1RC8A

T4 polynucleotide kinase bound to 5'-gtcac-3' ssdna
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
301
structure length
289
Chain Sequence
b'MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELVKRNSKRGTKAVPIDVLRSMYKSMREYLGLPVYNGTPGKPKAVIFDVDGTLAKMTDVINPMVVELSKMYALMGYQIVVVSGRESGTKEDPTKYYRMTRKWVEDIAGVPLVMQCQREQGDTRKDDVVKEEIFWKHIAPHFDVKLAIDDRTQVVEMWRRIGVECWQVASGDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*CP*AP*C)-3'
publication title Recognition of DNA substrates by T4 bacteriophage polynucleotide kinase.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase/dna
total genus 87
structure length 289
sequence length 301
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rc8A01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rc8A02
1YRAA 1R4AA 2O8EA 3KX2A 221PA 2WSMA 4ERNA 4H1WA 4A36A 3I4LA 2NYVA 1HQCA 2W2TA 4LGMA 3C14C 2DYKA 1L8QA 1UKZA 2ZSEA 2EU8A 1J70A 1Z4IA 2IEYA 1G8PA 1U81A 4GOKA 2BBWA 2P11A 1W47A 4HAVA 5JWRA 5EP3A 2AKYA 2GRJA 3DEFA 4HB2A 1BOFA 1TAGA 2ZSBA 3CUEF 4PZYA 1Z4NA 3N2EA 3G82C 3B9QA 4LHVA 5TARA 1VJ5A 2NIPA 5AI4A 3NBZC 1E9SA 4RFSB 3O8RA 3O47A 2WF5A 4GSYA 2XXAA 2I1QA 2E1RA 2OSBA 1IJEA 2JLVA 2A5FA 3ESRA 2OV2A 3TR5A 2MSEB 2PCJA 4L5BA 5AUOB 3QUTA 3EXAA 3U3RA 3V4RA 4IFTA 1TJ5A 1UDWA 4BE7B 2R8EA 5CYPA 2WKQA 2WIBA 2C95A 2XTNA 4GI7A 2R8YA 1VCNA 4PC7A 2PLRA 2QI9C 3SHWA 1Z4QA 4Q48A 2AKAB 4V03A 2HHLA 2QQEA 5J4LA 3WK5A 2IHBA 3HP1A 5HKKA 2XTMA 1VYVA 3CNLA 5FL3A 5IHPA 2C99A 3IO5A 2CFSA 1E2HA 2PQ0A 2ZI9A 5EZ6B 4UARA 2CCGA 2IA5A 5DHFA 1OSNA 4D82A 3U44A 2ZJ8A 2Z5FA 4I1OA 2WHEA 5ALHA 2AFIE 1P3JA 5SZKB 1UF9A 1YDFA 1JR6A 1ZRNA 3WYGA 2MU1A 4DLVA 4AIIA 1E9CA 1A2KC 4NYMQ 3W5DA 5KYKA 1NLFA 1IN7A 4AI6A 3TAHA 3SDZA 1XPOA 2GHQA 4YCNA 1JR3A 1Z83A 1FFHA 3MRSA 4OYHA 3N5CA 2IYYA 4J03A 2D2FA 5ALVA 5EP2A 1IXRC 1Z4MA 2YFYA 3VU9A 1KTVA 2ONJA 1QQ7A 3K0CA 1KO8A 2CBZA 1E4YA 1II0A 2QBYB 1L6RA 1Q0UA 3CKLA 3N07A 3R9KA 1QRAA 1RIFA 3UG6A 4AG5A 1M6NA 2AWNA 5G3YA 4AKHA 2B8JA 1UADA 3C7KA 4I1SA 1LFDB 2FG5A 4L15A 1LF0A 2ZITA 3B6EA 3D7MA 1GKUB 3L0OA 2FN4A 2J0UA 4NCIA 5EJEA 3M1YA 2IYTA 5CDFA 2I33A 3QENA 4PHHA 3EC2A 1M74A 3RS0A 3TUIC 3M1IA 4EAQA 4TN1A 1VPLA 1Q20A 1QHHB 2VL7A 3L2OB 4B35A 2AL7A 2XZOA 2UKDA 2HF2A 4OFZA 4EX7A 1QVAA 4QBGB 1JALA 1YVDA 5K8UA 3P26A 4RETA 2DCUA 3SHFA 2OCPA 1RLOA 3DPUA 3ZQJA 5AKZA 5CK4A 2A7QA 4UKDA 4XQ0A 1ZU4A 5ALEA 1E2EA 3NC1C 3UATA 3IUYA 3B2EA 1SGWA 1W0JD 3CNNA 3PUZA 1S2MA 3KDSE 3P32A 3D31A 3FVVA 3L0YA 2IYSA 5D3QA 2V55B 4I1VA 2GAOA 5BW8A 4M1KA 2BM1A 1EX7A 1G7RA 1YZLA 3EZ2A 4UNNA 5ELXA 2RARA 4JLPA 121PA 4ACBA 2GZHA 1G21E 4R9UC 4HDCA 4I1UA 1ETUA 4YXWA 3G0HA 3IBYA 2QG6A 4FMCF 4DWJA 4PQYA 3I5XA 2QP3A 2GF9A 4UMVA 2W6ID 3LWNA 3SLRA 3SNHA 3ESQA 4N0EA 2FNAA 3MFYA 5CLLA 1HE8B 4MDEA 2JAUA 4WZAE 1L7VC 1P75A 1S0UA 4D4KA 1SXJA 5FOTA 3I8SA 4LSGA 4DLZA 4BFVA 1HEIA 4OKSA 4V0ME 4F7WA 1N6KA 5ALXA 4C0QC 4EQ6A 1C9KA 3T1VA 2ANBA 4BEVA 2GXUA 2P3SA 2GCOA 3RC8A 3AB3A 1KNXA 4B47A 2B7CA 5ALFA 3L43A 5C4MA 3MN1A 2C04A 3QSYA 1E3MA 2B7BA 2ASEA 1VKJA 3GJ4A 3QY0A 4LPSA 1CR6A 3F0TA 2IXEA 2ZRJA 5AW0A 5H70A 4YXWD 2QP9X 3P20A 2GA8A 1F2TB 2G1JA 2QSYA 4LRWA 3FMFA 5DIFA 4DFDA 3GJ5A 4BPBA 1R0WA 3UMBA 1W49A 5IT4A 5JWOA 3GJ0A 1GILA 5DYIA 4JJKA 2QEQA 1YR8A 3Q72A 3RRYA 5AW3A 1H8EA 1JPJA 3KQLA 2F55A 4GXTA 1YZNA 5CJPA 1SXJD 2QMUA 3K53A 1DEKA 2DY1A 3EARA 1DVRA 4EPXA 1Z0DA 2WWWA 3IIMA 2K5UA 3AVPA 1YKSA 2R6FA 4RD3A 1RKUA 3UPUA 4D0GA 3DDCA 5AKGA 4JSYA 2F1IA 1EESA 4KSBA 4BZPA 1KJYA 4A0GA 2GEVA 3ZS9A 4A8JB 4DB2A 5BN3A 4OJQA 3ED5A 3CF0A 3RF6A 1KI1A 5FPKA 1U94A 1CBUA 1NBMA 4YIKA 3EG5A 2NO9A 2MSNA 1OYYA 3RRNA 4PPNA 1QBKC 4DIDA 2QE7D 3VKGA 4B74A 1EFUA 2GILA 1UFQA 4XTRA 2RB5A 3EPJA 1T8TA 3K0FA 3L1UA 3WKAA 2ZS8A 4D80A 3FM9A 2GJAA 5JSZA 3GLFE 4EENA 1ZM3A 2VEDA 2XB2A 3B9PA 4POAA 1I2MA 5AW9A 2XB4A 4X8MA 2F7SA 4QBHA 5EUMA 3MCAA 4JBYA 1U8AA 2C78A 2V8OA 2YZ2A 3QKTA 2VHQA 3KJEA 1UAAA 2R6GA 1TX4B 1YQTA 4QBIA 3WGVA 1VHLA 5J4HA 2HV8A 2J9RA 2FH5B 3CX8A 1AQ6A 4B2LA 1NG9A 2FU5C 2YJ5A 2XITA 4OHXA 5KSPA 3N70A 1AA9A 5P21A 1Z88A 5AW7A 3QU4A 1E9EA 1NBMD 2G9NA 5A3QA 3E1SA 1ZCAA 4HGPA 3VAYA 1JB1A 4D26A 2NO5A 5CM8B 2Q0HA 5AICA 2GMWA 2ZRMA 4P4SA 3K09C 1YU9A 2JLUA 1T9HA 1G64A 1KAGA 4CGZA 3U61B 3THXB 3EIEA 3UMSA 1DPFA 2WV9A 2F9LA 4GP6A 4MYTA 4YMSA 5HCNA 1IY1A 3BWVA 3QVUA 2BCJQ 4Y2TA 1LW7A 4OI4A 2IHYA 5ANRB 3W9YA 1II8A 3CNHA 3WK8A 3NTUA 3X1ZA 3CBQA 3UMGA 3LW8A 3U3MA 3LX5A 3GFTA 3ICQB 1S2OA 2ZUDA 4DC9A 3F5FA 2P6UA 4G5SA 3GLFB 4CEHB 2QROA 5E7IA 1ESMA 2EYQA 1NMZA 5FTNA 1GWNA 1ZC4A 1ZD8A 4B3DA 5JRJA 2HCJB 4K46A 5AKLA 3F8TA 4JS0A 2VYFA 4C0AC 4A4DA 4EPYA 4M1SA 2HUPA 1NSTA 3AV0B 5ALTA 4AP9A 4EPTA 1JI0A 3L0SA 1RMQA 2BBOA 5A5GA 5F2EA 1KO1A 1NLYA 4CYMA 4JLDA 5H8WA 1E98A 4WZ6A 4D4MA 3CZ4A 5JI2E 2BBTA 2RAVA 2HDNB 2G80A 4C30A 1KO7A 1N0WA 4Y2XA 1RRCA 5E4FA 3RVBA 1EFRA 1GZSA 3TE6A 3MMPA 5LD2C 4Q18A 3SS8A 5FL7A 2J46A 2HJVA 4PO8A 1KK1A 2CE2X 4C2UA 3R8FA 2GO7A 1T5IA 4L9WA 3QU7A 3V4FA 4GFDA 1TUIA 4HAZA 1E2NA 2FFQA 1KAOA 2W0MA 3SKXA 2YMQA 2CJWB 2Q3FA 2F43B 4FW9A 5AVYA 4PANA 5FTKA 3LBNA 1SWWA 4HAUA 1NRJB 2P6NA 2KBFA 1D5CA 5AIAA 1P2SA 2C4NA 