1RC8A

T4 polynucleotide kinase bound to 5'-gtcac-3' ssdna
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
301
structure length
289
Chain Sequence
MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELVKRNSKRGTKAVPIDVLRSMYKSMREYLGLPVYNGTPGKPKAVIFDVDGTLAKMTDVINPMVVELSKMYALMGYQIVVVSGRESGTKEDPTKYYRMTRKWVEDIAGVPLVMQCQREQGDTRKDDVVKEEIFWKHIAPHFDVKLAIDDRTQVVEMWRRIGVECWQVASGDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*CP*AP*C)-3'
publication title Recognition of DNA substrates by T4 bacteriophage polynucleotide kinase.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase/dna
total genus 87
structure length 289
sequence length 301
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rc8A01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rc8A02
2HEGA 3SYLA 4JT4A 1O3YA 1W46A 4BFUA 2O0HA 5AKXA 2MSEB 2EWWA 4CE6A 4PHFA 3E58A 2FSIA 3N2EA 2DPXA 4IDHA 4LHZA 1CJMA 1X1SA 2E9SA 4M1WA 5CYPA 3Q7QA 5ALKA 4BNDB 3C41J 1E1RD 2PLRA 3U4QB 4YIHA 4HGQA 4A82A 3EZFA 4AWXA 2G88A 4Q4HA 2I4IA 4TSFD 3B1XA 3QUQA 3QSYA 4B2PA 4JYCA 3EWIA 2ONJA 1XP5A 2OO7A 2YMQA 3PCTA 3DM5A 4M1TA 4R71A 4P4UA 3UANA 2G80A 4QGFA 2XEXA 4B33A 1GP2A 2HCFA 4N1AA 4Q1AA 1E0SA 1ONBA 1US8B 2J0SA 2IT1A 1TL7C 1X86B 2GCOA 3N5KA 2W6IA 4Q7JB 1NVVQ 4QBIA 5HCIA 2QSYA 1YQTA 4BX3A 3CW2A 2PJZA 1G17A 1IM2A 2GWHA 3QUCA 1N9KA 1U8ZA 2ZU6A 4WZAE 4LWZA 2HT1A 1WCV1 3MCAA 2CL0X 4RFSB 3SC3A 3QF4B 3THYA 1XTSA 4Q7LA 1OW3B 2Q3HA 3C15C 4Q4LA 4Q66C 5GJBA 4D4KA 3IIKA 3WP1B 3AP3A 3SU8A 4F7WA 3L2OB 5BN4A 3KTAB 3Q8XB 2FPSA 3W5CA 2PMKA 2NO7A 3ZDQA 5ALYA 1C1YA 1SXJC 2NMVA 1IAQA 2AD5A 3AUXA 1YR9A 1Z08A 3BRWD 1ZM2A 3B8HA 4B3FX 4OI2A 3BFXA 1A2BA 1PLKA 3I92A 1G3RA 3QNUA 3B9PA 4C4TA 4PANA 2XNSA 3ET4A 5IT5A 3W5IA 1UBFA 1OYYA 1CIPA 5KNCA 2CFSA 2OCPA 3LVRE 3GJXC 5DLQC 3WKEA 1P62B 4IDQA 1LY1A 3GQBA 3RWMB 3LO5A 2QA5A 2H18A 5FI0B 2O8DB 5ALSA 2BBWA 1VG9B 2CLDX 1CXZA 5EQTA 1WA5A 2FGJA 2IYQA 2ZBEA 1BH2A 3F3YA 2P9JA 4G5GA 1MR3F 4Q4AB 4MYHA 2WJJA 4PAMA 1HE1C 2IYLD 4ABYA 4MKFA 3GD7A 4GOXA 3T35A 1XMSA 2F43A 3OEEA 1T3LA 3A36A 1T9HA 3OFNA 4BLPA 4BLTA 4KBFA 1T0JB 3T1VA 3FYHA 3SOPA 1MO3A 2BBSA 3GEEA 1VCMA 2V8OA 1FZQA 1N6PA 3THXB 1RDFA 2ZI3A 1KKMA 4TMVA 5AK4A 1G9XA 1E9RA 1TQ6A 4HAYA 2BJVA 1D9ZA 4D4MA 2ZRLA 4HDOB 4UNNA 4EJSC 5FR1A 3K70D 3P96A 2OA0A 3B2EA 1T9ZA 2J0QA 3QYPA 1IY0A 621PA 3WK6A 3W3ZB 3R09A 4L6AA 2KI5A 1E1RA 1DPFA 2A2ZA 3ZWDA 4JSYA 1T3SA 4ZDIA 1OFHA 1JUDA 4EX6A 4MGKR 1ZVQA 4TSFA 1FUUA 4G5OA 4Q9JA 3L7YA 3RFUA 1IXZA 1GOTA 4IVRA 3VAAA 1DOAA 2CK3D 4I4LA 4XH9B 5L8VA 2PX0A 3ADDA 3BBPA 2W4MA 4RD0A 1XTQA 1UEIA 1X8LA 3S1AA 1UKYA 4JLKA 1CLUA 4LBVA 5SZHB 3AR3A 4QOSA 3C5HA 4V03A 5K8TA 1IN6A 1NN1A 1TNDA 2ZUCA 4FWTA 1DS6A 4AS2A 1LF0A 1W48A 4DEYA 1H65A 3U44B 5EE0A 1KY3A 2ZRDA 4QJ4A 2XOKD 2W2VA 3CWZA 1E2LA 2C95A 4QC2A 3OCUA 3AGPA 3RWOA 2MSDB 3RYTC 2JARA 4ACBA 3ETLA 4B3CA 4BLRA 3IO5A 4JBYA 1GZSA 3UWOA 4UM5A 4OFZA 1PLJA 5E7MA 1OH7A 1RQLA 3N70A 1E2KA 4AG6A 1W7AA 2OLJA 3SBDA 4OHWA 1C9KA 1KSGA 3ZVNA 3OCXA 4MITA 1NP6A 4KSBA 3NH9A 1OF1A 1X8JA 4KYUA 4MKHA 5CIWA 1RQNA 1W2HA 2JLUA 3NH6A 2HF2A 1M7GA 2O8BB 4TN1A 3KZXA 1ZU4A 4OKSA 1G7SA 5FUWA 4OQNA 4LBZA 5FPYA 2F3RA 3FWYA 4BUJA 3L82B 4NWIA 5ALXA 4IXMA 1E2FA 4O0MA 3SDZA 3W90A 3SYNA 1ZJ6A 1P72A 1FTSA 1R5BA 3VQTA 2FNAA 5AUNB 5AK3A 2QT0A 1M8PA 2IXFA 2G9NA 2IS4A 2FFHA 1E2HA 3PUWA 3VFDA 3DVLA 2ZJ8A 2ZRGA 3UMCA 2GXQA 2C96A 3CRRA 1PUJA 2RKOA 4JDPA 1AZSC 4NCHA 2GBLC 4XWOA 1EWQA 3EWAA 1I4DD 2WJHA 4GP6A 2CE2X 1XCPA 3QF7A 2C8KA 4KBGA 4CEHB 2WF9A 4BFXA 1VTKA 4E09A 1UKZA 4TMXA 5SZIA 2P3SA 3UMSA 3GFPA 821PA 2AH5A 1Z4KA 2WVJA 3CONA 4KNWA 2C9CA 3OZXA 1N6IA 5AK0A 2I1QA 2QU8A 3U7GA 2IHBA 1VIYA 2F6RA 2OAP1 2X19A 2YC4C 1P9WA 1SHKA 3K8YA 2JDID 4AD8A 2W58A 5TV2A 1SWVA 4HLUC 4MUAA 4D80A 4ZDWA 3FGOA 3SNHA 2ANCA 3FGNA 1KK2A 5FOTA 3FDIA 4NYIR 3DMNA 4ZDKA 2IS2A 2X4DA 2BM0A 3N1UA 5JRJA 1CJUC 5F3WB 1DAIA 1EXMA 2ZE8A 4DLZA 2WF8A 1FNMA 2IWRA 3UM9A 3KZ1E 2W0SA 4Q9IA 2NZ8A 3SHFA 2O8FB 3PEWA 1Z6AA 1E1QD 4A2QA 1SULA 2CK3A 1NSFA 3I73A 4IOJA 3HU3A 3W8RA 2QPTA 1GNPA 2A30A 2BOVA 2LKCA 2JIZD 2B7BA 2OCBA 4G5RA 3GLHA 3QKUA 5H68A 4HAWA 4BX2A 4M9ZA 4LC1A 3VHLB 4I99A 3L8YA 1T8TA 2IUUA 5JJKA 3U6BA 5EUMA 1E2JA 1BIFA 4BECA 3I76A 4XVRA 3IUYA 3NWJA 1IY1A 3ICEA 1L6RA 1RKQA 3TH5A 5IT4A 4G3XA 4Y2TA 1RKBA 2G1KA 4TLBA 2XOKA 2YZ2A 2CVHA 2ONKA 3KJIA 5EXXA 1A82A 3CR7A 4AYXA 4BLOA 5JWRA 3DNPA 221PA 4JIMA 2FOLA 3ZIAD 5UKDA 4OI1A 3GLIB 4J0QA 1E2QA 1ZD4A 4OHFA 5ALOA 3WY9A 2ZRAA 4X8MA 3OE7D 1K8RA 3F5FA 4FCTA 2JLRA 1JR6A 1VPLA 2XAUA 3OCVA 1MRNA 2C4NA 1Z5ZA 3TSOA 4NHOA 5AW9A 3CX7A 3J81k 2ZUDA 3BS4A 3ZVLA 4OQXA 1XBTA 4OBEA 1W0KD 4JZKA 4LYFA 3DDHA 2DHRA 4B6EA 2WWHA 3FTQA 2ODWA 4OHYA 1NBME 2VL7A 2H8KA 4FD2A 4BYGA 1NVVR 5AIAA 1KSHA 2ZRCA 2FPRA 1YZGA 2WPDD 1NLZA 1XNJA 2JLSA 3GLIE 4BASA 4CEIA 2HDOA 2QTFA 2W6JD 5FOWA 2ODBA 2LWIA 4B3BA 5F98A 1N6NA 4MRRA 3PGVA 3U13A 2FA9A 5FBQB 1EGAA 4IJMA 3RS4A 1XD2A 5J4YA 2C9OA 1QZXA 2NOAA 4BFTA 4C0SA 3O8CA 1ZM9A 2ORWA 5K8LA 1TTTA 1QVAA 2WKPA 5HKKD 3ZI4A 1N8NA 4QXAA 1G3QA 2NPFA 2R8ZA 1HA3A 1CR0A 1B0UA 3NDPA 3A3YA 4KX5A 4DLXA 2TMKA 1MABA 1F5SA 5KDDA 3QU7A 