1RC8A

T4 polynucleotide kinase bound to 5'-gtcac-3' ssdna
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
301
structure length
289
Chain Sequence
MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELVKRNSKRGTKAVPIDVLRSMYKSMREYLGLPVYNGTPGKPKAVIFDVDGTLAKMTDVINPMVVELSKMYALMGYQIVVVSGRESGTKEDPTKYYRMTRKWVEDIAGVPLVMQCQREQGDTRKDDVVKEEIFWKHIAPHFDVKLAIDDRTQVVEMWRRIGVECWQVASGDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*TP*CP*AP*C)-3'
publication title Recognition of DNA substrates by T4 bacteriophage polynucleotide kinase.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 87
structure length 289
sequence length 301
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rc8A01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rc8A02
3QG5A 1PZNA 2H17A 4GIBA 4DWJA 2WJJA 3IIJA 2JAWA 2BM1A 3PEVA 3CNLA 2G07A 2PZFA 3OPXA 4TN1A 4D0LB 2FU5C 4P3YA 1UFQA 2KI5A 3TR5A 4FWTA 2RGCA 2VSXA 3L7YA 3SE0A 2ZITA 4TTPA 4YONB 2ZI4A 3TKLA 4XWKA 2Q9AA 1M7HA 5DISB 3GJ5A 1UDWA 1F60A 2X8AA 4RD0A 5EXSA 3TSOA 5DN6D 2NYVA 5FR1A 3CZ4A 1L6RA 1FP7A 2HCFA 2VA8A 2JLXA 3Q72A 1ETUA 1CR4A 1P4SA 4AD8A 1O3YA 3ZLJA 5FPTA 1Q22A 3H86A 2PQ0A 2ZS7A 2KE5A 3R9KA 1H8HA 1IXZA 1W49A 1X42A 2ZE5A 3WRXC 1ZD9A 2ZRDA 4B3FX 1TNDA 2FSIA 3OEEA 4KVAA 3S1AB 2ZI9A 1KKLA 1XTKA 2OLJA 1G64A 2ANCA 4JLAA 3SFVA 1EFRA 4OHYA 1Z4LA 4ZCIA 2CHQA 5ALPA 5EP4A 2JJ2A 4PC1A 5C2JB 3CW2A 4QGGA 3W5CA 1DVRA 4P31A 4AKEA 5IK2D 2JLVA 1NSFA 2WAXA 4KODA 1Z0JA 3KJHA 4LX0A 4Q47A 4AYXA 2HCJB 4B3DA 2HF7A 4IOMA 1OHHD 3AR4A 5E0OA 3K70B 1VECA 2XZPA 4IOLA 4PFSA 1D2MA 2XSZD 3MC1A 4O8CA 2DR3A 4Y3UA 2AKAB 2X1VA 3SN6A 3KKNA 3UIEA 4TSFD 5FOVA 4MDFA 1OSNA 2YWFA 4KJZA 3R09A 1GITA 4TLBA 221PA 3AR2A 1TU4A 3W90A 2YZ2A 3MJRA 4JSYA 1F5SA 4UJ5A 4IFEA 1R5BA 1Q1BA 4YCMA 1EK2A 3SR0A 2R8YA 3EA5A 3GJ7A 1DG1G 1OPXA 3NANA 3W5IA 2IS4A 4NV0A 2ERXA 3GQBA 3Q85A 2OFWA 3ONNA 2WF8A 2DBYA 4LJ5A 4HAIA 2YWHA 1T3SA 4Y2RA 2AWOA 5FUVA 3N5CA 2QN6A 4HB0A 3FPSA 1ZUIA 1NBMD 3DZ8A 3OIUA 2FPKA 4M53A 1RW4A 3UATA 1DBSA 5B2ZA 5C4MA 3QI2A 3PEYA 3AQ4A 4NKRA 4PX9A 2BHRA 4CDGA 4LJYA 1ZINA 1CR1A 2NIPA 3FVVA 5E3HA 4XWAA 2P27A 3PUYA 3ZS9A 4LBVA 5G40A 3ZH9B 1QRAA 2BBOA 3EA0A 5FOWA 3I1FA 4JYCA 4Q02A 4HAVA 3F9RA 2GXAA 5AJXA 2D3WA 3CM0A 5AR1A 4OCZA 2FWRA 2GO7A 1QF9A 1Z5UA 1VHLA 3TAUA 2G3YA 3B1ZA 3FMIA 1E2HA 3GJ6A 4OK3A 5E7IA 4B73A 1SULA 2JATA 2VSOA 4EJSC 2FDCA 3ZIAA 1DELA 2O8EA 5AVQA 5AI9A 2GZHA 4M1YA 2F43A 2TMKA 1R8QA 1WPGA 5JWHA 5HR5A 1W4AA 5TMPA 3CH5A 2OUKA 3WKCA 2YINC 3P4YA 3U13A 1TEVA 4BLRA 1Z0KA 3GFPA 1KDOA 2W00A 5AM4A 2IYSA 3KFVA 2LKCA 1R0ZA 3QXSA 4RETA 3TQCA 3VR6A 5JHHB 2ODBA 4EQ6B 2JLSA 2RGGA 4JLKA 4IFTA 4TYWA 4RD2A 1RMTA 2F1RA 4ZEXA 1A2KC 3U44B 4KX3A 1ZIPA 1E1RA 3CX8A 4LYFA 3H1TA 4MGYR 5KDOA 3CRW1 3NDPA 4P32A 1SVIA 1LY1A 3WNBA 1GILA 3OAAD 2UKDA 4OL0A 2C03A 1GSIA 2Q3MA 3WP1B 1UJ2A 4KI0A 4KVGA 3VMFA 1GKYA 3FKQA 4TL6A 3O8RA 3BOSA 3RHFA 1DAHA 5JZVA 3K1ZA 2HT1A 1S1MA 2NG1A 3TUZC 2ZRKA 3M1IA 2GDJA 3L0OA 1GWNA 4WOPA 4DEYA 1SKYB 1TTTA 1XDBA 1YV9A 3OZXA 1QHHA 3TLMA 3GPLA 4NP6A 4G01B 1BMFA 1U9IA 2WVJA 4Y0AA 2FI1A 2IOFK 3ZVLA 1TE2A 2Z4RA 3KDSE 1SVWA 2WBLC 3VHLB 2IYQA 4X8OA 2XGJA 5DI9A 3B5JA 2PKEA 2FSGA 4V0MA 5AM5A 3TVTA 4ZEWA 3KJEA 3RABA 4QJ5A 4Y2PA 5KNDA 4ZKDA 4YH1A 1QH9A 1HTWA 5ALHA 3EX7C 1KSJA 2OLKA 1OXSC 4BNDB 5JI3E 3QIAA 4LRWA 1NBME 4DLWA 5KU1A 3ZX5A 1J97A 4CZ2A 3NAMA 1FFHA 1T3HA 1OFUX 5JEEA 1ZJJA 5CM8B 4DDVA 5EXXA 5L3SA 2DYKA 4WVFA 1NN0A 3GJ3A 3GJ0A 4II7A 3EF1A 4ZDWA 2F1IA 3OCVA 4ZPXA 5KSZA 4ARZA 1JQJC 4E09A 1KI4A 4UQOA 2FEAA 1HE1C 2A5GA 5KNCA 1G6HA 2H7VA 5LD2C 3EZ2A 2GK7A 3K0FA 5KSYA 1T8TA 1AZTA 2N46A 2FG5A 2R6DA 4Y0VA 4G5RA 4NH0A 5DYGA 1IXSB 1OKKA 2B21A 3EZFA 4P33A 4CEIB 1NN5A 4E07A 3S6JA 3WKAA 4ZEVA 3KXLA 4XSHA 4LGMA 3NALA 3LW7A 4A2PA 3AM1A 1GRQA 1XXHA 4OQXA 4I99A 3ADCA 5H8WA 5CYOA 4YMUA 4EIWA 1GM5A 2ONKA 1U2SA 5CDFA 2QENA 2VBCA 3FFBA 2C99A 2ZRPA 5A5GA 1TJ4A 4MA4A 4UAVA 3B1YA 1E2IA 2ZJBA 1SVKA 2UZIR 4AIIA 2FV8A 1LVHA 4YMSA 4XOIA 3DKPA 1PUJA 4NL4H 5ALGA 4Q5IA 4Q4JB 1E2MA 1HT1E 4QGHA 4KITB 1Z08A 1E2QA 4TWZA 1B23P 2IWRA 1C1YA 1TUEA 4QOSA 1GOTA 3BFVA 3K70D 4KXFB 3QYPA 1JR3D 3K9GA 1X1SA 1E99A 3ZZTA 3W5JA 4YMVA 4KX5A 1KO4A 1M34E 4PANA 3KUCA 4QNRA 3FM9A 1KIMA 5FUYA 2ZAOA 1XEXA 2HV8A 4JS0A 3IBGA 1Z0FA 1NRWA 5FFMA 2QNRA 5J47A 1E79D 3KTAA 3VKHA 2WSSD 1IWOA 2G06A 4NDZA 1KNQA 2HEIA 2J7PD 1ZYUA 4KFRA 4FINA 3TGPA 2RARA 1YQTA 4DDTA 1F48A 1S8FA 2F7SA 3FDIA 5C1BA 5J4KA 3UK6A 3VX4A 2IYVA 5E95A 3L1UA 3UWOA 4BRUA 1F2UA 4MYHA 4Q9IA 4M9ZA 3QXJA 3TMKA 5H1YA 5GADl 4UNRA 1GRRA 3CZQA 2BJWA 2ONJA 1XJCA 2ZJ8A 5AVRA 5J5CA 4WBSA 1H65A 1Z6TA 1K5DA 2VH5R 3JZAA 3R7WB 4EPTA 3GLHE 1NF2A 2FPSA 2GCPA 2ZOSA 3HJNA 3N28A 2NQ2C 4UXHA 4LHZA 1J8YF 4Q48A 1NJFA 3B78A 2FFAA 3AVPA 3IBYA 3W6PA 3GLGA 1COWD 5ANRB 5JSZA 3W5BA 4BFTA 1XTSA 2ZJOA 3KZXA 4DCNA 3THOA 3B7GA 3I6BA 2IYZA 4IOKA 1NNEA 2YJ5A 5D3QA 1T5TA 2XX3A 3KQHA 3R9XA 1P75A 3ETLA 3BBPA 4QM6A 3N5KA 2QMOA 1LS6A 1AKYA 2HDNB 3OE7D 1KSGA 2JLUA 1E2EA 3SNHA 1Y8AA 1N6HA 1RFLA 3RRNA 1HQYE 3ADKA 1JJ7A 4Q1BA 3A1EA 4DCVA 2WJIA 5GVSA 2WWYA 4B6EA 4FCWA 3F8TA 5JCZA 1MH1A 4RSGA 1AIPA 