3R7LA 2YMQA 1O0BA 2P2GA 4QHSA 4XYLA 4PZEA 3UG7A 3TAXA 1KC3A 3ZTTA 1I4EB 4UPDA 5E9WA 2YNMA 4ZVKA 1CQIA 3DDWA 3UXEA 3FZYA 2P30A 4J0CA 4XEHA 3X2SA 4LN1A 3HDGA 3I92A 3THWA 3RFFA 1XAHA 2PPLA 2C57A 4BFYA 2ZSKA 1RDFA 4RELA 2QSZA 1CXZA 1UXIA 2YBEA 4ESOA 1FVOA 3LBIA 3DCNA 4JZKA 3RVSA 2J3IA 2PRIA 2VYVA 1V4VA 3G2HA 4KG7A 2VA8A 4A6DA 3A25A 2H63A 3FCAA 3IJRA 1LD3A 2I4RA 2KQUA 1I24A 2GCPA 1GSOA 2P77A 3D3NA 4MB6A 4UDNA 4S1OA 4S24A 2V8BA 4B4KA 3COSA 5ALVA 3ZJ4A 5KYXA 3KQMA 1W52X 3ZH9B 3L18A 3MBOA 2ZRBA 1DO2A 3HCAA 2H1HA 2QD1A 3BH6A 5K3FA 4A92A 2V6JA 1GRVA 2QAGB 4NU0A