1JXOA 1Z6YA 3F9RA 4MRPA 2IF0A 1Z4PX 3ESRA 3M1YA 1E2IA 2A5GA 2FEMA 4BPBA 4ZIRA 3D7MA 1TA0A 1G41A 2IYRA 2JDIA 2WZQA 3QG5A 3WK5A 1KK0A 3C4JA 2D2EA 3E81A 4F93B 1Q22A 3BORA 2ZSEA 3R20A 2FX3A 1TJ3A 3K1JA 4MDFA 1QHIA 2G09A 5CITA 1Q1BA 1U8AA 2RH5A 3CNLA 3QXHA 3TLMA 1WQ1R 4MQBA 3CRMA 3QVVA 1MV5A 1YZQA 1E32A 1MT0A 3KL4A 1E1QA 2ZI7A 5K8IA 4AKIA 4EELA 2FFBA 1YR7A 2ODAA 1FNNA 4NMMA 3RAPR 1CRPA 2XB2A 2JIZA 1EX7A 2WHXA 1H8HD 4F4IA 1LFDB 1KNXA 1XD8A 1ZC3A 2KB0A 3CLVA 4MWOA 2RGXA 3AP1A 5A5GA 4R2IA 1BKDR 2ZM5A 1GWNA 3U4QA 4GDFA 3R7WB 1VYVA 3I5YA 4MH0R 5BN3A 3IO3A 3I8SA 3GFTA 4CF3A 2IYEA 1Z0JA 4MRNA 2HYIC 3N07A 2IS6A 2AWOA 2GJSA 1WBDA 2HHLA 1XTKA 1ZIPA 3ZIAA 2YMPA 1JR3E 3A1VA 4I9GA 2WJVA 3SI7A 3B9BA 2OZEA 3OE7A 1AKEA 4ZV4A 4Q7KA 3WRXC 4MRSA 5L3SB 4HAIA 1US8A 1L8OA 1W5SA 1NLFA 3A4NA 3CX8A 5TMPA 2OXRA 4QKQA 1PZNA 4XSGA 3TQFA 4B6FA 1J2JA 1W4AA 2OILA 2RCNA 2HO4A 5JS8A 3Q7PA 1W0KA 1DAGA 2GZAA 4R98A 3AGQA 2WICA 4B32A 1JPJA 2RB4A 3EZ2A 4AP9A 4UAUA 3X1ZA 4RFSA 5DI9A 3QF4A 4LJAA 3RHFA 1Z6GA 2E1RA 1NVUQ 4A6XA 3OIVA 4Q5IA 3U6KA 3MWJA 1U0JA 2VP2A 5AI0A 2WPDA 4IFBA 2DBYA 2W6JA 5KHOC 5BN5A 5JJIA 2RGNA 1KMHB 5JRZA 3KTAA 5KUTA 2VBCA 1Q1QA 4LRWA 4C0JA 3U5ZB 4EENA 1DELA 2FFQA 3T1QA 1JECA 1OE0A 1Q92A 4BFZA 4AI6A 2BDEA 2GF9A 3FMFA 4E88A 1U8YA 1G6OA 1KOFA 3QY0A 5HKKA 4Y2UA 4LDJA 3B60A 5HZHA 3M9LA 1Z3IX 1GRQA 1G1MA 3AVWA 3N5CA 3PUXA 1Z4NA 5AI8A 3WBKA 3A58B 1XMIA 3T5GA 1M74A 3ZH9B 2P69A 1G7CA 2QMOA 1Z4OA 2VSOA 3I1YA 2YHSA 1HQCA 4Y2XA 4MYCA 3VR1A 3MMZA 3WKBA 4UNQA 3LA6A 5EXPA 4M22A 5C2JB 1SVIA 4ILEA 1GSIA 4MGYR 3WK7A 4ARZB 1IN7A 3SN6A 3AR5A 1E0JA 4LJ7A 1DAMA 5E3HA 1J8MF 4NKRA 2IXGA 1XU4A 1W44A 1Y3AA 1XZQA 2D2FA 3TR5A 3REFA 4QM6A 1XXHB 3AV0B 1NN3A 2AKYA 2D7DA 1N5JA 2LCFA 3LRPA 1TF5A 2CLCX 5DN6D 3AVTA 4G5QA 3THXA 4HGRA 2A5JA 2H16A 1FOEB 5FTKA 3KQUA 3U26A 4TMZA 2R6FA 5DE3A 3PIRA 2VP4A 2VYFA 3TVDA 1E99A 4QL3A 5LD2B 1Z0KA 1H8HA 1R2QA 2P0EA 3IQWA 3VNVA 4HAVA 4FMCF 4DWJA 3SQWA 3L5KA 2AFIE 3KKNA 1S96A 2VIIA 5EP3A 4AKHA 1KSJA 2V1XA 3BH6A 1FMLA 4JB3A 3EAQA 3R9XA 5TB5A 2FPLA 2VHJA 2ASEA 3PQCA 4I1VA 2EARA 1BYIA 1XXHE 1M6NA 2CN1A 4KI0A 1NMXA 2F55A 4BX0A 4DCCA 4JLMA 2ZJOA 4EPYA 1HV8A 4OK5A 2QEQA 3CM0A 4PPNA 4Y2QA 2HJGA 3TR0A 2EQBA 2YINC 3TW4A 4WZBE 3HYRA 1S1CA 2ZVQX 3U3RA 4KCGA 2AK2A 5AJWA 3N2IA 2O9JA 4FMDF 3FPAA 3NBFA 1KJWA 2JAUA 3VU9B 1M34E 1XEXA 3U44A 4Y2JA 4ESVA 1NBMD 1E79D 2VA8A 4KFUA 1XJQA 1G64A 1O08A 4N0EA 3ASYA 3WBJA 3ZJYA 2WBLC 1ZD2P 1KHTA 4L6CA 2YKGA 2EW1A 4LV5B 1OB5A 4HSEA 3UWKA 1XCMA 4KLZA 2Y8EA 3GCGA 2IYUA 3ZZUA 5H70A 3ZQJA 3OCYA 3LNCA 1N6OA 3FFAA 2ZOSA 4IG4A 1NN5A 4Y0VA 4TQAA 3BH7A 2DB3A 4F4JA 4PNHA 3WHKA 4RCYA 1G3UA 4AY2A 1Z5GA 4ITRC 4TYWA 3WP0A 3L0OA 2GMWA 3CPJB 2ZJ2A 1SZPA 2VP6A 1VG1A 4C30A 1G6HA 2PEZA 3I3SR 3QKTA 4M53A 2F1RA 1CR1A 3QVUA 2NO9A 5GJCA 4E22A 5HE9A 2C9MA 2ZITA 4WZ6A 1XEWX 1G8GA 4GNKA 2NTYC 4L9WA 3ZQ6A 4GXTA 3OTQA 3W34A 2QP3A 2XITA 5HPYB 1G5PA 4ZKDA 1CR2A 1EFTA 1ELOA 2CL6X 4O2RA 3T5DA 4YXWD 3NASA 4G63A 1P6XA 4PSVA 5EE3A 2IW3A 3T34A 2B8TA 1Z83A 3B5JA 4DEXA 5TVKA 4RD1A 1Z63A 5AW0A 3PEYA 3T1OA 3CF2A 4CEHA 5B30A 4A1FA 4DSUA 4QNRA 1DAKA 5LD2C 2KE5A 4A2PA 3KB1A 1KI6B 1RYHA 4L16A 4Q1FA 4KYTA 1ZS9A 2IYVA 3K1ZA 4X8HA 4DIDA 5FR2A 1KO8A 1YE8A 2CLSA 4Q19A 3UG7A 3H1TA 5DN6A 2FEOA 4A2WA 4UASA 4LYAA 4Q18A 4XWAA 1XWIA 2KBFA 3I6BA 2CVFA 1E9AA 2QQEA 2ZI6A 1U98A 2YWEA 2ZS8A 1ZOLA 2FSHA 5HTKA 4YMTA 2C03A 4PHGA 3AM1A 2DFNA 2B1RA 2B8WA 2ZAOA 4B74A 2DY1A 5AW2A 4JL5A 4D0GA 3VR6A 3P32A 421PA 1SU4A 3IKJA 2KSQA 1Q44A 4W5HA 3P4XA 4GT1A 2RMKA 4HB2A 2I33A 2D4HA 4PXAA 1U7PA 1Z28A 2W43A 2P11A 1JR3D 5IS2A 2XNDD 3A1UA 1ZUNB 2O8FA 1QHSA 2O8EB 3NC0C 1XF9A 4UU1A 1YR8A 4M1OA 1S8OA 4NYMR 4DZZA 2BEKA 4AG5A 5F9FA 2GFHA 4B6JA 4JVLA 2F1IA 2G6BA 1LVGA 4CT4B 5AKEA 1RJ9B 1NNEA 3DAOA 5CK4A 1Q12A 4XPZA 4Y2PA 2BCJQ 1XFAA 1JBKA 3AF0A 1NBMA 4O8CA 4XE5A 3K70C 5CK5A 2F3TA 3K09C 4D82A 2O8DA 1E79A 1IY2A 4ZCMA 4DLTA 1FUKA 3GLIA 4C7OA 2RBKA 1TU4A 3NIWA 3QI2A 4PPFA 3TSWA 4F4CA 2H1LA 3RS2A 2ZRNA 1KZGB 3IPYA 4PQRA 5FI1B 5TXGA 3WYGA 5AKGA 5ALIA 2MMGA 4ZEXA 3WNCA 3L0PA 1E6CA 1P9NA 1II0A 4NYIQ 1S3GA 1YRBA 3SS8A 4EFNA 4UNRA 4D25A 5FTMA 1XMJA 5EXSA 2WV9A 4WIAA 2ZSBA 3NEYA 1E2EA 4DVGA 3D3QA 1CTQA 4E07A 3ZTWA 3EZ7A 4Y2VA 1P61B 3HPQA 3KKPA 3ICQB 2FSFA 3MJRA 1DO0A 1NN0A 1ANKA 1OXVA 3L43A 5H8WA 2ZRJA 1P2SA 4LI0A 5EP1A 1ZNWA 4KU4A 721PA 1CJTC 2Z4SA 4BRUA 1GKIA 4V0NA 4M9XA 1G4AE 4Z8YA 1P2TA 3LDAA 5JWOA 4Q21A 4FYPA 5AVSA 3K0SA 3ECCA 1MKYA 2ODNA 4YXWA 3PUYA 1JI0A 4L15A 1CU1A 5SZKB 2B82A 2G0NA 4A4DA 2OAQ1 3ZLJA 2ODEA 4MKGA 3QXXA 2J7PD 4IOLA 2ZYWX 4TL7A 2WWFA 3Q5DA 4XVUA 1Z6TA 3ED5A 1Z22A 2CCKA 2LKDA 1YJ5A 3BC1A 3T61A 1PV4A 1J8DA 3A1EA 4TYNA 3AF3A 4RFVA 1KJZA 2GEDA 1T4GA 5SZJA 1CR6A 2OV2A 5FPTA 1SQ5A 1W49A 4FCVA 3GLFB 1DADA 4CYMA 1ZRNA 5L3RA 2VF8A 1B23P 1GNRA 3EZ6A 4FFDA 5E4FA 4OJKA 4CF4A 2VHQA 2DR3A 5FUVA 1N0UA 1QRAA 4NFLA 4PAQA 5E7JA 3U7FB 1WPGA 2C5LA 2R6CA 2VH5R 3FB4A 1S8FA 4K8OA 5AVTA 1ZBDA 5E95A 1HY3A 4KITB 5IRCD 2HXSA 3H84A 3QXSA 4KYIB 5CJ2A 1RIFA 1VECA 2FZ4A 4OHZA 3MRSA 4BEBA 1P73A 4DSNA 2MSCB 2N42A 5AI6A 3U19A 1Z0IA 2R9VA 3AVOA 4KO8A 4US0R 1TADA 