4ZU6X

Crystal structure of o-acetylserine sulfhydrylase from haemophilus influenzae in complex with pre-reactive o-acetyl serine, alpha-aminoacrylate reaction intermediate and peptide inhibitor at the resolution of 2.25a
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
311
structure length
309
Chain Sequence
MAIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVKCRIGANMVWQAEKDGTLTKGKEIVDATSGNTGIALAYVAAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEGAKGGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of O-Acetylserine Sulfhydrylase from Haemophilus inuen-zae in complex with pre-reactive o-acetyl serine and peptide inhibitor
rcsb
source organism Haemophilus influenzae kw20
molecule tags Transferase/transferase inhibitor
molecule keywords Cysteine synthase
total genus 113
structure length 309
sequence length 311
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zu6X01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zu6X02
1K7XB 1WDWB 4I1YA 1KFBB 3SS9X 1A5SB 2ZSJA 1J0EA 4LMBA 1J0CA 1KFKB 1RQXA 4NEGA 4D8UA 4D9IA 1E5XA 2WSYB 4L0DA 5B36A 1C9DB 4KKXB 4LI3X 4JBNA 4ZQCB 5C3UA 4D9KA 1Z7YA 3DWIA 4Y6GB 1Y7LA 2RH9B 1K8ZB 2ZPUA 2JC3A 5DW3A 5E0KB 1X1QA 5I6DA 5D84A 4D9GA 1VE1A 4OREX 2CLIB 1BKSB 1TZ2A 2CLLB 2O2JA 4D9EA 4D8TA 1FUYB 2CLFB 4D9MA 4XUGB 1V8ZA 4PCUA 1VE5A 3L6CA 3V7NA 5B55A 3FCAA 2BHSA 1J0AA 1K8XB 1J0DA 5D86A 4D92A 1QOQB 2GN2A 3CEPB 3PC3A 1PWHA 1O58A 2CLHB 4AECA 1BEUB 4ZU1X 1F2DA 2J9XB 4L27A 1V7CA 1TYZA 1TTQB 1K7FB 1J0BA 4D97A 3AEYA 2D1FA 4D96A 4D8WA 1TDJA 5I7AA 3RR2A 1CW2B 4L28A 5CVCA 3X43A 3PC4A 2BHTA 4H27A 2ECQA 2GN1A 5I7HA 1TZMA 2TSYB 4WX2B 5KZMB 5B3AA 3VSAA 4LMAA 3FGPA 4D9CA 2CLOB 2C2BA 5I7OA 1QOPB 4IL5A 2RKBA 2CLEB 5JISA 1KL7A 4QYSA 4D99A 2V03A 3L6BA 3PR2B 2DH6A 5DW0A 4HN4B 1PWEA 5DVZA 4COOA 4D9FA 3DWGA 4HPXB 3TBHA 2ZR8A 3AEXA 5B53A 1TJPB 4JBLA 4HT3B 3X44A 3IQGX 5IXJA 3VBEA 3BM5A 2TYSB 3VC3A 5DBHX 5I7WA 4D9BA 3IAUA 4D9NA 1JBQA 1A5BB 5HBGA 1KFJB 1VB3A 5BW6B 1A50B 2ISQA 2DH5A 4L3VA 3IQIX 5JJCA 1P5JA 1K7EB 1FCJA 3R0ZA 2RHGB 3VSDA 1C29B 1K3UB 5T6MA 2C2GA 1M54A 1UINA 3PC2A 1WKVA 4HO1X 5DBEX 1OASA 5D87A 5KINB 1A5AB 3VSCA 1TTPB 4AIRA 5I7RA 5EY5B 1TZKA 3R0XA 1V71A 3ZEIA 2J9ZB 2CLKB 2Q3CA 3DKIA 5IW8A 5B1IA 2EFYA 1UIMA 2EGUA 1Z7WA 4NU8X 5CGQB 3SPXA 3IQHX 1KFEB 1CX9B 1KFCB 5J43A 4F4FA 2GN0A 5B1HA 2J9YB 1D6SA 3HMKA 2Q3DA 1UBSB 1WBJB 1C8VB 1K8YB 2CLMB 3L6RA 5D85A 2Q3BA 2ECOA 4HPJB 5IWCA 2O2EA 1WTCA 2PQMA 4OFXA 5J5VA 3T4PA 2TRSB 1TZJA 4ZU6X 3SS7X
chains in the Genus database with same CATH superfamily
2QXUA 1SWVA 4ZCSA 1JSZA 1ORWA 2CHEA 2G9UA 2O6HA 3NAZA 4LNUB 5DNWA 5C8VA 1JWLA 3EW7A 4KSYA 1SKQA 2ONYA 1NP6A 2XV1A 3VAZA 3LYAA 3SCZA 3C3MA 4W8OA 4B3FX 3KEFA 3H8SA 2ZYUX 4YRFA 4ER5A 2QPTA 3QBVA 4ISBA 1WXIA 3V3KA 4DUPA 1DP4A 1N5LA 1UK9A 1FTWA 2J6HA 1A9OA 3EGCA 4RV4A 4YRCA 1BS1A 4AJ9A 3CSUA 5BP7A 1CDEA 1QJCA 3SEQA 5D3KA 2O5EA 2V45A 2J45A 2GTHA 2DMRA 2F3TA 3AC0A 5EUMA 3IPAA 4B5KA 3D8UA 3QKWA 4JUFA 1OB2A 1XA0A 5B58T 1F7UA 2QAJA 3RTBA 2V4ZA 1OA1A 3D3JA 1Y9DA 4BVFA 4B17A 4WN3A 2LR0A 4GGPA 2HSGA 2OP0A 2BKVA 2DM6A 2YVLA 2Y6UA 4DBZA 2W48A 4H0FA 1FSGA 3PX7A 4Z8XA 2QL5A 1T2DA 2BM0A 3FZQA 4ZVQA 5IAJA 1TT5B 1TTHA 3N05A 4CETA 1TGYA 1TK2A 4LISA 1IONA 1TEVA 3BMCA 4LXXA 3HKDB 1AKTA 4LDRA 3O9VA 3UKJA 1NMQA 1D0VA 3N2IA 5EPUA 4OJMX 5L3SB 4V0LA 4MRNA 4C6HA 2JLUA 4HMQA 2AKYA 2C2MA 3IIEA 3O03A 1WXFA 3D1LA 3E0QA 2DSTA 3PPVA 4JP1A 4MO9A 5DVZA 3NDJA 1IWBB 5I9MA 2RKWA 5B1YA 5ED4A 5EHZA 1GTG1 4C3OB 2I6TA 4NDZA 2I3AA 3U4DA 5BV7A 5KTPA 1P77A 2AW3A 4HVAA 4FFVA 1CKEA 1CUZA 1DOHA 1S3SA 2PL9A 4ND6A 4OMDA 2GCIA 1Y4AE 3OF3A 4INJA 5LNK1 4BLRA 2XUJA 3EZ9A 5TEVA 4L8FA 1GYRA 3WGOA 4PC6A 4P5EA 5CYGA 4CV0A 4NBRA 2ZRPA 1PNOA 3VC1A 4RY8A 2Y71A 1PSZA 1JLRA 2I1WA 4RLSA 2Q6TA 3OC0A 3PXAA 1DZ3A 5LQUA 1VCHA 5F33A 5CLIA 1NWHA 2F3SA 4YV2A 121PA 5E1MA 2HF7A 5ULLA 1XZHA 2QMEA 3CVJA 4FYVA 3E7FA 2Z5FA 4G9GA 4LZZA 5AK0A 3TKYA 3OFSA 1R4AA 3U9TA 4TRNA 1RI3A 4WOKA 4ZI7A 2I3ZA 4J7UA 4RZ3A 1S2NA 3ABSB 1K4MA 3OLXA 1V6CA 2ZW9A 2VWPA 1XZFA 3UK7A 3W90A 3ZZUA 3LH5A 5FH9A 4JX9A 4GRIA 4YYZA 3LOQA 4ZZIA 5F1KA 1M73E 3WIBA 4O2LA 4C4YA 1E8MA 1RYNA 2DEUA 2ZJ2A 4WSOA 5K2OA 1L4UA 1XZBA 1E64A 1E1RA 1NI4A 3M33A 2YV4A 4D4HA 5A3JA 3W5BA 1CF9A 1LVHA 5EJMA 2II6A 2FMKA 4XA8A 2XB9A 2QRNA 1OXKB 2WWIA 2XBLA 1G8KA 3KYCA 4JSRA 3D2CA 4KRXA 3SN6A 3WWZA 1H4VB 1KPHA 3DLBA 4X3CA 4M8IA 4U3JB 2C20A 4ROTA 1GKKA 1KI9A 4V38A 4ZYUA 3W8DA 5HGJA 4DE5A 2JA2A 1FBTA 2PLNA 4KODA 1PT6A 2Z3WA 1FX0B 2OBMA 4YJGA 4QPCA 1E9CA 4W9NA 4M60A 4Y0AA 1ECBA 2H1FA 3TQIA 3NTOA 2I54A 4PXSA 5CDFA 2NM0A 2AOUA 1SM4A 2BTQA 1AY0A 4XDGA 3ZTTA 2DHQA 5LLDA 2RGXA 1Y33E 3PWTA 4KMRA 2B9EA 2GNAA 2HSJA 3M89A 4NBVA 4XIIA 5DTJA 4D0RA 1ST2A 1MPXA 3Q10A 2GPYA 1L1QA 3SZOA 1OLSA 1NW6A 1YBFA 2QF7A 2YZMA 3OWXA 1Q14A 1YQXA 1HKUA 1CUCA 4E6EA 3CFYA 4M1ZA 5SY9A 1LPSA 3MJTA 3LWZA 4FT4A 2VRCA 4JKOA 3V8QA 1QK5A 4HPWA 5LBIA 1DIRA 1GQ2A 2FSFA 5CH8A 1MOQA 2OD9A 1CERA 1ODLA 1U7HA 3K0EA 4MWCA 5K4GA 4ZYLA 4HLUC 4NZMA 4UCWA 1EFLA 1UMDA 1P5RA 2Z4RA 5EXTA 1QE3A 4CT4B 1HC7A 1E98A 3W5CA 5KDDA 3W6OA 2RHHA 4HQ0A 1T25A 1CF2O 2QRVA 