1EG7A 1V43A 3ETLA 2OUKA 4L16A 3SZRA 1XPRA 1VIAA 4A6PA 3AKDA 1XZQA 4DVGA 4QBFA 2LKDA 3CH5A 2REBA 4UNPA 4NPHA 2H8KA 3WY9A 4B33A 3ZU6A 2FPKA 3BWDD 4XOIA 5CK5A 1D9ZA 4URXR 1F5SA 1TADA 2GXQA 3DKVA 4LJ4A 4IJMA 3T06B 3SI7A 2ZS7A 3IHWA 4PAQA 3PG5A 2H5EA 3AF2A 5E95A 3RRMA 1C1YA 4QHTA 1CKEA 2ODNA 2GKSA 3CNOA 3BFKA 4MRVA 4Q7LA 4MRPA 2VP4A 4TTPA 4R71A 2HEIA 3RANA 3O8DA 1X8KA 1XU4A 3RS7A 2AD1A 1W5TA 4LJ7A 1IJFA 1R5NA 2H16A 3BRWD 3DO6A 3HWSA 3THOA 4HDOB 2FI1A 3N5KA 5EE5B 1N6LA 4CEJA 4AY2A 4YCMA 4UMFA 1P2TA 4JBWA 3U3OA 4E03A 1MO4A 5ALUA 1NI3A 1XMIA 1Q91A 3CRVA 3T61A 4F4IA 1TJ4A 5EE3A 1S4QA 3AVTA 3ZJYA 1TQ2A 2D7CA 2OCBA 1ZD4A 4TLEA 1TE2A 1QHGA 1LF5A 4RD4A 1VFPA 1ZS9A 1W2GA 4I81A 2PT5A 4KJZA 3W5IA 2AH5A 2WBLC 1GUAA 2EFGA 4HATA 2GEUA 1NN3A 4MGZR 3RDPA 4DCSA 3UM9A 1RJ9A 1CF4A 4BFTA 2B8WA 2QPAA 1QG4A 3LV8A 1Q22A 4KXFB 4EIWA 2ZSAA 1CTQA 2GK7A 3GLHE 3KD3A 2JASA 4IFBA 2J0QA 2ODEA 3FWYA 3TRFA 2EATA 3VR6A 4Y2UA 1DE0A 1AM4D 4FINA 5AKJA 3OIVA 2A30A 4BGDA 2ZI3A 3GJXC 5DSZA 1H8HD 2ZRKA 3KKNA 1O08A 3B7GA 2G88A 3QE0A 4UU0A 3PEYA 3C15C 5EE9A 1W4CA 5HE8A 3VHLB 5KOYA 4RSGA 4AURA 2BMDA 1XPJA 2QMHA 4AYTA 2F3TA 1WXQA 2ZJ2A 4G01B 2VA8A 1G291 2VSOA 4LC0A 4HGQA 4V02A 1S9HA 1E2PA 2O52A 2ZROA 2EW1A 1X8JA 4TMXA 1K5DA 3QKSB 3L0PA 1Z29A 2IS2A 3MWYW 1I4DD 2GEDA 2QUZA 2NZ8A 2OA0A 3VHXA 1FQKA 3FMOB 4MH0R 3BOSA 1E9DA 4M9ZA 3W90A 3OE7A 2BHRA 1X8LA 2NGRA 2H17A 5G3ZA 5JI3E 2O9JA 2C03A 4NCHA 2ZI4A 2C8VA 3CRRA 5H68A 4YMVA 1U90A 2IOFK 3CLVA 4UU1A 2Z4RA 5EP1A 3GLHB 4KYUA 3UMRA 4CT5A 1VCMA 2QMEA 2QQ0A 2RAPA 4LBZA 1DAHA 3TBKA 2KWIA 1ANKA 1GDDA 2C8KA 4Y3UA 5AK4A 3REGA 3VMFA 2RGAA 3KTAA 3L0IB 2FFBA 1E1QA 2WF8A 5HZKA 3T34A 1OB2A 3A1SA 4A2WA 4NCNA 1QHXA 2IYLD 4IOKA 1BYUA 4TQAA 1CJMA 4UNSA 3ZDQA 2Q9BA 1PLLA 1UEJA 1SULA 3TMKA 4CNQA 3ZIAD 1KSJA 2WSSA 3TAUA 2IBMA 3GQBA 2OHFA 3OAAA 3OEHD 5FBWB 3KQHA 3AQ4A 3HDTA 1KI6A 5AUQA 3GP8A 4Y2QA 5F9HA 1UDXA 2CL0X 1DAIA 1VYTA 5FUWA 3OE7D 1XP8A 2FE4A 4HYYA 2IOHA 3HU2A 1P9WA 4N0DA 5SZJA 3EZ9A 1GG2A 2QP4A 3A58B 4TLDA 2EVWX 1IQPA 4CZ2A 5CIWA 1GNRA 3BK7A 5HCIA 4C4TA 3J7TA 1E6CA 2OZEA 2CVHA 4EELA 1KI9A 3AP2A 2C5LA 1HT2E 2ZETA 5M04A 5AK3A 1XF9A 3R9XA 4QJBA 1J99A 1K5GA 1W7AA 3AKEA 4Q7JB 3AKYA 3TKLA 2ZXEA 2WAYA 3AR5A 2AXNA 4BFYA 4JLJA 4RZ2A 5AJWA 2P27A 2G6BA 3PR1A 1ZD3A 1WE2A 1AK2A 3CZPA 4RKFA 3ZVMA 1W0KD 3ADCA 4US1R 2JAOA 1M2OB 3K0CC 4MGIR 2YYZA 4Q00A 5AJVB 3X1WA 1SQ5A 5G41A 3H1TA 4JL6A 1XEFA 4JBXA 1XCGB 5T41A 1ZAKA 2ZRFA 5IT0A 4Q19A 1EK0A 4OQXA 2H18A 4C3ZA 1RW4A 3K70B 4XTCS 1IM2A 1MT0A 1C4OA 2GF0A 5AI6A 2ZRHA 3I76A 4NYMR 4M1YA 4ZDJA 1P2VA 2GBLA 2EYUA 2WM8A 2REOA 2GJKA 3U5ZB 1W2HA 5JCPA 1W4RA 4BBJA 1QHYA 4C4RA 1WRBA 3BB4A 1ZCBA 4BLOA 1GAJA 1UBGA 4BEJA 2QT1A 1CJUC 1O3YA 4PC1A 3WYAA 4NV0A 1WDTA 3WKCA 1TPZA 1ZM2A 2FWRA 4AKGA 4JLNA 3FKQA 1FMLA 1OHHD 1OIVA 1DAEA 4KU4A 4QGAA 4NDZA 4PC3A 4DLRA 4OK6A 1KK3A 2C9CA 3PIRA 3RYTC 3SEAA 1RKVA 2F1JA 1ZNWA 4C2TA 1H65A 3NBXX 1KOFA 1XTRA 1ZD9A 4E09A 4FE3A 3TR0A 5DYGA 5FOSA 1ZD1A 1E2LA 3O8BA 1ZJJA 4F92B 2OILA 1XEWX 2L0XA 4BX3A 1E2JA 2OE2A 2O0JA 3OZXA 1AIPA 1YZQA 3K9HA 4G1UC 1KNQA 3AP3A 4U5XA 3LH5A 5FBQB 5ALYA 1KMQA 3TK1A 6Q21A 2D2VA 5AVTA 3S6JA 3Q8XB 5FUVA 1D8TA 3K0AB 3EWSA 4B44A 3AVWA 1FUKA 1Z2CA 1ZVQA 2QAGB 4B32A 1Z08A 3QQ5A 2ZSFA 2O8DA 1RFLA 4W9MC 5EQTA 1F2TA 4Q4HB 4GZMA 4K8OA 3MC1A 1N6PA 2P65A 4Y0AA 2IYEA 2WFAA 3AVQA 1R5BA 1XXHE 3IIJA 3DVLA 4OHZA 3A3YA 2JJ2A 3ZS8A 2QU8A 4OQFA 2G08A 1RRPA 4LV5B 3BB1A 5DO9A 1R2QA 1U0JA 2Y8EA 2W83A 3B1VA 4QG7A 4C0KA 4TTRA 5JEDA 3QPWA 3AVUA 2QRNA 3ZUPA 1G7TA 3QKRA 3NASA 4IVPA 4IXMA 3WNCA 3TUJC 3BA6A 1T8UA 2O8BB 1JQLB 2FMXA 3W5JA 4AK9A 4KBFA 3UMFA 5ALRA 4MRSA 5EE0A 2Q9AA 2VLIA 4V0MA 4BLPA 3L8HA 2C88A 1ZP6A 1XRJA 2BEKA 2WWXA 3A6PC 3DOFA 1S96A 2ZREA 3MGCA 1RZ3A 4D0NA 4M1TA 2E9SA 1WR8A 4EJSC 2ZJYA 4MYCA 3ZWKA 2GNOA 1IY0A 1FX0B 1IXZA 1T5SA 4CW7A 2C9MA 5ALOA 1GL7A 1CJVC 1AZSC 1WMSA 2JJ2D 4LPKA 3REFA 2O8FB 4UMEA 1ZW6A 4JYCA 2C9YA 1Z63A 2RBKA 4A82A 2VP5A 4M22A 2A5GA 1FL9A 1YR7A 2IWRA 2WJVA 2B30A 2FZ4A 3KFXA 1K1EA 4NYJQ 2IF2A 3ND9A 1M1YE 3THWA 2FUCA 2YOFA 4QHSA 2ZJAA 1AS2A 1YR9A 4M0LA 1G16A 3CWZA 4DSUA 2GCNA 1NF2A 1M7HA 4MUMA 4EFNA 4RKEA 2OAQ1 3NALA 1KO4A 1NVVQ 4OK3A 4C0JA 5GVRA 5IT5A 3A4MA 2QORA 4Z51A 3GLGB 5ALWA 3RS4A 4Q9KA 4QC2A 4CIDA 1FNNA 2CN1A 1W36B 4UJ3A 1KK0A 4GRAA 3THXA 1HUQA 5AKYA 2GK6A 5A4JA 4GOJA 4OI1A 5JJLA 2D2EA 1ZM9A 2C77A 2QY9A 2V4ZA 4ASUA 3F9RA 2AXPA 1E79A 3KQKA 4YH1A 1NRWA 2JARA 2BVNA 2WTUA 5DN6A 4BUJA 2EFEB 1G6HA 5GJBA 2ZE8A 4B2PA 2F9MA 3ONNA 1WVIA 1LVGA 2PBRA 3GLFA 5H1YA 4CEHA 3ADKA 3I73A 3VX4A 4AKIA 1KSGA 5F9FA 1U02A 4GBMA 5BXQC 1GP2A 1G3UA 1OIWA 3IJ5A 5FR2A 3ECCA 2QSZA 2G1KA 3DZ8A 1KZGB 1G4UR 1RVDA 5C4GB 4DB4A 5ALJA 1NY5A 3ZVNA 3U7EB 5JJIA 2ERXA 2RGBA 1G20E 4FCTA 4UW9A 1EFHA 5B57C 1V5WA 1ZYUA 1BIFA 2WICA 3H4MA 3AR3A 4JLVA 2OEPA 2J0SA 1FOEB 3OIWA 3Q7PA 421PA 4EEKA 1GKYA 1VDZA 2ZRDA 3B1XA 3LVRE 5C2JB 4DUGA 1E79D 4DCNA 5KNCA 3QU9A 3PENA 1DG3A 2OBBA 2YKGA 2XTZA 2IW3A 1YV9A 2OLJA 5KDLA 3NXSA 2CCKA 2MMCA 2ZIAA 3GEIA 2IYXA 2ZR0A 4Q1BA 5L3SB 2BDUA 2FPSA 1GL9B 5EE1A 2G77B 3QBVA 2YHSA 2VF7A 1QQ5A 2CJWA 1BYIA 2F43A 1TEXA 