4ZU6X

Crystal structure of o-acetylserine sulfhydrylase from haemophilus influenzae in complex with pre-reactive o-acetyl serine, alpha-aminoacrylate reaction intermediate and peptide inhibitor at the resolution of 2.25a
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
311
structure length
309
Chain Sequence
MAIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVKCRIGANMVWQAEKDGTLTKGKEIVDATSGNTGIALAYVAAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEGAKGGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Cysteine synthase
publication title Crystal Structure of O-Acetylserine Sulfhydrylase from Haemophilus inuen-zae in complex with pre-reactive o-acetyl serine and peptide inhibitor
rcsb
source organism Haemophilus influenzae kw20
total genus 113
structure length 309
sequence length 311
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zu6X01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zu6X02
1K3UB 4HPXB 1UINA 5B1IA 1A5SB 2TRSB 1P5JA 1WBJB 2V03A 2ECQA 4QYSA 5EY5B 4ZU6X 3T4PA 3TBHA 4D9BA 4AIRA 5D85A 3BM5A 4H27A 2Q3DA 3SPXA 4D97A 2ECOA 3HMKA 1F2DA 1TDJA 2GN1A 1KL7A 4XUGB 1K7FB 5I7OA 3L6CA 3RR2A 3SS7X 5IWCA 4D9EA 4D8UA 4AECA 2DH6A 3IQIX 4Y6GB 4D99A 2TSYB 5E0KB 1VE5A 4NU8X 5I6DA 2RH9B 1A5BB 2CLIB 1K8YB 2TYSB 2J9ZB 4OREX 4IL5A 4L27A 4D9GA 1Z7WA 1OASA 4KKXB 4LMAA 4ZU1X 1PWEA 1TZ2A 3ZEIA 5I7AA 1A50B 2J9YB 3VSAA 2Q3BA 2C2GA 5D87A 2ZPUA 3IAUA 2RKBA 1K7EB 1V7CA 2BHSA 2RHGB 2CLMB 4L0DA 5B55A 2DH5A 5JISA 1KFKB 1TZKA 2GN0A 1J0AA 5D84A 3PC3A 5KZMB 4WX2B 1K8XB 1K8ZB 5DVZA 1K7XB 5IXJA 5JJCA 1TTQB 2C2BA 4L28A 3PC4A 1JBQA 1WTCA 1UIMA 3DWGA 3L6BA 4LI3X 4D9KA 2ZSJA 2O2JA 2CLOB 2D1FA 3IQHX 3PR2B 4JBLA 3AEXA 3SS9X 5T6MA 1TJPB 5I7RA 1V8ZA 2ZR8A 4D96A 4LMBA 5B1HA 5IW8A 5J43A 2GN2A 2Q3CA 3X43A 1QOQB 4I1YA 3VSCA 2WSYB 3FCAA 2CLEB 4HO1X 4OFXA 1J0DA 1WDWB 1CW2B 1KFBB 2EFYA 4COOA 4HN4B 1FUYB 2ISQA 4HPJB 5BW6B 1A5AB 1KFEB 5CGQB 4D8TA 1X1QA 5D86A 4NEGA 1O58A 5CVCA 3L6RA 3X44A 1TZJA 4D9FA 4D8WA 3VC3A 1WKVA 4D92A 1RQXA 2JC3A 3VBEA 3VSDA 5I7HA 3FGPA 2O2EA 4L3VA 5DBEX 5HBGA 2EGUA 1UBSB 2CLHB 1C29B 5B3AA 5B36A 1D6SA 2CLFB 4D9NA 4JBNA 1CX9B 1M54A 1Z7YA 3CEPB 1C9DB 1VE1A 1QOPB 1TTPB 3R0ZA 5DW0A 4D9IA 2CLKB 3V7NA 5KINB 1TYZA 1C8VB 4D9MA 3PC2A 4ZQCB 3AEYA 5J5VA 1BKSB 1J0CA 1VB3A 4D9CA 3DWIA 1KFJB 1Y7LA 2CLLB 1V71A 2PQMA 3DKIA 1E5XA 1BEUB 5B53A 5C3UA 4F4FA 3R0XA 5DW3A 1KFCB 1PWHA 4PCUA 4HT3B 3IQGX 2J9XB 5DBHX 5I7WA 1TZMA 2BHTA 1J0BA 1J0EA 1FCJA
chains in the Genus database with same CATH superfamily
1NUUA 2ECFA 3EDOA 4IJ6A 5DRTA 3BG5A 3VOTA 2TRSB 3U16A 2V6BA 1PS0A 3T7RA 4ZYLA 3W9YA 1DRWA 4L95C 2CVPA 1FTYA 4S35A 4YUZA 4ZGWA 1U98A 4GX5A 3CZ9A 1YZ3A 3G5MA 4EUFA 3HNPA 3LUGA 3VOBA 1JPVA 2CFIA 3LGSA 2I4OA 1HQDA 4MW2A 3A3PA 1GM5A 2OBXA 1B93A 1P77A 1XQWA 2P75A 2AKAB 2JI8A 5EKSA 3FCCA 5TT1A 3RU3A 1RBQA 3DE0X 5HUJA 2PIAA 3RT1A 3ZWCA 2FW1A 2P2CA 4RE5A 1K0UA 5IYZB 2ZUUA 5F7ZA 3MA0A 1BVRA 1FTNA 5G0UA 4WXPA 5K0JA 5CM8B 4FDMA 1YC2A 1P0IA 3AUSA 3FFBA 3JD0A 3ZHZA 2JRCA 3QFRA 2C83A 5SYAA 2IYUA 1G6OA 1I4LD 1ZI8A 1KXJA 1QYXA 2ACEA 1XCBA 2C98A 1NR1A 4UU0A 3QHPA 1H3FA 1RIFA 1KTVA 5FBHA 5JC1A 1GL3A 2WG0A 3FMPB 1VGRA 3BCSA 4XIFA 4UVHA 5C1PA 5LXTA 3VR2A 2B2NA 2HX1A 4DYDA 4ZRMA 3LVBA 1CU1A 5JSZB 4DR1B 1KOGA 4CQMB 1WV1A 2PD6A 2Y67A 1QYVA 1LVUA 1PWYE 1QE3A 2Z5GA 4JUAA 4ALJA 5HG0A 3I34X 2NQ8A 3U44B 2J59A 1J42A 4I4TA 4MVJH 2P35A 3GLKA 1SGWA 3A4MA 3QEKA 4GLBA 4M9SA 1VMIA 3R9XA 1KPIA 2VRCA 2GYVA 4YMLA 1DIHA 1L7DA 3L0IB 3DQZA 4Z7QB 4KXVA 1ZRHA 4F2PA 1XWFA 2QXTA 2VH1A 1N0WA 5DTIA 4AMVA 4L5CA 4D5EA 3F2VA 3DT8A 4BFCA 4UEJA 2JKYA 1I9GA 3JAKB 3HCDA 3P32A 4J9VA 4GNRA 3W34A 4F3NA 1C30A 3KKOA 1VKNA 3WMXA 3MM4A 2O2DA 4TWZA 4HBZA 2QRGA 1ZVKA 1F48A 4C21A 5K0LA 3OE7D 1J39A 2X8AA 1W5BA 1GPYA 1RJEA 1SOUA 4RY8A 3VSDA 1OTHA 3W4IA 1TU3A 4NK5A 2PVPA 1XN1A 3PC7A 1GARA 3M1AA 3FVVA 1IRXA 3R3JA 3KJGA 4OAOA 5BSTA 1DAFA 4CT0A 1XTSA 3K8OE 5JSHA 3RYCB 4NXNB 5K3EA 3I04M 4KFCA 1L8LA 3R6WA 1TQ4A 2DBZA 2A5LA 4OQMA 3SX0A 1XAGA 2GX6A 3RC3A 1TECE 4I5IA 1L4KA 1K86A 2ZBQA 4IIJB 4L5IA 4CFYA 2BEVA 1H2FA 4F5YA 2RGGA 4MW0A 3OEYA 1ICIA 1OC4A 1TK2A 2UDPA 1WMEA 3EGXB 4WOKA 1MJGA 1OMOA 1XQXA 4JMLA 4L4YA 2ZQYA 1IPEA 4GXTA 4LF9B 5FADA 1OF1A 2GBLC 5BRJA 4KHPB 2PT7A 1Y6ZA 2AB0A 1D2AA 4TT8A 1E58A 1ZAYA 5FLKA 4FE3A 3UO8B 3WL6A 3HO8A 3P0FA 3L8MA 1CVRA 1WZCA 1SCIA 2FGKA 3IOEA 5FNZA 4CM6A 4EYQA 5CLFA 4TZ0A 1C9JA 3BH7A 3QBVA 3AOGA 2BEKA 1O94D 3ENQA 2V6MA 1TYAE 1CP3A 4EUSA 1QV6A 1YZUA 2X7XA 3QUAA 4FQ8A 5KTTA 2ZM6B 2C77A 4EDHA 2JGKA 3V3KA 4XB2A 5SY6A 3CR7A 1Y82A 2YDXA 5GP1A 3V6LA 1KOJA 3TQCA 1A4IA 4H27A 2I6GA 2JI7A 4JI1B 3NAQA 4DQDA 1VI5A 2R7LA 5KTNA 4U63A 4Q1EA 3BS4A 4YWJA 4AMYA 1JXMA 4G4GA 3IE2A 1Y48E 3ML1A 2ONZA 3JRNA 2FVYA 3QXSA 5K0ZA 3WLKX 1YOBA 2WVHA 4DJ5X 5KVQA 3LC7O 1R8JA 4DUGD 1BCRB 4OH1A 1QG6A 1JQ3A 3PR3A 4H7KA 2NTJA 4MVYA 3ZG6A 4C4SA 3GVPA 1FOEB 3FFWA 3EZ6A 1AK1A 3H0KA 1CY0A 1JV2B 3M6UA 3CX3A 4Q19A 1SEVA 3Q5EA 4J29A 3Q8MA 3IB6A 1W4ZA 2Q7XA 2NYRA 1OXBB 1WF6A 3CNOA 1XVAA 3FIJA 1ABEA 4NCBA 4KE7A 5JBQA 3L0ZA 1A69A 1IHPA 1V1RB 4NHEA 2IT1A 2ZG6A 2XKJE 1FYEA 1MEOA 2E2WA 