3AVYA 1AKEA 4AK9A 5AK3A 3MFYA 3MCAA 2OM6A 3A3YA 5ALXA 2O8BA 4GT1A 3JZMA 4BBJA 3LV8A 2BC9A 5AJWA 1NRJB 2QRZA 2YVUA 3Q5EA 5AJZA 1UKVY 2K5UA 2WF7A 3FGNA 4EX7A 2WWIA 1DTSA 4NYMR 2REXB 1G9XA 2I54A 3R9IA 4M8NE 1JR3E 1TQDA 3N2IA 2ZJAA 2PEZA 3H84A 4CNQA 4ASUA 5FBQB 5ALQA 1ZC4A 2BV3A 2B92A 2KSQA 2GZDA 1ZM4A 2IUUA 4OQLA 2CHGA 2WWGA 4IVPA 3C5HA 2CJWB 3L5KA 2BJVA 4TLDA 3VAAA 3A1UA 2JLYA 4WIAA 1N5KA 3DMNA 3TQFA 3M4YA 4XD7A 5FOSA 4IW3B 2HX1A 1NLYA 3B1WA 2F43B 1R7RA 5AUQA 3L2OB 1E2LA 2WMOB 5AW6A 3EASA 2WOOA 3GLHB 3ND9A 4PSAA 4XSGA 3E70C 5JHGB 2IXGA 1BKDR 4JBXA 4CF3A 1OYWA 4B74A 1MO6A 2WF6A 1ZNWA 4EJSA 2DB3A 1J90A 5FH9A 1S3GA 4TQUS 1WF3A 2PCLA 1IXRC 2ZTSA 3EZ9A 1EFHA 4LC1A 3A1SA 4FE3A 5KDLA 3KJIA 4PR0A 4Y2YA 4XQ0A 1E1QD 1E96A 3CRRA 2OCYC 4M4SA 1II9A 1OFHA 3ZWKA 2IYWA 1N9KA 2XTNA 5SZHB 3VNUA 1LF5A 4DCSA 1KY2A 4ESVA 4F92B 2FPLA 4HDOB 4HLCA 3GP8A 4MKGA 4DT1A 5BYKA 2VRWA 1QHNA 1XRJA 1KAGA 2RHDA 2NO1A 4JLPA 4A6XA 3ZVNA 1I4LD 2ZIAA 4FFDA 3UMCA 1HUQA 2C8VA 4B2LA 2C8KA 2I1VB 1VCMA 2OZEA 5EE9A 2ZE7A 3RSOA 4DCTA 2P69A 5P21A 1IN4A 1E9BA 1NN1A 4IOJA 1OIVA 4BFYA 4ZI3A 1G3IA 2GEVA 3A4MA 5TXGA 2WFAA 5G53C 2A2ZA 3OFND 4O3MA 1LV7A 4NZYA 2OFOA 1P5ZB 2ZSEA 2ZRJA 1SQ5A 3TRFA 3I5XA 4AY2A 2NOAA 1YR6A 3DEFA 3MMPA 5A3QA 1OB5A 4OHFA 4L5BA 3BWDD 4AYWA 5DI3B 4JB3A 2BBSA 4GP6A 4M1TA 1ELOA 3DKVA 2C9YA 3K09A 1CULC 1K6MA 4KCGA 3OESA 4JLBA 5JRZA 5L3SB 4H1WA 1NP6A 2IYUA 1LTQA 1U8YA 1NL3A 4L15A 1OIWA 2BWJA 4Q9KA 4D82A 2D4HA 3CWQA 5K8IA 3QU2A 1KHTA 3NKVA 4UM7A 3EZ6A 2V1XA 2ZS9A 1SKYE 5KTYA 4LJ9A 1RE0A 1KKMA 5H70A 2QGNA 1RRGA 2B8TA 1H8HD 2DHRA 1E2NA 2HHLA 4KBFA 4IKEA 2MMGA 3VU9A 3I28A 2PLRA 3FMPB 5J40A 4RZ3A 1AGRA 5DLQC 4YMWA 1DAFA 1XXHB 3BRWD 3SFZA 3NDBB 1SHZA 3OEED 1YZLA 2JASA 1Z4QA 2P3SA 2JGAA 1KGDA 4RZXA 4FN5A 3MRSA 2ZG6A 3BAFA 1SGWA 1G8YA 1EFRD 3ZJYA 3I62A 2VP6A 1ZD5A 4MRNA 4EAQA 3WYGA 5JJIA 5K8TA 3LQQA 4TLEA 2JJ2D 2GVZC 1S0UA 3HWSA 4MUBA 2R8ZA 1U90A 3DZDA 2B8JA 5AKKA 2PR7A 1CJMA 4XVQA 1NVVQ 3EPJA 3LFUA 3PG5A 3FMFA 3PJRA 3T06B 3W3AA 1NVWQ 2Q9CA 3V4RA 2OBNA 2C77A 2ZRNA 4NBSA 2P6RA 1HT2E 3KD3A 4TMVA 4OQFA 5BYJA 1NMYA 1M7BA 1KI2A 2C95A 1P9NA 1VG8A 2AXNA 4ZCMA 3U6KA 3RS7A 3SBEA 1WDTA 1R4AA 4PHFA 4Z1MA 4BFSA 5K8LA 3NWJA 1G8PA 721PA 5DHFA 1NMXA 3R8CA 3ZD7A 5B30A 3AR9A 2CHVA 1T5SA 3WNCA 821PA 4YIKA 1U2TA 2QAGC 5A0FA 3K1JA 4GMDA 4XE5A 1E9FA 1DAGA 3LD9A 4PAMA 2YN4A 1KTVA 3AR3A 3PIRA 5HPYB 2GXQA 3RRYA 1II8A 4C4TA 3IPXA 2ZAMA 2GJ9A 1VCOA 4M1MA 1CTQA 1JBKA 1W7AA 1Q3HA 4LC0A 3I61A 1T5IA 3NIWA 3SHFA 1LB1B 4KHZA 1N6IA 4N1AA 4A9AA 3DDHA 3GLGB 3WKBA 4LV6A 3RFUA 5JSZB 2CVFA 3FKSA 4C7OA 5GVRA 5DHAA 5HCNA 4DLTA 3OCZA 3L0CA 3U19A 2EYQA 4DEXA 4OI1A 1CRQA 3B13B 2NPIA 1JNYA 1YKSA 4JIMA 1P60A 2AFHE 2IA5A 2HJGA 4RZUA 3K9LA 5CJPA 1CS4C 2VPPA 4PZZA 3DOFA 1TL7C 4RKEA 3LWNA 2V8OA 3QF4A 3T1VA 2ORIA 4LBZA 2KBEA 2Q3FA 5D3MA 4PZYA 3VR2A 2MU1A 2RAVA 1IM2A 3B82A 2OESA 4NONA 3GYGA 4LK2A 1XPJA 4ERNA 1D8TA 2FJUA 4R71A 3PUZA 4QFMA 2Z43A 1VIYA 1S96A 4Z8YA 2V55B 2V7QA 4CEHB 3B2EA 4B43A 4OHWA 3EARA 2P11A 3MMZA 3G82C 2VHUA 1W5SA 3A58B 2DWQA 1NY5A 1U9IC 2CL7X 4M21A 1YMQA 3W8RA 1CR2A 4D0GA 4U5XA 2GCNA 1Z88A 4RD1A 4HUQA 1KK2A 2FE4A 3BH7A 5CM9C 3QE0A 4B3XA 3PGLA 5FL7A 4DWOA 4CRWB 2ORWA 2V1UA 3TBKA 1E1RD 1KNXA 1HURA 3RC3A 4TYNA 2FFQA 2YJ4A 5F2EA 2H5EA 4B76A 4P4SB 4Q7LA 1E2DA 1KYIA 2Q4RA 4P0TA 3ZTYA 1T9HA 3E2IA 1G3RA 2ZJYA 2O0KA 1G17A 1DARA 1R10A 2C5LA 5TVKA 2XXAA 1M6NA 2OV2A 1UBEA 1VKJA 2WSMA 1RC8A 3BA6A 4A0GA 2Q6TA 1BMFD 5C4GB 2G08A 3AP3A 4MRSA 4DB2A 2J46A 2D2EA 3WYAA 2AR7A 2VF7A 3T15A 2XITA 2CDNA 4LPSA 4PC2A 4F71A 1YDFA 3PUVA 1GL6A 4BASA 5HE9A 1RQLA 4YCNA 1XMSA 4LJAA 4XTRA 3DO6A 4LZZA 4LYJA 1ZM9A 2X77A 1WXQA 2QE7A 3M1YA 5AKHA 4Q9JA 2WJHA 3Q5DA 3AKEA 3FZQA 3PUWA 3ICEA 1T5LA 4G3XA 3UG7A 4CGZA 4JT4A 2O8CB 3E84A 2FUEA 2AFIE 3AGQA 1IN5A 1TEXA 2WM9B 1JAHA 4N0DA 2YKGA 3IUYA 4QBIA 4LDJA 1Z07A 5CYPA 4URXR 4UMFA 2ZXEA 4EX6A 1W4BA 3MJHA 3AVOA 2IUSA 2QORA 3NEYA 4PHGA 2EFDB 4D6PA 3QUBA 2A9KA 1G8GA 1JEEA 3IPYA 3T35A 2DQSA 1W1WA 3C16C 1YVDA 4BLOA 4BEJA 2BDUA 3HYCA 3WKEA 1R6BX 2I4IA 2GJSA 1ESMA 4LCBA 1OKKD 1NVUQ 2JGNA 3AVWA 1SZPA 3UKDA 5LPNA 3ESRA 4CE6A 1T9ZA 2CVHA 2WWXA 1CIPA 1NLZA 4C0LA 521PA 4URUR 1JAIA 2QU8A 1YS9A 1ZOLA 5JEDA 4G5GA 3L43A 1OH7A 4XVRA 1QG2A 4PQRA 1E9EA 2VIIA 3OIVA 4I4LA 3GLIA 2CNWA 2B7CA 3NC1C 3DDCA 3LQRA 1CU1A 4UNSA 4B32A 1YJ5A 2P9JA 3LBIA 2WWWA 4HZUA 3HYTA 4TL8A 3A1DA 4EEKA 2ORVA 1Z4IA 2YMMA 4EPXA 1E2JA 2YOFA 5FUWA 1G5RA 1G41A 3L0YA 3KXKA 4PPQA 1CLUA 1M7GA 1S4QA 2WHXA 2QBYA 2ZBDA 1XD2A 2HF2A 3FHCB 3VFDA 2AUTA 3BFXA 3TLXA 2R6GA 3BJIC 3U6BA 4O2LA 3NHAA 4JT2A 2BKEA 2J0UB 1FX0A 1QYIA 2HLDA 1SXJA 1KI6B 2VP9A 5CB8A 2YC4C 4YDSA 4A0RA 2X19A 5E7JA 1TAGA 2IF0A 2ZRBA 3SS8A 1ZUHA 2PX0A 4J03A 3FVQA 2ODWA 1Z2AA 2IEZA 5ALLA 3IJ5A 2RAPA 2XNDA 3VU9B 1XPUA 3ZYCA 3SLRA 1MR3F 1P61B 4V0ME 3KDPA 4RFSA 4A0HA 1EFCA 1OV4A 2EWWA 2ZSFA 4QL3A 3B60A 3D31A 5G3YA 3PCRB 3B85A 4WZBE 4DVGA 3U3OA 4EFLA 1RLMA 3IQWA 1W0KA 4B75A 1YZUA 2F3RA 3LBNA 4CF5A 5LD2B 5ALSA 3BS4A 4WZAE 1F5NA 5AK4A 2BMEA 3KQKA 4FMDB 3FOZA 4HAYA 4GRAA 2EVWX 5B58C 5AW3A 5SZJA 2HF9A 3BXZA 3VR1A 1P2VA 1ZJ6A 