1RC8A

T4 polynucleotide kinase bound to 5'-gtcac-3' ssdna
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
301
structure length
289
Chain Sequence
MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELVKRNSKRGTKAVPIDVLRSMYKSMREYLGLPVYNGTPGKPKAVIFDVDGTLAKMTDVINPMVVELSKMYALMGYQIVVVSGRESGTKEDPTKYYRMTRKWVEDIAGVPLVMQCQREQGDTRKDDVVKEEIFWKHIAPHFDVKLAIDDRTQVVEMWRRIGVECWQVASGDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of DNA substrates by T4 bacteriophage polynucleotide kinase.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*TP*CP*AP*C)-3'
total genus 87
structure length 289
sequence length 301
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rc8A01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rc8A02
3K0CC 3QKSA 1SKYB 3EZ9A 4HATA 1EX6A 3VR4A 2UZIR 2EFGA 2PKEA 4FE3A 2O9JA 1HV8A 3DMNA 1DAEA 5KPDA 1W36C 1JUDA 1KIMA 4B47A 1AM4D 3CRMA 5B57C 4M1KA 3GLFE 2AX4A 3VQTA 1Q1BA 2D4HA 2QAGC 5ALKA 3CKLA 4OI1A 3KD3A 2A7QA 4HEJA 1NMXA 2JJ8A 5CLQA 1EXMA 5ALPA 3T06B 1W0KD 1F5SA 4ABYA 2RCNA 3V00A 2ZBGA 2A2ZA 3RAPR 2CE7A 3ND9A 4WXRA 1WBDA 1XWIA 3P26A 3WP0A 4C0BA 4CIDA 2Q9BA 4PQYA 3AVYA 2VP9A 1N0VC 4PZZA 3RS7A 4BNDA 5A3QA 1E6CA 4LYJA 4DSUA 4PPQA 5EXPA 3SYKA 3ONNA 2PL3A 4UM7A 1ZNWA 4JLBA 3B1YA 4QNMA 4IG4A 1NRJB 1G7TA 4RFVA 3WK7A 2ZI5A 4O25A 1NI3A 2R62A 1ZCAA 5AI9A 3AH8A 4EPXA 3HR8A 3WMEA 2YOFA 2Z4RA 3FFAA 3R7WB 5LDDC 4L5BA 5J4LA 3MMZA 1DAFA 2N46A 4JVLA 2YOGA 4H1WA 1WRBA 2YC4C 3EAQA 3NWJA 3TBKA 1N5LA 1QVAA 1QQ6A 2G88A 2C8LA 4BKMA 4HDOB 3VU9A 4N0DA 3SHQA 3CNOA 5JHGB 2QBYA 1EK2A 2A78A 3QGMA 2JEOA 2J7PD 4B71A 2QM7A 2KB0A 4JYCA 2F1IA 2P65A 2WIAA 5JRJA 4AKIA 4P31A 4DFDA 1E0SA 2ZJBA 1OFTA 1CR4A 4QFMA 4O2LA 4F92B 4BYGA 3FHOA 2BVNA 4X8MA 3GJ6A 1Z5UA 1U2RA 1U9IA 1FTSA 2ZSFA 2H18A 3ASZA 5BN4A 3PVSA 4IW3B 3RRYA 2FFAA 5EUMA 3W8NA 2CDNA 5AJWA 2JLUA 3SD7A 2CEAA 4O2RA 5AKYA 1YZUA 5IT5A 1L8QA 3WNDA 221PA 2G09A 1Z4QA 2HCBA 3DKVA 3L1UA 1W4RA 4N0EA 4F4CA 1Z22A 3C8UA 3LVRE 3Q72A 3DOEA 1J7KA 3EPRA 1N8NA 4FYPA 1XXHE 5DNYB 4HDCA 2YV5A 2ZU0C 4KU4A 3GLGB 4XVQA 2BEKA 3K0AA 5L8VA 4HAVA 5HR5A 2P6RA 1KO4A 1Q12A 2FUCA 2BMFA 4TLBA 5F2EA 5F9HA 2WF6A 1UKVY 1YHNA 1NBME 3NG1A 2EU8A 1XCPA 1QYIA 4RZ2A 3K1ZA 4F4JA 3THWA 3TSZA 1L8LA 3FMFA 5AKHA 4C4PA 5AW9A 4RCZA 3BJIC 4WIAA 1IN5A 4D0LB 3ICQB 2PQ0A 2IYRA 521PA 4TMWA 3MGCA 1B0UA 2HLDA 1ZUHA 4Q5IA 1UADA 3TRFA 3U3RA 2VP4A 2OLJA 4PSAA 2GA8A 4NABA 3F5FA 1Z4MA 3ZYCA 4RY2A 3BH6A 4FIDA 2XAUA 1LF5A 1KKLA 2ZSAA 2YKGA 5HTKA 3SHWA 1G1MA 3AVPA 1QQ5A 3U19A 1E9AA 2F3RA 2FV8A 1ZD2P 4MKGA 2MSDB 3SEAA 4DKXA 1I4LD 2F3TA 2ZYTX 2W11A 1A2BA 2P6NA 4PR0A 1I2DA 4BUJA 2H16A 4HGQA 1RLTA 2RGAA 3KQUA 2QAJA 1BOFA 2FZ4A 3EC2A 4M22A 1R7RA 1XMIA 2GF0A 4RD6A 4RD2A 4Y2VA 1IXSB 4EJSC 4NKRA 1H8ED 1YZLA 3QF4B 4EUNA 3B9BA 3EZ6A 3L0SA 4LGMA 3MCAA 1G3QA 2YHSA 4MYUA 1JECA 3ZS9A 4ZDIA 3SKYA 2E9SA 4B2LA 3U6KA 3OESA 2NO5A 1TA0A 4MRNA 3CX8A 4D4JA 3PUZA 2WWFA 2YVUA 3K0EA 3A1DA 5HE8A 1NBMD 5ALOA 3UM9A 4DCCA 1WP9A 3S1AB 3IKJA 2C88A 2WJVA 4BEJA 5A0FA 4UNSA 1ZM9A 4Q03A 1MRNA 4AURA 1W48A 3U2QA 4BZXA 2RAPA 2C9MA 2G0NA 1LS1A 4L6AA 1Z4JA 2YJ3A 1XTQA 1L2TA 3LBNA 2ZJ2A 4MITA 2GJ8A 3AF0A 1O3YA 2ZU6A 1M8PA 2HLDD 5AW5A 3SU8A 5AVVA 2ZI9A 3NBXX 2HYDA 4XJXA 1E98A 1SKYE 3AV0B 4QKQA 4L16A 2J0VA 2WSMA 3I4LA 3BS4A 2BIFA 4W5JA 2CL0X 5FUXA 4B73A 1DAGA 3ZVNA 3B1XA 5FR2A 2J59A 2R65A 4Q1DA 2HT1A 1AA9A 3BB4A 1NIJA 3H84A 4AYXA 1SHZA 3N8GA 2OUKA 2V6JA 4IKEA 3U44B 2FE4A 5ALEA 1US8A 3ZUPA 3DDCA 1G7SA 3UG6A 1XEFA 4UASA 2RGNC 1QRAA 3THXA 3GYGA 1MO5A 3IPXA 4HZUA 2XB2A 2QNRA 4KODA 3AB3A 2C98A 5JI3E 1XD8A 5FPHA 4PAQA 1T8TA 2HF8A 2Q3MA 1KY2A 2PLFA 4Z1MD 1S1MA 1D2EA 3EZFA 4YDSA 1WVIA 4J2TA 5DE3A 2VYFA 1GWNA 1GG2A 2XZPA 5FTLA 3TAHA 4C0JA 3U26A 3GMTA 3LW8A 4AIIA 4ON9A 1ZRMA 3OCWA 1DS6A 2IYZA 1FNNA 2O0KA 4EPRA 1DPFA 3DVLA 2ZS9A 3FM9A 1U7PA 5KU1A 3I76A 2EWWA 5TARA 5EQTA 5AKKA 3KOOA 4DT1B 2EVWX 3L43A 3WK6A 5JHHB 1Z4IA 1FNMA 5FOXA 4HUTA 2CL7X 1KZ7B 2H17A 4HUQA 2CFTA 3ICEA 1YQTA 3FPSA 5IT0A 4BFWA 1GITA 3LVQE 1CF4A 4XVRA 4KO8A 3A4NA 5KSPA 4JLDA 2F43A 4Y2YA 3DOFA 2W0SA 3OFND 2OCAA 3RVBA 1RPZA 2FSFA 2AKAB 1EFUA 1NG1A 3SJCA 3BWVA 4PPGA 1XEWX 5K8LA 2NYVA 4UNNA 2WMOB 3PUWA 4HAYA 4JVSB 3PUXA 2HDOA 4LZZA 4NHOA 4LBVA 2ZYWX 5GVRA 1T5TA 1OKKD 2NO0A 4FCTA 4QGGA 4Q4JA 5FOSA 2O0HA 4DEYA 1OH6A 1KSJA 4LJ4A 1DG3A 5CDFA 1D6JA 1VIYA 1Z47A 3A36A 1DARA 4BZPA 2OG2A 2RGXA 4BNDB 4AG5A 3K70B 3E81A 1F2TA 1RRFA 3AUXA 5KO2A 1Q1ZA 2WSSD 1L7OA 3A1CA 3AR5A 4UU1A 5TV2A 1T0JB 4NFLA 1TEVA 2OESA 3VKWA 4CDGA 1P6XA 4FWIB 3ZIAA 2ZOSA 5FOTA 3CX6A 2GBLA 1XXHA 1Z2AA 5CJPA 1TAGA 3UXMA 2CN1A 2IWRA 3LX8A 2F1RA 5KDLA 3KX2A 3P20A 4LWZA 2JLQA 4MKIA 1Z0JA 2ORVA 1SZPA 4OK3A 4R2HA 5DH9A 4AI6A 4OD0A 3LFUA 2JARA 2QEQA 3DM9B 3TH5A 2WBLC 3ZVMA 1KI7A 1M7BA 2IF2A 4HB4A 1M7GA 3QXHA 3TJZA 3PQCA 3K70C 1RDFA 3DKPA 2JA1A 2QMHA 2Z43A 3V9PA 2F7SA 4KFUA 1TJ5A 2ZRHA 2A5DA 1G6OA 1Z0AA 2XTZA 2QBYB 3LRPA 2FPSA 3KDSE 1T0HB 2O8FA 1G5TA 2O2XA 4A15A 1E1QA 4F91B 4NYJR 4OJQA 1TJ3A 1KI2A 2VP6A 3ED5A 4QGHA 4A2PA 2REBA 3KJHA 1QHIA 3A58B 3O8DA 3QKUA 1OXUA 2W83A 3I1YA 1Q44A 1TQDA 4ARZA 2QSZA 3WK9A 2ZVPX 