4Q93A 4MSUA 5LQUA 4EY8A 1T9ZA 3NDBB 5LQRA 2QOEA 3DE3X 2ON6A 4KR9A 5IM4F 1GIAA 3M6VA 1TLFA 1CQJB 3NNNA 3RUAA 2CVFA 3QVUA 1X1BA 4HNTA 1DQSA 1I7LA 3GWGA 1TQ8A 4CKWB 3QA3E 3HWWA 3V4ZA 1M9NA 3SR0A 1I14A 1EZ4A 2P5TB 2QAGB 2VF8A 4H0NA 2DERA 2FEMA 3TEMA 2RH5A 1DC4A 1L5HB 2A0FA 4WA7A 2C31A 3V8MA 1CJKC 2JFBA 4G4JA 1BE8A 2RHJA 4OKIA 4Z9FA 3RU9A 3KQLA 3F6CA 2AMFA 4AQYB 2QVBA 2V98A 1OFTA 5JAPA 5LMUB 2IPXA 1P0FA 1KORA 3F97A 3VHXB 1Y98A 2XIQA 3KYDA 1ZZGA 5LZ5A 1LU9A 1T5BA 3M2TA 1IJFA 1NUAA 4L15A 4OVKA 5I7FA 2ZIFA 3BCHA 4RVOA 2JLQA 1M2VA 2VKQA 3LBHA 2E55A 4C4OA 4PF1A 4EG1A 4WXYB 3GEDA 5A0FA 4UBOA 3PRHA 1JFVA 3CUUA 1V8BA 1UJMA 3A11A 3CGGA 2QD4A 3MAJA 1WCV1 2R97A 4HZGA 4CN8A 4QUGA 4CI9A 5JBNA 1K8RA 3BHIA 3MT0A 2BV3A 3I8XA 3NIGB 4XUCA 4DYHA 3UXHA 4RSGA 2JLRA 1Z7YA 3LHKA 3ZWOA 1KEWA 3FYUB 3DOJA 2BFEA 5ALOA 3TW8A 3VO1A 1C0LA 2JJ8A 5LM3A 4G25A 4QJ3A 4CQMD 3KSRA 1WMFA 2Q46A 1IBKB 2NUAB 2QN3A 3P9XA 2A4MA 5CCDA 1LWNA 1ISHA 4HNGA 4Q9NA 3DA8A 3EVAA 4RCVA 3AI3A 2I2DA 2WKQA 4EELA 5B53A 4YUAA 2FK7A 4LBZA 4EVIA 3TMYA 3MOIA 2VAVA 4DUZB 2AUNA 5B12A 5HDQA 3WRYC 2IXFA 2V97A 2NZWA 2Z08A 2ZI9A 3PUXA 5F5NA 5K3BA 3SBOA 3DUWA 5L4SA 1OI4A 1QKIA 3TAXA 1IEXA 1SC6A 1GR0A 2R751 3MRXA 5T41A 3RVMA 4FNOA 3LE8A 4UOEA 3ZD8A 2F8SA 4XIJA 5IXYA 3K05A 4QOFA 3B6KA 3E22A 4HTFB 1PLJA 4OU4A 3ZY5A 4FNAA 1UIRA 2ALJA 5K4AA 5K51A 2FMTA 1QNFA 2FOLA 4BBZA 3SHTA 1GU1A 4DWOA 4EJ6A 2CZCA 1G64A 2IY9A 4OK6A 1KS9A 2XUKA 3WL5A 3FZGA 3JQ7B 3VTFA 4DR2B 4ZI5A 2ZU0C 2Q6KA 3FLEA 4EJSB 2Z43A 4DA9A 3ZKWA 1CJVC 4FYYA 3A6JA 3AL3A 4OBXA 2XTMA 1U6JA 2DLDA 121PA 4XZ3A 3UGQA 1M0SA 3AUUA 4R4JA 5JMPA 4LIPD 3WQSB 2WJYA 1GZ5A 1M34B 3HDJA 4IL5A 3KS9A 3MTQA 2OXIA 4M9QA 3WR5A 2PGLA 5ARDA 3PZBA 3WV4A 1BGVA 1GG5A 5IG2A 1VYTA 2YIJA 1S6YA 2OFPA 1CQIA 1Q74A 3KPVA 4QPCA 2FN4A 4I8IA 2UYCA 3R44A 2V55B 1P7CA 4R1MA 4GSYA 1ZRMA 1JDZA 3VR6A 3D4LA 1DWQA 1FNDA 3G88A 4IBOA 1DRKA 4DMLA 1G8PA 1KI9A 2QIOA 4MB6A 4TXLA 1PL7A 1ZUIA 4PFKA 3QKWA 4ARSA 3KALA 4QDTA 1AB6A 1W76A 4QYWA 1JDNA 5AK6A 5DI3A 3TSZA 3UMYA 4PGMA 1KDZA 1WTCA 2AEMA 3QPCA 4PQFA 3WX0A 3TZCA 1RRCA 2X6TA 2PLFA 3N0VA 5JFTA 4YLYA 1KSHA 4XCXA 3IDOA 2VDPB 5AKGA 3U13A 5KB3A 3G8BA 1KHHA 1D2NA 2E18A 2QN2A 3D31A 1XZ8A 3I1YA 3H2KA 4IXMA 4JL6A 5TPWA 4DSOA 1WSWA 5BSVA 3ESXA 4FMCF 1AMNA 4MV6A 1R64A 3FJYA 1IZZA 3OURA 1OYYA 1OT5A 1WDWB 3ZD7A 5CB8A 1RZRA 3OUZA 1Z4OA 2NZUG 1PFQA 3A1VA 2WMDA 1F0PA 3B1XA 4R3UC 2WT8A 5CA1A 4ARCA 2Q29A 1ZEJA 5BY2A 1GNLA 3ZK8A 3A9WA 1LB1B 4UTOA 1G60A 1JG2A 1GFIA 3ENVA 3AF3A 1POXA 4INJA 1V35A 1ZMXA 1V39A 1Z2NX 2OCKA 1C50A 2PZFA 2Q3LA 2WYHA 2Z56A 3JYQA 2BM9A 3CTMA 4A6EA 5LXTB 2W2PA 1H4TA 1SMKA 3FUXA 2C4TA 3HJNA 1GPH1 3VZQA 1U02A 1DDOA 1L4YA 1T5HX 4AG6A 2WU0A 3HB4X 1UJ2A 4PLTA 4YJ3F 3GGJA 5BN4B 3H4TA 1KMCA 4ZOEA 5KC9A 2P9GA 5H82A 5EKXA 2XB2A 3STTA 3GEBA 4G9GA 3KSAC 2GD1O 1N8TA 2G72A 1FFBA 3KLPX 4YJFA 3P9RA 2GH1A 3INYA 5KMGA 1JJFA 3C3MA 4ZVUA 2ZBRA 5H3HA 3L1VA 3ND6A 3R9XB 3AHJA 3SWWA 5AVYA 4XKJA 2NXWA 2EKQA 4BB5A 4NV0A 5MFPA 3PNYA 1KC1A 4N0EA 3KR9A 2QT9A 1OFHA 1FSSA 4L7QA 1YZNA 2BHTA 3P0IA 4GL2A 2QZ4A 4QUBA 1C30B 2QTAA 3GC6A 4RPIA 3X1XA 1RJ9A 2OL4A 1LDMA 3G49A 3FCEA 3KJHA 4IOMA 3RS7A 1C8BA 4LRWA 5EY5B 4LSGA 1RLIA 4KO1S 1GPAA 4EY5A 4DGSA 4CMHA 4NG4A 4KVZA 3SYMA 5CTAA 3OOWA 4RWEA 1XJQA 1ZD2P 5AT1A 2QLLA 1MV5A 4CR7A 3LRXA 4RLFA 3V4PB 1B6SA 4U7JA 2GFIA 4DCGA 4K88A 4EG4A 1A72A 1CY6A 2XAUA 3IQZA 1KR5A 1V16A 2GHRA 3B1YA 4YFYA 3SX2A 5DEOA 3DNPA 4MR8B 1XEXB 2GM5A 2J3KA 3QM1A 2EAUA 3SSMA 5L6MB 3V8VA 1CRWG 4GPZA 5EE3A 3SJAA 2IS1A 3LG2A 2FXVA 5ILQA 3D2CA 3EGOA 3H97A 5DYYA 4G0OA 1H94A 1MD9A 3GLUA 1ZK2A 3KLOA 5SYNA 1FVFA 4OUDA 3M5PA 4O08A 3UJPA 3EZ2A 2PX5A 4PYNA 2VYVA 4WY2A 3WY9A 2G09A 3THWB 1UH5A 4JYBA 1JYFA 5DGDA 5J4VA 2WWRA 4UJ5A 4OSPA 3VC1A 1Z0SA 1XTRA 3D4IA 2QG6A 1G3RA 2JKZA 1LJLA 4WLVA 4N0PA 4UKDA 1JHQA 7REQB 3NWPA 5BNFA 4HWSA 4NJMA 3WBJA 5HTKA 3RG2A 1YDMA 3ZU2A 1DKQA 1E3TA 4C22A 1NQWA 4R6XA 1T8SA 4M0LA 5JS1A 1XVVA 2XUHA 3UMRA 1RWWA 1YU9A 3AIKA 2H59A 1RFGE 3JATB 1KIAA 1Z2CA 4P8RA 3AHFA 4IW3B 2EZ4A 3AG6A 1H5NA 3LA6A 2CZQA 3L8DA 3C87A 3OFSA 4GIBA 4JLNA 3ZI0A 4ZGBA 3TUZC 3KKNA 4KN6A 1AX9A 2Y9PB 1FC0A 1MIOB 4RD1A 1YFLA 2QU8A 1G20E 3I2IA 4HWRA 2W2XA 3U4HA 4ZJZA 4HFJA 1VA5A 1E20A 2XGMA 3KWFA 2P9EA 4H0CA 5ILGA 1L9KA 2BFDB 3G0DA 5CGQB 5COQA 2CZGA 1PV4A 3SYLA 1S89A 3ZHYA 4LHVA 1UCFA 2AN4A 1EDDA 2C7RA 3H04A 2XKBA 3QFCA 1LTQA 2HO4A 3JZDA 4DM4A 2CB9A 2FZWA 3LXXA 3WWEA 4D3DA 4FZ3A 3V7WA 1ZIXA 4PNPA 3ZGOA 4R8VA 3IAM1 4A5SA 1NI3A 3SEZA 1EK5A 1IM5A 3DBRA 1Z9BA 3F9IA 4KPUA 4ZOQI 2AZXA 3UA3A 4L9RA 5T8KC 4G63A 2X4IA 4IQ8A 3DLHA 3FY4A 3V7NA 3CZCA 3STYA 3GOHA 3F7OA 3JWJA 2VLIA 4AZVA 2PL1A 4HWKA 4G5RA 5DIFA 1TVEA 2RBGA 2C7OA 1XYGA 2OGZA 4WERA 4EZIA 1UDBA 3N75A 3GP8A 5BV8A 3ZXYA 2W6JD 2PUCA 1TQHA 2FG6C 4J1QA 2J33A 2OGSA 3ZHUA 5CB6A 1W0CA 3T1TA 1CNFA 5AHRA 3CNHA 3RSQA 1V0JA 5K45A 2JIZA 1QCYA 3F8WA 3DJFA 2CXUA 1C3OB 3GDWA 1ZIDA 4P7BA 2HV9A 2OCGA 4Q05A 1NP7A 4ZXFA 2XPCA 2HR1A 3H5TA 1YRLA 4MI9A 1R6BX 3DAFA 3FNHA 3KYDB 4PZUA 2XQGA 1ZNZA 4NDZA 4S0ZA 1G7TA 3MCVA 4E5VA 4PAQA 4Q82A 2BHRA 5F51A 3VR5H 4N41A 2OFOA 4RY0A 1M2VB 2HU2A 1VKJA 2ZPAA 4L5YA 1VYUA 