4AKIA 1NMZA 1XD9A 4TMXA 3OHMA 2BMJA 2GF0A 2XEXA 4WXPA 1UF9A 2OYCA 2CCGA 3QENA 1G19A 4V02A 1Q0UA 4M1KA 1ZD3A 2FMXA 1NIPA 4IVQA 4H9GA 1XCPA 1N6KA 1XEWX 2BM0A 3THXB 4CEJA 3OF5A 5L3RA 1DOAA 4LV8B 3RS2A 2Q3HA 3EW9A 3CX6A 4HB3A 1TMKA 3OCWA 1DEKA 2ZR9A 5GJBA 3QKRA 5C18A 4EPYA 2ZPTX 5C46F 1I4TD 4UM5A 2P5TB 4HGNA 2F9LA 4GOKA 2QTFA 4O25A 3EPLA 2C04A 2OCBA 1XXHE 4D4KA 1FTNA 3ZX4A 2W83A 2BY4A 5AW4A 2FA9A 1T8UA 5CDFE 1WB9A 4YDHB 3IO3A 1NG1A 1DAIA 1ZVQA 4JKIA 1XU4A 2ZROA 5AI4A 3QUQA 2WPDA 3ZDQA 2XTZA 4DSOA 4BUJA 5AUPB 4Y2SA 4TZ0A 1XEFA 3U4QB 1RYFA 4DLXA 1R8SA 1TX4B 3UMGA 3IILA 4ACBA 5IS2A 2QEQA 3X2SA 2GHQA 2PL3A 4BLSA 3CO5A 2QAGA 3G5UA 3WXMA 1VYUA 4NCKA 1E6CA 1J2JA 5FTNA 4ASUD 1I4DD 1T91A 2HUPA 2MSCB 2P5SA 2ZE8A 1G5PA 4ESHA 2O8DA 1EESA 1GAJA 2WOJA 4UMEA 2REOA 4GZLA 4OQNA 4UU1A 2QP3A 2DWOA 1JECA 1EWQA 1Z5GA 4GXTA 4JMPA 4IVRA 4TLAA 4JBWA 3P1JA 3I5YA 3FGOA 2I1QA 1N6NA 2ZBGA 1L7PA 1E3MA 1HYQA 3ND8A 1ZUNB 3T1QA 2YBDA 2GTPA 3Q8XB 2QMEA 3QF4B 4FI3C 2GJ8A 4XD7D 3GLFA 3OCUA 2QPOA 1L8OA 1Z5ZA 2Z0MA 1GL9B 4JLOA 1Q3TA 3X1ZA 4UMVA 2AGVA 3I76A 1WP9A 5EE1A 1WMSA 3NH9A 1W44A 2ZYUX 1AS0A 3CF2A 4GZMA 4TMKA 2A7QA 1VHTA 1Z0IA 2GZAA 3TUIC 3AF4A 2PJZA 3EC1A 3LDAA 4XIGS 3FYHA 3NH6A 1U0LA 1FQJA 2BBTA 2C88A 2SHKA 3CB4A 2G0AA 3AR6A 4CT5A 3H2YA 2I55A 4CW7A 3MWLA 1ZNZA 4I81A 5ALRA 2W58A 2NO9A 1N6LA 3UM9A 4C4PA 4GMXA 2ZRHA 4MKFA 3W9YA 4QM7A 3GLGE 4RVCA 3EXAA 4AWXA 1VMAA 2GBLA 4AURA 1W36C 2XNSA 3AR7A 4L9SA 4MUMA 4UNNA 2QAJA 2IS1A 1OJLA 2H8KA 3M6AA 4RD4A 3QKSA 2XXAB 3W3ZB 3LH5A 4HAZA 4OJKA 4Z8XA 3GEHA 1CR6A 4KSCA 2J41A 3GFTA 1P7CA 4AKGA 4DLSA 1CJUC 3VKGA 3TW8B 1ZNYA 4B47A 5KYKA 3DPUA 3K09C 4HGRA 4HLUA 3V00A 3T34A 1QVRA 1IJEA 4YLGA 5FPSA 5HKKA 2NO6A 2PJRA 5AVVA 1CR0A 2GRJA 2YWEA 3EIQA 2Z83A 1KO5A 1MO5A 1SVLA 3GFOA 3LVQE 1Z83A 4M1WA 5KPJA 5ALMA 2FFBA 5ALYA 1ANKA 2HCBA 2DFKB 2IYLD 3K0AA 4PPFA 4YC7A 1O08A 1YHNA 4UXIA 1Z4OA 1W36D 1G8FA 3ZVMA 4UJ3A 1MO3A 1F2TA 3MWYW 4MITA 5B64A 4I1VA 2R44A 1WQ1R 4P4TA 4HAUA 4UXJA 1VTKA 2H16A 2QI9C 2HJVA 4PO8A 3L0PA 1ZU5A 5IHPA 3QBVA 2FEMA 4Q4HA 5A3RA 1A1VA 1TQ2A 5FTLA 2YYZA 4DCUA 1ZCBA 4R2IA 4QJBA 1U0HC 2BOVA 3QG1A 3NEJA 4RD6A 3THYA 1PW5A 2WWHA 3BE4A 3DMDA 5FI0B 1DE0A 1K8RA 2OBBA 3EPHA 3WK6A 3QGMA 3X1XA 2NO7A 1VCNA 2FNAA 4M9QA 1VJRA 3UPUA 4C0KA 3B8HA 5CK5A 5SZKB 4BX3A 3UG6A 3ZGXA 3CKLA 1U7PA 1KI1A 1X8KA 3KQUA 2ZXUA 5HCIA 5FTKA 3IEUA 2Q0HA 3NRJA 2QQ0A 4ON9A 4DKXA 1G3UA 2KB0A 4Q4LA 4QBHA 2CE2X 4JLVA 2FX3A 1AM4D 4EKDA 1Q20A 5J4YA 3LXRA 3SJZA 1IBRA 4IHQA 4D2IA 3MGCA 4PAQA 3L1VA 1N6PA 4TLCA 5AIAA 3TNFA 4QNMA 1Q1ZA 3WMFA 4C9BA 3AVUA 3GLIB 1S3SA 5TARA 2J9RA 3K53A 3MPOA 3DM5A 4J2TA 1VIAA 4F4IA 4NE2A 4JBYA 2PX3A 2I34A 3R8FA 5DSZA 4D4MA 2VP5A 3L8YA 4M2LA 3X1WA 5AW9A 1OH6A 3JVUA 4PC6A 2QBYB 1X1RA 3KQNA 4MRVA 4LHVA 3QXGA 1XD2B 4OI4A 1S1CA 4PSKA 4BLTA 4DSUA 1K1EA 4L8GA 3B8EA 2ZBEA 4DJTA 3AEZA 4TZ6A 2QP9X 2AXPA 4M22A 4MKHA 3BB3A 1JR6A 4NPHA 2YJ3A 3K0SA 4A8JC 1FX0B 2Q9BA 3IO5A 4HYYA 4DC9A 4Z1MD 1IN6A 2YOGA 1S9DA 1ODFA 4BFVA 3GD7A 1IY1A 2ZM5A 3FMOB 1W4RA 1W4CA 2GILA 1YZQA 4GPTA 5KNBA 3RLFA 1L7MA 5JFGA 4LHXA 1CEEA 4URWR 2B8WA 2J45A 1OXVA 2RCNA 5DIFA 1ZC3A 2J0VA 1QHSA 4W5HA 1UBFA 2F1JA 2ZRLA 2ZR0A 5AI5A 5FTJA 2IYTA 1YRBA 1XP8A 2QSZA 2W2XA 1GNQA 4LY6A 5DE3A 3CONA 4AKHA 2HXYA 2PH1A 4OBEA 3TR0A 3WBJA 4HUTA 2B30A 2HEGA 3BWVA 1S8OA 2QZ4A 3ESQA 3B1XA 3AVTA 2P0EA 2FF7A 1FUUA 3RS3A 5AHXA 1LF0A 1IHUA 4OFZA 4AP9A 2GAAA 3VKWA 4A1FA 2E1RA 4D81A 3C4JA 4AG6A 4OI0A 2DFLA 3SQXA 2IS2A 1Z28A 2R62A 1EK0A 2ZRMA 2XSZA 4US0R 1KI7A 1KJWA 2PT5A 1Z22A 3ONWA 4NFLA 2ZRFA 8OHMA 3LLUA 2OT3B 5AUOB 2B1QA 1A7JA 5FR2A 1L7VC 3R4CA 3REGA 2QYHA 2QQEA 1XZQA 5T41A 4HAWA 3DVLA 3QKRB 3WMEA 3ICQB 2G09A 4UASA 5JJBA 3AVVA 5EUQB 1XWIA 5FL3A 3CRVA 3ECCA 4RESA 3WP0A 1RJ9A 1QDEA 4N3NA 2ZUBA 3BD9A 4G5QA 4N0EA 2V7QD 3CRMA 4M9SA 4OHZA 1ZRNA 2QPTA 4YIHA 3D6JA 1OW3B 4C2TA 2FZ4A 4ZKEA 4CT4B 1QVAA 3NHBA 2OBLA 2Y8EA 1XTRA 3CNOA 4Z51A 1FQKA 1II0A 3ET4A 1L8LA 3MSXA 5FUXA 3ED5A 3IDQA 4QJ4A 2C9OA 2ZYWX 1MOZA 1QBKC 5FL7D 1XTIA 5IDVA 1MRNA 2IW3A 3LLMA 3HPRA 3PFIA 1QQ7A 4JDPA 5AWFC 1FZQA 1Z8FA 2VHTA 2VF8A 3A4NA 4JLNA 2G1AA 4NTZA 1Q1EA 1XVIA 3PVSA 5BW8A 2O0JA 1UEIA 1FP6A 2FPMA 2O52A 3LVRE 4R2HA 3QPWA 2ZS8A 4QHYA 5ALUA 2WJVA 1UEJA 2O8EB 1P73A 5CITA 2G77B 3SOPA 2G0TA 5DO9A 3ZQJA 2GAOA 1XF9A 2R8EA 1GZSA 2R9VA 2F3TA 5TY0A 1R5OA 3U7FB 5JECA 5AVSA 4R7ZA 5KOYA 2GEUA 3SHQA 4OI2A 1U94A 2XJ9A 1RKQA 3WHKA 5JJKA 3UMFA 1IY2A 1XPRA 1TJ5A 4QBFA 3VNVA 2QE7D 1OFTA 2EQBA 3E81A 3K9HA 2WJGA 5ALNA 2C96A 4UMDA 3T5GA 3WY9A 5JWOA 3RC8A 2ZSAA 1MABA 1DS6A 3ZU6A 4D4JA 2CK3A 3KXIA 3A37A 1N8NA 4F93B 5F9FA 3QKTA 4RFVA 2WWFA 4PPNA 4JJZA 5J4LA 2OCPA 2X2FA 1CRPA 1Z6YA 1QHIA 1QHHB 4JL5A 4M0LA 1VG1A 4A2QA 3K0EA 5K8UA 2J0SA 2JAOA 1X8JA 1L4YA 3RDPA 4LJ7A 4GOJA 2JAUA 3WMGA 1N0UA 2IYYA 1NF3A 3E58A 5ALIA 4S35A 4DCCA 3CBQA 4JYBA 3T1OA 4YCLA 4ZDJA 2O8FA 4BFUA 5CLQA 3WYFA 2I3BA 2H1LA 3L8ZA 4BZQA 4F91B 3THWA 3LO5A 2JARA 3B9BA 2FOLA 5AICA 2IL1A 2RGAA 4PQYA 4Y2XA 4W7SA 2F9MA 1PUIA 4O2RA 1SXJC 1E0AA 3Q7PA 4Q00A 2WHEA 2WM8A 2YNMA 1TF2A 3T61A 3VR3A 1RVDA 1J99A 2CNWD 3BFKA 2GJAA 1TJ3A 2IXFA 2C8LA 