5ALXA 4LJ7A 1OXTA 2IXGA 1HH4A 2ZJOA 4HGOA 4YLGA 1E79A 1JPJA 4PHGA 3U3OA 2WOJA 3PUVA 4GZMA 1MABB 2AFHE 2OBNA 3DM5A 1KO7A 3OIUA 2IA5A 4FMCF 4JS0A 1S8FA 3EWAA 1YRAA 2C96A 4D4MA 3AKYA 4Z1MA 4JLPA 5J4HA 1K6MA 2IYWA 1U0HC 2GF9A 2PCJA 3L0OA 4I1OA 5EE9A 3H2YA 3SFZA 1E96A 3ASYA 2N42A 4FMDB 3X2SA 3X1ZA 2WF9A 3B9PA 3OF5A 3P4XA 2ZVQX 4MA4A 6Q21A 3TGPA 4F72A 4YMTA 1GDDA 5AKEA 3RS2A 2N1BA 5G3YA 4DLUA 4PQFA 1K5GA 3OEED 4M1OA 2WZQA 2C4NA 5FTJA 3O47A 4PO9A 2W2TA 1E2LA 2DHRA 1KJZA 3EIQA 5KSZA 2BDTA 1OYWA 2CLSA 2AD1A 2BHRA 4NCIA 2HUPA 4UMDA 1YZNA 3EPKA 1XNJA 3S6JA 1XD2B 2PX0A 5EE5B 4KYUA 1AIPA 2WWXA 1N5JA 3SE0A 3BB1A 4Q47A 721PA 1ZM4A 3ZZ0A 4I4LA 4IDOA 3RC8A 1BIFA 4M8NE 2C5LA 2QYHA 4EKDA 4DCTA 5KDOA 4OCZA 1KI9A 3L8ZA 4AYWA 4JSYA 1XEXB 2GEVA 4PAMA 2WJIA 1ZS9A 3L8EA 1XBTA 3UG7A 4F7WA 1P9RA 3C5CA 4PX9A 4MRPA 2JLVA 1XB2A 5AK0A 4HB2A 3EARA 3B8HA 4D6PA 2HEIA 1T9HA 4QJ3A 2GDJA 4JYBA 1Q91A 3NASA 1DVRA 1II0A 2XGJA 4YIKA 2WPDD 4I1VA 4Q4HB 4DDUA 5DHAA 4TYWA 4BLOA 3FFBA 4BZQA 1NRWA 5EP1A 3Q3JB 3PITA 4Q1EA 4QJBA 1R2QA 4DLXA 2B1QA 1IN4A 3QOFA 4HLUA 4KX5A 3ZX4A 3LA6A 2ZXEA 4OHVA 5AM0A 1SVOA 1SULA 1T6NA 4DIEA 2VF8A 3TSOA 2FEAA 4D2IA 5AM5A 4MUBA 1JEEA 4UKDA 5KNBA 1NJFA 3GJ5A 5ALRA 4BX2A 1XTIA 3CBQA 5B2ZA 3VAAA 2RH5A 3THYA 2FOLA 4JLMA 2PBRA 3ZX5A 3EC1A 4IEEA 3OE7A 3EWIA 4ZKEA 1KY3A 4A6XA 2QP4A 4D81A 4EQ6B 4Q9LA 4XSGA 2G83A 4C3ZA 1AKEA 3L8GA 4G5OA 3RSLA 1NVUQ 4TZ0A 3HYRA 3Q5EA 1G4AE 2V7QA 4ZDWA 4GP6A 4KJZA 4DDWA 4F93B 3SQWA 3KB1A 3HPQA 2LKDA 4A82A 5A5GA 2HX1A 1N3BA 1P2VA 1T3SA 3J81k 4IOLA 3U4QA 2WWIA 5AM4A 1XP8A 3LDAA 1E32A 5LPNA 3EPLA 2O8CA 1G64A 3VNVA 2D74A 5FI1B 5ALZA 2G80A 4POAA 3VX4A 1IOZA 2KBFA 4DEXA 1JEDA 1SXJC 1E3MA 3NUQA 1UF9A 5ALUA 4BLPA 4MYTA 1AGPA 3C4JA 3IBGA 5G41A 4IJMA 5KTYA 3B60A 4ASUD 1NN0A 4BECA 1II8A 1PUIA 4HI0E 2OZEA 4A2WA 4B3BA 2QMUA 1G16A 3NIBA 2AUTA 1LTQA 1AS2A 1Q1QA 3C15C 4MRRA 4EX6A 1UM8A 5CB8A 2QM8A 1S1CA 1G7RA 2QY9A 3KXLA 4QHSA 2DQSA 3K0FA 3AGQA 4TMTA 3QU5A 2GBLC 3K1JA 1MKYA 3EZ7A 1W4BA 4JLKA 4CEIA 3TNFA 4R7ZA 2Q4TA 3VR3A 4XTRA 1SXJB 4LHXA 3LAWA 5AI5A 3RYTC 1X42A 2QMEA 1W36B 3L8FA 3GLHB 2DY1A 2ZJ5A 1HE8B 3CO5A 4P3YA 2OBLA 2VHJA 2J9RA 3L8YA 4G63A 5AKLA 3K9LA 4MQBA 2R8ZA 3N70A 4M9QA 2YBDA 3U7GA 3QLEA 1CJMA 1OFHA 2PT5A 3ADDA 3PFIA 1OFIA 1Q92A 5CYOA 2R6DA 5A3RA 3KKPA 2ERXA 1Q57A 4LPSA 2O8BA 1I4DD 3WMFA 1N0UA 4RKFA 4B3FX 2BKUA 3KFXA 2GEDA 4BPBA 3OIWA 4PHTA 4XWAA 4MDEA 4ZIRB 2Z0MA 3D7MA 1YS9A 1X8JA 2C9CA 2FFHA 3WBKA 1TX4B 1RQNA 2ZUCA 1MOZA 1YE8A 1X86B 3FHCB 1W1WA 3LX5A 5E7IA 2NO1A 1HYQA 2D2FA 2VL7A 2OA0A 4KAXA 4GNKA 1E2KA 3TW8B 4CYMA 1IM2A 1F2UA 4MGIR 2ZITA 4YC7A 3QENA 2VTKA 1AKYA 3FYHA 5AJVB 3OAAD 1JNYA 1S9HA 1OKKA 1S9DA 1ZIPA 4JLVA 4X8OA 1CJVC 1HY3A 2GESA 4IDPA 4ITRC 1ZYUA 3IIMA 4A9AA 4BASA 2FZLA 2GJSA 3KZ1E 4MKHA 1CRPA 2G1AA 1A7JA 1E2DA 2CCJA 1G18A 4JT2A 3EX7C 4P0TA 1E0JA 2YYZA 4KFRA 1VYTA 4BRUA 1YV9A 5FTNA 2PZEA 2Q9AA 3W5BA 1G19A 2AR7A 2DFTA 2WHEA 1G21E 3AKDA 5ALVA 5BN5A 1OH7A 3NHBA 2VH5R 3QG1A 2B21A 3W5CA 3HWSA 3W5JA 3BFKA 3I1FA 2JAUA 2J0UA 4Y2SA 2ZIAA 4TL9A 1Z06A 2QN6A 3FKSA 2XOKD 4JL5A 3QUQA 1M1YE 1VCNA 4KSBA 5AW6A 2IYEA 4LYAA 4ZDKA 2GJAA 2GCOA 4WW0A 1BS1A 1KMQA 3WYFA 4M21A 4KX3A 5IT4A 1Z28A 4IRUB 1PW5A 2FUEA 3KZXA 3FVVA 1PLJA 3LLUA 5A4JA 1LY1A 1YZQA 4M1TA 1FFHA 3TQCA 4EFMA 2W2XA 4HDQB 4GZLA 4PO8A 4JMPA 4QNRA 4XSHA 2YMLA 1BYUA 2ZE7A 4URXR 1SVIA 4BLQA 2EFDB 2ATVA 3KKOA 1L7MA 1GRNA 2GNOA 2QORA 3CZQA 3IUYA 1FUUA 2NPFA 3ZQJA 1C4OA 2QP3A 2RHDA 5BYKA 1Z4PX 3AM1A 4HLDA 4P4SB 1HTWA 2DCUA 1CJUC 2QLTA 2CJWB 4TSFA 3HR7A 1QHSA 2YZ2A 1JBKA 4Q1CA 4TMKA 4A8JA 1ZJ6A 1RKQA 5AKJA 1P9WA 2ORWA 3UMSA 2J7PA 2ODAA 2R44A 4B74A 2FA9A 2ZI4A 1KAGA 1U02A 5SZKB 3OCXA 4JBXA 4BEWA 4AKHA 3ECCA 1E2GA 2YJ5A 2R8YA 1JQJC 2JJ2A 2AH5A 3F3YA 1L4UA 2P3SA 1ZP6A 4II7A 3TKLA 3FHTA 3W90A 1KTVA 4OQFA 3ZVLA 1H8EA 3LNCA 4WVFA 4LJ9A 1GIAA 4G5SA 2EAUA 1ZD3A 2ZSDA 4YCNA 2GFHA 4ZKDA 4UM5A 3QPWA 3PGVA 3DPUA 1NVXQ 3VR2A 4XOIA 2FGJA 1XTSA 1E9DA 3KQNA 2V55B 4DLVA 1XD2A 1H65A 3QXSA 5FPTA 3C16C 3TUZC 2GXAA 1MRSA 3KFVA 4Q21A 4Q9HA 3V4FA 1TF7A 3ZDQA 2AMYA 2CHGA 4DLYA 2F9MA 4YH1A 3SFVA 5DI3B 5IHPA 3Q85A 1KK0A 4LV8B 2OCYC 5IF9A 4OI4A 1XRJA 4PZLA 4IFTA 3D6TB 1G3RA 1DADA 1W0KA 2RGEA 4OK5A 2F6RA 4OYHA 4Q4HA 3HP1A 1XTKA 2B0CA 4WZBE 4OQNA 1E2JA 1S4QA 4YXWD 2ZR9A 4F38A 2X8AA 4W7SA 1Z0DA 4UJ3A 2WJYA 2D2EA 1VJRA 5ALHA 3K9NA 2WIBA 3JZMA 4HSEA 1COWA 3M1YA 2JJ2D 2JJ1A 2CXXA 3OHMA 1HT2E 4B3GA 4BFUA 2ZTSA 3WKCA 1P7CA 3DEFA 4PFSA 1CR6A 2VEDA 3L0CA 1CXZA 5GJWC 1LB1B 4D82A 1FMLA 2EW1A 3FDIA 2NG1A 2C77A 4LHWA 1UBEA 3LW7A 4WZAE 4H1UA 2WJHA 2QG6A 5JI2E 1N9KA 1VG8A 2XZLA 1LF0A 4RVCA 3VHXA 3T1OA 2YMPA 2B8WA 2A5FA 2Y8EA 2B8EA 2ZRJA 1DBSA 1X3SA 2JLSA 2QRNA 3HU1A 3KXIA 3GLGA 5SZJA 1OIVA 5AK4A 2CMKA 3BB3A 4YMVA 3GLIB 2ORIA 2AXPA 3AF3A 1NY6A 3A37A 1G6HA 4ZI2A 5BN3A 3W5AA 2O52A 2EYUA 3VR6A 4FN5A 4UARA 1DEKA 4D0GA 1VYVA 2ODBA 4DJTA 5JS8A 4GIBA 1UJ2A 2WPDA 4XVUA 3BH0A 5IK2D 5JRZA 2YJ6A 3CPHA 3CPEA 3THWB 1KKMA 1SHKA 4DLRA 3FMPB 5H1YA 2D62A 1EK0A 2RAVA 1TQ2A 1M2OB 4HZUB 5ELXA 3B1ZA 2IYYA 5B30A 2V9PA 3K0FB 1U81A 1DG1G 1P72A 1WBBA 4EPVA 4CEIB 1KI6A 2D2VA 