1RC8A

T4 polynucleotide kinase bound to 5'-gtcac-3' ssdna
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
301
structure length
289
Chain Sequence
MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELVKRNSKRGTKAVPIDVLRSMYKSMREYLGLPVYNGTPGKPKAVIFDVDGTLAKMTDVINPMVVELSKMYALMGYQIVVVSGRESGTKEDPTKYYRMTRKWVEDIAGVPLVMQCQREQGDTRKDDVVKEEIFWKHIAPHFDVKLAIDDRTQVVEMWRRIGVECWQVASGDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of DNA substrates by T4 bacteriophage polynucleotide kinase.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*TP*CP*AP*C)-3'
total genus 87
structure length 289
sequence length 301
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rc8A01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rc8A02
3ZS8A 3SBEA 1DAMA 1ZCAA 1JBKA 2IHYA 4V0MA 4EJSB 3T15A 4L9SA 5A3SA 5JMTA 5L3VA 1GRNA 2FPRA 4Y0AA 4FXPA 2I1QA 2FDCA 2G6BA 4BRUA 2GBLC 1CR6A 1ZRHA 5ALEA 3CWQA 4C4SA 3WNCA 1AA9A 1AS0A 2GDJA 3EZ7A 1GUAA 2BBSA 4DRZA 4BGDA 3QU2A 5AVSA 4A2WA 2NO4A 3AH8A 1NLYA 4EFLA 1PW5A 1M2OB 3OAAD 1AK2A 2OFOA 1E2KA 2ZR0A 3M0EA 1HH4A 2C77A 4MGKR 4HGPA 4TLBA 2BDUA 1PJRA 4P4UA 3BB4A 1Z4MA 3FMFA 5AVXA 1GAJA 4TL6A 1XNJA 2FFHA 2VH5R 3ICEA 4DSNA 1Z4PX 4NKRA 3KQHA 2IBMA 1RJ9B 1XXHA 1E96A 2R6FA 4FINA 1TJ5A 1Z4OA 3FVQA 4BFUA 4KI0A 5G53C 2GILA 5GADl 3OEHA 4YXWD 2AUTA 4AD8A 3R8CA 1ZJ6A 1RRPA 2A2ZA 3KZ1E 5EE9A 3NHAA 2ZI9A 3WMGA 1GRRA 1NN3A 1W5SA 4KNVA 4J2TA 2FF7A 3I92A 3U3JA 5E95A 3PITA 3V9PA 3QNMA 1G1MA 1CTQA 1NP6A 5BN3A 4FN5A 4Q1BA 1RPZA 2IYSA 1H65A 3OPXA 3QPVA 4KFTA 1X42A 2ZE8A 2AL7A 3E1SA 4JLVA 5FUYA 4YGYA 2XNSA 3EWSA 1FP6A 1CQZA 1B0UA 1WA5A 2B1RA 121PA 4ZPXA 4B3DA 3KD3A 3SJCA 3NH6A 2PL3A 1ZNWA 3OFND 4GNKA 1J7KA 4D4KA 2ZXEA 1NI3A 3CF6R 4CW7A 4JLMA 1L4UA 2OM2A 1P75A 1Z4QA 1EX6A 4LC1A 1WZCA 1CR2A 3IEUA 2I54A 3HDTA 1NF2A 2O8CA 4BEJA 4V0NA 1IXSB 1TQDA 4TMXA 3NUQA 3A4LA 2RB4A 1N6PA 3O8DA 1WPGA 3U61B 4AS3A 2FH5B 4EJSA 1OHHA 1FTNA 1UKVY 4QGHA 3OCVA 3HPRA 4Q02A 3WGVA 4BFSA 1ZD2P 3L0YA 2WV9A 2NZ8A 2IXEA 1AKEA 4MA4A 1TEVA 2FA9A 3DEFA 2BM0A 2ZXUA 2V1UA 2OCPA 3TUIC 2B21A 2JLQA 1OB2A 3R09A 4DUGD 1DG1G 4DB2A 3B13B 3NKVA 4IDHA 4PC3A 2A5JA 2J0UA 1PLJA 2QNRA 3QOFA 2SHKA 1SGWA 4NDZA 4F4CA 5KO2A 4QBGB 4Q5IA 2QTVB 1M74A 4Q1CA 3LBNA 4EX7A 4C0KA 1XPUA 4RJLA 1QG2A 2WHEA 2J41A 1HTWA 1RE0A 4BLQA 3EPRA 3P1JA 5FBWB 1OPXA 3U3KA 2QP9X 1SVOA 2FPMA 4LDJA 4EQ6B 3CWZA 2OCAA 3IB6A 1ZD5A 4D25A 1OH7A 1WF3A 3A1CA 2KBEA 4JSTA 3D8BA 4V0ME 3TGPA 2ZM5A 5FOSA 3CPJB 4DDUA 2ECKA 4Q9KA 1LVGA 1U98A 2QMHA 4D0GA 3FMIA 1G8HA 3A4NA 2ZI7A 1XTKA 2QE7A 1FX0B 1BYUA 1Q20A 3HYRA 4J0QA 2ZSFA 2YNMA 4HAYA 3EC1A 1U7PA 3Q7PA 2I7DA 3AR6A 4KV9A 221PA 4Y2QA 3P4YA 3QENA 4GMDA 5HR5A 5LPNA 3QXXA 2WMOB 1IHUA 5DNYB 4EQ6A 4TL7A 3UG7A 2HF2A 3SU8A 4IG4A 1SXJB 3K0AA 3OAAA 1GG2A 4ZIRA 1RKUA 2O8CB 1R4AA 1G7TA 4HGNA 3TW8B 1GM5A 4NU0A 1EESA 4AKGA 5D3QA 2RHDA 1ZD3A 4LV6A 1FZQA 1VG8A 3B7GA 1KJZA 1T3HA 1NN5A 4GP7A 1R0XA 4QG7A 4UASA 4D81A 2BC9A 4HUQA 4FFDA 3O8CA 5EXSA 4DT1B 2XXAB 4X8HA 2WHXA 3B2EA 2PQ0A 2RAPA 4NL4H 4OK3A 2FFQA 1A5TA 3EARA 3SQXA 1N0WA 1XDBA 1Z6GA 5EUQB 1ZW6A 3RRYA 4YMUA 2ZUCA 5AJZA 1XZPA 5FTMA 1Z0IA 3DMDA 2PR7A 4JBWA 5GJVC 2PZEA 4XSHA 3VU9A 2IEYA 2BCJQ 2HLDD 2HYDA 3CLVA 3EWAA 4KLNA 5DIFA 2B8EA 4BFZA 2R44A 1KIMA 1HQYE 1ZD9A 1VG9B 4TWZA 1TAGA 5HCIA 1S0UA 1OJLA 2VP5A 2ZS8A 3NHBA 5LB4A 2WM9B 2O8DA 3W3ZB 3RNLA 5ALXA 3WK9A 1UM8A 1JJVA 3TKLA 1YNSA 3ET5A 4N3NA 1AQUA 3AKEA 2GFHA 2PCJA 3RS7A 1E2JA 1SXJC 2V4ZA 1RVDA 5KYKA 4ON9A 4CF5A 5JJBA 1N6IA 2G3YA 3QUBA 3ZZUA 2R8RA 4IVQA 3WNBA 2DHRA 4GI7A 3VTKA 4NCHA 4CDGA 2IUSA 1S1MA 4MUAA 5DGXA 1AZSC 5KU1A 3FKSA 4LJ8A 5HTKA 2W2VA 2G9NA 3WKBA 4R2IA 3NANA 2BMEA 4BKMA 1COWA 3IRUA 3NTUA 1T3SA 4OK5A 3SZRA 1E1QA 2CNWD 2VRWA 3KQKA 2F3TA 1XD9A 2I34A 3AVVA 1ZD1A 4KVAA 1QHIA 4B3BA 4IFTA 5ALTA 2ANCA 1RMYA 4OHZA 2CJWB 1AS3A 1ZP6A 3U2QA 2P65A 3C15C 3L7YA 4M53A 3ONNA 2ZUDA 4KX3A 3GMTA 4TLEA 4Q4HA 4C0AC 1TE2A 5L3QA 3R9WA 2X4DA 4A8JB 1TADA 4JLOA 2YWEA 3IO5A 2QA5A 2X19A 4O2RA 3IJ5A 821PA 3GD7A 3X2SA 1HY3A 5AJVB 3CW2A 1T9ZA 5F9FA 2YWGA 2XSZA 4I1SA 4AC9A 1K5DA 3H84A 2VEDA 3CX6A 5BQ5A 2C9MA 5JWRA 1X1RA 4PHGA 4YIHA 1C4OA 2F3RA 3OEEA 3LVRE 3SBDA 3ZX4A 2ZEJA 5IRCD 2QZ4A 4D2IA 3QIAA 1O03A 2A9KA 4QBIA 1QHGA 3ZVNA 5AVQA 2QE7D 4Q7JB 3GJ7A 2KJQA 4L16A 1G291 4DXAA 1HA3A 4Z51A 3AVUA 2PKEA 4QJBA 4Y2YA 2QT0A 1II8A 2ONKA 4LBZA 2AWNA 1KI6A 4LJ6A 3C16C 4LJ4A 1MO6A 1TF2A 1RW4A 3LV8A 2ZVPX 5AJXA 3VNVA 4KO8A 1KMQA 1UBCA 2OLKA 3ND8A 1Z6AA 3REGA 2Q9BA 2D7CA 4A92A 1C9KA 1JB1A 1KDPA 2GCOB 1MH9A 4HYYA 3NBFA 5GVRA 2JEOA 2O8DB 3DNPA 3VX4A 3P26A 4WXRA 1L7OA 5CM8B 2MU1A 1G3UA 2G0TA 2YOHA 2IT1A 4DCVA 1VCNA 4UM7A 4JVSB 2GAAA 1NN1A 4YLGA 2DYKA 4RD6A 4JMPA 5AK0A 3WYFA 1KSHA 4ZCIA 4HB3A 2XGJA 4IFBA 4UJ5A 4Q4LA 2WWWA 1NNEA 1U7OA 1N3BA 4F93B 1XP5A 5G3ZA 1S96A 1KI6B 2FPWA 1Q1ZA 1XX6A 1ZD8A 4XOUA 3WK8A 1QYIA 3GEEA 3EA5A 3EZFA 3IPXA 1EK2A 4IJMA 3TE6A 4CGZA 1NLZA 1WP9A 1R5NA 1Z29A 4FMCB 2GCPA 2FE4A 5FPTA 4BYGA 1UKZA 3B1ZA 4URUR 3DDHA 1TQ4A 1Q1EA 3R7WB 2OFXA 4DT1A 4KU4A 3FDIA 1NRJB 1DS6A 1KDOA 3AF1A 2QBYA 3L0BA 4PO1A 1G5TA 3UK6A 1LS6A 4PNHA 3TUJC 4MRPA 