2NPFA 2R6CA 1TNDA 2PLFA 5JHGB 1LY1A 1R6BX 1AQUA 2JJ1A 4N3NA 4Y2RA 3D6TB 2Z6VA 2BKUA 5TY0A 4AD8A 2OXRA 4JL8A 4DW8A 2YWHA 2GJ8A 1OFTA 8OHMA 1Z0FA 1T6NA 3DHWC 2P69A 3VX3A 3ET4A 5HKKD 3D3QA 2ZE6A 2J59A 4KCGA 4L8GA 1TQ4A 4DUGD 5KPDA 4L57A 3U26A 2R8XA 2H92A 2HT6A 1PLJA 4RCYA 3WK6A 4YMTA 1KZ7B 4E5UA 4R2HA 2CLSA 3RAPR 1W46A 2HLDA 4PO1A 4GNKA 5AVRA 2JLQA 2IUSA 2BMFA 4MYHA 4QJ5A 2OCYC 1LS1A 3NHBA 1TL7C 4JVSB 4DLUA 5BN5A 3KJHA 5AM1A 1NG1A 2DBYA 5JS7A 4KYTA 1JR3D 2ORIA 3A1UA 2J7KA 3G5UA 1TF7A 1GL6A 4DCUA 2W2VA 2JJ1D 2X2FA 2ZRLA 3IKJA 4MGKR 4HB3A 3DL0A 2I7DA 3IILA 2BBSA 4MKHA 3IRUA 2PEZA 4HUQA 3D6JA 5K8LA 3EASA 1I2DA 4OD0A 1VCIA 1P5ZB 1IAQA 2FGKA 2PJRA 2UZ3A 3Q85A 4PSKA 3ZWDA 1KI3A 5KNBA 1COWA 1ZU5A 1IN6A 4QGFA 1G4AE 4YMWA 5HPYB 5ALPA 1GNQA 4ZCLA 3RRZA 4A6XA 4P4UA 4DEYA 1UBCA 4FD2A 4Q1FA 2IX3A 1SKYE 4ARZB 4UM7A 3GEEA 1AKYA 2HLDD 5B30A 4HGOA 3K8YA 3BE4A 3M4YA 3LRPA 2OFOA 2XNDA 1OKKA 3THYB 2FUEA 2QTHA 1NN5A 4HZUA 5AM0A 5FOWA 3AR2A 2HX1A 3U4QB 4G0NA 1ZUHA 4U7DA 2CCJA 1Q3HA 4PHTA 5AHXA 1ZIOA 3ZZTA 1S3SA 1TU4A 4FWTA 2IS4A 2D7DA 1TMKA 1IBRA 4DLXA 3EW9A 5LD2B 3ZD6A 2BMEA 3NEJA 4G5QA 3T35A 5ALZA 3NIWA 1E96A 1E2QA 2ZG6A 4DSOA 3TIFA 5L8VA 3VNVA 4UAUA 3VR3A 4D25A 5KPJA 2YBDA 1TU3A 3W6OA 2WWGA 3KFVA 2X1VA 2ZE5A 4P4TA 3IEUA 1UJ2A 4LBYA 4DZZA 1RE0A 4ZI2A 1P2UA 3CONA 3PCTA 4Q4AB 4DT1B 5A3RA 4UXIA 4OI0A 4Q1CA 4CE6A 5L3QA 3KXKA 2BC9A 4BFWA 3FMIA 4LHZA 1D2EA 3ADBA 1XMJA 5GJVC 4NAVA 4NWIA 3MUFA 2NO1A 3CPEA 2XNDD 1OKKD 4BLRA 1XCMA 3R9IA 1G6OA 3PUWA 3I32A 4MQBA 3W5AA 4WAUA 1CR0A 4TMVA 1DAMA 1L4UA 3OEEA 2UVQA 3RS2A 1SKYB 2ZRGA 3TQFA 4YDHB 1J97A 5D3MA 2FPRA 1KMHB 2ODWA 1ZD2P 5EP4A 2PZEA 3CO5A 4D81A 3OCUA 4B6JA 3Q7QA 1ZJ6A 4PO9A 4XIGS 4EJSA 4NTZA 1G8GA 4MRNA 1MRSA 4LHYA 1XPUA 3GLHA 4M9QA 1JUDA 3KC2A 2A5YB 4RD2A 4AC9A 1E0KA 3UK6A 2F1HA 2PZGA 1ZUIA 2QT0A 4JKIA 1G7SA 1KDRA 4XOUA 2W58A 1CRQA 2YC2C 2DWQA 4LJ8A 4TYWA 1E4VA 5TXGA 3E8MA 2V6JA 5KUTA 5JEEA 5DE3A 4DWOA 2VHTA 2GDJA 1H8ED 2YOGA 2QZ4A 4KBGA 2WJIA 1IHUA 1JXMA 3AH8A 3W34A 2NG1A 5CB8A 3BERA 3E81A 5LPNA 3OCVA 3KQNA 5C46F 2A3RA 4TTQA 5KSYA 1QZXA 1CR1A 4B3CA 4QXAA 4B3GA 1SVKA 1T3SA 2OESA 3W3AA 3LD9A 4MITA 2IYZA 4PTLA 3WHKA 5AIBA 4LJYA 3GJ3A 1OXTA 1TQDA 3PCRB 4NKRA 3WBKA 4WBSA 1S9DA 2MSCB 2ZAOA 3MWLA 1XTSA 3ZQ6A 4TSFA 2OBNA 3DMDA 2VO1A 4DSTA 5FFMA 4DLTA 2A2ZA 3ZH9B 2NMVA 3KKPA 4OHVA 4PHFA 1Q57A 5AK0A 1EX6A 4RZUA 2CHGA 1MABA 1NMYA 1E2IA 2YJTD 3FE2A 5DI3B 4OQNA 1FP7A 4BQSA 4G9BA 5ALQA 1BO6A 2FEOA 2W0SA 4EFMA 1G8YA 1HQYE 1ZNYA 3CPJB 3BD9A 4LDJA 2IK8A 4UAVA 1ZINA 1OE0A 5EUQB 5EXSA 2PX0A 4ZKEA 3GD7A 4YMUA 2PKEA 1NJFA 4L6AA 2DR3A 5AI9A 1GITA 1G3RA 4CEIB 4IRUB 3ZGXA 4PQFA 5TVKA 4TL6A 1KY2A 3K9NA 3SN6A 1OPXA 3B1WA 4JDPA 1OXXK 4TSFD 3PEVA 2ZXUA 4QQFA 1CXZA 4DXAA 3U7HB 2FDRA 2R6AA 4G5RA 3JZAA 1HT1E 1Z4OA 2R65A 2JDIA 4AG6A 4HGRA 1Q1ZA 4KFTA 3BS4A 1KDTA 3IDQA 2BDEA 2J41A 3PUYA 2ZANA 4OHWA 1SVOA 2GBLC 3C5HA 4UJ5A 3AR4A 3B9RA 3E58A 4XVQA 1RMTA 3L8FA 1XEWY 4D2IA 4MGYR 1LTQA 4PPGA 4W5HA 3IB6A 2DWOA 2HT1A 3BORA 2XXAB 3NG1A 4E07A 3NDBB 4TMTA 1N6HA 3E70C 4LHXA 1HYQA 4Q9IA 3T15A 3PJRA 1D9XA 3QXHA 3L8EA 2CNWA 4A2QA 2YVUA 1KHTA 4JT4A 5TV2A 5KDDA 3TLMA 3ZX5A 3L8GA 4EUNA 3C4JA 3OCYA 4ZDKA 1CR4A 2R44A 4NP6A 1Z4PX 5AVWA 5AW6A 5AI0A 3NVAA 1US8A 3R20A 1TEVA 5IF9A 4PC6A 5JZVA 3U7GA 1SVIA 4IOJA 1AS0A 5CJ2A 1Y8AA 4M9XA 1U2RA 2JLRA 1KI4A 3FPAA 3BH7A 1W4AA 2ZPTX 2VSFA 3IGFA 1GNPA 2D06A 3U2QA 2ODAA 5AVQA 2FFAA 3C5CA 2QTFA 1OFUX 1HH4A 4H9GA 4KYIB 4F38A 4Q4HA 2IT1A 3BBPA 2WMNB 4G5OA 4M8NE 3QXXA 5ALIA 3VQTA 4HAWA 4PZLA 5FTJA 3BFXA 3NBYC 5FH9A 3A1CA 5EXTA 3AVYA 3NBFA 2YJ3A 3Q3JB 1EFRD 3E2IA 2VHUA 5G40A 2O0KA 1ESNA 2ZJBA 4G5GA 4KO8A 4YLGA 3SJZA 3M9LA 5FP0A 2IWHA 2ZVQX 4ZEXA 3QNUA 5FL7D 4PPFA 4Z1MA 4KVAA 3LBHA 4IG4A 1LB1B 1VCOA 1Z6XA 3HYCA 1D2NA 4NU0A 3M6AA 1VG1A 3QF4B 5DGXA 1YHNA 1OH8A 2OBLA 3HU3A 4LI0A 4KNWA 1NVXQ 1OF1A 4XH9B 3W8RA 2B8TA 4HB0A 2B82A 3SR0A 2PR7A 2CFRA 4WOPA 3AF3A 1T3LA 4IDQA 1VIYA 4EZEA 5FOUA 3QXGA 1Z0AA 1FTNA 3CZQA 2ZYWX 1TQ6A 3MLEA 4ZIRA 4Q4LA 3UANA 5KSZA 2DFLA 4JIMA 3DM9B 1XD9A 4IVQA 1I4TD 3P27A 1SXJE 1E9AA 1Z5ZA 2VP2A 1E9FA 2FDCA 2FPLA 2PCLA 4MUBA 5IK2A 2IEZA 4PHGA 3Q5EA 1G19A 4IOLA 4LCBA 4M1WA 2WJHA 3S1AB 3SBDA 4EDHA 2C96A 2O8FA 4A0FA 2ZUCA 4D4LA 1KI7A 1NVUQ 3QEJA 5JJKA 4Z1MD 2AGVA 2LCFA 4M53A 4OI2A 2D4HA 3AUYA 2JLSA 3KZXA 1ZRHA 2WF9A 3KKOA 4NBSA 5FI1B 3PUVA 1XXHA 1ONBA 1ZM7A 2AN9A 4U02A 4NYIR 1KK2A 3GFOA 3KQUA 3KKQA 1P6XA 3PFIA 1G7CA 2X2EA 2A5DA 4NFLA 3UWOA 2YMPA 2ZYTX 1RLMA 1XDBA 4FYPA 2CL7X 5JMTA 5IDVA 1U0LA 4WZBE 4P3YA 4ITRC 5FBRB 1JECA 1NL3A 4JLOA 3TVDA 1Z4JA 2B21A 4TL9A 3P96A 3B82A 3CIOA 5IK2D 5AR1A 4F93B 2Q4RA 2JGNA 2XJ9A 4CDGA 2OM6A 4XD7A 1RQNA 1WQ1R 4BYGA 3QUQA 2YWFA 2WWHA 4TMWA 2VKQA 1G3QA 1J7KA 1CJKC 1UM8A 2VP0A 2WF6A 4HYTA 1SXJB 5AM5A 4TMKA 1Z4KA 4WW0A 1U8ZA 4FMDF 1WCV1 4GPTA 1Z22A 4RFSA 4EQ6B 4NCKA 4ZCMA 2IS6A 3E5HA 5EXPA 1AGPA 4LBVA 1JEEA 2GHIA 4IDOA 3GMTA 3IEVA 1L7OA 4LOAA 1IOZA 1Q3TA 2DB3A 1R0YA 2YWEA 5JHHB 2JLWA 2GETA 5G53C 4RY2A 2V3CC 4KFSA 5AI5A 4Q9HA 1LS6A 2WWYA 1DTSA 4NE2A 2ZRBA 3PXGA 2EWVA 1UKEA 4GT1A 1MRNA 3ZTYA 5AVVA 4OHYA 4B34A 3WK7A 