5HZMA 2XYQA 4DCOA 5K2MA 1NJ5A 1QFYA 2AMVA 2QJFA 3SVTA 1QIKA 2XYHA 1VBMA 4OP1A 3PXUA 5FBKA 1K2WA 3D7SA 1FTWA 3DOIA 3GRAA 3LKBA 1KEEA 2G5TA 1JI3A 1L5FA 4H7JA 1VLQA 2C4KA 2VJCA 2YCLA 1P81A 4NC9A 3X1KA 5GVRA 2H2IA 5DHFA 3I5XA 4Y2PA 4BVKA 1F1JA 2I33A 2X2FA 4AMZA 4RIEA 4ZOAA 2B4TO 2CMHA 1QANA 2QTBA 1GZDA 3TW8B 2EG5A 1QGAA 3SGLA 3O82A 1WQ1R 5I5GA 1MZPA 5EPUA 3RK4A 3RODA 4A2QA 3ZE9A 4F12A 4TLDA 3ETLA 3V2HA 4G0ZA 4OGFA 3F74A 3VI3B 3L07A 4BC1A 4JLBA 4GPTA 3I61A 2OD7A 4JR0A 1ODCA 3ISJA 1Q91A 2HU7A 1ONBA 3PNSA 4PM4A 4R40A 4KB5A 1T0IA 3HCWA 1ULSA 5C9ZA 3OQ6A 3EAGA 1LRKA 1IUNA 2GCOB 4K9RA 3C6YA 1JEDA 3PUZA 5LOVA 3VVCA 2YR0A 4O4IA 4AJOA 4I50F 2Y68A 3DHNA 2AA3A 3PFGA 4JROA 1V5IA 5EXTA 5I01A 4V03A 2I2XB 3E22B 1UBUS 2HFJA 4QOGA 3RC9A 4ALNA 1MB9A 1Z33A 2IL1A 3A25A 2JHFA 1NWCA 3T5GA 3H87A 2OO5A 4JU8A 2VHJA 2JFYA 3PL1A 1VFPA 4I5GA 3N8KA 2WBLC 3PCRB 4JAVC 3GN2A 2FMUA 4MKRA 5FKJA 1TFUA 3WLIA 1K6JA 3N5KA 4TXHA 4EB8A 4HXGA 3ZKWB 3AB3A 2GPYA 3QI7A 2XBUA 2WI8A 4URHA 3RHFA 1WB9A 1VLJA 2CWWA 4P36A 3A4TA 3MJEA 5JZSA 1Q57A 1M67A 5E7QA 3KXLA 3O1JC 4YREA 4KTVE 5ALXA 4BMYA 1G7RA 3LU1A 2D1RA 1FFEA 3F5SA 4Z9YA 2DQZA 2HRCA 1MTOA 1SN7A 4RA6A 1COWD 1R9JA 2L82A 4K9NA 4NEGA 2R87A 5CD1A 1PJTA 3O8CA 1EHIA 1BXKA 1CQIB 2QQ5A 4FDVA 4UPVA 4AKHA 4EPRA 5LQKA 2A9VA 1QNLA 4IHJA 5F12A 4NICA 1JSZA 2WSSA 3UJBA 5IT5A 3IBTA 3AZPA 1CUHA 3AM3A 4EUEA 4KRFA 4DJFC 5I3CA 1G5RA 1GJRA 5DI3B 3CVJA 1XLWA 2FF5A 1XCOA 3IXLA 1V8FA 3H16A 4Q3OA 3ZYZA 1FRQA 2HNKA 3NOOA 4FDAA 4KX3A 5IC4A 2XDWA 2R4QA 3O8OA 5LIRA 5LWQA 1Y81A 3O93A 4G5OA 5EHIA 4AMBA 5M2QA 3JWHA 4QECA 3IBSA 4AJPA 1H65A 1U7XA 2RKWA 3ABRB 1UDXA 2K87A 3RVQA 3X1JA 2ZZKA 1C1DB 3C74A 3LWDA 5IBRA 1IBSA 5JC8A 4ZWNA 1TC2A 4HB3A 1TTTA 3SXPA 2P3OA 2XCIA 1Z4LA 2YRFA 3GAAA 2D2FA 4NBTA 5C81A 2QLBA 3IOCA 5B1IA 4NZZA 5B58T 3T1HB 2EFDB 1E2GA 2AX3A 5JG7A 1CERA 4Y3UA 3VPXA 1XMPA 1NBMD 5EYPA 4YK7A 4DRXA 3HFRA 1GITA 3QJGA 4I7EA 4D9JA 1Y6FA 4UD6A 2XNHA 4IWYA 3G2LA 3W04A 3L7AA 2X8LA 1Q1EA 3V80A 5A4IS 4TUYF 4EKYA 1ZM4A 5BUCA 2GN8A 4EGCB 5TJ9A 1YZQA 1V7PC 4Y2UA 4JI4B 1G63A 1N4DA 2Q1WA 1FXWA 5F64A 5TLSA 3U40A 1SG0A 2PFKA 3L0DA 5EXXA 2YTZA 5AVXA 1VIYA 1G5IA 4PZCA 4YO8A 5B1SA 2TSYB 1XCPA 1VG8A 2H7CA 1M6NA 5K9ZA 3LK6A 1F7VA 4YJFB 1HK7A 1UJ4A 4QUAA 5K6TA 5KMGB 2I91A 2CLDX 3IB3A 1PBNA 4G4IA 2FRVA 3CRQA 4QRHA 4RE6A 3TLJA 2I76A 1E4EB 1S2DA 2QL6A 3RSGA 2GB4A 1ODLA 4TM8A 2LD4A 3KAPA 3SLKA 3VJLA 3H2YA 4X97A 1UUFA 2ZRPA 2JFFA 3A6GA 5EKUA 5COBA 3CURA 5FFMA 5EFZA 5JNWA 3ER8A 2QGFA 4KQJA 1BOOA 1WCWA 1ZRNA 1TK3A 2JJMA 2PR2A 3NH9A 3Q3VA 4BKRA 2VJYA 2GN0A 4NZYA 3ZHVA 1Z15A 5C1IA 4FEYA 4OGGA 4BMXA 1RXIA 1Z2EA 2F62A 3OFKA 1KY5A 4G2TA 5BWCA 1L5NA 2AG6A 2G83A 4YDRA 3RUDA 3LY5A 3MIZA 4Y6QA 1EK6A 4FIDA 3OT5A 5DX1A 3UC9A 3FUWA 4DUYB 1RXWA 1GTRA 3CVYA 4YTEA 2DHEA 2JH8A 1G59A 1P75A 5FTNA 3DEHA 4FFNA 2J0SA 5A62A 4XM2A 1G291 1TLLA 3ADKA 3NRJA 1V16B 4N3GA 4RVSA 3TR0A 4EUHA 4YAJA 5A2GA 3KQOA 2Z3WA 1JHXA 2RG7A 3WMWA 3KTAB 1E7QA 2QMZA 4KJXA 4W5JA 2CJFA 9LDTA 3L06A 5KTMA 1EKXA 1XU9A 4EMSA 2Y27A 1AY0A 2I99A 2O8DB 1E66A 4NCAA 4YI3A 4NECA 3BQMB 5KOYA 4K3UA 1EX6A 3LYAA 2X7JA 2ZUCA 1N2IA 1NJFA 4IMPA 1U2RA 3EW7A 2ZXFA 1NXSA 4OUDB 5HFNA 3KBOA 3USES 3BIFA 1GPDG 4E14A 5J4HA 2Q8PA 5JTUA 3IBFA 1KZHA 2BUAA 1O5IA 1HG1A 2G9ZA 1F1BA 4X7MA 3UK2A 3WGVA 5DPMA 3QF7A 2VQ6A 4S1PA 1Y1PA 1M5UA 3RF6A 1NVVQ 3LRTA 2YJZA 3PQ8A 5CHYA 3HB5X 1PV2A 3IT3A 5JDIC 4NJMB 2J6CA 3GMIA 1OZ0A 1UP6A 1ZK0A 4B48A 5FWYA 3I5MA 4O8CA 1NLUA 3D3JA 4JLJA 3RYHB 4EI2A 4JI2B 4BCCA 3QE2A 3TKAA 1BWPA 1F0NA 3GB9A 1ZD8A 3LT4A 3N0WA 3PC8A 3PI7A 3RAFC 2E5LB 3QXCA 2Z5FA 3KUUA 1HI9A 1PYGA 2M1ZA 2Z09A 1UQRA 5BNWA 1Y8RB 1GO2A 3GVIA 4B4WA 4H6PA 4YCDA 2W4QA 1NATA 3C16C 3KAQA 1DINA 4BV8A 1I5RA 3K16A 4RVCA 5BV7A 1V4VA 2GBCA 3NHSA 4Z9AA 1FP4A 3DWEX 5IH3A 1HDZA 2C03A 2CYAA 2ESRA 1KPHA 2YXLA 4HLDA 4Y2TA 4F86A 3FPSA 5LQMA 1EVIA 3EMKA 1L5SA 1DEKA 5CGZA 1N0VC 1FFXB 2CUKA 1LBTA 2TMKA 2PO7A 1B14A 2X14A 5AO9A 4D4HA 1L4NA 5HM6A 3A27A 3I72A 2O7SA 5TMPA 2FWBA 2ZJAA 3A1TA 1WUJS 5BVGA 5ES3A 4MVXA 4Q3LA 3C7DB 3K8QA 4O3MA 1LTKA 5E6UB 1RKBA 3KZVA 4NH0A 5JCXA 2Y2VA 2EARA 4DKXA 3IEUA 3RIHA 1VA4A 1MRSA 2E3JA 2I65A 1FP6A 3PBKA 1TF7A 2VNJA 1A9PA 1D4ZA 5F2NA 5KTYA 1M8FA 1JEQA 2C5FA 5JCJA 1P4HA 3L1IA 2ZDQA 2REBA 3KKKA 3C8ZA 5F4ZA 5FAKA 1RR6A 4LMAA 1Z5OA 5EMKA 1E2KA 4GECA 2HJHA 2IHVA 1YIDA 4NBVA 4U3JA 5G1OA 3TRIA 1EXWA 3TXAA 3BK7A 3U09A 3PLAE 4PE5B 1GCIA 3E81A 5DLYA 3D6JA 4CGZA 4FLMA 3LTNC 3RIMA 1T6BY 4FDUA 4CDNA 2AI2A 1DBRA 2HHCA 2WKSA 3L8EA 4XAQA 1JVBA 4KYIB 1GKLA 2NTYC 5JANA 1NP6A 3A6KA 3D8NA 3DAPA 4ROTA 3SM9A 4EMUA 4KGZA 1KEEB 2J45A 4UE6A 2IBMA 2W98A 1EINA 1Z4NA 4LRSB 1NSTA 4GUDA 4LYJA 4YB8A 2COEA 3PGA1 4ZOBA 4DVJA 4EHAA 3B70A 2B6HA 1L4GA 4PPFA 4GC5A 2Z98A 4AZ3A 4R5HA 4D98A 1BHSA 3ACBA 5J1TB 2X0IA 1E9DA 1T1EA 4OFXA 1IZ0A 1W0JA 1GP2A 2DPXA 2FPOA 2GWHA 2WKWA 3DDCA 1ZD9A 3DL4A 3AUYA 3HFJA 3ND7A 5I45A 5KNDA 2G1PA 4K6FA 1EEXB 1XNRB 3H6HA 3G8CA 3GYGA 2CNWD 3F7MA 1KMQA 1F38A 2VJAA 3JSXA 2NUBA 3CUTA 5BWMA 3VJRA 1VL6A 2OCLA 4PYOA 4LZAA 2QBYA 1KY2A 2ZYGA 2HSDA 2AYYA 4BJ3A 1OVMA 2HY7A 3MJCA 1NIJA 4Q18A 3GZNA 4Q7QA 4PAMA 5LOVB 1C7EA 4C0LA 