1V5WA 4QGAA 1SWVA 3U60B 4DLZA 2EATA 4Q4HB 4E22A 3F3YA 1Q92A 4NYMQ 3QUTA 4IDPA 621PA 2PLFA 1T0JB 1U98A 3KB1A 1JALA 5LBIA 3A1TA 4HAXA 4ARZB 2ZE6A 3DV9A 1E2PA 3ZQ6A 3THYB 2A78A 2VP0A 3KZ1E 1AQ6A 3FPBA 3LBHA 5ALKA 3K0FB 1E98A 5BN4A 2ODEA 3OTQA 3BERA 3ZWDA 3ET5A 1IJFA 1P62B 4B2PA 3BC1A 1OF1A 3EIEA 2HLDD 2YWGA 1SXJD 1KMHA 4O0MA 3RNLA 5AIBA 1VCIA 1T3LA 1PLKA 3B6EA 3I8XA 4PO9A 5KO2A 1JUDA 1N0VC 1CJVC 3ASZA 3AV0B 3CPHA 1R0WA 5AW5A 1TF7A 1S9HA 2ODAA 5JS8A 5EE5B 2XNDD 1DAEA 3QX7A 2P65A 5EZ5A 4F4JA 4IDOA 1CP2A 2GXUA 1ZAKA 4G5OA 2BMFA 3CF0A 3S1AA 1D6JA 1N5LA 4X8MA 3SYLA 3RAPR 1W0KD 3CNNA 4URVR 2IHYA 4TYPA 2CCKA 3L0IB 2V9PA 1RKBA 2OA0A 2VKQA 3U2QA 3A1CA 1UADA 3PR1A 3KL4A 4FXPA 4Y2VA 1XEXB 4MKIA 3RWOA 1Q44A 4ZCLA 1HQCA 3N2EA 3KTAB 1HH4A 4TT3A 4B2IA 4DLRA 2XZOA 4DDWA 2L0XA 3C15C 3L8FA 1FNNA 2VP2A 2FGKA 1UKYA 2H92A 4GSYA 2IWHA 2NTYC 3WGUA 1HEIA 3MD0A 2WZQA 4QC2A 4URYR 2UVQA 1J7KA 1F2UB 2VEDA 3GJXC 4I1UA 1S2MA 1YRAA 4DIDA 1E79A 1JPNA 1AGPA 2PMDA 2JLQA 4LJ6A 1OIXA 1LFDB 4PPGA 3RANA 1H8EA 1W48A 2RGNA 4NCJA 1RPZA 3KOOA 4GDFA 2P6UA 2R6AA 3P4XA 2XB4A 4KFSA 4XVUA 1G7CA 4UAUA 3GEIA 1GNRA 1OFIA 3CX7A 5TDHA 3TIFA 4A0FA 1Z63A 4UW9A 3U7HB 1YR7A 2BBWA 4EPWA 5AM0A 5KSOA 2OO7A 5BWMA 4Q7JB 4A8JA 1WE2A 2C2HA 4KBGA 3KKPA 2ZI6A 3GLIE 3B9QA 3SDZA 2WPDD 2RB5A 3B9RA 4IXMA 1AQUA 1RRPA 3W6OA 4OKSA 2QG6A 3W8NA 1JB1A 2OHFA 3QSYA 4BX2A 4BE7B 4KSBA 4E88A 3EPKA 1P9WA 2EFEB 2B7BA 4JL6A 1XMVA 2WV9A 3QPVA 3AVXA 2BVNA 1HY3A 3D6TB 1T0HB 2OCAA 3MUFA 2YMLA 2JA1A 4FD2A 2N42A 4IDQA 2VYFA 4QG7A 4Q4AA 4YXWA 4MYTA 1Z6XA 2J59A 4MRPA 1XNJA 4HLQB 4NWIA 3ZIAD 1QQ6A 2GEDA 4KNVA 5EE0A 5G41A 2HXSA 2WKPA 3ZD6A 4EDHA 3IHLA 4BX0A 4KYUA 3DAOA 1Z3IX 2H57A 5ALOA 4ZIRA 4BZPA 1GVNB 2GBLC 2OXCA 2HF8A 1A4RA 1RZ3A 3KKOA 3SYNA 3BH6A 1GIAA 1EK1A 1E69A 1NJGA 2GA8A 3HU1A 2O8BB 1TA0A 4MGZR 4QKQA 3MAAC 2YMQA 3SKYA 2ZVQX 4FMDF 5CB6A 1V43A 1X3SA 3K8YA 1GKUB 2BMDA 3A8TA 3WK8A 1VG0B 1XB2A 4DFDA 3J7TA 4A36A 3LA6A 4HLUC 1JXOA 5BN5A 4DLUA 5IT0A 1N25A 4FYPA 3AUYA 2I7DA 1AK2A 3QEOA 4L57A 4EQ6A 4BFWA 4L16A 1Z2CA 4IJMA 3AR5A 2W0SA 3AF1A 1P6XA 2XZLA 5AK0A 2QA5A 3CRQA 4Z54A 2EARA 1RQNA 2B0CA 3RYTC 4KYTA 2E87A 3VTKA 3U44A 1N0WA 1BOFA 1RYHA 5EJEA 2A3RA 1XTJA 1XZPA 5KDDA 3M0EA 1Q57A 1GTVA 1VPLA 2FUCA 1EWRA 4ZDKA 2J7KA 2RGDA 4XTCS 4RKFA 3T5DA 1U02A 2RB4A 2GF9A 1Z06A 5SZIA 3EAQA 4WZ6A 4C4RA 5HKKD 2JDIA 4C3ZA 5AKIA 1KSFX 2PZGA 4QJ3A 3A4LA 2ATXA 3NBZC 3U3MA 3SJAA 1G4UR 2KBFA 1EX6A 4EJSB 2W4MA 4C0HA 1KDRA 4ZV4A 4CVNA 4US2R 5AKJA 4FW9A 5LDDC 2VO1A 4EUNA 1ZBDA 3LW8A 4GBMA 5DYIA 4GL2A 4BQSA 2CFRA 4PNHA 1BO6A 1XJQA 5ALDA 2Z5FA 2VTKA 4BNDA 1MABB 4HI0E 4DUGA 3QPUA 4Q1DA 4OHXA 4NABA 1SVSA 4EENA 1E9CA 2QRNA 4DT1B 2AN9A 1CJKC 2ZANA 5EXPA 3WNDA 5LB2A 1CBUA 1KK3A 4NCIA 1IY0A 5CLLA 1GUAA 2VL7A 4LBWA 2H18A 4OK5A 3KBBA 2WTUA 2B6HA 4MYUA 2DFNA 4OYHA 2ZI7A 4P4UA 3U3KA 3GLFE 2HYIC 2D7CA 1VYVA 5AKYA 4PHHA 1VYTA 3CUEF 1W36B 4AS3A 4PAOA 1Q21A 4Q1CA 2YOHA 3EC2A 4KFUA 1YR8A 5UKDA 1MT0A 4BWYA 3T12A 2CN1A 4BFXA 2BKUA 1NKSA 3QXCA 4IDHA 2IK8A 2CMKA 1ZS9A 4KN8A 3QU7A 4Q9HA 2FN4A 4AS2A 4MUAA 5GJVC 3P96A 3A1VA 1YZTA 2HOQA 1XFAA 4JKYA 1DPFA 2NPFA 4DZZA 2J3EA 1EXMA 4Q4JA 2CEAA 5AESA 3TSZA 3CF6R 4NCNA 3EWIA 2GFHA 3VAYA 1NVXQ 2CXXA 3T1TA 2ZRGA 4BYGA 1YE8A 4W5WA 2ECKA 1WBBA 4JL8A 2V6IA 2ZREA 3BIFA 1KY3A 2NMVA 5EP3A 4DXAA 3O8CA 2AH5A 4KAXA 1O87A 2OG2A 3CR8A 3JVVA 2JLWA 5ALFA 5A3SA 1U7OA 1KMHB 5AJVB 5TB5A 4B6JA 5FBWB 2GHIA 1RLTA 1MO4A 1BS1A 5JS7A 1RRCA 2AWNA 1BIFA 2PT7A 1CKEA 1Z4JA 4HGPA 2IYXA 4A4DA 3ZW7A 2PEYA 4AYTA 1KJZA 5DNYB 1AA9A 1SWWA 2GCOA 2FZLA 1QQ5A 4B34A 1IAQA 4TMZA 4LSGA 1E9RA 5E4FA 1UKZA 1Y63A 3NTUA 3N8GA 4F4CA 1X86B 2WKQA 4I9FA 1G20E 3AF2A 3R7WA 1ZD2P 1EG7A 1C9KA 1FOEB 2GESA 1F6BA 2VP4A 2D06A 1ZRHA 1XEWY 2ZETA 3WHLA 2IYRA 2PMKA 2RHMA 3I32A 5ALTA 4GNKA 1UM8A 5CIQA 1SVOA 2V6JA 3BB1A 1OH8A 3E8MA 5FTMA 5FBLB 2G83A 3HLTA 3A1WA 1IN7A 5AM1A 5AM3A 4D26A 4IG4A 1Z6GA 2A5YB 3EWSA 1R0XA 4G0NA 3UMBA 3U7GA 2ZYTX 2WIBA 3BK7A 3WK9A 1E9DA 2NO4A 3CR7A 1L7OA 2I6XA 2Q5EA 1KO1A 1KSHA 4IEIA 4RCYA 4UKDA 1ZM7A 4FMBB 2OAQ1 3TW4A 4YGYA 1ZP6A 3D7MA 5CJ2A 3W6NA 1PV4A 4OK6A 1ZM3A 1XJ0A 1YZGA 1N5IA 3PQCA 1KJYA 3AF0A 3BORA 3K0CC 2G9NA 1II8B 2IYEA 1SVMA 1Z4PX 1BYUA 2Z4SA 3MLEA 4HB4A 3U3RA 1TPZA 1SU4A 1P2UA 2O2XA 3SJCA 4A8JB 3WK4A 1E94E 2RKOA 3G0HA 3QLEA 2JIZA 1W2HA 4MGIR 3HP1A 4M1SA 2ZSDA 4NAVA 3SZRA 3FE2A 1C4OA 2JEOA 4TMTA 1QZXA 2J87A 3QKUA 1TF5A 4C7OB 3PCTA 4KLNA 3SMVA 4LPKA 2Z6VA 1KAOA 2J5XA 3BB4A 4DHEA 2FPRA 1PLJA 3PUXA 3KC2A 4C4SA 2W0MA 4LHWA 2YJ6A 4OD0A 1DAKA 2FDRA 1KO7A 4Q4AB 1E9AA 5G3ZA 1XPOA 1OXTA 1LNZA 3FPAA 3OEHA 3ZZ0A 4A15A 3OCYA 3UANA 5D3MB 2XOKA 2JJ1A 3NIBA 1I2DA 1JXMA 3UWKA 2CBZA 4E03A 1N5JA 1W47A 1AZSC 3ADBA 5AW8A 3VHXA 4V0LA 5FI1B 4U7DA 4ZIRB 5AW2A 2CJWA 4TQAA 1WRBA 2PBRA 1JPJA 2OE2A 3RRZA 4HGOA 5EUMA 2WICA 2VLIA 3GJ8A 5FPYA 2RGEA 2GHTA 3QUCA 3R9WA 1RLOA 2IT1A 1Z47A 3REFA 3ZUPA 4PO1A 3MWJA 2ZUCA 1N3BA 3CPJB 1Z0AA 2LCFA 3LX8A 3LY5A 4H1UA 3B1VA 4HUQB 1G291 4KFTA 4BLQA 2YMPA 3F5FA 2FFHA 2HO4A 2W11A 3DOEA 1WZCA 4UU0A 1Z4KA 2MSNA 2IHBA 3KX2A 3EZ7A 3PITA 5AI6A 5AKXA 5ALZA 4CIDA 2V54A 1M74A 4E5UA 