1Z6TA 1N0VC 1BH2A 1E0SA 2QM8A 1PVOA 1N5LA 3WGUA 4K81B 1NNLA 1XNJA 5DHAA 3PDWA 4C7OB 4B76A 1CR2A 2JJ8A 5AI8A 2ZR7A 3L5KA 1P73A 4YONB 2A5JA 4DBLC 2N46A 5DH9A 3GJ7A 5SZHB 3KZ1E 4JT2A 2CK3A 5J4VA 2YN4A 5ALLA 1E2MA 1KO5A 4ZDWA 4E22A 4Y2SA 4TT3A 4OBEA 1KYIA 3DDHA 2W43A 1ZMXA 5A3SA 2RGCA 4R7ZA 2BEJA 2R8RA 3IIKA 3W8NA 3ICEA 1CQZA 1FZQA 2F6RA 4C4PA 3BC1A 1XJ0A 1SVSA 1T5LA 2D62A 2NTYC 3ASZA 4EFLA 3MPOA 1RYHA 1Z0IA 3CRQA 2CHVA 1E2DA 3K9LA 3MG9A 3SE0A 4H1UA 2QBYA 2YY6A 4JB3A 3WYFA 4XWKA 3DNPA 4KAXA 2QAJA 1E1QD 2PMKA 4N1AA 2XZLA 4YCLA 4I99A 4UATA 1NIPA 3OFNA 4OCZA 4KFUA 2YOHA 1ZBDA 3K9GA 2IYVA 4JYBA 2RB4A 4L9SA 2Q6TA 4KX3A 3C16C 2WSSD 1T9ZA 1Q21A 4TMZA 2AK2A 5AVXA 3QVVA 2QM7A 3OAAD 1B0UA 2CK3D 2EFCB 2GXSA 3Q5DA 1QHHA 4EPRA 3AF1A 1CS4C 1T5TA 4LJ9A 1XP5A 1R8QA 4Q9LA 2FF7A 5AKEA 3AGQA 2PEYA 3CX7A 2D74A 4B71A 1DBSA 2F3RA 4BEWA 1KSFX 3BFVA 2ZI7A 3CF6R 5FTLA 3I62A 2FPUA 1GTVA 3VTKA 4B75A 2R9VA 2RHMA 1N5IA 4ZV4A 4P4SB 1XEXB 4JVLA 2AR7A 2RGXA 2BWJA 4RZXA 2R6DA 1LV7A 1Z6YA 2FOLA 4MWOA 1EK1A 1CU1A 3AKCA 2O8CB 5ALSA 1CEEA 1JAHA 1W4BA 2V54A 3OFND 3AVVA 4KNVA 1J8DA 1NN1A 4ZO4A 3ZTWA 4R98A 3OHMA 5KDOA 4FN5A 5HR5A 5KSOA 1XCPA 4ARZA 3VR4A 1F2UB 2EFHB 2AK3A 2WPDA 1VTKA 2XOKA 1OXUA 1QHSA 2AX4A 3NEYA 4ESHA 3THYA 5AK6A 1U9IA 4Q1AA 4HLDA 1EWQA 2PX3A 1GSIA 4XWOA 3RNLA 3TVTA 4DRZA 3U4QA 1OB5A 4X8HA 5B2ZA 1YS9A 4NHOA 4KV9A 3CW2A 5HTKA 1JBKA 4FCVA 3BXZA 4XJXA 1WBBA 1IWOA 3CR7A 4B3FX 4A15A 5AJZA 1OH6A 2CVFA 2WIAA 5AJXA 3SQXA 4RFVA 2G1AA 5ALKA 3OPXA 2Q9CA 2YWGA 3WMFA 4I4LA 4G3XA 2OM2A 4Q1EA 4EPWA 2J7PA 1Z2AA 5JS8A 5UKDA 2DQSA 4C0BA 5AM3A 4US0R 3TSZA 2G0NA 4MKGA 4PAMA 4X8OA 2HDOA 4BNDB 4Q4AA 4OQMA 2Q4TA 1DAGA 3OESA 2ECKA 4BRWA 1AGRA 1VHTA 2ZOSA 2EAUA 4HAIA 2XOKD 4QM6A 3LXRA 1XD2B 3B9BA 3SKYA 3CB4A 1VECA 4HUTA 5J47A 4DCCA 4PSAA 3K0SA 2WWIA 1JEDA 2FGJA 3B78A 4ON9A 2WJJA 4TLCA 5LBIA 4DHEA 1XJCA 2ZTSA 1P7CA 4FCWA 1KMHA 3JZMA 4BKMA 2UZIR 2PZFA 2Z0MA 2ZR9A 3HR7A 4HDQB 3EPHA 1N0UA 3AR8A 2W2XA 5J4YA 1EXMA 4MA4A 1S1MA 2J7PD 4XVUA 1JAIA 3GLGE 4YQFA 4I9GA 1XB2A 1PZNA 4A8JA 4KHZA 5CIQA 4BFSA 1GFIA 1Z3IX 5KO2A 1GM5A 1XX6A 5JECA 1Z5UA 1P61B 1S3GA 3QJYA 4RD6A 2CHQA 1MV5A 4AYWA 4F4JA 2GJ9A 3HLTA 4FMBB 3A4LA 3GFPA 2I4IA 2RGDA 2Z43A 4MYUA 1Z0JA 3PQCA 3WKBA 2XX3A 4QGGA 5KTYA 3EIQA 3AM1A 3AF0A 5BYKA 3F3YA 3EPLA 1A5TA 3NDPA 3R7WB 5LDDC 2NO6A 1T4GA 4LJ6A 4O25A 4GDFA 2FFHA 2QGZA 1KDOA 3MJHA 1Y63A 3CM0A 4EX6A 5ALNA 1XBTA 2I54A 1MOZA 1RMYA 3QPVA 3U3KA 4F91B 4V0KA 4M4SA 4QL3A 3DZDA 1Z0KA 2D3WA 4JZKA 4PXAA 4ACAA 5C18A 521PA 2FPWA 2B8EA 4RD1A 4F71A 4OK5A 2QTVB 4Q03A 4PNHA 3H84A 2X8AA 2ONKA 2J5XA 5TB5A 1G3IA 5AKXA 3QX7A 1MO5A 4AS3A 2KB0A 4H1VA 4M21A 1OFIA 2ERYA 4TZ6A 3OCWA 1PUJA 3E84A 3A37A 1R7RA 1RJ9B 4KFRA 4QJ3A 3CRMA 4LWZA 4DDVA 5AW4A 4B43A 4C4SA 3EWAA 4RJLA 3D8BA 4W5WA 5LB2A 1CULC 2J3EA 3UG7A 3NRJA 1RQLA 2B92A 3R4CA 1A1VA 2QLTA 2ZAMA 1JXOA 1KY3A 4WXPA 4KX5A 4BX0A 2HSZA 4A0RA 4MDFA 5DI9A 4XSHA 3LLUA 1P60A 4ZPXA 4CEIA 3DMNA 4O2LA 3GLIE 4WVFA 3SD7A 3RWMB 2FSFA 5ALDA 3T1OA 3X1YA 3SFZA 2HXSA 1YE8A 2YMLA 1QG2A 4AKEA 3IO3A 5BWMA 1NSFA 5ALGA 4YIHA 3EAQA 3HU1A 4Z54A 1DO2A 3U6BA 4KI0A 2GVDC 4CVNA 2G09A 3BAFA 1S1CA 3PUXA 2VBCA 1U99A 3EZ7A 2EWWA 3MWKA 4PPQA 4B6EA 3K70C 1L8OA 3LQRA 4ZI3A 4GOXA 3R9WA 4URZR 3KXIA 4BECA 1F6BA 3TNFA 4ASUD 3HPRA 3KKMA 1FNMA 4C0HA 3RS5A 1R8SA 2WAXA 3EIHA 4HAYA 3TW8B 5DN6D 3VKHA 2ZEJA 4B6FA 1Z4LA 2VH5R 2FSIA 1HA3A 3BH0A 3IHLA 1RPZA 3ET5A 1TJ3A 4A92A 3A36A 3RWOA 3CX6A 1Q1QA 1XFAA 2BIFA 5AVSA 5AUPB 1R10A 3W3ZB 4LYJA 4UNRA 4B73A 2IYRA 1NN0A 3KBBA 1W5SA 1K8RA 2HF9A 2NQ2C 2WWFA 2C98A 4JL5A 1L8LA 2J45A 2MMGA 3KTAB 2VTKA 2GCPA 2ZRAA 4LZZA 4J2TA 3FGNA 3LAWA 3GLIB 3EZ6A 5FBLB 5JLJA 3UXMA 3FPBA 3L82B 3FGOA 1RDFA 3LA6A 1SWVA 4Y2JA 4FXPA 3PVSA 1G5PA 1VG9B 2HF7A 1OIXA 1Q1EA 3DM5A 4Y2PA 1JNYA 4QRHA 4DDWA 1N6IA 4OL0A 1OXVA 1VMAA 1J2JA 1KI6B 3BJIC 5AKHA 4BWYA 4ZDIA 2G3YA 2TMKA 4KN8A 1N3BA 1Q12A 2QAGC 3AGPA 5HZHA 4UM5A 2ZJ5A 2O2XA 1E2FA 3EX7C 1DADA 1TF5A 2BCGY 2IUTA 3P1JA 2J87A 2ATVA 3QF4A 2B1QA 2VSXA 1S8FA 1G5RA 2AWOA 3EA5A 4R2IA 2KSQA 1PJRA 1U7OA 3MD0A 2VQSA 5J4KA 3NWJA 1E2KA 3N8GA 4AWXA 5AKIA 1W0JA 3GJ6A 4Q7KA 4UNQA 3EA0A 1PV4A 4UXHA 4BEBA 1RRFA 3SJCA 4KLZA 4Z8XA 2HCFA 2KI5A 1E32A 2Q3MA 3T1QA 2ATXA 2YINC 1GRRA 4NH0A 4B3XA 3WK9A 3CR8A 1Z06A 3QUSA 4HEJA 1AQYA 1F5NA 2YMMA 2RGGA 3BB3A 3NAMA 3QIAA 5JJBA 2HEGA 2RGNC 5BQ5A 4PAOA 1SU4A 2W6IA 4IHQA 1YZTA 1CJTC 5FUXA 2W00A 3S1AA 1D6JA 2W4MA 1G8HA 1G18A 1PLKA 3GCGA 2V1UA 2ZBDA 5C1BA 4UMDA 4LV6A 4Y2YA 1QF9A 4FMDB 1ZD5A 3RS3A 3Q9LA 1M8PA 3SYLA 3OF5A 1DO0A 1JJ7A 2R8ZA 1N6RA 2XJ4A 4HLUC 1HY3A 2CE7A 3LDAA 3A1VA 4P31A 4XVRA 1E0JA 4UQOA 4KODA 1G17A 5HE9A 3UKDA 3X1XA 3T5GA 5JFGA 3X2SA 1HTWA 4M1OA 3TLXA 2YNMA 3PEWA 2ZM5A 3WMEA 2IXGA 2IYWA 3EF0A 3KOOA 5IS2A 4JJZA 3U60B 4D0LB 5SZIA 1XTJA 1SHKA 2C9OA 2RMKA 1COWD 1Q44A 3LQQA 3NH9A 3SBEA 5JBQA 3I1YA 1SVWA 2CLDX 3GJ8A 4IEEA 3NKVA 4PR0A 4D4JA 3B1ZA 4DJTA 1ZOLA 3TJZA 2WHXA 3R09A 4OQLA 2OFWA 5E3HA 1MO3A 1Z47A 1ZIPA 2QA5A 2E87A 1UBEA 3AR7A 3FHTA 1W44A 1IY2A 4D6PA 1MR3F 2BV3A 2DFNA 1N8NA 1F48A 2JATA 3LO5A 3K1ZA 2JGAA 3QKSA 4BFZA 1E9BA 4OJKA 3SF0A 2FV8A 