1J06A 1W6UA 1NRXA 1PBTA 1S1CA 4H15A 1CUAA 1OX4A 1Y3IA 3BGSA 1F9EA 2PGIA 4R2LA 5A06A 1UEXC 4P58A 5JEDA 1NUSA 1H2EA 3GFPA 3QKSA 1Z0FA 3B38A 1XEFA 2RK6A 3UOWA 4MR7A 4R0NA 1E3LA 4QYIA 1NGSA 2CLLB 2C7BA 2JD2A 2YOHA 3CJRA 4HDSB 1V71A 4QQ8A 1QYCA 1CHDA 2XB9A 1R4MA 4EMTA 3W5BA 4XJVA 3R5SA 5AW0A 4FZ5A 4BBPA 1WMBA 1P1JA 3UMJA 3OEED 2QRVB 1PWHA 1ETUA 2P3QA 1HKHA 1Q2XA 2OBNA 3LP6A 4K87A 3QK7A 4N9QA 3VNQA 1AKMA 4CG1A 5AW7A 4US0R 2W6MA 3AJAA 1R3DA 2Q1UA 4J1SA 4IH4A 2ZUEA 1B6GA 1O4WA 2ONCA 1TEHA 3VR4H 2V0CA 4R2WA 1JQ5A 4E5SA 3LXRA 1PUXA 1ZIOA 5DYNA 1Y8ZA 2O8NA 1QJCA 2ABWA 4A3SA 3G5UA 1BKDR 2W2KA 1KIMA 4J0IA 4GX2A 1Y5NA 3HI4A 4PRLA 1L5KA 4BL5A 3TNYA 3NHMA 1R0ZA 5IJ9A 1ZMRA 4E08A 3LDGA 4GZLA 3MJRA 2XUZA 4ZYUA 5F1KA 4FEGA 2ZANA 3E2MA 1X94A 4B6OA 4U9HS 3BB3A 4MDHA 3RM3A 4L8LA 5ALZA 2HJ9A 2ETXA 4LZZA 1E96A 2W2OA 1QIFA 5JD6A 4FYJA 3WMRA 2SKCA 2XSZA 3B9BA 5GGYA 3UWMA 5FOWA 3OE5A 1U2GC 2FXIA 1Z3IX 3TW0A 3F5QA 2WDPA 1LSJA 1OU4A 3IP3A 1GQFA 1VI2A 3LCCA 1XALA 2FE4A 4JP1A 2NSJA 1CDDA 3GVCA 2VJOA 3EC1A 5EQFA 4DLTA 5BSFA 2MMCA 3HC7A 4ZZ3A 1FNSA 3AEUA 2AR0A 4G8JA 3QUTA 1I33A 4ZV7A 3PVCA 1XBTA 3B60A 3KQYA 3UM9A 5DN6A 3E9EA 1APBA 4MI1A 1CUFA 3AJDA 3WAKA 1OGYA 3WQQA 4GI7A 1W9HA 4CGYA 1PWZA 3EVZA 3GA7A 2PRIA 2VDLB 2ZT6A 1QKKA 3T9DA 1Z06A 4KO2S 1KH3A 1XQ1A 3E9DA 4RZ2A 5LZ9A 3RUIA 3IP9A 2L42A 4RF2A 1E5VA 1ADGA 4FR0A 4KE6A 4QDJA 2HEGA 1NDQA 4WBNA 1Q0HA 3IEPA 5EYPB 4JYMA 1L5GB 1YE8A 4DRXB 4F92B 3PC4A 5I7SA 3LKDA 4YAIA 2X4LA 1SUCA 4XWOA 1JU9A 2W0MA 2D1FA 4JLPA 4Z0TA 1KMHA 4V38A 4NCNA 4WFIA 2XGOA 3GLRA 3KL2A 4C2UA 4A0HA 2VUSA 2AN1A 2YMPA 3DB2A 1EFPA 3Q10A 3QPVA 5TGZA 1HE2A 3SKYA 3MXTA 2PZMA 5JY6A 4B8WA 2D4AA 2O2GA 2NU9B 1AKRA 1M83A 3EQ6A 4QOSA 4HO1X 4M0CA 3KPUA 3QNWA 3LUAA 3EF0A 2GYYA 4K9MA 3O0TA 1FW8A 2V7WA 1SKYB 4ZODA 2QLTA 3C98A 2CWDA 3H9JA 3G2IA 3DGEC 2JAWA 2W7TA 4Y18A 1U0GA 1CR4A 2HTFA 3PUYA 4WK0B 3WKBA 3IX7A 3ORFA 4IEFB 4AO6A 3IIJA 2NSDA 5IJZA 2CXSA 2SBTA 3I9V6 1YSCA 3KYIB 2QP9X 3D6VA 5DV9A 5KJEA 4I1PA 4XVQA 1P2DA 1USWA 1OE0A 2AD5A 2IYZA 1M1NA 2NXNA 1UPBA 2OHGA 2VYND 3H0CA 3OQ1A 2RC6A 4NG5A 4Q4LA 4BTEA 2C57A 3FROA 4I5EA 1R8XA 3MNFA 2XRMA 1M54A 3K94A 4J91A 2BOVA 4F97A 1J7KA 4GI5A 4PO9A 4ZI7A 4I19A 4RD4A 2O05A 4LDZA 4QGGA 5DBFA 1I24A 4REQB 3RPEA 1NASA 2ZIXA 1OUMA 2ZRBA 3K9BA 3GOQA 3JY6A 1KDTA 5BN3B 5TF0A 2NT4A 3G0CA 2HMSA 3C1TA 5A7HA 4Y30A 3GPBA 3EYAA 1VPLA 4BZWA 1JG4A 1BFUA 1P4GA 1CVIA 4UCQA 5J5VA 1R4AA 1ZBDA 4HUQA 2H1LA 2WPDD 4Y2GA 3UATA 4X24A 3VNUA 3HVHA 2H65A 3DXZA 2K2WA 4S1OA 5T4FA 2W43A 3G2PA 1SZDA 2Q5HA 3F7TA 4CKYA 5KYNA 1DXQA 4BXOA 4QX6A 3IUJA 2FR1A 1U7WA 2YHIA 3HA3A 5AOCA 3W3ZB 2YV5A 3CWZA 2ZWVA 4CFSA 2PG3A 2O3SA 2UYGA 3RU2A 2FLKA 4DIBA 1FB5A 1UJ6A 2L19A 2I2CA 2PSSA 4Y9SA 4B40A 4DV0B 4ZV9A 3O9ZA 5ALLA 1NR7A 5T4BA 5FWYB 3UYKA 3NETA 3VM6A 4B31A 5J47A 4G1FA 1SUEA 3D64A 3A1FA 2UXDB 3LKZA 5BRAA 5LZ4A 4B3XA 1KI7A 2FUG6 5KBYA 3SS8A 5CITA 4IJKA 5SZHB 2G4LA 4K9QA 1XTJA 5IBQA 3LPDA 4BHTA 4CTMA 1F7UA 3NBUA 1RQ2A 3NHRA 1PWEA 4BJ5A 3S29A 4KR6A 4B6GA 3DAOA 3GPIA 3GK3A 5DYWA 2FWRA 2IDZA 3PA8A 1MB3A 4WXMA 3WG9A 3UBMA 3RRMA 3GAZA 2K7FA 5L40A 1CLUA 1VIVA 4MUAA 1FP4B 1P2VA 1YBHA 1PW5A 3L3BA 4MK4A 4N47A 4AICA 4DDKA 5K4GA 2WHEA 4R7GA 4EPTA 5IZCC 1QCDA 4EOGA 4F4DA 5AVSA 1DLIA 1HLFA 5INTA 2GZSA 4ZCIA 5F76A 3COPA 2OY0A 1EA5A 5A3QA 2QPAA 4G0MA 1LK0A 4WN3A 6GPBA 1PGPA 5HHTA 3DZFA 3MPUA 1NM5C 1DXOA 5KYWA 5C4MA 3S1SA 2MU1A 3FBWA 3DZIA 3A9UA 3LYUA 1RYHA 2ZP1A 4CU5A 2JFWA 3LQ4A 5GINE 1Z8HA 4XA8A 4A15A 4AJIA 4MA5A 5ANRB 4URZR 5KJFA 1BZYA 4LF4B 1GUFA 4NSNA 2VRBA 3OMWA 3PE3A 5DHAA 3U7IA 4DCCA 5LA6F 3OPQA 2R0QC 3X44A 3LDAA 4HJXA 2WM8A 3MINA 4CTJA 1ESDA 2I34A 3ACCA 2FQ1A 2FR0A 3RKRA 3FD8A 5JI2E 3KWMA 2HMTA 1FFAA 5HBGA 3ZLJA 4AT1A 1FDTA 2OG2A 3LUCA 2BSQA 3L4EA 5AUQA 4MYTA 2MR6A 3CLRC 3PEYA 3RTCA 1I1HA 2QNIA 3CO5A 3O4RA 4EHKA 2ODEA 1Z0DA 4P08A 1YJ8A 3PHBE 3LBYA 4URWR 3SFTA 3VKVA 5JFGA 2LCIA 2B98A 1PSDA 2PWBA 1FEZA 3DT9A 3EXEA 2VQDA 4NMWA 4YNBA 3CT4A 2RSLA 3NTVA 4E12A 3KHTA 1DIGA 4YJKA 5A3RA 1RLOA 1U3VA 4N5HX 2B21A 4YWHA 2G06A 5ALNA 4AZ3B 4GRAA 4UATA 4BQNA 4V3CA 1NE2A 5AM3A 1Q0ZA 1XVIA 3AZOA 4ZZ0A 3AUXA 3ROGA 2Z9CA 4NE7A 1EXNA 3UT0A 5IBCA 4EARA 1O89A 1BA3A 3OZTA 4OXRA 3I23A 4F93B 3AIMA 3OZSA 3TAUA 3WSVA 2QJWA 1I1QB 2AH5A 2AMLA 5LN1A 4KU4A 4C4RA 3UCXA 4Y9DA 1Z6YA 4WGFA 3CU5A 3HCAA 1XXLA 4R68A 2FVXA 4EGQA 1ODIA 5CDFA 1Q7EA 3EFHA 1UFKA 2ZVPX 2AOUB 3HSKA 3GXBA 1YJCA 5DHUA 2I62A 3KZMA 3SSOA 1OX4B 2ENWA 1HLDA 1MBZA 2I4TA 2QUAA 3AHIA 4TTPA 3K1TA 2OBYA 4Y1RA 1MC1A 1NN0A 5TXGA 3QKSB 4D99A 5CFNA 3M4XA 1G8FA 3ES9A 2DWQA 3LC0A 2CBZA 5FFFA 1K68A 3TRDA 2XOEA 1AF7A 2X9NA 1QRUA 2PQ2A 3FA2A 1XCMA 1XRMA 2RHBA 4C4YA 4HTAA 2QRZA 5HCUA 1KK3A 2QTWB 3Q98A 1U8AA 2NX2A 1SC1A 4J2HA 1NVMB 3R4CA 4JX8A 1TF2A 4WLUA 5IS2A 1M1ZA 4KIWA 3HKCA 5IJWA 1A8PA 3CG4A 4IS3A 3F6RA 1K7EB 2GNAA 5FUQA 4Z53A 5AVJA 4MUXA 1IHOA 4BWVA 4K0KB 2R6HA 1BHO1 3DZCA 4UNRA 2WSBA 3D6TB 1X38A 2AE2A 3MJDA 5C4IA 2W2KB 4PO3X 1GZ6A 1DNPA 2WOOA 1SCKA 5IJ9B 1RYFA 4K6GA 1FRZA 1GPKA 3HSYA 2ZSKA 4MAAA 3RANA 1VKRA 4ZK2A 2Z8YA 4G89A 2VI5A 1SVMA 3RNLA 2CK3D 3BL5A 3ICWA 1RHRA 3EASA 2OCDA 5ALSA 4QZVA 3W7VA 1LVGA 