3OOYA 1EAMA 1UXHA 2DSNA 2PCLA 3QOFA 4K28A 3BIJA 5HJ7A 3EZNA 4P35A 2AG8A 2AFHA 3I9FA 2WNIA 3K05A 4MX8A 2DFVA 2VHUA 3QFTA 2N0SA 1Q16A 1Y8AA 3DO5A 1SVMA 3FOEC 4Z7QB 2AD1A 2I2CA 4HGPA 1FNMA 1UBMS 5DT9A 4E22A 1Z5GA 1AIPA 3RVLA 1XEAA 3L1JA 1D6NA 2IKSA 2WPDD 4ZANA 4BQEA 3OJFA 5IU6A 3QW4B 4S1WA 1DJOA 1E7YA 1UKVY 4F96A 1T0IA 1DRKA 1ZKDA 3RIEA 4RK0A 3SHQA 4ZARA 1MOZA 3T8YA 3MFYA 5CCBA 5DCYA 5LPNA 2FPPA 3WMWA 3ZLBA 2X0FA 1QYVA 3HJUA 1LWOA 4P7BA 1F1BA 3W2IA 3L1HA 5KIAA 1E6CA 4P3PA 2IYAA 1KH1A 1XOIA 4KR3A 2R3SA 3KQPA 3SC4A 3WNZA 1L5HB 5IDXA 3E1KA 3ULKA 3IT3A 3A6HA 4A5SA 5KHOC 5A9SA 1A95A 1KZ7B 3HJTA 4GWKA 5BUCA 1YZFA 1WXHA 3GDHA 1PJQA 3WQHA 3QENA 4ECAA 5BXQC 4URHA 1ESDA 2ACEA 1LLDA 1VL6A 3T9FA 2Q28A 4R9SA 1JRLA 3SNHA 3HO6A 1TCBA 2OWDA 4F21A 3AV0B 1H69A 2P41A 5GZ1A 4OHUA 1FK8A 4QWMA 4F6LA 2X1LA 2G72A 3CMCO 2VT6A 1PUXA 2DQ4A 1O6GA 1UK7A 4ATNA 3A28A 3JPWA 4UM7A 4UDXX 4MRMA 5AIBA 4EHDA 1ZW6A 1C8VB 2BCJQ 3UATA 4OB6A 1PWZA 4WKNA 4GMKA 4MQMA 1OI2A 2PQMA 4XB1A 1QTQA 1JKMA 3MD9A 1NRWA 4HSEA 2Y99A 1W8DA 3A58B 4K03A 3GN2A 4LRWA 4MCAA 1DBIA 3L0DA 2YJ6A 3HFGA 5J2UF 3ZVKA 2MYTA 3G9XA 4B0PA 3NKLA 2DUUA 4RF3A 3I53A 1GSHA 5AOVA 5FWYA 1U2DA 4KN9S 4TRJA 3T9BA 3PNBA 1E69A 3FYSA 3ZKWB 3WY9A 3EB9A 4GPBA 1NYLA 3MSCA 4J07A 4NVRA 4BMNA 3JPYA 4D6XA 1FIUA 3T4UA 4XLLA 4BIIA 2GILA 3T3NA 5K8TA 4ND4A 4EW6A 5C81A 5D84A 2JZNA 4DTIA 1XPOA 2O52A 3WX0A 1WZEA 3A70A 2AYYA 2VNAA 1G7RA 3Q1LA 2OVFA 3DQZA 2MSWA 3H1GA 4RAQA 3VNUA 1M33A 3WIDA 3O7WA 3IAM1 5CFQA 2B8EA 2PJRA 2V4UA 4HQFA 2C5EA 4RJIA 2JGIA 4ZO9A 4ZDKA 5BN5A 2YC2C 4MVJM 4Q39A 4Q3EA 4MWZA 3SWWA 5AUPB 2QM3A 3RC1A 5IH7A 5J2UA 3BL8A 5HG0A 4MB2A 3REQA 1F0PA 1VIAA 2PGLA 2EFGA 5TQVA 3SXUB 1PTKA 3OE4A 3TSYA 3SC6A 3QXSA 1MV8A 2XJ9A 3KPVA 2V7QD 2Y2UA 4FFNA 2ZSDA 3I8OA 1P0QA 2D0OB 3BIOA 4PAGA 3VPFA 1WDLA 1S4QA 2H18A 3CEJA 5I4CA 3GMDA 5CR9A 4DL9A 3G0BA 4QDJA 1C8BA 2JK1A 5TV2A 5KYKA 3WDLA 1FXWA 4I8IA 3RBZA 4Y98A 1Q0PA 2Z2IA 1NV9A 3VTZA 5KWVA 3UM9A 3CLSD 1OIXA 3FDIA 4C08A 4BEBA 4Q4CA 1Z07A 5AICA 5HMMA 2HQOA 1PZXA 5F7ZA 3B2QA 4RXMA 4XD7D 3SDBA 3KKLA 5KTNA 4OO3A 3R6DA 4RLFA 1M2VB 1NBIA 5BQPA 1MA0A 1UBCA 1VHLA 1WZNA 2HHAA 5B1DA 1G55A 4IMPA 1JBQA 3TZ6A 3VZCA 4RGQA 1GKUB 1IY2A 4LZNA 4MCJA 1P9WA 4H7PA 1EK2A 1FVFA 4DT1B 4ETMA 1WLSA 2HXGA 2PQ0A 1TKRA 3EG9B 4PFQA 4JLMA 4P5PA 2JGMA 1SWWA 3PHBE 3T5AA 1RBQA 1XEXB 1JJVA 1LSUA 2HHLA 3BMNA 3FNEA 1AXGA 3AW8A 4KXWA 3ASUA 1WPXA 3X2EA 1NMEA 2ZPTX 3QVGB 2Z57A 1D2AA 1QHNA 2O1SA 4QXRA 4BVGA 2VK1A 1CUSA 2WUEA 2BZSA 3NBYC 4QFBA 2DVMA 2V55B 5FTMA 3W9UA 1YZVA 2BLNA 2ORWA 1CZUA 4IFEA 4EYGA 4N7RA 2WJWA 7REQA 3BRSA 3GJTA 2OO7A 1PX0A 1C7FA 3JTMA 3PZBA 5KJCA 1ZN2A 5A71A 3ECCA 3H9BA 1QRAA 5FOTA 2Y1FA 4Q02A 1AGRA 4XTCS 3DEFA 4YAGA 2SKCA 2VTBB 4CTOA 2GXQA 4GMDA 4ZQFA 3CT6A 2CFRA 3K5IA 3HB4X 2JJ1A 2CJWA 3GI1A 4J0CA 4V3BA 3ZJUA 3LF1A 1DEXA 4PQEA 4ZYTA 1XT6A 1VM6A 1XNJA 2ZS9A 4KQ1A 1ZVVA 5IVHA 1MXHA 4FCTA 1VPLA 1V6AA 3HJAA 4YP0A 2NT4A 4YJGB 2W98A 4BBPA 3NONA 2Q5CA 4B71A 1N6IA 2CMFA 3PR1A 1RD4A 2WICA 5EYPA 2EKZA 2Q5HA 4AUMA 4MV7A 3G5AA 4LSWA 3H9JA 3WKBA 1QH1A 3OBBA 4FYPA 2JC3A 3D8BA 1P1BA 1E6KA 2AQKA 2B1GA 3CA8A 4G5FA 2RGEA 1VRWA 5F64A 3WYAA 4M7RA 2ZJ8A 3MINA 4US0R 5GVRA 4B6PA 4B83A 3N74A 3N87A 5E2IA 5K03A 1A77A 2PZEA 3B7GA 3I4CA 1FNSA 5DI9A 1N9ZA 2O5VA 1RM3A 1GWNA 4KYUA 3K2BA 1GT6A 1VL5A 2XXBA 1WP9A 4HWSA 4AECA 3W3AD 1AN0A 1W6RA 3AEUB 1CHNA 1KORA 3FPCA 1KSHA 3L7BA 3OPYB 2PT6A 1WQ3A 1FVHA 3RSZA 4AN4A 5HR5A 2C2WA 1JI0A 3FF4A 4RSHA 5CLGA 1NJ8A 2V0CA 2UU9B 1P45A 3HU2A 1I1NA 1U2DC 2CL5A 2ZKIA 3RAGA 1Y4ZA 3P0EA 3SQOA 2W2LA 2RFLA 3ZH9B 2Q1UA 3F78A 3AP2A 4KWTA 5DKFA 3QELB 4Q7QA 3IOCA 4ZQIA 2XCOA 3OCYA 3WKCA 1ZK4A 2F8TA 2ZRFA 4D9JA 2QW8A 2O8NA 2IUUA 4WJLA 1NF9A 4P54A 4QPPA 2ZATA 1IQ0A 1U3FA 3TX6A 3WGKA 2O8VA 3ZCQA 3T6KA 1C80A 4XKJA 3I6YA 2PCJA 4D9FA 1NBAA 3ZWYA 4BMPB 3THOA 2B82A 2DFTA 1KSJA 3LT5A 1THMA 3GLTA 1JLKA 3O4FA 3PEEA 4YO7A 3WDSA 4DBLE 2AVDA 3FHTA 3C3YA 2G1KA 4ZO6A 4ZVSA 1HNZB 5AXDA 2YWRA 2RAFA 4AF8A 1MG0A 2VO1A 4PPNA 1JFLA 2VJAA 3OIVA 4WESA 1J39A 4Z9AA 1JHOA 1WEHA 2CBZA 4BNNA 1GA1A 3WG9A 4A91A 2DPMA 3CEHA 1SHUX 4HDNB 4KR6A 1IB0A 5HJ2A 1KARA 2IZOA 5GJWC 1JDZA 4G09A 1I3KA 2R8EA 1FDVA 1GFSA 3KJFA 4JKIA 3NEPX 1SBNE 3D54D 4FDLA 5CB4A 1XFAA 2WR8A 3Q3CA 2VP3A 4BRSA 2ZRQA 2EJWA 5KX5B 1JIUA 1VKJA 1QR2A 3ICPA 2UYGA 4EATA 5F23A 1CUDA 1X0XA 2QMQA 3BCRA 3ZE8A 4ARBA 1IM2A 2HWUA 1U98A 5B4VA 2W2PA 1P3DA 1U7PA 2XGMA 4OJKA 3RS3A 3UMCA 4Z0NA 1UBNA 2E37A 3BEOA 3JATA 4J16A 1R6DA 4EY7A 4HRYA 4XX0B 5D8DA 2ZUDA 1EYZA 1O5OA 3KKZA 2IBMA 2WT9A 3HJHA 3LKDA 4KUGA 4OY3A 4R1SA 4RH0A 2FMUA 4L5JA 4PO8A 1YV9A 2ID8A 2A9OA 1II0A 1NNLA 2WFLB 3GD7A 1M2OB 1LSSA 2XTJA 2JA1A 3C2QA 1JZQA 4TQGA 5IC6A 2PS0A 1Z2EA 4RD4A 1LRJA 2IEAA 2MWMA 1X14A 3BWCA 3MJRA 4L57A 1HL3A 1XD8A 2FZ5A 4Q37A 3U3OA 3DEIA 3ILSA 5FWYB 3U7QA 4DY4A 4G0UA 5F12A 1XMSA 3LUPA 2REQA 2AUTA 3DBRB 1H94A 4PZPA 4FPXA 1PEYA 2APJA 4LVOA 3ENQA 3ZCUA 5K9ZA 3GRVA 4Y2UA 2AK3A 4NR0A 4QUKA 3X1XA 1IN4A 2ATEA 3H6HA 3OF2A 3P5SA 3PFGA 5C2JB 3MMPA 1V11A 4Z8YA 5A02A 2QZJA 3D6NB 2PD3A 2WT4A 3B53X 3Q0IA 1U8ZA 2WIDA 4BMOB 2VTVA 2C2YA 5BRAA 1T3TA 3RGWS 2RHBA 2ZZKA 4MLCA 4WNYA 