1RC8A

T4 polynucleotide kinase bound to 5'-gtcac-3' ssdna
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
301
structure length
289
Chain Sequence
MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELVKRNSKRGTKAVPIDVLRSMYKSMREYLGLPVYNGTPGKPKAVIFDVDGTLAKMTDVINPMVVELSKMYALMGYQIVVVSGRESGTKEDPTKYYRMTRKWVEDIAGVPLVMQCQREQGDTRKDDVVKEEIFWKHIAPHFDVKLAIDDRTQVVEMWRRIGVECWQVASGDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*CP*AP*C)-3'
publication title Recognition of DNA substrates by T4 bacteriophage polynucleotide kinase.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase/dna
total genus 87
structure length 289
sequence length 301
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rc8A01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rc8A02
5AJYA 2GETA 4DXAA 3O8CA 3VMFA 3AVQA 1CJVC 3EZ7A 1N2CE 4JLAA 3RS2A 4ABYA 2ZJZA 3DM5A 2P6UA 4PZZA 2CHQA 2QAJA 5AK0A 1XTKA 1N6RA 4UU0A 3QUSA 3OCXA 3GLFB 3CNLA 3LA6A 2ZEJA 2XZOA 1XZQA 4ARZB 2IYQA 5AW9A 1NY5A 1P60A 3SNHA 4V02A 3TIFA 4BZQA 3D3QA 2OA0A 5ANRB 1P3JA 5FPYA 4BLQA 1XPJA 1TEVA 2BDUA 3AB3A 4CVNA 3WMEA 4MKIA 4I1VA 4UAUA 2YYZA 1CBUA 4DLRA 2C78A 3I3SR 4Z8XA 1E2LA 2NO5A 1ZNYA 3IHWA 1T3LA 3RYTC 5FUYA 5CDFE 1W4BA 3B9RA 3AUYA 5HZHA 2BHRA 2OFOA 4IJMA 4Q00A 1U8ZA 3BJIC 4RZUA 4OI0A 2CDNA 1YDFA 5JECA 2W6JA 1L4YA 1T5SA 4UNPA 2V4ZA 5EJEA 4L5BA 1O08A 4P4TA 1ZCAA 3FMFA 2XJ4A 5CM8B 5BN5A 3VU9B 1I4LD 3U6BA 5BW8A 4NH0A 3S1AA 2OSBA 3M6AA 1Q21A 1W44A 1H8HA 2ERXA 2WKRA 4PC2A 2H1LA 2VHCA 2O8CB 3PUZA 2QA5A 2ZRCA 4PO1A 4AWXA 4DLZA 4ZCIA 4FYPA 4OJQA 5ALMA 4TQ9A 2FPWA 1U7PA 3BE4A 4OCZA 1N6PA 3NRJA 5P21A 5AM5A 1ZIOA 1SVOA 5IK2D 1CR2A 5LD2C 2GF0A 3IBGA 3SYNA 1NJGA 1U99A 2VEDA 4IFEA 2BM1A 2QGNA 2W0MA 3OFNA 3H0KA 3LY5A 5AIBA 2ZREA 4FN5A 1NVXQ 3QPWA 5E4FA 2HDOA 4XD7D 1UF9A 5L3QA 1L7NA 3T1VA 3U6KA 5DYGA 4KFTA 4IDPA 1CR0A 1GL6A 1TADA 3CUEF 3WKEA 3VFDA 1II8B 1N0WA 4LJ7A 4KU4A 3H1TA 1F48A 1Z4MA 1L7OA 4URXR 4RZ3A 5CDFA 4BE7B 1QDEA 4K46A 2FFBA 1XMVA 1MOZA 3DZDA 2K5UA 2HJGA 3C8UA 4XOIA 5DGXA 1G7CA 3CIOA 1ZNZA 3SDZA 3U3OA 3L8EA 1XB2A 4HGNA 3SD7A 5E95A 4C0JA 2QAGB 4RZXA 2JA1A 4JT4A 3IIKA 4MRSA 2IK8A 3ZZ0A 4P33A 1YZNA 3AR9A 5G41A 4JZKA 1KI6A 2YV5A 2NPIA 3CM0A 5HCNA 2JGNA 4ZPXA 2CFRA 1N25A 1H8ED 4KVGA 121PA 4IFBA 1W47A 3P1JA 1KK2A 4M0LA 2ZIAA 2VL7A 1Z4QA 4HZUB 5AI0A 3N5KA 3OESA 5ALHA 3ZX5A 3ZX4A 4A6XA 2IX3A 2IBMA 1SVWA 2OILA 3BXZA 2WF7A 5AKYA 5DHFA 5AM3A 1AS2A 2OXRA 3I1YA 1GL9B 3LFUA 1OHHD 1R5NA 2CCJA 1F5NA 4HDQB 4TL6A 2YKGA 1KO7A 3W5CA 1GG2A 4NYMQ 1PJRA 1TUIA 2XX3A 1TTTA 2B6HA 2YWGA 5L3RA 2GF9A 2ZYWX 1EG7A 4OHWA 2OM2A 1ZUIA 5AUNB 1GDDA 3U44B 3PENA 5AJZA 3P4XA 5AVRA 1CS4C 2OEPA 3B8EA 3QOFA 2FFHA 1K6MA 1ONBA 4BWYA 1KI3A 2Q0HA 2I1QA 2IXEA 4OL0A 1R4AA 2W43A 3ZI4A 1NLYA 5IDVA 2OAP1 2D2FA 2ZUCA 4UW9A 1QHGA 5AM1A 3EIQA 2EYUA 3G0HA 2G88A 3NANA 4D0GA 4G5SA 5EP4A 2ZXEA 3QLEA 2LKCA 5A4JA 2RGEA 1AS3A 1UEJA 2IS4A 1FEZA 1SVLA 4IDHA 3UMRA 2O8FA 1F2TA 4KBGA 5ELXA 1NRWA 2Z4RA 1XXHB 2P5SA 1MO3A 1NLZA 1N0UA 2A78A 5C2JB 5F9HA 4F93B 3CW2A 2QZ4A 3K0EA 1NMXA 1FP7A 2GEVA 2B1RA 1XEWY 2RAPA 3IJ5A 1GKYA 3WHLA 2QSZA 4IVPA 3R7WA 3THXA 1M34E 4UNQA 1E1RA 3V4FA 4UXIA 1P7CA 1W0KD 5H70A 3CNHA 3U60B 3RS0A 5C4GB 4GZLA 2CVFA 1SWWA 3UPUA 2QT1A 2EATA 3AKCA 4QJ5A 3KOOA 3AF2A 2CL7X 1R8SA 3WMGA 2F1JA 3IILA 5KNBA 2TMKA 3QKRA 5AR1A 4YDSA 4KV9A 1BS1A 4GI7A 1WB9A 4DCCA 3W5BA 5AKKA 2ZS9A 1KMHB 1S0UA 3RF6A 3A37A 4DB4A 3B9BA 4EPWA 3G82C 3TRFA 3TBKA 3R9XA 2GBLA 1VCNA 3NTUA 4MDFA 2NO9A 4OQMA 4TMKA 5AWFC 1ZD2P 2BC9A 1P2UA 2W2XA 5C1BA 2ZRGA 4TL8A 2W6ID 4Y2PA 3ADBA 4TYPA 5L8VA 1Q1EA 3OEED 4P4SB 2AGVA 1MRNA 4Q5IA 1AN0A 4XH9B 1IM2A 1CRQA 1DADA 2D2VA 2I55A 3BIFA 4UATA 1N5KA 4HLCA 4PSAA 1DAKA 2GJKA 2PL3A 4BEVA 1EK0A 3BAFA 1OFTA 5JJLA 4RD2A 3ND8A 5AUOB 5UKDA 4BFYA 2GJ9A 2W2VA 2DHRA 1NBMD 3KZ1E 3FDIA 4LHVA 2WWYA 2GZDA 2F9LA 2EYQA 2C88A 3FPBA 3C4JA 3QE0A 4GRAA 1EFTA 5DSZA 3W9YA 4DCVA 3AVPA 4TT3D 3CH5A 1IXZA 4LPKA 4QNMA 1YQTA 2A5JA 2FUEA 5FOWA 3VU9A 3EXAA 3X1XA 3M9LA 2B8WA 1CEEA 5HKKD 2FSFA 1QBKC 4L9WA 3A4MA 3C5HA 3KKOA 2FDRA 5AW0A 2WBLC 2P69A 3LW7A 1VYTA 2CJWA 721PA 3KQKA 4UXJA 4QHTA 1WE2A 3EW9A 1G9XA 1N0VC 5FOUA 1KY2A 3GJ0A 3GP8A 1SHKA 2NGRA 4NCIA 3THYB 3T12A 1G8HA 2FEAA 3J7TA 3E81A 4G5RA 2G08A 1VCOA 1EFRA 5EXXA 3MWKA 2DR3A 2P3SA 1ZU4A 1L2TA 4RVCA 3A1WA 2F1RA 2D62A 2RKOA 2FJUA 4MGKR 3OZXA 5J4VA 2GWHA 2ZJ8A 1JAIA 3SBDA 4PAQA 4NYIQ 4WW0A 3SI7A 2FUCA 1KO8A 4Q1AA 4IXMA 4Q66C 1ZUNB 4TYNA 2ZS7A 5BYKA 1OE0A 4GDFA 3EWSA 4BLTA 2MSEB 4H9GA 2VBCA 5LBIA 5FOTA 2A3RA 3X1DA 4B6EA 3K0FA 3B85A 1YVDA 1UFQA 3EZ6A 4TQAA 3HR7A 4ZEWA 3IKJA 1J97A 1E79D 3TVDA 2FPLA 1I2DA 1OXTA 3K9NA 4GXTA 2IXFA 2WJVA 3U2QA 2QORA 4IEIA 3ECCA 5GJBA 5EP3A 3K70D 1OFUX 3AR3A 4AY2A 4HEJA 2G07A 3PGLA 4ACBA 4DLWA 1W0JD 3NHBA 4X8LA 2VKQA 3FB4A 4PHFA 3T35A 2R8RA 1OW3B 2G0NA 1BMFA 3PFIA 3U5ZB 2IEYA 1CF4A 1TU3A 2J46A 3K9GA 1JB1A 1YR9A 4XWAA 4HB4A 1ZD5A 3GFTA 2DPXA 1U98A 2R6GA 4D6PA 1ELOA 2EFGA 2QTHA 3VR6A 3LXXA 4NBSA 4QGGA 5B64A 2JGAA 4LJ8A 3EARA 2QM8A 2J0QA 3C14C 1CKEA 1J99A 1U2RA 2BBTA 1PW5A 4MWOA 4B3FX 4TZ0A 2ORVA 3FTQA 3OCUA 5E0OA 2QGZA 1N9KA 