2ODNA 3W5JA 4Y2PA 1YZLA 1Z0DA 4IVRA 2Z4RA 2XNDD 2J7KA 1U0LA 1L7MA 3NEJA 3AQ4A 2IK8A 5SZIA 1XMVA 1MH1A 3A1WA 3NBZC 3BFVA 4CEIA 4JB3A 2ASEA 1YE8A 4Y2XA 1HT1E 3DAOA 3P32A 3SDZA 2IYVA 3W6NA 2VQSA 1RYHA 1FX0A 1W4BA 4JLKA 4MKGA 2Z4SA 3I76A 3L8HA 2OBLA 3IIJA 3QUQA 3TQFA 3GFTA 4LGMA 4XD7A 2R62A 1DAGA 2V7QD 1GKYA 4UNNA 4AK9A 3OIYA 1H8HA 3DOFA 4RZXA 1K8RA 1KKLA 1COWD 1L8OA 4XTRA 4YC7A 3QUCA 4WW0A 3L2OB 4NH0A 3RRMA 1NY5A 1Z6XA 1CU1A 1ZNYA 3KXIA 3ND9A 5AWFC 4DKXA 3M9LA 1GNRA 5FL3A 3SQWA 1ZUHA 1BIFA 1YQTA 2HHLA 1CJMA 2AN9A 1E9SA 4PZZA 2YHSA 4QNMA 2J59A 4EPXA 4OQMA 2DFTA 1Q44A 3CRRA 2YJ5A 3E84A 2I3BA 5ALSA 1XD2B 2R2AA 5UKDA 2Q5EA 1W1WA 2UVQA 1E9AA 4BLPA 4OQLA 5JCZA 2JATA 3DDCA 3LLUA 3C14C 3U3MA 4AKEA 2P11A 2V7QA 3T06B 4C4PA 4ZKEA 1JPNA 2BMDA 2QTFA 3L8ZA 3B8EA 3RFUA 4LJAA 4DLYA 2ZRGA 1NN0A 4UQOA 3PDWA 1J8MF 1WRBA 2WSSA 1KAOA 2AFHE 2HDOA 1UBFA 2FOLA 2JCSA 1Z5GA 3ZWDA 2RMKA 4HGOA 3FHOA 1NVWQ 1G18A 5KNDA 4UMVA 3RLFA 3I5XA 3O8BA 4NE2A 1F5SA 1D2NA 2CFRA 2GXAA 1AGPA 5JFGA 4HDQB 1SVKA 2JGAA 4UKDA 1KAGA 3BBPA 2OILA 3QY0A 2ZRCA 2I33A 3HR8A 5ALIA 1GNQA 1JXOA 1KK1A 2ZSAA 3RYTC 5J47A 3U5ZB 2FFAA 3NIWA 5AESA 4HYTA 4G01B 2WFAA 2AD5A 1AM4D 4HZUA 1EK0A 3GJXC 4NPHA 5AUQA 3PUXA 3NDBB 2R8XA 2GZDA 1AS2A 3AVQA 3QSYA 4BLRA 4PSVA 2R6GA 4US2R 2HXSA 4WAUA 3T1TA 4H1VA 3BE4A 2AFIE 2FSFA 1S8OA 4II7A 3LVQE 4XWOA 1W0KD 1KHTA 2IYXA 4JVNA 4X8OA 3K70B 2ZIAA 2JJ1A 1GL7A 2NQ2C 4IDQA 4W5WA 4J03A 2DR3A 3U7HB 4TMWA 1KTVA 4TLAA 4U5XA 4Q4JA 5SZHB 2GJSA 5DSZA 2F43A 4JLJA 2CCJA 2BVNA 2O2XA 1E2MA 3OCXA 3T61A 2AWOA 3GLHE 2KB0A 1BO6A 5JJKA 1OYYA 1GRQA 2WF9A 2VP6A 4MYCA 4UNPA 2EU8A 3H86A 3LAWA 2WOJA 4HZUB 4Q47A 1E79D 5ANRB 1Q0UA 3I72A 5ALLA 1XZQA 3NBYC 2PT5A 4RFSA 1X8LA 2R65A 3W5BA 1NL3A 1UFQA 4ABYA 3PEVA 3QF4A 2O0HA 4TT3D 3R9XA 1Z0FA 5FTKA 1ONBA 4KBFA 1JEEA 5FR2A 4RKEA 1YZNA 3K70D 1CRQA 3CNOA 3ZGXA 1AQ6A 4L57A 1P3JA 2WBLC 4ZO4A 2EAUA 4HI0E 4WA7A 2P67A 2ORVA 2QENA 3ZQJA 2XZOA 4OI1A 4UATA 1DPFA 2J0UB 3NXSA 4KODA 4O2LA 5FUXA 4F38A 5AK6A 2HF8A 1AKYA 2ZE6A 1E0SA 3BORA 4NCNA 4NP6A 4PTLA 3TW4A 4NZYA 1IN7A 1HT2E 1D6JA 3IPYA 4KN8A 4M2LA 5CITA 2IOFK 1L8LA 3DVLA 4URXR 2LKDA 3OCUA 2PJRA 1CJVC 1OXUA 1T5IA 2ZRFA 3KUDA 3R20A 1RRFA 2CEAA 1N2CE 2OUKA 4LZZA 1W4AA 5FBRB 1Z8FA 4HAZA 3SOPA 5B30A 2GCOA 4LSGA 1PZNA 1CXZA 4IDOA 3NAMA 2H7VA 3P4XA 3T35A 2VA8A 5ALOA 4BFXA 1NKTA 2GWHA 2W6JD 1SHKA 2O52A 4B3FX 3W34A 3S1AB 4G5GA 2VF7A 1A2BA 2QPAA 4FD2A 4QHTA 2XSZD 1JR3A 4M1WA 3C5CA 2C95A 2EFCB 2P27A 1XEXB 1VIAA 3G5UA 3ZJYA 4UM5A 4KHZA 1NJFA 2WSSD 4P4SB 2VHTA 3K0SA 1K6MA 1SHZA 4MKIA 721PA 5AUPB 4GIBA 4JLNA 1UADA 3EZ9A 4QFMA 3FHCB 2GESA 2C8LA 2LKCA 4W5JA 3SKXA 4DLZA 2R8ZA 1P60A 1DTSA 3PV0A 1KO1A 1YZGA 3BS4A 1G16A 3N2EA 5B58C 3O8RA 3U6KA 2GVDC 3FOZA 2R6AA 1PLKA 3I62A 2GJKA 2A5GA 1G3QA 2WJYA 5KUTA 3KQLA 3QBTA 3SYLA 2R6DA 4IKEA 1Q91A 3QPWA 3UMBA 4IRUB 2FJUA 4OHVA 5H1YA 3IHWA 5AI6A 1F48A 3NIBA 1ZIPA 3NDPA 3T34A 1KI7A 2NO6A 3AVOA 3EF0A 3JZAA 2ONJA 4CIDA 4NCIA 2QORA 3TNFA 1QQ7A 1CJUC 4CF7A 2HCJB 5IT0A 3MFYA 4RZUA 2ZQ5A 5CIWA 5DYGA 2AXNA 2C4NA 2CL6X 2HX1A 2JJ1D 1VYTA 4Z1MD 4HB0A 3H2YA 6Q21A 2YJ3A 1QH9A 1ELOA 3AR3A 1SVSA 5KNBA 1UBEA 3QPUA 1W36B 1Z08A 2OSBA 2R8YA 3T1VA 1VPLA 2CLDX 4AI6A 2YMPA 1OKKD 4US1R 2WF8A 1M8PA 1WBDA 2MSEB 3WXMA 2Q3FA 2VSOA 4N1AA 3K1JA 5DH9A 2W6IA 5FTNA 1WMSA 2IOFA 4FMDB 3QQ5A 4B35A 5CYPA 1ZM9A 3QXCA 621PA 3CPEA 4NABA 2W00A 3WKCA 1I4LD 4HLCA 5JCPA 2VP4A 2WAYA 5BN5A 2ZI6A 1ZCBA 1WBBA 2G80A 4PC7A 2GK7A 1XPOA 3I8SA 1NNLA 3I5YA 5HE9A 4KSCA 3U6BA 1T5LA 4Y2TA 2HJGA 1NF3A 1QHSA 1VG0B 3B8HA 4XJXA 3WNDA 3L8YA 2C9YA 3MGCA 5HE8A 2EW1A 2YFYA 1UPTA 2ZSBA 3QUSA 1DADA 2J7PA 5DN6A 2BIFA 5BW8A 3MAAC 3WK4A 1S1CA 1MRSA 4HEJA 3UANA 1G8PA 4ZDIA 5IF9A 2FG5A 1Z63A 5DI3B 2ZRNA 2IOHA 1XCMA 5AI9A 1GP2A 5AKYA 4DVGA 4Q03A 2CHVA 3EIHA 4RFVA 1IOZA 1T0HB 1UKEA 3K09C 4YCNA 2ZAMA 3EASA 2IYRA 3RS0A 2E1RA 3B6EA 2IS1A 5AI8A 5C1BA 1U02A 4OHYA 5FOUA 1EK1A 3PG5A 1XTIA 1ZRNA 2W6JA 1JJ7A 1E2IA 3C5HA 3SI7A 4A6PA 3JZMA 4XPZA 1ESMA 2ZAOA 3B5JA 3WGUA 4LYFA 4AP9A 2WJGA 1T8UA 3AUXA 3OIUA 2REBA 2YKGA 3QJYA 3FFAA 1FUKA 3DOEA 3Q72A 4QRHA 4RFSB 4Z8YA 5FUWA 4OI4A 4TN1A 3K0FA 1DARA 3VR6A 5J4VA 4GSYA 4TMTA 1U8AA 3T12A 2ZJ2A 2GF9A 3I1YA 5IT5A 3ZW7A 2OBBA 2NO7A 2HEGA 4POAA 4B75A 4LJYA 2WJHA 4CVNA 4D4JA 4EELA 3VHXA 3FZQA 1I2DA 3V00A 2ODBA 4JT2A 3ECCA 4GZMA 2ZYVX 4BWYA 5ALDA 1U2SA 1RLMA 2IF2A 3ZD7A 3AR5A 1ZC4A 1S2MA 4UNQA 2EQBA 3QYPA 3KJGA 4PHTA 3ZS9A 4CYMA 3B60A 3ZIAD 1OH6A 2FSHA 1E2NA 1XXHE 3CF0A 3SS8A 5BYKA 5FBVB 2FPKA 4K46A 3GJ6A 5ALJA 3CNLA 1U8ZA 1VYVA 1H8ED 3K0CC 1OFUX 3U3OA 1KY3A 1U99A 1UKYA 1QHYA 4Q00A 3ESQA 1EX7A 3L0SA 3K53A 3QGMA 1DVRA 2B1QA 2WJVA 4RD2A 1YR9A 1VFPA 3K9LA 3KUCA 1ZS9A 1DBSA 3TVTA 1D2MA 2EYQA 2PLRA 4M9XA 2B8JA 3ET4A 1NVUQ 4WBSA 3X1XA 1CRPA 3RS2A 2Z83A 2QAGA 5FPYA 1Z4LA 4NMMA 4RZ3A 3BRWD 5AVRA 4XVRA 5E3HA 1L7VC 3KX2A 2WF7A 1YRAA 5EQTA 4KYTA 1AN0A 3ED5A 2E87A 2V54A 1F2UB 1E1RA 2W6ID 1E9EA 1VECA 4NYMQ 4YXWA 2Q3MA 3AVTA 8OHMA 3BK7A 1OYWA 1R8QA 4KSBA 4XWKA 4FCVA 2IF0A 2VYFA 3SEAA 3ZD6A 4HGRA 1T0JB 3BFKA 4JZKA 3TRFA 1GITA 1EFUA 3QEJA 4C0QC 3HLTA 1GL6A 2CHGA 2JLRA 1GL9B 