3RRJA 4MMXB 4GHWA 3N07A 4EJMA 3ZWVA 4M8NE 1DXQA 1MRNA 4KO3S 4RK7A 3ROZA 1XTJA 2P9QA 2AZDA 1YZGA 4W7HA 2CMGA 4M53A 4NOKA 4I9HA 2WZDA 1RKXA 2Z1DA 2RCNA 4RY0A 3UOWA 1RPNA 4NU5A 4BB0A 3TNDA 4DTCA 3UYKA 4AM8A 1PUJA 3IEUA 1IY0A 2R87A 3NATA 4GH5A 5ERXA 5PGMA 3WHIA 2BEJA 4NULA 1KDTA 2FYTA 5LYYA 1X7WB 3CRW1 3IKJA 4K9QA 2ECQA 2B9VA 3DZIA 4HADA 4RLHA 1MHPA 2AI2A 4DY6A 1E3SA 4ZIRA 4QQ8A 3S6JA 1ETHA 1UP4A 4DIFA 5E8RA 5AQEA 4EPTA 1TQ2A 5FNZA 7AT1A 5L3VA 3N7UA 5CIQA 5DLYA 1XV5A 4QYSA 1A8QA 4CKXA 3IDZA 1C8LA 2F00A 5JQGB 2OB2A 1X94A 1EWVA 4R2MA 2PGIA 2IYRA 4GYKA 5IAOA 4DC1A 1Z4LA 3GMSA 1N5MA 2N1BA 3T1QA 4MROA 1SC9A 2ODNA 3A4TA 5CBPA 2B37A 4CQMD 5B53A 2HXYA 3ILXA 2RDMA 4EW1A 4QU9A 1WQ4A 2AQIA 4OUDA 5E3HA 1IBLB 4PANA 1PJZA 1MAUA 4FJ0A 4FN4A 4AC9A 4R3NA 2PKCA 1FW6A 2I66A 4M36A 1C3EA 3FIJA 4Q47A 2W2OA 3TTVA 3KVYA 5AJVB 2ZTSA 4GPEA 1QFYA 1X9IA 2GN8A 2WMDA 4QTXA 4E09A 1XRJA 3UHJA 2TMYA 4ZOLA 1YR7A 5K6AA 4B9EA 2UYCA 4F06A 4KQFA 1BQ4A 2BCGY 1NUHA 3ZZMA 4YRTA 2O4UX 2YXNA 2AFIE 5D51S 1O96A 5AVJA 3SYTA 3T1VA 1GKYA 2Y0CA 4M7OA 2C2GA 1Y5LA 2GKGA 3DT8A 4GAEA 4C0BA 4HEA6 4JEIA 5MGNA 4RA9B 1HKHA 3PXXA 4AS2A 5TRTA 4J3NA 4ER0A 4YAKA 2DFLA 2PGDA 2WUFA 3W0LB 3UUGA 3MB8A 4F45A 1WY5A 2P9TA 4LJ4A 3E2MA 4FGSA 2FPRA 4KQMA 4JBGA 4EQZA 2NW6A 3GEEA 4NU8X 2CNKA 4BJ1A 3HXTA 4Q1FA 3C3BA 3PPWA 1PR4A 1MDBA 3FDJA 1DAKA 1EZ1A 2VHWA 4IXMA 3VR3D 4EK9A 1I14A 1KO8A 1JJIA 1V45E 2BM9A 3GARA 3ETNA 2O7SA 4B74A 2C82A 5BSMA 2DPYA 4HXFB 2C1ZA 2C5SA 4RETA 1I1OA 3F3YA 4QUEA 3AM1A 3J80A 1I7DA 1BA3A 4CMEC 3DLPX 2B4RO 1EG2A 2TRSB 3O8QB 4K8RB 5B58C 3U61B 1WB4A 2YNMA 3GJ3A 4PCLA 5L3ZA 1CZNA 4QEKA 4BNTA 1I4OA 2VQ6A 2CJFA 1J0CA 1N6PA 1PS9A 1NBHA 2WJZB 1VB5A 1S96A 5F5XA 1IC6A 3NDRA 3TJRA 3EPKA 5F76A 4AYWA 3RIMA 5FPHA 4KJZA 5IK2A 2VNKA 2QTLA 2R8XA 3GY0A 1R8SA 4CMIB 2CLLB 2EVWX 4U7PB 2BFOA 2FQYA 2NTJA 3G2OA 1U0LA 4D6PA 3A6JA 3HVIA 3VU9B 2QRHA 4N47A 5BT9A 1D09A 1RZUA 1THTA 4INPA 2IYEA 3ITEA 3M9XA 3PDIB 2IH5A 1E2NA 1F48A 1RRFA 4IDOA 2A94A 1BVHA 1LWNA 2FEWB 3KJZA 3LX5A 4XH9B 5DSXA 5I7EA 1LZLA 3NOQA 1YS9A 4UBLA 1CRPA 3MTEA 2Y1GA 3CF4G 4ZO8A 3RR2A 2G9VA 3L8HA 4MGIR 3CJRA 7MHTA 4WVFA 2ETXA 3DE2X 4DEXA 1W36B 1NW9B 3GP5A 4UAVA 3EWSA 3O3CA 1Z6YA 3F97A 5I7OA 2G83A 2RKBA 3N53A 2EGHA 3DH0A 2IOYA 4YGXB 1KBZA 3VH3A 4DMFA 4RTOA 5SYMA 2JCXA 3TLJA 4FFBA 1RC8A 3A3PA 4COOA 1M0SA 4F4DA 3MS4A 3NFYA 1PIWA 4XM0A 3QLUA 3GIDA 4WKPA 1HDXA 2KBFA 4QHTA 2GTIA 2ECKA 3I01M 4DAEA 4EUFA 2O59A 4RKEA 2GM5A 4QODA 1OOEA 3B3QA 4RESA 1U9IC 2GXAA 1AKUA 4IDHA 1XKTA 2P9CA 2C94A 4FLFA 1S02A 1XVLA 2A78A 2WSBA 4HNGA 4NOLA 4HH1A 5IM4A 4M9RA 2NACA 2GH1A 1UXKA 1YQTA 2CJPA 3CW2A 1A88A 1WVGA 2W6NA 2C00A 3L8GA 2HCFA 1X1BA 4I7EA 2DT5A 2ERCA 4UU1A 3UBTA 1Z39A 3A10A 3DCJA 4NWIA 3T1NA 4E33A 2ODTX 3FTQA 4BN4A 2Z8YA 4AZSA 4L4UA 4AMYA 4CFSA 3K09C 2GQ0A 1UR5A 2FSUA 2OHXA 1RAHA 2OV6A 4PCAA 3EXFA 4MIOA 2IS4A 4YJHB 3DOEA 2PXHA 1H22A 4UXIA 4I4TA 4ZOBA 1I51A 3UMRA 2LNDA 1YZHA 4MR9A 3WGIA 3TSCA 3JYQA 1VLJA 3ZZ0A 4RJTA 3OQIB 1G8SA 1T8SA 2EFEB 2PSDA 4FMCB 4G84A 3ND8A 3SLGA 4WERA 4DPMA 2OHOA 1XCPA 3BEDA 4HVLA 3GP8A 1QP0A 1PZMA 1NVBA 3GJ8A 4O59O 3PS9A 4OHRA 1LS6A 2JGDB 1A69A 1FP6A 4NPHA 5CNMA 5JBIA 4PEVA 2MCFA 3UOGA 2AR9A 2B30A 1SOAA 2R62A 4BO6A 2RK6A 1GAXA 2GBPA 4FHFA 1E94E 2QPLA 4RZUA 3VR1A 5EIBD 4EY3A 4RGBA 2XVAA 1Y8CA 3P2EA 4LWPA 5AT1A 4G24A 4JI1B 3ZU5A 2REQB 3PE6A 4KACA 2C2OA 3BX1A 3FZEA 5B36A 3QEKA 4ZXPA 4AG6A 4CNBA 4JYCA 3GJSA 1PR3A 3W9YA 2WKWA 5K7SA 4IEIA 3IKMB 3GFGA 2ONKA 3TZQA 5MFZA 3D7SA 3V46A 3AKEA 4NOMA 5LD2C 2WG2A 2E4UA 1KQGA 2IXBA 3Q5GA 3V2UA 3V1TC 4RPGA 5H81A 1FUEA 1QVWA 4L8GA 2GPSA 4TMVA 2PWYA 5IVIA 5C53B 3HS3A 2G76A 3SU8A 3U62A 2YY5A 4UM5A 1P18A 2HNBA 4HL6A 2KHZA 4J91A 2ZB2A 4YJKA 5H9VA 5IF3A 3IP5A 5IULC 4LECA 3ZY6A 4B33A 3WLJA 4O2AB 2OO5C 4MPPA 2ZIXA 2JKVA 1LDEA 5FL7D 1TTQB 1KA9H 1TU3A 1U4SA 2X2OA 3G8BA 4ALNA 1NLUA 2X4IA 3L0CA 5LQSA 3TLXA 4KQ6A 1DBRA 2JBHA 2QX6A 1MEJA 2K87A 2FF5A 2MMGA 1GNQA 3FCCA 1NJ5A 3NJRA 3QOXA 3PNSA 1U2TA 4CEIA 5AI4A 1AK1A 2VP4A 4C9BA 3UANA 2WU1A 3VSAA 1RRGA 3FYUB 1RI4A 2REOA 2V98A 2Z43A 3LD9A 4X71A 4RIGA 3NS7A 4KRGA 1VG1A 3KDPA 4XQEA 1OR8A 3EDYA 1IUKA 1LGYA 4Q4JA 3VI3B 4EG8A 2XBMA 3ZDQA 1U2QA 3ASVA 3DZBA 2ZAYA 3QFHA 5JTUA 4KPUA 5IT5A 5KOJB 4N12A 1P73A 1PEAA 5KNBH 1KXZA 1DTEA 4JOQA 1QLJA 5I5EA 1Y5RA 2ILVA 1ZGZA 4FYHA 2BWJA 2ODPA 4WOBA 2GRUA 1UXIA 2R8YA 4XYBA 5AH0A 1DUIA 3SC2A 4UFNA 5CM9C 4BX0A 1BDIA 2XTMA 3O95A 1VXOA 3VNBA 1GTL1 1L6IA 2GTPA 1JXAA 3GEGA 3OQNA 1EK1A 4LE2A 4FXOA 2WQ7A 3ZQ6A 1TA4A 3MUNA 3MXTA 3CPJB 2HU5A 3B1KA 4AJLA 1P3Y1 1ILWA 1U0GA 2V8BA 1E2KA 3DAPA 5JFTA 2GAFA 4UVEA 4PSAA 4H3SA 1DOZA 3W4KA 4Z4HA 5CA0F 5IT4A 3DB1A 4H3HB 3S1SA 2HF8A 3QVVA 1FX1A 2DUJA 4P4TA 2OO3A 1DQPA 1A5ZA 2R9VA 2VCHA 3AR2A 3LY8A 3CMMA 4PGGA 2QROA 5LC1A 3IUYA 2BMJA 1RKUA 5D2CA 1ISGA 3GXBA 5FBLB 4ZO4A 2FRDA 4P4SB 1FMCA 1SAYA 1TIPA 2V74B 4H35A 5MF6A 3KQLA 4O3MA 4OTZA 4CCYA 1NE7A 2A35A 4HEA1 4IJVA 3B38A 2DYKA 1FUIA 1FTYA 1RNLA 2UZAA 4RL4A 1J9ZA 4O29A 5P21A 5I8PA 4TV9A 2OZKA 1YI8A 2JGRA 2PY6A 2V7PA 2X8WA 3G0IA 4YMSA 5DGHA 2RHWA 2P6OA 3VVLA 4DC9A 3KQHA 1HURA 1K7XB 4UARA 1KFBB 1RLTA 1WPRA 1ZL2A 3G85A 