1W4RA 2WWIA 3NDBB 3PITA 1HH4A 1FQKA 1E2DA 1JR3A 1XTRA 2BBOA 2XNDA 3NBZC 4M1KA 5GVSA 3ZUPA 4CF7A 2PZFA 4JKIA 4IVQA 3D6TB 4URZR 1OXUA 2ZJYA 4QFMA 2DWOA 2IYWA 3LBHA 3QEJA 4JS0A 5CM8B 3CPEA 2FMXA 2B92A 3QKSB 5C4GB 2GXAA 4MUMA 4X8OA 3HWSA 1WRBA 3OAAD 2HV8A 1QDEA 2WF6A 1UKVY 4IFTA 5AVUA 3JZMA 1GVNB 3E1SA 3R7WA 4LYJA 4JLDA 3IBYA 3GPLA 1RMQA 2BHRA 2ORIA 1K6MA 1KMQA 4N3NA 3U3MA 2Q9AA 2JLXA 2IL1A 3LFUA 2ZSDA 2ZRFA 2R6AA 5ELXA 1SVSA 2I6XA 4NU0A 5ALWA 1T5SA 4UMVA 2ZG6A 4O25A 2FPMA 1NRWA 2D2VA 1KTVA 3AF2A 2GJ9A 4FWIB 5FOUA 1N6LA 5L3SA 2WF5A 1GDDA 3KXLA 1Z5UA 2RB5A 3A1CA 3DZDA 3OIUA 4YH1A 2XJ9A 5LDDC 2WWGA 4LGMA 2YBDA 1L8QA 4B75A 3ZX4A 4TLEA 1N3BA 4LBWA 1CR4A 4JBXA 4ZEWA 2W0MA 3WMFA 5DYIA 3ZYCA 1TQDA 4JLBA 3KOOA 1CF4A 1LS1A 4BEVA 4KFRA 3THWB 4FN5A 2G0AA 3PCRB 3L8ZA 4OD0A 3X2SA 2V1UA 5ALVA 3CR8A 8OHMA 4PHTA 2HCBA 3AF4A 3H2YA 1KMHA 1IOZA 1JQLB 2QAGA 3K9GA 3WMEA 5IK2D 4DT1B 2IOFK 1U0LA 1S2MA 4TLCA 2QROA 3J7TA 1E96A 2OBMA 2BJWA 3X1DA 2J7PA 2IX3A 3FZQA 4UKDA 2HT6A 2P6NA 2AFHE 4QG7A 3MG9A 2QORA 2ZANA 3BE4A 3HP1A 3WKAA 3QXGA 4MYTA 2NZJA 1KK1A 3M4YA 4GIBA 1BS1A 2FH5B 3QE0A 2FUEA 3AR6A 1DG1G 3B82A 3CZPA 1VFPA 4UATA 3SFVA 3FM9A 5AM1A 1E4VA 4BLQA 1QHYA 3GJ4A 4ZI3A 4PQYA 4BZQA 3TNFA 1YNSA 1Z4IA 4EQ6B 2C8LA 3LBNA 4HAXA 1T91A 3AR9A 1XEXB 4HUQB 3GYGA 4NH0A 2J45A 2RGNC 4ARZA 1EWRA 4BGDA 3L8GA 1G5RA 2REXB 1RKUA 2IK8A 1N5KA 2GRJA 4Q01A 1G3IA 5CB6A 4YONB 1XXHA 2R8RA 5JCZA 1LF5A 2WJYA 2WKRA 2HLDD 2P6UA 4XTRA 4DIEA 3SD7A 3RVBA 1A7JA 2VF7A 3PUZA 4JL6A 3VR2A 2JLZA 3S6JA 1U99A 4V0KA 1AGPA 1ZD1A 3AVPA 4DCUA 2AGVA 2W11A 4JLJA 1QHHA 4G01B 2VP0A 3ADCA 3MPOA 5JHGB 2CJWA 4AKGA 1Z2AA 3EIEA 4GBMA 3DOFA 4U02A 1OFUX 3OAAA 2Z0MA 2ZYTX 3CKLA 2P65A 4L9SA 3SYKA 1IWOA 1HQYE 3RLFA 1U90A 1ZIOA 4US1R 5AJYA 3TMKA 5A4JA 1FTNA 2RGDA 4URYR 3MAAC 1VJRA 1SVOA 5FOVA 3L1VA 1G7RA 2YYZA 4EFLA 4MYUA 2YNMA 5CIQA 1F2UB 1XDBA 1Z47A 2GTPA 2H92A 1N0VC 1Q3HA 1OIXA 4Y0AA 2BKEA 5CLQA 5ALMA 5AM4A 2JJ1D 4HAUA 4BE7B 3TRFA 3LY5A 4A0HA 3VU9A 4DDUA 1SKQA 2GF0A 5ALPA 3IGFA 3G5UA 1E9FA 1F2TB 2OSBA 5DNYB 4HGNA 4CT5A 4DB4A 3D8BA 4ZO4A 3L8FA 3NRJA 4Z8XA 1QVRA 4PSKA 4W7SA 1ETUA 4JYBA 4WBSA 5GADl 4B71A 2XGJA 4TYQA 4A9AA 1R10A 2VHUA 1Q0UA 4H1VA 4OQLA 1FW6A 4UW9A 2PJRA 1E2MA 2ZSFA 1JJ7A 3IHWA 1KI4A 3AH8A 2J5XA 3K0FB 3K09A 4B2IA 1NKSA 5DO9A 5EP4A 1WB9A 2G07A 5IK2A 4FW9A 2Q4RA 1CJKC 3X1YA 4Z51A 1WMSA 5AUPB 1KDPA 3KFXA 2ZUBA 3OCWA 3ZU6A 2OE2A 2JJ8A 3T1TA 2QYHA 3RF6A 4PAOA 4R7ZA 4TTRA 1UDXA 2DFTA 2HF8A 2IBMA 5AVWA 4PPQA 1G4UR 4C0QC 2R8XA 3UKDA 2P67A 4S35A 2X1VA 3CWQA 3WK4A 1RZ3A 4KODA 2ZSAA 3TIFA 4URWR 1GG2A 2ZYVX 3IHLA 4H9GA 2DCUA 5EUQB 4OK6A 4PQFA 3VAYA 2G3YA 1ZUHA 2P2LA 2HJVA 3EZ9A 4TTPA 3WNBA 1F48A 2WIBA 1D2NA 2ZIAA 5FH9A 2FI1A 5TARA 3Q5EA 1HYQA 5AKIA 1O03A 2KJQA 3CX6A 3N8GA 3KUDA 4PFSA 1OJLA 2QRNA 2QMUA 4II7A 2ZXUA 3MD0A 3KC2A 5FTJA 5ALNA 5EE1A 4B34A 4C7OB 1AJEA 1FMJA 1KI6A 4BRWA 2OUKA 4D26A 1KI3A 2HLDA 4GSYA 5AESA 4JVMA 4JLAA 4J03A 5AW1A 1MO6A 1E3MA 2OESA 2AX4A 2EFDB 3B9RA 2I7DA 2IYXA 2WOOA 3RRMA 1RMTA 4UARA 1YHNA 4JLNA 4Q4JB 3LH5A 3ZTYA 121PA 2YC2C 1U94A 3G82C 2ZI4A 4MGIR 3KJEA 4M9SA 1R7RA 1RYFA 1Z4LA 2GVZC 1HURA 2WAXA 3D31A 4DBLC 1YDFA 1E0AA 3IIJA 4Q9KA 1PLLA 3LXXA 1E9SA 1YVDA 1KDRA 2A9KA 2UKDA 3GJ6A 2O8EA 1VG8A 2AXNA 2DWPA 1ZP6A 2R8YA 1JAIA 1UDWA 1WP9A 1Z06A 3A6PC 1JEDA 2QE7D 2ZI9A 5JZVA 2O8CB 2JJ1A 2QM7A 2BV3A 4A6PA 3FKQA 4P0TA 1TE2A 2AWNA 2ORVA 4F72A 2G83A 4CGZA 1VIAA 3EC2A 3RC8A 1NMYA 4OCZA 4C0AC 1RJ9A 2JAQA 1Y63A 5FL7D 4YIKA 2W2TA 3X1WA 2VLIA 1K5GA 2ZBDA 3EC1A 4JVNA 5KPJA 3W8NA 1XVIA 2PBRA 2IYTA 4AK9A 1XPUA 1ZCBA 2GCPA 3REGA 4DDWA 1AM4D 1JXMA 2K5UA 3ADKA 1CEEA 3AB3A 1NNLA 4YCMA 2I55A 1UADA 3BH0A 3NG1A 5G40A 4DHEA 1XP8A 4QJ5A 2ZJ5A 4KFTA 4QM7A 1ZD8A 2NPIA 1VHTA 4Q9LA 1NRJB 4OQFA 3RABA 2D7CA 3QLEA 2QTVB 2GEVA 3EA0A 1KDTA 2FF7A 4EX7A 3SR0A 3A4LA 1JQJC 3TK1A 2GHTA 2O5VA 2C98A 1ZNXA 4CEJA 5IF9A 4WVFA 3NALA 4NYMQ 1JALA 3MJHA 2WAYA 5KSOA 1W4BA 3RS5A 5AKHA 5GVRA 4IOMA 3MFYA 3LV8A 4OK3A 1RRCA 1KK3A 2H5EA 4KXFB 4V0ME 2VQSA 5AI5A 2WHEA 2OYCA 1M2OB 2OFWA 3HLTA 4HATA 2EFEB 5BQ5A 3WGVA 5CM9C 1E2PA 1GRNA 5AVVA 3PUVA 4I9FA 3U7EB 2PLFA 1W0JD 4R2HA 1ESNA 3V4FA 3Q85A 3VR4A 4RSGA 2XX3A 3UK6A 3ZGXA 3AR8A 3UMFA 1UBCA 3B13B 3P4YA 4C4RA 2A3RA 3W6PA 2B8EA 2ZJAA 3GLFA 1AQ6A 3QG1A 1VHLA 4UNPA 1VKJA 2NO4A 4UMDA 2V7QD 2XZPA 3AR2A 4C0KA 1SVKA 5P21A 1KI7A 1GILA 4DXAA 5B64A 5AI4A 3HR8A 3U3KA 4C4PA 1UBGA 2QQ0A 4FCWA 4NDZA 4PC6A 4A0RA 3AVQA 4IDOA 2ZR9A 1FP7A 2FSGA 2WTUA 3QOFA 1W36B 3I5XA 4CNQA 3WGUA 5AVQA 3P20A 2VKQA 5CJPA 1YV9A 1PVOA 2IEZA 5T41A 3E5HA 3I8XA 2RHDA 1M7HA 4IVPA 5DHAA 4KSCA 4Y2RA 4BFWA 2C8VA 4DUGD 1Z6XA 2FG5A 3RRZA 4ZCIA 1V5WA 2O0JA 3VKWA 2Q21A 3B78A 2FJUA 4XD7D 3NEJA 2CMKA 2QAGB 4LJ5A 2BKUA 5DIFA 4AC9A 3R9IA 1D9XA 5EZ5A 2G0TA 1SWWA 3QKSA 2QE7A 1IJFA 2DQSA 1E0KA 1KO4A 2J0UA 4GOKA 3LLMA 3IB6A 3W6OA 1EFCA 5KSPA 2X2EA 1ZCAA 5FL7A 3RS3A 2CFRA 1GM5A 2QBYB 1RPZA 4D2IA 2WF7A 2XB4A 4TZ0A 3SBEA 5J40A 3GEHA 4IHQA 2A5FA 2ZTSA 3DDCA 4ESHA 2VP5A 2G08A 2G77B 4DJTA 1LVHA 2PH1A 2BBTA 1UAAA 1L7PA 3FKSD 4TT3D 4HB3A 3GJ8A 4RZ3A 5DI3B 4YDSA 1Q20A 4PPGA 4DDTA 2JJ2D 3MC1A 4KN8A 