3IO3A 4TL8A 5KDLA 1Z0JA 4E03A 4QJ3A 1Z2AA 5CLQA 1IJFA 2CBZA 3IUYA 1XJQA 2BEJA 2OZEA 4PO9A 2WTUA 1CP2A 1S2OA 1E9CA 1LVHA 4AURA 4FCWA 3A8TA 4C7OB 3LQQA 2FU5C 4QHYA 1QRAA 4EDHA 2YMLA 1IAQA 1KMHA 4MRVA 5ALVA 2WJJA 5GJCA 3CNHA 2EATA 4TTQA 2RGXA 2EARA 1OIWA 5E7IA 4UJ3A 5AM3A 3B9PA 3B78A 4C0JA 5IK2D 3C4JA 4Y2SA 4CT5A 1Q92A 1I4TD 2BMFA 2JAUA 2JLUA 2V3CC 1E2EA 4IDPA 4L6AA 1KI4A 2J46A 3WYGA 2YC2C 1FFHA 1N6LA 4UXJA 1SXJD 5CM9C 1YR7A 3OZXA 2O8BB 2ATXA 4B33A 4B3CA 5DISB 3KL4A 1EFCA 2RGNC 3E2IA 1N9KA 3M1YA 2DB3A 4Q4AB 3FTQA 5JBQA 1M34E 2DFLA 3CRW1 2ZRIA 4LX0A 3WK6A 2JIZD 4NFLA 2TMKA 3F0TA 2ZUBA 1XP8A 5FL7A 3N2IA 4EPWA 2GEUA 2DCUA 5FOXA 4M0LA 2P6RA 3AM1A 1OE0A 1E3MA 1RIFA 2CVHA 3ETLA 4BZPA 3TSWA 3GJ3A 4PXAA 1KSJA 2P0EA 4XQ0A 1XPRA 1JAHA 5J40A 3PEWA 3KOOA 1XRJA 1RDFA 4B3XA 3SD7A 1LF5A 3MLEA 5FOWA 1Z6TA 3T1QA 3TJZA 5AICA 1QHHA 4G5OA 3VKHA 3CX8A 3A1SA 2CFSA 1HYQA 3GJ0A 4B71A 5H68A 5ELXA 2Z43A 3X1DA 4LHYA 1HEIA 2I55A 1DAIA 3CO5A 2NPFA 4OHFA 1CULC 2HV8A 3LX8A 4TMKA 3AP2A 4OHXA 2GXSA 5AW4A 2JLXA 2GHIA 3CIOA 3LNCA 3PCTA 1OIXA 2B8TA 1M7HA 3W90A 4CT4B 2FEAA 4BBJA 2FV8A 5E4FA 5EUMA 4LV8B 2FZLA 2ZE5A 2QUZA 2PMDA 1UEIA 3RSOA 2H16A 4B44A 3QKSB 4WXPA 2EWWA 2KI5A 2G1JA 2QTHA 4YH1A 1GOTA 2WZQA 4E22A 4UXHA 3ASYA 3QEOA 5LDDC 3GFOA 4BEVA 4PZLA 2GXQA 1R0WA 1VKJA 3CUEF 4OQNA 1DE0A 1FPMA 1W0JA 4Q9LA 1YDFA 4TTRA 5AW0A 2V6JA 4Y2RA 1DELA 3K9NA 3IEVA 4L4UA 4TLCA 1Z0AA 2JASA 2ODEA 4TT3A 4XOIA 5GJWC 2OESA 3IIKA 3GLIE 1FUUA 1ZM4A 3GPLA 3NH9A 3AF3A 2WKQA 4B73A 1HE1C 4JLPA 4BUJA 3EZ2A 2UZ3A 4NWIA 1D9ZA 1OKKA 3ZDQA 3UMGA 3D31A 1GWNA 3K9HA 4RD3A 4B6EA 4EPYA 3DKVA 2KBFA 2ZETA 5CK4A 2IEZA 5C46F 1FQKA 3TK1A 4C4RA 5AVUA 3IKJA 4OJQA 4YDHB 4HLQB 4JJZA 3ADCA 2ZYWX 2DFKB 2ZRDA 2GNOA 5JI2E 4MQBA 4EIWA 3AKYA 4H9GA 3WMEA 5ALUA 1IY0A 2PJZA 3ZX5A 4URVR 5EE5B 2ZE7A 3ZZTA 4URYR 1NRWA 2J1LA 4F91B 4YMVA 1U2RA 2Q3HA 1P7CA 4TZ6A 2IS2A 1YR6A 3BERA 1VJRA 5EP3A 1M7GA 3Q5EA 2OHFA 1QF9A 2HT6A 3CB4A 3QU7A 3QG1A 2CK3A 1KI2A 3IHLA 4JL8A 1E99A 3QKTA 1XPJA 3SJAA 2VHJA 3UXMA 1AZTA 3MSXA 4QGGA 4ZCMA 5AKKA 2E9SA 1Z4KA 1G17A 2CMKA 1FL9A 2ZRPA 1P72A 3PQCA 5AK3A 4CE6A 1OFHA 4M1YA 1HURA 5AI0A 3QXJA 4MGZR 5A5GA 3A6PC 4DSUA 5JHHB 2ZRLA 2J87A 1SKYB 1NKSA 2GETA 1LNZA 1F5NA 2N46A 5KSOA 5AKLA 1IN6A 5FTLA 2MMGA 3T5DA 3W6PA 4FWTA 2JARA 5CDFE 1JPJA 5KDOA 1J97A 1W4CA 1SKYE 3CKLA 5KSPA 1FMJA 2QT1A 4PPGA 2OCYC 2C04A 4GPTA 4GP6A 3JVVA 3PUWA 3VR3A 1ZD4A 3R9IA 2EFDB 5CB6A 5JLJA 1OV4A 3P20A 4DW8A 4PX9A 4D0NA 1BS1A 2F9MA 5JHGB 4AKIA 4O8CA 1NMZA 2IHBA 1LB1B 3V4RA 3EAQA 4L9WA 3CH4B 3I4LA 1JUDA 2GAOA 2PT7A 2ZRAA 4QQFA 3I32A 5FH9A 3IQXA 1CF4A 5B57C 3BA6A 1N5KA 2OT3B 3LFUA 3CONA 3GJ4A 4LJ7A 3TAHA 1A7JA 1U81A 4QJ5A 4MKFA 1JEDA 3UWOA 4A1FA 1SXJE 4KLZA 4YMTA 3I61A 1ZU5A 3EC2A 1VHLA 2BKUA 3ASZA 4QBHA 1L2TA 1XFAA 3HU2A 1PUJA 3LXXA 2F1RA 4Q1DA 4BFWA 1YS9A 1XXHB 1P9RA 4MGIR 3A1EA 2RGGA 3QKSA 1P62B 3NBXX 3GP8A 4A4DA 4YCLA 3ZTWA 2ZJOA 5AVWA 2CVFA 5IDVA 2IA5A 2C8VA 4JLAA 5EE3A 1T5SA 2F1HA 2RCNA 1KYIA 2FMXA 2CJWA 3NC1C 4RVCA 4B74A 2G77B 5DLQC 3WP0A 4A9AA 4B34A 4QM6A 3QU4A 1J70A 3D7MA 2QQ0A 4Y0VA 4A8JC 3EPKA 4O3MA 3SF0A 1XU4A 3MJRA 4GZLA 4R71A 2R9VA 2VO1A 4KITB 4OCZA 4LBWA 3GJ8A 3GEIA 3PEYA 1F2TB 1S9DA 1ZOLA 3QE0A 4M21A 5KSZA 3EA0A 2WPDD 3P27A 5FPKA 3E58A 1U0JA 2ZBDA 2C2HA 1OH8A 5JS8A 2CK3D 2DY1A 1E1RD 1E32A 2QG6A 3Q8XB 4Q7MB 4JVMA 3M6AA 5C2JB 5H8WA 2YJ6A 1S3GA 4TYYA 5DYIA 1N6KA 2YJTD 4JDPA 1XEFA 5D3MB 1M6NA 3GQBA 2GZAA 5AKIA 3REFA 1DAHA 5F3WB 4TLDA 4W5HA 2OO7A 4JYBA 5AHXA 4C30A 1R10A 2O0KA 1UAAA 1F60A 4A0GA 1TQ6A 2BKEA 4JT4A 3AR7A 2F1IA 3KKMA 1NVXQ 4FWIB 3N1UA 4WZBE 1E2QA 2WOOA 4N0DA 4V0OA 1XB2A 1GIAA 1GSIA 1W36D 1Y3AA 1JR3E 4R7ZA 2ZYTX 4UAUA 3DKPA 3KDSE 3VHLB 2IYTA 1FTSA 1TNDA 3I6BA 1KJYA 2GBLA 2BBWA 1N5JA 2WKPA 1KYTA 1YVDA 3Q7QA 3LLMA 3UG6A 3U60B 4ZI3A 5JEDA 1RC8A 1VJ5A 2VP0A 3EIEA 2PX0A 1YRBA 2V8OA 2GXUA 3N5KA 1TU4A 1CJTC 3OIVA 4TYWA 4YCMA 3AB3A 3MUFA 4US0R 3A4MA 4TQAA 4G5SA 3VR1A 2PBRA 4FYPA 4P33A 2C03A 3KFXA 4DLSA 3BH7A 3ZLJA 2BDEA 3I3SR 3QX7A 4DLWA 1E98A 1MO5A 3CM0A 1G8FA 4GBMA 3E5HA 3KKNA 1P73A 1YZUA 2ERYA 2XJ9A 3W6OA 2ZVQX 1Z5ZA 3H1TA 2P6UA 4MUMA 3CRMA 2VTKA 4DIDA 3RWMB 5JRZA 3RVBA 5AVVA 3L0CA 3CR7A 4NYIQ 1IQPA 4Q21A 3BWDD 4ZKDA 4O25A 2VL7A 3PXGA 3WRXC 2PEYA 5L3QB 1XWIA 4HLUA 4XIGS 2DPXA 2ZANA 3ICQB 2ZJ8A 1JI0A 2QQEA 1BOFA 3GLFA 4C3ZA 1E2FA 1S3SA 2PEZA 2W2XA 1MRNA 2XJ4A 1E69A 4S2EA 3QVUA 4TMZA 3B1YA 4A6XA 2IXGA 3LY5A 3PENA 3ADDA 3RWOA 4D26A 1GNPA 2ZS9A 1MO4A 1QG4A 2ZJBA 4GOJA 1FMLA 4Q1EA 5JZVA 3THXA 3PVSA 4OD0A 5AKXA 5IHPA 1NIJA 3KXKA 1TJ4A 4EEKA 2W0MA 2RARA 1US8B 3QXHA 2I4IA 1SZPA 1EWQA 4UU0A 1JR6A 5ALZA 2GHTA 3IDQA 1RKVA 4IVPA 2CLCX 1E9FA 3KZXA 1F2UA 4CF4A 3TSZA 4ZDWA 2ZU0C 4Z54A 2JGNA 4NAVA 4DC9A 1SVIA 1E4VA 2JAQA 1IBRA 2ZRJA 4AYXA 5FFMA 1PVOA 3SKYA 3KXLA 2RB5A 1LTQA 2B7BA 2P5TB 1P2VA 4M9ZA 1G7CA 5AUNB 3F9RA 5AW8A 4UXIA 5IS2A 3MD0A 2YYZA 4DZZA 5AKZA 2YZ2A 3A3YA 2B6HA 5CLLA 3B85A 3KB2A 2H92A 1ZC3A 1R0YA 2OBMA 5FBLB 2OLJA 3OE7A 5K8TA 4BPBA 2HI0A 3TLXA 1C1YA 2UKDA 2ERXA 4F72A 3SHQA 1DG3A 1NSTA 1OHHD 1YZKA 2FNAA 4O0MA 4DEYA 1JQJC 3IBYA 3T1OA 1UJ2A 5JWOA 