1SVMA 1CLUA 1EWRA 2BY4A 2KBEA 1Z6AA 1W36C 4A1FA 4TQ9A 1U7PA 2BM0A 3ZX4A 1MH9A 2GVZC 2XAUA 3EPKA 2P5SA 5KNDA 4Q4JB 2ZBGA 3FFAA 4BASA 4LJ5A 4WA7A 4Q02A 5E7MA 3WNBA 3CWQA 3QOFA 3T1TA 3RC3A 3NC0C 2FEMA 1UBFA 2O8DB 5E7JA 3NIBA 4CRWB 4ZKDA 5FR1A 5FPSA 4DLYA 3A8TA 2QE7A 2DPXA 2VHJA 1GOTA 3PGLA 2NPIA 1FP6A 2WVJA 2N42A 4JSTA 4P32A 1A4RA 5AK5A 2WOOA 1WB9A 1DAKA 1KI8A 3B85A 4QGHA 2XSZA 3H2YA 4JKYA 3IPXA 3ZLJA 3B1YA 5K8TA 3SJAA 1IONA 1XTQA 2QYHA 1SVLA 4TL7A 2A9KA 4C7OA 1AN0A 1U8YA 5GVSA 4L6CA 1DARA 2QNRA 3J81k 3AVXA 5AW8A 2WZQA 2DFKB 4W7SA 3ZVLA 3LW7A 1OJLA 1KGDA 4IKEA 3QKRB 1XMVA 4DLWA 3LLMA 3OEED 3L0CA 1IN5A 1Y3AA 2MSDB 2ZVPX 5CLQA 1JQJC 2I1VB 5BYJA 821PA 2IYUA 3H86A 3HYTA 4Q7MB 4TYPA 2P2LA 5EZ5A 2AD5A 2CMKA 4JLMA 3L0BA 1FPMA 1XVIA 2QENA 5GADl 4S2EA 2IF0A 5B64A 4P33A 4HB4A 1HV8A 2H57A 2QL6A 3T5DA 1Z5GA 1RC8A 4WXRA 3QEOA 5JCZA 5K8IA 1U2TA 3AP1A 3TGPA 2WM9B 1YZUA 3W6NA 1OFHA 2XSZD 3ZZ0A 3SQWA 1RKBA 3LNCA 1J8YF 1NNEA 3AVOA 4PC2A 3FMPB 4RZ3A 3SC3A 1YNSA 2WF7A 4C0LA 2OCAA 3MAAC 4X8LA 3SU8A 2HXYA 3SJBA 3THWB 1N2CE 2C2HA 1BKDR 2FPXA 4RD0A 4GL2A 2PT7A 4YC7A 2O8EB 3PEUA 3SFVA 1ELOA 3I1FA 4LC1A 1G1MA 2RKOA 4US2R 1U2SA 1XEXA 3NUQA 4QNMA 2ZYUX 3RSLA 1P62B 1KJZA 3QU2A 1VJRA 2NOAA 1NF3A 4JLAA 4TLAA 2BMJA 2GFHA 1RYFA 2WOJA 4DCVA 4DIEA 2O8CA 1GRQA 4A2PA 2QN6A 1FTSA 1XD8A 1SHZA 1A82A 4J0QA 5AW1A 4E88A 3NANA 3PITA 4NMMA 4ZEWA 4QHYA 1F2UA 2BKEA 4TYNA 1JR3E 1U98A 1Z8FA 2IC5A 1N25A 4I9FA 2KE5A 2GTPA 2P0EA 2V7QA 2DFTA 2X4DA 3QLEA 2HYIC 1AZTA 5KHOC 4B48A 4DCTA 3WBJA 2ZBFA 2V6IA 4ABYA 3V9PA 621PA 3K70D 4P0TA 3RFUA 2RH5A 4BLSA 2JA1A 1KKLA 3IQXA 2WMOB 3WP1B 2ZU6A 4PSVA 4O8CA 1IXSB 4OHFA 1E2GA 3QI2A 4MKIA 2EFDB 3L1VA 2A78A 1FEZA 2W11A 1PUIA 2QMOA 3AEZA 1ODFA 1ZM4A 1U9IC 2IUUA 3JVVA 2WJYA 5FI0B 5CDFE 3QYPA 1NMXA 2P67A 5GJCA 4BNDA 1E0AA 3K0AA 2JDID 3CH4B 2HOQA 2OXCA 4NZYA 2QAGA 2VRWA 4BX2A 3ADDA 4FWIB 3QF7A 3QUBA 1IN8A 5L3RA 3B8EA 3U44B 3V00A 1R0XA 2X77A 1L4YA 3L7YA 5AJYA 2CXXA 3RLFA 3IPYA 2V7QD 1N6OA 3X1DA 1XD2A 5E0OA 1KDPA 1L2TA 3A1EA 3B5JA 2WKPA 2N1BA 1GRNA 1HURA 1YJ5A 4C9BA 4EKDA 2J0VA 5AUNB 1KKMA 2CNWD 3WRYC 1OXSC 3CPHA 2QPTA 4Q01A 3VAAA 3RHFA 2B6HA 2GJSA 2I3BA 4Y2VA 2W6JA 4TQUS 3TSWA 3VU9B 1L7NA 2GESA 2RGNA 2HI0A 1M34E 3FVQA 2O8BA 5CB6A 1SZPA 3O8CA 4FI3C 1LVHA 5CM9C 1X42A 1A2BA 1Z28A 1ZC3A 3FHCB 1TA0A 3N28A 2RHDA 3FB4A 3K1JA 4UXJA 1OH7A 1T0JB 1N5KA 3CF2A 3P4XA 3A4NA 1EGAA 3U7FB 3ZI4A 1XJQA 2J0UB 4HLUA 3EPRA 1NIJA 2IXFA 2ZU0C 1NP6A 3LFUA 4JVNA 2DWPA 3N1UA 4IW3B 3QXSA 1G3MA 5JWHA 1N5JA 1WPGA 1FX0A 1MO6A 2J1LA 3FKSA 4A8JC 2P5TB 3IBGA 4M2LA 3B60A 4JLKA 4KITB 2ZRNA 3R7WA 2JIZA 2QRZA 1UKVY 2JLXA 1BMFA 2IL1A 3U3JA 2W6JD 3MMZA 4XWAA 3QBTA 4M9SA 3DV9A 1H8HA 3GPLA 3I6BA 1Q1BA 4HUQB 4U00A 1WBDA 3I92A 4BZXA 3CRW1 2PH1A 2R62A 5AWFC 4G63A 3ASYA 3VFDA 2ZYVX 4LYFA 4V0LA 3VKWA 2V9PA 3I61A 4Y0VA 4CF4A 4CF7A 1M7GA 1F3OA 1QDEA 4DDTA 2ODBA 3GLGA 2ZS9A 4LY6A 2NZJA 4UASA 1WA5A 4QKQA 5F98A 3EC1A 2FA9A 3GEHA 3FKSD 1QYIA 3WRXC 2ZI5A 4HZUB 4HAXA 4Q47A 2FJUA 3FFBA 1QVRA 3ZD7A 1LNZA 2YC4C 3FZQA 2JIZD 721PA 3DKPA 2FX3A 3PGVA 4O0MA 1BMFD 1NJGA 2NO7A 3PV0A 4DSNA 4YDSA 4CF3A 2JLZA 1R0ZA 4DKXA 1NBME 1A7JA 4O3MA 1KIMA 1AS3A 1YR6A 2P9JA 1II9A 1D2MA 3LBIA 2GCOB 3HR8A 1S8OA 3AF4A 1YZGA 1ZNXA 2IS1A 1PW5A 1XMSA 3VR5A 1IN4A 4CF5A 2CLCX 4IFEA 4LV8B 3WMGA 4F72A 1NY6A 3VNUA 3JVUA 2PL3A 1DS6A 1VG8A 4GZLA 4TWZA 4HSEA 4NYJR 2YJ6A 2Q3HA 2JCSA 1AKEA 3EWIA 5L3QB 3RSOA 3WKDA 2F1RA 2NO0A 2OT3B 3NHAA 4LYHA 5AESA 5FPTA 1KJWA 1W48A 2XZPA 5A0FA 1U0HC 3FHOA 3WHLA 1W36D 2ZRCA 5FPHA 4DLSA 1ZUNB 4S35A 4XD7D 2VIIA 5J5CA 3ZIAA 1NVVR 2XGJA 2AHOA 3OEHA 1UPTA 2V1XA 4URVR 2ZRPA 1P9NA 4C0SA 4BRUA 3R8CA 2Q21A 4BFXA 5D3MB 4L4UA 1Q92A 2FSGA 3L8ZA 1T3HA 3B8HA 4EJSB 5L3SA 4HLQB 4LJAA 5FOXA 1X6VA 2O5VA 3QUCA 3TW4A 2QPOA 3QKUA 5FUYA 3FOZA 2BDTA 1G41A 1FUUA 2GXAA 3NH6A 5B58C 2GAAA 2ZJZA 5FTMA 4Z8YA 4TL8A 3GLIA 1MKYA 4MKFA 1Z6GA 1K6MA 4Q9JA 2I34A 5AKKA 4GP7A 2C8LA 3ONWA 3RABA 3K0EA 4GMDA 4NL4H 3K0FB 3SOPA 2OLKA 1E1RA 3TSOA 4Q1DA 1W1WA 1OV4A 1M7BA 1W0KA 2EQBA 1G9XA 2LKCA 2OBMA 5JSZB 2AMYA 2HO4A 3WNDA 3EF1A 1WF3A 2VHCA 4HZIA 4XSGA 1VYUA 1B23P 1QHIA 2FZLA 1UKYA 1E9RA 4DEXA 2OYCA 4URWR 1KI2A 3LY5A 1KSHA 3K09A 4BLTA 2FEAA 4V0NA 4A9AA 3TUZC 1NKSA 3W6PA 1X3SA 3AUXA 1OW3B 1GIAA 3A1TA 4F4CA 1QH9A 3IQWA 3MJRA 3FPSA 3WXMA 4ILEA 1FMJA 1UEIA 2YJ4A 4TT3D 1AJEA 2G0TA 4BZQA 3W5BA 3ZZUA 2G06A 3VR1A 4JLBA 3B13B 5EXXA 1I4LD 2VF8A 5AM2A 2WKRA 2X19A 2JAQA 4KLNA 4LBWA 3OIUA 3HYRA 1E69A 2BJVA 2ZSDA 3QG5A 2SHKA 4FMCB 4URUR 5CYOA 2G07A 2ZBEA 3W5CA 5GJWC 3U6KA 1ZRMA 2G83A 3HPQA 1MABB 1E1RD 5AM4A 1F60A 4HLCA 3C8UA 4A0HA 4TLBA 1OHHA 4HGNA 4GIBA 3MSXA 3OIYA 3QU5A 1XTKA 2CFTA 4IDNA 1QQ6A 4QJ4A 3OCXA 2H1LA 2ORVA 4RVCA 4TYYA 2OG2A 1II8B 2REXB 2WJGA 2OO7A 1N9KA 1FW6A 1QHNA 4ZEVA 4WIAA 3ZW7A 2VP9A 1Z07A 4JMPA 4LK2A 2LWIA 2VPPA 3FDIA 1P72A 2VP6A 4LHWA 1OLOA 1E99A 2HYDA 3QNMA 1JJVA 4TYQA 1GVNB 1J90A 1X86B 2ZUBA 3BH6A 3LVQE 3T12A 5L3VA 1EK2A 4FFDA 3SHQA 5DNYB 1YZKA 5IRCD 1OT3A 1G8FA 1JPNA 2RCNA 2CEAA 3N2IA 1RKQA 1WP9A 2HJGA 1R5OA 4MUAA 3M0EA 4ESVA 1J8MF 2EARA 1KYTA 3UMCA 3L8YA 4RESA 1YRBA 2NO4A 