3FMOB 4DWOA 2X19A 4MGKR 4CEJA 3ZLJA 1RKVA 1O08A 4QL3A 1SVLA 4I9FA 3H86A 3NTUA 2HSZA 1VTKA 4Q9JA 5FBQB 4V0ME 2WV9A 4LHYA 2IF0A 4NYMR 3R4CA 1XTJA 2FNAA 4CEHB 3L5KA 4UQOA 3IB6A 3NBYC 1OIXA 2J7KA 5AWFC 4EPYA 1CLUA 4HUQB 4ZDJA 3KQKA 2O8BB 2CVHA 1UAAA 1SVWA 3C7KA 4LCBA 2OBMA 3MWLA 3QUCA 2UKDA 3QPUA 4ZI3A 2PMKA 5EUQB 3DO6A 3W3AA 4TQUS 1Z6AA 2QI9C 3AGPA 1GM5A 4OFZA 1UPTA 1E9FA 2ANCA 4LBZA 2BBTA 4RZ3A 3G82C 2QQ0A 4Q1BA 3VKHA 3QNMA 2X2FA 2G0TA 1ZINA 3K8YA 4KHZA 2FH5B 2FSHA 1W0JD 2I55A 2R8XA 3DV9A 3U6BA 5AK6A 4BFSA 1VYUA 5AKZA 5AKIA 2W00A 3NVAA 4LC0A 1NN1A 2NOAA 5HE9A 5LBIA 3AR2A 1N5KA 4F71A 4A36A 2ZYUX 1E9RA 1DTSA 5JSZA 4DW8A 1CULC 4QHYA 4V0KA 4CGZA 5LB2A 5EP2A 2C2HA 4GFDA 1W5TA 4G5QA 4HAWA 1XZQA 1YKSA 3WYAA 3K70D 3GPLA 5ALQA 5AVZA 2OM2A 3WKBA 4C7OB 2B82A 3PUYA 4HGPA 4QBFA 5BQ5A 3OEHA 1RMQA 1YNSA 2OILA 1CR2A 1JALA 4FD2A 2AKYA 4I99A 3RS0A 4D25A 1NP6A 2JDIA 2J0UB 1XPOA 2BKEA 1PUJA 4CW7A 4EDHA 4UMVA 2IYQA 2GRJA 1KJYA 121PA 3IHWA 2WSSA 4L57A 4G01B 2W6IA 4US1R 5FUVA 3EASA 4MGYR 4AYTA 2ZJYA 2ZYVX 1Z4KA 3CRVA 5JEEA 3KBBA 4TL7A 3EWSA 1Z0IA 3CNLA 1A5TA 2QRZA 3NAMA 3K9GA 3MJHA 2IS2A 5B64A 2ZRKA 4AKEA 2WWGA 3UMCA 1R0WA 5IS2A 4I9GA 1P2TA 3L0BA 4OHFA 1RMTA 4BFXA 2NQ2C 1VCMA 5EXTA 4A0HA 4W5HA 3MSXA 1XDBA 2V6IA 1JXOA 2A5JA 1E2NA 2XNDD 2ZJAA 3BWDD 1B23P 2FI1A 1Z5GA 2GCPA 3KKNA 3QXXA 4PQRA 4TLEA 3C5HA 4BFZA 3I5YA 1VFPA 1KHTA 3DMDA 4LPKA 4NU0A 2BEJA 2YWFA 1KSFX 1R8QA 3S1AA 1EX7A 3GFPA 4ZCIA 2WWHA 4DUGD 5CIWA 1ZOLA 2Q4RA 5FPSA 3ZTYA 4LI0A 1Z83A 2W58A 2ZE5A 3M4YA 2IYTA 2GHIA 3X1DA 5FBVB 621PA 1VIAA 4LSGA 4AWXA 3JVVA 4NCKA 1ZD5A 4A6PA 4PTLA 2GAAA 4ZCMA 3AR6A 4R98A 5K8TA 3QVVA 5TDHA 2CFRA 3SHFA 3VMFA 4PANA 1E2FA 1IY0A 1ODFA 1Z0FA 5D3MA 5FPYA 3ZQ6A 5JZVA 2ZE6A 3P1JA 4YONB 3CPJB 3WKAA 3SQXA 1NVVQ 3LBHA 3SI7A 2I34A 1JAHA 3IO5A 3GLHE 2YJ4A 4EELA 4Q7KA 3T12A 1A2KC 4UU0A 1FPMA 4RETA 3ADKA 3TUJC 3THXB 5AW8A 3UWOA 2F9LA 1E99A 4FCVA 4WA7A 2XJ4A 1C1YA 1HEIA 2FGKA 3TIFA 3TLXA 2W6ID 3REFA 3FGOA 3ZWKA 3A1UA 3MUFA 4AKGA 4S2EA 1U90A 2RB5A 2DPXA 5H8WA 2ZRLA 1KO8A 1NIPA 2OFWA 1D9ZA 2IHYA 2IXFA 2FN4A 2KJQA 4A4DA 4TYPA 2X4DA 3H4MA 1DAMA 5DI3A 1ELOA 4LJ8A 3EW9A 2DBYA 1G3IA 1TTTA 2WICA 2E1RA 3ZI4A 1Q21A 3OZXA 2PEZA 4PC2A 2WJGA 3BE4A 1ZC3A 4Q18A 3SN6A 3IQWA 5TVKA 3QSYA 1KGDA 3THOA 4U5XA 3GJ4A 1U2SA 3CZPA 2CFSA 5E7MA 3BA6A 1XFAA 1AK2A 2NO7A 3AVTA 1S2OA 1XPUA 2ATXA 1AN0A 4M9SA 5DN6D 1FZQA 1K5DA 1M34E 2IYUA 1HE1C 3RS5A 3QPVA 3B1WA 4KVAA 5CITA 3SDZA 2Q3HA 4DXAA 2AHOA 4DC9A 4AC9A 4KNVA 2ZI6A 2PMDA 1KNQA 2QMOA 3Q8XB 5BXQC 4LBWA 3LO5A 1AJEA 2IYLD 2JJ1D 5F9FA 4GMXA 1HQYE 1OIWA 3K0SA 1YR6A 2V54A 3RABA 4E5UA 1SU4A 4V0LA 4UMEA 2HOQA 1DAIA 2HO4A 1MABA 3A1WA 2J3EA 1QHYA 4NE2A 4D26A 4LC1A 4JBWA 1N6RA 4G1UC 4PPFA 4Z8XA 4BGDA 3ZTWA 4A0RA 4BEVA 5JJBA 2WWWA 3E1SA 5JMTA 2DWPA 3P32A 2FPMA 1MT0A 2FJUA 1TPZA 2ZJ8A 2GEUA 4AS3A 1JPNA 1BKDR 2J87A 4AY2A 1VHLA 4Q1FA 1VKJA 2RMKA 3G0HA 2LKCA 3QUSA 2DB3A 4M53A 2W43A 3GLGE 2P5SA 3VFDA 3GLIA 3BD9A 2JDID 1V5WA 5ANRB 2W0MA 2O8CB 2EATA 4NV0A 3R8FA 2FFBA 3M1IA 4RESA 2GK7A 1BO6A 1R0YA 2FEOA 4YQFA 4UATA 1VECA 2VP0A 3ZD6A 3D8BA 1PZNA 1VG9B 2ANBA 4MYHA 5ALMA 3RRNA 3A4LA 1F3OA 4CZ2A 2P27A 2YWGA 3AEZA 4QM7A 3WRXC 4DDVA 4EPTA 4KITB 4C2UA 2FU5C 2ZI3A 4HYTA 2IHBA 4FI3C 4PZYA 3UMGA 3WGVA 3RLFA 1W46A 2A5GA 1ZD4A 3R9KA 3GJ0A 2BCGY 2C8KA 1TU4A 4QBIA 3SLRA 1WF3A 1OJLA 1LS6A 5AM3A 2A30A 4JJZA 2AXNA 1KK2A 1KI6B 4B43A 4C4SA 2WHXA 1L7NA 3SOPA 4R71A 5EE0A 2AWOA 2ZRNA 3QBVA 4ARZB 2ZBFA 4B33A 3FZQA 1RRGA 3UATA 4WAUA 4Q4AA 3EPJA 2B92A 2IK8A 3PENA 1WCV1 3QY0A 5DGXA 4DRZA 3B2EA 3LXRA 5SZHB 2BDUA 1EGAA 4BE7B 1J70A 2BC9A 3BGWA 5DLQC 1SWWA 1FUKA 1TEXA 1AGRA 2IOFA 4ASUA 3CRQA 2YN4A 2NO6A 1V43A 4CF7A 3E5HA 1IY2A 1GNPA 4JDPA 1RRPA 5L3RA 1Z0KA 2I33A 5E7JA 1E9BA 5GVSA 3J7TA 3SF0A 3EIHA 5E4FA 3UWKA 3PG5A 4EIWA 2O8EB 4Q4LA 2P11A 1CKEA 4NAVA 2HYIC 4CF4A 5L3QB 2PH1A 2VA8A 4KV9A 1P3JA 2XNSA 5FOUA 3TSWA 2CK3D 4LDJA 4M1MA 1F2UB 5L3SB 3FE2A 1NF2A 1YDFA 1TF5A 3AVXA 3SS8A 1TADA 2FPXA 1N6LA 4HAZA 5FBLB 4EEKA 2OXRA 3BC1A 5D3QA 3MRSA 4Q7JB 2ZS8A 4MUMA 4M4SA 1NKTA 1U7OA 5GADl 4NZYA 4PNHA 3GJ3A 4TWZA 5DYGA 2PEYA 1E9CA 1Z6XA 3BAFA 1G4UR 3MPOA 1XEWY 4HLUC 1OHHA 4NDZA 2OBBA 3OCVA 1JR3A 1XEXA 4LUCA 3V4RA 1E79D 1MR3F 4C7OA 1E1QD 4MKFA 3KKQA 2MMGA 2Q21A 4Q7LA 2HV8A 1Q22A 2WF7A 3QU4A 3GLFA 5CLLA 3EXAA 4IVPA 4B3XA 1ESNA 1OH5A 1J97A 3EF1A 1UFQA 3N2IA 1II8B 1Y3AA 1E1RD 3LD9A 3QEOA 5JBQA 2AD5A 2GCOB 3QUTA 1L6RA 1VPLA 2V8OA 1R5NA 4KLNA 4TN1A 1XZPA 2DWQA 1IQPA 3BFVA 3AP1A 3MFYA 4XH9B 3I5XA 4A0FA 3A6PC 2NMVA 2ZBDA 4ILEA 2DWOA 1DAKA 2WAYA 3T15A 1JB1A 3OAAA 4Y2XA 1CRQA 2TMKA 5C18A 5B58C 3I61A 1OH8A 2EYQA 4GRAA 5GJBA 2B8TA 2XTNA 3AVQA 2IT1A 4Y2QA 3SC3A 3O8RA 2GVDC 4PC7A 2QQEA 1P75A 2CJWA 1N25A 3IGFA 3KKMA 5EJEA 3OTQA 1RW4A 1VCOA 2WMNB 3WGUA 1E2QA 3PDWA 1ZD1A 4TQ9A 3CW2A 3TLMA 2EFEB 2GKSA 4P32A 3ET4A 4KNWA 1LV7A 3NDBB 1KDOA 1JI0A 1SGWA 4DDTA 3C14C 2MU1A 1HT1E 2IUSA 1PV4A 1IAQA 2OSBA 2UVQA 1S0UA 1PLLA 4OBEA 2I6XA 2X77A 1JJ7A 1TQ4A 1IXRC 5ALJA 5JFGA 4L4UA 3CX7A 2MSEB 4KXFB 5AVQA 2D06A 1BH2A 3NXSA 1U9IC 3C41J 1Q1EA 1SVSA 4PO1A 3A3YA 4GT1A 3FB4A 2IC5A 