3WNCA 2J7PD 1D2EA 4JLJA 1GOTA 1XPRA 2RAVA 2GCOB 3KUCA 1KMQA 1FW6A 4YMWA 3W5JA 2GCNA 3L8ZA 4BFTA 1RKUA 5DE3A 3T1OA 2FEOA 3V00A 5ALKA 4O2RA 1TAGA 2RB5A 4QXAA 2OG2A 1YE8A 2F3RA 3UWKA 2FA9A 1G4UR 2EQBA 3K8YA 1LW7A 1E2QA 4KFUA 3U44A 1QZXA 4BRUA 3HPQA 1S9HA 4GNKA 2IYXA 5ALFA 4PPNA 2EFHB 1NNLA 2P27A 1GNRA 2B7BA 3OCZA 3TVTA 4UNSA 4BFSA 1N3BA 5FUWA 1UKYA 2GAOA 1MRSA 2ZYUX 1OIVA 5KYKA 2ZI5A 4RY2A 4RETA 2ZYTX 1QG4A 3WKDA 2B7CA 2HEIA 2OCBA 4YC7A 3WK5A 4M1SA 3U7EB 1ZRMA 2R6CA 2F6RA 2HXSA 3FOZA 3VX3A 3EASA 3B9PA 5M04A 3QF7A 1SHZA 2J1LA 1XD2B 2WJGA 3LAWA 5FOVA 5AVZA 3DMDA 1GILA 1SVKA 2J5XA 2AK2A 3EC2A 3Q85A 1NJFA 4MRVA 2IEZA 4DT1B 1U0JA 4R7ZA 2WJJA 1QHHB 1KI4A 1RQNA 3A36A 3X1ZA 4I81A 3N2EA 4NU0A 1HY3A 1ZP6A 2XOKD 1A7JA 1FUKA 4MUAA 4ON9A 4URZR 1T0HB 2C03A 3KXKA 4Q1DA 2G3YA 1XTJA 3RRYA 5ALIA 3ZW7A 4E5UA 3RVBA 4B3GA 3K53A 5DN6A 3GLGB 3ZVMA 3CO5A 1JR6A 3QVVA 1JEEA 4KITB 3KQNA 2IOFK 4GOXA 2PLRA 3CR7A 3ND9A 5FL7D 2R65A 4A2WA 3X2SA 2D74A 2NMVA 2G6BA 3GPLA 4CZ2A 3AP1A 2VF7A 4C4TA 5AW5A 2ZRHA 4HATA 1XEXB 1N5LA 2BBWA 3QKSB 3X1YA 1WBDA 4CEHA 3AR4A 1MABB 1E96A 1YZTA 1WXQA 1U94A 1CJTC 3K70C 3TSZA 5G3ZA 5KSPA 2LCFA 1PLJA 1E32A 1TF2A 2RHMA 5AUPB 1JXOA 4YCLA 2ZE5A 4D4LA 2HOQA 4C4RA 2WV9A 2XXAB 2J3EA 2IC5A 1E0AA 4MQBA 1CP2A 1E69A 2KE5A 3MJHA 1DAEA 3LLUA 1HA3A 3QJYA 2HCJB 3SJBA 2D2EA 1GP2A 3CLVA 3ZLJA 3OCVA 2Z83A 1EK2A 3OPXA 1N6LA 2UKDA 5TMPA 2ZOSA 4V0ME 4XSGA 1UPTA 1U0HC 3U7HB 3I28A 4LJYA 3FYHA 1JJ7A 4QM7A 3L43A 1VTKA 2BOVA 1P62B 1KDPA 1XD8A 4F72A 3KUDA 1IQPA 1NP6A 1HURA 4H1VA 4V0NA 1Z5GA 2V1XA 1KGDA 2NQ2C 3NIBA 5L3SB 2MSNA 4TTPA 1ZNXA 4BYGA 1OIXA 4GT1A 1VFPA 4EDHA 4Q4JB 4G9BA 3AVVA 4CGZA 4Y0AA 2QPTA 1YU9A 3E1SA 4OQLA 5EE9A 5ALXA 4HDCA 4KXFB 1ZVQA 3QUQA 1AIPA 1KJWA 3L82B 1M1YE 4C2UA 2ZSEA 2ORIA 3CRW1 3VHLB 5E7JA 5FOSA 4YLGA 1US8B 1VCIA 3LW8A 3CX6A 3AR2A 3RRNA 4L4UA 3W34A 3WK7A 4W9MC 4KYTA 2PT5A 4A8JC 4C7OA 3KKMA 4HLUA 4BZXA 2IYVA 4YONB 4C0HA 2UVQA 5F9FA 5AK4A 2NPFA 4B34A 1LNZA 4DIEA 4NCKA 1CR1A 2ZG6A 3PGVA 1QG2A 2DFNA 4YGYA 3TAUA 1N6NA 4CF5A 1ESMA 2ZI3A 1G21E 1EXMA 1SWVA 4PQFA 3HJNA 4V0MA 3LRPA 2CK3D 2AL7A 2FSGA 2G0TA 2BVNA 1XVIA 5SZKB 4DRZA 4ESHA 4KYIB 3J81k 2W0SA 3L7YA 1IBRA 3L2OB 4EX6A 2IYTA 4C3ZA 4IVQA 1II9A 1D6JA 1YZKA 4K81B 1QHXA 4LBZA 2FV8A 4XVRA 2PBRA 4KFRA 4QJ4A 5FI0B 3WNBA 1IXRC 3ZVNA 1JPNA 3T34A 1GZSA 3AH8A 1ZD8A 5AVVA 1NVVR 2BEKA 2OBBA 4TQUS 4FWTA 1AKEA 4GMXA 1W36D 3KTAA 2IHBA 4NYJQ 5AI9A 3W5DA 4EEKA 1Z2CA 1T4GA 2A5DA 2D4HA 3UATA 2RGNA 1NG1A 2V1UA 4DW8A 5B57C 2GDJA 3S1AB 1XEFA 4BLPA 1AK2A 2HLDA 2YJ4A 2WOJA 4CF7A 3ETLA 2ZETA 2D7DA 2XSZA 1Q1QA 2WICA 2NTYC 521PA 2ZVPX 2R62A 2R44A 2R6FA 4W7SA 3L0SA 5TVKA 5ALNA 3WK9A 3AQ4A 3O8DA 3RAPR 2XOKA 4BEJA 4M21A 2EWWA 3PR1A 4AKHA 3PVSA 4Q7JB 1ANKA 1YRBA 4LI0A 4PR0A 2WWIA 4ASUA 1ZRNA 1MO5A 2BMEA 2OBLA 4PX9A 1PUJA 3K0CA 1Q91A 4UKDA 3REFA 2YJ3A 2XTMA 2JASA 3LBIA 2WF9A 4UQOA 2Q9AA 3A1CA 3KB2A 2IOFA 1X1SA 4ESVA 3LD9A 5L3QB 1BH2A 3ZS9A 4QGAA 1Z2AA 3KBBA 4EPVA 1SQ5A 5GVRA 4TTQA 4M1KA 4M1MA 5KO2A 1Z4LA 1IY1A 2FWRA 2WKPA 3DVLA 2GKSA 2VSXA 1CTQA 1AZSC 1G291 2P2LA 3ASZA 2ZRNA 1QH9A 2G1JA 1E9EA 1XFAA 1ZC4A 2YJ6A 1EGAA 2OO7A 1YJ5A 4FMBB 3LVQE 3BS4A 1XWIA 3ZJYA 5LD2B 1DBSA 3HU2A 5KDLA 2HI0A 1T5TA 5EE3A 1NNEA 3AVOA 2PX0A 1HT2E 5CB8A 3TUIC 1QHHA 1J2JA 3BH7A 4MRRA 4F91B 3DKVA 4PZLA 4Z8YA 3IGFA 2P5TB 1Q1ZA 3H2YA 4AK9A 2HF7A 2AX4A 4UAVA 2C96A 5FOXA 4UNRA 2FSHA 3ZVRA 3DNPA 1Z6YA 3KQLA 3JZAA 5TXGA 2WMOB 3VR4A 3GLGA 1HQYE 2PZEA 1GKUB 4UARA 4IOJA 1YR7A 1ZUHA 3K09A 3L8FA 1KI8A 3FFAA 4M9XA 4OFZA 4ZDKA 3PUYA 1U90A 1DOAA 1L4UA 3R20A 2IYWA 2ODEA 3CH4B 1NVUQ 2FU5C 5CYPA 3AKEA 5FPSA 4BBJA 1ZM3A 1T8UA 2X19A 1YS9A 4BLOA 2G77B 1HT1E 4JL6A 3GJ7A 2FGKA 5KDOA 1MABA 5HE8A 1VCMA 2ZYVX 3PUXA 3SU8A 1S8FA 4XSHA 3SJZA 2OAQ1 2VHQA 4KNWA 3L0OA 5G40A 5KNDA 4GMDA 2V7QA 1KZGB 2AWNA 1WQ1R 4O3MA 2WWXA 1W36C 1C9KA 2NZ8A 4JL5A 5FI1B 1OIWA 1A2BA 4HLDA 3B1WA 1FTSA 2QL6A 2HF8A 4S2EA 2NYVA 1E9CA 3I72A 3DPUA 4LHYA 4DEYA 1WBBA 2WF8A 4NWIA 2C8KA 3OEHD 2C5LA 2N46A 1U9IC 4BEWA 1F2TB 1Q22A 2ZTSA 5DO9A 4Z1MD 5ALJA 2FG5A 3LXRA 3CNNA 1TE2A 5A5GA 3NAMA 2G06A 3GLIE 2R8ZA 2PJRA 3QXGA 1OXUA 821PA 1PZNA 3AEZA 4N3NA 1X86B 4R9UC 4B44A 4XWKA 4XPZA 4EKDA 3THXB 5AM2A 3IO3A 4JVLA 3EPJA 2QPAA 3E5HA 4JVMA 5FBWB 3HR8A 1UJ2A 2Q4TA 1KHTA 1UM8A 5ALRA 1YZUA 4P32A 3RS5A 3W6OA 3H4MA 3TW4A 3DZ8A 2FGJA 3I62A 5AK6A 3ONNA 4BNDA 1KKMA 1QVRA 4PFSA 3L8HA 2Z5FA 1U9IA 2RGGA 5J4YA 5FTKA 4NE2A 3OAAA 4Q7LA 2B92A 3D8BA 4TZ6A 4TYWA 3FVVA 3DO6A 2WZQA 2Z4SA 2HO4A 2ZJOA 4BASA 5AI6A 4M1WA 4O8CA 4WZAE 3WXMA 3WMFA 4B48A 2BKUA 2ZRJA 1A4RA 2R2AA 3KKNA 3ZD6A 5AVQA 4OK6A 1XJCA 2BMJA 2G9NA 3AKYA 2VF8A 2JDIA 3TH5A 1T91A 4OHZA 5LB2A 3M1YA 2HYDA 4B74A 1JALA 3C16C 4LY6A 3RC8A 4EFLA 4PZYA 3BWVA 2XNDA 2AR7A 2YOGA 4AYTA 2GVDC 3U13A 3ZIAD 3TR0A 1G6OA 2B0CA 4PHGA 3U3JA 4LZZA 4DLVA 1SXJD 1QHSA 1TJ5A 2XGJA 2WHEA 2PX3A 3VR3A 4BFWA 3LQQA 2ZXUA 4QQFA 1E9BA 5ALEA 5AW7A 2G0AA 4B73A 3MPOA 4D4KA 3N70A 4PTLA 3QF4B 2VP9A 4R2HA 1X3SA 5EXPA 1YZGA 2OCYC 3Q9LA 2JLXA 1G8FA 2OBNA 4FI3C 2GHQA 2PZFA 4QG7A 2V8OA 2ZSAA 4Q47A 4JT2A 5CK4A 2V9PA 4URYR 3KFXA 1P5ZB 3NALA 4UMVA 