2CK3D 1KZGB 2I33A 3QEJA 5ALJA 1U8AA 1ZD4A 3K9NA 5A4JA 4QXAA 3N07A 3L0SA 1KYTA 5EXTA 4Q7KA 2B1RA 1ZD8A 3QNUA 1OH5A 1NNLA 4Q9LA 4NYIR 3IB6A 4X8LA 1G7SA 2ZUDA 1VG9B 2OM2A 2P6NA 4MRRA 5IT5A 2P67A 2ERYA 1G3QA 3LRPA 5BQ5A 2JAQA 4XJXA 1XTQA 3SJBA 5TV2A 3V4FA 2W6JA 3C5CA 3QOFA 4R9UC 1GDDA 3C14C 3DM9B 5FP0A 3DNPA 2HDOA 4EFNA 1XD8A 5AVXA 1Z6AA 3BGWA 3NXSA 2W6IA 3KKMA 1UPTA 3SQWA 5FBVB 4RZ2A 4V0KA 3IHWA 4IEEA 2QTHA 3EF0A 2EU8A 4ILEA 1B0UA 1G16A 3QQ5A 3ZTWA 3PEUA 5AW0A 3DHWC 3PXGA 4JJKA 1U0JA 1XX6A 5FBRB 5AK6A 3L8EA 1RRFA 2OEPA 1HV8A 4DDUA 1J8DA 1LVGA 2VHJA 1K5GA 5AJYA 5DI3A 3AH8A 4A2WA 2A30A 4UNQA 4W9MC 1WVIA 2HT6A 5FPKA 1GP2A 5F98A 3DL0A 2AKYA 1AQYA 2ZQ5A 4U00A 3QUSA 4LV5B 4XPZA 2MSDB 4Q18A 3BH0A 4AG5A 2A5FA 2J0QA 2VHCA 1G4AE 1E2KA 4QRHA 2ATVA 3H4MA 3HU2A 3KB2A 4BGDA 1FTSA 4I1OA 2A5DA 2DCUA 3A6PC 4BEBA 3OIWA 2DPXA 4B3BA 3K70C 3H0KA 1FMLA 4JVMA 1E4YA 1E0JA 4W5JA 5HZHA 1G3MA 2W2TA 1AS2A 3D8BA 2BDTA 5L8VA 2ZRCA 1W0JA 1DO2A 4A82A 2BDEA 4HZUB 3P32A 3SYKA 1US8A 2C98A 2ZJZA 1E2FA 3QXXA 2WF5A 2NO5A 3QVUA 3WBKA 1A5TA 3IKJA 5EP2A 2RGNC 5GJWC 1KMQA 5EZ6B 1GRNA 5AW7A 3QXHA 4C30A 1TU3A 5KUTA 1RKVA 3SI7A 1X6VA 2CLDX 2YY6A 3U26A 2D2VA 1KOFA 4B48A 4WA7A 3L0BA 4NU0A 3SBDA 1W46A 5DN6A 2YHSA 3SU8A 4U02A 4TT3D 5FOTA 3NUQA 1SXJB 4PC3A 3ZI4A 2OILA 4PXAA 2AL7A 1NG9A 4MGKR 1HE8B 5DH9A 2O0HA 4MYCA 5J4HA 5ALWA 2QPAA 4L9WA 1P2TA 2EFHB 2BEKA 4OHVA 2D62A 3L8GA 4NYIQ 1J70A 2GK6A 1E4VA 4EFMA 4RFSB 2O9JA 3RF6A 4HDCA 3LXXA 4JVLA 1H8ED 1KDPA 1QG4A 4J0QA 1NKTA 3RS0A 1FW6A 1D9XA 3MG9A 1R0YA 2QGZA 3D3QA 2ZYVX 5HZKA 2GCOB 1TADA 1O03A 1FL9A 5IK2A 2Q21A 1M2OB 1UKEA 2CE7A 1GG2A 2ZI3A 1A2BA 1NLFA 5KSPA 4A92A 4FCTA 1ZIOA 3FKSD 5IRCD 2LKDA 4M1OA 4Q66C 4TYQA 5JLJA 1OHHA 3CIOA 3W5DA 3C41J 1W2GA 3EIHA 4JLJA 2X4DA 3P20A 2C4NA 1RKUA 3GEEA 4YMTA 2CCJA 5JJLA 1T6NA 4CEJB 1PLLA 3CH4B 3B9PA 4TSFA 4YXWD 4Y2TA 3KQLA 2OFXA 3QNMA 2V4ZA 3AGPA 3VX3A 4QQFA 2BEJA 5HTKA 3AP2A 2QMUA 4WAUA 4V03A 1OB2A 2QM8A 1L7NA 2EW1A 5LB4A 5E7MA 2G88A 2W2VA 3P26A 1FEZA 5F9HA 2HSZA 4DW8A 4MWOA 5JCPA 2GMWA 2GKSA 4LJ4A 1R2QA 3CLVA 1BYIA 1UDXA 3KKQA 4NYJR 4TTRA 3UXMA 4HZIA 3KJGA 4D4LA 5AKGA 3N1UA 2FSHA 5AI0A 1AN0A 4QHSA 4C0BA 4FMCF 1BH2A 1OT3A 3SEAA 5L3QA 3HU3A 4WW0A 1DADA 1X8LA 4CEHA 1CJTC 2F1HA 1NBMA 4QGFA 2W43A 2YC2C 1NSTA 3AKCA 1WCV1 2AD5A 3UMSA 1L8QA 1G8HA 1OYYA 2QAGB 2NZ8A 2WKRA 3FWYA 4IXNA 4MDEA 4KO8A 1TQ6A 2E9SA 4PZLA 3X1YA 3ADDA 1PVOA 2O8DB 4V0NA 2EFGA 3K0CA 4K8OA 1DAMA 4KU4A 1ZW6A 2DY1A 1IN8A 3GMTA 2QMHA 4B44A 1TUIA 2IF2A 3I92A 4P4SA 2IUTA 3PGVA 3TJZA 3CPEA 1RDFA 4B33A 1P3JA 1GL7A 4C0AC 4D80A 3ASYA 3GLFB 2A5JA 3WK5A 421PA 4D25A 1E2GA 3OCXA 3J81k 3C8UA 2C78A 1UBCA 2AK3A 4RJLA 1AJEA 1HA3A 3ZZUA 2LWIA 2CFSA 3WKDA 2IOHA 3SF0A 2PCJA 4Q7MB 4G9BA 2D2FA 3P27A 2WAYA 3HR7A 4NCHA 2FPXA 5AVUA 2JDID 4D0NA 4RD3A 1KI8A 1N2CE 4FIDA 1CXZA 2R8XA 1QHXA 2ZSBA 3SD7A 4PTLA 2JJ8A 5ELXA 1YR9A 2G80A 4BPBA 2ZEJA 4AC9A 3GCGA 3NASA 4PSVA 5EP1A 4L6CA 4FWIB 4Y2QA 4LWZA 4DB4A 3EG5A 3IRUA 2JLZA 3R20A 4GI7A 1Y3AA 1G21E 1D2NA 5B57C 1RIFA 4MQBA 3V9PA 1NN3A 1NVVR 2GJKA 2QT0A 1WBDA 3HPQA 3AF3A 4DUGD 1KZ7B 1J8MF 2AD1A 3TVDA 2CLSA 2O8CA 4Q1FA 3OAAA 4HLDA 3E1SA 3I3SR 1JQLB 2YV5A 1I2MA 2G1JA 3QKSB 4TQ9A 3U5ZB 1M8PA 1NIJA 1TQ4A 1WR8A 4S2EA 4KLZA 3QU9A 1Q12A 3TH5A 2CL6X 1N6RA 2QROA 5F3WB 3VQTA 2V3CC 2OAP1 4C0JA 1Q91A 2EAUA 3VR5A 4HDQB 4HATA 4JLDA 4TMWA 4QHTA 3M9LA 4K46A 4QBGB 4DBLC 4ZO4A 2ZR7A 3EPRA 2ZVPX 1QHYA 3K0AB 5KHOC 2QLTA 5KPDA 3CNHA 4BLPA 3UMRA 2YFYA 5AUNB 1F2TB 4M9XA 3Q7QA 4US1R 4L6AA 2XTMA 4NYJQ 2GETA 2VSFA 1KI9A 3GLHA 2G6BA 2QL6A 4I1SA 2P2LA 3AKYA 5BXQC 1KO8A 2REBA 5FPHA 121PA 4F7WA 4JLMA 3OIYA 1S2OA 4LHYA 5EQTA 3PDWA 1ZNXA 2AX4A 2D74A 2EYUA 4Q21A 3TUJC 1RMYA 3IEVA 3QY0A 1LW7A 5CIWA 4RY2A 2FH5B 3NBXX 1VFPA 3AUXA 3KUDA 3WRYC 3IGFA 2X2EA 4POAA 4EZEA 3LAWA 4H1VA 4ACAA 5AI8A 1Z4MA 2WF9A 1XBTA 2R8RA 3GJ4A 1A82A 3PENA 2OBMA 1FPMA 4BECA 3AP1A 1ZM2A 2WIAA 1N6OA 3PV0A 4DIEA 5JMTA 2QM7A 1YU9A 2J0UA 5AKLA 2DFTA 2YJTD 1KI6A 3LX5A 2B82A 4ZDIA 1CF4A 2RH5A 2R65A 4B3GA 1EX7A 1U8ZA 1YNSA 3HYRA 4Y2UA 2ANBA 2C9MA 4BEWA 2ZJ5A 1FUKA 4IRUB 4JZKA 4NMMA 3NC0C 1XCMA 2ZRIA 4FMCB 4TTQA 3SHWA 3FB4A 4B3CA 1P2SA 2HYDA 3CWZA 4IFBA 1US8B 1M1YE 1XCGB 2QT1A 3RWMB 3VR4A 3O8DA 2QUZA 3U7EB 3FTQA 1G7RA 1Z29A 2AK2A 3TSWA 4BKMA 2VQSA 1L4UA 1JR3A 3TE6A 2F6RA 4OJQA 1ZU4A 1VJ5A 3NBYC 4EPRA 2RBKA 1IOZA 2EWVA 4HB2A 5J4VA 4BEVA 5AVYA 2ZBFA 3IIMA 2MSEB 3I73A 5IF9A 1E0SA 1WA5A 3HDTA 2WSSA 2NO0A 4NHOA 2J7PA 1OXUA 3QVVA 2BIFA 4HEJA 1NI3A 3C7KA 4JVSB 4B35A 1W5TA 2QTVB 3THXA 1JEDA 5AVZA 3SKXA 3EWAA 2WMNB 4KNWA 4DSNA 4LOAA 4DRZA 4UATA 3RS5A 1T4GA 4V0OA 2C9CA 1ESNA 4DLVA 1VDZA 1DO0A 1ZMXA 1D2EA 4G1UC 2N1BA 3AB3A 4MH0R 3TAHA 2JLRA 4B71A 5GJCA 4FCVA 2FPWA 4CYMA 1U2RA 2Q4TA 1SKQA 1KDTA 4JVNA 3QJYA 2J1LA 2JIZD 3TK1A 4IDNA 3FHTA 5ALEA 3WGVA 1ONBA 1Z4NA 3I4LA 2EFCB 1D5CA 1COWA 4LYAA 2IC5A 1ZCAA 2R6CA 5EE3A 2FEOA 4RCZA 3U4QA 1MH9A 5AM2A 4R98A 3O47A 4F38A 4G5SA 3LNCA 6Q21A 1SXJE 4AI6A 4Q01A 2R6FA 3I72A 3OEHD 4F72A 2ZI5A 3W5AA 2CL0X 4JSTA 4Q19A 3SC3A 3ZS8A 1JI0A 1G6OA 2JJ1D 2XOKD 2XAUA 1E9SA 3I8SA 1ZRMA 2AMYA 4Q1EA 2XJ4A 1YZNA 