2ECKA 4B3DA 2HEIA 1KKLA 3ZS9A 1RKVA 3LW8A 2AL7A 4B47A 4Y2YA 5AIBA 2QGNA 3GJ5A 1ZM4A 3AR7A 3P1JA 1OIWA 4URXR 5KYKA 5C18A 5B58C 3SKYA 4TQ9A 3AEZA 2QRZA 4B43A 5C4MA 4AKEA 4DLSA 1EFUA 4Q48A 3KDSE 2V6IA 2ZREA 4GPTA 4NP6A 1OXXK 5C46F 1ESMA 5EP2A 5B2ZA 1F3OA 3THWA 1GFIA 1L7MA 5ALRA 4KX3A 4CF5A 3BAFA 1QHHB 4GI7A 4Q00A 1XX6A 1E69A 2X2FA 2CJWB 2YJ4A 2VO1A 4PZZA 1R8QA 3QXJA 2HF7A 5ALDA 2GK7A 4UJ5A 3PENA 3KQNA 4DT1A 3QNMA 3HU2A 4EEKA 3KFVA 2J46A 4OQMA 4TLAA 2BMEA 2N46A 3VR5A 4ZI2A 4D0NA 2WM9B 3CNNA 5BW8A 5JCPA 4GMXA 5EZ6B 3Q72A 3NUQA 2JATA 4H1UA 5KNDA 2WM8A 3G0HA 1TF7A 3QEOA 1XJCA 1UEJA 4P4TA 1W0JA 3TUZC 4HGPA 4NZYA 4TL9A 3OIYA 2DFKB 1X6VA 2V3CC 2ZS9A 1FFHA 4FMBB 3H86A 3OHMA 3TLXA 5A3RA 3QU2A 1TAGA 1N6HA 2P5TB 4UXJA 5CYOA 3KDPA 4QGHA 3KXIA 4G1UC 3V00A 4B3GA 4AURA 2FU5C 5AWFC 4EPXA 3CH4B 4A15A 1L7OA 4A8JB 2FEAA 2AK3A 4NAVA 2C78A 4RD6A 4EQ6A 1R0ZA 2V7QA 3K53A 2X8AA 3AKYA 3LW7A 3AKDA 2GZDA 2VRWA 4HUQA 1AS0A 4NCNA 2CHQA 2QAGC 2PL3A 4RESA 3MWLA 3QUSA 2V9PA 4M4SA 2Q0HA 3KB2A 3LLUA 4FIDA 4HB0A 4YMVA 2Q3MA 2V55B 1KAGA 3SQXA 3BWDD 2BCGY 3ND9A 4QNMA 2GEUA 2IWHA 2R2AA 4DUGA 1U2TA 4L5BA 4LHXA 3FVVA 3EG5A 4TWZA 1RW4A 4LPSA 4XD7A 1BOFA 4C9BA 1HEIA 1DTSA 2OEPA 2Z6VA 2Z4RA 1OB2A 4I81A 3C8UA 2CCGA 3BERA 2EYUA 3NKVA 1ZD5A 4PX9A 1UFQA 3JVUA 3NHAA 3L0CA 2IYYA 5AW3A 4WAUA 4W9MC 1XPOA 2JAWA 4Y2SA 4B76A 1LW7A 1X3SA 2WKQA 2AKAB 2BDUA 4A92A 4RD4A 2VHTA 1NY5A 2IXEA 1II8A 4YQFA 1QQ7A 1I4TD 3SEAA 2PCLA 1DO2A 2REBA 2QNRA 1F2UA 1JEEA 1ZM7A 3GEIA 3P27A 2FUCA 1NI3A 3SZRA 1D8TA 1R0WA 2A78A 1D6JA 2OFOA 4PO1A 5AJXA 5L3VA 1P7CA 4Q47A 4QBHA 2FZLA 3WRYC 1CULC 3B1ZA 2JGNA 3E2IA 2P6RA 1OHHD 3FKSA 4TT3A 5FPKA 4ACAA 1QHGA 2W00A 4GZMA 1EG7A 4K46A 4GL2A 2JJ2A 4KAXA 4FXPA 2RHMA 1DAEA 3SMVA 1F2TA 4JMPA 3R8FA 4L4UA 4TZ6A 1U02A 2R8EA 4DLRA 2I1VB 4HZIA 3WMGA 4HB4A 3CNHA 1HT2E 1S3SA 1VJ5A 3TW8B 1T0HB 4MUBA 3T15A 4CIDA 5FUXA 4G9BA 5FOSA 1X1RA 4BFSA 3T06B 3AVUA 1TPZA 3GP8A 1IBRA 2PQ0A 3DKPA 1ZAKA 1WF3A 2QPOA 3QKRB 4Q1BA 1P60A 3PR1A 4YGYA 3K0FA 1VYTA 2OCYC 2MMCA 3H4MA 3LWNA 4NPHA 2RAVA 4HGOA 5EE9A 1WBBA 4HDQB 2HOQA 1DVRA 4EDHA 4UMEA 1L8LA 1GL9B 2EU8A 2NO0A 2WSMA 4XTCS 2HDNB 1WXQA 1GKUB 3L1UA 4EPWA 3BWVA 1E2NA 3UMBA 1Q57A 2GETA 3L0BA 1IN8A 1QHXA 1EK0A 2VP9A 4M9QA 2RGAA 2ZVPX 3SJCA 4DLWA 4B35A 4L57A 1Q1ZA 1Z2CA 2YY6A 1N25A 3EA5A 2BDTA 4ERNA 2ZS7A 4XQ0A 2QT1A 2F9LA 3U2QA 5KPDA 4YMWA 1MO4A 2EWVA 3QU4A 1M7BA 2N1BA 2ZI5A 3ZS8A 2GESA 3QBTA 4UXIA 3TKLA 2Q3FA 3BFVA 2NO1A 1ZU5A 2PZEA 4Z1MD 3PXGA 4BKMA 5DISB 3MSXA 4NONA 4QHYA 3T12A 5B57C 4JLVA 4Q03A 3WYAA 4DC9A 1OT3A 5J4LA 2FPKA 4LHVA 4C0HA 3R9KA 5A3QA 5HCNA 4ZKEA 4Q1DA 4WOPA 3THOA 3A1TA 4YCNA 5L3QA 3IILA 2OT3B 4V0OA 4EKDA 4LJYA 4NE2A 3B1WA 4RJLA 1ZNYA 2YWFA 1XMVA 4LJ9A 3R4CA 2F9MA 4A0FA 4Q1EA 5FP0A 3DEFA 1L4YA 2WSSD 4Q4JA 3K0AB 2JAOA 1W36D 2GHQA 5JBQA 4O3MA 1RFLA 3RS0A 2I34A 3KUCA 3TVTA 2Z43A 4CEJB 4N0DA 3BFKA 2ZJZA 1OFTA 1SXJB 4LPKA 3VTKA 2PT7A 1FPMA 5A3SA 5JHHB 1Q21A 1W5TA 2SHKA 4FMCB 2CFTA 3CB4A 2MSNA 1L2TA 3MLEA 1P4SA 2IS1A 3E8MA 4Q1CA 1W4CA 4RKEA 3WYFA 1KI2A 2PT5A 3EXAA 5DHFA 2O8CA 3BIFA 3NAMA 4DCSA 2WMOB 1R4AA 1UBEA 1JNYA 2UZIR 1C4OA 1U9IA 1OXSC 1XB2A 3B1VA 3CF0A 3WXMA 1OHHA 4LV6A 5JEEA 5AKZA 2ANBA 4HDCA 3DOEA 2CNWD 1S2OA 2YJ6A 5CB8A 1P9RA 4UM7A 4IFEA 3AKEA 1E98A 3U61B 2EAUA 1SXJE 2YWHA 2ZBFA 1CS4C 4FMDB 3VKHA 4JJZA 5AM2A 4GOJA 1DAHA 3TAUA 1WZCA 2VSXA 2Q4TA 5AKLA 3HU1A 4HI0E 4D6PA 1QYIA 3BB4A 3AF1A 3BD9A 3HJNA 3KKMA 4QGAA 3SLRA 1TU3A 4FINA 3DO6A 1MH1A 3NHBA 4CRWB 1OKKD 2HI0A 4V0MA 1U2SA 3PJRA 4IEEA 4Q7MB 4QRHA 3FPSA 5ALFA 5F9HA 3BB3A 1T5IA 3PVSA 4BZXA 2IA5A 1AQUA 2OXCA 3UPUA 1FEZA 3SKXA 4UXHA 4IRUB 4JLPA 4EJSB 3EIHA 4KFSA 2VHCA 1SVMA 2XZOA 3K9NA 2Q5EA 2DWQA 3VKGA 3B1YA 1OFIA 3PGLA 3I72A 3GJ7A 1KIMA 2XTZA 4OI0A 2Z83A 2QLTA 4MDEA 2CBZA 4URUR 4BZPA 4P33A 4EAQA 1FP6A 4V0LA 1YRAA 1XJ0A 3LVQE 3RSOA 3U7HB 2CL7X 2J0UB 2MU1A 4DRZA 3M0EA 1NIPA 2OCAA 2BWJA 3M1IA 3TJZA 3AP2A 1DE0A 3FVQA 4Z1MA 1D2EA 2B21A 1QQ5A 5LPNA 1OLOA 2GZHA 4EFMA 3IEVA 1OH6A 5AKKA 2REOA 1XTIA 4MRVA 3W6NA 3P26A 2EFGA 1UPTA 3ESQA 5JEDA 3BA6A 3CRW1 2V6JA 2QENA 1GIAA 2WOJA 2G06A 5AW8A 1R5NA 1CBUA 5J4HA 5TDHA 3NIBA 5LB4A 1N2CE 1NF2A 3FMOB 2WSSA 1YZUA 3EASA 3KBBA 3U3JA 5FBVB 1S9DA 3A37A 4LBYA 1W47A 2O52A 1MRSA 1LB1B 2BC9A 4BFYA 1XRJA 4LHYA 2NO5A 3RRYA 1GAJA 5K8UA 1CRQA 3CRVA 4LOAA 2BMJA 4TLDA 4URVR 1SVWA 2RGGA 4XVQA 3NTUA 2EFHB 5C1BA 3ZVMA 1ZUIA 3BXZA 1PUIA 2E87A 1E4YA 2BVNA 4DSOA 3K0CC 5DGXA 3CBQA 4B2LA 3OPXA 3TGPA 1L7VC 1UJ2A 4W5WA 5JFGA 5ALEA 5EJEA 1NSTA 2J41A 4JVSB 4DKXA 3OCZA 3O47A 2YJ3A 2Q9BA 5D3QA 4XSHA 4CW7A 1QHNA 2I3BA 1ZW6A 3O8DA 4EUNA 5BWMA 6Q21A 1N0WA 2JLWA 3QUTA 2CNWA 4M8NE 5IHPA 4UU0A 2QBYA 2ZEJA 2X77A 3RS7A 5AW6A 1YU9A 2ZR0A 3IRUA 4GMDA 4G0NA 2G1JA 1XPRA 5AVZA 4WXPA 3OEHD 1P2UA 4M1MA 4YLGA 1RLTA 1G5TA 2PX3A 1J97A 2BMDA 1YZLA 4OHVA 1Q1EA 4EIWA 4ZEVA 2YV5A 1OKKA 5JSZB 1IXSB 1KGDA 2YMLA 4PC2A 4UNSA 4B3XA 5DI3A 1K1EA 4F92B 1T5TA 3SHWA 3W5AA 3MGCA 4D4LA 3DMDA 1KO5A 3C16C 2J0VA 3HPRA 1FL9A 3KJGA 3RRNA 3VR3A 1F60A 1G8YA 4LX0A 2QGZA 5AKYA 1OH8A 2DFLA 2QI9C 1CP2A 2JASA 3HR7A 3QQ5A 4IDPA 3ZVRA 4LCBA 3CZ4A 1J7KA 