2FPSA 1T9HA 2CJWB 2OBMA 2FEMA 2Q4RA 1O03A 4LC0A 3T1QA 4AD8A 1T3HA 1SU4A 4JYBA 5EUMA 5KU1A 1KNXA 3QPVA 4MKHA 4CE6A 3GJ8A 3S6JA 2YNMA 1NSTA 4PSKA 1KAGA 2VHTA 4WOPA 2B8JA 2ZBGA 4Y2TA 1I2MA 2BM0A 4I1UA 1E0KA 3QXXA 4TYQA 3MFYA 3R8CA 1Z07A 5FPHA 4OI4A 5EE0A 4TLCA 1R7RA 2ZBDA 1CR4A 2F43B 1G3MA 4KAXA 3JVUA 4PC7A 4Q1CA 4D25A 2ANCA 4QOSA 4HAZA 1G7RA 1Q57A 2OLJA 1QRAA 3QKUA 4S35A 4JS0A 3K0FB 3UWOA 4QM6A 4US2R 2FSIA 3RWOA 3A6PC 4DKXA 4TSFD 5CITA 2VLIA 1FNMA 1NI3A 1G7TA 1E2HA 4DBLC 1B23P 1QHYA 4GP6A 2IS2A 1OKKD 1FOEB 2CLCX 3GFPA 1VG0B 4YXWA 2QE7D 3V4RA 2YMLA 2DWPA 4OQFA 3B2EA 4TMVA 1RMQA 2EVWX 2C9MA 2GXSA 1P9RA 2BJVA 4E22A 1A1VA 1TJ4A 1RJ9A 3GJXC 2YMMA 2AMYA 5AVSA 1TQ6A 2CL6X 4X8OA 3ASYA 1P72A 1KIMA 2QMEA 2Q5EA 3QU2A 4JYCA 1KAOA 2A9KA 1L8LA 2PKEA 3D6JA 3W6PA 2JLRA 1JJVA 2O52A 4I1OA 4IG4A 4TYYA 4Y2XA 1HV8A 5C4MA 4B2IA 1RFLA 2C9CA 2BV3A 4FINA 4GBMA 1NKTA 2GXQA 2IYLD 3EWAA 4XJXA 1DG3A 1VECA 2AK3A 2FDCA 3CBQA 1Z88A 3I8SA 4UXHA 1XP5A 4OD0A 1RLOA 1CLUA 4O2LA 4LHWA 1OLOA 2QMOA 1RRGA 3PV0A 4LPSA 1Z29A 2ZRDA 1E98A 1KTVA 3H86A 5ALZA 4YIHA 1WVIA 5JCPA 1RYFA 1XJQA 3NG1A 4EZEA 1KDRA 1J90A 2WPDD 1SVIA 5EZ5A 3U3RA 2YWFA 2Z0MA 3BOSA 1CJUC 5AUQA 1SVSA 1W4AA 3MWJA 4RJLA 4FMDB 4RKEA 3JZMA 5J40A 1DELA 4DLXA 4KSBA 3F5FA 2FE4A 1ZINA 5AVUA 4KVAA 1TF7A 4EAQA 3WK6A 3SZRA 1LB1B 4G01B 5AKGA 1P4SA 1TNDA 4DCUA 1NKSA 2FPMA 4DUGD 1RZ3A 4DFDA 4YMVA 4HSEA 4Q1FA 2PEYA 2BWJA 2ZI9A 2DWOA 5JHHB 3M4YA 5ALSA 3AVTA 4HZIA 1I4DD 4KCGA 4LWZA 1KI1A 3U3MA 4Z54A 5GVSA 2QRZA 2RGDA 1HH4A 4C4PA 3MD0A 1S3SA 2O0KA 5FH9A 4PPFA 1Y63A 4NYMR 4FWIB 1KSFX 1RRFA 4LV6A 4N1AA 4ZDJA 4IVRA 3FGOA 2X2FA 2W4MA 3UMBA 3IIJA 4OKSA 5JI2E 4B6JA 1J8MF 3B9QA 1MO6A 4ITRC 1XNJA 3IHLA 4QJ3A 3AR6A 5KUTA 3AM1A 1UDXA 4FMDF 4TLBA 5AKEA 5JS7A 3A1EA 1FZQA 1HE8B 3ESQA 4LC1A 3ICQB 2WJYA 1ZAKA 3KJHA 4EPTA 3DOEA 4M1TA 2MMGA 2VQSA 3L1UA 3KX2A 3O8BA 4CEHB 1QHNA 5DYIA 5AI8A 1FMLA 1TEXA 5IK2A 1E1QD 1Q44A 2OXCA 3CZ4A 4YDHB 3C7KA 3I61A 3FHCB 4M22A 2CN1A 3DM9B 4JSYA 4PAOA 2D06A 2DCUA 1WF3A 4Q4AB 5JS8A 3FKQA 4BKMA 2RGBA 2YJTD 3WYGA 1FQJA 1MO4A 4XD7A 5FR1A 5CK5A 1Z47A 5KTYA 1XD9A 1R8QA 1W2GA 3GEHA 1P73A 4IOKA 4F38A 1OV4A 5FTLA 4MGIR 2V55B 4DC9A 4UMDA 1G7SA 3EX7C 3CRVA 4PPGA 3IPYA 2C2HA 3FZQA 1LY1A 2IL1A 3BH6A 1OH8A 5JJIA 1Q3HA 3EZ2A 1WPGA 1ZD4A 3BORA 3OHMA 4JL8A 1SZPA 2PCJA 1NMYA 6Q21A 5BQ5A 1UBFA 1KYIA 4RKFA 3CONA 4AYWA 3QF4A 4LYHA 2WF6A 3THOA 3K70B 3BGWA 1ZRHA 2ORWA 2XEXA 5FBRB 2XITA 1RKVA 4BLRA 1KSJA 3AGPA 1E9RA 1H8EA 1WCV1 5K8LA 4MKGA 3FGNA 4B2PA 2YY6A 1T6NA 1M2OB 4G3XA 4E88A 3ZWDA 4B3CA 2FH5B 1GL7A 4A15A 4HGPA 3B7GA 2ZBEA 4AI6A 4JLVA 1G8PA 4CYMA 3REGA 2ZRBA 1OXXK 1NL3A 4C7OB 2IYRA 3FMIA 2HDNB 3LBNA 4ACAA 5A3SA 2IYZA 1Z22A 1COWD 3KQHA 1OHHA 1ZNWA 4GOJA 1VMAA 1G20E 2FF7A 1KYTA 3RRZA 3GJ4A 2F43A 3RANA 1G19A 4Q1EA 2VP2A 3RFUA 2BJWA 5F2EA 1OF1A 3W6NA 1XPUA 5AIAA 2QAGC 2JJ1D 5CIWA 2P65A 4LUCA 2H18A 4QKQA 4EENA 1HUQA 1XTQA 2ZAMA 3HPRA 5G3YA 1OH7A 2WMNB 1ETUA 1TJ3A 1S8OA 4URVR 4WXRA 2PCLA 3LDAA 3KB1A 1ZYUA 2I6XA 2AHOA 4DSNA 4P3YA 2B1QA 1WDTA 2ZAOA 2A5YB 1Q12A 4F4CA 1J8DA 3WP0A 4TL9A 1WA5A 1G5PA 3C15C 1LTQA 2CLDX 3FHOA 4JVSB 5H68A 2Q9BA 3KTAB 3U7FB 5IT4A 1P61B 1JR3D 2VYFA 2QU8A 3HYCA 4LHXA 4XOUA 1OB5A 1Z0AA 1NF2A 3MN1A 2CHGA 1K8RA 2QQEA 5AICA 4NYIR 4R71A 2FPUA 4X8HA 5D3MA 1NBME 4AG6A 4LX0A 5AKJA 4J2TA 2JJ2D 4LK2A 5DH9A 4RESA 2ZJAA 3EF0A 1W0KA 4FXPA 3ZS8A 1U7OA 4NHOA 2IYUA 3WP1B 4XVUA 4DCNA 4FW9A 3G5UA 4FCTA 2WIAA 1XMJA 1IHUA 2ZJBA 1CXZA 4YMSA 1E0SA 3T1TA 1KO5A 2CCGA 5F3WB 1SKYE 2YC4C 1E2DA 3GLHE 1N6KA 1CRPA 4LJ6A 2GVZC 4N0EA 4KBFA 4ZCMA 5JSZA 1RPZA 4J03A 5AKLA 3TW8B 1R6BX 4LBYA 3TLXA 3K0AB 3PEUA 1E9AA 2HCBA 3TE6A 3ZQ6A 1RLMA 4P31A 2W6IA 2R6DA 1XTIA 4Y0VA 3OEEA 4ZKEA 4ZEXA 2ZRLA 1L6RA 3I6BA 1DAMA 2J0VA 5AW8A 2J9RA 3NBZC 4Q02A 2VSOA 4WIAA 4DIDA 4D4MA 3RC3A 3WBKA 2JIZD 1H65A 3A4NA 3PDWA 2RBKA 1G17A 421PA 3FKSD 4YQFA 4Y2YA 3KJIA 1ZD1A 2ZSDA 3CB4A 1RKQA 1NBMA 2Q3HA 2YWEA 3TK1A 2REOA 4HAUA 2ZUBA 1NN3A 3U3KA 1D9XA 3RS4A 1BYIA 4M8NE 2HX1A 4TT3A 1TA0A 1W2HA 4QL3A 3PXGA 5ALPA 3HU1A 4TWZA 4B76A 1KZ7B 1OYYA 4QGHA 1Z5UA 2WWHA 5HKKA 5AHXA 1VJRA 2GJSA 3GLHA 4LV5B 2EFCB 4Q9LA 1DAFA 1D2MA 2QT0A 4B35A 1JR3E 1JECA 4HGQA 3NC0C 1MT0A 3VAYA 3I5XA 3MMPA 1U8YA 3VHXA 1IN4A 2ZE6A 2ZRAA 4R2IA 4V03A 1P75A 2VO1A 3BFVA 3LBHA 4EJSC 2BBOA 5IRCD 3R8FA 2QP3A 3GFOA 3H84A 4HLQB 5D3QA 2IT1A 5EXSA 4Q4AA 5T41A 3MWYW 5LB4A 3CWQA 2MU1A 1LV7A 2F3TA 1VYUA 2GEUA 2GK6A 4PAMA 3ZQJA 2DB3A 3OIUA 1CR6A 2YMPA 4KO8A 2Y8EA 4ZIRA 4A4DA 2B21A 3HYTA 2GRJA 3DMNA 2FZLA 1JXMA 1W4RA 2FPKA 1K5GA 4Y2JA 4ZI3A 5IT0A 1AQUA 2DWQA 2W00A 3MGCA 1U02A 2DBYA 1R0XA 2I3BA 2V54A 4ZI2A 1E79A 4Q21A 2WIBA 2ZRKA 4UJ5A 1Z0FA 2W11A 2KJQA 4B3BA 1JNYA 5AJXA 5CB6A 1XZPA 2F7SA 2BMFA 2WVJA 4MH0R 2GXAA 4QBHA 4OJKA 5ALGA 3RWMB 2JARA 4U7DA 2NO0A 1W0JA 2X77A 4RCYA 1QQ5A 3MC1A 3THWB 4O0MA 4N0DA 1AA9A 2B8EA 2FOLA 2O8DA 3CKLA 4D82A 3Q7PA 4AKEA 1Z4IA 4QHSA 1W36B 3QU5A 3NBYC 5FR2A 1RMYA 2REBA 3QUCA 5AKIA 2AFHE 4BNDB 4OK5A 4YMTA 4MGZR 5JWHA 2O8EA 4A9AA 1K1EA 2J41A 1JAHA 2C77A 2IWHA 2R9VA 4HAYA 2RH5A 4PO8A 4U5XA 4UM5A 3EA5A 1IOZA 1XMSA 2CNWD 5CJ2A 4Y2VA 3K1JA 