3OE7A 3N70A 1PJRA 4KYIB 4CF4A 1RJ9B 3QBTA 5AKZA 1SHKA 3RVBA 1MKYA 1FNMA 3IQXA 4TL7A 3MWKA 1JJVA 4ABYA 1RMQA 1EFUA 3RRMA 3I1YA 1D9ZA 4X8HA 4Q03A 3X1DA 5H68A 1CQZA 2KWIA 3RS4A 5L3QB 4B6FA 3W34A 4XWOA 5ALVA 5BN3A 5AVTA 1GKIA 1KK0A 5JRJA 1EFTA 2XB2A 1KK1A 2G0NA 1IONA 3FHOA 2JCSA 2RGBA 2OSBA 4GOXA 4TYYA 4KV9A 5FOUA 4Y2JA 3U3JA 3WK7A 1AS3A 2IBMA 1ZD1A 2GXSA 4L4UA 1MV5A 4ZI2A 1IQPA 1P9RA 1R5NA 3QU5A 1KI3A 2HI0A 4BFZA 2GVDC 2IXEA 2AHOA 2MMCA 1F3OA 3HR8A 4XOUA 3Q9LA 5AW1A 5M04A 2B8EA 4K81B 4XH9B 2ODNA 1XMJA 5JI2E 2GWHA 2DWPA 1OE0A 3NVAA 4EPVA 2BCJQ 2BCGY 4HSEA 2G1KA 5AVWA 1GNPA 2W6JD 2NZJA 1G1MA 3CZPA 2UZ3A 4LJ8A 4WXRA 3AKDA 5JWRA 5DGXA 2NGRA 3F0TA 2IX3A 3RSLA 1G18A 4C0QC 2W6ID 4C2UA 3A36A 3PEWA 3O8BA 1NY6A 1Q1QA 4C0SA 5FOXA 2IEYA 4LI0A 4UARA 5HE8A 2WJYA 2ASEA 2PZEA 2ZU0C 4PC7A 2QP4A 1E32A 1LS1A 2F55A 1GFIA 1G7TA 3QF7A 3KFXA 1FMJA 3L8HA 4GP7A 4URZR 2IOFA 4CF7A 5AK5A 1XP5A 1OXXK 1E1QA 2CLCX 1YZKA 2CFTA 2FSFA 1E0KA 3FFAA 1DG3A 2OXRA 2D7DA 2ZU6A 1U99A 3U61B 4HGQA 3AVQA 2FGJA 2QY9A 4OQMA 3AR8A 1MRSA 1QHGA 3NG1A 1UAAA 5JBQA 2QSYA 3E5HA 2O8FB 3MN1A 5L3VA 5CK4A 4BRWA 4DSTA 4I9GA 4A6PA 4YQFA 4PQFA 3NBFA 4CEIA 2FPUA 4BZXA 2VHQA 1Z0DA 4PHTA 3THWB 4HYTA 5AKEA 1G5TA 4EELA 3QU4A 2KJQA 1OLOA 4ITRC 2RMKA 1U81A 1P72A 3IIKA 4DLYA 1XMIA 4Q1AA 1EGAA 2GNOA 4UNPA 4LBYA 2RGXA 3L82B 4LUCA 3Q3JB 1L2TA 3ZVRA 2R2AA 5IT4A 3OFNA 2ZRAA 2O5VA 4G63A 2ZJ2A 2IS6A 4GFDA 1W0JD 4TL9A 4LYHA 1UBGA
chains in the Genus database with same CATH superfamily
2EKBA 1G6KA 2C5EA 2IFTA 4WBNF 4DPMA 1D7AA 2GNAA 2H17A 1XZHA 5HIMA 3FTEA 1ZJ4A 4UULA 3UA3A 3RHSA 2JAWA 5EWLA 4DG5A 3I09A 2J5BA 4OB7A 4S0ZA 3T9CA 3CF4G 4BS9A 4FWTA 4A1OA 4XGIA 5ES4B 2VSXA 1GU1A 3SE0A 2ZITA 1FQWA 2YDXA 4EFKA 4EMTA 4YONB 5KYXA 2QV0A 4TRJA 2Q99A 2WUWE 3GJ5A 2QRQA 2NSHA 5FR1A 4MVJE 2GB4A 2SECE 4WCVA 3L05A 2HCFA 1PEYA 1F0YA 4O4HB 3W77A 2W22A 2ZBRA 1GTSA 3HDHA 1RADA 3ZJ5A 4QVGA 5FPTA 2QTRA 2PQ0A 4WGGA 1Z0SA 1BH6A 1TKRA 4WNYA 5A3VA 4EI8A 2LCIA 1L3IA 1K6XA 1D09A 1KP9A 1O96A 3EIWA 5BNZA 2XCUA 4BO7A 3H5WA 2D0DA 1KKLA 4RIEA 2ANCA 1Z4LA 4ZAYA 5CYGA 1HLGA 1L5OA 3GX1A 1YBFA 4N49A 4Z0HO 2QYTA 3TQTA 5HRAA 5BRNA 5C2JB 4PC1A 1G0NA 2XNJA 3GUYA 3ZHRA 3W5CA 2O7NA 2RDMA 3AHJA 1DVRA 4UDOA 3V42A 3B3GA 3IAAA 1M83A 1QK5A 5JOQA 3TOSA 1Z0JA 3KJHA 5C1IA 4H3HB 1TIKA 4MEJA 2HCJB 1K08A 4AYXA 2VRCA 2EKQA 2F3UA 4K6KA 3ROTA 1T25A 4IOLA 2XWPA 3MC1A 4CIVA 2C2GA 3UK1A 1FA9A 3ZQKA 3F1LA 3ZI7A 1GD1O 1RWQA 5CGQB 3FNHA 4CU2A 3G6WA 3R09A 3BSSA 5JXJA 1GITA 2NX2A 5GAJA 5GP1A 3FCCA 4JSYA 5IKMA 3JATA 4UJ5A 2PUBA 3P5SA 2CMHA 1R5BA 4N6GA 5FULA 2IP1A 4R8SA 3MRXA 1N2CB 4II3A 4DPKA 1PJAA 3N6RA 3LP5A 4H7DA 3NRBA 3NANA 2OCLA 4DBVO 4FDLA 3MUOA 5GV7A 3HKDA 4PX5A 5IPFA 1HNXB 2JIOA 3ONNA 4LYGA 2ZULA 1QIFA 4HAIA 4MO9A 1GG9A 4ED9A 3I8OA 3C1OA 4X9XA 4D9IA 4IHAA 3OEWA 4GOND 2AWOA 2EC5A 3DV2A 1K7FB 4RY0A 1X13A 1ADGA 1W8DA 3DZ8A 4COOA 4ZANA 4BTVA 1WCIB 2FPKA 3HGTA 4M53A 1JDUA 1RW4A 3NTLA 4QU5A 4Z9FA 2Q5JA 4PAWA 1TFRA 1Z2NX 4DDKA 5B2ZA 1VJCA 5LC1A 2O0MA 3T7SA 4C4YA 1VKRA 4NKRA 3TI9A 1D0SA 4LJYA 2MCFA 2NIPA 2Z3WA 2P27A 2EGGA 4XWAA 4BVLA 5D2CA 5KQLA 5MF6A 4LBVA 5CURA 4WA8A 3SQNA 4MP8A 4CM4A 5FOWA 5EUBA 2WI8A 4IJQA 4JYCA 4KFCA 4YRMA 4KUEA 5AJXA 3MTAA 1C3XA 4AQDA 2FWRA 1Z5UA 3NZEA 4Q24A 3B1ZA 4JNKA 5ED0A 2PYZA 1SULA 4MDYA 3L01A 2WYUA 3OFJA 4JXXA 4B3SB 3E9DA 3ABSB 5AI9A 4N3CA 3AHFA 7REQA 2TMKA 3C3PA 3WGYA 4L0MA 1TVCA 2JNWA 5BQPA 2ONCA 3AEKA 4BLRA 1Z0KA 1C3JA 2P1DA 1AO3A 4ZHQF 4MPTA 2O2JA 2EJVA 4LRTB 2IYSA 3KFVA 4OOFA 5AM4A 5F21A 4B83A 1AMNA 1O6ZA 3QXSA 1UZLA 3L8MA 1EVEA 1NJ2A 1A9OA 4KGZA 4KR6A 4D97A 2GHRA 3ST7A 4TYWA 2X9LA 1JFLA 4J7UA 4QPJC 4HYEA 4GKJB 3U44B 1IHYA 3OWXA 3QFTA 4LYFA 3H1TA 4PZAA 3LVBA 3NDPA 1SVIA 2VDKB 1PTJA 1ECPA 3BIJA 3WNBA 4FZRA 1QJCA 1W34A 1NXPA 4BV2A 3TM5A 1UPXA 1VPDA 2ZJ0A 1GKYA 3D3JA 4TL6A 4U2FA 2CL5A 3A6GA 5JZVA 4H7HA 2ACKA 3SR4A 1UJ5A 2JJQA 3R3ZA 3RREA 2WSYB 4DEYA 1SKYB 2AXQA 1NR1A 1RRVA 1YV9A 3MINA 2WVJA 4GBED 1DC7A 2FI1A 2IOFK 1U2EA 3ND6A 4Q3KA 3KCQA 1TE2A 1T6BY 1VLHA 1QM5A 4GBGA 4N0MA 5DTIA 3F2IA 5DI9A 3QOYA 2J5RA 2ZSIA 3KJEA 2C4WA 4LI3X 4JLWA 1IY8A 1M1YB 5KNDA 4PG4A 3DKRA 3SX4A 5FHQA 4GM0A 4WDRA 5EOVA 3SS7X 2W2KA 5KJ1A 3TF5A 1ZH6A 1SO8A 2Z58A 3QIAA 4ENVA 2EZUA 5EXDA 1T0BA 1YS2X 1E6WA 2YZGA 4P93A 1F17A 1JKXA 5TF0A 10MHA 1EXWA 3AEYA 2RKBA 1T3HA 2EOAA 2E0IA 1KMIY 3BN3A 4Z4IA 2SNIE 4B81A 1AK1A 2BTQA 5EG5A 2VYCA 5CM8B 5EXXA 3KPUA 4PLVA 4WVFA 4Y67A 2IDZA 2EG5A 4II7A 3EF1A 1FSGA 3OCVA 1QK3A 5H7XA 3P5BA 1JQJC 2FZVA 1BTOA 2JFQA 3DUFA 1U3TA 2R87A 3JD0A 5EYPA 4L50A 4AJ1A 1G6HA 1A88A 1F6WA 4WOPA 2UXBB 2DP4E 2P9GA 2B21A 3EZFA 3HCOA 3OKFA 1NN5A 3AETB 1RS0A 4WKOA 3G02A 1ZA2A 3KXLA 5J2TB 2AOUA 1H85A 3AM1A 4CKYA 5HF9A 1QUFA 1DB3A 4I99A 3ADCA 5CYOA 2NUBA 1P31A 3WNZA 1U2SA 2O5EA 2VBCA 3KOXA 1WDMA 1YOVB 2IY8A 1PO7A 2XCOA 4N0QA 2JI6A 2ZRPA 1DTEA 3P52A 4P92A 1BXKA 2Y4NA 3B1YA 4UAVA 3TTYA 3UJDA 2IHKA 5DLYA 1SVKA 1ENZA 4HNGA 4AIIA 3QOXA 4XOIA 3N05A 3P45A 2VTDA 5ALGA 2FMKA 3FWZA 3WWEA 3VR4D 2WUFA 4ZCSA 2CBXA 1Z08A 4K05A 2D0IA 4B09A 4MVJF 1GOTA 3OT4A 3QYPA 3UOWA 1JR3D 1U8EA 4KXUA 3O5AA 1PBTA 3V1UA 4EMUA 