5D01A 4ZVNA 5GGXA 3AR4A 3ZNNA 2H63A 2QVYX 5AHOA 2F3UA 4LHYA 5EHGA 1NOKA 4R9VA 2QU8A 3K8OE 5IT0A 2HY7A 1K9VF 1V1JA 5C5IA 2EFCB 3KEMA 3LY5A 4PNPA 3RS8A 3RTGA 3IODA 3TN7A 3TUIC 5IJ9B 2ZWVA 2QPOA 1MABB 3HRIA 3ZXUB 1M7GA 3GDGA 3EX7C 1CRQA 2FEOA 4PLWA 4TMFA 4UTXA 1PSWA 4EPXA 2QENA 1AQLA 5DNDA 3JYLA 4BU1A 4MO2A 4F8EA 3ILYA 4ZAVA 1S3IA 3OJCA 1FNCA 5KEIA 1HA3A 2QRMA 4R7TA 1GZHB 2J9FA 2XW6A 3UXEA 3ISVA 1E7MA 4G2TA 3OE7A 4U02A 3DE0X 3R7SA 4N0PA 4UE6A 1AUOA 4IV0A 4GUAA 3Q7EA 5GZ6A 4LJ5A 4FD2A 2MSNA 2W9XA 1VSBA 3RRFA 1D03A 3CH5A 3FUUA 1LH0A 3L40A 3OZBA 4H1UA 4YQZA 1J8YF 3C43A 2O7QA 1U3WA 2FUKA 3IC5A 3NOXA 4BATA 5ALZA 5IDQA 4HYQA 3AP3A 4MHOA 3WRXA 3VUFA 5EIFA 4AP9A 1UFQA 1GOTA 3D4OA 2J1LA 3EUAA 1V5FA 2ZJYA 3PF8A 4BN5A 4D4GA 3WTCA 3DEYX 3QEBZ 1YB4A 1IMJA 3NHPA 3DT6A 4FFBB 1IJFA 2B83A 4DMCA 4EFKA 3LQ1A 5T67A 3LUBA 4MIYA 4TKVA 2X76A 3I5UA 2BKUA 3BHNA 2QLLA 2YVUA 5CLQA 4JT2A 5JAOA 2IPMA 1W88A 1ECJA 4ZHQA 2ACVA 3W2TA 4JT9A 3RWBA 1T9HA 3A3YA 2N75A 3I58A 3OCUA 3VBEA 3OA2A 2JCYA 4O8CA 2J5BA 5TT1A 1K5GA 4AFNA 5F4ZA 3TNLA 1E3IA 1U8CB 4Z4FA 3QIVA 4S0ZA 2AK2A 3C6MA 2H00A 1FLAA 1DNPA 5ESDA 3V80A 3DO8A 1IXKA 1K92A 1SHJA 1SUIA 4NJMA 5I45A 2IDMA 1C29B 2OO5A 1A76A 1N5RA 4HH3C 1XXLA 1QG0A 3B60A 3ND5A 2OGWA 4D46A 4J1SA 4MP8A 4ZGGA 4ZYYA 3VTAA 1HORA 1YBMA 5E1OA 3ZHTA 2Q3FA 2I5PO 5LUAA 1PR6A 1UWVA 3AKCA 3THYB 1U2PA 1LW7A 3RU7A 4LY3A 5ARCA 4MQ6A 4UUNA 4G5XA 3LM8A 5ANRB 3WFIA 2WM3A 5JXJA 3NXSA 2X86A 2H0RA 4U2GA 2DX7A 4MR9B 1I3OA 1EEHA 1RAIA 3QLVC 5AO9A 1M2WA 1T0UA 3MT9A 2PMKA 2I6XA 1DCTA 3A6PC 1HQKA 3UFXA 3DEZA 2AFHE 1CB0A 1O95C 1WU7A 1Z0UA 2PSJA 4M1SA 3W7BA 2ZVQX 3HVUA 2CD9A 3IS3A 4PHCA 5AIAA 4H1HA 4FHZA 4UVIA 1TQ4A 2Q3EA 4AYXA 1V35A 1HEYA 3NPAA 2PE5A 2JBWA 5FLXA 5IFKA 1OWPA 3PFFA 2VXOA 4C4ZA 2DTEA 2XZTA 1U80A 4XPZA 1XELA 4AJEA 2EU8A 1AT1A 1SMKA 5C8DA 3TZLA 2HN9A 1I6LA 2X5KO 2POCA 3IR6A 1G8AA 1ZD2P 2O8BA 4W4TA 5KYGA 2R7AA 3SJUA 2EP5A 2IYLD 3BXZA 4BO1A 2IV2X 3AFNA 3D3WB 5TMDA 1SKBA 3COJA 1P2UA 2C5HA 3MWJA 3T4XA 2B4TO 1H65A 2G4CA 1W2WB 3AHCA 5CDYA 5JYDA 2MR5A 3GT0A 3T7RA 5C3MA 3G1UA 4DQKA 1T9AA 3NKVA 4UPEA 4KLAA 3BFJA 4LHZA 4D4JA 1BJKA 4F04A 1NN5A 1RHUA 1Z38A 3EA5A 3N59A 4L9RA 3FMOB 3O9ZA 4O4JA 3UHOA 2WFZA 3STVA 4C07A 2O8CB 2O0HA 2B1QA 1YZLA 4N5MA 5JFGA 2C7GA 2H6EA 2OFFA 1XL0A 1I6KA 1MVOA 4QYXA 4CT5A 5L3SA 3PUIA 5M34A 1A1VA 4K6KA 3SNKA 1KHHA 5CDFE 2DETA 3JVIA 1PR2A 1O94A 3OBIA 5ELLA 3ZDXB 1OBHA 3U1VA 1TPYA 1C7JA 4PPYA 5TX7A 4TVBA 2P3LA 4CODB 1R66A 4PIVA 2ZT5A 5ENDA 4H7KA 1L5HA 5LIPA 5CT5A 3BHMA 3PLAE 3EVCA 1OU4A 2XNHA 4Q9DA 3STTA 3UW1A 4YPFA 3LGXA 3PV0A 4HFMA 2NIPA 4A03A 2ZJ5A 2C1EA 2JI6A 3II6X 2XOXA 4OH1A 2OM2A 3RF6A 2G77B 5ALXA 1OTYA 2CVFA 1ZD9A 1SJ9A 3H9QA 1GTVA 1RMTA 1K3TA 3R6GA 3PGXA 3OZVA 4L15A 4LIPD 4I1VA 3TAHA 4J0FA 4YRLA 2PL1A 5JDIC 1B3RA 2Q1SA 3H65A 4J8PA 4JXKA 2ZIUB 3E9MA 1COWD 3E22A 1D2GA 2MR6A 4BMSA 2VT7A 4DUGD 4KHPB 4I5DA 5T41A 4KQKA 1KI1A 3OIUA 4JUBA 2ZSBA 5IKPA 1AXEA 4JDPA 3JU3A 3R5KA 1J22A 1LDGA 1WV1A 2BGKA 3ENZA 3QWAA 4TPKA 4XGKA 3VOBA 4C21A 5BW6B 5JTTA 1N32B 3ROTA 3TG8A 5AJHA 1L2TA 3HCRA 3WP1B 1SR8A 5LU9A 1APBA 3C87A 2ZUVA 1RQ2A 2IIPA 3JAMA 4BFTA 2E4YA 1Q7GA 3NWOA 4GKKB 5CFZA 2UZ0A 3OLQA 5IZCA 4NQRA 4RPLA 4U7TB 4I8XA 4NCKA 3IB3A 5JNTA 3ZQ4A 5JMWA 1KI3A 3IH5A 4ISCA 1VZ3A 3H7IA 3N2KA 2H4FA 4N3CA 3CNHA 3G7UA 3R0XA 3UA3A 3O8RA 1H9CA 3KAQA 4DLRA 5LZ9A 3NIBA 4BASA 5JXGA 3FR8A 2ATIA 2WD8A 1QYXA 1PD1A 2E87A 2R8OA 1DIHA 4LXHA 1B74A 1T3GA 1N5JA 1YWGO 2GWHA 2P9YA 3EZ7A 4KQ9A 1TAQA 2OKGA 3CF4A 1T36B 2HHHB 2HJ9A 5BOSB 2CSUA 4NG5A 4ITUA 3WB9A 2I3GA 4L9AA 3DDHA 3RHFA 1E32A 4URUR 3R5XA 3NBQA 4KK3A 1X80A 3GG9A 3SXUA 4QDKA 1M1YA 4RS3A 4CCAA 4OV6B 2Q2OA 4ITRC 5KNBD 3RS2A 4F12A 3P4UA 2VXYA 4JD5A 3EGDA 4NEGA 4DW8A 1JIQA 2PMBA 5IBQA 2OA0A 1ODJA 1JXMA 4KWIA 5CHYA 4OSOA 3I1JA 3M4ZA 4C6TB 3R8CA 1EX7A 4J3JA 4CL3A 4ON9A 2E0IA 3E9EA 2XMDA 1JFVA 1N2IA 2YV5A 3CG4A 3DV2A 4OI2A 1K88A 3JTEA 3L02A 4QECA 4ZAZA 1IN5A 3FOCA 1T10A 4FYMA 4HN9A 4M0DA 3ZU2A 3Q7RA 1TD1A 4D8TA 3D8NA 4P2GA 4QBGB 2IFTA 2XZDA 4OGKA 5F2KA 5FDFA 5IXYA 4NESA 1VQ1A 2EG9A 3I2HA 1UFVA 1T1EA 2PIDA 4TVKA 4V1CB 2YBEA 4EG7A 1NBME 4YS6A 3HJGA 5DHRA 5AJTA 4DUZB 1NVDA 2QRVB 5D6OA 3Q3EA 3EMKA 4NBUA 1X86B 1TE2A 4Y2TA 3Q5DA 4F91B 3S3TA 2GVNA 3AF2A 4C04A 3AETB 3I4FA 4E3WA 5CXXA 2FSIA 1Z15A 1GITA 3PYMA 5AI9A 3RSFA 1RM0A 2VL7A 3ON5A 4H59A 4H27A 4M54A 1JILA 2AMFA 4RHCA 1G4UR 4UHJA 4YCJA 4XE5A 5JI2E 1FMLA 1D07A 1DC4A 5I9SA 1HDZA 2GEKA 4BB5A 1IOZA 1FMTA 2QUBA 4O02B 1CT9A 5EMMA 1V9CA 1XMXA 3BQ9A 2V0GA 3PUZA 2EIXA 3RKSA 2MSKA 5E8JA 1C3LA 3DYVA 4JC5A 3SR4A 1YFJA 2QVBA 3ZYZA 3QY9A 2C97A 4MI1A 5IX8A 1XJQA 3HZHA 3DPIA 5EXXA 4BC0A 5FRDA 3S8EA 1Q77A 3HUEA 2B4KA 1C0PA 3IOYA 2PL5A 1NQAO 3KM0A 2P2YA 2EFHB 2R11A 1S9HA 2ABWA 3VVMA 4P0QB 2V7BA 1K1EA 3ZBQA 4QASA 1JG7A 1RBZA 2B0CA 2F8LA 5A9SB 4NXNB 2Z5VA 2F48A 2HK8A 1QGUA 2OXEA 1YIDA 3A1SA 2IP1A 3RFXA 3V9PA 1X1SA 4M98A 4IIXA 4BMYA 4DMRA 1BWSA 2H2HA 4L22A 3BCHA 2ZRAA 3K09A 1CVRA 2D06A 1RXWA 5DSTA 1QH0A 2DWOA 3ZS9A 4R05A 3E82A 4Z1MD 5H8WA 4L8YA 4DMHA 4V0SA 3F6EX 3VSDA 2ZULA 3DF7A 1WULS 2P65A 2C5LA 2WWVD 1XZGA 5IS2A 1HNXB 3LVRE 3GHHA 3PQEA 3GLVA 3FKQA 