2J7PA 1PLKA 2VP6A 4US0R 4NAVA 1WMSA 2ZU0C 2GXUA 2PT7A 3FVQA 4F4IA 4FMCB 4G5QA 4LJ9A 5FTNA 4EQ6B 3PG5A 1DARA 1NVVQ 2OZEA 1R0ZA 1D2NA 2PZGA 3DEFA 3ZGXA 3CZPA 3KDPA 5AVXA 3OE7D 3E8MA 2EARA 1ZIPA 5FTMA 4DCSA 4YMUA 4JBXA 5J47A 1MKYA 4DDUA 3TGPA 3AR5A 1TF5A 4KLZA 2P67A 4IOLA 1ZS9A 2H17A 1UKVY 3E2IA 3SN6A 3GLIB 3EZFA 1IY2A 3NHAA 1KK0A 1AQ6A 5AI4A 2WJHA 4JLPA 4CF4A 4F4JA 4A8JA 3NUQA 1X8LA 4C4SA 1LF5A 1XCPA 1Z5ZA 2MSDB 3AF4A 1E99A 3HU3A 4HB3A 4IFTA 2EFEB 2JJ8A 3HDTA 1S4QA 3CR8A 5DLQC 3UMGA 1G3RA 4L15A 2OYCA 2WKQA 5K8IA 2P6NA 3P27A 1E2NA 1R5OA 1ZJJA 5GADl 4OHYA 1GSIA 5AK5A 1IN8A 1DE0A 4KODA 4FMCF 1YMQA 3PEWA 1RDFA 2GFHA 4GFDA 2DQSA 1S96A 4Z51A 5CLQA 1KI9A 3T5DA 1G6HA 5AVTA 2Q3MA 2GAAA 3SE0A 5C46F 3KXIA 1F5SA 1L7MA 3SKXA 1KK3A 3HP1A 4C0AC 4IKEA 5JWOA 5AW1A 3I76A 3IRUA 3NDPA 1P9WA 1GITA 2GJ8A 4AS2A 1NN5A 5FL7A 1E9DA 3BWDD 3U26A 4RFSB 2ZBFA 3TUJC 4WA7A 3QG1A 3SEAA 3NH9A 4HI0E 1Q92A 2C95A 5AKXA 4ZDIA 3GJ6A 1Z28A 4B32A 3ET5A 3SLRA 3K0AA 3KKQA 4FE3A 4Y3UA 2C99A 2WJIA 4NYJR 3TQCA 3PCTA 2YN4A 2NZJA 1NG9A 1D8TA 4OHXA 1Q3TA 3F8TA 5TY0A 1MH1A 4DDVA 1P6XA 1RC8A 4C2TA 3RDPA 3UMCA 4C0SA 3KJEA 3DL0A 2HV8A 4JLOA 2ONJA 1UADA 1W1WA 3EAQA 3N28A 5AM4A 2J87A 4Q9HA 8OHMA 3AR8A 4KSCA 4B47A 1E0JA 1Z6XA 3A3YA 3U7GA 4RD6A 2KB0A 5JBQA 2V3CC 2JAWA 1R5BA 4JLKA 1DO0A 3B6EA 3ADKA 1RJ9B 1OJLA 4UJ3A 4US1R 3B82A 2GEDA 4NTZA 4BEBA 1S1MA 2GJAA 1X1RA 2QUZA 2QG6A 1NIPA 2YVUA 2W6JD 1UBEA 2DY1A 4XTRA 3PIRA 4DDWA 4JBYA 1FP6A 4L8GA 5HTKA 3SMVA 3TLMA 1YR8A 2F55A 3UKDA 1R0WA 1G16A 1B0UA 1RVDA 3AVUA 1HYQA 1XEWX 1IONA 2UZIR 2H92A 5EZ6B 1JEDA 5EQTA 4A6PA 4EPXA 5ALUA 4KI0A 1H8HD 3GMTA 3EC1A 3NKVA 1I4TD 3I1FA 1EX7A 2VHJA 2IA5A 3PEYA 2RGAA 3SC3A 3ZVLA 1F6BA 2JLVA 3GYGA 2B82A 3NH6A 4GIBA 2ZRPA 3WKCA 1SKQA 1VDZA 3RS3A 1E2EA 4UMEA 1II0A 4Q9IA 1GFIA 1YZQA 2KBFA 4WAUA 4B75A 4JBWA 5JRZA 1Z63A 1QQ7A 2A5FA 2BBSA 3MUFA 3OFND 4RSGA 4AURA 2R8XA 1VJ5A 2ODAA 4CRWB 3A1DA 3MRSA 2QP4A 3P32A 4MYCA 3SQXA 3M0EA 4Q4HA 4B43A 3WNDA 1J8YF 1IJEA 5E3HA 5IF9A 4LV8B 2CEAA 2XAUA 1GWNA 2O9JA 1RYHA 5FP0A 3B1ZA 2CK3A 2LKDA 4H1WA 2QNRA 5E7MA 4PNHA 4NP6A 5FBVB 2O8BA 2J59A 1OPXA 3B8HA 2XB2A 3SR0A 4B6FA 5JLJA 5K8UA 4YIKA 2ZPTX 1NY6A 5AW2A 2OFXA 2GHIA 3WRYC 4Q9JA 3AR7A 4HGRA 1Z6GA 3THWA 5FFMA 4DZZA 4HB2A 2KBEA 4LCBA 2HT1A 3GCGA 1ZD3A 4Y2QA 3SKYA 1BYUA 1V5WA 4JLDA 1OT3A 2FMXA 2VP5A 4Q01A 2ZR0A 4RCZA 3SFZA 1UDWA 1EK1A 2VPPA 2C98A 1Z06A 1RE0A 1Z3IX 4HDOB 1GRRA 1IAQA 2EWVA 4J0QA 2ZI4A 3N8GA 1S2OA 5J4HA 1R2QA 1E2KA 5AM0A 5DI3A 2PJZA 3D31A 1E4VA 1TPZA 3N5CA 4Y2RA 5SZHB 3Q8XB 3EPRA 3L0BA 2D3WA 2O0HA 2EU8A 3QEJA 1KDOA 2IW3A 5JCZA 1W7AA 3DDCA 4UASA 1PVOA 3F3YA 1TX4B 1G64A 3MWLA 1KJYA 2REXB 3CF0A 4OYHA 3IEVA 2ATVA 1M74A 5TB5A 4A2QA 4Y2SA 3PEVA 3VR5A 4EQ6A 2ODNA 1ESNA 1G5TA 2GTPA 1FUUA 2P0EA 1KSGA 4JSTA 5J4KA 3U4QB 1OB2A 1S2MA 5LPNA 1YKSA 3KZXA 5BWMA 2P6RA 2IWRA 4M4SA 1GRQA 1UEIA 3GQBA 2JAQA 2J45A 1HTWA 4ZCLA 1QQ6A 3FE2A 5FUVA 1M8PA 3NBXX 2Q3FA 5AJWA 2FI1A 3AP2A 4Q18A 3VNVA 4A0HA 3GLIA 4BECA 4CEIA 3WKAA 1EFUA 4M9QA 2QM7A 3UANA 4C0KA 3I73A 3CPHA 2MSCB 5C18A 4TL7A 1VHLA 1L7PA 1MH9A 1Y8AA 5EP2A 1T5IA 1PLLA 1Z4OA 2OCAA 3WKBA 1PV4A 5JZVA 2PH1A 1S3GA 2IXGA 1GUAA 1TUEA 2NO1A 3CF6R 3LV8A 4CT4B 3LO5A 3QXSA 5EUQB 3GJ5A 2QTVB 5HZKA 5A3QA 5KSOA 1FL9A 1GTVA 2H5EA 5KPJA 4NKRA 4PQRA 2C9YA 1RIFA 2ZRMA 3UXMA 4BQSA 4LJ5A 1XBTA 3HWSA 4XQ0A 1Z0IA 4TLEA 4DLTA 4F7WA 1VG1A 4WZBE 4AG5A 1LFDB 3ZYCA 5FPKA 1NLFA 1DAHA 3OCYA 4KHZA 1LVHA 1KY3A 2F1IA 4G5OA 4ZKDA 4MUBA 2P9JA 1E1RD 2JLZA 3A1TA 3GJ3A 2XZPA 5ALQA 5BXQC 3PQCA 2HT6A 4B71A 2G1AA 1LVGA 4LYFA 3VAAA 5KPDA 3MAAC 2OHFA 2I4IA 4RFSA 4U02A 3T5GA 4B33A 3C5CA 2GNOA 5SZIA 4YH1A 2R8EA 5JRJA 3B1YA 1JI0A 1TQ2A 4CEJA 3TKLA 2A7QA 4IDQA 3L1VA 3DDHA 1G41A 1TL7C 1ODFA 2V6IA 1J7KA 4IRUB 4IW3B 4TLDA 3TNFA 4DSUA 4LHZA 5EE1A 3ICEA 1RRPA 3EIEA 4HUQA 2I1VB 1VKJA 3A4LA 4LJAA 5B58C 1FMJA 3ZDQA 4ZDWA 2D7CA 3VKWA 1U8AA 3QU4A 1F60A 4EX7A 4LRWA 4QFMA 3SOPA 3WGUA 1P2VA 621PA 2EFDB 5KHOC 2OFWA 1XU4A 4G1UC 2BMDA 3QXJA 3V9PA 1YZLA 1UKEA 3Q72A 3KXLA 5DISB 1KI2A 2ZR7A 5AKHA 1AGRA 5ALWA 2R8YA 3M1IA 3OEHA 3TSWA 2QSYA 3BB4A 2GZHA 2JAUA 4P0TA 1ZM4A 4Z1MA 1G18A 5LDDC 2ERYA 3UG7A 1E9FA 2GK7A 2DFLA 4HYYA 4B3XA 2WM8A 3AUXA 1MR3F 1ZOLA 4WXPA 3NEJA 1BO6A 4DWOA 2E9SA 4GL2A 2XJ9A 5D3MB 1OXSC 4QBGB 2V6JA 1JBKA 1SXJE 3P96A 4ZEVA 3GEEA 3FWYA 1M7BA 4V0KA 3AF1A 3CNOA 3SYLA 4Q7KA 3QSYA 2P11A 4AP9A 3W8NA 2J0UA 1ZJ6A 3SQWA 3OTQA 1FX0A 3RNLA 2Q21A 4MKFA 5FBQB 1VPLA 5G53C 1Z0KA 3P26A 3SFVA 1XCGB 4C0LA 3NWJA 2NOAA 4E09A 3SJCA 5F98A 4BFVA 3CRMA 2JLUA 4KX5A 4NV0A 3UM9A 2IF0A 4EELA 3MJRA 2CXXA 2F1HA 1O87A 4KYUA 1EFRD 1SXJC 3ZU6A 2ANBA 2QLTA 3DHWC 3OIYA 1E94E 3A1VA 4NCNA 1TU4A 5JSZB 5IS2A 4K8OA 4QNRA 2HEGA 4F71A 1E2MA 4LBVA 3ED5A 2OCPA 5BN4A 3L0PA 3B13B 4CNQA 2HHLA 1X8KA 3LNCA 4NCJA 4BLSA 1YRAA 2QRNA 2E1RA 1RQLA 3I4LA 2CCKA 2WSSD 221PA 3T06B 4DJTA 3B1XA 2ATXA 3NBFA 1NN0A 2OM6A 4TTRA 3TAHA 2QTFA 2OV2A 1A2KC 4HYTA 2XB4A 1L8QA 4B3DA 2QN6A 3ZIAA 1YV9A 1Q0UA 2GMWA 1KO4A 4HAXA 4UM7A 1N5JA 1IJFA 1SXJA 4IDOA 4MYHA 2BCJQ 4NONA 2ONKA 1LF0A 2AXNA 2RHDA 5KOYA 1Z4KA 4QRHA 2ZANA 4QJBA 3GLFE 1F2UB 2GZAA 