3CUEF 2ZS7A 4NYMQ 1TQ6A 3IJ5A 4YCLA 3CRW1 1JR3D 4RCYA 5D3MB 3Q7PA 5TB5A 4LJ5A 4CVNA 4HZIA 3QI2A 1CEEA 1T8UA 4B3DA 4AP9A 3F8TA 4PHFA 4KYIB 1CR1A 1DELA 2ZRDA 3GCGA 4GSYA 3SYNA 3NDPA 1RIFA 1WB9A 4DCSA 1ESMA 2ZRAA 4G5RA 4BWYA 4OQLA 3NRJA 4QJ5A 5AKXA 2IYSA 4C0LA 5AVTA 2O5VA 3F0TA 1KDTA 4UXJA 1XTRA 1N6PA 1EFCA 3QKRA 1T5SA 1NLZA 1UDWA 2YMQA 4KBGA 3R9XA 5CJ2A 3B78A 1TUEA 2V4ZA 1RMYA 1KNXA 2D7CA 4Q1AA 4UAVA 4N3NA 4D4LA 3LXXA 3PV0A 4C0QC 1SXJE 1XJ0A 1FW6A 3A8TA 4XWOA 1IN7A 4G9BA 1FQKA 1KZGB 4KI0A 1YZKA 1ZNYA 1Z29A 3KXKA 2QSYA 5EXSA 1VMAA 3LWNA 1W2HA 2RGCA 1U8YA 2OFXA 2JATA 1YR8A 2BBSA 3GFOA 2QT0A 5UKDA 2BWJA 1R6BX 3QU9A 4K8OA 3PIRA 3AVOA 1EG7A 4JJKA 4Q02A 1U0LA 2QTHA 4ZIRA 2GO7A 2PR7A 1T91A 1GILA 1E69A 4CT5A 5J4KA 2WF5A 2O0JA 5FR1A 4NWIA 4TYNA 2VHTA 5AJXA 2ZSBA 3ND8A 1R8SA 4PC1A 2IUUA 4A92A 2ONKA 1NNLA 1N2CE 1FL9A 3NKVA 2NO9A 4F4IA 1S3SA 2IUTA 2HHLA 4GL2A 3UPUA 1JAIA 1WDTA 4H9GA 4W9MC 2IS4A 2ZRGA 5AW7A 3MJRA 2GHQA 1RE0A 1IY1A 1NBMA 4ZPXA 2JGAA 1R10A 5J40A 3KUCA 4ESVA 1KMHB 1QHHA 2JCSA 4LY6A 1H8HA 3KQLA 1ZM7A 2KI5A 3GEHA 4RJLA 3AVVA 1A4RA 4XD7D 1RC8A 2YINC 1P2SA 2FMXA 4B34A 1FQJA 1TNDA 1OXVA 4URWR 3NC1C 1NKSA 2P9JA 1T5IA 2OE2A 5JLJA 1WXQA 2I1VB 1KOFA 1W4AA 3RF6A 3I8SA 4A2QA 4US0R 5AHXA 3ESQA 1G41A 5P21A 1OT3A 1N6NA 4QOSA 4BRWA 1CIPA 3AVUA 2HXSA 4LYFA 1G9XA 4NTZA 5J4YA 5FH9A 3BH7A 4QXAA 1WZCA 5AI4A 1EFRA 3WYGA 2W6JA 2NZ8A 3UMFA 2IX3A 3BERA 3MWJA 4B2PA 1GZSA 1U0JA 3K09C 2BDEA 5J4VA 3SJZA 4S35A 4ZEWA 2H92A 3EZ2A 2CNWA 3FGNA 5J47A 1JXMA 2YWEA 2WJJA 2IEYA 3MMPA 4HAUA 4P4SA 4IDHA 4RSGA 3HDTA 1QG4A 2BM0A 4ERNA 3BRWD 4A8JB 2Q6TA 2DFLA 4K81B 2GZDA 4MUAA 1G8GA 1ANKA 3NALA 1OXSC 3FKQA 4ZCLA 2QTFA 3KTAA 3ET5A 4TQAA 3VR1A 4DSTA 1GTVA 4E09A 5IK2A 1KO1A 2GZHA 2YC2C 4D4KA 2CLCX 4URZR 1U8AA 2GTPA 1ZBDA 2JIZA 2YMMA 1L7VC 5CK4A 4LRWA 1EFTA 3AF4A 3IDQA 4HAIA 1UEIA 3TVDA 3MAAC 3ZZUA 4P4UA 3AQ4A 4DCUA 1OF1A 3DNPA 2FG5A 4G0NA 3W6NA 3U3MA 1FX0B 5DISB 2VF7A 4TL6A 1Z4LA 2G1KA 4US2R 3QF7A 4FCWA 2PZGA 5AVWA 2IS1A 5G53C 1XJCA 5JECA 2BJVA 3ADCA 3WMGA 4TMVA 4DSOA 1E2MA 2WF8A 3NBZC 1F60A 4EZEA 1CQZA 1WE2A 1U99A 4LBYA 4DBLC 4LJYA 3E70C 1TMKA 4NPHA 2QAGA 1NJGA 3I28A 1X1RA 1UKEA 2RBKA 3Q9LA 4QC2A 4C30A 2BMJA 4XTCS 5AUQA 5AI0A 5AK5A 4L15A 4N1AA 2BCJQ 3KUDA 1KDPA 2ASEA 2R6GA 5AVXA 3D3QA 2OFOA 4NH0A 4B3CA 1XVIA 3SJBA 4NYJQ 2BV3A 4DWJA 1LVHA 1G17A 1M7HA 3NEJA 3T1TA 3N5CA 4OQXA 3GLFB 4DB2A 2KE5A 2HF2A 5KUTA 3KC2A 5DYIA 2ZANA 3CNHA 1K1EA 3GEEA 1XCMA 4FMBB 4TL8A 5AW0A 3Q7QA 3NHAA 2A3RA 4EAQA 4XE5A 1GVNB 2IBMA 3AF1A 1IWOA 3QKTA 4HGRA 4MRVA 2Z83A 3VR5A 4DZZA 2CCGA 2VQSA 1ZW6A 2ZRFA 5DI9A 1E2EA 2NO4A 1MO6A 3IILA 4YCMA 3WNBA 5CK5A 2GK6A 1QBKC 3CR8A 3P27A 2GETA 1W5SA 2Z5FA 4CEJB 1W44A 2CK3A 2WM9B 5HCIA 4TLAA 3E58A 2R6CA 5HCNA 3WKDA 3OPXA 1G5PA 5EP3A 1HUQA 2A9KA 1OV4A 5EZ5A 1DAHA 2FEMA 2I4IA 3WP1B 4YIHA 3W8RA 5AUNB 3AR3A 4QGFA 1NL3A 3A1VA 1D2NA 5FOVA 4RKEA 4OHWA 2ZI7A 1SVKA 3B82A 4CEHA 4NYIQ 2NZJA 4GOXA 3SJAA 2G07A 2PJRA 1WR8A 3K09A 3RHFA 1MO3A 4M1SA 1JQLB 1UBGA 3OIYA 3QKSB 3KQHA 3A1TA 1UKZA 3LLMA 1M74A 4JIMA 3RFUA 3DZDA 3IO3A 4B76A 2R2AA 3U60B 4EX7A 2J46A 3N5KA 1OSNA 4M2LA 2FFQA 3WNCA 1CBUA 4JKYA 1KK3A 5EXXA 3PEYA 1G7CA 1RYFA 2C78A 4M9XA 2AK3A 1VDZA 5FL7D 3TR5A 3L8HA 3N2EA 3SR0A 2FDRA 1QQ7A 5AVUA 1U94A 1E9SA 5AJYA 3SZRA 2CHQA 3ZH9B 2I7DA 4LK2A 1ZAKA 1E2IA 1XJQA 4XOUA 3U7EB 1KYTA 3QU2A 3DZ8A 2HCJB 1MH1A 3PCTA 1F6BA 1Q3TA 5ALLA 1N6IA 3WRYC 2OV2A 5JSZB 5LB4A 1XMVA 5JJIA 3K0CA 5TXGA 3O8CA 2G77B 2XJ9A 2ZAOA 5CM9C 3BFXA 3CZ4A 1R0ZA 2EFHB 1UBCA 3DHWC 3LQRA 4LJAA 4C0AC 4M9ZA 4DHEA 2GJ9A 4JVNA 2ODNA 2ZRBA 5K8UA 2B1RA 4AS2A 1ZVQA 4UMFA 1G20E 4MH0R 3ZIAD 1Z5ZA 1KJWA 4RFSB 2BOVA 3UMRA 4OHZA 1DE0A 1FMJA 1W0JA 4H1VA 5GJVC 3HLTA 3G5UA 3AKEA 3QUBA 3GD7A 4LHVA 3SBDA 4IOKA 4FINA 1ZIOA 2VSFA 2WTUA 4ZO4A 1KO5A 1YRBA 3QEJA 821PA 1PJRA 1ZCBA 2JLRA 4FMCB 2B7BA 1BMFD 3QXCA 4IDQA 1QVRA 2WKQA 2K5UA 1YZGA 3W5DA 3U13A 2CE2X 1OW3B 1G8PA 1GKUB 4GMDA 5F98A 5HKKD 3X1WA 1Z08A 3MWYW 4JLOA 1X8KA 5J5CA 2XXAB 3PEUA 5AVRA 4Y2TA 2ZETA 3FPAA 3OE7D 4BX0A 1ZD9A 4AG6A 4A0GA 4IVQA 4C9BA 1SXJD 1QHHB 4AK9A 1A82A 3I8XA 2B8JA 4K46A 2BMEA 3QQ5A 4NBSA 3DAOA 3T1VA 4FWTA 2C9YA 4KVGA 3W6OA 2RB4A 2XX3A 2R6FA 2YJTD 3B6EA 2A5YB 4IEIA 4MYCA 3SYLA 3UIEA 3WHKA 2DFKB 2ZJZA 4EENA 2IYVA 2VPPA 4QG7A 1NVWQ 4JLNA 1QHGA 3CR7A 5DN6A 4HYYA 1Z88A 3TQFA 5ALIA 5DIFA 3AKCA 2J1LA 5GJCA 4C4TA 1EFHA 2E87A 1P2UA 4Q48A 4RD0A 3KDPA 1FOEB 4YDHB 2JLWA 5FTMA 1RKBA 3TK1A 4XPZA 3WKEA 2FDCA 3L0PA 1AQYA 4U02A 4URUR 4KSCA 3RWMB 1JR6A 3NIWA 1CR0A 1F48A 1Y63A 3AF2A 5FOWA 3BOSA 1J8MF 3OCYA 1KI3A 3H1TA 4Y2JA 4C0SA 4E07A 4L8GA 3Q5DA 1SKQA 2VHCA 4Q19A 4RZXA 2WM8A 1G8YA 4B6JA 3CM0A 4BLRA 2JAOA 2JAWA 4XIGS 2GMWA 3GFTA 3MG9A 4HAXA 3P96A 2ZRIA 1Z4NA 1SQ5A 1Z63A 2J45A 4CT4B 1QDEA 4FXPA 5ALFA 3WXMA 2XEXA 4WZ6A 3CWQA 4Q4AB 5FTKA 1XU4A 2SHKA 2J0SA 5F3WB 1X1SA 2J41A 5IDVA 2IOHA 1H8HD 1GSIA 5DO9A 4XD7A 2NIPA 3SNHA 3X1YA 1EWQA 3EA5A 2AGVA 1ZUIA 1IJFA 2ONJA 1PLKA 4GBMA 3M9LA 4Q9KA 3MLEA 3OEHD 4BBJA 1NMZA 1TL7C 3B85A 3IEVA 3FTQA 2ZUDA 5FP0A 3CF6R 2O8EA 2O8DA 2IOFK 2ECKA 1ZMXA 4DSNA 2JIZD 2IS6A 1P60A 1XMSA 3QNUA 