3C7TA 3L8HA 1T1RA 2P6NA 3AVQA 3ELBA 1K4YA 5GZ3A 1XD2A 3QBJA 1AUQA 1DAOA 2FWPA 3N6VA 4KPYA 2C5AA 3EWIA 3QFTA 4HRAA 2OUKA 3I52A 3IPAA 3EQ2A 3KZXA 3MHPA 3QVJA 5DHTA 3DBHA 1XZPA 4K9LA 2A0KA 4QEZA 3AEUB 4F0JA 4UUAA 3IUSA 3PGXA 1GEEA 4S2EA 3SOPA 7ADHA 5LU9A 1K5DA 1KKLA 5CYPA 3GL9A 2X1HA 3A6FA 3PJGA 4N3AA 4Y67A 3RUFA 3VR3A 1UBGA 4AXBA 2Y93A 5AJTA 4PAOA 3RGWS 1U5AA 3DOFA 1M75A 1UT6A 1Y1LA 2WTNA 3DFUA 3R6GA 4LISA 4QXQA 3U3DA 4YT4A 3DYBA 4ZI2A 4TS9A 1J56A 3GLFE 3MFYA 5AHOA 1E5LA 3WRVA 2CYCA 2PUEA 4WBNB 5BN3A 3G5AA 1LBQA 4RIFA 1AKYA 3I9KA 3T0GA 4FJ0A 1TXGA 1A7AA 2RIRA 1SELA 2HZ7A 2B1RA 1SD2A 2IC5A 2P27A 4DIDA 3FNBA 2ZREA 1YS9A 3SC2A 3DEAA 4G1MB 4N5DA 1WZEA 2AFHE 3NV9A 1E2EA 3M1LA 1VPTA 4CTNA 4L3OA 4DLVA 1LBSA 2JIPA 4MHSA 3IQGX 4HDQB 2HKIA 8ADHA 1KWGA 3SJUA 2V7EA 1K2VN 2NV2B 1G9XA 3NTQA 3UV3A 4LXGA 5C8YB 4X95A 2FAXA 1FMLA 4RJLA 4CQLB 3WP1B 5D5PA 4ZT5A 4BO0A 3UGJA 4ED9A 2Z95A 2LRHA 4MV0A 1KPGA 2OV6A 3II6X 1GSIA 1PJCA 3OZWA 4R1OA 3TD2A 3KVYA 3AMVA 5C32A 3FYHA 2FPMA 2YY6A 3JQBC 1CY4A 2OE2A 4OO3A 4RVHA 5CUQA 5AJHA 4I55A 2IA5A 3BM5A 3CIOA 4KBFA 4UE2A 5CMLA 5GTDA 4YHHB 1GZ3A 1I4DD 1UWVA 2ZU6A 4KH1A 1M1NB 4HBGA 4GLJA 1DEHA 3MK31 3QWAA 6REQA 3ZWXA 4RV9A 5KKNB 4P3NA 4IGAA 5HE9A 4U2GA 3REQB 2HSEA 2G7ZA 2VH2A 1O8BA 1OZFA 3I9LA 5E1MA 4ZI7B 1F14A 5CU7A 3JZAA 2GF0A 2OA0A 1R5OA 1XEAA 2JZOA 2NO4A 2QT1A 1O8CA 4YRBA 4N03A 4ZVTA 1H9AA 1XMSA 2FWJA 1JLSA 4WADA 3EXG1 3EQ9A 5IN4A 1WBBA 3BWDD 2EKPA 5IP5A 1G8HA 2HJSA 5GOZA 4LXYA 5C7LO 5LLDA 1GGHA 1JDBC 5BPFA 1ORWA 2JJ2D 1PGJA 1CJCA 2GN6A 4RGYA 3CIFA 1NNEA 5I9MA 5IF9A 3NEPX 1RYEA 1E1CA 3QQPA 4NF2A 2VS1A 3M6LA 3AEKB 4UVDA 3LIPA 1RM3A 3ECAA 3C5HA 4HXEB 3L8GA 4KK3A 4YMTA 2ZWMA 2P5UA 1NU8A 1XJCA 1GILA 3L4SO 1X6VA 4BXOB 1CE8A 3ZCRA 4BS9A 2YHIB 5KYKA 5IJ0A 4OHZA 1PGQA 2CUTA 1T15A 2BISA 3SHQA 1SBHA 3RIYA 3S8MA 4Z0PA 3K70B 3DDSA 4DLAA 4IX1A 2NU7B 4XWYA 1QK3A 1TJPB 2BWJA 3UKJA 3UUWA 1JR3E 1U28C 4F5EA 5ISMA 3C5CA 3CSSA 1NSFA 5JJLA 1WNTA 2ZI4A 3UJCA 1I4WA 2JRLA 3FF4A 1SJ9A 4J9UE 4GR5A 3RVLA 3M82A 3FTPA 3OKCA 1S4QA 1A5AB 3PG5A 1Z35A 1WPXA 1X8LA 2BUCA 5HKKD 3UT6A 1C0EA 2W58A 3RS2A 2HK9A 2WHPB 5FJIA 1FP1D 4J90A 4BE9A 2PH1A 3L43A 4P53A 4IO1A 4DQVA 1RQXA 5F98A 2QW1A 3F98A 3EULA 5A4KA 10MHA 2JFVA 5DLEA 1DELA 3NYRA 1I9CA 3O8NA 3CLRD 5HCNA 5A3VA 2HDNB 4E32A 2PV7A 3MJHA 4NS4A 1IN8A 1N2JA 1EX1A 3FOEC 2RBKA 3NHFA 3IS3A 4FN5A 3DCIA 1ISIA 3WXBA 2DP4E 1F4LA 5CBPB 3R0ZA 1A1VA 3K15A 5AOBA 3BB1A 5TRTA 3FSGD 4FNMA 4QO7A 5KX5A 1Z4JA 3ZPXA 3BOSA 5HF9A 1ILWA 1BDBA 2F3RA 2QTTA 1PK8A 2OGUA 2XTZA 2O06A 3QPDA 4Y1GA 2XX3A 3PFIA 1SG6A 2E4WA 3PCXA 3FRHA 2YMQA 4IV0A 1L9XA 6Q21A 3RAEC 3F3SA 3P4YA 1CSEE 1NTRA 1N32B 1Z0KA 1FLNA 2WNIA 5AWFC 3ZJTA 1T9CA 3OLCX 2F59A 4IJMA 4JSTA 4ND5A 5I9IA 4A0FA 3D4PA 1GQQA 1XZBA 2DECA 1M2GA 2DFDA 3C39A 3E84A 4I50A 4CIWA 5HRCA 3Q7EA 2B8WA 3DH0A 3OQMA 3FTFA 4LVOA 4TQUS 4XX1A 2SICE 4W5HA 1I7DA 1WCIB 1RJFA 1KSJA 4L85A 4ETWA 5EJ8A 3HJRA 4CMEC 4DLKA 1DAPA 3MINB 4I1SA 3HZRA 2XYGA 4V0ME 3U4DA 3WO1A 3CLTC 3WZMA 2P6RA 1MG5A 4PNZA 4H6XA 2CNKA 3EVEA 1D2RA 4OFBA 4P4LA 1XFDA 4QBHA 1NYTA 4V0KA 2XRFA 3JWIA 4LYHA 4FKZA 1VIMA 4R1SA 4KAXA 3WDMA 1G8SA 3LNTA 1P72A 2G5GX 4MUBA 4RMNA 4KJZA 4I6EA 4YH1A 3P94A 4D9EA 2VSFA 3LBNA 4K6KA 3E3AA 5TARA 2IV7A 3AR6A 2RHWA 4AW9A 1Z4QA 2BE9A 2FW9A 4K26A 5JCOC 4DIOA 4ZDJA 3I01M 3KTOA 2EL9A 4J0CA 3HEMA 4G2NA 1QH9A 1SCAA 3BWCA 1JEEA 4CM7A 4QUDA 3V8EA 3DF9A 3PFWO 4CTOA 5TGTA 4E7PA 3C7CB 4NFHA 3FNQA 4MW7A 1JIJA 2OOSA 5DGXA 2BZ1A 3A7EA 1H2WA 1GZUA 1H5QA 1TAHA 1U0OC 2JHPA 1JIXA 1XDWA 4GOLD 1U2SA 1BSVA 3C2QA 4OLJA 4CLRB 1AHPA 4H6VA 1LK5A 5AW1A 1HQKA 1U5BA 1HRDA 4GMHA 4K9DA 5FEUA 3BMQB 1CVLA 3BIXA 3JD2A 4L72A 5HM8A 3IEIA 1Y9DA 3CJTA 5DYIA 3HY3A 4C6HA 1N2CB 4HGYA 1RPTA 1H05A 2ZAIA 1NMYA 4RLQA 4KYUA 4ICIA 3T3MB 1BG6A 5AJZA 3RRZA 2PFSA 4UBLA 1XRSB 1GHTA 1E6MA 4NYMR 4YRMA 5DTEA 2WB2A 1Z6GA 5SZKB 4O29A 4JUIA 1Z4MA 4IHKA 5GGXA 3ZXUB 3N9IA 5IAKA 2D7CA 2B4AA 1EJ0A 3UAVA 1JIIA 4P92A 1N9ZA 1AXEA 1E2JA 1NU6A 1PT7A 2NZJA 4Y1RB 2GO7A 3OCUA 1J6UA 4XDHA 4PX5A 3CB4A 5DK6A 1RWXA 5GJVC 5KHAA 3N2NA 2J6HA 4B4KA 1F6WA 2H48A 1FS4A 1HA3A 3FVQA 1S3IA 3F6BX 2OXCA 2XWQA 3A1CA 3DZDA 4J1TC 4GMXA 2Z04A 4DDTA 4GICA 1Z0UA 2F43B 3IHWA 3OCYA 1X8XA 2FUCA 3RHSA 5ITWA 4ZPJA 2IXTA 3IP7A 5A4JA 4XIGS 4Y7CA 2QNBA 1CZRA 1R18A 3NU1A 4BVHA 2Z3VA 4YPOA 3GLGA 1BS2A 1GPLA 5GMOA 4EGAA 2XCTB 1GAQA 5AKJA 2YJ5A 2Q50A 1I3OA 1LXCA 3A26A 3B5EA 1L2TA 3W3AA 3IESA 5EJIA 3WLPA 1ZVQA 2JVIA 3E0XA 3EN0A 4PYIA 3THRA 4BKQA 1Z63A 1R0CA 1PCXA 4F38A 4OB7A 1N6NA 2BMAA 1O0CA 3O8QA 2BJHA 3W8NA 3PPVA 1ZN8A 3D2LA 3AXSA 4P4UA 5E2BA 3ETDA 1XD2B 3Q9NA 3ISVA 4A0QA 5JYBA 3BRCA 3H4IA 1EUCB 3BGWA 4GYJA 4N0QA 1HY3A 2VATA 3V2IA 5C5DA 4PLVA 5TDHA 4H7IA 4PLYA 4E6PA 3LNCA 4X3OA 3V4VB 3F2IA 3EZLA 3UMGA 2QSYA 5KNCD 5JT1A 4K2AA 4L4RA 3ZHTA 4D42A 5L7TA 4RF5A 2XB8A 5K3DA 1NW7A 2O2ZA 4G1BA 4UM9D 2HTEA 3UYLA 4FMDB 3E03A 4QNMA 2VP3A 1QFXA 3M9XA 4J0EA 4WUTA 2G36A 2O8CA 3DBVO 2IE8A 3ITNA 3OAAA 1FDRA 4OL0A 1PNRA 1D2MA 1J1UA 1I0ZA 3Q7QA 3IP1A 3SYRA 2FSVA 2Y1XA 3QY9A 2ZXUA 3JVIA 4LZPA 1RQ7A 5HJ2A 3FCYA 4LK3A 5JJBA 5G1PA 2GZHA 1B6TA 2RIPA 3VVBA 4D9GA 3COZA 