3QXJA 4B3BA 2H7VA 1BS1A 4KSCA 4BLQA 4DT1A 5BN4A 4Q66C 2HF8A 4NCJA 5TDHA 2Z83A 5F3WB 2P6RA 1T91A 3I28A 3H0KA 3I3SR 2HCBA 1XWIA 1NLZA 3EZFA 2WPDD 2GHTA 2PMDA 4QM7A 5ALMA 5LB4A 1SKQA 5CITA 1RRGA 4QFMA 1OH5A 3KUDA 3KJGA 1CRPA 5AVUA 3UIEA 1EFTA 1DAFA 3SYNA 2I6XA 2FPMA 2BOVA 4IOMA 1MH1A 3KXLA 4RCZA 3WK4A 3BGWA 1TTTA 4M1MA 1US8B 4LX0A 1N6NA 1NVWQ 1NKTA 4AS2A 4PZZA 2YV5A 3TQCA 1YMQA 3AR9A 1X1SA 2B1RA 4Q4JA 3U13A 3KB2A 1T0HB 4LYAA 3QPUA 1SXJC 1CIPA 4IVRA 4JVMA 1XTIA 1O87A 2IYQA 3I72A 4URYR 4CT4B 5FPYA 1DELA 2ZQ5A 2ZJOA 3QG1A 3QXCA 2B0CA 2ANCA 1G5TA 1TF2A 4KVGA 3ZYCA 1HE1C 5AW2A 3DAOA 4XPZA 2OAP1 4B2IA 5TMPA 2GWHA 2Z4SA 4LUCA 2CDNA 4EPVA 1O03A 2OFXA 2JEOA 4NYIQ 4BFUA 4YGYA 2ZRIA 3P4YA 4V0OA 5DISB 3U19A 2RGEA 1ZNZA 4IDHA 3KL4A 1P9RA 2ZE7A 3KB1A 4TZ0A 2AUTA 2AFHE 4IXNA 1DG1G 4Q5IA 3BIFA 1P4SA 3I8XA 1RLTA 4NABA 4O2RA 4HI0E 2O0HA 2DHRA 4PX9A 3GYGA 1WZCA 4IDPA 3WKEA 2I55A 2BJWA 3AR6A 3KDPA 4ZIRB 1TUEA 2QGNA 2Q5EA 4CEJB 3HJNA 4II7A 1DOAA 3MWJA 1XZPA 1FQJA 5AVZA 3A1WA 2CL6X 4MRRA 4NONA 5J40A 3SYKA 4DDUA 5JRZA 1OYWA 4ZCIA 1L7PA 2IOFA 2JLYA 3OTQA 2PJZA 1E94E 2GZAA 4QNRA 3KJIA 2JAWA 2XEXA 1EFCA 5AW5A 3C41J 4PFSA 3WP0A 3A1DA 3FTQA 4AYXA 5KU1A 1X1RA 3LX8A 4QOSA 3TH5A 1L7MA 5FOVA 4PQRA 5DI3A 4Q21A 1CP2A 5FBVB 3OCZA 3KUCA 3LXXA 2GZDA 2R2AA 3ND8A 3UWKA 3VR2A 1XXHB 4FIDA 5DLQC 4W5JA 3FYHA 3I5YA 2XNSA 3DOEA 3ZVRA 4GMXA 2ORWA 3SMVA 1VG0B 2G0AA 4XE5A 2KJQA 1GKIA 3QGMA 2ZI6A 2FSHA 4IEIA
chains in the Genus database with same CATH superfamily
1R4AA 3Q4GA 1Y6ZA 4UQPA 1LPSA 4H1WA 5BNIA 3T5CA 1THTA 1CFZA 1HQCA 4R69A 2Z04A 2Z08A 1UKZA 1CB7A 2ZSEA 4TT8A 3VUFA 2V6GA 2EU8A 5DNCA 1MJGA 1VZ2A 4RTOA 3GEMA 1GQFA 3GD5A 5FHRA 1KZ4A 1RYYA 2QVLA 2V6FA 3EGWA 2JGIA 4G9GA 1VGRA 2WNHA 1KR2A 4NICA 3LSYA 3DEFA 2ZIGA 3QRWA 4QU8A 4YRFA 3RUCA 4CGYA 4NARA 1LLDA 4PNZA 4ANFA 4MUKA 3HVHA 1JEQA 2GN0A 2DJIA 1VJ5A 4AJ1A 2ZVDA 1A7KA 3NBZC 2DZDA 1ZJYA 2NUAB 1PFVA 2C1XA 3B48A 1XZHA 3JQ8B 5ECWA 3DA8A 3QA9A 1XMXA 1SNYA 4JH0A 4R8LA 3LUAA 3TZBA 2JKVA 1C0IA 2OSBA 4X20B 2BTOA 2I2FA 5FT9A 3FI9A 4Q3KA 3TR5A 3T1NA 2MSEB 3BA1A 1OASA 1V7PC 1NBWB 2EBWA 2CHFA 2PCJA 2WYIA 3D8UA 1TK9A 3QUTA 4IFTA 4YAJA 4MP3A 2CZGA 1WY7A 1H5NA 1HMPA 3QE2A 5EUBA 1CRZA 1I36A 1M2NA 2PX4A 1VB3A 4GI7A 4PN7A 4UU8A 4BNFA 2ROQA 1KFKB 1C9DB 1N2CA 1EP3B 2PWPA 4O2AA 2HHLA 5J4LA 3REQB 3T5TA 1EJ6A 4I8XA 1HETA 1OTHA 4ZOCA 2YHBA 3C3XA 3I76A 5FBKA 2FZEA 1I30A 3EIUA 2C99A 3IO5A 3LT2A 2YFHA 1NVDA 2ZI9A 4IHJA 4F3NA 1IB0A 5DB4A 1SC1A 1N4AA 3EVBA 1OSNA 1ORIA 1QC5A 1B0AA 2ZJ8A 4OM8A 4WK2B 1NYQA 1HI9A 1PQ4A 4NCAA 3CUWA 2GYUA 3C39A 5SZKB 1JR6A 1ZRNA 1NR7A 4O2BA 3ECSA 4AIIA 5L95A 2EJCA 2AW5A 2WHYA 3AUJB 4Y1RA 4WY5A 1IN7A 2YXBA 1BXGA 1TGYA 4A91A 4CIVA 4GSKA 2WR8A 1XPOA 3EJ6A 3CR3C 3VV3A 3CZ9A 4UTPA 2DU8A 3V46A 1JR3A 3MRSA 3N5CA 3N05A 5EP2A 5GTDA 2Y66A 1U0RA 1CDZA 4EHIA 1E4YA 1II0A 1L6RA 3CKLA 1V3TA 3IQDB 4ESEA 3R9KA 3EXEB 5H80A 3EH1A 1F0NA 2OB1A 5G3YA 1H2WA 4G97A 1VLMA 4G1FA 4HNRA 2JIQA 4MW5A 3D7MA 2QLMA 1QR2A 3KVYA 4E46A 4ECEA 5B2EA 3MVEA 2JK0A 4PBRA 1D6SA 1NV8A 4PHHA 3EC2A 5G02A 3TUIC 4EAQA 1X7YA 3M1IA 3PK0A 3ROGA 2WP0A 1QHHB 2WDPA 2G40A 4WBXC 2XZOA 5B1EA 1GPNA 2V0NA 1FTYA 1QVAA 1JQDA 1UJNA 4NEGA 1YVDA 4QPDA 4RETA 4YAEA 1TW2A 4AL4A 5K8UA 5TS2A 2H48A 1Z18A 3ZQJA 4DG8A 3PC3A 4IDGA 2CYBA 2HA3A 3W4JA 4TS3A 1V9SA 1ZU4A 4GBJA 4N9WA 3UATA 2C7RA 2QDKA 1D2GA 3FVVA 3H2IA 3UJ9A 2F8SA 2OXTA 4DAOA 1ZZGA 2GD2A 1JXAA 2DUWA 1B93A 3BCHA 3BICA 4I1VA 3AFIA 4EB3A 4RENA 3BG5A 5K03A 3I4FA 3EZ2A 1YR1A 1SJ9A 3OZEA 4BN5A 4R81A 4R9UC 1MEOA 1QGZA 4OXRA 2ASVA 3TLCA 4ZICA 3EEOA 4DWJA 3FBGA 4PQYA 2GF9A 4REMA 3GVXA 4CKEB 1SPXA 2XMZA 4HDSB 4J94A 4JP8A 5CLLA 2C5SA 1Y1SA 1XALA 5L6MB 1SBIA 2JAUA 4OX9B 3ROPA 4X00A 4WZAE 5IDQA 4M46A 1P4GA 1S0UA 3WGZA 2C1EA 2IKSA 3AB8A 3MBKA 1ST3A 4DLZA 2IZOA 1XLWA 4BFVA 4IF6A 4EYGA 3EZXA 1FFCA 1WCIB 1KQFA 4N7BA 3T1VA 3DP9A 3IR5A 1WAMA 4QOFA 4BEVA 1M5UA 4ALKA 1Z56C 1YDEA 3DFKA 4FXOA 3WIBA 4XFDA 1KNXA 1WHTA 2B7CA 3L43A 2CXOA 3MN1A 5EHIA 1M8GA 3QSYA 2XQFA 3NHFA 3QWBA 4LPSA 1CR6A 3GJ4A 1TKBA 4R7TA 1CPYA 4U1RA 1B8OA 1U2DA 3QVXA 5HQ3B 3MAJA 5A5EA 2PUEA 4QT0A 1WXDA 4GGOA 2QSYA 3FMFA 4A6EA 3QE3A 3GJ5A 3C4VA 4Z3DA 1R0WA 4CCWA 4DFDA 1PR6A 1OX4B 3KWLA 3PSHA 4GVLA 3A6JA 4H2DA 1PFWA 4JJKA 3VXKA 2QEQA 3Q72A 4GF5A 5B7QA 3QBEA 3MSCA 4NK4A 1E5LA 5JAQA 2C4UA 1DTEA 4TKVA 1YZNA 5DEIA 3L4EA 1EZ4A 4BZZA 2H9IA 4H3KB 1DEKA 3EARA 1HTBA 1SC6A 4J1NA 3AHJA 3DLIA 3IIMA 1LDEA 5KQGA 1RKUA 2R6FA 2VJMB 1M1XB 3NAQA 3UPUA 4RE6A 1JZQA 4JP3A 1N7GA 3VC2A 3M9XA 1RI2A 3II6X 4CIYA 5LOVA 3D3JA 4KV7A 4OJQA 2IITA 3CF0A 4HZGA 3ESAA 4X6LA 2EDAA 1NBMA 4JUBA 1INLA 4RU1A 1AUQA 1I7LA 2KM1A 2QL5A 3DLPX 2NO9A 3GFQA 3UQYS 1U0GA 3E9MA 1K98A 3DBLA 2QE7D 3C6KA 4H7DA 3P0FA 5BQOA 4E5KA 4F3TA 3VKGA 1DC5A 1HM5A 1OU0A 4A73A 1T2DA 1UFQA 2HMYB 2RB5A 3KDAA 1Z2OX 2ZIZA 3KHKA 3RKUA 4CIWA 3E23A 1CQJB 4GR5A 5T57A 5JSZA 3GLFE 4EENA 1NM5C 2XB2A 3B9PA 4POAA 5EMJA 1XZFA 1UJBA 3HYNA 3DYVA 2XB4A 2OHIA 1CK4A 2EL9A 4YDQA 1E3LA 2F7SA 5EUMA 4FHZA 1PVVA 3X1KA 1YL6A 4F45A 1NX9A 1ZI8A 5CTJA 4YREA 3ZJ4A 1NW4A 3DZJA 1TM7E 1UAAA 3IJEB 4QBIA 3G2IA 1VHLA 5KREA 