4FOPA 1CUYA 2R1UA 3EDCA 2EZ9A 1R8YA 2YWDA 3IXQA 5EZ6B 4AZWA 1S7CA 2A88A 1UBHS 3HYTA 2HIGA 3ML1A 2EBUA 2O7NA 3PR3A 4KZKA 2WP8J 4OQNA 3QHQA 3SKVA 4EJ6A 1SXJC 5K99A 1K8QA 5HF5A 4IXDA 4M0LA 3T5CA 4JXZA 3QUAA 3V48A 4AZ3B 5EJAA 2LZ0A 2EW1A 1FY2A 3R3HA 4LHXA 3WMFA 5CGZA 4JBWA 3T95A 1EDEA 2J5QA 1XQ1A 4IIDA 3HLYA 3FZNA 1N9GB 2Q3DA 3JYNA 1QHXA 1J5PA 2L69A 3L0SA 2NXCA 1K8YB 4BAUA 3CZ4A 3TI7A 4CKBB 3ZDZB 4GMXA 1U1FA 3RSGA 1W44A 3WLSA 4HDRB 5CMLA 1RC0A 4CGYA 1IQPA 3EARA 5JDIA 4F8YA 3N7AA 1Z25A 2CE7A 4S24A 1CJTC 1D6MA 1FLVA 4I1SA 1N2XA 2OHJA 2XGOA 2YYYA 3AEKA 3C7KA 3KFVA 3HVKA 3OM1A 2ZK7A 4ZEWA 5LB4A 4B3IA 3DA8A 3ACBA 4O2BF 5GONB 2DKFA 1JEEA 1VSTA 2GOYA 1SOUA 3C7AA 1E9RA 2DJ5A 3OZUA 1H9AA 4J6EA 1UAAA 1EP3B 3X0DA 4CYMA 4CR8A 2PANA 2LGJA 4X97A 4EB6B 4I6JA 4N0DA 2IW3A 2WW8A 5CVUA 1WOYA 3DVLA 2EF0A 5TMEA 2EEZA 3IQDB 1J7JA 2OCDA 3FY4A 4XVHA 2PUAA 1MG5A 1NI3A 1O7JA 1M1XB 5CG2A 4JJAA 3KZ1E 2M6SA 4PCUA 3G59A 5LA6A 4YY3B 1B8VA 2IPAB 1B73A 1GUAA 2RGWA 1D2NA 4PS0A 2AN5A 4M1EA 5FAKA 1PWHA 1V5EA 1Z08A 3PHHA 2ZDQA 3P0FA 3WRVA 1C3XA 2QUKA 2JIPA 3TVYA 4LJRA 1I33A 2PWAA 3DZKA 2JIMA 1R1DA 1BU8A 2ET6A 4MVJI 3AFOA 4LDNA 3H5IA 1ZRHA 4H31A 3VR6H 3W3ZB 2FEXA 1IUNA 5EHXA 5IBCA 1RCUA 3FTEA 1DJLA 1MC8A 3NT2A 1RXSA 1ZM4A 5TQ0B 1QYWA 5P8WA 3EF3A 4EG5A 2PUVA 2QYOA 3RVRA 1T5HX 1Z2OX 2BR5A 1I4TD 3AIIA 1CUUA 4F86A 3PXUA 2DPXA 1YHNA 2EKDA 1TVKB 3JASB 5AXAA 4CTKA 3OLWA 3T3HA 1JEYA 2XWJI 4II3A 1V9SA 4QARA 3UK0A 5I7WA 4DDVA 4AROA 3O8LA 3KALA 4JK3A 1MQ8B 2ZTUA 2XUGA 2R44A 4X6YA 4Y2PA 3GVPA 1GAWA 4TMWA 2OXIA 4DCCA 1JDVA 2A9VA 1DPGA 1Y1SA 2YZ7A 4RQBA 3D5EA 3PNQA 3VOAA 4B4VA 2DUMA 1CY6A 3GJQA 1TMGE 4LNUA 1CBUA 4HXYA 2CK3A 4N7BA 5FOWA 3WGNA 1QR6A 4FLEA 4GD3Q 2YASA 4BNXA 4DRZA 3HU1A 1DO8A 2QRQA 3FPAA 1NJGA 1N2ZA 1TPZA 1YL7A 4KN6A 4MCIA 3C74A 3IESA 4URXR 4RH3A 2P1DA 5H68A 2J31A 1S8OA 1WKCA 1NMSA 1R2QA 2JAUA 1FNNA 3FI9A 3IEPA 1V11B 2A7XA 3E3AA 3NJ4A 3R2JA 4RV9A 1NMZA 1V0JA 1I2DA 1ZXLA 2JG3A 1JB1A 1OT3A 2ZETA 5F73A 4LBZA 3IEVA 2YHUA 1OFVA 3EZ6A 3MM4A 5IM4F 4C0SA 4GM0A 1KAEA 3EVFA 2ECFA 3VR4H 3VKVA 2X0RA 3TTTA 3HMKA 3RTEA 1X1CA 1XQXA 3GX1A 4MTCA 4DLWA 5CFNA 3DTVB 4YR9A 3RJZA 4HPJB 1X80B 2Y9PB 1CUVA 1HDYA 1BE8A 1QDUA 3EISA 4K9MA 3SJCA 1FXUA 3IE1A 1Y6FA 4HDOB 1XRMA 3ZLJA 2AA3A 1DWOA 4I1YA 4RF2A 1CEQA 3A7DA 3EGDB 1KI2A 1F6WA 1OZ0A 1ZGJA 1J1IA 3ZW7A 2XUOA 4PRLA 1D2CA 1JDBC 1YE3A 4QQFA 3TO5A 5KNBA 1W4ZA 2K6GA 4K9NA 3BICA 2RH9B 3EQ2A 3WAKA 4R31A 5KYWB 3PQ3A 1GLGA 1D4AA 2ZE6A 3SSNA 2NTEA 2F6RA 3B51X 4L7QA 1FC0A 5AVUA 3QWIA 1T2UA 2O2JA 1QYCA 2CLFB 3GRRA 5JASA 1U8YA 4MS1B 4LVNA 2EFJA 3G1TA 3W2FA 3E15A 4DV3B 3G82C 2FWBA 5LQRA 3QUQA 1HUQA 4YMGA 1TFRA 3S27A 4G5SA 5KKAA 2FA9A 2PKRA 4BJ5A 4FEYA 5T3YA 5CFOA 3UGJA 4CEJB 2MJLA 2O0KA 1RPZA 2KS6A 1FB5A 1EB8A 1LZKA 2YWBA 2JJYA 3QU9A 3ZK7A 1DDGA 2ODQA 2P40A 3BHJA 5I7AA 3UPUA 1TJ4A 2VJYA 2VRCD 4YI3A 1L4FA 3FDZB 4RY9A 3ZY3A 1PI3A 4F2GA 5JRZA 4YA6A 3HL4A 1UFOA 5DEOA 3WNQA 4FHDA 3AJAA 1C9YA 2IYUA 2DBVO 1A8UA 1P2SA 4TMTA 1RACA 1JWAB 4C7OB 2QBYA 3WBBA 2J0SA 1Q15A 4DLBA 4JBIA 1RE0A 3G0CA 3UMFA 4HWPA 3NX4A 1YJ8A 4KL8S 3PXEA 2VHQA 1C9EA 1G9SA 1RJDA 2PKWA 3BBLA 4AICA 3KYCB 4NK5A 1TQ6A 3IAAA 1KU6A 3IFSA 3JVEA 4RFSA 1CUAA 5CB4B 4P3OA 2H65A 2GXUA 3ZI4A 2AN4A 3KTAB 2PT5A 2KLHA 2WM8A 2XECA 1X1AA 3GA0A 4G4SP 1R00A 5DLQC 5JARA 5ALQA 5A06A 2UZ1A 3H4TA 4I46A 5KNCH 4ZCIA 3I5YA 1OD6A 2YRFA 1ZR2A 3K70B 4N5LA 1KZYC 5JAQA 2DH5A 3LUFA 4OLJA 4IRUB 4Q24A 1P5JA 4C7VA 1E9SA 5KVSA 3JALB 5F98A 4H2DA 1Q7BA 1U3CA 2O2CA 3NXKA 1L3IA 1Q1AA 3EK2A 4QUDA 1SUPA 2DFDA 3EQ8A 1J1UA 3EWAA 4RSRA 1V5IA 2JD1A 5KYTA 2CB9A 4FGJA 4MGEA 3R9XA 2EW2A 1V48A 4A0GA 2I6FA 2G6BA 3FCUB 4EKNB 1O54A 2Q41A 4RSMA 2WJ3A 1ZKMA 4BMXA 1MAHA 4L7VA 5DTRA 3DTNA 3IR7A 5FYDA 1PQUA 4GZ3A 3TDKA 2A2ZA 5JWRA 1Y7HA 4RDIA 3VR6D 5EEHA 3DGFC 1K86A 2XNSA 1AD2A 3FAZA 4W8GA 1JIKA 3VTKA 4A8HA 4YCCA 5BR8B 4NONA 3UEOA 3C3EA 1MOSA 2DF8A 3DBRA 2WF6A 4AQYB 2I91A 1ENYA 1WAMA 5DHTA 5SZKB 4ZZ1A 4PONA 4WK6A 2JASA 5E4TA 2V6IA 1R0CA 1XTQA 2Q1YA 2Z98A 4OGLA 5FNVB 3Q98A 4S3MA 5LOVB 2A67A 5FHRA 4Y2JA 3AY0A 3VR2D 1VRCA 2R86A 3ACCA 2J3HA 5DMHA 1S3GA 2O8FA 2VATA 2WF9A 1BMDA 2HPVA 4IIEA 1G2PA 3SSOA 4B32A 4DNXA 3P0IA 4AVYA 2EERA 2P62A 3HDHA 4E7OA 1C1XB 4PX2A 1EPUA 3ZGZA 1NPYA 2NV6A 2PLAA 3A2NA 3NRJA 1UWLA 1FP1D 2G80A 3HR4A 5IEBA 1QQAA 1ZMXA 3K1ZA 3P19A 3O0DA 1P2BA 2ZTHA 2WMYA 2B8NA 1R10A 4GXQA 4ENRA 1F8FA 4KB5A 4URFA 1ODCA 3AGQA 4TWZA 4CF6A 3S81A 1CQJA 2D7JA 3ABZA 3NP9A 1U3VA 4B47A 2GVZC 5BMVF 1P39A 2BE9A 1Y3BE 2B94A 3KXPA 4Z7JA 2WZBA 2CXSA 2EARA 4I1OA 3FVTA 4B76A 4LYDA 1Z5UA 3RVDA 4HGRA 4RSGA 3W7VA 1QGAA 4GPIB 4F3CA 1RPJA 1NJFA 1VECA 2VRBA 2DR0A 3E0XA 3KPWA 4H16A 4NCJA 4Y1GA 3RARA 2PBZA 5EJ5A 3C1OA 2FGJA 2JFOA 3RAFC 4G37A 1V8DA 2I22A 5M29A 2CSXA 5CBPB 5BYBA 3ZD7A 3D4NA 1H0HA 2BAGA 4DPKA 3CJQA 4YLEA 4IDAA 2R6AA 1MA3A 4FMCF 5LWHA 4BP1A 2ZQZA 3ZBUA 4F5EA 1WVIA 1OC4A 2BI8A 3GGGA 1DRJA 1W29A 2ZSIA 2GBFA 4XLZA 2IK8A 1IVYA 4CU2A 4UAUA 3ZDFA 4E5YA 4I6GA 3NTRA 4QU5A 4BMCA 1XWWA 1GDTA 3IPXA 4YJHA 4NOJA 4DA7A 4MXDA 1BH6A 3HP1A 1TAHA 5KQMA 1ZBQA 2EBFX 5I01A 1JEYB 4KYVA 1L7NA 1XN1A 4YJ3A 4YRQA 4MIKA 2OOKA 4R98A 3A26A 