4NYIR 1M72A 1AA9A 3OOYA 4NU5A 4N01A 4EW2A 2PL3A 4ZJUA 1WCXA 3L92A 3PFNA 5HJ5A 1XDBA 3PEUA 1DBWA 3CZ4A 3Q8KA 4E5UA 1J0XO 1NPTO 2MYNA 4PSKA 1SUBA 2YVAA 1N5DA 2DQSA 2XA2A 2I71A 3F1LA 2D62A 4JLSA 4V2IA 3SF8B 4O4JB 4HDOB 4P0TA 4DAEA 1J0AA 3R9KA 1VKOA 5AHXA 3WNDA 2ZIAA 4QNRA 5EXEA 3PUIA 3R8FA 1FLDA 3LHSA 4I55B 4P83A 5FLEX 1P2GA 4JOQA 1QGDA 3RBZA 2JAPA 4UQLA 3U7HB 6REQB 5JY1A 1XZLA 3L93A 2J8ZA 2E5FA 5K5EA 2N75A 2JGJA 4NBLA 1Y7TA 1NF3A 2XODA 3NASA 2QTZA 1LDEA 2OGWA 2D6FA 4DR4B 1X7WB 2NZYA 2OO3A 1FDUA 3L01A 4U5QA 4G1EB 3WNVA 4BB0A 1FYVA 2PJUA 4GBMA 3ZCXA 3B8HA 1E7MA 4BVAA 1OXSC 1M34E 1GGMA 3M6MD 3MJFA 5F3WB 3G13A 3B2NA 1QHNA 2CHEA 1SZCA 2FDXA 2JGFA 3AG5A 3E9YA 4R1NA 4YJHA 5TF4A 3SR3A 3EA4A 2ZVQX 3TIXB 5BQFA 4C4PA 3X1WA 3DDUA 1SQGA 3I6QA 3E9NA 2IIQA 2MSWA 4DCUA 4IO0A 1MQAA 3I2YX 4UMEA 5AI6A 5T5QA 1W2WB 2HU5A 1TB4A 4DCJA 3C8HA 2CLHB 2BR5A 1VL8A 5HFJA 5JZOA 1JFRA 1CS4C 4XVRA 2QN6A 1UBFA 4NONA 4HEJA 4LCEA 1M7HA 4JJEA 1TM4E 4OHVA 2J3DA 3GJ6A 3KDAA 2EX1A 3D2BA 4ZK6A 2G1KA 3K09A 1ZJJA 3LAWA 5IJ0B 1UBOS 2GXSA 3TJRA 4YRKA 1SQSA 5EZ6B 2OBLA 2AZ4A 3F3KA 1XWIA 4CN9A 1DARA 2WV7A 1WUYA 1G5FA 2EQBA 4WZBB 1T1GA 3ABOB 1NPDA 4ZAZA 3V5NA 1GR1A 2ATVA 4ENPA 1AT1A 2BFFA 2XYPA 1TKBA 1EWYA 4PBTA 3WL3A 7YASA 1L7VC 2EEPA 5HWSA 2HC9A 3HUEA 3RAGA 1WXFA 4DAOA 1KYTA 5L8VA 5IVPA 1FCJA 1NUPA 1L3CA 2IWRA 1IMJA 1OFUX 1EXDA 1L7AA 3I4CA 5LLSA 3R7LA 4CKEA 2XXBA 1L5RA 3R0IA 3CLTD 3RK0A 2VP0A 1XZIA 3QFSA 4ODIA 4BMZA 5EJ7A 4LCBA 2X5OA 1G3QA 3UHFA 4H4DA 1AV7A 5CXXA 4I9NA 2C29D 4NENA 4A9AA 4F84A 2OQIA 2VDKB 4B0PA 2QM3A 4M7OA 4R3NA 3UJAA 3NANA 2VSNA 4G41A 3GFFA 4AULA 1H8ED 4RXUA 3SR4A 4AY5A 1GTMA 2ZBPA 3FBGA 1FTQA 2ZE5A 4GVXA 4Y6PA 4AZWA 2OT3B 1Z28A 4V2UA 2XECA 2I78A 3CISA 3AL2A 3ELUA 2VTEA 3EEIA 3T35A 1LPAB 1HZZC 1DU4A 1VMAA 1I8TA 4OREX 3G0HA 1JB9A 4ZMRA 5M5BA 2HK7A 1AN0A 3CYFA 1U9IC 4V0OA 1HDXA 3KQKA 1E5DA 1IIBA 1ZOSA 3QVSA 2FRDC 1ORVA 3DUFB 5KDOA 3HNRA 4MYCA 3HUTA 3E5MA 3KEGA 4RM2A 5DN6D 4EIWA 1AB5A 2YIVX 3O31A 1MABB 2H6EA 3BIOA 1STOA 1Z39A 3O92A 2IZ5A 4M8KA 3KV3O 3ROPA 3SXUB 2PJZA 1EX7A 2PX8A 4GEGA 3RIXA 1TMGE 4J7UA 2ODPA 4MS4A 5EI5A 4BB6A 1B8NA 1UOEA 3FMVA 3G85A 4IM7A 2EFGA 3OLQA 4NU0A 2PWYA 2QY6A 5TMBA 3R8CA 4ZCPA 4PRYA 1FDVA 3OQIA 4OXXA 3C70A 4AJ2A 4QC2A 5AKKA 4EPYA 2QGNA 3B13B 3TI9A 4ARUA 4J0HA 3KXDA 4L9SA 2QEQA 4JIGA 5BYKA 1MEJA 3G1UA 2FWNA 2C3OA 4OOEA 3VU9A 1J8QA 2WWFA 2PWPA 1P6UA 4GOJA 2ZSEA 3NTXA 1NLMA 1S7CA 1KO5A 1QP4A 3CX6A 2BMEA 2V5AA 1UDWA 3EY9A 1HNXB 2FPLA 4ZVVA 4WI1A 1ZKMA 4MWGA 5I9LA 2A0YA 4IKEA 4EZEA 2YVUA 3QVKA 3COSA 3O1HB 2AN5A 1EFUA 2D74A 4LN1A 4KITB 2P6PA 3V1YA 3L41A 3H9UA 1RACA 1Z88A 3F4KA 3ZYCA 1ZK3A 2DQKA 1D2HA 3NBQA 5JQGA 1AKUA 2NTVA 4KQMA 3R7SA 5EL0A 2AF4C 3E35A 4C4AA 1OIXA 1ZD1A 3AM1A 4HATA 4W82A 2QSJA 5P8WA 2IXGA 3HXPA 1TO2E 4B47A 2WWWA 2E89A 2VAXA 1AF4A 4JWTA 1WU7A 3VU8A 1U1IA 3GD5A 3WIEA 2J3QA 4U0KA 1NR5A 1JG3A 1HT2E 4NWIA 4YAKA 4EF6A 1C0KA 4KWEA 4RTJA 1ZGAA 2HJVA 2RD2A 4Q39A 3DW1X 4XDZA 4LDQA 1JKJB 4OQLA 3IKJA 4M7WA 5CW1A 5HZGA 1P2UA 3VHLB 1PJRA 2YX1A 2JHGA 1C4KA 3HU1A 1M5TA 4LYGA 3VDRA 3IERA 4QXRA 4L07A 3DVAA 1N6LA 2QX9A 3D0KA 5E3IA 4XWWA 4YP6A 2GJAA 3LHIA 1XP8A 1A4RA 1T2VA 2G8NA 4IFEA 2DGDA 2IIVA 2NLOA 4GMGA 4QYXA 5EJMA 3UCFA 3WBBA 3ZW8A 4F2WA 5L95A 2JFXA 6CHYA 1OWOA 2JANA 5F5XA 3HRIA 2IHBA 1K1EA 2XCUA 2XXAA 1KZ7B 4DIUA 1PR3A 1U9CA 1OWMA 5BN5A 3R2JA 3KLBA 4I4IA 3V1MA 5L3SB 2IELA 3A2MA 2H1FA 4BTVA 4ENUA 4M8SA 1BXGB 4EX7A 1UOPA 1BVUA 4XB6B 5EUBA 1SRRA 2GM9A 2NSHA 1SRQA 2JGEA 5DX0A 4MO2A 5EWJA 5BQOA 5IKMA 3KT0A 4AUMA 3FKSD 4AVYA 4MV3A 3B2QA 2LP4Y 1YFZA 1KAQA 3EAQA 3ILXA 1O3YA 1A9XB 4HAZA 1PX2A 4PZPA 4KREA 1W94A 1VZ2A 4NXMB 3L7LA 1JZQA 3TKYA 5JIBA 1SCQA 5J58A 1WP9A 2FFAA 2Y0DA 3T5DA 1TX4B 2HF9A 5DP1A 1JGTA 3CNNA 1KE2A 2OXRA 3ISTA 5GJCA 4AB1A 3ELDA 1JSLA 2FHSA 5EIHA 4QVIA 1IJEA 2X0DA 4HOYA 4OJQA 4PXSA 3W77A 3MS4A 2H3HA 5G2OA 4Z2AA 3ILYA 3RT7A 4ALMA 1NT2A 3BE6A 1QONA 3WK5A 2WIKA 1KBZA 1B3RA 2A3NA 3HZOA 1QQBA 4WX2B 4X6XA 4CF6A 4CM5A 3B3QA 1GL7A 1WEKA 1TJYA 1A9QA 3GJRA 2WG1A 4EA7A 5IHXA 1JJAA 2P90A 4IVPA 1MJFA 1CETA 1NXPA 1U2QA 2ZT8A 3PR2B 4RPHA 4TVKA 5CURA 2I3AA 4P3KA 1DAGA 4R9UC 2O8CB 4ZO7A 4FYIA 3RRBA 3TVDA 1G5HA 1RABA 1N33B 3MGKA 1ORTA 1Y7PA 3T94A 1IY2A 1V2HE 1PS9A 2BSAA 4TX1A 1JW9B 3WL4A 1TVKB 2WD7A 1A9OA 1V5WA 2CT8A 3HV0A 4WNIA 2GESA 1COZA 2EP8A 5CX4A 3K9LA 4G9BA 4HH0A 2EFHB 2YN4A 2A0UA 2INGX 1XMVA 5JOQA 1E9SA 1M6VB 4W1PA 1RPAA 5DHSA 5KIAA 1O58A 2WTEA 3UWOA 4MV7A 5I4BA 1JMVA 2NT3A 2JLSA 1EP9A 3A1SA 5ICFA 3RC7A 1GNRA 1WWKA 3PDIB 4IDQA 2VF4X 1CP2A 1CR2A 2AMJA 3VR2D 3WWCA 3ZXXA 3EPLA 1LF0A 1YZHA 2WU3A 1LW6E 2PD4A 3EC7A 2X3UA 3JYOA 2CJYA 4KLNA 4AXXA 3K32A 3F4BA 1U99A 2AHRA 2QN8A 1SH7A 1KY4A 1DAMA 3S81A 3G02A 3TTWA 5B7QA 1JLLA 4Y0NA 2EF0A 2Y1GA 3TRFA 2JEZA 1M1YA 1WP4A 4JUCA 2M6LA 1DC5A 4QATA 1OTXA 4IQ4A 1GTG1 3IIIA 1IEWA 1HRKA 4RZUA 3MGAA 4MVJD 4YRFA 4YASA 3UAOA 1I7NA 3LSTA 4CMIA 3GDOA 4IMRA 3QVMA 1HE3A 1IM2A 1ATZA 2BDTA 2QIPA 3DHEA 4PZLA 2ARKA 5KVCA 1OKKA 4N6NA 3T0FA 3E9ZA 3FKQA 2C7GA 1JXQA 3R3UA 2BBWA 3LCJA 1HT1E 3JS5A 2XNDA 1SO8A 1Y7IA 2NYVA 2Z9BA 2OILA 1X3SA 1WUKS 2J9XB 3D3QA 1NT4A 2FEKA 4X6YA 