1BWSA 1PW7A 2HV8A 3CMMA 1E8NA 2FH5B 1XROA 1QH1B 4OHXA 3AI2A 1AA9A 2HNAA 5EQFA 1E9EA 3WGYA 2G9NA 3RFVA 4BVAA 1LLQA 1HL3A 1MB4A 1ZCAA 2FWNA 3ACDA 4GWKA 4IMPA 1KPGA 2GMWA 4JZYA 1GN8A 1LBTA 3I34X 4P4SA 2BE9A 1EP9A 3IMGA 4BQPA 2H08A 3SHTA 2JLUA 4BS9A 3KYCA 1DLIA 3U80A 4FHEA 3DSRA 1FP1D 1K4MA 2WV9A 4MYTA 4GP6A 5EA2A 3TQHA 1EE9A 1BGWA 3G0IA 1EYZA 2BCJQ 3AFOA 3CNHA 3VNAA 5IEBA 4DNXA 4RTKA 2E6UX 3NBQA 1FNCA 2FJPA 2VHXA 3UMGA 3LX5A 3JYQA 4JI8B 3GFTA 4H0FA 1QV6A 3F98A 2JFYA 4DC9A 3AM4A 3F5FA 1B8PA 4G5SA 4TWIA 3S70A 5B3AA 4UDOA 3WMRA 4PU0A 2NU7A 3H8VA 1Y3IA 1H0HA 1NMZA 2JLAA 3I9FA 1ZC4A 4K9OA 5FTNA 5JRJA 1L4LA 3MWFA 4FMPA 4K46A 2WYWA 4R1TA 1UC9A 1WEKA 4U7GA 2HUPA 4DDKA 3F46A 1HGXA 2C20A 5CP8A 1MF7A 3PHGA 4AP9A 1SQSA 1JI0A 2VP3A 3O3NB 3VDRA 6GPBA 1KXZA 1VKRA 4BGIA 3MMNA 2E18A 4EF5A 1KO1A 1E6EA 4RHFA 5EKUA 2V7TA 3SDBA 5H8WA 1DLJA 1AHHA 2P9GA 4Y6RA 3BF8A 3CZ4A 5JI2E 1BS9A 2BBTA 2RI1A 3JASA 3F49S 4JB2A 3STVA 2WLTA 4RZSA 5LBUA 3RVBA 3STXA 1GZSA 1BE8A 4IV5A 4FDUA 3WS7A 4Q18A 3T1HB 3X1MA 1GGHA 4X1OA 4ZAVA 5IAOA 5FL7A 2J46A 4ZI7A 2BFMA 2HIGA 4OA8A 1KK1A 4AO7A 5JADA 4C2UA 1QO7A 2PTGA 3DMHA 3I3OA 3R8FA 2PWAA 2VSYA 2IHKA 4F04A 1NQAO 3CKMA 5BYAA 1KAOA 4EUFA 2CJWB 4PVCA 4I4TB 3DPSA 1URPA 5FTKA 4ZRNA 3F3MA 3LBNA 5T7BA 5FLEX 2P6NA 3DOOA 1S02A 4KREA 1KU6A 2XI4A 4HEA1 3KLBA 1P2SA 2C4NA 4DMHA 1EG7A 3G2QA 5LLSA 3VOTA 1V43A 4L16A 1GFZA 5CGZA 5JCJD 1Q5PA 1X9IA 4A6PA 2WC1A 1NNUA 2M1XA 1PVDA 3AKDA 1XELA 3ESCA 5SY4A 3CW9A 1HX7A 4GNRA 4UNPA 3OT1B 1IEVA 3BWDD 5CK5A 3RIMA 1D9ZA 3PGJA 4URXR 1F5SA 1XZIA 2CLOB 3KKKA 1TADA 2E49A 4LJ4A 4AJIA 3V8NA 3TSAA 4KKXB 3SI7A 3C48A 3IVRA 1OZFA 1A72A 5K09A 2IEAA 3AF2A 2ATIA 2ETXA 4OYYA 3MXOA 4OHUA 5E95A 2Y9PB 2HB6A 2ODNA 1RU3A 2GKSA 3CNOA 1U28A 5EPUA 2BGWA 5BUCA 4MRPA 2VP4A 3I09A 4WASA 4R71A 2HEIA 3P9NA 2RK6A 4F5ZA 5KYWB 4QFCA 1XU4A 3RS7A 4R68A 1W5TA 4R16A 1IJFA 1S8AA 3TLJA 1KQ3A 2FI1A 1TKRA 1BVRA 4AY2A 4IHAA 1ZOOA 1X1CA 1EMDA 1YL5A 2BI4A 3NWOA 3OJEA 4UMFA 5DSXA 1XVLA 1MO4A 3O21A 4N6NA 3BXHA 1ZDMA 1NI3A 1XMIA 1CUFA 3Q0IA 3CRVA 3OE5A 3T61A 2VZ9A 5EE3A 1S4QA 2BGMA 1TQ2A 4K88A 2OCBA 4X41A 5ED4A 1TE2A 4UEKA 4ZT7A 4LDPA 1F4VA 4MXDA 4RD4A 1AB6A 5HIKA 5EHZA 1VFPA 5C53B 4XWYA 1LX7A 4I81A 5I7FA 4QUJA 5KC9A 1JX6A 3LZCA 1GUAA 3VV2A 1E3QA 4HATA 1NN3A 3B3JA 4MI6A 4DCSA 5LM3A 3KT3A 3PRHA 2VPQA 2X41A 2HCTA 3KO8A 1N0IA 2B8WA 4AX8A 1QG4A 3BT7A 4HWKA 3ETEA 5CB4A 4HBZA 5IANA 3FMVA 2XUQA 3LOPA 4LS3A 5K7SA 5KOJA 3GLHE 2AOWA 1RI5A 2JASA 3KD3A 3UA4A 3FTEA 2J0QA 2P8SA 5HBGA 4BKOA 1J9EA 3JVIA 1ZWLA 1ISPA 3VR6A 4LQLA 3OIVA 1GZUA 2XCRB 2H85A 4BGDA 2GCIA 5DSZA 5YASA 1WHSA 5C1PA 2FRXA 2JH3A 3H9GA 1EXNA 3C15C 3ZDFA 4ESOA 1W4CA 3VHLB 3Q6IA 4OXIA 5KOYA 4EUHA 3ZWCA 2BMDA 4BNLA 1D5WA 2WABA 3T3DA 3RFCA 4LC0A 4F4UA 4F5DA 5K2MA 4EG8A 1BHQ1 2J4FA 2E82A 2P91A 4V02A 4HXYA 5AHRA 4KHPB 1W1UA 3ZHCA 2BFAA 4RUKA 5D87A 1G55A 2IZ7A 2EW1A 2X0DA 2AEFA 3RC9A 3A06A 4NBKA 4DQLA 3QKSB 1Z29A 2GN8A 3MWYW 4OA5A 1IEXA 2E3JA 3RSZA 1TCVA 2NZ8A 3JQ8A 3ZJTA 2K2QB 3GDGA 4C29A 2WQZA 1FQKA 3DZIA 4K2HA 4NQZA 5MF6A 1WVGA 2BHRA 4FNMA 3HJFA 1FSSA 5G3ZA 3WJ1A 1PK8A 2C03A 4PYRA 2D2XA 4NCHA 5EJ8A 4N6GA 2VDOB 5KQSA 1U90A 5CA1A 1N75A 2IOFK 2JIPA 3CLVA 1ZGBA 4UU1A 3IUJA 1R0BA 2HZ7A 3CF4A 2CB9A 4KO1S 4P4LA 5EP1A 4LBZA 3UMRA 4LY3A 4AWAA 1XN1A 1LBHA 1GDDA 3HDQA 4MQ4A 4RO0A 2VKTA 4Y3UA 3T95A 1FDIA 4KPEC 2OFFA 3REGA 3U56A 1CJBA 3REQA 4CUZA 2VVTA 3NBKA 1JDZA 1HMYA 4MUJA 3T34A 2G9ZA 5EMHA 3A25A 5JY1A 3PIIA 3R3WA 1PQUA 3DO5A 3NHRA 1E3IA 3KZVA 1EH5A 1CJMA 2Q9BA 1IN1A 5DPMA 1SULA 2CLFB 3TMKA 4R31A 1KSJA 2PWZA 3P2MA 1R6XA 3FCAA 2DTDA 2BFCB 2OHFA 2VC2B 4LRQA 2PMEA 4P08A 2BHSA 1G2PA 3T9FA 3KQHA 1J1UA 3WADA 3FCXA 3TRJA 4WLOA 3GP8A 2WB2A 2CL0X 5F9HA 1DAIA 1RI4A 3OJCA 1MJGM 2DBRA 3JATA 4A5SA 4FI3F 4D4HA 4CODB 1JMKC 4HH1A 1CE8B 3HJTA 5CRIA 2AN4A 3L0ZA 2FWBA 3KEFA 2VK2A 4JGGA 4AZVA 5FADA 2WSYB 2VNIA 1CB0A 4X66B 4R1LA 2XNJA 2Q6LA 1KI9A 2W37A 3BRSA 1FDSA 5E4YA 3JD0A 2AHRA 2J3JA 1XF9A 3DB1A 2CLKB 3I6MA 1RCUA 4GM1A 2QTMA 1K5GA 4RJIA 3ZLUA 4B4DA 3R9XA 1FU7A 4O6VA 3ZHVA 3TKLA 4Q7JB 2SKDA 3OPYA 3TPCA 3RV3A 3IXQA 4OHCA 1TTHA 3QP9A 1PU2A 1M72A 2G6BA 1ML4A 1ZD3A 3OMWA 3CZPA 4P4GA 2B5WA 4YP6A 3QLJA 4LXQA 4US1R 2VN8A 4YCDA 3URKA 1KH2A 1SQ5A 5G41A 1ZHHA 1BAPA 3H1TA 4WOBA 4JBXA 5J43A 3G88A 2Y4OA 2H52A 3DFZA 3WRVA 2W2KB 4J7CA 4QUEA 1EK0A 2H18A 2Q28A 1Y3DE 1NF9A 2C31A 3BXXA 3IQHX 4HH0A 1QGED 5HEKA 3W6UA 4Y6GB 2M6SA 3QM1A 1VBFA 2DAPA 1P2VA 1PFGA 2PKYX 1E20A 3CA8A 4EA9A 2XUJA 5CFOA 2LIVA 2VDQB 1MJFA 3BB4A 3C3YA 3IPCA 4XUCA 5JNSA 1FFYA 4V0RA 1GAJA 1IUPA 1V71A 3GLKA 2QT1A 3KRTA 1F2VA 3BL6A 4PC1A 3WYAA 2OZLB 3A10A 1E18A 5D85A 3KTDA 1V48A 4EY7A 1ZOIA 4AKGA 1FMLA 2R1TA 3DD5A 3EVEA 1CV2A 2YXNA 3MJCA 4KU4A 4BU0A 4NCBA 4GM0A 4CKEA 5CA0F 4HDSA 1W59A 4RTMA 3BXPA 2W90A 3KD2A 3PIRA 5CW1A 3OTOB 4KPYA 2D5AA 4I3GA 4L0QA 4L8LA 2PXHA 4E09A 1XRLA 4BNMA 2JD1A 5DYGA 3EMKA 3CEJA 1SC3A 1NJ8A 4D41A 1TT5A 4QGBA 1KMMA 2OILA 5DGHA 2L0XA 4BX3A 3UV7A 5CFRA 4F92B 2OE2A 2QTLA 1WCIA 2OV6A 2HU2A 2Y1OA 4JGIA 4KRXA 1KNQA 5ALYA 5FBQB 1F51E 1Z12A 2D2VA 3NFRA 3NOVA 2A35A 3TE7A 3UHOA 3GBPA 5EEHA 5BVHA 