2H8KA 4Q66C 2V3CC 1AQ6A 2REOA 2QE7D 4G3XA 4Q9IA 5L3QA 2FPRA 1XCGB 3FVQA 1FX0A 1SVMA 2ZROA 1VG1A 5L3SA 4RD1A 4C0HA 1LW7A 2C9OA 3K53A 4O3MA 3O8BA 2I54A 3IPYA 3ETLA 4EFLA 1CJKC 3L0YA 3WY9A 1YU9A 4X8LA 1IJEA 1NNEA 1RLMA 4CF5A 1Q20A 3B1VA 4ACAA 5BW8A 3P4YA 2RGGA 2RKOA 1RVDA 3PR1A 2YY6A 3QU7A 3RNLA 2XNDA 2QAGB 3GJXC 4PSKA 4WOPA 3MN1A 1P62B 2HXYA 5FI0B 1RKUA 2ODWA 5M04A 3GP8A 2GJKA 4ACBA 3A4MA 1II9A 2L0XA 3QBTA 5FL3A 1NLFA 3RS3A 4TLCA 2BBOA 2ODEA 1NF3A 2ZEJA 1S2MA 3KJGA 3RRMA 4LX0A 2WFAA 2GILA 1OXXK 2WAXA 2YNMA 2QPOA 4P4TA 5AUOB 2IWHA 4D0NA 2FX3A 4LHZA 4LOAA 1HQCA 3E84A 3I73A 5AKGA 3OIVA 3VU9B 4OL0A 2ZG6A 2QPAA 4LV6A 3AR4A 2CVFA 2ZR0A 2VLIA 5C2JB 4CF3A 1R0XA 2G3YA 2MSNA 1YVDA 3CH5A 3EA0A 3RSOA 3L1VA 1UKYA 4M0LA 4GOJA 1U98A 2CL6X 3B7GA 4QRHA 3X1XA 4JZKA 5CB6A 3JZAA 3HYCA 2B7CA 4B2IA 2OT3B 1J2JA 1NSFA 2HT6A 1GL9B 3W34A 4XWKA 3ADBA 1WMSA 2EFCB 1COWD 1E4VA 4GPTA 5FBRB 1YZTA 2JLZA 2G6BA 4L6CA 5EE1A 3T34A 4TT3D 4NYIR 2WWYA 5AW1A 4A1FA 4BX3A 4V0NA 1T4GA 1Z07A 1RZ3A 4IFBA 3UMBA 1GRRA 1LVGA 2YWHA 3NH9A 1ZC4A 1MO4A 3W9YA 4B48A 1S96A 2I3BA 4OK6A 3KL4A 1R4AA 1L7PA 1E1RA 1WA5A 2W2VA 4D80A 5JS7A 4MDFA 2QTVB 1R5OA 2P5TB 1Z8FA 1NMYA 2IL1A 4KFTA 3BORA 3L0IB 3K0AB 4KCGA 4OHXA 4C2TA 1EWRA 2F43B 1E4YA 2PJZA 3MWKA 3B9RA 3UANA 4PSVA 4Q00A 4TYYA 3L2OB 2IXEA 1Z2CA 4BFYA 2VHUA 4TLDA 3TAUA 3I6BA 1R5BA 2VIIA 1US8B 2RGDA 1KAOA 3ONWA 2XSZD 5FFMA 3PCRB 4B35A 4DCVA 3BIFA 2FWRA 3CIOA 5C4MA 4Q4JB 5KOYA 5EE3A 1QH9A 2B30A 3WK5A 1HURA 2F1HA 2HDNB 4E88A 3H0KA 5K8IA 1RJ9B 3GQBA 2C8VA 1ZM2A 3B5JA 4GP7A 4Q7MB 1CS4C 3GLIE 2QGNA 3U7HB 1T9ZA 3WK8A 5AVSA 4HB3A 2KSQA 3QKRB 4PXAA 5H70A 5ALTA 2Q9CA 4TZ6A 2ZRCA 4R2IA 3OEEA 3ZD7A 421PA 1S3GA 3F9RA 3N28A 2PX3A 5G3ZA 1KDRA 3R8CA 4DB4A 4HB0A 4WXPA 4CE6A 2OLKA 3ZVRA 2ZQ5A 2GZAA 2VP2A 3IIKA 3E2IA 4U7DA 1YJ5A 2EQBA 5ALGA 4B6FA 2NTYC 1P73A 4DT1A 8OHMA 3I92A 4IXMA 3CWZA 3UK6A 3CONA 3MC1A 2ZRPA 3ZWDA 2REXB 4QBGB 1JR3E 3LQQA 1YR9A 4Y0AA 4UNRA 1XMJA 3KJEA 1O03A 1T3LA 3ZJYA 3A1SA 2PZFA 4OJKA 1EFRD 1KI1A 1MV5A 2HJGA 4V03A 2O8FB 2W6JD 2P2LA 3QF4A 2GVZC 5LD2C 3ZGXA 1QG2A 3U3KA 2P67A 3IRUA 4Y2RA 2WVJA 4NL4H 3NC0C 3JVUA 1K8RA 1ZD8A 5AR1A 1AQUA 2F1JA 5AI6A 5ALNA 2OCBA 2VO1A 4CRWB 1VG0B 5AI8A 4L9SA 2JGNA 4QHTA 1GFIA 5JEDA 2JLXA 1BMFA 3AUYA 1VJ5A 4UW9A 5AW4A 1D9XA 2VP5A 4R9UC 1E2PA 3AP3A 1E94E 1IHUA 1N5IA 2QGZA 2XSZA 4EJSB 4LJ6A 4TSFD 3K9HA 2HEGA 4J0QA 3KB2A 5LD2B 4UJ5A 1F2TB 4V0OA 1D2MA 1NSTA 2CHVA 2F55A 3PGLA 4BQSA 3R09A 4ZEXA 3FWYA 4EPWA 4URVR 1G8HA 2FPUA 3QXGA 2BMDA 3I62A 3VAYA 3TW4A 4YMUA 5AIBA 1KYIA 3A1EA 4PPNA 2OYCA 2QA5A 5FUWA 3RRZA 1KI4A 4IVRA 1D8TA 2QL6A 4IDNA 1LFDB 2IYXA 5C1BA 1I2MA 1W2GA 2R8EA 1A1VA 2C04A 3B13B 1OPXA 3RANA 2BBWA 3IBYA 1UDXA 1NN5A 4FFDA 1ZRNA 4MGZR 4OI2A 1E0AA 3D6JA 5KPJA 4GDFA 4A8JC 1U2TA 5EZ6B 2V1XA 3ZZTA 2XZOA 2P0EA 1X8LA 4TTRA 4QM6A 3PJRA 3N1UA 1G3MA 1GAJA 1ZJJA 5C4GB 5A3SA 1IONA 1WQ1R 2AWNA 1GUAA 2FF7A 1CJTC 2LWIA 2Z4SA 4YMSA 2V7QD 1DO2A 2R6AA 5ALDA 1D5CA 4O0MA 4B75A 1EESA 4BLSA 3OFNA 5JWOA 4ESHA 1ZM3A 2ZRMA 1OE0A 2RGNA 4AD8A 3PEWA 3RWOA 3QIAA 3SMVA 4V02A 2G08A 2QT1A 4I81A 1ZRHA 3W3ZB 4X8HA 1N6OA 1KK1A 2VKQA 2DR3A 2ZM5A 5AM2A 1NN3A 4RZUA 1TUIA 5FUYA 2QROA 2VRWA 4PC6A 5KYKA 3VKGA 2ZPTX 4NP6A 4P33A 3WBJA 1FEZA 2GXQA 1XP5A 1OYYA 4GI7A 1O87A 4BFTA 3SBEA 1UBFA 5EP4A 2J0QA 2OO7A 1XPJA 4DLZA 1PVOA 2BY4A 2HCFA 2JASA 1W49A 1RLOA 2O8DB 2H5EA 2CCKA 3D31A 5KNCA 4TTQA 2OCPA 2OXCA 4IOMA 1CTQA 4IOJA 5FBWB 3R9IA 2KBEA 2Z6VA 4PC3A 4DLWA 3IIJA 1E0KA 3QJYA 3THYB 4B32A 1NVVR 3AR9A 3HJNA 4JL8A 1OB2A 3HYTA 1RFLA 4B44A 3IHLA 4UNQA 3AP2A 3T35A 4FW9A 3HU2A 3CLVA 4GOKA 4C0KA 1KMHA 2H7VA 3QE0A 3DDHA 3CRRA 2J5XA 3LV8A 3R20A 4DCNA 3NBFA 1C9KA 2GXUA 4UNPA 3DL0A 1YR7A 1FP6A 4NCHA 1J90A 1T3HA 2WKRA 1MH9A 3NANA 1E2HA 3U4QB 2P69A 3CF0A 2CLDX 1ZU5A 4JT4A 3RDPA 4DIDA 4DLSA 1IXZA 1QZXA 3I72A 4E22A 4RD4A 1XXHB 2QUZA 3R7WA 2RGBA 1NLYA 3CF2A 3M0EA 3PXGA 5TY0A 2FSIA 3I32A 5HZKA 1ZNXA 3REGA 5ALWA 1TE2A 2QZ4A 2G1JA 4JLJA 1UEJA 5CM8B 1F5NA 1GRQA 4UXHA 4TMXA 3FPBA 2NGRA 4BEBA 1XX6A 2NPIA 1OLOA 3L82B 4V0MA 3LBIA 2DFNA 5CYPA 3VX3A 4HGNA 4QGAA 4QJ4A 1W7AA 1RQLA 1I4TD 2OAQ1 5H68A 2WOOA 3KJIA 4JSTA 4BFVA 2B6HA 4IHQA 1TJ4A 4NCJA 3L7YA 2QENA 4UXIA 2GWHA 5G40A 3AR8A 4OI0A 3SKXA 2XOKA 5TMPA 1ONBA 1VHTA 2JAQA 1EK1A 4KBFA 4PHHA 5KDDA 1RYHA 2GCNA 1GP2A 4Y3UA 2UZ3A 3IEUA 5JJKA 1KSHA 3GJ8A 2PCLA 3QXJA 1SWVA 4EQ6A 2ERYA 1KI8A 4JBYA 2KWIA 3KTAB 1XPRA 3QYPA 1P61B 1Q0UA 4Y2PA 5CDFE 5AW2A 3HU3A 4URYR 4OHYA 1XF9A 2FPKA 2BJWA 5BYJA 2W4MA 1S8OA 2QE7A 2H57A 1GNQA 3TE6A 1TU3A 1W47A 4LYHA 4LV5B 3EPHA 4HLQB 3RS4A 2XB4A 5CIQA 4MRSA 2GHTA 1Z6TA 2C99A 4KLZA 4Y2UA 3T5DA 5JCZA 1T5LA 2X2EA 4UAUA 2CNWD 2ZXUA 2X1VA 2QPTA 2XITA 2G0AA 3LY5A 4Y0VA 3NEYA 4JL6A 4L9WA 2RARA 1G291 2FSGA 2AK2A 3AVWA 2VSOA 1IBRA 1W4CA 4YGYA 2PT7A 1J99A 1Q3HA 3TMKA 5KHOC 2RHMA 3VNUA 1RJ9A 4TMZA 5E95A 5BWMA 1HA3A 5HZHA 1QHNA 1Z4OA 1U8ZA 5ALSA 3FMIA 4YMWA 3OCZA 1P4SA 5AICA 2VBCA 1SXJA 1NY5A 3LH5A 3ZS8A 4XQ0A 5E3HA 2R8RA 3T1QA 1N6HA 5AJZA 2G06A 1QHXA 4BLTA 1GKIA 3WK4A 4W5WA 4QQFA 5SZIA 3BK7A 3U61B 3ZU6A 1XD9A 1CP2A 2QU8A 2VHQA 2WKPA 5T41A 4TT3A 