3LQ2A 3FPKA 1PNVA 5BVHB 4P53A 3CX7A 4ESOA 4LDPA 1JHQA 4Q03A 4BWYA 3BRWA 3IUBA 4KE7A 2ZWPA 2JGDA 4X45A 3MXOA 4YDSA 3WWDA 5LQJA 3PIDA 1LCIA 721PA 4O08A 3MUEA 3PNVA 1PFGA 3T41A 4EHBA 2Q1XA 1KERA 3BH6A 4GMFA 4ZMSA 5L4SA 3D6HA 4BNFA 3DCIA 4MRPA 4RWEA 5JDCC 3RKUA 2QUHA 1LI7A 2VUUA 1GGNA 4J0QA 4H3VA 1T34A 3V4SA 1E2HA 1IZ9A 4WINA 4ETNA 4OOFA 3KS9A 1FFGA 2GNPA 1IZZA 3GLGE 1D8AA 2HQSA 3MOSA 4HEQA 3IUSA 4PAOA 4UHHA 2IYWA 1RWNA 4BFWA 3CWZA 4Q3CA 1F9EA 1SH7A 2OG2A 2E82A 4RD3A 1M76A 1XMVA 4WQMA 4X7BA 3WO1A 5CBKA 3QSYA 3I30X 2R79A 4WFJA 1SKYB 1Z82A 3VR2A 2RB5A 4EPWA 3RTAA 3DAFA 4FGUA 5I48A 5JZOA 1C50A 2AOTB 3LKZA 2WTXA 4QGAA 4BVHA 1GCGA 3QWBA 4XJVA 4PAWA 1L8LA 3O5AA 2H06A 4E7PA 1JB9A 5SYNA 1NRJB 1TZBA 3WLKX 2CFCA 1V16B 3AV3A 4L95C 2ZKLA 4EAAA 2FX2A 2J41A 2Q3BA 1Y89A 4C30A 1WXWA 3R5FA 1T15A 2XOKA 4YBRA 3TQOA 2ZU6A 3TD2A 1L9XA 3R5SA 5M5BA 1J2YA 1IK4A 1KAQA 3JARB 1U3GA 2G5CA 2WSIA 4G4JA 3D7KA 3HBAA 3PHIA 1PGPA 1Z5ZA 1JTVA 1WNFA 3LV8A 2VHTA 1IPHA 4M7PA 2IKQA 3B8EA 1UZNA 1NYQA 2YNMD 3C0KA 3E61A 2Q7DA 2NYRA 4BVBA 1TADA 3QF4A 2HRCA 1N7HA 2I2AA 4RIIA 3ET5A 4BVAA 6REQA 521PA 4X1OA 1JVNA 5LMUB 3TCNA 3K0AB 3BJMA 3KWMA 4TSKA 3UC9A 4OUKX 1YZYA 1NKVA 4KDEA 2VKQA 4RC9A 4XB6B 1E2DA 4QXQA 2BYTA 1H3EA 3NC0C 3I5MA 2BUBA 2CDAA 5CTJA 1IVNA 1GJRA 4UC0A 1I9CA 1YGYA 2PGJA 3F6YA 4AO6A 3D2LA 3DC2A 3EASA 3W5SA 4P7GA 1VZ2A 4HY3A 3SY8A 1K68A 3EG9A 1P1IA 3QYFA 3PKIA 2XBUA 2RH4A 3SZ3A 2BEWA 2XF2A 4RDCA 3EGVA 3O6VA 2QUIA 4PGAA 1QANA 5DCUA 3NGMA 2J30A 2R00C 3OIDA 4XWAA 2EJBA 3HR8A 2WF7A 2O2ZA 3L92A 3QVGA 4AWBA 4CHGA 2JAQA 1QC5B 3ETCA 2GJ8A 3GQBB 3C8HA 3L0OA 4BV8A 2WYIA 3OT1B 1ZITA 1QGED 4RQAA 3IILA 2K4MA 5D7NA 3NUZA 5DPMA 3HACA 1ULUA 5FBHA 5C8YB 3DE5X 2ROQA 3U26A 3KJQA 1Y1LA 1R6XA 2GETA 4NCNA 1U11A 7REQB 3ICEA 1BKYA 2G5PA 3QUSA 4E32A 1U94A 3PCXA 4NFLA 4GPZA 1PKXA 4LXTA 5ALFA 1OLOA 2A1IA 4CM8A 1NC1A 3PUJA 3TXXA 4BRUA 1XDZA 3HH8A 5F7XA 4XQCA 5JXWA 1X9HA 5LN1A 5J40A 4BO2A 2M1ZA 4R1UA 5BW8A 1EUYA 2CXOA 5DTQA 4DLKA 5JAZA 1P7VA 3DFZA 1F2TB 3EYWA 3SFVA 2GN6A 2Q29A 3HWSA 1ZL0A 1NW8A 1KKLA 1RI1A 3JALA 4Z86A 4A36A 4LQDA 3QNMA 4AT1A 3OSUA 4GR5A 4TWBA 1U3TA 4HR7A 4UD2A 4ZCMA 1U1IA 4Y2YA 1W4LA 3Q9SA 2HM7A 3DE7X 3H87A 3HCAA 1DAEA 1IE3A 3FPEA 4Y1RA 1ZMOA 4ETIA 5A0FA 4Z4IA 3BC1A 4U7HA 2BUAA 2Y92A 4TKZA 1XXHE 3H1EA 1NKSA 1G20B 4YK7A 3GLKA 3UTCA 5CB6A 1P9NA 5HJ5A 4AIRA 3AU8A 4YTEA 3VZDA 1GGJA 5EY5B 5HOQA 2DWUA 4J0HA 5C1BA 4LAFA 4TV8F 2P4UA 1XCJA 4PLVA 3PQ6A 4EYSA 3G2MA 1KRXA 1UADA 3O2JA 2MOKA 3BH7A 1GN8A 1CQPA 3L5OA 4QU0A 3BILA 4U7GA 4WD3A 3HGTA 5EZQA 3U17A 3U9SA 2J9FB 3L8YA 4B85A 1O3YA 2HWKA 2HO5A 3FA2A 1W34A 2PJDA 5AKGA 2A0FA 1LRLA 4HAZA 1S1MA 3HDTA 1JP7A 1WR8A 3HBMA 4TLBA 1PJBA 3OTQA 1KYIA 1UPAA 1VJRA 3D7RA 1R5JA 2HLDA 3MJFA 4QX6A 4Y67A 4QG3A 2NSDA 4K3UA 2G07A 2PWPA 3ITNA 3URMA 5KQSA 4Z0PA 5BW5A 5JS1A 1KOFA 4YCMA 1GTJ1 4L74A 4NENA 1ML3A 2HH9A 1WUIS 1MMFB 1YQEA 4JOSA 5BORA 2H2AA 1C7QA 3L46A 3GMTA 2J33A 4WZAB 3RWMB 1ZC4A 4CJXA 4UEKA 2XADA 2JJ8A 4OFBA 2OMKA 1QYRA 1RJ9A 3GRAA 4MI3A 2WSSA 2X7JA 3K8QA 5GZ3A 2CEKA 2BCEA 5E0KB 5J4HA 3BGVA 3EBLA 1YB6A 2D5IA 5IBRA 4NV3A 5AVYA 5LQDA 4RHUA 4ZHQB 5ITZB 1XTPA 3I92A 3P9ZA 3L82B 4YUYA 1ZRSA 4AY2A 4PX9A 4TL8A 2QWXA 3NNSA 2NP6A 2C96A 1GILA 1T1JA 3KKKA 3AMVA 4DYHA 4GPTA 1KH2A 2PL3A 1IM5A 1Q7RA 2P6NA 2RJ3A 3GHYA 4H77A 1QO0A 4YONB 1JHVA 3FNGA 3HYLA 3DMTC 3TI9A 3HBJA 3GH1A 4NNOA 1VKOA 4YCSA 4ZRDA 3TR5A 3JQ8A 5C7YA 4TT3A 2L19A 2Z5LA 5LMZA 4LJ8A 1NVAA 3PUYA 5CA0A 1SD1A 3VVCA 2FJ0A 1JAYA 1HOTA 1T9KA 3F4LA 4AO8A 1GY8A 2QD4A 1E62A 2K2WA 5FX2A 1QVZA 4CIAA 1DKRA 3Q7TA 4MV3A 2Y66A 3E35A 4X54A 5CX1A 2FPXA 3BDIA 4OXXA 1KVTA 2IVZA 2XT6A 1H4SA 1FPMA 1UPTA 3QRWA 3WWCA 3ORSA 1G3QA 4Q4HA 2OCYC 3JRXA 4ZCTA 4MRRA 2QV0A 2D5LA 1PV1A 3DXFA 4OBBA 1E1QA 3ZK9A 3PGJA 3QLUC 3KLOA 5E7MA 2QN8A 2H08A 1N6HA 2O2HA 2XB8A 1V8FA 3QKRB 3CR3C 3HSSA 1LDNA 3GLIE 3C6KA 3A1CA 1KSGA 4B3DA 5AVRA 3CW8X 3VC3A 4QYMA 3GC6A 5A03A 4G2NA 1R6TA 4B6EA 4D2IA 2GHIA 3DZCA 3U60B 1LDBA 1Q12A 1NOIA 3GJRA 1MKYA 2IZ5A 1Y3DE 3A0RB 4DM7A 2COUA 3NIGB 3TIGA 3ZCXA 3DE3X 4TV8A 1IM8A 1WMFA 2CFSA 1ZISA 3ND7A 1WHSA 3KJIA 4CCYB 3SDZA 4AULA 1OU0A 1N2EA 1PL0A 5A6SA 3JQ6A 3BWVA 5K09A 1AZWA 1NQXA 3D8SA 3EEYA 1DO0A 5FLEX 1OV4A 4X44A 2BGWA 2AMLA 4H1TA 1YS1X 2IZ7A 4QUHA 3TIIA 4B31A 3CZ9A 4MV5A 1WKBA 4PRYA 1A72A 4INOA 1R0WA 3K9QO 3REFA 3FNQA 4JSYA 5BQOA 4B2IA 1FLDA 4TLLB 4QUJA 4CXMA 4WZ6A 3IERA 3PX3A 1H8EA 4O4JB 2PMWB 2BI4A 3KV1A 1WS6A 2O8CA 3EC1A 3P4YA 4EG3A 4KGXA 2BF4A 4BCDA 1CVLA 3R1IA 1T4CA 3UWPA 1PS8A 4JI7B 4CFYA 3BWEA 2YDXA 1XDDA 3C7CB 2N42A 3QUTA 4G36A 1KNQA 5JS7A 1Y7TA 2DPGA 1ULTA 4YUAA 2CYCA 2VAMA 3PFKA 4NV0A 3BA1A 3JSXA 2OOSA 3Q3HA 4NH0A 4Y6PA 3E7PA 3VPCA 4FNMA 2BR3A 3KHTA 3OFND 2BJWA 1I2BA 1XCOA 5GVSA 1DRWA 4ASUD 4B6QA 2GMWA 1CRWG 4TMXA 2V1XA 1UXGA 2RD2A 1E3EA 1YFLA 1MT3A 1Q11A 1L4LA 2VDOB 2X3UA 1QIMA 2DOKA 5K8JB 4OUDB 1QWOA 2RBGA 4IIGA 1CUXA 2PUJA 3LHIA 1ENZA 1F0YA 1KMCA 1HWYA 2ZRLA 1N6RA 3DBHB 4LOLA 4RCVA 3S29A 1R7RA 2H59A 1WMBA 2NVWA 2O3TA 2Q5OA 4Q9NA 5HX7A 1OY1A 3FROA 2PNFA 4YRAA 4LFAB 4V0NA 4LDQA 2C58A 4LNAA 2DLDA 4B3HA 1U6JA 3R3ZA 4YACA 4AAYA 1NX6A 3T3PB 2FFBA 3OKFA 4QLAA 