4PANA 3ZCRA 3MTQA 2PH3A 1JE1A 1NRWA 1Z0FA 2VCHA 2VRBA 3ZC3A 4BYMA 1JQAA 2J7PD 1ZYUA 1Q2UA 5LQMA 4XJSA 2NXEA 3TGPA 4EATA 1K06A 2G04A 4WLVA 2F7SA 3DGFC 3LDFA 3LUHA 3VX4A 3HGQA 4X60A 5C1BA 3COSA 3NKFA 3VJRA 5E95A 1PV2A 2O1XA 3AHGA 3L1UA 1F2UA 2Q3BA 1ONNA 4M9ZA 1GZ4A 5B1SA 5LXTF 3QXJA 3V5NA 4OSOA 2WUVA 2XVMA 4LDAA 1P4GA 4OGLA 4U6QA 3TMKA 1GRRA 1Y9JA 4WOCA 4QEKA 4M9RA 3U62A 4UNRA 3EFOB 1Y82A 3BF8A 2HA3A 3P2JA 3MIIA 5D7BA 4UBIA 2EIHA 3I2IA 1M9NA 4ZVUA 1K5DA 3JZAA 3R7WB 3WLPA 1FDTA 1HNWB 4X20B 5CVVA 2PR2A 4RCVA 1X87A 3FPLA 1XKLA 3I3OA 1J8YF 4EI7A 1QIJA 1NJFA 3B78A 3NHMA 2JGJA 2MINA 3AVPA 1ZQ1A 3AU8A 3GLGA 4RXUA 3X0DA 2PLNA 2I6GA 1JV2B 5JSZA 3W5BA 5ECDA 5LP6F 3BIWA 2QLJA 2BL4A 2F00A 3KZXA 1ECJA 4KQMA 2RGWA 1O2DA 3JVEA 3TFWA 1DT5A 3I6BA 2E18A 3LWBA 1EUDB 3AI7A 1CJCA 4IOKA 1NMQA 8ABPA 5GONB 2CKDA 4CQLB 1IK6A 3MFQA 3BCUA 3R9XA 3ETLA 3BBPA 3FNIA 3T4PA 3IVRA 1MB0A 3D7LA 3QELB 1GTG1 1N6HA 2HQOA 3CISA 4GR9A 4PQGA 3SNHA 5F7XA 3ADKA 3KSMA 4Y30A 3RQIA 4DCVA 2WJIA 4WN3A 3OU2A 1E1MA 3F8TA 1MOSA 4Q3BA 1MH1A 5JCZA 3CCCA 3HKDB 4RSGA 3D3KA 3ANXA 4BLUA 3AVYA 1AKEA 3VNAA 4AK9A 1CRWG 1RXUA 2C9ZA 2VAXA 3WIEA 4BNKA 4JOSA 2O8BA 2W70A 2ZCUA 3TS1A 4BBJA 4UQLA 3DFIA 1DXOA 5AJWA 3K9WA 3Q5EA 5B1HA 1EDZA 1DRUA 1UKVY 3OQ6A 5IKXA 4GX1A 3W6UA 2QRVA 2WWIA 1ZEJA 1DTSA 3C24A 2REXB 5I5GA 2FTKE 3R9IA 3HABA 1JR3E 3L02A 3N3AC 2ZT7A 5DK6A 2ZJAA 4ASUA 4LVUA 2Y4OA 1KXJA 2VDRB 3MS4A 4MUXA 2O0LA 5DW0A 3IBSA 3SE7A 4CM4B 3FVTA 5FXMA 1DXYA 2WWGA 3U31A 2CJWB 1CZLA 1HI9A 1VGQA 2F3SA 1JFFB 4B6GA 2J3KA 5FWAA 4WIAA 2OVFA 3GAAA 4IW3B 5FOSA 3U39A 2K6GA 4NH4A 1NLYA 1H2WA 1YI1A 1AHIA 1KZ4A 1IHXA 3EULA 3H2SA 3PX3A 4RX1A 4AJLA 2PL9A 2WMOB 2ODQA 3ND9A 3RYFB 2P9EA 5G1OA 1XWFA 1MVOA 5M34A 1E59A 4Z86A 4WUVA 4XSGA 3FYSA 2X76A 3AJ9A 1PGPA 2PWPA 3CNQS 1BKDR 3OZBA 3P97A 1R27A 1X8XA 2WF6A 3M5PA 1ZNWA 3DZJA 4EJSA 1S3GA 2GYUA 1L4MA 1I9GA 4Z9YA 5GOZA 3C3DA 3AG5A 3ZDEA 5KDLA 1EE1A 3JQCA 3CVYA 1NFQA 3U3ZA 3CRRA 1P0IA 1C8KA 1NHGA 1LBIA 2WC1A 1II9A 4MW7A 3ZWKA 2IYWA 2XTNA 5SZHB 2J0EA 1ORVA 3OT1B 3OLVA 4RGBA 1QTQA 2VJKA 3CG0A 5KIAA 1IRIA 1I13A 4HDOB 3BL8A 2TECE 2X1HA 4MKGA 4DT1A 1XR3A 2AQ8A 2VRWA 3K5PA 1XRJA 1P4HA 2PKYX 4MTCA 2RHDA 3T3HA 5C7LO 4E6PA 3ZVNA 2WUEA 5TSDA 3V1LA 4AAYA 4CQMA 1EGQA 1HUQA 2W98A 4B2LA 4G2TA 4QU0A 4P4GA 5FF9A 1YH3A 4M0FA 2XKBA 5JSUA 3RSOA 2P69A 3NM5A 3I2FA 1IN4A 1E9BA 3JQ9C 3U49A 2ZYRA 1OYVA 1XVUA 3BAZA 4O6VA 2I03A 1OY1A 3TQSA 2OXFA 3OFND 5I48A 4DUYB 1YC5A 1P18A 2C0PA 3FOAA 2IITA 2WJAA 1KVSA 4NZYA 5CFLA 2OFOA 1YJBA 2VJMA 2ZRJA 2F64A 3TRFA 2W2KB 2IH5A 4AY2A 4W7HA 1BWPA 1OB5A 1VOTA 4IHKA 2WD7B 4L5BA 3BWDD 4I4TB 4ESOA 1D07A 2IYNA 2QY6A 4GP6A 1YC2A 3ZWPA 3IT1A 3GDWA 4J3FA 4BATA 1CULC 4KCGA 2CNOA 3LPMA 2ZZKA 1UBOS 3PDIB 4IHJA 1SEVA 3AUKA 1NL3A 4L15A 1QVWA 2BWJA 4Q9KA 4D82A 3PT5A 4DADA 4F5ZA 1BWSA 1KHTA 2NN3C 3NKVA 4ZRMA 2Q1YA 4UM7A 4ZT2A 2VPZA 1VMIA 3EZ6A 5FX2A 5K0TA 3DUFB 3U9SA 1L3BA 1DHRA 1SKYE 2ZS9A 2PGLA 4LJ9A 2ATCA 3KQVA 4FEAA 3LUDA 5CM2Z 3CEHA 4RS3A 4L7QA 1SZCA 2DHRA 2HMWA 5A5FA 3CC8A 3T5AA 3OQ1A 1KJQA 2MMGA 2P35A 3AJ8A 3NPAA 2OCGA 2PLRA 4HS9A 4RZ3A 3GGPA 3OM8A 4J0GA 3IAXA 1DAFA 3UAXA 1VI6A 3T0FA 3AFNA 1SHZA 1W85B 2JGAA 3NO4A 1Z4QA 2P3SA 1OQAA 2ZG6A 3PXCX 4KUGA 5CDTA 5AM2A 1UBKS 1SGWA 1G8YA 2WVHA 4K9OA 1YCFA 3R0IA 3RFCA 1FFCA 4EJ2A 3EGEA 1H0KA 1FYFA 2GVZC 5C0OE 3GA7A 5THXA 4HXEB 1U90A 3DZDA 3OM1A 5AKKA 4UVGA 5LNK1 3E4DA 3TZ6A 1MPTA 2X8JA 4JQYA 4CM5A 4YRAA 3EPJA 3PG5A 2FY8A 3FMFA 1WNFA 4HVAA 2VRCD 3T06B 3T0GA 1NYTA 1Q0LA 4LJRA 4F3CA 2IBTA 2OBNA 2AVDA 2C77A 4OKIA 2P6RA 3KD3A 1QUEA 4TMVA 3CVOA 4LEIA 2BTOA 1OI4A 1PR0A 3MW8A 1JJIA 1SBTA 3GA0A 3GLUA 4H7KA 2FSVC 3EMKA 4J7XA 4LXXA 1CE8A 3A10A 4JWKA 3D2LA 4PXYA 4OEHA 4V1CA 1ZMOA 1V3UA 1FDVA 1G8PA 1ZIDA 1I7NA 1NMXA 5CAEA 1CS0A 4AKTA 3R8CA 5B30A 1OLSA 1CY8A 5D3KA 1XJWA 3F5SA 3JWGA 3QYFA 3QEAZ 4PIMA 821PA 1DC8A 1FF9A 1U2TA 2XXJA 2JFPA 4BCDA 5JYBA 2O23A 2M6LA 3PLRA 4XE5A 1E9FA 2FK8A 2YN4A 4KZKA 1VRCA 5H02A 4MHTA 2OSVA 2P8SA 1P4JA 2XQGA 3RRYA 4N4AA 4DAOA 1IQ0A 3EEIA 4GC9A 4MTLA 3NT5A 4WK0B 3JQBC 1M72A 3I61A 1X7YA 2MINB 3SHFA 5HP4A 1MLDA 1YAJA 4KHZA 2CXUA 3LSTA 3GLGB 2K7FA 4MWTA 1EVYA 3UJCA 5JSZB 4ND3A 4D8WA 4K40A 4C7OA 4QA9A 1QGOA 3JTEA 4O3MA 2OBYA 2P90A 1FUEA 2VVTA 3HP7A 4DA8A 3OD1A 4QUEA 1VL8A 4N82A 1S7GA 1TMGE 1LJ8A 1PUXA 2CHFA 2NPIA 3CSDA 4D1YA 4JIMA 5TR9A 3UYLA 3K2IA 1Z39A 2DWCA 1TL7C 2D0PB 3LKZA 5H82A 3HMQA 4IDEA 2RAVA 2Q3LA 5D3MA 1JKJB 3B82A 1JZTA 1QMGA 3GYGA 1VJ1A 2SCUB 1T0UA 3BSYA 2Z43A 3DB1A 1S96A 4L5IA 5DTRA 1QSGA 4CEHB 4AUEA 4D3FA 3ZCTA 1VE7A 4CUJA 3Q7EA 4OHWA 5HEKA 5LNK6 3G82C 2VHUA 3ENZA 2DWQA 1U4OA 1VLLA 3KZVA 3ZHSA 3V3TA 3A2LA 1CR2A 1YU6A 5LQRA 5DBEX 4TTVA 4QQ8A 1KK2A 4YQEA 5CM9C 4B3XA 1CIJA 3PHIA 4HVTA 3HCFA 2XRYA 4ISCA 5FL7A 5DGCA 2V6BA 4CRWB 5HUJA 4NARA 4CPDA 4TYNA 2YJ4A 2FFQA 1UFVA 5F2EA 1M67A 1IBLB 4X90A 4B76A 4GG1A 4ZICA 1KYIA 3DFFA 4P0TA 5B57C 1HX7A 4TVOA 3O9VA 3HJCA 4W5RA 3UCFA 2XXAA 3C3JA 1DARA 4KR2A 4L8LA 1GYPA 5C1PA 4KAAA 1M6NA 1B2LA 1UBEA 1VKJA 4DNFA 4AN4A 1PTKA 3BXOA 3KVRA 3BA6A 2M98A 3S29A 4CN9A 5IUKC 1PYOA 3ACBA 1BFDA 4WZZA 3SZLA 1UXKA 1OV6A 