4OQMA 2VSXA 2ZREA 3I3SR 2GXSA 5FPKA 1GKYA 3QX7A 3EG5A 2HF9A 4KN8A 2D7DA 2MMCA 1W36D 2LCFA 3UKDA 4JKIA 1Z3IX 1CU1A 2ZBEA 1OB5A 1N6KA 2PLRA 2JLYA 2ZAMA 4IXNA 1L4YA 5FL7A 4B6EA 3HPRA 3B8EA 1DO0A 3OCUA 2D3WA 4JB3A 3W5IA 3EIEA 4E03A 2OEPA 5KSOA 5E0OA 1GOTA 1QF9A 2EWVA 3NH6A 5AUPB 5IRCD 5JJLA 2HF7A 1BYIA 2ZUBA 3VTKA 1AZTA 2C95A 4I1UA 1IN8A 1G5RA 3T61A 5AESA 2P6UA 3FKSD 5AVYA 1P9NA 3M6AA 4DLTA 4TYQA 1VCIA 4DUGA 5AM1A 3QVUA 2IW3A 5DSZA 2H1LA 2FPWA 2DYKA 2XTMA 1IN6A 3ESRA 3ZW7A 4CNQA 3TR0A 2XXAA 5JWHA 3MD0A 5KNDA 5KSYA 2HI0A 1GL6A 4EJSA 1OHHD 2YOHA 4M1YA 4NCNA 4DVGA 5JCPA 5AW3A 5ALYA 2R9VA 4G5GA 4KYTA 4FMDF 1GNRA 1E9EA 3U7FB 3PEVA 1L8OA 2Q0HA 3CH4B 4OKSA 2BM1A 4YXWA 3R9WA 2OAP1 1FTNA 1DOAA 1Z6GA 3BBPA 5HKKA 2IEZA 1AZSC 2FPLA 2ZSEA 1G3UA 3EF0A 4Q01A 1RRCA 1JJVA 3E8MA 4QBHA 1OFUX 3B9QA 1P5ZB 4EFNA 5JWRA 1AS0A 2Q3FA 2GAOA 3U44A 4TTPA 5AIAA 1ETUA 2ZE8A 1YMQA 4M1WA 4JVMA 2AL7A 2YFYA 4Z8YA 4U00A 3AR7A 3W6PA 1ZUNB 3T5GA 4MWOA 4O8CA 2I1QA 4I1SA 4KFSA 4GXTA 3VHLB 3GEIA 3FOZA 2C03A 4RD3A 3WHLA 5C46F 3IQXA 1ZU4A 1G8FA 4NMMA 2Q5EA 4WBSA 3CNNA 2V1UA 3U3JA 1Y8AA 2OHFA 3N07A 1N0WA 4JLAA 4HLCA 3CB4A 4ZV4A 4C4RA 4ZEVA 1NG9A 4IFEA 1M6NA 4Z54A 3U5ZB 1LNZA 1GL7A 2EARA 3GJ7A 4Z51A 5DHFA 3GLHA 3QG5A 5HPYB 3BXZA 1TF2A 2AFIE 2HJVA 1ZNZA 2CBZA 2AN9A 2MSCB 1AS3A 1KSGA 2G9NA 3RC3A 2ZR7A 3TUIC 4J03A 4RFSA 1J8YF 5L3VA 1X6VA 1FP7A 3TVTA 2OM6A 1J8DA 5AK3A 4NONA 4PAOA 2QP9X 1WPGA 1Z6YA
chains in the Genus database with same CATH superfamily
1C8VB 3QIVA 1L7RA 1C7RA 1ZK4A 1GSOA 4HATA 4W4TA 2UZIR 2ZB8A 5IG2A 4GAEA 1HV8A 1OXKB 1TKBA 2HB6A 3QLTA 4PWYA 1N34B 1DAEA 2X13A 2Z6UA 1AKMA 1WDKA 1KIMA 1YVUA 3M4NA 3EEQA 3TEJA 4QVKA 1NDQA 3AZPA 1MVNA 2QAGC 5ALKA 2F3PA 3BMQB 3T7IA 4B79A 1WVGA 4L1KA 3HG7A 1NMXA 2JJ8A 2SNIE 3FDJA 2HFKA 3G0DA 1E4OA 3RARA 4B7XA 1MA3A 1W0KD 4H6VA 1S2LA 2BZ0A 1ZN9A 4EZBA 4C4AA 1OTHA 1U8CB 1DC3A 1LLCA 2P5YA 4CR7A 3AWDA 3MCVA 4D45A 2OOKA 1OWMA 4JR2A 1K4MA 1VIMA 2HPVA 4G25A 4PQYA 5ENDA 1YL5A 4HQFA 3U31A 3VTFA 3ZHTA 1Z8NA 1EVYA 4PZZA 3NTOA 4X85A 3GMIA 4DLAA 4LYJA 2HWYA 3QMMA 2NU8A 1J00A 2DLDA 4FDMA 4RIFA 3DBIA 1J1ZA 3IT0A 4QNMA 1H2HA 3K4QA 3OIFA 1OBOA 2GBFA 2ZI5A 4RFVA 1M6EX 1YJBA 4AY4A 4CQLB 3BMNA 5ITSA 1LC3A 3KEFA 4I14A 5J63A 3RRJA 4BKQA 2RJOA 3AH8A 4R68A 3FHJA 4ENQA 1GU0A 5CLFA 3LPNA 1I2BA 1KDYA 3IQEA 4RKWA 1DAFA 2LVBA 3IKVA 1U3UA 5IWCA 4PCVA 3EAQA 4LY9A 3TBKA 3ER9A 1QVAA 2G88A 2TSYB 4W9NA 2VK4A 4HDOB 1UEXC 4N0DA 2QBYA 3ZHYA 2C0QA 2D54A 3QGMA 2Y99A 4TMTA 4ZOBA 4N41A 2NP7A 2QM7A 4PFJA 1C81A 3VYRB 1T2FA 2CXUA 3G17A 4ZCQA 9ABPA 3FNEA 3DEZA 2WIAA 4FS3A 2MSLA 3PIIA 4R8LA 5C8ZA 5BV8A 1L1RA 1PT8A 5M3BA 1GUBA 4F92B 1NJ5A 3VKFA 3FHOA 3WLOA 3KT3A 2HA0A 3U4HA 5DM60 4UVEA 2R0QC 1RYDA 1UAYA 5KTOA 1QXSA 3G2JA 1XA4A 5DCLA 4IW3B 5DK6A 3RRYA 2FFAA 5EUMA 3W8NA 2RIPA 3OOYA 1QS0B 4CHGA 1HFEL 5LUAA 1XVAA 2VYND 4IJ6A 3A6ZA 2CF5A 1NFQA 1E5XA 5CLGA 3HYSA 2X14A 1Z22A 3RYIA 1XIVA 4EGFA 4YT2A 3PNOA 1CY1A 1J7KA 1N7HA 2N47A 4HDCA 3K6JA 1HE5A 5TRTA 2YV5A 3DW1X 4LY3A 4KU4A 3WMWA 2FRVA 3MYRA 4RA9A 2BEKA 2GQ0A 2O0MA 1RQ7A 5BO5A 2PMEA 1YOVB 4KQ2A 2P6RA 1Q12A 1K89A 5GIPE 2BMFA 5JPIA 2WF6A 3NOXA 2HPAA 2OPBA 4HNAA 1T6ZA 4IPTA 1K6JA 1YHNA 2LXNA 5IH7A 1NBME 1NF8A 3T9DA 1MQ8B 4NFYA 2EU8A 4R6WA 4NBLA 3K1ZA 4RZ2A 4Z99A 1QZTA 3LY8A 1TJNA 3TSZA 1H3FA 2GI4A 3FMFA 4C4PA 3MGKA 1JHAA 2DX7A 2ZM6B 4CMBA 1PL8A 1X14A 5KVSA 1C0IA 1SU7A 2PQ0A 2XCOA 2IYRA 4LG1A 3KG2A 2H63A 2CLFB 1I6MA 3OWOA 1DJLA 1ZUHA 4FIZA 1UADA 3PC8C 4LMRA 4XB2A 5FWXB 4LFBB 3IDSA 4P93A 1O0BA 1JEYB 4NABA 5KHAA 3SYRA 3F5FA 4LKRA 4R2MA 3VDNB 3GPBA 1XZMA 1FTQA 1QIIA 3NCHA 2WY2D 5B3LA 5KHLB 2XE8A 1KKLA 2GZ1A 2OV6A 1Y5LA 5CDHA 4M55A 4RHTA 4MAFA 3SHWA 2YIDA 2MOKA 1Y48E 3JQGB 4B6SA 1Y7HA 1JT2A 1I4LD 1X2BA 3U7RA 3IE1A 1A2BA 2P6NA 4Y6LA 2H1RA 1I2DA 5L95A 5B7NA 3VR4D 4BUJA 4OM8A 4PRLA 2QAJA 3NV9A 4PX3A 3HO8A 4PU0A 5TMEA 1FU4A 2H9IA 5JH7A 4H3VA 2JCBA 1R7RA 3HRIA 3IP9A 4UPVA 1XMIA 1I1OA 4XDHA 3WQRA 4Y2VA 1IXSB 4EJSC 2M32A 1YZLA 2OB1A 4ZQFA 3L0SA 3H5WA 4F5YA 2OGTA 1HBJA 1GVHA 2E9SA 2ZSIA 1JILA 4NFSA 2CUZA 2QZ9A 3RBVA 2HPZA 4RWZA 3ELYA 4D4JA 3KJNA 2M6KA 4H16A 3HNRA 5CFZA 3ZJUA 2WWFA 3NORA 1NVEA 1FNCA 1N2BA 2V5VA 4JXXA 2C88A 2IPAB 4RVHA 5A0FA 2INGX 3HCPA 3DOOA 1ZM9A 1KAMA 1MRNA 3INGA 3CNBA 3PF8A 1PQPA 4G24A 3VKUA 4GM0A 3WLNA 2MSWA 1MX3A 1NPDA 4QARA 5CFOA 1XTQA 3DBRA 2ZJ2A 3A1FA 2NU9B 1GAWA 4XD2A 3L6OO 4QKQA 2EGUA 2NUAA 2J0VA 4L16A 3BS4A 3CNQS 4MK4A 4W5JA 1SMKA 3DO8A 1E3TA 1DAGA 3I9FA 3B1XA 3OJFA 1GPNA 5FR2A 1Y9EA 1JDTA 3FN4A 2GRUA 1NIJA 3N8GA 4PNHA 4UDOA 2OUKA 2V6JA 4G1BA 4BO8A 2JIDA 1TRKA 2FE4A 4AULA 2X42A 3EA4A 2B61A 2WSIA 1F6WA 3GWGA 3DDCA 4LRXA 3H7IA 1C8LA 4MO9A 3P2EA 1XEFA 2RGNC 4FGJA 3GZNB 5BP7A 5I4BA 2YS7A 2P9FA 3I45A 3T9AA 4OFWA 1A97A 2VLBA 4UQLA 4WCFC 4MLPA 2QRGA 1VIVA 3G6KA 1R4NA 3IPXA 4MV4A 1RZRD 5EQFA 2XB2A 1I3KA 2QNRA 4KODA 1QVWA 1AQNA 3H1BA 1MIOB 4PAQA 4AKSA 3JZFA 4J2TA 1D2EA 4YDSA 1F0NA 3GAFA 3KPUA 4JQCA 5DE3A 2XUAA 3C7TA 5E3IA 4TVSA 2VYFA 1I1HA 4QSMA 4PONA 4U7PB 5EIBD 1T25A 2OK8A 3DVSX 2IYZA 5BV2P 1FNNA 3E61A 3A9RA 3LUAA 3DVLA 5FBKA 2ZS9A 3MPUA 1U7PA 4WRRA 3WGIA 3HHPA 