4W5JA 4KVGA 3QUBA 4HLCA 2DYKA 4RY2A 2R6GA 3L0YA 1OXTA 3CUEF 2GAAA 5FOXA 3ZW7A 3QIAA 1J90A 1ZRMA 2YMMA 4Y3UA 1YKSA 1XEWY 4PTLA 4FE3A 5AVYA 4TTQA 2G1AA 5AKJA 1G18A 1T5LA 4OYHA 1NKTA 3ND8A 4JBWA 1KI1A 3JVVA 4QQFA 5FL3A 3L0IB 5DSZA 3NANA 3DHWC 4MKIA 3AVXA 1II8B 1E9CA 3DZ8A 3GLGB 1TF2A 2D74A 4M1YA 4P3YA 4P4SB 4TYYA 4DWOA 2CDNA 3IBGA 4MGZR 2KBEA 1P75A 1NG1A 5BYJA 2AMYA 2VEDA 1IHUA 4PZLA 2PEYA 3DPUA 5JI3E 4L8GA 3EW9A 3L0SA 4M0LA 2CCJA 4PC7A 4A8JA 1ZD9A 3L8EA 5FBRB 3N28A 4O2LA 1S0UA 2OM2A 1W1WA 4BFVA 4EPTA 1COWD 1QF9A 2WMNB 1EX6A 1LNZA 3W5BA 1L4UA 1QBKC 1KNQA 1GL6A 4LC0A 4E03A 3L8HA 3I1FA 1T3HA 2ATVA 2GCNA 1YZTA 2C2HA 4RVCA 4A0GA 1Q91A 2WFAA 1G8FA 2OM6A 3CH5A 3QX7A 3VX4A 3PFIA 1YZKA 3K9LA 2JA1A 3C14C 1UKEA 4X8LA 4Z54A 3GLGE 5H1YA 4DCNA 1N5LA 1Z29A 1LTQA 1T6NA 2JEOA 3K0EA 3SE0A 3EARA 5AUQA 4E5UA 1XPJA 1KJYA 5JJLA 3B6EA 3CIOA 4IDNA 2ZBGA 3OF5A 3BJIC 4Q02A 5DYGA 1I2MA 1R0XA 3I4LA 2RARA 2OLKA 3ONWA 3BB1A 3QU5A 2IEYA 4TQUS 4IOKA 3RANA 3W5DA 2OFXA 4UJ3A 1SXJD 5KDLA 4BWYA 4RETA 1OYWA 1GITA 5IT0A 1A5TA 2GK6A 4KJZA 4BEWA 5AVRA 2UVQA 4BEJA 3EF0A 2Q6TA 4HEJA 3TBKA 3O8RA 2NYVA 4U5XA 2R6DA 4HZUB 4YDHB 521PA 4NV0A 4EZEA 3OEHA 5JJBA 3EIQA 3EPLA 4V02A 4OJQA 4LZZA 4DLVA 5D3MB 1Z4QA 1NLYA 2IOFA 1AN0A 2H17A 2GA8A 1E94E 4JKYA 4KHZA 1KI8A 2B6HA 4NYJR 4DCTA 2ZU0C 3HYCA 1EESA 2IYSA 5KSYA 3OIWA 2Q9CA 1YR6A 2BMFA 2BM1A 3O8BA 4LYHA 4PC1A 4NCJA 4DSTA 3I28A 2B0CA 1BO6A 1G19A 3EX7C 2GJ8A 4XOUA 4AS3A 4DLUA 1G8PA 1TEVA 4BBJA 3VHXA 4PSAA 1YMQA 5BXQC 1QH9A 5L3QB 1Q3TA 4CZ2A 5KDOA 3TUIC 1Z4MA 4NTZA 2OBLA 5GJWC 1VCIA 3U3OA 1N6RA 5AI9A 1SHZA 2C9YA 2YN4A 3FMIA 3QU9A 1U81A 4DFDA 3QKRA 1F6BA 1VCNA 3CRQA 2V4ZA 4HAZA 1GNQA 4POAA 2GHIA 1WE2A 1D2MA 5HE8A 1XCGB 3CZQA 5AR1A 2WWYA 1QG4A 3WK9A 1LS6A 4GZLA 3RDPA 5CDFE 2B30A 2B8JA 3GJ3A 3MWYW 1P2VA 1KI9A 3PV0A 2QMEA 1J99A 2J3EA 1VG0B 2A7QA 2C99A 4TL8A 4QGGA 3FOZA 1FX0B 5J5CA 2QTHA 3FFBA 4LJ8A 5DH9A 2XXAB 5JECA 1F5NA 1NL3A 1E9DA 2GVDC 3AVYA 4OHXA 3RC3A 1TX4B 1COWA 1FQJA 5ALZA 4KNVA 3R9WA 1H8ED 1SVLA 2QAJA 2IC5A 3PEVA 3UXMA 5FBLB 1J70A 2JLVA 3CF6R 1TUIA 4LJ4A 4XJXA 1P5ZB 2AR7A 5AM5A 2P27A 2J59A 1XEFA 3NBYC 3NVAA 2ZRPA 4RZ2A 4XWKA 5KNBA 2AUTA 5AHXA 2ZE7A 2GNOA 4ZPXA 4IW3B 3KKQA 1Z0FA 4OI4A 1U2RA 2QSZA 3MUFA 1ZINA 1KYTA 3ET5A 2WWXA 2VPPA 4Q4HB 4LY6A 2GKSA 3K0AA 2AXPA 4DLYA 4HYYA 4CVNA 1XZPA 3FHCB 2ZRHA 1RRGA 3HDTA 3UATA 5E0OA 2C04A 1GKYA 1QG2A 1CKEA 4F71A 3MMPA 1SXJA 2O0KA 2QL6A 3DL0A 2FPWA 3LXRA 3B9QA 1NVWQ 5ALUA 2J87A 5LBIA 1NVXQ 4B44A 2YOGA 1RE0A 4KVAA 5KTYA 2GCOB 4AYTA 2KWIA 3UG6A 4JJKA 3DV9A 1G21E 4DB2A 2BIFA 4G5SA 3UMGA 4XIGS 1JJVA 5J47A 4F91B 4DDVA 5AM3A 3THYB 3TSZA 1DG3A 1KZ7B 3A1SA 5LB2A 2XZLA 2PMDA 4EPRA 1JB1A 3ZD7A 1YZNA 1KDOA 1G291 1R5OA 3K0CA 1EK2A 3CNOA 3C7KA 1N6KA 4KV9A 2R62A 1R0YA 5BYKA 5JMTA 3X1XA 5FFMA 4JSTA 2VSFA 5G3ZA 3CPHA 4EPVA 5KSZA 3I62A 2CEAA 4BNDA 1VDZA 4C0LA 5KU1A 2GILA 2F7SA 2A5YB 2AHOA 3ZZ0A 4QJ3A 1M1YE 1TJ4A 3WK8A 1RRPA 2RGEA 1NJFA 1RVDA 4KLNA 4GP7A 2HX1A 1AGRA 4J2TA 4U7DA 1JAHA 3FHOA 4HLDA 2OBBA 5AW4A 1AA9A 1U9IC 4EJSA 1VYUA 2B1QA 4M1SA 4H1WA 1G8HA 2FE4A 3VMFA 1O87A 4WW0A 2V54A 2HYDA 4DCVA 1XD9A 3TAHA 2CHGA 2YOFA 2F1HA 3AKCA 3ZX5A 1OH5A 5FTNA 2QPAA 1BMFD 4HYTA 2QN6A 4PO9A 2NIPA 5ALHA 1HE8B 1NJGA 2WWWA 1RMYA 2F43B 1E9BA 3KJHA 2HXYA 4HUTA 2QM8A 3E84A 5HR5A 1TMKA 3W9YA 3ZWKA 5M04A 1X42A 4K81B 1TJ5A 4YC7A 3BK7A 3FE2A 3NXSA 2HUPA 5JI2E 2QY9A 4D81A 2PZGA 1U7OA 3LQRA 1H8EA 4D0LB 5ALJA 3KKOA 4PO8A 3IJ5A 2OG2A 2YWGA 5F2EA 3SF0A 3H0KA 1MH9A 2D06A 2ZETA 3B7GA 2CXXA 3A8TA 2FPXA 1IJEA 4RCZA 5JLJA 4C2TA 2WIAA 3QPWA 2WJIA 4OL0A 2JCSA 2C77A 3M6AA 2RAPA 1KSFX 1PJRA 4I1SA 5TY0A 3GLFE 1D5CA 4Q9HA 4P32A 2YJTD 5GJVC 2R44A 3A1WA 1WR8A 4I1OA 1VMAA 1W2GA 2NG1A 1TQ2A 1IN4A 2ZXEA 1ZRHA 4GRAA 4XOIA 3KQKA 5KO2A 1A4RA 1ZC4A 2ZQ5A 1J8YF 3FMPB 3S1AB 3UMRA 2F1JA 1NY6A 3LQQA 2W2XA 2XTNA 4BLSA 3A1DA 1II9A 3R8CA 2VTKA 1CQZA 5J4KA 1RRFA 2AD1A 1U0HC 4U00A 2QG6A 4Q4AA 3ONNA 4NCKA 3W5JA 4HLQB 2FDCA 3FHTA 1WVIA 5AW7A 1NIJA 1TQ4A 1S4QA 2IF2A 5CLLA 2YJ5A 3VX3A 3AR4A 5E7IA 2QMHA 2UZ3A 3UIEA 1CJVC 1VCOA 5A0FA 2H57A 1SGWA 3LAWA 3LD9A 4JT2A 3JZAA 1W36C 1AQYA 5G53C 2GBLA 2ZAMA 2BEJA 3B85A 3KX2A 3D6JA 4QHSA 1KAOA 2D3WA 3SFZA 3GMTA 2GJAA 2WJGA 4RKFA 4LSGA 4NBSA 2ZRKA 2FN4A 2GDJA 3I32A 4LV8B 1K5DA 2ZRIA 4M2LA 4B48A 5JSZA 5ALLA 1ZMXA 1NF3A 1IN5A 2C88A 5AICA 1KO7A 1TUEA 3A4MA 5IDVA 5FUYA 4WXRA 2YVUA 2ZRMA 1R8SA 2HCJB 4TYPA 4P31A 1Z4JA 5JWHA 4D4JA 4PR0A 3QGMA 5HZKA 3EWSA 2ZROA 3PEUA 3QENA 3WKCA 2XTMA 3CO5A 4HLUA 1G20E 4NL4H 1RC8A 2I54A 1TEXA 2GXSA 4TL6A 4A36A 4PC3A 1UF9A 4IXNA 4NABA 3DKVA 4F38A 1Z0AA 3AUYA 2R65A 4C4SA 1HT1E 3TE6A 1N5IA 4RD3A 4S2EA 3EPKA 1YS9A 1V43A 1BMFA 2IHYA 3PDWA 3RNLA 5FPHA 2FWRA 3Q3JB 3K9HA 3KQHA 1A1VA 1Z07A 1E2GA 4YCLA 2AN9A 2GXUA 2J9RA 2QP4A 3QJYA 3EF1A 1S1MA 1DEKA 3NC1C 3HYTA 2EFCB 3GFOA 4AIIA 1AZTA 2ATXA 3GLGA 1QQ6A 4P4SA 2XSZD 2ZYUX 4LUCA 5JS7A 1HTWA 4QHTA 4WA7A 3E70C 1Z0DA 3WKDA 5EXTA 2EYQA 4ASUD 2IUSA 3K70B 2JGAA 3AQ4A 5J4VA 2O2XA 2RGCA 2BY4A 2IOHA 1KO1A 1SKYB 1KYIA 1OIVA 5EE5B 4UMFA 1EFRD 1GTVA 2O8BA 4TMKA 3VNUA 3SJBA 4JLOA 2FDRA 3BOSA 3ZD6A 2NGRA 2OBNA 