1BMFD 1C4OA 4Q48A 3GEIA 5L3VA 1WP9A 4EIWA 4JJKA 4KLNA 1R0YA 3SJAA 4BZPA 2GESA 4QHYA 4UMFA 1QYIA 3AF3A 1TMKA 1SULA 1W46A 4BFUA 2GBLC 4DSOA 3L0YA 2W2TA 3QG5A 1SKYB 4R98A 4FCVA 3GLHB 4D26A 5JEDA 4NDZA 4MUMA 1C1YA 3ZD7A 1QHIA 3F0TA 4A1FA 1RRCA 1XDBA 2BIFA 4M53A 3TUZC 1N8NA 2JEOA 1X6VA 3O47A 2QBYB 5A0FA 4MYUA 4PC1A 4BRWA 1KKLA 2FPXA 2G83A 1IN6A 3BB1A 1LS6A 4D81A 3U4QA 1E4YA 1OSNA 2WTUA 3WYFA 1KJZA 4PHTA 1GVNB 1N5IA 5J5CA 3QPUA 2H57A 4EPYA 4JIMA 3DV9A 4A0GA 4L57A 1ZW6A 3NC1C 3C41J 1IY0A 1E2IA 2A2ZA 3PITA 5CYOA 4YCNA 2IF2A 2RCNA 5FTJA 3SS8A 2WM9B 4LYJA 4ZIRB 3OF5A 3QU9A 3VX4A 2BDEA 4FIDA 2ZI7A 5JMTA 2XZLA 2O2XA 5CIQA 1HEIA 1VG8A 4DWJA 1HQCA 3FFBA 4RZ2A 3KL4A 2QPOA 5HR5A 5EE5B 3Q3JB 1K5DA 1OFHA 2HYIC 4EFNA 4TSFA 1X42A 3GLFA 1ZMXA 3W8RA 4ARZA 4ZV4A 1XCMA 2XTNA 1W5TA 3E58A 2ZROA 1E2JA 4C30A 1N6IA 4DSTA 3IQXA 5GJVC 5ALTA 1OKKA 4L16A 4EJSB 2C8LA 4DHEA 2FFQA 2QE7A 4MRNA 3SYKA 4GP7A 2ZS8A 2ZJ2A 2O8DB 3AVXA 5KNCA 3FPSA 1G8YA 3UIEA 1IN5A 5AW6A 2PMDA 4JKYA 1IN7A 2ZJYA 3AF0A 1W4CA 1KO1A 3W3AA 3WBJA 1G4AE 1S1CA 1ZM2A 3KKPA 4NMMA 2WWGA 2O8EB 1Q1BA 1LS1A 2WFAA 2GHTA 5J4LA 3LX8A 2QQ0A 2CL0X 5DN6D 2KSQA 4LGMA 3RLFA 2ZM5A 4TLAA 5JWRA 1GNPA 2G1KA 4LYAA 4PQYA 3T15A 1YNSA 2O8CA 3QUBA 1CULC 2CMKA 2BDTA 1PUIA 2AN9A 5A3RA 1P2TA 3BK7A 3VNUA 3ZTWA 2GCPA 3AP3A 2UZ3A 3AKDA 4WVFA 2PR7A 3SF0A 1Z83A 3QXCA 4G5GA 4JJZA 4EPRA 2WPDA 1FNNA 1XTSA 2O5VA 3E70C 4RD4A 4V0OA 4GSYA 4QGFA 1G5RA 1VIYA 3I8XA 2OLKA 3NASA 2X4DA 2ZVQX 4OHVA 4CW7A 5SZJA 4DB2A 1JQJC 3A8TA 4A8JB 1E2FA 2ZI6A 4FCWA 1BIFA 2AD5A 2OE2A 4P4UA 5ALDA 2WSSA 3CRRA 1II8A 4A2PA 3U19A 4DUGA 1HE1C 3FM9A 2RARA 4HGOA 3MCAA 2JLSA 4BUJA 2XNSA 2FN4A 4MDEA 3AVYA 3WK4A 1AJEA 2IOHA 2KI5A 2QAGA 4M1YA 2ODBA 1XJ0A 1T8TA 4URWR 4Q4LA 3NIWA 5CM9C 3ZZTA 3PCRB 5CJPA 1G3QA 3K1ZA 4C0QC 3PUWA 5FBLB 2IYSA 2N42A 2WAXA 4V0LA 4JKIA 2IYYA 3JVVA 2NIPA 1TQ4A 2BKEA 3BFXA 3ZZUA 3U61B 1ZBDA 3B78A 3FHTA 1RKBA 1XXHE 2PEZA 4HZUA 2GILA 4BFZA 4NPHA 1OYWA 4JLBA 2AUTA 1DO2A 2ZR9A 4XTCS 4EFMA 4AC9A 4HUTA 2AFIE 4A82A 2HSZA 4O25A 3ET4A 5HE9A 4DLSA 1OFIA 2YC2C 3EF1A 1VHTA 1E1QA 3RSOA 3QUTA 1DG1G 4HAIA 2QI9C 3QX7A 2HF2A 2WHXA 3BD9A 1E6CA 4JB3A 3BB3A 1T5LA 1YR6A 1P9NA 4XE5A 3WK8A 3TR5A 4NL4H 1AZTA 1JQLB 1DVRA 3IIMA 3LX5A 4POAA 3B1VA 3VKHA 1G3IA 4KNVA 3R9IA 4QBIA 1RLTA 5H8WA 5JJKA 2CE2X 3B5JA 3IB6A 3IBYA 4BX0A 3EPHA 2VSFA 2RGXA 2IUUA 1IWOA 3BERA 5H1YA 3MSXA 3HYRA 2WAYA 3O8RA 3K9HA 4OQXA 3VR1A 3NDBB 3L0IB 3QNUA 3KD3A 5DI9A 1QVAA 1NMZA 3OIWA 4ZO4A 1XPOA 3DAOA 2YHSA 1F2UA 1NVWQ 1GRNA 2ZU6A 1T0JB 1CIPA 3A1SA 2NO4A 1S9DA 4NABA 3BH0A 2WF5A 4GZMA 4RD3A 3RS7A 3Q5DA 3W5IA 1CQZA 1G8GA 2A30A 1DEKA 2B8TA 1XXHA 3A1UA 4D0NA 4A92A 5DIFA 2CFSA 5AK3A 2HLDD 4M9SA 3IUYA 3WY9A 3R9KA 2CLSA 2XSZD 4JLNA 1FQKA 3DKPA 4Q7MB 1CU1A 2H7VA 3L8GA 1CJMA 4NCHA 2W58A 2FPRA 3SHFA 3CPJB 2QBYA 1F3OA 3UMSA 1M7HA 1AKYA 2YOFA 1MV5A 1U2TA 3ADDA 3ESRA 2AKAB 2ZRIA 4ASUD 3IEUA 1Q20A 3QYPA 4W5HA 2VH5R 2W83A 2QP9X 2EAUA 1Z0JA 3QNMA 1E2GA 4LBWA 4PC6A 4KN8A 1RMTA 4IEEA 1COWA 1ZU5A 5AVWA 4PHHA 2R6AA 4GOKA 1KMHA 3K0SA 3F9RA 2AD1A 1ZM9A 1L7VC 4BFXA 4Q4HB 1Z6TA 4ERNA 3LVRE 1WR8A 2HCFA 4HB0A 1SGWA 3QIAA 4YCMA 5GJWC 2H16A 2IS1A 4U00A 1JPJA 4II7A 1J70A 2I54A 2JJ1A 3CX8A 5TDHA 4E07A 3SBEA 1ZCBA 2I33A 1UKZA 2JCSA 1N6OA 4D2IA 4AS3A 4M1OA 1Y3AA 1ZD9A 3A58B 2O8BB 4P4SA 1WZCA 5AW3A 2RMKA 1DTSA 3TSOA 4BX2A 3NVAA 2G80A 5FPTA 2ODWA 3EA0A 1DAIA 1E3MA 2C4NA 4DVGA 4EJSA 2FFAA 2RB4A 3FMPB 3UK6A 4TMXA 4QC2A 3VR2A 4G0NA 3DOFA 2IUSA 2OT3B 1KI7A 2YWHA 3CZQA 4WBSA 4X8MA 2DYKA 4TMTA 3ZH9B 1JR3A 3QBTA 2BCGY 4PSVA 4HLUC 3I32A 2N1BA 1UBGA 4Q19A 5DI3B 4OI2A 3TMKA 2IUTA 4G63A 1T9ZA 3R9WA 3CWZA 2FX3A 2JJ2A 4CDGA 1E2PA 3KC2A 1U81A 1FTNA 3CF2A 4CT5A 4H1UA 2DFTA 2YINC 4L9SA 5TV2A 1EWQA 2AKYA 3PJRA 2Z6VA 1XF9A 3LWNA 1A5TA 3FMOB 5FUXA 4A0RA 2JAOA 3ZWKA 3NEYA 4WZ6A 1NN1A 3IQWA 4OHFA 3WYAA 4F92B 2H8KA 3THYA 4B2LA 2A5GA 1GNQA 3LQRA 1U0LA 3QQ5A 1UAAA 1OXVA 5EP1A 1W48A 3MG9A 4E03A 4CF3A 2V7QD 3I92A 3NXSA 4CEIB 3LH5A 3KDSE 3IDQA 2GO7A 5ALOA 3ZTYA 1KSHA 1GAJA 3WRXC 2VIIA 4LSGA 4A0FA 4M9ZA 4AIIA 5B2ZA 3L0CA 1G1MA 2VP0A 2RGNC 5IHPA 2AWOA 2E87A 2GA8A 3IO5A 3P4YA 1EWRA 2CBZA 3D6TB 1NIJA 2QY9A 4MYTA 2B30A 2MMCA 5AKZA 4MGYR 1M7GA 5JJBA 4D80A 1XTRA 2QMUA 4LDJA 2G09A 1AM4D 5KSZA 2HJVA 2JIZA 4I4LA 2IHYA 5BYJA 4D4JA 3FKSA 3R4CA 3WGVA 3Q7QA 1RW4A 2VP4A 2WWFA 4XIGS 2Z43A 3EZ9A 3ONWA 2I34A 4MRPA 2XTZA 4DEXA 1T3SA 4C9BA 3ADCA 3RRMA 3HLTA 3X1WA 1GIAA 5K8TA 1TQDA 4JLMA 4DLYA 4C0BA 4BX3A 3RHFA 4W5JA 2WWWA 3K0CC 3OCWA 2QEQA 2HUPA 4JDPA 1NF3A 3W90A 5E7IA 2Q9CA 2LWIA 3QXHA 4PPQA 3L8YA 2RGCA 4XVQA 1Z8FA 5DNYB 1XMIA 5BN3A 1Z4JA 2X1VA 1CJKC 4W5WA 5KSYA 2PLFA 3CX7A 2BY4A 2L0XA 1AQYA 1X8JA 1Z6AA 4Q9KA 4OI1A 3EG5A 4TMZA 3W3ZB 1ZC3A 1U2SA 4DDTA 3TQFA 4CEJB 3OAAD 4PC3A 3KJGA 2X2EA 2C9OA 1O3YA 3RSLA 3PUVA 2IYEA 3MLEA 2JLYA 2SHKA 4PO9A 3QY0A 4HUQB 4OBEA 3BA6A 2CHVA 1DPFA 2YJ5A 2GCOA 4RD0A 4Q1BA 3BRWD 2ZE8A 3GLGE 1A82A 4HAWA 3FPAA 5DHAA 3SHQA 3K9LA 2FZ4A 1AGPA 4OK3A 3R09A 2BEJA 5JI3E 2PQ0A 3AV0B 1L8OA 4BGDA 3Q5EA 2JDID 4CIDA 2AXPA 4MA4A 3D7MA 2YZ2A 1NRJB 5FL3A 3I5YA 2J0SA 3BBPA 3QVUA 3WHKA 2FNAA 1BKDR 