2QRJA 2FTKE 3AOGA 2EVWX 1JDZA 2G40A 3S81A 4L3WA 1FUEA 2BH9A 3FW1A 2OHXA 3B7PA 1XUOA 1KZ7B 2CFTA 4PGMA 5FPQA 3FPSA 4NMHA 3T95A 4D8TA 1XKQA 4QDZA 1PL6A 1H2YA 2IPLA 4COKA 3L84A 4Y1RB 3OLCX 5KSPA 4X6XA 5DNCA 4Y2YA 3V8NA 3LUKA 1RBMA 4UD2A 2E0IA 1CIVA 1EFUA 5IFKA 3D3WA 4JQSA 1GT91 1QOZA 3BWVA 3IBFA 3RNOA 3TZCA 3WAKA 3JQAB 1ECFA 2HDOA 2WMOB 4HAYA 3PUXA 3D59A 2JGMA 4F4UA 1XL0A 4I55A 4LBVA 1T5TA 5GVRA 4J6FA 3SX4A 3T7AA 2R5WA 2WD8A 1W6UA 4BVKA 3O4IA 4BV3A 4JX8A 5KTPA 4BZPA 2HU2A 1Y6GA 2F1OA 2PHZA 3NVMB 4BNLA 4CLEA 4MEAA 1KFKB 2V4UA 4Z4EA 1G6KA 4QG3A 4RENA 1TCAA 5GGXA 3K70B 1NDHA 1X7XA 2DETA 1F2TA 2Q2VA 1Q16A 1ZJ5A 2IITA 5IU6A 1MDFA 4JWKA 3R7SA 3FNRA 3NOVA 1X0VA 5TV2A 1EFVA 1TEVA 2OESA 3E5MA 3AI7A 5C51B 5FAXA 5FOTA 5D3ZA 5CJPA 4WASA 4Q05A 1TAGA 1Z3CA 2DVMA 5KDLA 4MKIA 4B85A 3KQYA 1RT9A 1X1EA 5DH9A 4OD0A 3LFUA 2R751 3DM9B 3WB9A 1RFGE 3KBOA 4B84A 4HB4A 3DKPA 2Z43A 1PYGA 1QFJA 2G9UA 5AOCA 4D1YA 3WL6A 1NT2A 1PFVA 2ZRHA 2XTZA 1Z0AA 5EIBC 2QBYB 4CTKA 2W93A 2O8FA 1KEKA 4HFMA 2O2XA 4GMKA 3UZUA 4IP0A 1V8PA 4NYJR 4E6EA 1KI2A 1OVMA 5IM4A 1Z2EA 4HH4A 1WCIA 4Z3KA 4EY3A 1OXUA 1MRZA 2W83A 3I1YA 1Q44A 2X40A 1TQDA 3LP8A 1NT4A 3R3ZA 4PQEA 1CK4A 2ZVPX 3PC3A 1MD9A 5D7BA 1D1QA 3KYDA 4HGOA 1HH4A 3SEFA 4RHYA 1ZGGA 3K8ZA 1TM4E 3IP1A 1P7YA 2CXOA 1QWOA 2E5FA 2WIKA 2WOJA 1SIWA 1MABB 3HBJA 4WQMA 2AFHE 2OBNA 2WSBA 1AGYA 3HJTA 1TVEA 1PD0A 2CVOA 3DTVB 1M9NA 3L07A 1LBHA 2C96A 4D4MA 3HXLA 5EE9A 1U0HC 2J3IA 2PL1A 4I1OA 8LDHA 3H2YA 4Y0NA 5A03A 1E8MA 2FQXA 3FTDA 2WF9A 4RANA 5CD9A 1FP1D 1FU8A 3DWFA 4UE3S 1Y8QB 1NW5A 2QJOA 1EZZA 1YOVA 6Q21A 4F72A 1YB4A 3IMCA 4AZ3A 1SUCA 3OX1A 2C3UA 1L7DA 3R3UA 3TIXB 1ZXXA 4RVFA 1I5EA 2WZQA 4OUKX 2YXPX 4JAVC 3KZNA 1KYZA 3AHHA 1KJZA 1XRPA 4KVZA 4AMUA 1SIOA 4I3FA 3JATB 1TUBA 1WDWB 4RLFA 2OK7A 5BVGB 2VQDA 3PXDA 5J2UB 5ERYA 1BW9A 2BLNA 3I3OA 1N1GA 3SQLA 1W1IA 4KYUA 2ZJ4A 3ORRA 3TI9A 5FV7A 1I7QB 4QPJC 3BB1A 4XDZA 2DE0X 1O6ZA 2IVZA 1AXGA 4GZ6A 3IPCA 3G68A 3IJEB 4EKDA 4OCZA 5AHRA 3L8ZA 1ZJYA 3IP8A 4OQYA 2GEVA 1U2GC 4YAJA 3O0DA 2CLHB 5C8YB 1RHQA 3TDNA 5IVHA 3C1AA 4Z4GA 2LR0A 1L0BA 1CERA 1BS9A 5AK0A 2BKXA 3UB4A 4CMJA 1PDWA 1M3SA 1WXXA 2P7IA 3ERCA 3DUWA 2HEIA 1DWPA 3JSXA 2E1PA 2JD2A 1V2HE 3NASA 1DVRA 3SVZA 4FDTA 1LLUA 3BK2A 3I4CA 2DUNA 1DLIA 4UE2A 3FFBA 5BRJA 4KXUA 4QJBA 1R2QA 1XCJA 2JAXA 3VSAA 1I6KA 5BSFA 3QOFA 5U4XA 1JDBC 1M33A 5EZYA 3ASVA 3WJ7A 3V8MA 2G72A 3AHIA 2ZXEA 1GZUA 3KCQA 4OHVA 3VPBA 4DIEA 5I4KA 4MI9A 3EZGA 1XNGA 3S40A 1ADCA 1WOMA 1SUSA 2H85A 5KNBA 2BEWA 5ALRA 4BX2A 4OQZA 4CKBB 1M1NA 3RSCA 1T4DA 4AW9A 3THYA 4CTJA 2DPMA 2A1UB 4LCJA 3TTYA 4HPWA 4KBYA 4DQDA 3DQZA 1NASA 3OQOA 1KY3A 1XJWA 2QP4A 1NQXA 2WAOA 3LKZA 5J5AA 4DSZA 4HT3B 3W2GA 1AKEA 4C89A 2FOXA 2J9FA 3HDGA 3HYRA 3Q5EA 4OA5A 2EJTA 4DLKA 4A5OA 2IXDA 4GOOD 2YVAA 2PL5A 4KJZA 2ADMA 3DL2A 3CLUC 1T3SA 4XLLA 3U4QA 1OH6A 4LYEA 2BI4A 3KHTA 1E1MA 3LDAA 5JD3A 2O8CA 3LECA 1G64A 3N2YA 2WABA 1KDZA 5JSUA 5M04A 3VX4A 2KBFA 4DEXA 1SJ9A 3KR1A 4GXRA 2V5UA 4BLPA 2RFLA 3S8YA 3GELA 3EIWA 2VJCA 1YK1A 3W2FA 3B60A 1PT5A 3G9ZA 4BECA 5H4HA 5LZ5A 2ZWIA 1C9YA 2OZEA 4ZC8A 1I4EB 4A2WA 2YHBA 1KQFA 3TTVA 1X7ZB 2ZUUA 1E6LA 2HDWA 3KXLA 2FDXA 3TVYA 4BAZA 5LWHA 2DQSA 5C1OA 3BWCA 3FYTA 2GBLC 3UW1A 3ECAA 3HGMA 5HQ3B 1W4BA 4ZREA 4CEIA 1NTRA 1Z37A 4XTRA 1WXHA 3TLKA 4D4GA 4ZP1A 3VPXA 4Z53A 1SB9A 4LHXA 4REQB 3KWLA 3C39A 1HF3A 2WPNA 3HVRA 1MC5A 4UUPA 2HO5A 3CVXA 3NX4A 1Y1KE 1IZYA 1OMOA 1IH8A 3PPWA 3L8YA 1TT7A 3VKVA 3KQPA 3S2GA 1Y5RA 3DT6A 3U7GA 2ZK7A 2VZ0A 1QO9A 2PT5A 4M8SA 1XSEA 1OFIA 2P2CA 3RRBA 5CYOA 2JD0A 3VZQA 4R3WA 4TVOA 2C3PA 4JGIA 4UBIA 3WMFA 1N0UA 1DC4A 3IOYA 5KREA 2BKUA 3QLUA 5TJ9A 3OIWA 3CISA 1HPLA 4WFIA 4KE8A 4MVJG 2ZLBA 3MZ0A 4PHTA 1PJQA 3QA9A 3WBKA 4DJFC 3OQHA 3R23A 1TDJA 4UZFA 1ESCA 3K0BA 3V48A 4F85A 4M0EA 1DBVO 3FHCB 2V03A 4YR7A 4ETWA 1E6WA 3IAM6 1ATIA 3LGSA 5K3BA 5TQ2A 2I1LA 1SOAA 2VL7A 3PSHA 3OZRA 1NBIA 5A7FA 1Y4ZA 4YC7A 1F2UA 1V9CA 2ZITA 5B6IA 2OXTA 1KFEB 3QFCA 3O26A 3LSYA 4CLDA 3QENA 2PKQO 2VTKA 5AJVB 3KLBA 3OAAD 1ZGZA 4ARIA 3W9UA 4PXYA 1OKKA 3RYCA 1T4BA 3DP9A 4JLVA 4A9AA 1CUWA 4J2HA 1W87A 1YJAA 3VC7A 4BASA 4RTSA 1AD2A 2FZLA 1ZBQA 4HFNA 5CPBA 1E2DA 4HLNA 3F7TA 1G18A 3BXOA 4JJFA 4KVFA 5JYEA 3GFGA 3QOYA 4B5KA 2EBHX 1E0JA 3ACDA 1YV9A 4BGIA 2PZEA 4CUZA 3PE4A 2NUPB 4OFXA 5C1IA 3OP1A 4GUDA 3S2SA 5FNVB 4RDXA 3GRYA 3QG1A 4OGGA 2B21A 4IS2A 4MV1A 2WUWE 1T24A 2BUBA 2X5XA 3RSFA 4E5DA 4MPJA 4R05A 3TNYA 3BFKA 4Y2SA 3AU9A 1Z06A 2QN6A 2XOKD 2CDBA 4JL5A 4WBNF 1BX0A 3BQ9A 5AW6A 4LYAA 4ALKA 2B4KA 1FLAA 4LF5B 1THZA 1EFAA 1W6RA 3B6IA 1MOSA 3RAFC 1Z28A 1PZEA 2FUEA 3FVVA 1PLJA 1VJ0A 1WW2A 5IBCA 4WKGA 4QLOA 5A4JA 1GNTA 3V1YA 5EJIA 1FFHA 3KPVA 3RKSA 2W2XA 2V5AA 4EFMA 3ETHA 1DX6A 4HDQB 4Z7JA 4PO8A 5HW0A 3FBWA 1I33A 1BYUA 3OA2A 2OKGA 4V0QA 1RP7A 4D46A 2ATVA 3KKOA 2GN8A 4MW9A 5ILGA 3ZQJA 4RVUA 5T8KA 1MW8X 1C4OA 4LWPA 3UJ3X 3GEDA 4Q3DA 4DMHA 4P2GA 3B52X 1WW8A 2IEAA 3C43A 2CJWB 3MWDA 4KV7A 3VR6D 5AKJA 2ODQA 3AY7A 2ORWA 3PZRA 2ODAA 4B74A 1JV2B 4D8YA 4NMLA 1LBSA 1U02A 3E0XA 3EMBA 5EUCA 1M8FA 3RRFA 3WMXA 4JBXA 4BEWA 4BNTA 3PICA 3O21A 1FYXA 3JRWA 4NV3A 3PJEA 1RYYA 