5FTLA 3KXKA 5G41A 1IONA 1P3JA 5AJZA 5KOYA 1I2DA 3EPHA 4PZYA 1RLMA 3RSLA 3I61A 1ZJJA 3KD3A 3QPVA 1LV7A 1WDTA 1GUAA 3GLHB 3WHLA 1MO5A 4I1UA 3F0TA 2QZ4A 2GO7A 3KQLA 4AYWA 4CDGA 4R9UC 3V9PA 2EVWX 5AJVB 2GAOA 3IPXA 4QJBA 4RZXA 1SKYE 3ADBA 3QPUA 3QBVA 2J7KA 4PHHA 2CHVA 4A8JC 4C3ZA 1IQPA 1G3MA 2P5SA 4TMTA 3ZZTA 5G3YA 1G7TA 4GFDA 1E9EA 2ERXA 4C2UA 4YMSA 3EPJA 1ZM3A 2PCJA 1OPXA 2GJKA 4DW8A 1GL7A 1ZNZA 5AK6A 5ALQA 3Q9LA 3GJ0A 3GLHE 4LJ6A 1AIPA 2W6ID 1HUQA 4ON9A 5ALTA 4UQOA 4HZUA 3V4RA 3OESA 1Z88A 1PW5A 1MOZA 2ZE6A 5D3MA 1AS2A 2ZR7A 4IEIA 2W83A 1EFHA 3ASZA 2D62A 3MWKA 5AUOB 2EATA 1DAFA 1XTJA 5AVXA 2QUZA 4ZDJA 1S9HA 2J1LA 3LX5A 1DBSA 2IYZA 2FFAA 3SJZA 1GRRA 1RLOA 3IDQA 3PG5A 4LK2A 4RZUA 1X8KA 2QP9X 5CDFA 4CEIB 1I4LD 3U60B 1JPNA 3FPBA 3SHQA 5ALGA 3AVVA 2JLYA 4B73A 3MN1A 1EK1A 2HF9A 2NQ2C 2ZPTX 4FI3C 1XD2B 2A5DA 1A2KC 4MA4A 2YOHA 4JL8A 4TMWA 4C0BA 5AM0A 2FGKA 1AKYA 5FBWB 3B8EA 3TQCA 2FPUA 1ZYUA 2B7CA 1DARA 3NBXX 4QBFA 4QBGB 1IXRC 2ERYA 4IKEA 2ZJBA 2OHFA 2HSZA 2JLQA 4M21A 2ZRBA 3W3AA 2XJ4A 2Z5FA 3LX8A 4UAVA 1G16A 4US2R 1BYUA 2ZE5A 1OSNA 1ODFA 1MABB 2IUTA 3EPRA 2L0XA 3DM9B 4NYJQ 3IEUA 2PKEA 5AW5A 1OV4A 1UM8A 2XSZA 3WNDA 2RGBA 4LHWA 1R6BX 4ZIRB 1Y8AA 1ZD3A 5AK5A 5FPSA 3QXCA 1AS3A 1FX0A 3IQXA 4ASUA 4BQSA 4YMUA 1T8UA 2YFYA 3OEED 2CE7A 3BGWA 3C5CA 4RD2A 1Z8FA 2NO6A 3OFND 3SJAA 3TUJC 1NG9A 2XXAA 3LBIA 1EFRA 1KY2A 3F8TA 5ANRB 2PR7A 1NMZA 4NCIA 3IIMA 2H7VA 1L7NA 2FV8A 4ZCLA 1AK2A
chains in the Genus database with same CATH superfamily
3KT8A 2CHFA 4P2BA 1O3YA 1RADA 2O0HA 4IVNA 5BVHA 2MSEB 1ZONA 2DPXA 2A9RA 1VSBA 3Q7QA 3HWRA 1E1RD 3BHMA 1L9KA 2Q0QA 3ELBA 3OKAA 4YIHA 1T0PA 1EHCA 4B7AA 4A82A 4BCDA 3MERA 4TSFD 2I4IA 5BN3B 1RC1A 4IS3A 1B43A 1GCAA 1R4MB 2X15A 1XP5A 2XCOA 1L1RA 2OO7A 3GFRA 1LPOA 2YMQA 4BS9A 5E6UA 2DEUA 4R71A 4P4UA 1YE3A 3OKCA 1TLTA 4D3DA 2Z6QA 4EHJA 1J2RA 3LC1O 4QGFA 2OV6A 3HSKA 1GP2A 2HCFA 4N1AA 1HMYA 4MQ5A 4HV4A 3FNGA 3TLGA 1IHOA 2J0SA 3FF1A 4ESOA 3G2NA 4OATA 1H5QA 2I7VA 4RF2A 5DSXA 3K2QA 4C3OB 2B5OA 3PTLA 1YQTA 3DEJA 2VJLA 3C97A 4BX3A 4OBWA 2FZCA 1TM5E 1U8XX 1IM2A 4EGQA 5KNDH 1B2RA 5E6RA 2ZU6A 1VPDA 5BV0A 3COSA 1GNSA 3M5PA 4Q7LA 2HGZA 3E53A 2Q3HA 4Q66C 3SC3A 4F1KA 3CKYA 5GJBA 5BRAA 1FYXA 3HC7A 3IIKA 1TJYA 4HSGA 3OQMA 1CZKA 3ER9A 2JAPA 4YT5A 2QVGA 3QFRA 3AEKA 1G63A 2E4VA 4J4BA 4UDOA 1HNWB 3RIXA 5BN5B 4B09A 5LKAA 4PONA 3Q8XB 2BI7A 1ESEA 3EFOA 3K31A 3ZDQA 1P19A 1C1YA 2XYVA 3VUFA 3ITKA 3AUXA 3EZNA 1YR9A 3AHFA 1CQWA 3EFBA 1FP4A 3H11B 1P4GA 4OI2A 3BCUA 1I7LA 4RE6A 2EQ5A 4C7KA 2WB2A 4MXDA 3BXOA 1K6JA 1LBTA 1YJAA 3E9DA 3ET4A 4JWKA 1C3JA 2PUHA 3ABSB 3W5IA 1OYYA 3CLKA 3DH0A 5IT5A 3LFHA 3FNEA 2CFSA 5KNCA 3AUUA 2OCPA 4TN5A 2WJZB 2GM5A 1ZK3A 2BR5A 4DCPA 3S8YA 1VJCA 2EL7A 2EZ8A 1L7EA 1P62B 3ANLA 4TWIA 5B4UA 1LY1A 3K73O 3LO5A 2AXEA 1SQ0A 5FOQA 1Y34E 3MB5A 4UAGA 1H0KA 5EUCA 2FGJA 2YASA 1BH2A 4B79A 2PJUA 5ADHA 3Q8WA 4WXHA 5GWXA 4LS3A 4MDHA 3QVGA 3F3YA 2VP3A 1NYQA 3Q9UA 4PAMA 1CS0B 5NLLA 1IBMB 2Q1XA 3DHYA 4ABYA 4ARBA 2ZSHA 5E6SB 3T35A 4QQ8A 3OCCA 3A36A 3D7RA 4E15A 2VDNB 4ER0A 4BLPA 3Q8KA 4NULA 3NVKI 1B6SA 3U56A 3VYSB 2O3TA 1ND5A 4GYKA 3G9TA 3M4XA 1W1IA 2O6LA 2WM2A 1FZQA 3SR4A 1DFHA 1ULZA 3V8VA 4D5EA 1KKMA 5AK4A 4U2EA 3SX2A 4X60A 2PV7A 4GYWA 2R8OA 2ZRLA 4HDOB 4QDKA 1DL5A 3D2BA 3K70D 2H1SA 4ETIA 1RRVA 2RH9B 4PYLA 4YP0A 3L7MA 3W3ZB 1XC7A 3O4FA 3HYSA 3HA2A 2VDKB 3HKEB 1ZVQA 3JARB 4X7RA 4RKQA 2VR1A 1K6EA 3BF8A 1X77A 1UAGA 1IXZA 1DJOA 3ITNA 1EVKA 3L7YA 4GI5A 2A1TR 5FI3A 3ZBQA 2CK3D 3FW1A 3PC8A 4XH9B 3MJDA 5HZMA 2RGRA 3J80A 1B74A 2W4MA 3ZLTA 4EGFA 3E7XA 5G2OA 1UKYA 4JLKA 2FE1A 3O26A 3OEWA 2GAIA 3AR3A 4AIRA 1IB6A 5K8TA 3B3JA 2XVXA 1YACA 2ZUCA 3FCCA 1R4NB 1NNSA 4HFRA 4U8HA 2JFYA 3B2NA 4Z0HO 1QFJA 4AS2A 3GCDA 1OZAA 1KY3A 5E2BA 4Q9JA 3N0TA 2XOKD 2W2VA 2ALJA 3CWZA 4QJ4A 2B2NA 3HEMA 4GOLD 3FWPA 3SF8A 3OCUA 2MSDB 3D5TA 3RYTC 3IAS6 1NYRA 4ND8A 4FQ8A 4IIHA 3ETLA 3T3PB 4B3CA 5KJFA 1HLGA 3NI2A 2PKYX 1GZSA 3P2YA 3NOOA 4TTAA 3UWOA 3IDZA 1KU0A 4HN9A 4C2BA 1LTKA 1OH7A 4QODA 2QY6A 2O2YA 1E2KA 2DKOA 4AG6A 2Y1XA 1G20A 3RH0A 3SBDA 1NE2A 1C9KA 1I2CA 4R1SA 2PUVA 3DOOA 3QNWA 4KSBA 1YRYE 2VUTA 1I6KA 1L5VA 1T3TA 1X8JA 1RQNA 2M6SA 5CIWA 4EY6A 2B36A 4RUKA 1K7FB 3S2FA 1CIJA 3P2MA 1V6SA 2O7RA 4I9NA 1ZU4A 1WMDA 4JDUA 4OKSA 4Q3EA 5FUWA 4BQIA 5TGZA 5KVVA 2DPMA 2IS2A 5I01A 1E2FA 3RBXA 3SYNA 3HMQA 5CW1A 5T6MA 2VAXA 1R5BA 2X6QA 2Z30A 2O1WA 1NWHA 5DWDA 3SEZA 2JJQA 4F5EA 5AUNB 2FFHA 4U6NA 1EFPB 1ECGA 1KYQA 3I01A 4GWKA 2MSKA 4CQMB 3TD2A 2GXQA 3VNRA 4UFOA 3ZWOA 4BNUA 2FPIA 1NV8A 5JVDF 1VSTA 1RAIA 2PLWA 3WGOA 1EWQA 1LX6A 4MO9A 1LC0A 4W7HA 2CE2X 2DSTA 3KPVA 3UTDA 4J94A 4MHOA 1VTKA 3GJZA 5BMVF 2AMLA 2AN4A 3RFVA 2EP8A 3GFPA 1MA3A 4IJWA 2YZKA 2WVJA 3CONA 4RK6A 3BMCB 1JT9A 3EC7A 4X1YA 3OZXA 3TKAA 4JCCA 2WZDA 2HK7A 2I1QA 3SM9A 2QU8A 4UTXA 3KWMA 3VZCA 2IHBA 1A7KA 2F6RA 3DC7A 3IOCA 3NWEA 4ZOLF 1RZUA 2PZBA 1A95A 3KYDB 4FT4A 4DR2B 2X19A 3GLKA 2WJWA 3PVCA 1SHKA 4G56A 3K8YA 2JDID 4P82A 5ILGA 4Z49A 2F17A 1ML3A 3C3DA 1JHVA 1SWVA 2O8NA 3LRXA 4HLUC 2XNJA 3NHLA 4MUAA 4KR7A 1E60A 3FGOA 3RAEC 3SG0A 1KK2A 5FOTA 3FDIA 3I39X 3N1UA 3X3HA 3IEKA 3AM5A 