3SBEA 1H2RS 3WB0A 1ECFA 1IB0A 4WLNA 4YJHB 4GOMD 3JQ9C 4ZVQA 3WMEA 4Z0HO 4HAVA 3LWNA 4N5IX 4YIHA 3L49A 4FS8A 2B94A 3QE0A 4EFDA 1OILA 1N36B 1UFOA 4LTNA 1G3UA 4MGHA 4ZAGA 4C1BA 4DT1B 1LC0A 1KJNA 1TA9A 5LZ7A 4C88A 1QRSA 2OV4A 1E79A 4P93A 4YMUA 3QKIA 4Q9JA 2SHKA 1MOSA 4IUYA 1J70A 2E4XA 1K7FB 1SIBE 1L4MA 5AK3A 5L45A 4XOIA 5PNTA 2Z0MA 2JJQA 4CLXA 3B1WA 3OCXA 4KSBA 4W1SA 2PUGA 2AR7A 1GPBA 1JXOA 2OB2A 2IPLA 1QVVA 3VU0A 4WXHA 2HHAA 1FPQA 3BSSA 4QDOA 3WRXC 3I6YA 2GEUA 3ZNQA 3KKEA 3LZCA 3TSYA 1E18A 5LQNA 3OCZA 2BFFB 3JQEA 1ISSA 1ZD4A 1NVEA 4FMPA 1GG9A 2P0YA 3ZH2A 2FSFA 2YRXA 3GJ4A 4DCVA 4EJFA 4ZYYA 5BQ3A 3W05A 5AVOA 3LUDA 2YWDA 4LE1A 4MMXB 3LSYA 5B3KA 4O25A 5LP6F 2DH5A 2PX4A 3WB9A 2HQ1A 3R7AA 5CR9A 4BU1A 4KR3A 3PC3A 5DU2A 2WAYA 4CLHA 1ZYUA 3EIUA 1VE6A 2C2BA 4EY3A 3J81k 3DMGA 1AJEA 1GXSA 1W0KA 5CNJA 1T26A 3EFBA 2YN2A 4NENB 1QWSA 3OT4A 2XQIA 4Y0VA 4A8JB 4JLUA 2VA9A 4LBWA 4MQ5A 3PDCA 2FHPA 3MELA 1QGUB 2E5WA 1W581 4BMDA 3A70A 5H3LA 3JPYA 3R6DA 4L8VA 1FP7A 4RANA 1K3TA 3IVCA 1NW6A 3VTZA 2OXFA 1EAMA 3PD0A 3LT5A 3WGQA 3DC7A 4D26A 3C8MA 3Q87B 3DD5A 3VC7A 1E9AA 2RGWA 1PHPA 2YUTA 1RHMA 5ADWA 3L7JA 1KEVA 4XTRA 4MI3A 3ZGXA 1LQTA 1XX6A 2R6GA 3SQXA 1OWPA 1JDSA 4ND8A 1GPNA 4XIYA 1G4UR 4B8YA 2O0KA 2ZGVA 3QBEA 4F9EA 3K0BA 3ENKA 5KNBA 4RTKA 4JBIA 1LY1A 2DYKA 1Q6ZA 4W9NC 4O2AA 3OICA 4DCSA 5CBKA 4BVLA 1HFWA 2CXNA 1GQ2A 4RYDA 3RV3A 3W2TA 1EUZA 3HHPA 4HKTA 4MS4B 5IEBA 1EUQA 5EXSA 2IUYA 2Z1MA 5J2UA 4K6MA 5LFAA 4UJ3A 3NB0A 5TPZA 2IV3A 3ZLUA 1KO8A 2I29A 4RW0A 4TV9A 4CYMA 1TEZA 1XKQA 4LGMA 5LMZA 4M9UA 1AK9A 1A3CA 5CEFA 1XDZA 3VU9B 1J8VA 1O77A 4YV2A 4M0DA 4Q66C 2PS9A 3N2IA 1KKMA 3QELA 4K46A 4WY5A 1U8ZA 4HH3C 5BUZA 4XI9A 1YQEA 2W2VA 3BJIC 3JZFA 1PR6A 1P2FA 4DPKA 4WWHA 3K1AA 1JQJC 3PGMA 2FSUA 1K3UB 3LKVA 3SEAA 3H1GA 4U7GA 4ZCRA 3H8JA 1SVKA 2BI4A 2IXAA 3AY3A 3NG1A 3ZE7A 1Z56C 2YMMA 1LV8A 2YNMC 1NG9A 4BNDA 3PPYA 3G59A 1E8DA 2BR4A 2VOJA 1O95A 1X1EA 1Y4DE 1UMDA 2QVCA 2VT6A 1A5TA 1U1FA 3DEZA 4G26A 4FYPA 4K9KA 3IP5A 1DBIA 4MCHA 3CUWA 4TTQA 2Z1NA 3OUTA 4UTXA 1MHTA 1T6NA 4JP3A 1GUZA 4RZIA 5G0TA 3H17A 4CKBB 4JSRA 4X6LA 2A7XA 2GETA 3A4IA 5M29A 4RTNA 1HYBA 2WU4A 1QGZA 3MTJA 1U7DA 4IJQA 2K6GA 4E11A 3MCZA 1R9GA 2BJVA 1X7YB 3GROA 1GQOA 4Y2JA 5DGCA 2HJGA 2ZUWA 3U1VA 1A82A 4YFVA 2ZIZA 1MAWA 1XB2A 1OA0A 4ZU1X 4YBRA 5K20A 4U2DA 1OLUA 1OBOA 4UULA 3SQDA 5JU6A 1DIRA 2W6IA 5AKZA 1PUIA 4KI0A 3DVAB 2W48A 1PZNA 3FVRA 3OIUA 3WIUA 5BW4A 2Q27A 2P8SA 2CN1A 1GVHA 1UC9A 4M76B 1KHTA 2A9QA 3RAJA 1CZLA 4TYPA 4V02A 3ZJUA 4KWCA 5ALEA 1XQVA 5KEIA 3IVRA 1NRIA 3KUDA 4MYHA 3PD7A 2WAAA 3AVUA 1OAOC 2NWQA 4NKRA 1BW9A 1YD7A 1CCWA 1C4WA 3MWEA 1KJ8A 4HL6A 2ZJ0A 1C0IA 3DMDA 4OK5A 4Y2VA 3IKTA 3U5ZB 2DSTA 4KQEA 1U7OA 1OBVA 2FPPB 2IOHA 2YDYA 1BS9A 3SYNA 5BMVF 5CLJA 1B8VA 2GARA 4C04A 3QLJA 2AVNA 2VF7A 3I9JA 4COKA 2GN2A 3WLOA 1R50A 2R8BA 1G4AE 4UTVA 4XPIA 4GD3Q 2BGLA 4M8LA 1K4KA 2CKDA 2LV8A 2FX5A 4FGLA 5LQJA 1VJDA 2A5FA 3FPLA 4P9NA 2NVOA 1QB7A 3VGJA 4PG6A 2OR3A 2H57A 1CW2B 2DWPA 1TADA 1N5KA 2CDAA 2VHUA 4MV9A 4PC6A 5FTJA 3WYAA 4DXHA 5J4LA 1ABBA 1WXGA 3H2IA 1E7SA 2VVTA 3ANSA 2RHHA 1O9HA 4HVCA 1D03A 2B2CA 3WWDA 1ITZA 3KWLA 5KQMA 1OROA 2JKVA 1BE1A 4JJIA 3SEFA 2C5HA 2EWMA 2MSEB 3GRPA 4NY1A 4U9IS 5SV2A 2D5LA 3O1LA 4PSDA 4LX8A 4L2IB 2NO6A 2XDAA 3RKSA 2G9UA 4C6SA 4U1RA 1P80A 3LCUA 3EVGA 4LXIA 5F1OA 3RV4A 3R7FA 4UHCA 1LKZA 2N0SA 1LLQA 3PITA 3BN3A 1Z2OX 4M86A 8LDHA 2G67A 1YR8A 2J3MA 1U1GA 2PA3A 4RAOA 5HW0A 1XTBA 3OG9A 1PNQA 2R9VA 3PTLA 3JYLA 1VPWA 1U0LA 3JARA 4AZSA 2RB4A 4O4LA 4PX3A 4Y1FA 1PJLA 3J7TA 5FO0A 3U5TA 4YX9A 2ZM5A 521PA 3DE1X 2DEUA 1BEEA 3JD4A 1RZRD 3P2OA 4DR3B 4WNCA 4F8JA 4M21A 2OB1A 4D3SA 3BXHA 3RGGA 2VXBA 2AWOA 5DCLA 1F8XA 3UJ8A 4ESVA 3K0EA 1DRUA 2J9RA 2ZRHA 3RS8A 3CKYA 3WNCA 3PQ5A 2Q4DA 5IVDA 1P5HA 1WBJB 2GK6A 4XSHA 4EG6A 3RTDA 1O5TA 2BE7A 1NN1A 2VUTA 3TBHA 3TCKA 4DLLA 1KAHA 1ATIA 4GR9A 3ROEA 3R3ZA 1KWKA 1G4HA 2XOKA 4W7HA 2IHJA 1EVLA 2PS0A 3BICA 3QKRA 4MS1A 4NYJQ 4XLLA 5EZYF 2VNAA 4OPMA 1D5WA 1V1MA 1R10A 1BWQA 2RBEA 3FRIA 1FX1A 4ZO9A 5FBWB 2CEAA 4AN4A 4YXFA 3LX5A 1RRVA 4LWQA 4TXNA 3KT6A 3G9XA 2WMNB 2C95A 1M1YB 3D54D 1P4JA 4Q3AA 3BL8A 5FV7A 3Q0EA 4FONA 4N82A 3ZN2A 3TBKA 1FZTA 3CFYA 1B7GO 4J6EA 5BPHA 2CV1A 5DYGA 2JEOA 3KXKA 4M9CA 4CMIB 2Y0CA 2I4IA 4IX9A 1LV7A 1THGA 2QYHA 1IUPA 2C2WA 2FMIA 5FPHA 2WAMA 3O91A 5AKHA 5FX2A 5A0VA 4Q4HA 3VHQA 3WGOA 5CDYA 1GOTA 1XAJA 1JZSA 2XJ9A 2ODAA 3B6ZA 5KYYA 1H4VB 3DBIA 3JQAA 3HBJA 2JLAA 1SOAA 2A1IA 3G9ZA 4OEHA 4C7BA 4F1KA 1X14A 3M89A 4LTDA 1Z7EA 4Q9KA 3TLXA 3UW3A 1R4NB 1LRLA 4FEEA 2D54A 3MILA 1EEHA 1WTAA 2C1XA 1OHHD 3GIDA 3UJ3X 4MP6A 5FYDA 3HMQA 1AQNA 1B26A 2BGRA 3TPFA 3AESB 3IXMA 2IODA 4I1OA 5E7IA 3VDXA 3DYIA 5BURA 4PG7A 3TZ6A 4ZYZA 2O1EA 4FFBB 1S3FA 3ICPA 4ZCQA 3T99A 5JAUA 4MDEA 3GGDA 3V2GA 4BCBA 3WL7A 1WDKA 3Q2OA 5FEMA 1Y9AA 1NVXQ 2WJGA 3AJEA 3NVKI 1D07A 3NX4A 3MUFA 1U2ZA 4IIUA 4OHYA 2CYBA 4OQQA 3PQ6A 2X5NA 3KZNA 3DLCA 1YZGA 2KBFA 2IYQA 2Y0PA 3F6EX 2VDMB 3L0CA 5FL7A 4Y1EA 4R1UA 4EHDA 1C8KA 2HMWA 3ZX4A 4MUHA 4D41A 1PDOA 3P7MA 3KSBC 1A2OA 2IUFA 2OZVA 1P19A 2PMCA 4HGQA 4R7TA 3QUBA 4HSEA 2WILA 3HVKA 4C43A 3B85A 3FHOA 2Q2OA 1QQAA 5LNK1 