3ZE6A 2CNDA 2Q6KA 4P58A 5IKMA 4Z4EA 2AJDA 2HQBA 1K7YA 2BOVA 3KJHA 5D3QA 1ONSA 1QC5A 1ZDMA 1ZD1A 3GQBA 1JR3D 4N18A 3PA6A 4X84A 3TMKA 3WGVA 2H1LA 3C8UA 2Z2XA 2WKQA 5AM3A 3F6BX 3Q11A 3DKVA 3NCTA 3M70A 5B3AA 1T4DA 2EX1A 3WYBA 4BNUA 1SXIA 2CLOB 3L4SO 4R71A 3F67A 4E2WA 1MF7A 3GROA 1NP7A 1R0SA 2PLRA 2C83A 3MT7A 1UBTS 1WJGA 1KJZA 5DYGA 4BLPA 4UBJA 3G02A 5CJ2A 2Y1CA 2YRWA 1DCMA 4KLCA 4E31A 4GOKA 3UH1A 1AV7A 4QOGA 3FR7A 1J23A 2YWHA 4FFSA 4XIYA 1SFRA 2GUWA 3RG8A 5I7SA 2JZCA 1XNGA 2I7DA 2JIZA 3B5EA 4NTZA 4LGVA 4RHTA 4N48A 4BTLA 1C9JA 4ZI7F 3H2HA 4IP0A 2EL9A 3KZKA 1EVIA 5E2BA 4RW0A 5CK4A 2AEFA 1ZIYA 4LC9A 1MQ9A 2NPFA 4A4DA 2NZWA 4N8DA 1P4GA 2X4DA 1RFGE 3KEQA 4QO8A 1SC6A 1QKJA 5DN6A 1QQ6A 1KFJB 1L5ZA 1YA4A 3QW2A 2P9FA 3MGBA 3DM9B 1QB7A 3CLHA 1BDMA 2BW0A 1NQOA 3OO1A 2X0KA 3GJZA 3Q2OA 4G1CA 4WADA 4QLBA 1H5NA 1AO3A 2OUIA 2CLCX 1CP2A 2RGCA 3KQQA 4WXMA 5T3UA 4DG9A 3KPYA 3H9GA 2AEMA 3A0UA 1JH8A 3I04M 3H99A 5AK3A 3SSMA 4CV1A 4ZV9A 1X38A 1RXEA 2IZ0A 2O2IA 3F98A 4YRBA 2ZCJA 1VIMA 1KOJA 1NRXA 4X62B 1IJEA 3W8EA 1PO7A 1MX9A 3ROFA 1XTTA 2X1VA 3IJEB 5JC8A 3GRFA 1X8KA 4FEEA 4Y8VA 3F46A 1RS0A 4PSVA 2DY1A 3AL3A 1UBOS 3ZOZA 2O8BB 2QTVA 3PEFA 4UTPA 3F6RA 3PGVA 1Z7BA 2J09A 3LDUA 3BHIA 3HDJA 3IV9A 1LF0A 3SF8A 2VBIA 4EJSA 1N2GA 1SCUA 5CDHA 2IPXA 3W5UA 1O4WA 1KDVA 2EBHX 4X64B 4BQOA 1CJCA 2FN7A 4BJ3A 4PFJA 3H9CA 2YFKA 3JAWA 4Y9UA 1KQ3A 4HDKA 1ESEA 2QNBA 1Z5OA 2V0NA 3MUOA 3U4IA 4ICIA 3U48A 4HGOA 4FE7A 2ECPA 4TOIA 3WLOA 4N0EA 5JW6A 1EE9A 4MUEA 3B9RA 2VTDA 2ZB4A 4N65A 2OKCA 3KYDA 3Q6MA 1E3JA 1E92A 4MYSA 4GI5A 5TGTA 3LX4A 2XDQA 5C3UA 1RMQA 1RVV1 2BFEB 3GU3A 1NJ1A 5DYNA 1E5QA 4GVXA 2OK8A 3M5CA 1XB2A 2K7ZA 4TKLA 1XXHA 2F1KA 3USZA 3EFBA 2XA9A 3TD6A 3CZAA 1OILA 3RQIA 3HJCA 3UTDA 2V5AA 4E2FA 1USGA 1P5ZB 3N5CA 4MINA 4EO7A 3HCEA 4W99A 2WKSA 4X94A 1JXOA 4EHJA 2KQUA 2O8DB 5K4AA 2A0KA 3HI6A 3G88A 3AHIA 5D86A 2QD1A 2HWXA 2JH9A 5KWJA 1U7UA 1DFIA 3EODA 3AIMA 2IXEA 3BXEA 2JJQA 2LD4A 3LXUX 4G8BA 4IDFA 2OB1A 5H7XA 1AUXA 2EZ8A 2X23A 5TPZA 1H5QA 3HRKA 1KDRA 4AJPA 2I71A 3H4IA 1RRKA 3P94A 4LZPA 4D97A 4IWNA 1ORIA 3MWFA 4Z7OB 3LLMA 3FYUC 3KT6A 3WK8A 5BNFA 5CA0B 1G59A 1N2JA 3FUVA 3ZIAA 5TVKA 4MEBA 4F0JA 1N1EA 3ZI7A 1H2ZA 2G0TA 4EVIA 2LP4Y 2PEZA 2WAYA 4A6EA 1F2UA 3GELA 2ACKA 1RZ3A 4JH0A 4TWAA 5HRAA 4AF6A 1K7CA 2R1TA 2QN1A 1K6XA 5A4JA 3R76A 2NO1A 3R7NA 4N54A 1TYBE 3SK0A 1N8NA 3C3XA 3WQRA 3TL2A 1HTWA 1I9GA 2IRWA 3HUUA 2ANBA 3CIOA 3R0JA 3UF0A 2HA7A 1GSAA 3O4RA 4CDRA 1JMKC 4RJKA 2LCIA 4BGVA 4MCHA 1H6AA 3DO6A 3W6ZA 2HDNB 4KNWA 3V4FA 3KETA 3L1VA 1XU4A 3HY4A 3T3GA 4JIGA 3TOCA 1PUIA 1HL7A 4DSZA 3V00A 1IBCA 1W25A 5JFOA 1LFAA 3D4LA 4GKBA 2A0UA 3MERA 3PNLA 3O75A 4M38A 4QVIA 3MLAA 5TVGA 5K5EA 4D57A 3WK5A 1JDPA 2YV1A 1OFGA 1FQWA 1POXA 2J3EA 3O90A 3A9RA 3QH4A 1X1RA 4ML3A 3TD9A 4BNMA 7MDHA 5KVAA 2ZI9A 4X5OA 4E5UA 4LF7B 3GRPA 5IKOA 4L8LA 3EGEA 3ESDA 3HFSA 2Y6VA 4D45A 4ZEVA 2Y27A 2Q07A 3TAUA 1F8GA 2B5OA 2TS1A 2X1HA 3N9IA 4WY5A 4P6VF 5GP1A 4EKGA 3WMEA 5TMBA 2BGTA 5BOSA 5H3HA 1J25A 1QIGA 3OU7A 2DU8A 3RYFB 2J7PD 2H2GA 1YR9A 3VH1A 4GXNA 5COQA 2UZ4A 1Z74A 3X1KA 6NULA 2HT1A 3OJLA 1DDIA 1KQOA 2ZIFA 3EIOA 4DAOA 1YBAA 2IHBA 5KOHB 2IIVA 1SUFA 1GV0A 2CNOA 3ODPA 5LA6B 2VPYA 2OAGA 1U2GC 3K2IA 4GT1A 3IHKA 3IPYA 4IO1A 1FEZA 2BEVA 3P7MA 5DSZA 3K20A 5GJVC 5DP2A 1RYYA 3L6RA 3V9AA 2HCBA 1Z4NA 4UCQA 2VZLA 1U8UA 1DKPA 4IOMA 3P9YA 5JY1A 3H11B 4J0KA 4YDHB 4HNTA 1TM4E 2E4XA 5BWLA 2X0DA 1XLWA 4OGGA 3T52A 1NR1A 2Z56A 1N3BA 3SS9X 4NI5A 4C4AA 1C4XA 3MF4A 3UB3A 1GRNA 1XAIA 1XRSB 4IUDS 4PYJA 5LB2A 1XDBA 1P1HA 5HZHA 5C32A 1VHTA 3T0GA 5JPIA 3M6XA 2BY4A 3FCOA 1KE1A 1N0VC 3F7TA 4V1CA 1EUDB 4BY9E 2P4HX 1JHZA 5A05A 1ZK3A 1OIVA 2PZKA 3PI6A 3VC7A 3HBFA 3OIWA 1Q83A 1IXSB 3M34A 2DBYA 4PX3A 3KZMA 4QGFA 3G2PA 4R4JA 3ZCVA 4EGJA 1VE9A 1ESMA 2P2NA 3DE1X 4U8GA 5DYWA 3JASA 3ROXA 4EW3A 1W0CA 1NATA 1U7DA 1GRQA 2VPZA 4H6WA 4ETWA 4JUAA 3AL0C 1P8JA 5EMHA 3QFRA 1YIAA 4YHBA 1N2HA 1U8FO 3C6QA 1EGMB 4RU1A 4I14A 2MYPA 2VJNA 3EJWA 1QX4A 1CFZA 2FPGA 1NBMA 1GZ4A 1KRWA 1UT8A 2VSOA 3KQWA 4L27A 4LN1A 2OD7A 1SY7A 4FS8A 5G1OA 1UP6A 2ID4A 2AVNA 2PX2A 1MDFA 1NBMD 1ZCBA 1ML4A 2E4ZA 1PNRA 4M9QA 4KH1A 3BXOA 4QM6A 1V2GA 4WFQA 3I52A 4QNRA 4R01A 3MRSA 3UT0A 3IUNA 1BX3A 1CLUA 5JVDB 4X6UA 5JH7F 5A4AA 5EZYA 3TB4A 3O1IC 5AK6A 1AG9A 4P4GA 4UHKA 1SKUA 3IQXA 2Z4TA 5JAMA 2I0FA 7GPBA 3SYKA 3IDOA 1IN7A 1WMSA 2I3BA 1I32A 2BFCA 2QJOA 2YQ5A 2Z9CA 3N8KA 4MW4A 2NYVA 4NQZA 1EVJA 3I9V1 2BJHA 1H8HD 4ZQBA 2ORYA 1PQWA 4GIBA 3KQNA 4YAWA 2H2FA 1C2YA 5LKRA 1SC1A 1C2TA 3D6JA 2WTUA 5JWOA 4ZT2A 3U19A 5CCDA 2PNJA 4EAQA 4F2WA 4DMUB 3JAKB 1SN7A 4C4RA 5D5QA 1AMUA 2PFGA 2XOKD 4AS3A 4FYKA 4A0HA 5DN6D 2YX1A 1XHFA 3FPBA 4GM4A 4ZQEA 1E3MA 2C61A 1WXEA 2FK8A 2V9ZA 3NO4A 2P9BA 2PMDA 4HBZA 3AZQA 1LEHA 2PAFA 1N25A 2GEDA 1BEZA 2WWGA 4GNKA 3MCVA 2PRIA 1Y9JA 4MJLA 4Y9RA 3LC2O 4UUBA 5THXA 2XCQA 5JE8A 1Y8ZA 3K8ZA 1F14A 2O0MA 4CKBA 4U2DA 1W1IA 5JJBA 1REQB 1T5IA 1W6UA 3AU9A 4OKNA 1L8QA 4JXXA 4MAMA 1SGWA 3W2EA 4A2WA 3U31A 4IV5A 2I2FA 2FZKA 3PXDA 1OBFO 2XQIA 4X0EA 2X58A 2Q45A 2HZ7A 2QK4A 3SQDA 2P1RA 2ESRA 4R1MA 4KI7A 4Z9BA 2GN0A 3RVSA 5BWBA 3KUKA 3PWSA 4PYMA 4B73A 4AI6A 1R4MA 