2BM0A 4ZDKA 2ZUEA 4WBNA 4YDQA 1FNMA 2QZ9A 2IWRA 1HNXB 1T24A 3TJMA 2O8FB 1Z2NX 2LR0A 1Z6AA 4L0QA 3I73A 4BBPA 4IOJA 2QPTA 3E0QA 4FFLA 2UZ0A 2ZWOA 2WJAA 2A30A 1DFIA 4YROA 1TC2A 3AHHA 4EX7A 4F3CA 3VKGA 4HAWA 3VH4A 1ISSA 3VHLB 5DMXA 5BR1A 2IUUA 2PUJA 2GM9A 2QHXA 3PDIB 3WAKA 2D4AA 3K35A 3IUYA 4JI0B 4EO7A 1EUQA 1RKQA 1VSUA 3ICEA 3GP5A 5IT4A 1NBWB 4FOOA 4Y2TA 1RKBA 2G1KA 4TLBA 4DLXA 4UASA 2CVHA 3ND7A 4G0VA 3K0BA 2O8DB 1MIHA 1QVWA 1XZEA 2GZ1A 4FOLA 4JIMA 1L1FA 3ZIAD 5UKDA 4FOPA 4ODIA 3O38A 4KK4A 1TTQB 4J0QA 1MGPA 1ZD4A 1K97A 1LDBA 2G9RA 2VCHA 2ZRAA 3HLKA 4OHFA 5DGCA 3WLLA 2VNIA 3VSEA 2JLRA 4JC4A 4UBMA 3QVLA 3SF8B 1MDBA 2B99A 2Q7DA 2JGKA 3KZOA 5AW9A 4DW8A 3J81k 1RPAA 1B73A 5EGNA 4EJ0A 3AXTA 1XBTA 2FN9A 4G4IA 1W0KD 4G0QA 2EEZA 4LYFA 3WGIA 5I4IA 2GASA 3FTQA 4XX0A 4BGIA 2VL7A 4LCEA 2DT5A 1PJSA 3AB8A 1ZLXA 3G79A 4RHXA 3ZCVA 4YRPA 3QYJA 3GMDA 4QXOA 1RWVA 2LIPA 1XNJA 4BASA 2BH9A 2DULA 2YXBA 3DLTA 4YMLA 3ZV7A 2QRVB 2V6BA 3U13A 3ZCPA 1N6NA 1SOUA 4MRRA 1U04A 3H99A 4OYYA 3DV0A 5FNVF 2VVTA 3KLBA 4WLVA 4X1KA 1WSBA 2J5RA 1WHSB 4F04A 2QX7A 4Y7DA 2CVZA 3O8CA 3EY4A 5I9BA 1CNMA 5DHTA 2V96A 2WKPA 4E1BA 3ZI4A 1JQEA 1TQ8A 1U5CA 4JJ6A 1MFPA 4L6IA 3X1MA 1OZHA 5DNUA 1CP3A 1DEXA 3DFUA 1NAIA 1NF8A 1O5IA 2BD0A 2QE6A 3A3YA 3R4VA 4KX5A 1XNQB 3G8AA 3FOBA 1LNSA 2PTGA 3LZ6A 2TMKA 3LCJA 4UHCA 5KYTA 2BFWA 1A97A 1TPYA 1N78A 2AB0A 1Z5PA 4GLJA 4L2IA 1T0BA 2QV7A 4V39A 1U0NA 5CCXA 1E2IA 2A5GA 2FEMA 1WKCA 4L4XA 2P41A 3LUFA 5LP6F 1BX1A 1F0PA 2A6PA 3ESBA 3D7MA 4NEGA 1TA0A 2B4TO 5LQKA 3BT7A 1FMCA 3QG5A 3BHNA 2AN1A 4ZQGA 4X9XA 2CL5A 2D2EA 4F93B 1Q22A 3U48A 1TJ3A 3UT5A 4AP5A 2Z8XA 1BMQA 1XNRB 3G0BA 4MDFA 3OECA 2IQ5A 3FCEA 2YWRA 3CNLA 3DZIA 3TLMA 5JMPA 3WIUA 3SS7X 3KTFA 3A9TA 1YZQA 2B4RO 1E32A 2H29A 2JCBA 3QLUA 1E1QA 2DF8A 1YR7A 2ODAA 2Y2VA 3RAPR 1ZK2A 3N3AC 4DV4B 2JIZA 4BNIA 3O4IA 5DN9A 1QLJA 3VPSA 1PJ8A 4OQDA 4ZRMA 1YJXA 2P3OA 1ZC3A 5IZCC 2RGXA 5EVCA 4LK3A 4PRYA 3SOZA 1GWNA 3BF7A 5ERXA 3R7WB 3LUKA 4GDFA 3M6MD 1GUZA 1NBEA 3MM4A 4MH0R 3SDSA 4WZAA 3IO3A 3AUAA 4RELA 2IXTA 2HRDA 3B7WA 2HWUA 1F8GA 3MJ4A 4X90A 3W77A 4BP8A 2HHLA 2O2HA 1WBDA 2IS6A 4ZU3A 3M6XA 1QO0D 3A1VA 1OCEA 1BW9A 2WJVA 3FYUA 3H42B 4I9GA 1ZIDA 1U6JA 2OZEA 4HDRB 3KOYA 4L8VA 4NZOA 4TM8A 4ZV4A 1YUMA 1WG8A 1V3VA 1URPA 1RHRA 1SBNE 1US8A 2OC9A 4E2FA 1GHTA 2ZR8A 2P30A 5TMPA 3F47A 4QKQA 1FDWA 4AJ2A 4HRXA 1QUEA 5DK4A 2OILA 2VSQA 2H4FA 3DOUA 4CKZA 5JJ5A 1U7XA 2WFLB 3ABOB 5C9ZA 3Q7PA 2YS7A 1FUIA 2PM8A 3UA3A 3AGQA 2WICA 4U1RA 1WDKA 2RB4A 1RXUA 3EZ2A 3S5JA 2GBCA 3AY6A 5DI9A 3HACA 3QF4A 3DE0X 1Z6GA 3EIWA 4DCGA 4A6XA 3OIVA 1CC1S 4PHCA 3CLTD 5CA1F 3ZU5A 4WNCA 2W6ZA 5AI0A 2WPDA 3NGMA 2DBYA 2HWWA 3FUUA 1AUPA 2W6JA 1EVYA 2PZAA 4L73A 3RSFA 2RGNA 4S1OA 1J0EA 4FKBA 3FMVA 3ZGNA 2VRCA 1R0SA 4EJMA 4Y1EA 3NAGA 5F1KA 2YHIB 3MJFA 1RRMA 4C0JA 5C51B 1RD4A 1DO8A 1DELA 2FFQA 2QWXA 1JECA 3LPLA 1OE0A 4FE7A 5AOCA 4YN3A 3T1QA 4J90A 4BFZA 2BDEA 3FIJA 1SOMA 1OX4A 1VLZA 1ZHHA 3IT1A 4MDYA 3DZJA 1U8YA 2FZKA 3D64A 3QTTA 5HZHA 5CB4F 1WVGA 2ABWA 4L08A 5EIAA 3WIEA 3WBKA 3A58B 3ONFA 5EKXA 3E3LA 3HO6A 3GCWA 1Y7IA 4RHFA 2EZ9A 3OZSA 3VR1A 4TXMA 4IIGA 1HDEA 4DQ0A 4LTNA 1SVIA 2I6UA 3F78A 3NCTA 4KPUA 1IN7A 3AR5A 3KZCA 1R37A 3MWEA 5E3HA 1C2TA 2MYPA 2YXPX 1J8MF 3FSGA 4NKRA 2IXGA 1WPXA 4Q7QA 4D02A 1DQYA 2HL6A 1Y3AA 1W44A 3HUEA 1XZQA 4MLDA 2D2FA 4URHA 4CKWA 1K0UA 1CUGA 4QGSA 2DQYA 2Q6LA 3NTQA 4QFCA 4QUGA 5IU6A 2D7DA 4TS1A 4B3JA 1TF5A 4IDGA 4HTAA 4O4JF 5DN6D 4QSHA 3AHGA 3FLEA 4K6KA 4KB5A 3TIVA 4LXQA 5FTKA 3VH1A 4ZAWA 3VSDA 3FPCA 3L7BA 1OD6A 2VP4A 1XTZA 3TVDA 3JYHA 4V1CA 1BN6A 1R2QA 5A7HA 4GQBA 3VNVA 3VR6D 3U4IA 4AKHA 2JL1A 3BH6A 1DBRA 1YJQA 3GGDA 5F64A 3TQRA 3R9XA 1SCDA 5DBGA 2EARA 3T7EA 5U4XA 1HDIA 3F6BX 3QLVA 2P62A 3AV3A 4IH4A 5FFFA 4ZVUA 1B3RA 5FBKA 3ROTA 4DCCA 2ZJ1A 4BKPA 3BA1A 2RC6A 3T7AA 1HV8A 1VL5A 4MVJA 4OK5A 4PPNA 5KX5F 2HJGA 1CUSA 3W6UA 4BO6A 5GIOE 4MWCA 3TW4A 1O96B 5K4HA 1OU0A 1T1EA 4OP1A 5GY7A 3BEOA 2O9JA 3N2IA 1RIIA 4K5QA 1TZKA 5EIBD 4A7PA 2H4JA 5IFLA 4JXZA 1FLNA 4U39A 3G1WA 2XVYA 4HADA 1WO8A 2HU7A 1E79D 1X1TA 4I4TB 4KFUA 3ISVA 1O08A 3WBJA 4IKOA 4JH0A 5K45A 1CEYA 2YKGA 4MHSA 4FVTA 2E5FA 1IUKA 4E6EA 1PGPA 2X0RA 1QYCA 1SCUB 2I6FA 3BJMA 1OWPA 3MWGA 1AV7A 1XCMA 5K0GA 1U0TA 2GPYA 4KLZA 4OEHA 3VVBA 3ZZUA 4ZCSA 3ZQJA 2CDBA 3PC8C 3FFAA 1SUFA 4HLNA 4YJFA 3Q0EA 1CUJA 4QQKA 1YS6A 4WZZA 2HIHA 2GCGA 1IJKA 3GGSA 3MMSA 1FP1D 3SFTA 3FDZB 3WHKA 4BN0A 1T1SA 3L0OA 3PC2A 2ZJ2A 5TE9A 4UCFA 4ITVA 2QYSA 3S70A 4PRZA 1VI6A 3DDWA 2WFMA 5EESA 2MINA 3OEYA 3STXA 2PEZA 3I3SR 1RBZA 4C2AA 4F2DA 2BN4A 1K8XB 2G67A 3OM0A 4MUKA 4HWPA 4OXXA 2IDMA 3BBLA 3QVUA 4UE2A 5GJCA 4MZXA 5HE9A 2Q1WA 3TQTA 2Z3WA 4WZ6A 4I08A 3M2PA 2NTYC 2HCTA 4RJ2A 2UUCB 4H31A 3W34A 1AF4A 4DIBA 3IUQA 4JR0A 4ZKDA 1CR2A 1ELOA 4G63A 4YRJA 4O2RA 3T5DA 4BP3A 3MTGA 4RMNA 4HBGA 2ZK7A 1L5KA 3RHTA 4DGSA 4YI3A 3P0JA 1Z83A 4H0CA 4DV1B 3HCBA 4PSCA 4GOMD 2IP1A 4RD1A 5HRCA 3MTQA 3T1OA 1D6SA 1ADYA 4TYMA 2GWRA 2YZGA 2H52A 5LD2C 1B00A 2KE5A 3FZEA 4ZT2A 3SVZA 4L16A 3TD9A 2W7TA 2BEUA 1WCYA 2X22A 4EG6A 5HILA 4WE3A 1YE8A 4Q19A 4B3FX 3H1TA 3DZFA 3PD1A 4WCVA 2YW2A 4I5EA 1CUYA 3Q9NA 