2XAAA 3IOYA 4QO8A 4FT2A 3JASA 5MN5A 2P4EA 2ZJ8A 2JCBA 3IR7A 1L8OA 2YJ3A 4B2LA 5HFAA 1HMYA 1EP1B 4WPGA 2F8MA 1PJQA 4MKFA 1VKHA 2O54A 3HY6A 2BKXA 5HIIA 3BD9A 4HYQA 1P0CA 5C0OE 3WOHA 4TLAA 5LQAA 3WLQA 3SMQA 5FP0A 5K2OA 1B2LA 2ADFA 1T8YA 3BSYA 3OIYA 4JIMA 2ERXA 4PCAA 4S05A 2FE1A 1R5JA 3GEPA 1KFCB 1KQPA 2R66A 1OI7A 2X19A 1JEJA 3OZ7A 4LQCA 1W88A 1GNSA 2Z5LA 2H54A 3LPAA 2ZS9A 5IYZF 1SKYE 3JAWA 1UZAA 4JC8A 1W87A 4C7JA 2SCUB 4C7KA 1GADO 3Q2KA 1LNQA 1GTZA 2GCNA 3GAFA 4Q1DA 3RNOA 2ASVA 3AGPA 2R6CA 1HEIA 2YNMD 3I2KA 1L3BA 5D5HA 4M6WA 2JH9A 3DFFA 3B2EA 3GRUA 4RKRA 5GQSA 2GASA 4EZBA 4ND8B 1V41E 2G17A 4KZPA 3Q7SA 7MDHA 1XLTA 2PAAA 4CZ2A 4X66B 2HQBA 2H31A 1CPYA 4HN9A 3WWYA 3CRZA 4R2XA 4D97A 3E9QA 4O2AB 4TSFD 3BT7A 1TYBE 4XUGB 4YV7A 3HXMA 4MGZR 1ZSYA 1D9ZA 1JNXX 3L6CA 3SS7X 2OWEA 3T61A 1OVGA 2VF2A 3OMLA 1DPFA 2B3TA 3IIMA 2I2WA 4YCLA 4RIIA 1MJGM 1L8AA 2LZ0A 1I3NA 3NM4A 1BO6A 2HRRA 5J2UB 1D0SA 1DKPA 2ZI6A 1QLWA 2EBFX 3OQBA 5CVUA 1JAHA 4TV9B 3ZE6A 1WO8A 1FJHA 2FU5C 2QE7A 4NE2A 4P82A 4M3NA 5KAPA 1UBLS 4BZPA 4IDPA 3LDHA 4RBNA 3O4GA 1XNGA 4P4GA 6AT1A 3PT9A 2D4HA 4FI3F 2GBGA 3GLIA 1Z22A 2QTVB 2FQYA 3O8DA 3QELB 2Q6IA 3L4BA 3OFND 4O02B 4ER6A 5LZ2A 4IIEA 5D87A 5FA6A 2RHMA 5KCZA 3VMFA 1FFGA 1O6FA 2A5DA 2V0NA 3PXGA 3SZGA 3W1EA 1XL1A 1PFGA 4TZ6A 2HRZA 4FSDA 3GCGA 3HBMA 2OPHA 5C5IA 1EK1A 2XLCA 1UK7A 1OFVA 3ZZ1A 3W4JA 5JEEA 3VR5D 1AM4D 1KQGA 3E5NA 4R1PA 3DV0B 4BN4A 3EG5A 3NBMA 4HV4A 5HP4A 1FXUA 3QKTA 1XHLA 5IDYA 1KYVA 2EZUA 1FFWA 3PT5A 2HAEA 4LC1A 5LR6A 1WZNA 5HMMA 3MMSA 4KDEA 3T7CA 2AZTA 3WHKA 4DABA 5BQPA 3FR8A 2IEYA 1Z34A 1F5NA 2WVJA 1DPGA 3IDZA 4JV5B 1SXJB 4MRMA 3F5FA 1YL6A 2IQIA 2R00A 3KEMA 4CL2A 1D8TA 3OPMA 4X93A 2PD3A 4IIJF 2XUPA 1FTSA 2YZNA 1DHTA 4OA5A 4F11A 3ASYA 2HYIC 2VFAA 2WZQA 4X1KA 5H9WA 4RK1A 5D7BA 4LTMA 4OUKX 5D86A 5ALDA 5CH8A 3X2SA 2TMYA 5JXIA 5L3QB 1OLUB 4BO2A 2C88A 2XE8A 2FEXA 5E2AA 2WF9A 2BM8A 5FR1A 3SYTA 4BRSA 2G9QA 5B4VA 4D92A 1EFRA 7GPBA 4DBZA 1JFSA 4AYWA 1CFJA 4PGFA 2Q62A 4GBJA 4CIDA 3WHLA 1XZJA 1QHFA 2RFLA 2IYTA 4TT3A 5BXYA 4C87A 3DKVA 2ODQA 4GGPA 2YW2A 4ZREA 3FKJA 4FFVA 3K9FC 4AI6A 1E0DA 4A16A 4IDEA 3CVWA 2E0IA 1NYQA 2ZYIA 3LUPA 3LWBA 1ZGBA 1F5SA 1KAOA 2FP4A 3QIAA 4Z3KA 1FRFS 1YQ9A 3EWAA 3JQFA 1XP5A 2EG9A 1J0CA 4LVNA 4C4TA 5KOIA 1NOIA 3BXPA 3Q0IA 3W8FA 4X91A 5E3HA 5CFZA 1YB2A 2JAQA 4UAJA 4LOJA 2XD4A 4BO5A 1BEUB 1MO2A 4YGYA 4KFSA 1M7BA 1JILA 1E2DA 5ESXA 2Q28A 3KOZA 4Q0MA 1CIPA 2WIDA 1E1RD 1WHSA 2NU6A 4CETA 1EFCA 1VCMA 2HWKA 2QUKA 1BMQA 3FVWA 3K6KA 5CFRA 2GCGA 4ZN6A 2A9OA 4XARA 5B37A 5A3JA 3L7KA 1KMMA 3HWX1 4QYSA 2PLWA 5D51S 4LHSA 4DM7A 1WPQA 4RTPA 2IHTA 2UYHA 2G9NA 1P5FA 1XN4A 1G5PA 2Y9MB 3S2FA 4B32A 1NUTA 4KXMA 1R0WA 1OLSB 3OM9A 2OBBA 1ULTA 1WPGA 3HXTA 4H7HA 4ZEVA 4L8FA 4EYSA 5CLHA 3KTDA 4JZKA 1WXQA 1IDN1 3PRJA 1H1LA 1T9DA 4GT1A 3BJZA 2GK3A 1E94E 3D59A 1WLYA 2GJ4A 2ZJZA 3NP7A 3OOJA 3G3EA 3LYHA 1UFRA 3QXJA 1UJNA 1ZGHA 2NNWB 3D6FA 3P4XA 2R8OA 1YJBA 3JARB 2RH9B 3QHAA 5TS3A 4FFPA 2ZYUX 4UBJA 4O4LB 3UPTA 1TYCA 3AHDA 2NACA 2CNBA 3W9SA 4ZYWA 4JCOA 5GJWC 1FNNA 3OJCA 4FJ2A 4FGUA 2WJIA 2A78A 4OQPA 5LIPA 3RT9A 4UD2A 4LSMA 3UMCA 3DDOA 1K08A 3IURA 4QLOA 1LH0A 1L6IA 1X1RA 1R8YA 4Q6WA 1F2UB 1WPRA 4YPFA 1PG2A 5BO5A 4RXTA 3CHYA 4ZYXA 1OU0A 1TUGA 1RBMA 3HB9A 1E32A 2J4FA 1UJBA 2AR9A 5MFZA 2R8RA 4JI8B 5ADHA 2EIHA 1D4AA 3I9FA 4DLRA 4EY6A 4DHEA 1DSSG 4MS1B 2GN9A 3K9CA 4EG8A 1XWWA 2GF2A 2ID9A 2B7LA 1KZYC 1V1MB 1HH4A 2JNWA 2ZJ5A 3IQWA 3KZ1E 2JEYA 1HLPA 3A6EA 3P9PA 4DCPA 4LY0A 4FBLA 3KLNA 3DVLA 2FFQA 4DSAA 3F8SA 2EDCA 2V7GA 2JG3A 5AVRA 1EVKA 1U94A 1T29A 3NCTA 1KFBB 3PGLA 4AS1A 2WB4A 2IYAA 3IGFA 4TSRA 2H4YA 1LLCA 1J07A 3I6ZA 1KFEB 4CLOB 2BT4A 5KYTA 1EQ2A 4OCZA 3UHJA 2POQX 1VKZA 1VHJA 2W4MA 1T1IA 3P9NA 4RIHA 1JJ7A 2ZYDA 2VJNA 4MAFA 4TZTA 7MHTA 1Q7CA 1R12A 4S3MA 3AW9A 3GD7A 4OHMA 3QU5A 3JQAB 3MFQA 1JQBA 4ZOLA 5A4AA 4WVLA 3GMTA 1SC3A 5EWMB 1KETA 1ZH4A 5TY0A 1NQXA 2VHYA 3TBFA 2MMGA 1N6OA 1DHRA 5C51B 4DMHA 3A6PC 2B4QA 2RK3A 4BC0A 1HTWA 2WZCA 2Q4RA 3TI7A 2VNKA 1CR1A 2I3ZA 3PTZA 3KYCA 5ALYA 1VB3A 3ADOA 4EYEA 3I42A 1HSOA 1ACLA 3FGZA 4AURA 4LRQA 4HUTA 4DR5B 4PQYA 3H8VA 4JLWA 4R8MA 4YAFA 3RAPR 1VLHA 3I9MA 3KQWA 4M2LA 3R4VA 5K0BA 5AXAA 1P9OA 3KDSE 1II0A 1TA0A 2Q9CA 2CXRA 1WHTA 3IBGA 4OI4A 4RVNA 2V65A 2D13A 2Q5JA 1L4LA 1NAHA 3DS8A 3NOVA 4YCMA 2MINA 1YIAA 4E46A 5KS2A 4O33A 1SXJD 5I4IA 4NMLA 5C1OA 1QWOA 1Z08A 3ZDEA 4A5OA 1ZH8A 2HCRA 1NRJB 3KPJA 1A5SB 1A0OA 1FRNA 2PMDA 3NQ41 2FPGB 3OC6A 1ISFA 3ODGA 5FUXA 3V4RA 3U7GA 2I6SA 1F12A 1C3VA 1CS0A 1N7JA 5HKBA 3D3NA 5C4GB 1FNCA 1JKXA 3DVRX 3VYUB 2JI4A 1KBQA 1U65A 1E2QA 3MCAA 4MGYR 1E3WA 1QE0A 2ACKA 3SDBA 4EGJA 5JCZA 1D5CA 1JBKA 4FWIB 3JASB 4PC2A 2HPZA 1XV5A 2PX0A 1E2HA 5FUBA 1KDVA 3TB6A 4HQ6A 1DIBA 1PF7E 1VL5A 1BTOA 4MW4A 2JIQA 5LD2B 1RJWA 2X9QA 3FGNA 1QE5A 3AHEA 4RZQA 4KRYA 1YMVA 1MGOA 4YP5A 2VOEA 4L9WA 4B44A 2ZRAA 3DE7X 2DU8A 3OFVA 1GAWA 1OI2A 2F8TA 1RTTA 5K3SA 3L7BA 3PQCA 2E6KA 3G9QA 1T34A 4UVGA 3ZDYB 1Y1TA 1X9IA 4QULA 5K8UA 1QF6A 1T9GS 5LBUA 1DGQA 1QGYA 4X20A 4FOOA 4RTMA 3SOZA 3AKZA 2WMYA 4F2HA 3I8OA 3JAWB 1A97A 2NO0A 3MD9A 1LLDA 4O1IA 4YQFA 4ZT2A 1N34B 1U8CB 1Z6QA 4NDNE 4ER7A