3ROPA 5CVUA 1SG0A 1UR5A 2ZAGA 1K08A 2Y2UA 3TQRA 1JQJC 2AH5A 1U0NA 1B1CA 1C5KA 1L4UA 2P3SA 4CETA 3O82A 3OJWA 5IVPA 3FHTA 3I6YA 3SFTA 1KTVA 4TMFA 3W90A 4RY0A 1K88A 5F12A 4DGSA 4X65B 2VXBA 3LNCA 4C3OB 2ICAA 4LJ9A 4CM4B 5HOQA 1X7GA 4DIUA 2WG2A 5P8WA 4ARCA 3NTRA 1FDSA 1WD7A 5HQTA 1Z75A 2GFHA 3W4JA 4ZKDA 4YGXB 2PZJA 2EBFX 1MW9X 3PGVA 4OXKA 1GAQA 3IUBA 1ZUNA 3DPUA 4P1ZA 4F2GA 5GIOE 2A9JA 2V8BA 4JP5A 1EP2B 3R44A 2FGJA 4P7BA 3S2FA 1BW9B 2PWAA 2HWUA 4RXUA 1HC7A 2GEKA 1YRYE 2D5BA 4P3PA 4JD5A 1WPXA 2QD1A 1J9EA 3PRYA 1R88A 3I1IA 4Q21A 1GSHA 1PEYA 4IDDA 2AMYA 3F7MA 1RTKA 2CHGA 3UPTA 1VRVA 5MFZA 2F9MA 1ZEJA 1P1BA 1JEQA 3RHZA 1J9ZA 2ZIXB 4R2XA 1KK0A 1QV7A 4FSDA 4D0SA 4PFQA 3P2YA 2HAEA 4IFTA 1YI0A 1DADA 3G5AA 4DMKA 2P1ZA 4XUGB 3HP1A 5JH7B 5CB0A 1TU0A 2B0CA 4YMIA 4J0KA 2R6ZA 1AO3A 3EGIA 1E2JA 3S2ZA 5FBZA 1MZPA 4YXWD 1LSSA 4F38A 5GGYA 1TTPB 4W7SA 4IQFA 1DP4A 3VR5H 4B46A 2JFGA 3SAJA 1NX9A 5ADHA 1PR5A 4HSEA 1JIXA 3ER6A 3L18A 4BJ3A 1LFAA 4MP8A 3MGAA 4RQBA 3GNSA 4BFUA 2B69A 4C43A 3H2ZA 4GGMX 4I1IA 1Y98A 2F8MA 1BKSB 2QVYX 2GAIA 1FLVA 1NQVA 3INTA 4D82A 4QUAA 2QRPA 1H69A 4LHWA 1UBEA 4YA6A 3BXEA 3ODPA 3Q98A 5K6TA 4KH1A 1TYEB 1WLYA 1KXZA 1LF0A 4HSGA 4ZAGA 1BVUA 1ESZA 5JQGB 4D02A 1GUFA 4ZVQA 4GYWA 4P4NA 1X3SA 1SELA 5AK4A 2BYTA 1E7WA 1OIVA 1OBHA 2H1VA 1JTVA 2J31A 4BO2A 5C31A 4YMVA 4CQLA 5FORA 1B7GO 3WLEA 2D4AA 1P0PA 3A37A 4INZA 2EYUA 4NG4A 2PBLA 3MBOA 4F4DA 3DE7X 2V7VA 3JD3A 2O6LA 2VSYA 1UJ2A 2Z95A 3PNYA 4GIBA 4HG2A 5K20A 3BH0A 3TZKA 1EYZA 1L4LA 2EHJA 2O7VA 1IEVA 2YJ6A 3CPHA 1Z2DA 3CPEA 4LYGA 4AJPA 4POOA 5K9ZA 4BX9A 3QWFA 5H1YA 3BKXA 2CXHA 4TM8A 1TQ2A 4IY1A 3KHKA 3ZHCA 2IHKA 2PAFA 3UXHA 2ZJ1A 4EB3A 2IJGX 5HJEA 5B30A 1WXWA 1U81A 4GGPA 4UDXX 3VOAA 1Y5MA 4L7VA 1IQUA 3L6BA 4V0RA 1WBBA 4EY4A 4CEIB 1M34A 2D2VA 5ICEA 1AB6A 2ATEA 4QU5A 1ODSA 1OVGA 2CVPA 1SOVA 1JTFA 1SVLA 4QGSA 2QNBA 5EKDA 1R4MA 2HSZA 3NTUA 4NOLA 1RRMA 5BNTA 1ZCZA 3UMVA 1SU8A 1QS0A 3AJAA 4NDAA 4UHDA 3EUAA 1TOAA 2XNKA 3RVQA 4LHYA 3OZVA 1B4DA 2JS7A 1EUCA 4NYMR 2RHBA 1PHRA 3JTEA 3BT7A 1Z7EA 3BICA 3IB6A 2XF2A 3ZHXA 4EPYA 1E60A 1OIXA 2ES4A 4K9MA 4LWQA 5AWFC 3H5AA 3VRHA 4TLLB 4E13A 1EK6A 3KQKA 1OBVA 1X1DA 4PAGA 5EKUA 2C4KA 4LCBA 3MWLA 2E49A 1FSFA 2O20A 2UKDA 2BGIA 3QUCA 4LVCA 4RA9B 5J2TF 4ZI3A 5EUQB 3CRNA 4A8TA 1VSVA 1T13A 4CFYA 1SB8A 2QI9C 3MTDA 5LFAA 1NE7A 2DWUA 5ARCA 4OFZA 1UPTA 1E9FA 1SU6A 4RZ3A 3NJ8A 4Q1BA 5KVVA 1E3JA 4MOWA 3DZHA 1IXKA 4QXRA 2FH5B 5CA0F 1W0JD 1UT5A 2I55A 2PDAA 3A6KA 2E6KA 1QE0A 2RK3A 3HA5A 5DN9A 4PRKA 3TCKA 1VYUA 5FRDA 5AKZA 5IJ9B 4LC0A 4J16C 3P9RA 4TN1A 4MS4B 3A6JA 1MJ5A 1N5KA 1V1MB 3DZKA 2ZYUX 5JSZA 2GSDA 4QHYA 4P83A 1XWFA 2X1LA 4BAUA 5L45A 2VBIA 2VHYA 2GSWA 1W5TA 3BD8A 1Q7RA 4ITVA 3VV2A 1WDMA 1XZQA 1YKSA 3PDHA 3WYAA 4B6QA 3PYLA 4J1TA 4X61A 3CO0S 4BBPA 5LBIA 4DZRA 3WKBA 5BSGA 3RG2A 3PUYA 4HGPA 3OEHA 1RMQA 5FNVA 3D8NA 4XEHA 3T3NA 4I99A 3CCFA 4MW1A 5ES3A 3L1IA 4PSUA 7YASA 3S55A 3DCIA 5DXAA 1G20B 1RQ2A 1J9GA 1SBQA 2G28A 2J0UB 4LZPA 4LF4B 3UAZA 4JH0A 4IDEA 4CLRB 1WHTB 2EX4A 4L57A 3IXMA 2W6IA 3JQRA 1TIPA 2C5EA 3VH1A 4WKBA 2I65A 3DL4A 4AYTA 1A9SA 4C06A 1AU9A 1Y6RA 3L7IA 4BFCA 4TL7A 1LTHR 3K2BA 5JVDF 1GD1O 1ACLA 2F8LA 3TBHA 3NHUA 1DZIA 1GQYA 1TGYA 1VKRA 3JZDA 3K9GA 2YX1A 1MX5A 4LE2A 3RC7A 4AKEA 3UMCA 4D79A 4MCAA 5BR8B 4ZODA 2D1SA 1P2TA 4OQQA 1NGSA 4XYBA 1EM6A 2Y0EA 4U0JA 5B1HA 4MEBA 1ZJZA 1PD1A 2V6IA 2A5JA 2V7XA 2FI1A 2GCPA 3QXXA 2B78A 2GN6A 3I5YA 2I0FA 3UY4A 3DMDA 4LPKA 1PUXA 4O4LF 4B6RA 1R8QA 2DHEA 2JFPA 1EX7A 3HCEA 1KP3A 1ZGHA 2CNNA 3MQ2A 4DUGD 3TLGB 1ZOLA 1MFPA 3TNDA 1MV8A 5EVCA 2IYTA 3C3PA 5FBVB 4S1PA 2OG1A 4AWXA 1DB3A 1NJSA 1VA4A 3E9CA 1C9DB 1MO2A 2QL9A 3ICVA 4FJ2A 4KXWA 4D9GA 1OU0A 1BWQA 3KB8A 3SC4A 4X6YA 2XDAA 4NOJA 2P2ZA 4HV4A 3SHFA 3EXG1 3T3MB 2C2KA 1L7MA 4EL0A 3ESZA 1U2GA 1CUJA 3SQXA 1OXBB 4U9IS 3IO5A 3TZBA 4IAOA 2F9FA 4EELA 2V0CA 4ZN6A 5IZCA 1HX7A 4UU0A 1FPMA 4C7MA 2BZGA 5BVGA 2NQ8A 3IBSA 1E99A 4FT2A 1GV1A 2ONYA 2FGKA 3FGOA 1JS1X 2W6ID 3REFA 3VPHA 1ULTA 3HDJA 2JGFA 1K66A 2AEMA 1VKHA 1GTG1 2RB5A 2DPXA 1FSPA 4MX8A 4ARVA 4JXKA 1YE3A 2MT9A 2OXEA 1MEEA 2PTGA 3B48A 1R9JA 1D9ZA 1LLQA 2HLHA 2OFWA 3O1IC 4LW8A 4O4HA 4TYPA 3UYLA 4A4DA 2GAFA 5EIAA 1DAMA 4IIJB 3RK1A 2VJKA 1AHHA 3S2IA 4BQQA 4BZWA 1G3IA 4BMYA 2E1RA 4KO3S 5F3RA 3BE4A 1ZC3A 3JD4A 3EEFA 4MHTA 2XOEA 1EWKA 3ELBA 1IE3A 3FCEA 3L93A 4LISA 4N6NA 1U2SA 1XZ8A 4U5XA 5F78A 3NAZA 3DDSA 1BXRA 2G17A 1AK2A 2NO7A 3HJRA 4S04A 3HGTA 2ALJA 2W71A 2Y1OA 5E6SB 3MHTA 2CUNA 4B40A 3FPJA 5FWNA 1NVDA 2I7XA 5GY7A 2IYUA 1ZK3A 3BDVA 2XCTB 1Z26A 2PRKA 3GWZA 4J94A 1B8NA 4P92A 2AHOA 2J5QA 4DC9A 1NFRA 1G2OA 4EW6A 2FR0A 2NXNA 4G4IA 1ENOA 2PMDA 2QMOA 4TS3A 3SEZA 4S1NA 1L5OA 2R48A 4H3KB 5JSYA 3DTVD 1N9GA 2CXPA 3E9NA 1P1IA 3K0SA 1AHIA 2WU3A 1X80A 1B15A 1FA9A 3DLTA 4NE2A 2DQZA 1FDWA 3DE0X 3E3NA 1N8SA 3IA7A 4X1IB 4LC1A 4PPFA 4G1UC 3HDVA 4XZ3A 2HZBA 4MUEA 3U37A 1EG2A 5JJBA 3OU6A 1UJ4A 1V16B 2VTEA 3E1SA 2BGJA 3FGZA 3GJTA 2ZJ8A 2FJUA 3M6IA 4S1WA 5JQGA 1JPNA 1X39A 1BKDR 1BGVA 2J87A 3A7DA 3N58A 1VHLA 1S89A 4Q1FA 4DARA 1JYSA 1PJCA 1D0IA 3G0HA 1ODCA 2W43A 3IAAA 3QUSA 3GLGE 3PX7A 3TGWA 4NU8X 2W0MA