2CXXA 2G88A 1TA0A 1OXVA 1IN4A 3LW7A 4F92B 2VP2A 1R8SA 3F5FA 4NTZA 1II8B 1WXQA 4QL3A 4C2TA 1XJCA 4WVFA 1DOAA 3H4MA 3W3AA 2YBDA 2YINC 5EE1A 4DSOA 4LC0A 2C99A 4A82A 1KK2A 4MKHA 2FFBA 3KQNA 4ZCLA 2RGNA 2BMJA 2Z6VA 4Q4AA 4JS0A 4GL2A 1N5LA 4HAIA 1NY6A 4Q18A 5K8LA 3RABA 2Q21A 1NBME 4JKYA 4AIIA 4MDEA 2O8BA 2GEDA 1HUQA 1MABA 2C96A 3KFVA 2ODAA 1E1QD 1TX4B 1IXRC 3AGQA 4OKSA 4F71A 3L1UA 4BRWA 1SVLA 3DZDA 4DCNA 3LRPA 4DLRA 4PQFA 3V4FA 1ETUA 5C18A 5A3QA 3SYNA 4E09A 3WKDA 2Z5FA 4D4MA 2F6RA 3TMKA 2XTNA 1KZ7B 2HEIA 2FSIA 3TR0A 2BBTA 2G1KA 3EWIA 2C9OA 3TQCA 1T8TA 4IOKA 4A2QA 1ZNZA 3MWJA 4RD0A 2QGNA 1O87A 1LY1A 2RKOA 4G5RA 5TB5A 3ZZ0A 2GCNA 3SLRA 1V43A 2J45A 1UDWA 3EZ6A 1A82A 1DAKA 1OXXK 1T3LA 4ACBA 2NOAA 1YMQA 4OJKA 2FGJA 2KE5A 2IX3A 5G41A 1WVIA 5E7JA 1G3MA 1NMYA 2XX3A 3L0PA 4DLTA 2CLSA 3WHKA 4H1UA 4CEJB 3AR2A 3OEHD 1VTKA 4F4JA 2WWFA 4ZEXA 2Q9AA 1GKUB 2O0JA 4P4SA 1S4QA 4MDFA 3KKPA 4ZI2A 4K8OA 2ZBGA 5FR1A 5HCNA 1IONA 5TDHA 5E0OA 1VIYA 1Q21A 3C8UA 3TH5A 1Z06A 2ZS7A 3VR2A 3ZH9B 3WKAA 3ZWKA 5HKKD 3EPLA 5AKEA 1LW7A 2F1JA 2RH5A 3C41J 5SZKB 2G09A 3L43A 2AKAB 4QOSA 2A78A 5KTYA 2WWIA 1F2TA 1GKIA 4OI2A 2RGAA 2Z0MA 2YN4A 1W46A 2O9JA 1Z4JA 4EX6A 4A36A 1YKSA 3FGNA 2F43B 3TAUA 4KFUA 2XTMA 4TQ9A 5EP1A 1UF9A 1R7RA 2WKRA 3OF5A 4R98A 1WDTA 2O8EB 3CR8A 1WQ1R 2GEVA 4UMFA 2Q6TA 2XOKA 1KI1A 4G63A 4NHOA 3CRQA 5AKJA 1OSNA 2VSXA 3U26A 3RAPR 3AP3A 3R9KA 3FMPB 3ADBA 3THOA 2D3WA 3W8NA 2C5LA 3Q85A 1EXMA 5TARA 4DLVA 3RS4A 3U7FB 5AM5A 1ZUNB 3OCZA 4IEIA 1KI3A 3OE7D 4QHSA 4I9GA 4DFDA 1X1SA 2ZOSA 4D80A 2FPXA 1P9WA 1XMJA 4A0HA 2QMEA 1KDTA 4WOPA 4LI0A 1N6NA 5JSZA 4C7OA 4JYCA 1GDDA 1I2MA 1KO5A 1U0HC 4IW3B 3FHTA 1K5GA 1MKYA 1FQJA 1JECA 3HYTA 5DE3A 2YVUA 3VQTA 5AK5A 1GVNB 4JL5A 2OV2A 4EUNA 1E0JA 2XNDA 2ZJZA 4DDTA 1XVIA 2JAOA 4KX5A 3EF1A 2HSZA 4XSGA 2FEOA 2OM6A 1DEKA 2IC5A 3ZU6A 3PIRA 1XCGB 3KJIA 1E2PA 1XTJA 2CN1A 1CR4A 4L5BA 2WAXA 1OB5A 2O5VA 1J8YF 1Z2CA 3A58B 5DHFA 3WMFA 2ZRHA 4HAUA 4IEEA 4PHHA 1RMTA 1QQ6A 4B3GA 2G08A 2F7SA 3MJHA 1X6VA 1OF1A 1NG9A 2H57A 4CNQA 1XEWY 1IXZA 4LY6A 3SFVA 3EIQA 3DV9A 2JA1A 3CF2A 4Q1FA 2IYEA 2F55A 4RESA 4PHFA 4YQFA 3GLIB 3ONWA 4LV5B 3HU1A 2IYYA 3U3RA 1XJ0A 4MYUA 4Y2UA 4BLSA 5JECA 4LJ9A 3VAAA 4JKIA 3TVDA 1BMFA 2DBYA 1QVAA 3CX7A 1IWOA 4LOAA 5TV2A 3VFDA 1P61B 3WBJA 5BXQC 4EKDA 3THYA 2CCKA 2QM8A 3RANA 5JWHA 2QY9A 1Z3IX 3R8FA 2JAWA 3RC8A 5A0FA 4DHEA 2H17A 1AJEA 2YC4C 4CEJA 5TVKA 1KSFX 4DCCA 4OFZA 2JJ8A 3PUVA 4G0NA 5K8IA 5AKGA 4G3XA 1Q22A 2JLWA 2B82A 3U44A 5K8UA 1DO2A 1Z5UA 2X2EA 2G83A 4A8JA 5J4YA 1MV5A 4OK6A 3HR7A 4N0EA 2A3RA 2VP9A 2ZI3A 2EFGA 4JSYA 5EXPA 1XD2A 4U02A 2Q4TA 2CE7A 4EPVA 3BXZA 3D6TB 2IWRA 4PPNA 5ALRA 3Q9LA 5AK4A 3LXRA 4URZR 2P2LA 3PJRA 3QI2A 1KKMA 3L5KA 1IJEA 1MOZA 4DWOA 1G6HA 2V6IA 2ZU6A 3AP1A 1A2KC 5GJBA 1U9IC 2DQSA 4PZYA 1S9HA 3U7EB 2WF5A 2G07A 4M9SA 2OE2A 1G7SA 4QC2A 1MABB 1E9RA 1T6NA 2IWHA 4BNDB 3BOSA 1GTVA 4TQUS 5P21A 2YMQA 2B8WA 5AIBA 3NVAA 4NCJA 2RAVA 1OH5A 1W2GA 4BFTA 4ERNA 2ZTSA 4PO8A 4XVQA 1E79A 1VCIA 4NYMR 3J81k 3N8GA 4PFSA 4PSKA 1R5OA 2OXRA 1W44A 2NYVA 3CZ4A 3THYB 3X1YA 4QGFA 5CDFA 1UDXA 1ZM2A 2ZI5A 4JIMA 2KWIA 4B76A 3N28A 2FI1A 4LHWA 1RRGA 2UZIR 5KPDA 2FPUA 2PZFA 5CYOA 5FI1B 4DDWA 2GRJA 2BDTA 1T5TA 4NONA 1ZYUA 5C4GB 3VMFA 2HF9A 4BZXA 2GK6A 5ALWA 3NRJA 5TMPA 2J0QA 3VU9B 2ZJ5A 4HAWA 4JLBA 1DAFA 4KNWA 3KC2A 3K9GA 5JEEA 4I9FA 2RHMA 3W5IA 4AS2A 3AF4A 3GFPA 4RKFA 3D6JA 3PGVA 3LX5A 5AW6A 5JJLA 2FWRA 1W47A 2QEQA 3SE0A 2HDNB 3VAYA 2BEKA 1QQ5A 4DJTA 2ORWA 3FPAA 5EZ5A 4RSGA 4DSTA 1D8TA 4G5QA 4UNSA 1BYIA 2VPPA 4HAVA 3K1ZA 2CDNA 1G20E 4OI0A 4ZV4A 4RETA 4TSFD 3FE2A 5TY0A 1RMQA 3GLHB 2IYZA 4HLUC 1XMIA 5LBIA 4EJSC 3P96A 4XH9B 1W36C 1YZTA 2WWGA 3RSLA 4ESVA 4G9BA 1DO0A 1N8NA 5AIAA 4HATA 1PV4A 1UBGA 1JXMA 1SU4A 1ZUIA 1ZAKA 2NGRA 2NG1A 4DCTA 1TJ3A 4V0LA 4D0LB 3AR9A 1NMXA 3CRVA 5G40A 3LDAA 3MN1A 3R7WA 2YOFA 1PUIA 2AX4A 1IY2A 4QKQA 2HCFA 2DWPA 5BYJA 1J90A 1F3OA 3QKUA 4KJZA 3G82C 3MRSA 4PANA 5E7MA 2VIIA 4BQSA 2DFNA 3RS5A 4F7WA 3OEED 4MUBA 5LD2C 4M1KA 4ARZA 5L3SA 1RJ9A 2YY6A 1ZU4A 2WM8A 4PAQA 4L6CA 4NCKA 3VKWA 3OESA 2AD1A 4CEIB 2FN4A 2YV5A 2HYIC 4DDVA 1ZNXA 3NASA 1XD8A 4HGQA 3U19A 2FUEA 4FMBB 3LH5A 3X1ZA 3U44B 5AW5A 1RLOA 2JDIA 3WKEA 2LCFA 4GT1A 4EZEA 3RS3A 4QM7A 2D2FA 3LBHA 4B2IA 3EW9A 4YDSA 3UWKA 4Y2JA 3MWKA 5CB8A 1KDRA 1OFIA 2VLIA 3JVUA 4P0TA 4PPQA 1XMSA 2FPLA 2NO0A 3OIWA 4LPKA 4Z1MA 4MH0R 1KO8A 2WJIA 4LJ5A 5EJEA 1L6RA 4LBYA 1Y63A 4AYTA 4U00A 4LHVA 4LHZA 2REOA 4OHWA 1RZ3A 4TL9A 2AMYA 1NLFA 3NWJA 2P6NA 3I8XA 4KFSA 2BOVA 4X8LA 2V1XA 3E70C 5AJYA 3UIEA 2IL1A 3D3QA 1D5CA 1Q57A 2HO4A 4KXFB 2G06A 3E81A 1EGAA 4YMWA 3LO5A 1SVMA 4V03A 5AR1A 3FB4A 4QJ4A 2LWIA 3QG5A 5ALKA 4HZIA 4BX2A 5H70A 3HU3A 4QBFA 3EPHA 4LWZA 3E8MA 4MRSA 3SR0A 2DWOA 1KI9A 1Z4IA 5ALQA 4MRRA 2HOQA 1GILA 2Q9CA 3LWNA 2XOKD 4LPSA 1AIPA 2RGDA 1ZM3A 4M1MA 3W5DA 3MC1A 3ZTYA 1N0UA 2W4MA 3ZVRA 1VYUA 4BASA 5FPHA 4QNRA 2BJWA 4KCGA 4ARZB 4C0SA 5L3SB 1LV7A 2YWHA 4FIDA 5L8VA 2QSZA 2XEXA 4I1VA 1KO4A 4Y2VA 5AI5A 2PMKA 3HJNA 5DN6D 2Q4RA 4OL0A 3VR4A 3AF2A 3QF4B 3OTQA 3CZPA 1H8HD 1X8KA 3IIMA 3MG9A 2WWYA 1N5IA 4XD7D 1YHNA 1OT3A 2C98A 3G0HA 