4QYSA 4UUAA 2YNMC 4XWAA 5DLEA 3C24A 3H8WA 2ZI6A 2ZS8A 3UJAA 1U98A 3DWIA 2I67A 2VA9A 3BMOA 2FSHA 5HTKA 2QR3A 3DMYA 4OXIA 3QLTA 2NU6B 2YHAA 2PWAA 4GWGA 2DY1A 5AW2A 4JL5A 2HMVA 3I6IA 5JPCA 3EVTA 3T7JA 2KSQA 2ACEA 1Q44A 4W5HA 1M2NA 1Q2XA 1R64A 4GT1A 4TKMA 3V4ZA 5IS2A 3KPJA 3OQ1A 5JD4A 2J4CA 4EGAA 5JS1A 1HOTA 2O8EB 2UYHA 1SUWA 2OCIA 4OM7A 2D7JA 1TRKA 1H1TA 1YR8A 2F8MA 4PYKA 3G3EA 1S8OA 4DZZA 4RIHA 3WADA 3ZU3A 4JBGA 4ZZIA 4B6JA 1QPBA 2F1IA 4YLEA 1RVV1 1MJGM 2J6BA 2P77A 1RM4A 2PX2A 4CT4B 4CLRB 4E7PA 3IV9A 5BNFA 3OOEA 2XUOA 2JLBA 3IP5A 2XMRA 2BCJQ 1PGNA 4TZTA 4O8CA 5CK5A 5L6LB 1GO2A 2J67A 4WESB 1ZNQO 4DLTA 1BRTA 4C7OA 2PL5A 1U28A 3AYZB 2H1LA 2REQB 2ZRNA 3FGZA 3GD5A 1W35A 3IPYA 4PQRA 5T6BA 5TXGA 1CY2A 5LVAA 4N8EA 3D4NA 1Y8QB 3L0PA 4JASB 1PQPA 4BVHA 4YLYA 1P6UA 1BDJA 4D25A 4Q1VA 2WV9A 3R44A 4H60A 4KP7A 3JD2A 4DVGA 4EHNA 4WBNF 3ZTWA 4E30A 5G4KB 3DZBA 3EZ7A 4Y2VA 1C0KA 3L7AA 4AF8A 3IMGA 4PCUA 5BSTA 3X1JA 4O4LF 4MO2A 4KMSA 3ICQB 3LCRA 3NKLA 1DO0A 1ODCA 2JA2A 3AG6A 3VZPA 2EFYA 5H8WA 2HNBA 3A4VA 4BMDA 721PA 2SECE 1TD9A 2GKGA 4KLAA 1ES9A 3NT2A 5K3CA 5ITWA 3AOEA 4BU0A 4JI5B 4Q82A 1P2TA 4RWZA 4COKA 3DE1X 1DDOA 4FYPA 4O33A 3ECCA 4YXWA 2CMHA 3K0SA 1YA8A 2FSSA 4UM9D 3GFGA 4RVFA 4N6GA 3QXXA 1Y48E 1DJQA 3F6SA 2ZYWX 3CMCO 2WWFA 4IOLA 4TL7A 4TROA 4ZI5A 1KAMA 1Z6TA 4AROA 3ED5A 4CKXA 2LKDA 3BC1A 3EYWA 3F67A 1YRHA 1J8DA 4DKJA 4FQ7A 4O2AA 1NE7A 3PYMA 1KJZA 4BE9A 4TSRA 5SZJA 4NECA 4FJ1A 4ZAFA 4L3WA 3RK1A 1DADA 2QSUA 3ES9A 3IMKA 4NK4A 3WWOA 2G6TA 2Q2QA 2C9BA 1CY7A 1UBRS 1NMEA 1SIOA 3EZ6A 4ZGBA 1NUHA 5EHGA 2I3GA 5E4FA 1XFDA 5BP7A 2WSIA 3AESA 3KEMA 2JK1A 3VOAA 2Q8NA 5FUVA 3N6RA 4PICA 3EGOA 4FFBA 4EOGA 4KXXA 4CG3A 5AVTA 1VIVA 1SBQA 1ZBDA 2BGLA 1HY3A 4OG2A 5E95A 4KITB 1RIFA 4ICIA 1AGNA 4CKBA 4FSHA 2DY0A 1QO9A 3QITA 3MRSA 4PFQA 4MMZB 1DXOA 2PPLA 3UV3A 2NNLD 2O2IA 1A0OA 3JV7A 1XJ5A 5AI6A 5JATA 3AM4A 2FMTA 2P0AA 1K5PA 2R9VA 1V35A 2C5GA 3OZEA 2RI1A 2VAVA 2IHVA 3NDBB 1GU0A 1B8OA 1AB5A 1E2DA 4M1KA 2EKLA 3E4DA 4DN6A 4EM6A 1MP0A 5HQ3A 2D5BA 2B2CA 2OTCA 1UQTA 2QLBA 2G63A 5F1PA 3WL5A 1BEEA 3D6TB 5LU8A 2HRQA 3QEJA 2IYWA 5DGIA 2C94A 4YFYA 3LUGA 4BV8A 1IDOA 3V1TC 4B0OA 2WVGA 3VYTB 1D3AA 1VXOA 4GP9A 3WBBA 1GVNB 3E1SA 3UGTA 5AVUA 2WQ7A 3DB1A 4ZHQF 3GPLA 2HDWA 1MG5A 3OX2A 2AG1A 4HOYA 1OZ0A 3ZWWA 2Q9AA 1UXKA 2YNMD 4YCCA 3LFUA 2ZSDA 5TMDA 2ZRFA 2R6AA 3RADC 3AIMA 1H1LA 1SVSA 1ILEA 2R97A 2G36A 5F5NA 5ALWA 1DV2A 4LISA 4O25A 2FPMA 5L3SA 2QYTA 1N6LA 4GXNA 3QLUC 3KXLA 3S2IA 1M75A 2GTIA 2WHPA 2E48A 3OIUA 2WWGA 1M8GA 4EG8A 1L8QA 1YUBA 1PT6A 3ZX4A 3R6LA 4JP2A 4L0MA 3CCFA 2AFHB 3R6DA 1ZH8A 4HWSA 3CSUA 3I37X 5DYIA 4X64B 1KJJA 1CF4A 2JD0A 5AOAA 5FBZA 2PNFA 4QAJA 3C1AA 2XBMA 3UXHA 5JMWA 1G59A 3OIGA 3AF4A 3H2YA 4AD8A 1KMHA 2RDMA 4GX1A 3AM1A 1JQLB 2QAGA 3K9GA 5C3UA 2GPTA 1R0RE 2ZUUA 3FYUC 3C4QA 3U0VA 3ZCQA 1KZ6A 2Q46A 3V1LA 4DT1B 2SKEA 3J7TA 2OP0A 2H9IA 4FYMA 2QW1A 4YWHA 3EXHB 3FZQA 4ZOEA 3U9SA 3P5SA 3I9V1 3ML1A 4XYEA 1M2VB 2AOUB 2AFHE 5HEKA 3MG9A 3GA0A 2QORA 4M87A 2XD4A 4XFDA 1ZUD1 3LX4A 5ERGB 2GZMA 3I2YX 4AO8A 1D0SA 2G40A 3H87A 4ZCRA 2FRDA 2FUEA 3HJBA 1JFSA 3RRFA 1DG1G 4LIPD 5CNIA 1KMCA 1CB7A 5JD5A 1CZOA 1E4VA 4ZI3A 2WPNA 1I0LA 4IHJB 3LBNA 1L4NA 4DDHA 2G9QA 2QNBA 3BIWA 3HP4A 1XEXB 1C29B 2XUAA 3GYGA 4J7CA 1T1GA 1Q77A 2J45A 2RGNC 5DHPA 4LAFA 5H4HA 3UT6A 4OGGA 3ZDZB 4RFLA 3TNDA 2IK8A 4YR9A 4J0IA 9LDBA 3C3JA 3JYNA 4DYHA 1T36A 3LXUX 3CF4A 4ER6A 5CB6A 3ZE9A 1T2AA 1VI2A 3JQAB 4PZCA 1EEXB 1I4OA 2BFFA 3PFFA 3RVBA 2ZWAA 3PUZA 2JLZA 3H6KA 1F8FA 4V0KA 3T3HA 3AVPA 4Z86A 4ZO9A 4BNGA 4DCUA 3R3YA 3LY9A 3HJFA 3GQVA 3C6QA 3ILHA 4MCIA 3KSRA 1GLGA 3R5FA 1Z82A 4JENA 2X0FA 2M2IA 3K9BA 4MPRA 2V7UA 3GPIA 1BCRA 1JHXA 2PWYA 1F12A 3EIEA 1M34A 4ROTA 1ZOIA 1OFUX 4E31A 1BXRB 2P65A 1IWOA 1L5FA 3EIOA 3FNHA 1HQYE 1JPUA 7AT1A 1N33B 3I5AA 4XSVA 1Z2EA 1VJRA 2NNWB 2YV3A 3G5TA 3HKDA 3OJ0A 5HNKA 4IQ8A 2R84A 2YYZA 1GGJA 4MYUA 4DWJA 2WUDA 1Z47A 2GTPA 2H92A 4UM8B 5JW6A 3ZNOA 1OIXA 2UYYA 3DTVD 2BKEA 5CLQA 1BC5A 1OBHA 5FWDA 1XVTA 5AM4A 4MW5A 4HY3A 4V1CI 1HFKA 1JEYB 3OZAA 1CY6A 1MOQA 3KLPX 4JELA 4BE7B 3JR7A 4II2A 3TRFA 1YONA 2QX8A 4EY5A 5BR4A 1XGKA 3SC2A 3K6SB 4OUDB 4DDUA 4A10A 2WU1A 2GF0A 3H4IA 3ANYB 3PLAE 2H6EA 3UHAA 3I9V6 2OSBA 1P45A 4HGNA 4YRQA 1M1ZA 3G1TA 3H9UA 3QE3A 1DV1A 1S7CA 4F11A 4IL5A 4JB2A 4DB4A 4BIMA 1YFZA 3D8UA 5CFPA 3PUHA 3COVA 4W7SA 2O7VA 2J9FB 2Z2XA 5GADl 1SHUX 1L4KA 5J2TB 2PNJA 2VHUA 3EEIA 4OQLA 3QLVC 4UW9A 4A9AA 1FW6A 4NARA 1FNBA 1TC1A 3BMNB 2YTZA 3IHWA 3SICE 2D00A 2HMAA 2J5XA 4AZ3A 2PVSA 4EW6A 2RH8A 3F6YA 5DO9A 1PQ4A 2RK3A 2YYSA 3KZNA 1DZIA 3PB3A 5IK2A 4E5VA 4Z51A 1KJNA 2FR8A 5HGJA 5LLTA 1VE7A 5AUPB 2GZ2A 2ZUBA 4AICA 3WL7A 2JJ8A 2WUGA 5KQSA 4CMCA 4R7ZA 1PZXA 1SD1A 1DBVO 4C7MA 3HB7A 1PEKE 1XV5A 5E8JA 1SOWA 2R8XA 4KI7A 5GV8A 1AK1A 1QX3A 2ZIFA 1S89A 2ZSAA 2XKJE 4KODA 1JDBC 2HRCA 5EKTA 1KA9H 4KREA 2ARKA 1XWFA 2NWQA 2DHQA 4H6VA 4IGAA 4OAPA 3UFXA 3VOBA 4URFA 4PQFA 3VAYA 2G3YA 1NFQA 2GCEA 2EGUA 3OE4A 3WMWA 4YQYA 4KE6A 4TTPA 3T9CA 4HXFB 4DJAA 2OGTA 2CHEA 3OTGA 2ZIAA 2H07A 1SC1A 3LQ4A 4I2NA 1YIDA 4FDLA 1KEVA 5FH9A 3FPKA 2KJQA 3R3UA 5F77A 2FHSA 3OD1A