4KFSA 2XNDD 3N2IA 4Y2UA 4URUR 2CFTA 3W5AA 1XX6A 3SHWA 5JEEA 1D9ZA 3TJZA 2AH5A 1W49A 1P2SA 3QI2A 2I7DA 5IT5A 1QF9A 1UBCA 1XRJA 2QROA 3K09C 3QKTA 4UNNA 5EXTA 5B30A 3QEOA 5AW4A 4LJ4A 1EX6A 5ALYA 1DAGA 4NZYA 4OQNA 2Q6TA 2VA8A 3B60A 1ZM7A 4FD2A 4L6AA 2X8AA 1XD2A 4M2LA 1WRBA 1XP8A 4LOAA 1G3UA 5HPYB 2NO6A 4I1SA 4NFLA 4I9GA 4DT1A 1KI6B 2J0UB 3UG6A 1BOFA 1E9SA 1FX0B 4AKGA 3N07A 1EFHA 2NG1A 2PMKA 2IS6A 1IXSB 3QBVA 5ALLA 4IOMA 4JMPA 2ZE7A 1M6NA 1OH6A 4FFDA 2QENA 3VQTA 4I9FA 3UMFA 1NSFA 2WOOA 3KQUA 1W5SA 5JFGA 2WSMA 2CNWA 4GPTA 1GKIA 4JVNA 5HCIA 2ECKA 2CE7A 1D5CA 3BFKA 2JLWA 3QU7A 1DS6A 1R10A 1XEXA 4PANA 3QKSA 3OIVA 1JUDA 2YOHA 2YFYA 2VRWA 1KOFA 1KNQA 3OE7A 3VTKA 4L6CA 1VG9B 4AYXA 2JATA 4IDNA 3RABA 5ALVA 5CLLA 4D0LB 1OH5A 3L5KA 3LLMA 4PXAA 4UU1A 2C8VA 1Z0DA 3CPEA 2XXAA 2YBDA 5AVYA 5JHGB 4MITA 4DCTA 4Q03A 1SXJB 2ZSFA 2OUKA 1Z4PX 3VKGA 4YXWD 2JLQA 2CVHA 5AI5A 5AESA 3IPXA 3CRQA 5GJCA 3EPLA 2ZQ5A 1Z08A 3E84A 2QMHA 4I99A 4IXNA 2EW1A 4RFVA 2ASEA 2ZITA 4A36A 2O8FB 1KK1A 4TN1A 2C04A 3P20A 2ZUDA 3T61A 4ILEA 1VYVA 3ZUPA 3GD7A 5L3SA 3EIHA 2QYHA 3AVWA 2VHUA 4RD1A 5TARA 4BPBA 1EFCA 1N6HA 2HXYA 3EWIA 4DLUA 2F9MA 3MMZA 4Q4JA 4XWOA 3R7WB 4TMWA 2YMQA 2ZJ5A 3QENA 4HAVA 1EESA 1GM5A 1Z4NA 4IHQA 1SVMA 1VIAA 1KDTA 4QBFA 1FFHA 2VTKA 2KWIA 1AS0A 5KDDA 1YHNA 1FPMA 4AKIA 4EUNA 3QGMA 1US8A 2J7KA 2ZSBA 3EPKA 3QKRB 3AGQA 5AJVB 2ZRFA 1V43A 2OESA 4KX3A 2O0JA 2DFKB 3N1UA 2NO7A 2HF9A 4KJZA 3BC1A 3KFVA
chains in the Genus database with same CATH superfamily
2BKXA 4DXAA 3BRSA 1JFVA 1CJVC 2H3HA 3V2UA 1PTJC 4ZU6X 4LZLA 1UC5B 1NC1A 1YE3A 4MIEA 2P6UA 3M82A 3OT1A 3HO6A 4AXBA 2HJRA 4L08A 1PX2A 2XOXA 4RIFA 1GRVA 1S5PA 4RAQA 5CX1B 3OCXA 3D4OA 3L6BA 1I36A 4XFJA 5AW9A 1H66A 4GLJA 1NY5A 1P60A 3TIFA 1JKIA 3MTIA 2VDOB 3D3QA 4TTAA 5FPYA 4YAOA 1OTYA 1IM8A 1JHRA 1X9GA 2WE7A 4FR5A 1R6XA 1Y5RA 4RPKA 1GR0A 3WMEA 4CVNA 2YYZA 3P2EA 2VQEB 1GUDA 2OORC 4CM4A 2QX4A 2F3PA 3I3SR 2YR0A 3UN1A 5KZMB 5IPFA 1E2LA 2IUEA 2J48A 3OKCA 4J7XA 4RVDA 3TNLA 2GEFA 5FUYA 3RYTC 2YNMC 2DBVO 3N8IA 4FOSA 5HFJA 5B36A 4OI0A 2XBUA 2EP7A 3D8HA 1YDFA 3EGXB 4G8DA 1IHXA 1VE9A 2RJNA 2W6JA 1L4YA 1KEEB 3EEYA 1UH5A 5HEKA 4ZQEA 3FMFA 5CM8B 1HMPA 3S5JA 2IQ5A 3GRPA 3U9LA 5BN5A 1I4LD 3CKKA 4PBRA 5BW8A 5U4XA 4NH0A 3UTDA 1BGWA 2OSBA 2QRQA 2Q6VA 4LYDA 4U7PB 3USES 3WLLA 5H16A 2FWMX 1W44A 3OHSX 4PC2A 2VHCA 2O8CB 2Q46A 2VJLA 3GBVA 2QA5A 1W8IA 5JD3A 4D6YA 4E5NA 4EHJA 2FPWA 1DX6A 3MTDA 1N2SA 1N6PA 1O7JA 1R8JA 5J2TB 3ENWA 4BO1A 2DMRA 5IK2D 1C41A 3T54A 4HS4A 1PV1A 1ZCJA 1RCUA 4DC1A 1ISFA 1H2AS 3B1FA 5D2CA 5EZSA 1J2EA 2QGNA 1V5GA 2QW1A 1WULS 4UPVA 1C7JA 3LY5A 4BN0A 5AIBA 4NX2A 4MRAA 1IK6A 1DFIA 2NWQA 2Q2WA 4FYVA 4XD7D 5IZ4A 3OQHA 3F6YA 4MS1A 4RKYA 5IABA 1OX4B 4IDPA 3UENA 1CR0A 1GL6A 1TADA 2WG0A 3BBLA 3CUEF 5KQMA 5C53B 2C1ZA 1PZXA 1VIDA 2IKSA 3KT3A 3V4SA 2EKDA 4KU4A 3IT1A 4JC8A 4U9UA 3L6DA 4URXR 5CDFA 5HX7A 2BGWA 4K46A 2FFBA 1PRYA 2VJOA 1XMVA 4CKWA 5EIEA 1QP7A 3C8UA 4XOIA 3P52A 1E61A 3L8EA 3SDZA 4YMLA 4JYZA 2CXTA 2VT6A 5E95A 1QLJA 1YULA 2G8LA 2GZSA 1T25A 3RYHB 3SNKA 5B1IA 4YUVA 1HR0B 1ZXXA 3N74A 4TS4A 1VL8A 2JBAA 4MHTA 4ZAWA 4EG3A 1N7JA 1D07A 2WTXA 2E89A 3ST7A 1PJSA 4H60A 1KI6A 5DJ5A 5LC1A 4R81A 4OA5A 1NLUA 4D9NA 4KE7A 2A86A 3F7OA 5AXAA 3CINA 3SC2B 1Z4QA 3CEMA 3GIWA 5ALHA 4CBVA 4Q4CA 1KEWA 2JJQA 4GE0A 1SVWA 3BXZA 4TRNA 1SUEA 1RP7A 2IIBA 2Z8ZA 2F3SA 4KQMA 4UDOA 4MR9B 3R4VA 5DM60 1LCIA 4P58A 3C6KA 3LL4A 1GZ4A 3QLJA 1P0MA 3SS9X 2BGRA 3SICE 5F7XA 1G5HA 1GL9B 1JVBA 1OHHD 3PQ3A 3BEDA 4GRDA 4JSRA 2CCJA 1MIOB 4BV2A 5L95A 4TL6A 4P2BA 3R3HA 4PLVA 3PQEA 1PJRA 1TUIA 2XX3A 3LHSA 2B6HA 2PX8A 5DWDA 3VO2A 5ADWA 3VH3A 1KWGA 3WQSB 3L46A 5L3RA 2PE5A 4KXUA 1VJ1A 2ZYWX 1EG7A 2JCXA 5IJ9A 4XWTA 3UAGA 1GDDA 3U1BA 3UJ7A 4N7MA 4ZTUB 4JOCA 4BNLA 4GGOA 4I19A 1J39A 4R8VA 4HNRA 3QOFA 2F59A 5KEIA 1TKCA 1KI3A 2QTLA 5CBKA 4JYPA 3IODA 3AY7A 2W2PA 2OAP1 4Z9BA 3EIQA 2EYUA 3MPUA 4QJIA 1DC6A 4TV9F 1G5QA 4DMUB 3E9EA 4J16A 1GXSA 2FLVA 1BKYA 2LKCA 3QLEA 4YRZA 1KMIY 1QIKA 2C3PA 2CNDA 1Q83A 3Q1LA 4FCCA 4M86A 3RTGA 2WU0A 1L5FA 3KSDO 4FDLA 3WG9A 1SXGA 1HBJA 1XXHB 1QGOA 2P5SA 2EKQA 1NLZA 2YXPX 3LS2A 3LTEA 3M4JA 3R3JA 1R9NA 1JDBB 5DEOA 2PLAA 2X3UA 2ALJA 4HQFA 3QW2A 2KHZA 5AO9A 1IK4A 1F2VA 1FP7A 4Q34A 2RAPA 1ECGA 1LTHR 4NH4A 3P9YA 1CUZA 1QJ4A 2EXXA 1OX6A 2QSZA 3AWDA 3GGDA 3NT2A 4KWCA 4P9NA 1M34E 1X7YA 4KMMA 2VCYA 4O5OA 5G0VA 3SY8A 4A5SA 2HRCA 1MBZA 2Q49A 4IAOA 4JB2A 4YCDA 5H70A 5C4GB 3ZDFA 2IPNA 3OKAA 3IEXA 3OU6A 3AKCA 1XQWA 4XDGA 3CURA 4MPDA 2CL7X 4AULA 4BMXA 3TOSA 2DH5A 4NENA 1R18A 3BKXA 2P5UA 5BR1A 1WXFA 5KNBA 5KNLA 4YDSA 3F6SA 3W5BA 4GI7A 4DA8A 3O38A 1UBKS 1CP3A 3H0EA 4X61A 3VZBA 3RF6A 2ZT8A 5CD1A 1YRWA 4OIFA 4UOEA 1W52X 5JARA 4F2GA 2BELA 3TBKA 3R9XA 1VCNA 1REQA 3ROQA 2GYVA 3L0DA 1ZD2P 3IMFA 4MDFA 2XAAA 3FNHA 1X94A 4LNHA 1P2UA 3I4FA 4FN4A 2FQWA 1XN4A 3S99A 2HJWA 3PT9A 2FQYA 1CZOA 2D00A 4TYPA 5L8VA 3DYIA 1Q1EA 1A04A 2GPBA 5EIOA 3VYRB 1AN0A 3JALB 4XH9B 3ZE6A 3CH6A 1RNLA 3NI2A 2IHKA 1HEYA 3RVSA 4JR1A 5KYGA 1EWYA 3DF7A 2W2OA 2D7JA 3PCXA 1N5KA 3E1GA 2JH8A 4HLCA 1DAKA 2PL3A 3FOBA 4NF2A 4UATA 1DC3A 2XTAA 4BEVA 3SXPA 1EK0A 