3WHLA 3KKOA 1IM2A 4JBXA 1FOEB 1U94A 3W8RA 1G7RA 4TSFA 3QXSA 1FW6A 4DLUA 1NG1A 2GA8A 2J3EA 3SJZA 5FL7D 2QN6A 3IGFA 2HUPA 3SNHA 2CCGA 2A30A 4ASUA 4EENA 2JLZA 2C8KA 4M1OA 4TYPA 3KJEA 4FMDF 2RGEA 1SKQA 2QMUA 1OIVA 4Q4JB 3SJBA 2FPSA 3HPQA 5B64A 2QP4A 5AM0A 4RD4A 1BMFD 4HB4A 3NC0C 1B23P 4ZIRB 4Q1AA 5A4JA 3PGLA 2QLTA 2BBOA 2VHUA 3TBKA 2AGVA 5FBQB 1QHHB 2ZROA 4IXNA 2K5UA 3DM5A 3PFIA 1TF7A 1VCMA 1TL7C 2BY4A 3U4QA 3PCRB 1W0KA 2YMMA 1E4YA 1PLLA 5KSYA 4PPFA 4Y3UA 1TMKA 4IXMA 1G8GA 4KFRA 1V5WA 5GVSA 4V02A 1KK0A 1JNYA 1OW3B 2JJ2A 1W5TA 4X8MA 4U7DA 1CEEA 5D3MA 1T4GA 2EYUA 4I81A 2FGKA 2OA0A 5AKHA 4KYIB 3DM9B 5SZJA 1QHXA 5JJIA 3CNNA 3A1VA 1FNNA 1DAEA 2IYWA 3MWLA 3FGOA 5AM1A 2F9LA 1Z83A 3GCGA 3ZVLA 4RCZA 1G5PA 2ZJAA 2P69A 3DMNA 2RGCA 2QAGB 3PR1A 5F98A 2D74A 1E9BA 2ZSDA 2NO1A 1WB9A 2ODWA 5J4KA 1KI8A 1G3IA 4PC1A 1Y8AA 2PCLA 2VBCA 2ZI4A 4LYAA 1KMHB 3MPOA 2GF0A 4HAXA 2XTZA 3Q5DA 1EG7A 2GHQA 3AVPA 1RKBA 2AR7A 1CJKC 3FM9A 3AVWA 1MR3F 2O8FA 2PH1A 1E0AA 2QPOA 1NIPA 5FOVA 3AEZA 5CJPA 1U2TA 3K0EA 4YIKA 1E6CA 3KTAA 2NIPA 1CS4C 5CJ2A 1ZRMA 1RQLA 4E88A 1ZBDA 3RF6A 2ANBA 1KSGA 1G4AE 5BWMA 5AVTA 1G5RA 4LK2A 3SHFA 4I1UA 2VHCA 3THWA 2IS4A 2C9CA 4LYJA 3VKGA 1VG1A 2C88A 1WE2A 4ZEWA 4ASUD 4Q7KA 4R9UC 2GJ9A 4XWAA 1N6HA 2FEMA 1G64A 4JLDA 5DI3A 5EE0A 5FUVA 2IUTA 5TXGA 4ACAA 2B7CA 3W5CA 5HZHA 421PA 3QKRA 1Q1QA 1NVVR 4PC6A 1RYFA 1KNQA 1CIPA 2C78A 1Z6YA 4S35A 3T5GA 1M1YE 2IYLD 2QGZA 4HDCA 3MMZA 5C4MA 2FX3A 3EX7C 2BM1A 2A7QA 5HPYB 3RC3A 1JAIA 2ZBEA 4ILEA 2P5SA 1P6XA 1R2QA 2D7DA 4NV0A 2QAJA 3AVXA 4WIAA 5J4HA 2B0CA 3BFXA 3MMPA 4AYWA 3MCAA 2B30A 4UMEA 2WMNB 4TYNA 5DI9A 3PEUA 3QU9A 2EFEB 1OLOA 3BB3A 3HP1A 2G0NA 4OQFA 3WRYC 1Z07A 3QUTA 3AV0B 4XTCS 1G8YA 2J9RA 1P9NA 4JVLA 1NSFA 4C0HA 3J7TA 2KSQA 4B43A 4GMXA 1KZGB 3UM9A 1KY2A 3GEHA 5J5CA 3A1TA 3O47A 4DBLC 4A15A 2AK2A 3LW8A 4B48A 2CHQA 2AKYA 2J0VA 2W83A 2OYCA 2I1VB 2QAGC 4V0KA 3BJIC 2D06A 3QVVA 4B6FA 5ALYA 4BX0A 1P2TA 1XTSA 2PX3A 4AG5A 2ZR7A 5DHAA 2ZSEA 4DLXA 2JLSA 1U9IA 5HKKA 5A3RA 5J4LA 1NJGA 1XBTA 1N6RA 1VHTA 3Q3JB 4GOXA 5CIQA 4PQYA 2H5EA 2XITA 2AHOA 4P31A 1YV9A 5FOTA 4UW9A 2D62A 4D82A 4JBYA 3BH0A 1E0KA 3N70A 3U13A 2BV3A 1WCV1 3UMSA 4OYHA 4Q9JA 2Y8EA 5AW2A 4NYIR 2H18A 2QRNA 2HT1A 5JRJA 1G3RA 1OFTA 1GZSA 1FNMA 2IS6A 5KOYA 3B1WA 4DWJA 3KTAB 1J2JA 4EPRA 2QI9C 2R6CA 2REXB 3OCWA 1X86B 4B2LA 5EXXA 4NYJR 4EPTA 1LS1A 2HLDA 3N5CA 2IYQA 4MGYR 2QU8A 2BHRA 1XEXA 1BKDR 4Q66C 2G0AA 3L8GA 2W43A 3OCYA 2QMOA 3S1AA 1RRCA 3AR4A 4K81B 2W2TA 5AM2A 3A1UA 1IN8A 4MYTA 2WIAA 3K0CA 1KGDA 3WBKA 3CBQA 5AM4A 1FP7A 2V55B 1CBUA 1N0VC 2X2FA 1OXSC 1YZQA 2A5YB 2N42A 2VHQA 3L0OA 5T41A 4LRWA 1W48A 4HLDA 1N6OA 5B2ZA 1G41A 2XB4A 3HWSA 1IY1A 2HXYA 3UMFA 2H8KA 2IXFA 1LF0A 1YR8A 1E2HA 2MMCA 3N07A 1ZMXA 2PZGA 5CK5A 2HCBA 3FKSD 5EP2A 4WZAE 3L8FA 1EFHA 3LBIA 5ALFA 1TTTA 3UMCA 2D4HA 3ZYCA 2D2VA 2X1VA 3BC1A 3B9BA 3SN6A 4JL6A 1P2UA 3ZVMA 3FWYA 5AVYA 1G21E 4C9BA 3S6JA 5G3YA 3BD9A 1GFIA 4P4TA 3TLMA 2BCGY 4M1TA 5LB2A 4WZ6A 5AW7A 2FZ4A 3A37A 2OEPA 3GLGB 3NG1A 3B9QA 5AW9A 5AJWA 2JLVA 1TEXA 1G19A 2G1AA 2P9JA 4FE3A 4DB4A 2IUUA 4HUQB 3THXB 1J8DA 1EFRD 1M7BA 4QGAA 5FTJA 1KK3A 2BJVA 4IOMA 5LD2B 1SWWA 1R0ZA 4FMCF 3A1DA 1RQNA 1VCOA 3B82A 1E2LA 4UAVA 4Q01A 3U7GA 1QVRA 2WSMA 5JS7A 2YOGA 4MYHA 2QP3A 4FW9A 1Z4NA 1KO7A 3TIFA 4NYJQ 2XB2A 2N1BA 3THWB 4Q7LA 3C7KA 4A0RA 1TUIA 4XVUA 2OFWA 3KQUA 2ZG6A 2HF7A 2AK3A 2ZITA 4GXTA 1EFRA 3M4YA 3RRNA 4RD1A 1Z47A 1BH2A 4GOKA 1J99A 5ALPA 2A5DA 2Q0HA 2VF8A 2NZJA 2I6XA 1Q12A 1QZXA 3BIFA 4H1WA 4LHXA 3KKQA 2JJ2D 4URWR 1D2EA 1TU3A 1VDZA 4HB2A 3AVYA 3M1IA 3ZIAA 4BEWA 1L7PA 5ALMA 5JSZB 1XTQA 4M4SA 2V9PA 1QBKC 3B9RA 2HJVA 4PSAA 5F2EA 2GO7A 2RBKA 4FI3C 1CR0A 4AWXA 2P3SA 3CPHA 4DCSA 1O3YA 3SC3A 1NBMD 2CFTA 5HZKA 2VSFA 2FDRA 1JALA 1Z0KA 3BB1A 1E94E 3NALA 5F9HA 4ZDJA 2WVJA 4NBSA 4ITRC 3L0IB 1R5BA 5L3RA 1U8YA 3F8TA 5ALGA 3WK5A 2O8EA 3QF7A 3TUZC 3QNUA 1WR8A 1QDEA 2EWVA 4GRAA 4BFVA 4BLOA 2GTPA 4DEXA 2WPDA 1AQYA 3BH6A 3X1WA 2ZYUX 2X77A 3LD9A 3QBVA 4DIEA 4TZ0A 1W2HA 2NO9A 4B2PA 2OBNA 4M9QA 2W58A 4BX3A 1NBMA 3AF0A 2QPTA 1YJ5A 1NVVQ 4A0FA 1YU9A 3QU5A 2GJ8A 2GVZC 2OAQ1 1KJWA 2QSYA 4I4LA 4OBEA 4RZ2A 3SYKA 3TSOA 2H1LA 4BFYA 4L15A 4IDNA 1FEZA 3AKCA 3RRZA 4MRNA 3U4QB 2WF6A 4UNRA 4Q19A 4DUGA 3GLIA 3K70C 1JQLB 3IBGA 4E5UA 2MSNA 4XE5A 1XTRA 4D6PA 1Z88A 5AW1A 3UMRA 5FPSA 4P32A 2JIZA 1U90A 3MWYW 3BWVA 1HV8A 4IOLA 3QXGA 4IOJA 2EFHB 1SULA 1W7AA 5IK2A 4CEHA 2PLFA 3FYHA 5KDDA 4DCUA 4BEBA 3KDPA 4UARA 4BNDA 1E9DA 2OG2A 3EXAA 1SXJA 3K0AB 4M8NE 3HYCA 1F6BA 1JR3D 4I1OA 1L4YA 4ZDKA 4P3YA 2FUCA 2ZRMA 3ESRA 2W0SA 3I28A 1CLUA 4M22A 3ZUPA 2B92A 3UKDA 5AW3A 4UMDA 4A2PA 4KYUA 4Q9HA 3GYGA 3FMOB 3GLGA 1OXTA 4TMVA 1TQ2A 3KJHA 4PC2A 1S8FA 2BWJA 5ALHA 5FI0B 1R6BX 1W49A 3GLFE 2CL7X 3PUYA 3L8EA 4BZQA 2J7PD 2MSDB 1ZM7A 1RKQA 4Q48A 3UATA 2GZHA 2QROA 2X8AA 5DO9A 4CZ2A 2W11A 2CNWA 3K09A 1Q3HA 4B32A 3ZI4A 3B1XA 3ADKA 3H0KA 2FSGA 1O08A 1MO3A 4W9MC 2NO5A 3GLHA 3CH5A 3R4CA 2NTYC 3A36A 4G1UC 4OQXA 1L7NA 4ZEVA 1IN5A 1W0JD 2AXPA 1SVWA 2ZR9A 1T9HA 3IQWA 1ESNA 1E2GA 2ORIA 2XZLA 3VX3A 3RDPA 1TF5A 3ZQ6A 1X8JA 2QL6A 2YWFA 4YMSA 1N25A 1ANKA 