3JZFA 3Q8XB 3RBZA 1D8TA 5JUWA 3H75A 2DLDA 5J63A 3EYAA 4J1TA 1WKCA 3DF7A 1PFQA 1KETA 4FILA 4QJIA 5EIBC 2RBEA 5IP5A 4B44A 4QRIA 1FUKA 1Z2CA 1ZVQA 3FLEA 4KH1A 4MRMA 1YRQA 10MHA 4U8HA 3QQ5A 3KSZO 2WTXA 3PHJA 1RFLA 1YZHA 1OZ0A 4K8OA 2H59A 4Y0AA 1J7JA 1YBMA 2F3UA 4JV5B 4L8VA 1GHTA 3NMUF 5AO9A 1QCCA 3I9V6 4XDZA 4M49A 1REQB 3AESA 2XUZA 4YRRA 4F3YA 5BMVF 1G21A 2MSKA 3HN6A 3D4BA 4D9MA 2J8ZA 2G08A 1U2DC 4WPGA 1DI0A 1YBAA 1M9NA 3EK2A 3EVFA 3ZXYA 2J9GA 5DO9A 1N2HA 2QMQA 3B1VA 1SA0A 2VJMA 2QRNA 3SDSA 4TM7A 2DSNA 3NASA 3BK1A 5CPBA 1P6UA 2BLLA 1JQLB 2FMXA 4AK9A 4D9NA 3U4AA 2C0QA 4GICA 4OU4A 2FY8A 3L7CA 3TL6A 1KYYA 4V0MA 2VTDA 2FHSA 3RIYA 5LNK6 2LPMA 2I1WA 3W78A 3DOFA 4PYIA 3ZY4A 5AVTA 4M1TA 1A8UA 1GGNA 4IHJF 2ZJ7A 4ZVUA 3PWKA 3IOYA 4P36A 5FUQA 4M3NA 1HE5A 2GNOA 2EBHX 3E05A 3EHDA 5GZ6A 5I7HA 1CQJA 4QDUA 5FNVB 4QUAA 1WBJB 1GL7A 2JJ2D 3KK0A 3REFA 3V1YA 2O8FB 4YEDA 1Z2PX 3WWDA 1X77A 1TYZA 2C9YA 2CDBA 2SECE 8GPBA 2RBKA 4GAEA 4J3JA 1E77A 3NIDB 2J31A 1A1SA 4M22A 4XDHA 3WVNA 2O54A 2A5GA 2P4UA 3IMEA 3UT0A 5C37A 4CTNA 3KIPA 5EVCA 3VYVA 3RFTA 3BCSA 3A9SA 1N7HA 3ND9A 3LFTA 1OAOA 1GRCA 5BUZA 2JJQA 1LBSA 1YR9A 2V3WA 2UYCA 3PB3A 3SIXA 3B20A 1NF2A 2XECA 4DSUA 3W77A 3AM5A 1KO4A 1VJCA 5FUMA 2BZSA 3O73A 5DNEA 4C0JA 5IT5A 2JIMA 3A4MA 2QORA 4TWAA 3RUAA 1I4EB 4PZEA 5ALWA 3RS4A 4Q9KA 4Z51A 4EA7A 4U6SA 4CIDA 1FNNA 2XB9A 4BPRA 4JN6B 4ENQA 3SWWA 3Q6NA 3HTXA 1QF6A 3GRRA 1I2ZA 3OM9A 4GOJA 2RHRA 3VKFA 2VWPA 3TXAA 2QY9A 2V4ZA 3F9RA 2COKA 2D0PB 1TO1E 1VHWA 3K1AB 2QL9A 3KQKA 2B78A 3VVMA 3UC5A 2JARA 4ML3A 1Y42X 5GM1A 4BUJA 2D4AA 4PWZA 4CBVA 1IPFA 2ZE8A 1WDLA 5KB3A 1E7WA 1LKZA 3ONNA 4X1KB 2R6ZA 3GC6A 1J0DA 3K5WA 5AXCA 5H1YA 2FKNA 4QPPA 3BSSA 4K9KA 4XA8A 2K87A 2H8GA 2QRGA 1DXOA 3W2TA 4W8GA 4CM1A 1GP2A 3AIIA 2X4GA 3TIGA 4BY9E 4J76A 3VI4B 2G1KA 3KLMX 3HBNA 1KZGB 3MERA 3OTGA 5FWXB 1ACLA 3U7EB 2V7EA 4FCTA 4FB4A 5JJIA 1EFHA 1TVEA 3VJRA 2XUFA 1XFDA 3H4MA 1CRWG 1VC2A 2WICA 4W1PA 5KTMA 1DX9A 2J0SA 4PLPA 1BD4A 3ND6A 1UZLA 3VZSA 1VDZA 3ZDAA 2HC9A 4DUGA 1E79D 2X3FA 4MWDA 5KNCA 1P4RA 2X0RA 3LPNA 2QX9A 5BUSA 4QXMA 4FONA 1ZVMA 1DG3A 1X1EA 4HDMA 4BIIA 1YV9A 1JGTA 1YJCA 3G2KA 3N3BC 3NXSA 2IYXA 1EUDB 4YJDA 4RIGA 4CL8A 3MINB 5EE1A 2G77B 5EG5A 4KDRA 4ZCSA 4ENVA 5K8JB 2C2BA 2JCBA 1RC1A 2CJWA 4K6MA 4F3KA 3BL8A 1SH7A 2QW8A 2R6CA 1RQPA 5DU2A 1GPYA 1KAEA 1AQUA 4RORA 1FIUA 1BCSA 4DC1A 1UJ5A 2DFDA 2BKUA 3ZQ4A 4ZVNA 5TY0A 2FOIA 3SC2A 4RVDA 1VI2A 4JL8A 2FEKA 4DW8A 3C3WA 1AQJA 1SY7A 4D56A 1RZVA 1U8CB 3EBOA 2EGUA 5ICGA 3VX3A 3C7AA 5DXJA 4KCGA 5MDHA 4D8WA 1TQ4A 1NULA 3U26A 4L57A 5LMUB 1SRQA 4RCVA 1PLJA 4GYWA 4L4RA 4PWYA 2HDWA 4G84A 3WK6A 4N03A 4C88A 2E4WA 3DUWA 1KZ7B 4TTIA 2CLSA 1GUYA 2BTQB 2QRQA 1KXJA 5DCWA 1K7CA 2HLDA 3VR5H 3V3TA 2OCYC 3NHBA 3N53A 2EJBA 5DDIP 4DLUA 1YMUA 2YXDA 1BGVA 3KJHA 6YASA 4EJ2A 4O5AA 1HNZB 3JS5A 3F6SA 4PG7A 4L85A 2GS9A 1JR3D 1KJQA 3G5UA 3K4QA 2X2FA 2JJ1D 3ORYA 4MGKR 2RHBA 4LY9A 1MENA 4HB3A 5K4HA 4X62B 3RGWS 4KXQA 5F2NA 4FYXA 2ZSHA 3D6JA 4HUQA 4AJ4A 3U48A 3EASA 1I2DA 4OD0A 1LDMA 3IP7A 3OOEA 1U1IA 2FGKA 2UZ3A 1ZEMA 3Q85A 3Q8MA 1G4HA 1U28C 1KI3A 1GRVA 1ZU5A 4PIPA 3OPNA 3PTZA 5ALPA 4TVOA 1DV2A 2P79A 1GNQA 4A6XA 4DEYA 1U4OA 4NC9A 4FD2A 3T4PA 1SKYE 3WNZA 2OCKA 5B30A 4CETA 2OFOA 3THYB 3H99A 4HZUA 1NN5A 2QHXA 4YJGB 3KYBA 4R5MA 3UT5A 2HJRA 2BF4A 1NWCA 3CZMA 4XIIA 3TX2A 5ICCA 2JZCA 5H9WA 2IS2A 2I3DA 4G0NA 3U4QB 2CCJA 1Q3HA 3EPPA 4EI8A 5CDSA 3ZZTA 2PKQO 3B38A 1NVKA 5JR3A 3JRXA 4FWTA 1H22A 3AZOA 3KUXA 4JBLA 3N0WA 3EW9A 4OXKA 4G5QA 3RWBA 2GJ4A 3T35A 3JSAA 5IYZB 1BXKA 4BVLA 4G56A 2WWGA 3KFVA 4DZZA 2ZE5A 1CF4A 3IEUA 2BL4A 5BVGB 5IHXA 2DUMA 3NM4A 3QVKA 3WICA 4RGBA 2HSGA 3I52A 1UMCB 3KXKA 3Q12A 4BFWA 1D2RA 3DEJA 5JISA 1P81A 1KMNA 4QBTA 4IJ6A 2QXYA 3MUFA 1B6GA 2AI3A 1LJLA 1B74A 3TI9A 2C3OA 1IK6A 2GA9A 3GCWA 4UC0A 4WINA 3ITNA 3PUWA 3LQYA 4MQBA 3JTEA 2ZWOA 5EIBD 4NFHA 4DF3A 5FH9A 3W5AA 4NXMB 2X6TA 4C7MA 1CR0A 2GD1O 3ZV4A 5HK8A 1N8SA 4TMVA 2QI9F 2SCUB 3MCZA 2UVQA 1C81A 3G1TA 2RH8A 2VUIB 4R8SA 3RUIA 4WKCA 1ZD2P 1Z6QA 2PZEA 3CO5A 1C3OB 1EHYA 2RBGA 2ZFUA 4D81A 4DDMA 1FMFA 2W4QA 3CSDA 3E7WA 5IKXA 3AUFA 1MRSA 1XPUA 1NAIA 3D4LA 4CIAA 2H9AA 3TMAA 2CLIB 4YRNA 1KERA 5JBNA 1E0KA 1A4UA 3HUTA 3FPGA 2YHIB 3UK6A 3X43A 3VSCA 2D7JA 2IV7A 3IBFA 4JC4A 4IJQA 3L01A 3DTTA 1PFKA 3EVAA 1KDRA 4X45A 3AJRA 1FTGA 1U1CA 4G2TA 4BVFA 1WMAA 1K2VN 1T2AA 4ZALA 3LUHA 4YCMA 5JC1A 2PQMA 4BNNA 3QX8A 3CGWA 1ZXLA 2OHGA 2OAEA 2V6JA 2M32A 2VNKA 2VAXA 4MNTA 5LP6B 3PXBA 1I6LA 1CJSA 5AVKA 2YOGA 4YMLA 2BFCA 3F7MA 3JQDA 1IHUA 4D96A 1KEEB 5JSKA 5JDIA 2NG1A 1DX6A 3H1EA 3E81A 3BERA 3Q3IA 3U3ZA 5LL6P 2C4WA 4LTDA 3COPA 4K9NA 1IZ8A 5KSYA 3A9TA 1H2BA 3M6MD 5HF6A 4U5QA 2VT7A 3BDAA 1T3SA 1UMDB 4GSLA 3LD9A 4JLUA 1SUFA 2IYZA 3LRXA 4WOCA 1X2BA 3WHPA 3GJ3A 4Q3EA 3GDWA 2MJLA 4WXHA 3WLQA 4WBSA 3RJ9A 5JAHA 4LFAB 3CH6A 2DE0X 2C2GA 3MJ4A 4M83A 2YIDA 3HEAA 4FKBA 4TSFA 5C81A 2P1RA 2OR3A 5FFMA 3U3DA 1YI8A 1TCUA 3GRPA 4YUXA 5LYYA 4C6TB 1VBNA 4WNYA 1ACMA 3FNIA 1IY9A 1Q57A 2EX4A 1N8TA 2L42A 5CNKA 4J3NA 4FBMA 1NMYA 2YJTD 5ALQA 4BQSA 2FN8A 3IUMA 1EFVB 1FP7A 1IIBA 5DI3B 3S7TA 3R0IA 4E33A 5IXYA 2G9RA 1BO6A