1LPNA 4QU9A 3S8MA 1T4DA 1XC7A 4RD2A 1ZAYA 3ND8A 3EOZA 4LK3A 2XEDA 1U1EA 4BFYA 4Q3EA 4LHVA 3FDIA 3WMRA 3JASA 2D8MA 3C4JA 3Q9UA 3IOEA 3OPYB 2WIGA 5I7AA 4GRAA 5DSZA 3AVPA 3S3TA 1U4SA 1PCXA 4JGGA 4UUPA 5KJCA 3CH5A 1P33A 2SCUA 5A9SB 1YQTA 1F4VA 2XMSA 4CLRA 1TZCA 5FOWA 3V2GA 3JQGB 3VU9A 2B8WA 1CEEA 2FSFA 2PH3A 5DXJA 2AZMA 4L9WA 5A62A 1HDXA 2FDRA 5AW0A 1ZL2A 4C78A 2FLWA 4MP6A 3C1OA 2WBLC 5I9IA 3LW7A 1VYTA 4PU0A 4D9CA 3NTVA 1NJ6A 2CJWA 3L04A 1U31A 3CPSA 3RU7A 4Y9DA 4DAOA 1N0VC 5FOUA 2F17A 2PR2A 2IU4A 5EIHA 3THYB 4DXDA 3JD2A 2D13A 3J7TA 4G5RA 4FFMA 1EFRA 1VXOA 2DR3A 2P3SA 1ZU4A 4HFJA 4J9VA 1KAQA 2NYRA 1XMXA 1R4NB 2FMKA 1R6UA 1RYEA 3OZXA 1RXVA 5J4VA 2OKGA 2VXYA 3AWIA 1B8NA 1PT7A 4FW8A 4PAQA 1AD2A 4FGKA 2YWXA 2ADMA 3RHTA 4I2NA 3M6MD 1UPCA 2G1UA 1JA1A 3TINA 4AT1A 4UTRA 1AH2A 3TOZA 2H4ZA 3MRTA 4GDFA 1FS5A 2XYQA 2O2GA 2MSEB 4FDUA 2VBCA 5LBIA 5FOTA 3NOOA 3F2VA 2Z04A 3B20A 3C3MA 3K6JA 3IQIX 4J1QA 2Y1WA 1W1UA 1XF1A 1E79D 1KJ8A 2IDJA 2FPLA 2QLMA 3I3OA 3FWPA 3K9NA 3GEPA 1KPGA 2WJVA 2GX6A 3HUEA 4MEBA 4R1SA 3U2QA 1LXCA 3VNRA 4QG3A 3D2LA 4Y6PA 4F3NA 1OFUX 1Q0HA 2FJ0A 3AR3A 2G07A 4UEOA 3S7TA 5KWJA 2VKQA 2I7XA 2P4SA 1QV7A 4Y1GA 1MQ9A 4ER7A 5B5SA 5CUQA 1MTOA 3U5ZB 2AEMA 4DA0A 2I8LA 3FOEC 3NWPA 3O4HA 3PSHA 4MVYA 1YR9A 3S2FA 1RCTE 3F4LA 5FHQA 3GFTA 4UDNA 2RC5A 5PGMA 4D6PA 1CDZA 1ELOA 1DZIA 3T7RA 1OA1A 5CLJA 1PZMA 3GGCA 3U7RA 5B64A 3PR3A 2XE4A 2QM8A 1Q1NA 2GD1O 2VWGA 2BBTA 1J99A 1PW5A 3FPFA 2QIOA 3MB8A 4B5KA 3BICA 1Y34E 1UCFA 4AJ2A 2I7TA 4S1NA 4TZ0A 1Y3HA 2P9CA 3FTQA 3GBSA 4TYMA 4MV1A 1OCEA 4HCJA 1XAHA 4RAOA 3NKFA 3V1UA 3WNCA 1P1CA 1P1FA 3T1HB 2HBQA 4CQNA 3TLKA 2P2DA 1YOVA 4BJ1A 2XLCA 3AB8A 1LC3A 4UPDA 3RE1A 4YMWA 3HV0A 3ICWA 5DE3A 3T1OA 4O2RA 3VMMA 1SHTX 3DKKA 1TAGA 2RB5A 3VYVA 1UEXC 1ENPA 2O2CA 5KBYA 3QK7A 5TVGA 3UWKA 3P8ZA 4WUVA 1LW7A 3GBPA 3SK0A 3KM0A 3PQ2A 4U2DA 2EFHB 1XA4A 1SB9A 4GEKA 1TCCA 3W1VA 5C7OO 3I1JA 2XUFA 2B7BA 4QT0A 1JH8A 3EGDB 5LQNA 1K9SA 4UNSA 4BFSA 3CZ5A 2GAOA 1MRSA 2NXNA 1S89A 2ZI5A 4RY2A 4HH0A 3WKDA 1QG4A 5K09A 1IIRA 1IHPA 1BX3A 1P4GA 1XE3A 3GLUA 2DM6A 4Q6WA 3NU1A 4AJOA 4QEKA 4E5KA 3WK5A 3PC7A 5IJ0A 4M0EA 3U7EB 4D74A 4PGGA 1QQAA 3TZLA 2HXSA 3IR7A 3GA0A 4C5AA 5DNAA 5M7EA 2K4MA 3QF7A 1LNSA 1SHZA 1Y5MA 2J1LA 3KJZA 3V8PA 3LAWA 1XDDA 3Q85A 2W42A 1HNXB 2IEZA 1XTVA 4FGSA 5P8WA 2LZ0A 3RUPA 5JCOC 1KI4A 2O2JA 3A36A 4Q12A 2HH9A 3N2EA 1HY3A 1V1RB 4I66A 1EM8A 2X23A 2D3TA 2Q2OA 4J6EA 1NNUA 5LWHA 4OX9Y 1FQOA 5BV1A 3VA7A 2I8AA 4B3GA 3EZLA 5ITZB 4RTOA 4J3JA 3ZVMA 3JVEA 4K05A 2IOFK 3EYWA 3KQNA 5I8WA 4JQCA 3CR7A 5FL7D 2Q5QA 4A7PA 2R65A 4HNTA 5TQ0A 1SK8A 4UUNA 7REQA 2O5CA 3VGJA 5I7SA 4C4TA 4JWKA 2ZRHA 2AZDA 1XEXB 3D0OA 2A92A 4I46A 2BBWA 1ZOIA 4I4IA 1TCVA 3DZIA 3P97A 3EDYA 5CAEA 5JNRA 1XR3A 3DLHA 4CEHA 2UXCB 1WCXA 1QP0A 1U94A 1CJTC 1JG1A 2UYQA 2VHVA 4K9RA 3LNTA 4CHGA 2LCFA 2H1CA 3ZNNA 1PLJA 2P2CA 2VNSA 4YCLA 5EUBA 1OLSA 3AZPA 4EEZA 1SG0A 1I3KA 4MXDA 2P0YA 2R5WA 3SYRA 4BDSA 4V1CB 3SBOA 5FYDA 4J43A 1GTSA 1NUTA 1R3DA 3EFHA 1RR6A 3JWJA 3QJYA 1SXIA 4N65A 5A7HA 5PNTA 2D2EA 1GP2A 1KDZA 2RE8A 2X1MA 4JROA 2YN2A 3OPXA 1IG3A 2UKDA 2ZOSA 2Z5LA 4HRVA 2YXBA 3TW0A 3ZWOA 2O20A 4S2UA 4QM7A 2WSBA 4R3UC 4QPZA 5KYVA 1XD8A 1BXKA 1NKVA 2RH4A 1D1TA 3E22B 5KOJA 1SBTA 3KUDA 1IQPA 3K9WA 4Q9AA 4H1VA 5LUAA 1SA0B 1Z5GA 2ZJ0A 1LKZA 1Y6RA 2NQ2C 4V0NA 4CR6A 2QN2A 4TTPA 1Q16A 1WX1A 3UV7A 3ZWMA 3ZY3A 1S2GA 4BYGA 4GT1A 3AY0A 4ZVVA 3K6RA 3O3MB 3QP9A 4QXMA 3FSJX 4OQLA 3C1AA 1R6AA 2ORED 5EE9A 1ZVQA 2EW8A 1ISSA 3UUGA 2V3VA 3I0MA 1V6CA 2ZSEA 3CRW1 5EVCA 3JAKB 3SEZA 3VHLB 5E7JA 4RV5A 4YLGA 5IVDA 4RPCA 4AX8A 3NYRA 4ODIA 4DWWA 1QANA 1TJNA 2QMYA 3HA3A 4L4UA 4W9MC 1XTBA 4KYTA 4A8JC 3J7AC 1NRIA 2QYSA 3QVOA 4YONB 4C0HA 1M0SA 4W5QA 3GDOA 5F9FA 1D09A 3BGIA 3MMNA 4DIEA 4L8YA 4EGCB 2HL6A 4RX1A 1CR1A 1DXHA 3QELA 5A0VA 3L79A 2DFNA 3L9XA 4GPIB 2XCTB 2GZ1A 3PD1A 2DUWA 2FSSA 1G21E 2MIIA 5LA6F 1B8OA 3L4JA 1SWVA 3HP7A 1ODKA 4IUBS 4B7CA 1QTQA 1H22A 2OZVA 2PUWA 3QE3A 1JU3A 4XCVA 2PA3A 5IWCA 4C4RA 1XVIA 1BMDA 2AS0A 3C5VA 4KYIB 4ESHA 3GPDG 1FU7A 1RYYA 1D6JA 1X9IA 4LBZA 1H0KA 1QHXA 2VBGA 4XVRA 4HDNA 2VJAA 3ODPA 4UBKA 5FI0B 1IXRC 4DVJA 5JQWA 3OPMA 3NOQA 3O75A 1RQGA 3PFKA 1GZSA 1NR5A 4NQRA 3TB4A 3AFMA 2VNIA 1ZD8A 4DYDA 2BEKA 2V5AA 1TC1A 5AVVA 4IWYA 4TQUS 4J75A 2J3HA 3KNZA 1LJUA 3BQ9A 3VVMA 4QOHA 3W5DA 2FOXA 1K7SN 1Z33A 3LTNC 2OPBA 2WU4A 1V2GA 2OGUA 2V1UA 1E20A 3OWHA 2ZJ1A 1FXWA 2GDJA 2WTBA 3OO0A 3S1AB 1ICEA 2VH2A 2YJ4A 5K3BA 2AQ8A 4WRRA 3OC6A 2X41A 5CNKA 1T8SA 1Y5IA 2GK3A 3L7AA 521PA 2GEJA 1GKLA 1QOZA 2HZBA 3PFBA 3L0SA 3TDNA 4EW6A 3S81A 3H3JA 1WSWA 4L8LA 3RAPR 4ZCTA 4ZVOA 4M21A 4PRYA 4AKHA 5INTA 3R7NA 4LI0A 3FIJA 1ZRNA 4NNOA 4IV5A 4PR0A 3VDXA 4XRGA 1YIAA 2H1RA 4MPJA 4R16A 4GLLA 2OBLA 1RZUA 4PX9A 4XUCA 3F71A 3O03A 5U9CA 4UTXA 3GJYA 1PD0A 1DAOA 1GGNA 3K0CA 3BRQA 4UKDA 3EY9A 3REFA 4B6RA 1U5AA 2WF9A 3HRKA 3KB2A 2A9QA 4ZA2A 4OJTA 1DKLA 5L3QB 1K97A 4RHUA 4QXQA 3HGTA 4DS3A 1V7CA 4QGAA 3V8NA 1Z2AA 2JAPA 1TLTA 5JD5A 2DKOA 4EBBA 1W59A 2KLBA 2I8CA 5GVRA 2XZTA 4OF4A 4RNCA 4V1CI 5KO2A 5BW6B 1EUQA 3RREA 1H42A 2WKPA 1FP4B 3ESYA 4UTOA 1ISRA 2JIDA 3NW9A 2ZRNA 4G56A 