1G4UR 1XEWX 5JI3E 1W4RA 3BGWA 2JDID 3WY9A 2QM7A 3I73A 1HE8B 1LFDB 3RHFA 4EFMA 4B6JA 1II9A 1EFTA 2QBYB 1TPZA 2NMVA 1TUEA 1ZIOA 3FFBA 2IW3A 5KHOC 3LQRA 4M1SA 4BECA 3KB1A 4GFDA 2WICA 3AR8A 4CRWB 4C4TA 4C0LA 1H8EA 1I4DD 1XF9A 2ZPTX 4YONB 4LYHA 3FVVA 1Q1BA 1G9XA 3DO6A 2ZREA 4C0BA 3QKRB 1VMAA 2ZJYA 4L8GA 4RY2A 5AVZA 3AGPA 1ZJJA 1EWRA 1SWVA 4FCTA 3VR5A 3GLFB 2XAUA 2ZBFA 2EVWX 3EPJA 2OCBA 3PUZA 2XXAA 2OXCA 5AI4A 1P4SA 2VKQA 2J0SA 4D4LA 4ESHA 1SQ5A 3AKDA 4C2UA 4IHQA 2R8EA 1A4RA 3KBBA 2OAP1 3GJ5A 521PA 2J5XA 1T91A 3WP1B 3OFNA 4TYQA 2WWXA 3L1VA 3K8YA 2ZRKA 4PAMA 4LCBA 1ZVQA 1E2DA 3K0FB 1US8A 3WYAA 3VNUA 4E07A 1II0A 3BAFA 2D2EA 2L0XA 4Q9IA 5AUOB 5BN4A 3UPUA 2O8FB 4MWOA 3QLEA 2WWHA 3CZQA 3AUYA 4Q4HB 4AG6A 4KAXA 2MSCB 4KBGA 4Z8XA 3B1VA 4LUCA 1ZINA 1KOFA 3SFZA 5KPJA 3WK7A 3SMVA 4CF3A 1RLTA 3OHMA 3DHWC 2QRZA 4EFNA 1HQCA 4R2HA 3DZ8A 5M04A 1D9XA 2NPIA 5KNCA 3L82B 4W7SA 2JLYA 5IT4A 1Z28A 4I99A 1QHNA 1AGRA 3DL0A 4KVGA 4B47A 4GDFA 2IYUA 1A1VA 2RGBA 4HSEA 1G6OA 1CKEA 1RFLA 1UEJA 4PQRA 5EZ6B 4HUTA 3FPBA 4TTPA 5FP0A 2DWQA 3DPUA 4MITA 2YJ4A 1KNXA 3SHWA 3I1FA 1K1EA 2GKSA 1P2SA 4RCYA 5EP4A 4JJKA 2QYHA 4F4IA 5EXTA 3FKQA 3LA6A 4CEHB 4PAOA 4BE7B 4QXAA 2GMWA 4AKHA 4HDOB 4PR0A 2CE2X 2CL0X 4BLTA 2GJAA 3GLGE 3W9YA 2A5FA 1CR1A 1Q3TA 4UU1A 3EG5A 3F3YA 1P5ZB 1MT0A 2XZPA 4AY2A 1ODFA 3FPSA 2ZRBA 2AH5A 1XCPA 2WIBA 3TR5A 1X3SA 3IILA 1Z22A 4LBVA 4EAQA 2ATVA 3W5AA 4IFEA 5ALNA 1L8QA 3NEYA
chains in the Genus database with same CATH superfamily
3ZDCA 1A1SA 5LKAA 1JBKA 2IHYA 3OFSA 1EJ2A 2XPCA 5TMDA 2JIOA 3VJMA 3L6DA 4J0DA 3TTUA 4TS4A 2K4MA 3D6AA 4MV4A 4BRUA 1BMTA 5F7JA 4AIRA 2VQFB 3JZDA 4C4SA 1HLFA 3WNCA 1AA9A 2H11A 4E5SA 4MW9A 3AIOA 1EBUA 1K7SN 1Q84A 3ODGA 5E0KB 4R1QA 3VKVA 4DCMA 1GGHA 3LRXA 1DKQA 4EFLA 1M2OB 2CLLB 3R0IA 4MGKR 1HH4A 2C77A 1JEAA 4NH4A 5T3YA 3OC0A 4F2WA 1YCDA 4C7JA 3T5PA 3BB4A 2ZM5A 2O7QA 4N01A 1GAJA 4XSVA 2W2KB 3WTBA 1XNJA 2VH5R 3ICEA 1Z4PX 1LH0A 1KQ3A 2QZ9A 1DCKA 3MBKA 3QH4A 4JFRA 4XFDA 1J25A 3OPYI 4F96A 1Z4OA 2W22A 2XF2A 5HCUA 5IJ0A 4BFUA 1JKFA 3OP1A 4EBFA 2QNIA 4E94A 5GADl 1DIAA 4AD8A 4BNYA 1SQSA 1B1AA 2JFFA 4I0WB 4DNPA 1ZK2A 3A6GA 3T9FA 1GSHA 4YRMA 1BROA 3HCDA 2B61A 3NHAA 2ZI9A 3G9QA 1PJCA 3WMGA 1HR0B 1QAMA 3UKOA 3GLVA 3IAM1 3RUAA 2HHCA 1E6LA 1LW6E 2IEGA 3U3JA 5E95A 2VRBA 3PNBA 3EGDA 4NJEA 1C2TA 2F1OA 2VHEA 1V1RB 2GHRA 1X7YB 3OOWA 3CUSA 2ZIVB 2HU5A 1G8MA 1FS4A 1THGA 3LPLA 2AL7A 4JI1B 4YGYA 1XZFA 1B0UA 1WA5A 3VI3B 1RBYA 1QV7A 1EJ6A 3ZQUA 4I14A 3SJCA 3NONA 1D7AA 3VUFA 2BSQA 4XJTA 4PZPA 2LUOA 3HM2A 3OFND 3WBFA 4F2PA 4CW7A 2VTDA 2GAJA 1MZPA 2BZ1A 3AY6A 4I46A 1KEKA 2HHHB 2J08A 2BP7B 4UVEA 1CR2A 1CDEA 2Z09A 2NSLA 1NF2A 2O57A 2KX7A 1L7BA 3C2QA 3CCBA 3E7WA 3FYCA 3WFZA 4BEJA 2YWRA 4V0NA 1QVVA 4G81A 2GKGA 2JF0A 3KQPA 3TI9A 4ENQA 5CXSA 3MWGA 2FTKE 3TG8A 2Y92A 1CY7A 2JFUA 3A4LA 2RB4A 1RM0A 3QIVA 4R9NA 5BT9A 4PYKA 1XU9A 4E5DA 1WPGA 1T9DA 4AS3A 2FH5B 4LY3A 4EJSA 1AMUA 1OHHA 2QZJA 5D01A 1UKVY 3V80A 2P4SA 5BN1A 4QGHA 4AU1A 5BSKA 3CT6A 3VDMA 4MK4A 3LCJA 5KX5A 2AMJA 2YFKA 3AFOA 2NZ8A 1U9ZA 4JUBA 5THQA 3R7AA 3ZDAA 4MA4A 2FA9A 2VNJA 2V7PA 1QB7A 2PV7A 2H5JA 3ZHVA 2V1UA 2B21A 3MFQA 2II6A 1OB2A 4IXTA 2H2DA 3KZMA 1SHUX 1UWVA 4DUGD 1DEAA 1I33A 2GM9A 2MYNA 1SGWA 2X3FA 1PG2A 3IUPA 1WXHA 3FNRA 3QOFA 4QBGB 3RS8A 4Q1CA 1M74A 2B3TA 3S0JA 4DHWA 5KQLA 3E61A 4X9XA 4EX7A 4OY3A 4FVTA 4J1TA 1FTQA 4P5EA 1RE0A 2SBTA 2J4CA 3P0RA 2ATCA 4HDKA 4J7XA 3HUFA 5FBWB 2FPMA 1OWPA 5CA0F 1P39A 1YNOA 4DBZA 1AXRA 2K2WA 1CQJA 1NXQA 1QIJA 4D25A 1WF3A 3GCWA 4L4SA 4W9RA 2GZ2A 4XJVA 1YC2A 2QKYA 1GGVA 2R4TA 3KPUA 2PGNA 4A03A 4ZTUB 1O95A 2XZTA 2QE7A 1X1DA 2JGJA 3H75A 1Q20A 2LRHA 3GHYA 2ZSFA 1RLUA 3HYRA 3EC1A 3KBBA 4HAYA 1XV5A 4MV0A 4ZOLB 2A35A 2UZ4A 1TAQA 1A9RA 4Y2QA 3QENA 1DOZA 1U0TA 3Q10A 3WLEA 5HR5A 4DY4A 1IHUA 3BK1A 3AX6A 3DWEX 4EQ6A 4TL7A 3JAKB 4ZVPA 3SU8A 1O9HA 3PDCA 3WYCA 1SXJB 2V6FA 3OAAA 1CIVA 1RKUA 2IYPA 2OQIA 4ZIRA 4EMBA 4UAGA 2W8BA 3I9FA 4H4DA 1EESA 4ZQHA 1ZD3A 2FRDA 2RHDA 4D9EA 2BONA 1VG8A 2R1VB 3SOZA 1T3HA 1NN5A 4H4CA 1R64A 3ORHA 3JRWA 1J0EA 2YFHA 2AIRA 1FS6A 1YKFA 2JI4A 1L5YA 2REQA 4PHCA 4QYIA 5F5LA 1U7TA 1CUXA 1QQTA 4R81A 4F8JA 4WESA 1DBQA 2X5KO 1KEZA 1PHRA 3OHPA 3RAFC 1Z13A 2WDPA 1X7GA 2RAPA 4M87A 1ZRSA 2FFQA 2GBGA 4QDZA 2V0GA 1GPYA 3G0BA 1N0WA 5EUQB 1Z6GA 3G89A 3KYBA 3RRYA 3DEYX 3SEFA 4YMUA 5K3OA 3JYLA 3D02A 3ZBTA 3FTDA 3VNBA 4IIXA 3RHTA 1J21A 1XFDA 2GFQA 5DBFA 4YAGA 4GHWA 4D44A 1T36B 3EEBA 5GJVC 4U0KA 1MEEA 2BCJQ 3CLVA 3EWAA 2GFIA 4ODIA 4FC7A 1KIMA 2A4MA 2C57A 1PF7E 1ZXBA 1EI9A 1VJCA 2GAIA 4UHKA 3T52A 5L7TA 5LZ9A 5TC4A 3GFBA 1OJLA 2VP5A 4WGFA 4Q9AA 4JP8A 1NXWA 2WM9B 3UJAA 3W3ZB 2O8DA 2E4UA 2OV6A 3WK9A 4I1RA 2JJYA 4J49A 2VN8A 3PNMA 1NJ2A 2OXFA 3OTIA 3TW6A 3VISA 4X54A 4N3NA 2NM0A 3AKEA 2EJTA 3DL7A 2HGZA 1QGUB 2PCJA 3O2QB 3CISA 3QHAA 1SXJC 3EG9B 3QY9A 4R1NA 4OMFG 5HJ5A 4L28A 2G3YA 2VPXA 3EQ9A 1I3KA 2PKWA 2NXEA 4IVQA 5LA6F 5KWEA 3EIOA 4NCHA 3DVQX 1S1MA 1RIIA 2ZB2A 1UMCB 3FKSA 3NBUA 4IIJB 1DCTA 2GRAA 3U4IA 2RHGB 1PEAA 3IQGX 4R2IA 1P1CA 2JZCA 3TLKA 3DFKA 4BKMA 1COWA 4BQFA 5LWHA 1FTGA 2HMSA 3NTUA 3R8XA 2CNWD 1Z68A 3AL3A 1XD9A 