3HN6A 1JR3A 1IU9A 1GSOA 3A32A 4FUTA 5EERA 2BMVA 1U8AA 2ECOA 2VRWA 3AB7A 3JAWB 3KFLA 4KSCA 4A9AA 1TCVA 2G0NA 4CKYA 3W3AA 3CXRA 4I50B 4IMJB 5IDYA 3TSZA 4DSTA 2V4MA 3CUUA 1ISMA 4RIEA 1UEIA 4GLBA 2JI8A 1SVIA 2BMWA 2GASA 1I01A 3EQ6A 3UBMA 3ILHA 3WP0A 4JXJA 5AVOA 1L4NA 1N7GA 1E5XA 1O6FA 4HD8A 4M1TA 2OENG 3QA3E 2Z1MA 1XZIA 2WE8A 4R83A 1ONPA 3UGTA 1EEXB 4C87A 2ZLBA 1Y9ZA 3CWCA 4IKEA 3IUEA 5IHPA 4C7OA 4WCVA 2ZPUA 3KKNA 2AFRA 2J32A 1Z3IX 1U2EA 1ICEA 3UIEA 2YUTA 3K4PA 1LVUA 3QFCA 3R5HA 4HQ6A 3PLNA 3D4BA 1P61B 2IWHA 1USWA 4XUGB 4YN3A 3S2UA 1P4JA 1YU9A 5EC8A 1NR7A 4RELA 4K81B 1KEWA 5HS6A 1RLMA 5AW4A 1U4OA 4RXTA 3B1ZA 3THWB 4PG4A 5JJLA 5EXEA 4IX1A 4TLDA 1SBQA 3NALA 2OHFA 5L3QA 2H8GA 1YU6A 2J0UA 4KTVE 3VPSA 2DERA 1ACJA 1YUBA 1AN9A 3KTOA 2JHGA 4TT8A 1G2IA 4WAUA 1ZEMA 2Q2WA 3O3OB 1KI7A 1ODSA 3U6KA 3DZFA 4YCLA 1FUKA 2OCPA 5TPZD 1FDTA 2YJ4A 3AVPA 2W2NA 1P1JA 3DXXA 1FA9A 3EA0A 3E7XA 4A8JA 2WJ6A 4B44A 3B36A 1K89A 2GPWA 4RNDB 5CVDA 1NY5A 3ZCPA 4ZCPA 4NE7A 4GR4A 1K8RA 1XRRA 2C2ZA 4JEMA 2N1MA 2QNRA 4KP7A 4ILEA 2IPOA 5E9AA 1ISRA 2DWCA 2IY9A 1Q91A 4TSRA 1B16A 1E8NA 2XD4A 4ND3A 5G40A 4DLPA 4BO4A 2WAMA 3I64A 3H4MA 4IXNA 3QYPA 1XQVA 4IQFA 1XA4A 2ZJ4A 5DISB 1Q84A 1RM5A 1L3CA 2NVUA 3DVAA 3NT4A 3C98A 2HYIC 1T6XA 1YA6A 1A27A 3EH1A 2F43A 2GM3A 4IIJA 2XB2A 2YOFA 3T94A 1ZN7A 3WTBA 1VC2A 2E3JA 3IEKA 4URWR 1IEXA 2JD0A 1QNFA 4RD6A 3RC7A 1O97C 3A6ZA 1PFUA 4POAA 1VP9A 3L06A 1OYOA 5FNVA 1HDRA 2Z30A 3M6FA 2B2XA 4MKRA 5K3FA 3LUKA 1L7RA 5C9ZA 1C1DB 5EIEA 3K1YA 1JDSA 4TROA 1G8PA 4Y6SA 3IBFA 3S2SA 4LQLA 2I87A 3MJHA 3RTDA 3UGKA 3COSA 1KMHA 2Q50A 1L5VA 3Q9UA 4CMJA 4AK9A 2RGDA 4U5QA 2D54A 3ONWA 3IEXA 5SZJA 5T6MA 4REQA 4K86A 3KVRA 2GN9A 4UJ5A 3DDSA 4J7AA 2MHCA 1BCRB 2YCLA 3H3JA 4PGFA 1QKKA 1PJ2A 4J6FA 4GKJB 2GEJA 1AS0A 2XVXA 3E9YA 3JY6A 5F5LA 4YUXA 3PENA 2GBCA 3P96A 5I7RA 1VGRA 5LQAA 5KOHA 2BFNA 1DBPA 3SXPA 4L5IA 2OSVA 3M4NA 1TX4B 1KK1A 3SPXA 4EJFA 1UBGA 3LSTA 2IZ6A 1ABEA 2ZEJA 3EE6A 1EK0A 3HFRA 1TCCA 5JD4A 2QSUA 4R40A 3UJNA 2QLTA 4QBKA 3Q3JB 3F9RA 1USVA 2LKDA 4TLAA 3MSXA 5NLLA 3RFFA 3UJCA 3SYMA 2IY8A 1WTCA 3CZPA 1DBVO 3DF9A 4PYLA 3LPLA 4NIMA 2JLZA 4AMVA 1TRKA 2PO7A 1J7KA 5G4KB 1V39A 1W96A 3QU5A 5JWHA 2HMUA 1Y6JA 3A9UA 4JL6A 2Z2ZA 2AX4A 3DTTA 3K16A 2BONA 3ROQA 2E1PA 2HC9A 4B48A 1R3DA 2J3DA 1IOVA 1YNOA 4OX9B 4Y2GA 4JC0A 1OHHA 1Z45A 4FK8A 1XU9A 2ATVA 3KDSE 1EFAA 1XQYA 3HA5A 2GEVA 5L6MB 2ZUEA 1Q20A 1R16A 3K1JA 4CMKA 2PDAA 2XWBF 4XGIA 1WV0A 5BSTA 3LPNA 1OGYA 3C5VA 2YHIB 1A9ZA 3EUWA 4WXHA 1AA9A 3GCGA 5GV7A 4C0LA 2VDUE 2AD5A 2JGJA 2J3KA 3HYSA 3RT1A 1I3LA 3CVVA 5BRNA 1G9TA 3RFCA 5EN4A 3TQCA 4DMLA 3UPTA 1LPPA 2IP4A 3TECE 3COPA 1ADCA 5AKHA 1XJCA 5TJHA 5T57A 1FNBA 2I2DA 1DQNA 4NZ9A 3THXA 1ZVMA 1OXSC 2F1HA 3SFZA 3DBOB 4B6OA 4YAIA 5I8ZA 1UWCA 4IHQA 3S68A 2BFAA 5A4MS 1GNTA 1LUAA 4UUQA 1CNEA 4KIGA 3MPUA 5E6RA 1FU8A 3T99A 5JSQA 2FW0A 4IH1A 1A82A 5HRUA 2AQHA 3KUDA 1HGXA 2E4AA 3OQJA 4CLRB 1U7OA 2QRPA 2FWAA 4C4OA 1CY8A 3BJEA 5DW0A 3J7AC 4OOEA 2AMJA 5J4LA 6AT1A 2PA0A 5A62A 2XNCA 2FOXA 1KJQA 1YDGA 3N2GA 4QICA 1UKBA 4E15A 1RDFA 2A58A 1PJ4A 2AJTA 3O26A 1LPNA 4C0QC 5I3CA 1H8HA 4ER7A 3IKTA 2A9FA 3KOXA 1R4ZA 3GJ4A 3IT2A 4L4XA 4OLFA 1JDBB 1NIJA 4H4EA 4BRWA 2HBQA 1QH1B 4BQQA 1B43A 3BTOA 3EJ6A 5CU7A 4ALLA 4PR0A 4GZMA 3W2GA 4FILA 4GEGA 2L82A 2QG6A 3PNPA 3HHPA 3EGWA 4ODIA 1E1LA 2Q2QA 1FW8A 3LUAA 3SLKA 5B37A 1YI0A 2GKOA 4WH0A 3HCBA 1J56A 2E7ZA 1ID1A 1N2CE 3T9AA 1AB5A 1QHIA 3BDVA 4X9XA 5BV2P 1YOVA 2B3DA 4YBZA 1M74A 4DG8A 3GGOA 4HO1X 3LWDA 4C2TA 3QF4B 2ZTVA 3BQNB 4HDMB 3NJ8A 3TGWA 1WUHS 1JHDA 5H3CA 4ZD6A 1UPFA 4IQ0A 1N92A 4H4CA 1V8BA 2V6GA 1U0FA 4COKA 4M6WB 4KWHA 2ZI5A 4X93A 1LQ2A 1B15A 4KV9A 3Q7SA 2F3QA 1LQUA 1Y8QB 4MWSA 3ZV5A 4TTVA 3V1KA 1KBOA 2GFHA 2GLXA 2ZYHA 3DMRA 3MWDA 4D0NA 2CVHA 1KO5A 2E5WA 4IFBA 4YVFA 5DGIA 2R6FA 3ZHZA 2PUFA 2F8MA 1LNZA 5BMOA 3U1TA 5DM60 5LD2B 3F96A 3Q9LA 1CQWA 1VLQA 2WJHA 3FSGA 1HLDA 2FG5A 4H9GA 4RDXA 1D0SA 2V7QA 4PSCA 1PW7A 2GD2A 3GUCA 3QX9A 3M6WA 3NBKA 5F51A 1WP4A 1NXXA 1X7DA 2IXGA 3CCFA 4MEJA 1XAGA 3T4PA 4K5QA 4A0RA 1ICIA 1SVOA 1HK7A 1M0TA 4X1YA 3LLUA 3GEIA 1DLJA 3A4YA 1C81A 1IZ8A 1WUYA 1MHTA 3KZNA 1G42A 4HLUA 1SG6A 5UKDA 1CSEE 4R8SA 3JQGA 1I10A 3B6MA 4WESB 4EENA 4HDQB 2JAWA 5FEUA 1NSYA 2JIDA 1VJGA 2UV8A 2PMCA 1DCFA 2VHXA 5G0WA 1WWKA 3DLAA 4A10A 4BUZA 2J3JA 3ET4A 5JHGB 5LDDC 4N0QA 4L8WB 3ZIUA 4MWBA 1M6VB 1GQYA 1Y6RA 1GL6A 3WIOA 2WT8A 2VJMB 5LL6P 2R8BA 3L49A 5TQJA 1YRWA 2XOEA 3H5RA 3MMXA 2L42A 4ZOEA 2Q6LA 3HM2A 2AX3A 2D4HA 2YBDA 4JJZA 4TS1A 4XCXA 1KQFA 3D7LA 1N2SA 1QFSA 1UC4B 2OBLA 1QO9A 2JJ2D 3UKOA 1PZGA 1ULAA 3KOOA 3Q40A 4IZ6A 3TSOA 4CMGA 4ZOLF 1C8KA 1YS6A 4UXHA 3RYCB 1LC0A 3CNLA 1PFKA 3G0GA 4YAJA 3VYRB 4FXPA 2YZKA 3A3KA 2FQQA 4HAIA 4AXBA 3N8GA 2OORA 3I76A 2FG7C 1B1AA 5CVCA 1QNLA 2ZR7A 3R09A 4YJ2A 3PDCA 5KNCD 3GEMA 2EF1A 3SHWA 3KAKA 1RZRA 1XVUA 4QGGA 3NKFA 1F17A 3TNYA 5EMLA 1BHO1 4AJ2A 4GMGA 4F11A 1BGWA 1DX6A 1IEWA 1ZI8A 3LDHA 3M6MD 3U7JA 1QONA 2C4KA 5HE8A 3HV0A 2LPMA 3NH9A 3PUWA 4D3SA 1HFEL 1EWRA 4LQ4A 1T0JB 2W5UA 3FCEA 1ISJA 1YZTA 1ZWKA 3L7JA 2PYDA 1Q1EA 2ZRDA 1EE1A 2I34A 3HVHA 3R7WB 2C7OA 3PUHA 3THRA 5JEEA 2IUEA 3OEWA 1TTTA 5ICG