3LHDA 2G1JA 3DOUA 3F9CA 2B36A 1ZC4A 1JHOA 2LBPA 1EGHA 4QT4A 1EGAA 1H1DA 3KQYA 3IDFA 3VBEA 1GU1A 1U9CA 1XWIA 3RU9A 2CL5A 2NU8B 5LD2B 4LJRA 4F3KA 1IHYA 3L49A 3RIEA 2QW8A 5CA0A 1VPWA 5J9FA 4E2XA 5CB8A 4YUZA 3TUIC 1V16B 2O2EA 2P9BA 1JEJA 3AI7A 4MRRA 3MJEA 1JG6A 3IGFA 1F14A 1MOPA 2DY0A 5KTMA 1V11A 3VPGA 1VE1A 4PGFA 4REMA 3UAXA 4BPRA 4F4DA 1QE5A 5FTWA 4UNRA 2I2FA 1KEKA 1KAEA 4MINA 3RJMA 4MQEB 1TAUA 1U80A 4LY0A 1KH3A 1BW9A 4HWGA 2PZEA 4MJXA 3G7SA 5K1ZA 4IOJA 3OFSA 3L8FA 4IXTA 1KI8A 4OFZA 3PTAA 4NATA 3JWHA 4J49A 1G2PA 1MN6A 1RHJA 1TRKA 5EJ4A 1PQ4A 1L4UA 2DWCA 3N6XA 3O9VA 2F4NA 4RCVA 1J6UA 1NVUQ 2FU5C 5CYPA 2QL7A 3INRA 3IVRA 5EA2A 5I9LA 1KEVA 2X19A 1A5ZA 2G77B 2O0LA 1DU4A 3COVA 4IH1A 1WUKS 3PYMA 4H7EA 3UC5A 5A9RA 5IKEA 1AE1A 5JMOA 2ZYVX 3PUXA 2GPYA 4FSXA 3SJZA 3K4HA 3MTGA 1W29A 2OAQ1 5G40A 1KYXA 4I6EA 4GMDA 4TWAA 3ZV4A 1W8DA 3FTFA 2UXBB 4O3MA 1WQ1R 4RJJA 3OWXA 2JL1A 2IZ7A 1FRQA 4XUGB 1PR1A 3W4JA 1JKJB 1A2BA 1BE0A 3BMQA 4GP9A 1XTZA 2QL6A 5ESWA 4X60A 3VXKA 5HQTA 3WO1A 1QP8A 1TDJA 2OY0A 3DPUA 3LI2A 2O57A 3PE4A 4LHYA 2C8KA 4NWIA 4Q4DA 4B6QA 4Z49A 3L7MA 1UJ6A 3V3TA 3A27A 3H1PA 2N46A 1TQ8A 1WDMA 1RPAA 3OP4A 1YCGA 2ZTSA 3IEIA 3QSGA 5ALJA 3LXRA 5A5GA 3TFOA 1X2EA 5LA6A 5KU7A 1R4MA 3NUZA 2XH8A 2XWJI 1XNHA 1JT9A 1PZNA 2XR1A 3RUDA 4N3NA 3M4XA 1X86B 3O4RA 4R9UC 2PD6A 1Y0BA 3Q8WA 4FNGA 4PFQA 1QPGA 4KDFA 2FWPA 4GECA 4JVLA 2OD7A 3E5HA 1BHSA 3K1TA 3HR8A 3LY7A 3O0DA 1UJ2A 4JVMA 1MGOA 5FBWB 5SY6A 1BS2A 2C8JA 1TYCA 2PS9A 3FSGA 4P32A 3LF1A 3DCIA 3RS5A 3W6OA 3TN7A 5IKMA 3TW4A 5GIPE 1GVHA 1R9JA 2FGJA 4BNDA 5A71A 4LDNA 4NARA 5K51A 2P41A 3L8HA 4D43A 3ZWXA 1P19A 2IHNA 2Z5FA 3P0FA 5DLEA 1U9IA 5J4YA 4AAYA 3OQNA 4R1NA 1D4FA 2J3JA 2HPVA 1T2EA 1U8FO 3WAJA 5LZ7A 2EF1A 3D8BA 4FOPA 4ND8A 2QTTA 3QVMA 3MXTA 3S2GA 3WMFA 3X3HA 3ND6A 3BRWA 2ZRJA 1QFJA 2R2AA 4RH0A 4ZK2A 4R1OA 3DA8A 4AMYA 5AVQA 1XJCA 2BMJA 4H7JA 3ZE0B 4C76A 2BFFA 1RM5A 4FFSA 4R2MA 5I5EA 3H3FA 4IIJB 4M6WB 1EFPB 3H05A 3M1YA 4QOJA 3L8DA 3ISJA 4B74A 1JALA 2MYPA 3AV3A 2B2CA 2FETA 2P4EA 3BWVA 3C16C 4HDSB 1ISIA 1E1CB 2YOGA 4EFLA 3PGJA 1Y3FE 2X8LA 4NOKA 5DLYA 2RI1A 2B0CA 3MCVA 1LI4A 3PICA 3TR0A 3H17A 4DLVA 4FYKA 3NVKI 1HM5A 1IBLB 2XGJA 1RHMA 5ALEA 3LQQA 4ZT4A 1E9BA 1BFKA 1M34B 3ZHQA 3IDOA 1JLLA 3HJUA 4B73A 1Z73A 1P80A 3DGEC 1OWPA 1EP9A 3RIYA 4D4KA 4MARA 3Q8KA 2IBSA 3ROEA 4R2HA 1Y42X 5EXPA 3ZHTA 1N0IA 2AMLA 3Q9LA 3CU5A 2GHQA 4KIFA 2AF4C 4M46A 3LYLA 2IUFA 3FRJA 5KHAA 3TPCA 2AB0A 4URYR 2JGDA 3F6PA 1E4OA 3KEFA 2FPSA 5IKPA 2OBMA 1ND6A 1L5VA 3B6ZA 3AJ8A 3TXXA 2CKMA 4OBWA 5DOZA 1H9AA 1DCTA 1T3HA 4RTJA 3GWGA 3P2IA 4CE6A 3JRWA 4GO1A 8AT1A 4D8XA 4J1TC 1NSTA 3ICOA 4CN9A 5DOVA 1W19A 3ZKAA 1GT6A 1NBOA 1N2GA 4MUKA 4WOPA 2PD4A 4BMSA 1TLLA 1I2MA 1QB8A 2BM0A 3NVDA 3QXXA 3MFYA 4XJSA 5FPHA 1QRTA 13PKA 2ZBDA 1I14A 4YXFA 2V7VA 2F43B 4DSAA 1VB3A 2MCFA 2QD3A 1N75A 3EQ2A 3HFSA 4H0FA 4IKPA 4D25A 4QOSA 3DOCA 3D3NA 1Q57A 4JS0A 4O1MA 3A6HA 3A6PC 3IUSA 3RWOA 2E2WA 2I2AA 2NQ8A 3TKYA 3IMCA 4DKXA 4DR7B 2Q1SA 5B4VA 2PUCA 3G9XA 3KR2A 2CBXA 4RKWA 1E2HA 4MCHA 1H2FA 2WE8A 3BIJA 3L3BA 4BBAA 2VH1A 3GFPA 1VG0B 4YXWA 4BC0A 5LJIA 2YMLA 2DWPA 2CYCA 2R5FA 2VHWA 1R8XA 2EVWX 4WFKA 4TZTA 3MERA 3NJ8A 4N5LA 4G07A 5EJFA 1TXGA 5H4HA 3UGTA 3QWBA 3NAQA 2YMMA 3VU1A 2AMYA 1TQ6A 4EMTA 2E7ZA 3U16A 1F20A 3UQZA 1KIMA 4R8LA 1WZIA 2J6HA 1CQXA 1ECLA 4O5AA 2ATCA 4MUGA 1UZAA 4PYJA 2JLRA 2W4QA 4Y2XA 4IG4A 5GY7A 1HV8A 1RZVA 5C4MA 4YCBA 4FINA 2E0IA 3C8DA 4GPBA 2GXQA 2Q5CA 1DG3A 1VECA 1BDJA 3EXIB 3CBQA 3CX4A 1D8AA 1NMQA 2YWCA 4XLLA 1Z45A 3RRBA 3BZWA 3V55A 5K03A 3EXG1 1C3VA 2G4VA 4OD0A 4ZVQA 2JANA 2RONA 3FY4A 1ZMBA 1GU7A 1NVEA 1UBLS 2ID9A 4LHWA 4C88A 1VLLA 5ALZA 1Z29A 3ZU2A 3OMXA 1M75A 3F7MA 1WVIA 1XJQA 1FY2A 2C42A 1AB5A 3HCNA 1KDRA 4KP7A 4NE7A 1X14A 2WPDD 1TA4A 3GJSA 4GXNA 3U3RA 4EARA 3KZCA 2CW5A 4B5LA 4CUKA 5DSXA 2CF5A 1R0KA 2QE6A 1RU3A 4KGXA 3OWOA 2RBEA 5KTOA 4YJFB 1DELA 4DLXA 4KVAA 3OQMA 1HG0A 1V3VA 5CRIA 4W9NC 4EAQA 2ZZKA 1SQ0A 4G01B 4NBNA 4YJ2F 1P4SA 1EBBA 1TNDA 1WVGA 2JHCA 4UBIA 2F9FA 3TR6A 1C3JA 2FPMA 2ZW9A 4DFDA 1N36B 1A98A 1T6YA 1ZK2A 4YMVA 1GYRA 1PJLA 2O7VA 3EVBA 4EHHA 2ZI9A 5JY1A 1P4RA 4JUDX 2ZIUB 2QRZA 2VT2A 3K0HA 4WZZA 3S2EA 4E6PA 4TM7A 4KXWA 1E1NA 1NI4A 4C4PA 5IP5A 3V8QA 3MD0A 1IQUA 3DBRB 4ATNA 5LMZA 4NYMR 5EC8A 4F4HA 2BFPA 3SVTA 2J3IA 3NMUF 2A4MA 4LV6A 4X3OA 5ERYA 3ZDBA 2X2FA 3KPWA 3UMBA 3IIJA 2R60A 2C4KA 1F0KA 5JI2E 4EDFA 3L5OA 5IYZA 5EWMA 1KU6A 3AR6A 3IHLA 1QWOA 2VZLA 3LUAA 4IJUA 4LKRA 1N1MA 4QJ3A 4BLUA 4FMDF 2QZSA 4QYMA 4AJIA 3ZCRA 5IBCA 3D1LA 4HVLA 4NK4A 3ESQA 4DCMA 4FD3A 5G02A 2P4HX 3AEYA 5U1PA 1JTFA 1G6Q1 4M1TA 3V97A 4N0QA 3IYLW 3L1UA 3KX2A 3WLTA 4B1FA 5BSVA 1QHNA 4C7XA 4LG1A 1FMLA 4KPYA 2PXCA 1QV9A 3VHXB 2EDAA 3UEOA 5HHTA 1LQ2A 3C7KA 2AEEA 2C58A 2IYAA 1N9ZA 4M22A 5TRTA 2JFQA 2OENG 1MEJA 2J4CA 3BE6A 2DCUA 1ILWA 2G9VA 3KD2A 4W4TA 4WKNA 3ETHA 3JZIA 3RR2A 2RGBA 2YJTD 1OVMA 2VUIB 2ATEA 4BBPA 4N40A 5CW2A 3F8WA 5FR1A 3H3XA 3LCVB 3BF8A 1W2GA 1X7WB 4JT8A 4ZHQA 1N7GA 1OV4A 5FLXA 1YR1A 1PDWA 1ULAA 2P90A 4TV8B 4UMDA 5ARCA 5BR7A 2IGTA 2C2HA 4QQNA 4G89A 3LP6A 5JJIA 3ANTA 3BORA 1I2BA 5F76A 1SZPA 1C8KA