3CT4A 3RSHA 3AVVA 1MA3A 4KVAA 5ALTA 1TVMA 2P35A 3PJFA 4OHZA 3DMYA 3OPVA 3CTPA 4Z7OB 4O5AA 2PUDA 1AHNA 1KC1A 3E82A 3C15C 1BS2A 1ULAA 4GUDA 4XI9A 5LJIA 2ZUDA 1GPKA 1ZISA 3N3AC 1AT1A 2X4DA 3Q3GE 2OGUA 3OPYB 1Y82A 2YWEA 3UAYA 2EXXA 1PJ3A 3B5IA 3LHIA 2F4VB 3LP8A 1ZO8A 4B45A 3GD7A 4GF5A 1HY3A 5AJVB 3X2SA 3CW2A 1MN6A 1M8FA 2BFCB 2CDCA 2PBFA 2VWPA 1UDAA 3Q7TA 3QVWA 4FDMA 4K6MA 4M0MA 3TTSA 1B16A 4F3YA 3VO2A 2H1RA 2W48A 2E49A 4IJKA 3DKIA 3OEEA 4RL4A 1WHTB 4IMJB 4HGZA 5IRCD 2QZ4A 1DBPA 1M2JA 2VP3A 4L07A 4WFQA 5DV9A 1O03A 2A9KA 2P5YA 5AVQA 3F8SA 3Q11A 3ZVNA 4F8YA 2GUGA 3VOAA 1RWMA 2KJQA 1ABFA 4YO8A 4U2BA 1HA3A 4XX1A 4V0SA 3W3AH 3JQFA 3DDZX 3UO8B 3T9BA 3GGSA 1II8A 1VCHA 2A33A 2AWNA 1CZRA 4EB8A 1BWQA 1MO6A 1QFZA 1X7XA 2I6FA 3C7DB 5EVCA 2XECA 3BQMB 1UPFA 1KMQA 1D1TA 5JMPA 3EMBA 1ZITA 3BMNA 1CK4A 1J5XA 1C9KA 1JB1A 1TMOA 2FSVA 2D7CA 3DOHA 3DNPA 2XNCA 1ITZA 4KAFA 5GVRA 5GIOE 3P26A 4MCHA 1YH3A 1EXNA 2MU1A 5KMGB 1QF7A 4NBUA 2YOHA 2QRQA 2IT1A 3ZU3A 1BZYA 3HNRA 4UM7A 4WNIA 1N2SA 2CXUA 2X4IA 3AHGA 2C2YA 3ILHA 2Q07A 2XGJA 1VE9A 2Y6VA 3HDHA 3QITA 3VO8A 3PWSA 2C7RA 5HTOA 2O2JA 1U7OA 3HSSA 1H93A 4CG2A 4GOMD 4WFJA 4ZCSA 2C5BA 1XP5A 5G3ZA 4QTTB 4DF3A 5KX5B 1AKQA 1HC7A 2F17A 3OQOA 1M34B 2G7ZA 3EZFA 3D3WB 3RV3A 4YS6A 3PRKE 2PBZA 1LD3A 1Z29A 4FMCB 4I6EA 5TJHA 3GFGA 1TQ4A 3R7WB 1E7SA 2OFXA 5TS3A 4DT1A 1NLUA 3HGQA 2JA2A 4KU4A 2Q2NA 4HT3B 2QBYA 8AT1A 4DM3A 2NYUA 5C0OE 4PO1A 1G5TA 3T7IA 3UOAB 1F8GA 1GSOA 1ZG3A 3TDMA 5HW0A 4MRPA 5CYGA 4M0FA 3W5JA 3MGAA 3LIIA 4IVRA 2WYUA 3KOUA 2BUAA 2QYOA 4L4YA 1R6UA 1U0LA 1EZ4A 4QFDA 1N5MA 3NEJA 1XCBA 4V2IA 5EXDA 1H85A 3BIWA 5SZIA 3UY4A 1XMVA 3CN7A 1JBEA 1X38A 3NBZC 1DTWA 4KZPA 4TVSA 1YQXA 2MHCA 3ZOZA 4TRRA 4JB3A 5A0TA 4ZAWA 1CUFA 5DXAA 4DUYB 1YE8A 3N6XA 1WX1A 4G26A 3DAOA 3IEXA 3SDZA 3GIDA 1FX0A 1I1HA 2I8AA 4GAEA 2OBLA 2CUTA 3HWX1 4JFAA 4C1NA 2BFBB 3QVGB 2CDRA 3LK6A 3FROA 2R62A 1Q7BA 2V7QD 2AZMA 1P81A 4YMIA 1I3NA 5CH8A 1K8RA 1Z7EA 2JAHA 4B6RA 3JR7A 3G23A 3EZXA 4MW0A 4CTJA 1THZA 2C8JA 3QUCA 3TJRA 4A7PA 3RRMA 3UGKA 4UEKA 4JEIA 3RC2A 2NP6A 1CG6A 1XMXA 5AWFC 3KYDA 4YB8A 3DBVO 2Q4EA 2X23A 1ESCA 4R2LA 1BIFA 3GG9A 1YQTA 1CJMA 1DIGA 4DEXA 4PZZA 2DETA 1E9VA 2VRCD 2J6HA 5CNJA 1H2HA 1MNAA 3E84A 4TV8F 5LNK6 3ZGZA 5ALSA 1BXRB 2Q5EA 3FHLA 3VNQA 2UVQA 4B85A 4EQZA 3QJGA 1O4WA 3LLUA 4AKEA 4B3SB 2V7QA 6NULA 5JCOA 4L51A 3B1JA 1JPNA 1MQ9A 1TO2E 3KSUA 4UOZA 3L8ZA 2JVJA 2HQ1A 4LJAA 2IHKA 2ZRGA 3HE3A 4ECAA 2IRWA 3JQCA 2VH2A 1KAOA 3UAGA 3DZHA 1KQFA 1Z5GA 3K5HA 1DKOA 1TVKA 2XKJE 4UBLA 1IEQA 1PJLA 2RMKA 1PT9A 4ZARA 4AMZA 2DM6A 1IVNA 3D59A 4UMVA 4LFAB 2QUKA 3I5XA 3OJEA 2J3DA 1OZHA 1D2NA 3QLUC 3U49A 5C8YF 1AGPA 5CX1B 4N49A 3SQLA 3H8VA 3VSDA 4YRAA 1KAGA 2I33A 5C51B 1SBYA 3HR8A 1GNQA 1JXOA 2RJNA 3HRHA 1VGRA 2NSDA 2UUPA 3DTTA 4FHFA 4PGMA 4FJ2A 2WFAA 3RGWS 2AD5A 1QAQA 4MUEA 3PUXA 5F7XA 1BW9B 3AVQA 4MVJG 3D8UA 3VPXA 3EVNA 2QVBA 2CFOA 2YWXA 4JOSA 4WAUA 5C3MA 3STWA 4H1VA 3BE4A 2JHCA 3NLLA 1EFVA 1HFWA 1DAOA 2CYAA 2XB6A 4L85A 3SS7X 3JATB 4CT0A 2CZGA 4ZVOA 3K9CA 4M0PA 3VJLA 5JYEA 3EIFA 4JVNA 4YALA 3K70B 2UUOA 2ZIAA 3HJRA 2EHDA 1OGJA 4IDQA 3I34X 2DR3A 1GQSA 2G25A 4TMWA 4U5XA 2RI1A 5SZHB 3WLPA 4BUZA 5C7IO 1L4BA 2C5HA 1JHYA 2GJSA 2ZT8A 1E58A 3GGJA 1I36A 3B3AA 3I2KA 1I5OA 3K5WA 4JLJA 3I2HA 1T5HX 3STVA 2BVNA 2O2XA 4GVPA 3KXDA 3OCXA 2RGYA 2BJHA 1KXZA 2KB0A 3H1BA 4QOGA 4C14A 4GWKA 4CDMA 3WSTA 3AHJA 1ODCA 5F33A 3BL5A 1QE0A 3HEMA 2HW8A 3PIIA 2EU8A 4F4CA 1HFEL 4HY3A 2K7FA 3EGVA 1AE1A 1E8NA 1TCCA 1JI3A 3I72A 4J4HA 4YAEA 5ALLA 1UMBB 5CPBA 4IJVA 1VGVA 5HBRA 3V8VA 4MV7A 3NBYC 4EYOA 1MX9A 4W5RA 2P9CA 2P62A 1HT3A 2PT5A 5HVNA 1JHZA 1BHQ1 1X8LA 5E6SB 3AY7A 1NL3A 1UFQA 2YASA 5CHEA 5LVAA 3HQ4O 4KBFA 3CEAA 5E2AA 5FR2A 2V4UA 1CRQA 2ZTVA 3CNOA 1HMPA 5H9VA 2PGAA 4ZO4A 5E9WA 4HI0E 4WA7A 1ZAYA 3ETEA 2ORVA 2FW6A 3FZYA 4D9JA 4OUKX 1GU7A 1DINA 3ZQJA 1YBVA 5C5IA 2XZOA 5ELLA 1DPFA 3P4UA 1X74A 4TZKA 4YNBA 3HLYA 4NDNE 4QARA 5IUJC 4H7HA 1E0SA 3BCSA 3D64A 3PQEA 2HTFA 2PGXA 4HEHA 3KWLA 4TKUB 5C31A 1IN7A 1HT2E 3IPYA 1FYXA 1LCIA 4KN8A 3JCZA 1Z15A 3AI3A 1UPXA 4X20B 1LDYA 4MQ5A 4YRKA 5KKNB 5C53B 1CUYA 1DDOA 1CJVC 1OXUA 2BZ0A 5KVSA 3OZVA 1I2CA 3KTOA 3ZG6A 2OUKA 4DGQA 5E4TA 1S8AA 1WLYA 4HAZA 5B30A 1BDJA 3KT6A 1PZNA 1CXZA 4YBZA 3VU1A 4OKNA 3T35A 3TCXB 5IKEA 1WHTA 2G5GX 4R6WA 2FZWA 3ODPA 2GWHA 3A6DA 5LUBA 1TM1E 4JQCA 3IP9A 3B38A 3E3MA 4ZOBA 1GGKA 4UVDA 2O2IA 5EKXA 4CGYA 4G5GA 2VF7A 4QHTA 1V8ZA 4FD2A 5ILQA 5BN5B 2XSZD 2DUJA 3ZY2A 2C95A 3UT5A 3HUUA 2P27A 1XEXB 2FY8A 1VIAA 3F49S 3H8JA 4LNUB 2HA4A 4ZQFA 1M72A 1X0VA 2XLCA 5DTEA 1NJFA 4GOOD 3WGTA 4NDAA 3ZJYA 3FTEA 4OIFA 1E8DA 1KYWA 2X86A 3EY4A 3PJDA 5GZ1A 1RHRA 2B9VA 1UADA 3EZ9A 4Z4FA 1FMFA 1S3IA 2GESA 1K3FA 1S8NA 4W5JA 2BM8A 2PRKA 4DLZA 2ENWA 4E6PA 1WY5A 2GOYA 4B79A 4CUZA 1YZGA 3BS4A 1DZ3A 2GVDC 3U6KA 3GGCA 4X3OA 5DBHX 2A5GA 5BW6B 4C5CA 4GPBA 3RT9A 3UHJA 4YQEA 1Q91A 4HQKA 4E5KA 3QPWA 5EINA 3T5CA 4F4UA 1EXWA 1ONSA 2FJUA 2C3OA 4OHVA 5FJIA 2ACVA 4HDSA 4IIJA 4MW7A 3F9CA 5EYPB 5THXA 2VATA 1M1ZA 1ZIPA 3AVOA 1C2YA 3LLSA 1TA9A 2ONJA 1P74A 4OAQA 2QUHA 4NCIA 2DWCA 1M2GA 4BQNA 1JIKA 3FPHA 4IQ4A 