1U2DA 2D2EA 2VYND 4HQKA 4RF4A 3WYAA 5B6PA 3OSUA 1V39A 2VF7A 1EH5A 2XITA 3T15A 2WKWA 5KQMA 3Q1LA 4PC2A 4F71A 4XUEA 1SK8A 1QGUA 3NB0A 2XVZA 4O4JF 4YRTA 1RM0A 4BASA 3BILA 2YWXA 5KNDD 4LZZA 4NDNE 1XRPA 1ZM9A 4LYJA 3WE7A 4GLOA 3RODA 1HXHA 4WFKA 4Q9JA 3M4XA 5KWIA 2FLVA 3H9EO 1RQ7A 4OP2A 1A4UA 1D2HA 3PUWA 5LUBA 4HWSA 4G3XA 1BCSA 4JI4B 3HBLA 2O8CB 4CLEA 1GU0A 2J8ZA 4CT0A 4EEXA 2VHVA 2YXDA 4WKNA 4EI9A 4AXXA 3HSYA 1CX9B 5LMNB 3G7NA 5D86A 4RA6B 2P62A 3TXAA 4PIVA 4EUFA 4TVSA 1WMAA 4QO7A 5J58A 3IAS1 2XDWA 3DSRA 4NX2A 4URXR 5LZ4A 2G70A 2TMDA 3MJHA 1KVRA 3AVOA 2Z8YA 3NEYA 3OQIB 3G2QA 3M8KA 4MW6A 5AFSA 4FC7A 4O0LA 2PA3A 4O4LF 4DMMA 2A9KA 3QMWA 5EMNA 1SRRA 2DQSA 4IP0A 3WKEA 1YVDA 1CQWA 1R6BX 5IBQA 2I4IA 3HCWA 3ZU3A 3OFKA 1NVUQ 3CV3A 4G07A 1CVRA 2WWXA 4C0LA 2H4ZA 5F12A 2Q3EA 1IYZA 3HRKA 1LX6A 3B6MA 1LJUA 4KQWA 3BXGA 1L7RA 1Q14A 1L5ZA 3G7SA 3HVJA 5JAHA 3GFRA 4MVJI 5CFZA 2ESRA 4G5GA 2PUGA 1OH7A 5DBFA 2FX5A 3T4XA 2JD2A 2GCEA 1WXIA 3M9WA 3EAFA 3FDZB 3O9ZA 1DC3A 5B36A 1K5PA 3GRYA 3T1HB 3RJMA 1Q5PA 4G1BA 4BLWA 1NNSA 3LQRA 1CU1A 2P9JA 2WWWA 2JGEA 3HYTA 4WCFC 1CUVA 4KQCA 3SSAA 1EVLA 3GGOA 5K5EA 1XSEA 4EPXA 2XGSA 3T3PB 1G5RA 4EGFA 2WB4A 2O5RA 3SMQA 4JJIA 1M7GA 2I3AA 4BCBA 1N5RA 2QBYA 1V8PA 3VFDA 4EG4A 5KTKA 3HCAA 4YCBA 1KEPA 3E18A 4IHJB 3NHAA 1U1GA 2QT9A 1UQTA 5FKJA 2DPGA 1FX0A 1XZBA 1D2RA 2Q45A 2OBXA 2XUOA 1TC2A 1D0IA 2YC4C 4B17A 3FMVA 4GI1A 1YJXA 5IUNC 3OT5A 5ICEA 3V32A 3S1SA 4QYIB 5IFLA 3WWCA 1NT4A 3T5BA 1MJFA 2XNDA 3COPA 1FUIA 1SU8A 1OZ0A 3F6YA 3FCEA 3ZYCA 4X1IA 1P61B 4DZRA 1NQTA 1XZDA 3KDPA 2H52A 1W6RA 4A0HA 5HW0A 1OV4A 1OFUA 1ZQ9A 4QL3A 2J0SA 3MJVA 3B85A 3RW9A 2XMZA 1O94C 4Q37A 4R2MA 5H5JA 5GWXA 1IDOA 5JS2A 2MYPA 4KE8A 1SCBA 3PWTA 4B75A 3ZHVA 3GRRA 4H0CA 2D5BA 4W9RA 5LD2B 3O0TA 1PCXA 3VU1A 1Y9ZA 1N5DA 2BMEA 1M5UA 4FMDB 1LBSA 1IZZA 3R3VA 5B58C 2F4VB 2OCDA 4YUZA 2PPVA 4OY3A 3IAS6 3BXZA 3DHVA 5DP1A 4DDMA 5KOHA 1XRSB 1ACLA 4JC8A 4ZAWA 4P3PA 4PBSA 1V8BA 1Z2OX 3QVKA 2Y1DA 4DXHA 2CCGA 1ULTA 4KKVA 1DRKA 2DHQA 5JNWA 4BV9A 5EEGA 2Y0BA 3AY0A 3VZPA 4NCBA 1NIPA 1O57A 3GQVA 4IVQA 1XCPA 3HKCA 1U28A 2VJCA 1XEWX 4IINA 4IV8A 1N3IA 1DOAA 3R5SA 4LV8B 5DIZA 3AF6A 3EW9A 3GXBA 2UDPA 4ZXFA 2ZR9A 3UV6A 3KT3A 3QKWA 5C18A 1ECFA 3P9SA 2NZUG 3ABRB 1SUPA 1I4TD 3NAQA 2VBFA 1E5QA 2EEZA 3WADA 1NLUA 2C04A 1NUPA 5CH3A 3IT2A 1FTNA 3GLKA 5I01A 2CXTA 2W83A 3KAJA 4BVAA 2AYZA 2FA9A 3D0QA 3DQPA 2GBPA 1UEXC 2XRMA 1R4MA 4N7RA 4GAEA 5DLPA 1ZMBA 2N9UA 3X2FA 1Z45A 4B9EA 4EF5A 5TC4A 1XTPA 4OLHA 2ZROA 3ED1A 3U1TA 2WPDA 4BX8A 1Y37A 1ADBA 1R0KA 4DSOA 1JT9A 4BGUA 4BUJA 5AUPB 2X5KO 2AKEA 1OBFO 3FGPA 4DLXA 2WINI 1TX4B 3ZWQA 1TYBE 2B2XA 3E6AA 4ACBA 2FXVA 4FM9A 4AXBA 1V16A 1UCFA 1EG2A 5EJ5A 1RYBA 2QAGA 3D5EA 3G5UA 4J49A 3ITEA 3WXMA 2P3OA 4NCKA 2C3MA 1J2JA 1KRWA 4ASUD 2MSCB 4ZO6A 4ARSA 3KHSA 4HR7A 4WLNA 1A8SA 2CLOB 4UMEA 5C3UA 4GZLA 1QHEA 2D54A 3DOIA 1EGVB 3HA5A 1NQOA 3EEYA 4JBWA 3I5YA 3FGOA 4J07A 4JJ8A 3U3XA 1N6NA 5K0FA 1FE8A 1S5PA 1YUNA 1ZIXA 1ST3A 2YBDA 3PR2B 2GTPA 1E3MA 3N87A 3KVYA 5JSKA 5A0VA 1L8OA 4CIAA 4PR3A 5GMOA 1L7EA 1YZYA 1CZKA 1LU9A 3K16A 4RIIA 3ORYA 4Y6PA 3X1ZA 2D2IA 3PGKA 4UHBA 4B6QA 4ER3A 4CG2A 3JARA 5EE1A 1WMSA 1CZRA 2W6NA 2XOEA 2ZYUX 3BD7A 4GZMA 3RWBA 4J2OA 2XVYA 1GSOA 4TMKA 1VHTA 2GZAA 3A4TA 3TUIC 3EC1A 1IHDA 4YP7A 3NH6A 4DREA 2BBTA 1FQJA 1YKFA 1IM8A 2G0AA 2GGSA 2QM0A 3IJPA 4QBKA 4CWAA 3DE6X 1E6MA 1ZNZA 2ID8A 5ALRA 2VPIA 2W58A 2NO9A 3OMXA 3UM9A 3R7LA 4GMXA 4EO4A 2HC9A 3GLGE 4UZSA 3WMXA 4DN6A 3EXAA 2Q1UA 1GCGA 3UXYA 3AR7A 4MVJP 1OPRA 4LKRA 4NU6A 5FI5A 4C01A 1OJLA 5I6DA 2Y1CA 4RTSA 2B4TO 2XXAB 1TGVA 1QIEA 4DNXA 2NXNA 4NOLA 5LQSA 4HAZA 5DDIP 2CT8A 3GEHA 2BTEA 3JYHA 4IQGA 3ZD9A 1Z5WA 5JS1A 2J41A 1P7CA 4CQMD 4AKGA 2P2YA 4TS1A 3G9QA 5J2UA 3ELYA 4PN7A 4G0VA 1TK9A 2X9VA 3H19A 3K09C 4AMUA 3T34A 3ZWCA 4E7OA 4U8HA 2GRJA 2Z83A 1N2BA 4QPNA 2FFBA 1NBOA 4NZPA 4PYRA 4DYHA 3B3FA 3OPQA 2HCBA 1VKOA 2IYLD 2V7TA 2VAVA 3DTNA 3FY4A 4HQFA 4PPFA 4QEDA 4QELA 4W82A 4XA8A 1E3SA 1Z4OA 2G5GX 3VSEA 2EBFX 3M6MD 4CLOB 1CV2A 4WNCA 1W36D 2GEKA 3VDMA 2YYSA 5EKUA 3L0PA 1JEYB 3M4NA 5IHPA 2DULA 3QBVA 2FEMA 4OMFG 5K0ZA 4PZUA 1G66A 3AERB 1SFRA 4JAVC 4QJBA 2MSKA 1S2GA 3PUKA 4TLMB 3VYVA 2WWHA 3HCCA 1DE0A 1I01A 1K8RA 2QTCA 2QL5A 3N0WA 1GQOA 3QVSA 4OHPA 3WK6A 3X1XA 3H05A 4EG8A 4F9EA 1NAIA 2NSDA 5KOJB 3KT8A 1VCNA 1LLUA 3ZY6A 2GLUA 4M9QA 2DF8A 3UPUA 2QTMA 1PE0A 1MMFB 4NPCA 3VYTB 4EGAA 2LVBA 3ZR4B 1YB4A 2CWDA 1TCVA 1U7PA 2H0QA 1KI1A 2IX9A 4GOOD 3ZDFA 5K3EA 5JU6A 4RHYA 3PDCA 5HCIA 3FUWA 2PBFA 5FTKA 2NUPA 2VK2A 4ON9A 4NF2A 2H4YA 1YDEA 1ISPA 4EKDA 3DKKA 2YN0A 4NU5A 1IBRA 1HE5A 2D1YA 5LFAA 2G8NA 2WP8J 5HBGA 3T5MA 4LMAA 4TLCA 2G67A 3FBTA 5FHRA 3ENVA 3MUNA 3TNFA 4QNMA 1XNQB 1L5GB 4Q12A 4Y18A 3AVUA 3A3KA 3Q41A 3K53A 2R00A 1DG9A 3NOOA 3PC4A 1JZSA 4H7FA 3DM5A 5KNLA 4LGVA 2VDUE 5EIAA 3A28A 4ANFA 5BQOA 4B7CA 4NE2A 4MIYA 4JBYA 2O3TA 4L4SA 3T4UA 1HZJA 1G42A 4BVKA 3KVVA 3E82A 1T24A 3L8YA 3P2YA 4ZOBA 3B3AA 2GWRA 2AZTA 3GWZA 4OIFA 2C61A 4PC6A 3UUGA 3DH0A 3KQNA 2W42A 2QBYB 3HYSA 4OI4A 3B8EA 1S1CA 4PSKA 4QASA 5T8KC 4RF5A 2PWZA 4RSRA 3M5DA 2PRKA 2DFDA 2QP9X 4M22A 3LXMA 3N86A