4CF7A 1G2QA 3MFYA 1XF1A 3VU3A 2O3SA 3ZEAA 2JJ1D 3FPGA 4Z1MD 4HB0A 1QH8A 4K6KA 3D8RA 3G85A 4LVCA 1QH9A 4EKGA 2EJWA 3AR3A 1UBEA 4QPNA 1T8RA 2DMRA 5HMMA 4I36A 3AIMA 2GF2A 1Z08A 4H1TA 1W36B 2B2NA 2OSBA 4IIYA 3TTYA 4CUJA 2R1ZA 2YMPA 1KAQA 4P5DA 1M8PA 4D8VA 1WBDA 3A3OA 1NOJA 3Q7IA 4WDRA 3UJBA 8LDHA 3IAUA 1QO0A 3Q7EA 2IYOA 2XD9A 5H0IA 3O74A 2G70A 4ENRA 4MHTA 5CYPA 4D43A 4MEBA 1T1SA 4NABA 1X8XA 2JCXA 4QG3A 5ERYA 1JH9A 2W6MA 1IUOA 1ZCBA 2ECFA 4CR6A 1D2AA 2G80A 4XM2A 1AUXA 4PC7A 2GK7A 4OMUA 1L5LA 2AB0A 5K6AA 4KPEC 1P8JA 3I8SA 1DLIA 1GCIA 2XCSB 5DEIA 3WL4A 3WLAA 5M5BA 3I5YA 4FJ1A 4HXGA 4WESB 3OZRA 1T5LA 1Q11A 1NMQA 2AVNA 5IVPA 1JKJA 1QHSA 3THSA 3WNDA 5K20A 1D0VA 3L8YA 4GZ3A 1K3TA 4ZZ0A 2YFYA 4IIJF 5K9ZA 3HXMA 1UPTA 4G4SO 3F5SA 4BOYA 2J7PA 3D8SA 3FNQA 5BW8A 1PFQA 7ABPA 5HIJA 2YVKA 4F3TA 1WS6A 2HRDA 5AKYA 3VSBA 3OLWA 1A50B 4RJJA 1KHHA 4RFVA 2PT6A 3RVNA 1FZTA 3KQSA 2D2XA 4BB6A 3T0GA 1EQ2A 3A14A 4G1FA 1L7QA 4X7PA 2AR9A 5FOUA 4B4DA 5E1OA 1EK1A 3OZDA 3PG5A 2W6JA 1E0DA 1W5AA 3DL2A 4XPZA 5FEMA 3SI7A 3G5TA 1Z7BA 1CNEA 3SP1A 3B5JA 3GB9A 4OEHA 3UAZA 4LYFA 3HHEA 2C4TA 3WGUA 2XDAA 1GV0A 4FOLA 5CBKA 4S05A 2IZ0A 1L4MA 3DOIA 1ISRA 1JGTA 3OT5A 1IHYA 3DOEA 3OU6A 3O5AA 4QRHA 4RFSB 3O2NA 4Z8YA 2VDWB 4K2HA 4OGFA 1DARA 4OHMA 5FUWA 3FLBA 3PC6A 5I9BA 3EW7A 1FE8A 3HBFA 4WLNA 3T12A 2PUFA 5IT5A 2DOKA 3ZW7A 2ZUVA 3U7JA 4Y1FA 4O6VA 5KWIA 2K6GA 3GFFA 4POAA 5EJ4A 1Z26A 1CUDA 1LQUA 1SCQA 1Z82A 2AN4A 3I9MA 3ORYA 3FZQA 4CM3A 1IZ0A 2DPGA 3ECCA 3ESDA 4GZMA 2XCRB 1U2SA 1RLMA 3OZSA 4YQZA 3SEQA 4YJGB 3C98A 2X0JA 2FWIA 4JMLA 2H29A 5A06A 5ITSA 2NP7A 3JYPA 4PYRA 1TKRA 3ZBPA 1O7JA 1GTZA 4O2AF 4PHTA 4CYMA 1QOQB 1TW2A 2XTJA 1EGVB 2E37A 3FRIA 5AOVA 3NGMA 1XXHE 5BYKA 3HRKA 5FBVB 3N7TA 5ILOA 1KBOA 3AERA 4K46A 4O4HA 1EUCB 5DCUA 4TKLA 5ALJA 5G4KA 3U7RA 5LQMA 1GU1A 4RTPA 2AUMA 4Q00A 1EX7A 4BE4A 3FZGA 5BYBA 1DWPA 1OXKB 3VH4A 4N12A 5JV5A 1YR9A 1OYOA 2SKDA 3GT7A 4OH1A 2FSUA 2EYQA 3C6YA 1X1TA 3OUZA 3ZD9A 1NVUQ 4RTRA 3X1XA 1CRPA 2QAGA 1DT3A 2GK4A 2PLWA 4H18A 3VPHA 1BN7A 4RZ3A 5EIBC 4FQ7A 1L7VC 2W90A 2R97A 4C0WA 3VTAA 1HKHA 2C2WA 4RORA 4TS3A 5EQTA 3H5LA 4N40A 2P2GA 1SRQA 2Q1UA 2WIGA 4G8DA 2O2YA 2HK7A 4L72A 1E9EA 4OQDA 4ENUA 5FEUA 2BMVA 4FCVA 4KMMA 3TW8A 2IF0A 2POCA 1SAYA 2IXDA 4JU8A 2NUTA 3RYIA 3SEAA 2P9FA 3WZMA 4BC0A 4C0QC 3MCUA 3ZD6A 4G0VA 1KVUA 3R7BA 2CHGA 2O19A 1TO6A 2E2WA 3HJGA 5KDLA 1NAIA 4QJ3A 5CLQA 1E3SA 4MMZB 4CIYA 2VUHB 5FV4A 1A8HA 2PZJA 3P19A 1U0SY 2ASVA 3LQQA 4JC8A 5FFFA 1QRAA 3ZU2A 4HMPA 2SECE 4CL0A 4EDHA 5IJ0B 4H0NA 2QTCA 4M8LA 4Z5XA 2PSDA 1KWGA 3D8TA 2WJJA 4Q6WA 5JASA 2GN9A 2RGXA 3HA3A 2EARA 1JEJA 3N0WA 4UJ3A 5AM3A 3B9PA 3K8ZA 3B78A 2P1DA 4X93A 3RKRA 2XCIA 4JGBA 5IK2D 4CT5A 4ABTA 2VJNA 3LPDA 4F4HA 5LZ5A 2DXIA 2VT2A 2JLUA 1M2EA 2P1RA 3KYJB 4R83A 4QDJA 4UXJA 4ZVQA 1LDEA 4LYEA 1GQ2A 1YR7A 3L4EA 5BR7A 1NP7A 5DISB 2UYQA 4DLBA 1EFCA 2RGNC 2DB3A 3RTBA 3FTQA 3N2GA 3Q5GA 3I5UA 1O96B 5JBQA 3CRW1 1E4EB 3AXSA 3HO6A 2HWXA 4NFLA 4F60A 1DMRA 1KH1A 5TT1A 2IEBA 3H18A 3O3CA 4Y9RA 4K3UA 3TIXB 4ARVA 1BVHA 3AM1A 3GLUA 4YRIA 4K9KA 4BZPA 2MR5A 5I4CA 3D81A 3QLUA 3FCYA 1VP3A 3H1FA 1V8FA 4GO1A 4UHBA 4DJAA 4AJIA 1TAUA 3RBVA 3PEWA 4Q4DA 4G65A 3GPBA 3KOOA 3EVBA 1WO8A 1SK9A 3O26A 4FWBA 1LF5A 3NPMA 5EJIA 1CD5A 5FOWA 4D46A 1JP7A 5E1DA 3LYLA 1OXMA 5I01A 3MUNA 1JWAB 5AICA 4X84A 1R88A 1TAHA 5DYTA 3CX8A 2CFSA 1GD1O 4HXFB 4REQB 5ELXA 1SY7A 3TTVA 2VSYA 2NPFA 3VJRA 3RW9A 4WADA 4ESOA 3AP2A 5AW4A 5KS2A 2W9XA 2XE7A 4NQZA 2JLXA 4C2AA 1OIXA 4X1KA 1QIFA 2XUPA 2OHVA 4AUMA 5EUMA 5E4FA 4TKVA 3PU6A 1B0ZA 1JEQB 2I76A 4GU5A 3RSOA 4JQSA 5IM4F 2YN2A 4RF5A 4WXPA 4BIIA 4YN3A 5KWJA 1K86A 2EWWA 2G1JA 3F97A 4NZ9A 4YH1A 1AN9A 1U2DA 2WZQA 5JMWA 4R2MA 1KDVA 1RM4A 1G66A 3NHYA 3ASYA 4MVJE 4JDUA 5FHRA 3TZHA 5LDDC 2XKKA 4FR0A 3CUEF 3DGEC 4OQNA 1DE0A 1FPMA 4DMMA 1YDFA 1XUOA 3K1AB 1QFSA 3JD0A 3EFEA 3PGJA 1A2OA 3PR2B 3IEVA 1Z8HA 4TT3A 2ODEA 2JI7A 3T3HA 2GN8A 2OESA 3DYIA 3BRWA 2VWGA 1CUWA 2MSWA 5LUAA 3BD7A 2BFBA 2XWJI 5I4KA 3EZ2A 3ZLVA 4NWIA 1YS2X 1OKKA 1XYYA 3NAQA 1HGXA 4XLLA 3ZDQA 4F9GA 4B6EA 4OAPA 2KBFA 2ZETA 5CK4A 1DJPA 3R6WA 4DADA 5C46F 4QEZA 1T3TA 4G0PA 4CMIA 5B6JA 5JROA 5HM6A 1SBQA 1WKCA 3HJHA 3G1TA 2WT8A 1L5HB 1Y34E 5DWVA 5JI2E 4MQBA 1NBAA 2HA0A 2MTBA 4YRCA 1JJAA 2PIAA 4WQMA 2PJZA 3ZX5A 4URVR 1R0RE 1DIRA 2ZE7A 2FMFA 4TLLB 2FZCA 2LNDA 4URYR 3G02A 4XRRA 1U2RA 4WZBB 4ZCQA 3SBXA 4B81A 4YMVA 3ROMA 3VBEA 1CZOA 4Q3EA 5A62A 1VJRA 1SUSA 3DMHA 3PQFA 4EW2A 2XA1A 5HIMA 3P0JA 1T0PA 1NVEA 1QF9A 2HT6A 4RIEA 2CK3A 1H05A 1KI2A 4JL8A 2ZAYA 4LGYA 4TTIA 3VVLA 5A5EA 2QI9F 2ORED 1OMOA 3EMDA 4NULA 3DCNA 1V7ZA 3AT1A 3MSXA 4ZCMA 2GN6A 2XV1A 4ZHQB 4C08A 1X7HA 4CE6A 5AK3A 3EXG1 3KLBA 3MWEB 1OFHA 1JU3A 1HURA 5AI0A 4CI9A 3DFIA 3QXJA 4FFSA 1X80B 3HA5A 3HZOA 3I45A 3K35A 3O8NA 4FI3F 4NZPA 3TLCA 5A5GA 5BPFA 1NKSA 4Y1RB 2N46A 2XCLA 2HSJA 2XNHA 3RVMA 2LDXA 5FTLA 2MMGA 3S2GA 1LGYA 4X71A 2O7NA 5CDFE 2QQ5A 1J97A 3ITNA 1H4SA 2B4RO 4PPGA 4TQGA 2C04A 3PUWA 4KOAA 3I04M 1YJ8A 4R4JA 2R68A 3MAJA 1TZMA 1RWKA 2R0QC 5LYJF 1NW7A 4D0NA 4N48A 1S01A 1ZL0A 2F9MA 4O8CA 2OVFA 2IHBA 7YASA 3HUDA 2DTXA 1CZUA 3EAQA 1ADJA