1X86B

Crystal structure of the dh/ph domains of leukemia-associated rhogef in complex with rhoa
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
180
structure length
180
Chain Sequence
b'AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 12
publication title Structural determinants of RhoA binding and nucleotide exchange in leukemia-associated Rho guanine-nucleotide exchange factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/membrane protein
total genus 52
structure length 180
sequence length 180
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2004-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1x86B00
4OHYA 1KYIA 4GMDA 3RWOA 2JLSA 4Q4HB 3AF2A 2O8FA 4PPQA 2XB4A 2VL7A 1OF1A 3OZXA 5FR2A 5FTJA 1NN0A 2VPPA 3QPUA 1DADA 2PLRA 3AVUA 1E0AA 1W2GA 2EFGA 4LHXA 5JS8A 2PMKA 3CLVA 3AKEA 5FI0B 3HWSA 2WWGA 4TTRA 4A1FA 4Z8XA 4JBWA 4G5RA 3R8FA 2VSFA 2J3EA 3NC0C 2EWWA 4PR0A 5EP1A 5DGXA 4FMDF 4I99A 2FE4A 1TNDA 1FNNA 4YXWD 2JLXA 4BECA 3C5CA 2CCGA 1JXMA 1TPZA 1DAIA 3WP1B 2ERXA 1XCGB 1KK1A 2ZSDA 1G7RA 5EXPA 1XD9A 2GKSA 3U3JA 1E2QA 1EGAA 3EZ2A 3NG1A 4DB4A 4GOKA 5L8VA 1DAMA 3P27A 1YZNA 2N1BA 1BS1A 4A6PA 4A0GA 1U9IA 2QP3A 4Q1CA 4RJLA 2D2FA 4MRRA 4PZYA 4RD4A 3U7HB 2P6NA 3VNVA 4RCZA 4Q00A 1W47A 5JFGA 2BHRA 3WRXC 3RS2A 3QXCA 2GETA 2YOGA 3IQWA 4D4MA 1E2NA 3AUYA 1PUIA 3GQBA 1WRBA 4JLMA 4W5JA 5KHOC 3KUCA 5GJCA 4FW9A 2VF8A 4Q66C 2F43B 4GOJA 2WTUA 4HDOB 1M7HA 4ZI3A 2ZROA 2ZRIA 3UATA 1ZINA 4AIIA 4CT5A 1MT0A 1G9XA 3IEUA 1BYUA 1Q1EA 2PX3A 4FCTA 5GJVC 2Q3FA 3TUJC 4DLWA 2W83A 4YDHB 4QM7A 4HAZA 3ND8A 1CR0A 4DB2A 3PR1A 1E9FA 4EFMA 3KDSE 4KSCA 1KO7A 2CL0X 5DN6D 1KMQA 1KY2A 2BIFA 2P0EA 3QVUA 4DLRA 4DWJA 2OLJA 3B78A 3SDZA 3IO5A 2XZOA 4G01B 4C7OB 5L3RA 4TLAA 3KQNA 1XD2B 1GILA 4JL6A 1COWA 4H1VA 4U02A 1OLOA 3I5YA 2EQBA 4LJYA 1JALA 3ASYA 2CMKA 4LC1A 2R62A 1P61B 3C4JA 4U00A 5G41A 5BN4A 2GJ8A 3AKYA 2IX3A 5IK2A 3GJ5A 5JJIA 1ZD9A 4UNPA 3ZVNA 1G4AE 2K5UA 1YZLA 3PIRA 3ICEA 1ZNWA 3DO6A 1VCOA 3A1SA 2GZDA 5EUMA 2FFBA 1F2UB 4ARZB 5FL7A 5FBLB 3GLHA 5FTMA 2RH5A 3FMIA 1R5NA 3CRVA 1AQUA 5FOXA 1DPFA 1KZ7B 4M0LA 4RVCA 4TYPA 2QBYB 1X1RA 5DH9A 2J0QA 1YQTA 1A7JA 4JIMA 3TUIC 4KVAA 4DSTA 5BN3A 4DLYA 1EFCA 1E2EA 1S9DA 2VHJA 3BOSA 3IPXA 1KSGA 5E3HA 1H8ED 1NLFA 1T8UA 3MJRA 3SJBA 4HAVA 2JLQA 1IY2A 3B6EA 2WIBA 1KO1A 3QUSA 2JJ1D 4C0LA 1IXSB 3KJGA 4JJKA 2DR3A 4MGZR 3V00A 1UBFA 1NN3A 1KZGB 3HYTA 4G5OA 4URVR 4LI0A 1F5NA 4A9AA 4NCNA 4M9QA 4PHHA 4HLCA 1F3OA 2IXEA 3AF3A 5C46F 3LWNA 2RGBA 2ZUBA 4BFTA 3P4YA 5J4LA 4UXIA 2AD5A 1NSFA 3KJHA 4E09A 4D4KA 2A5JA 3FDIA 4E07A 4MRVA 2EWVA 1GNQA 3HPQA 1OXUA 3RS3A 1FMJA 1IQPA 3MWYW 4GL2A 2A78A 1KNQA 2VHUA 3VFDA 1Z07A 4ZPXA 5J47A 2QL6A 4M1OA 4TQUS 2Q6TA 1OFHA 1P2UA 2B21A 4LJ6A 3ADDA 3AVTA 5KU1A 1NVXQ 4KFSA 4Z1MD 3W5JA 1XD8A 3NC1C 2BMJA 2VA8A 2YV5A 2OCYC 4M9SA 1KI9A 2P5TB 4LUCA 1XMSA 1GOTA 2Z4RA 4OQXA 4DCTA 4B3CA 5AUOB 3CX8A 1Z6YA 1KK0A 2J0VA 2LKCA 2XNDD 4IDPA 3WNBA 2ZRMA 1E9RA 2ZI5A 3BB1A 4IRUB 2ODBA 2Z6VA 4Q03A 1YVDA 1FL9A 1ZAKA 2ZJAA 4BE7B 1JPJA 4B47A 2Q21A 3T1QA 1AZTA 2AL7A 3UG6A 2XGJA 1RJ9B 2HXSA 2ZQ5A 3B1VA 3Q5EA 3EPKA 2CCJA 4U7DA 3C16C 5TARA 2R44A 1E9CA 2OUKA 4EPTA 4I81A 3K70D 1OFIA 3AVOA 2YKGA 3G0HA 2PBRA 5C4GB 2X1VA 4LRWA 4MH0R 1UF9A 3ZH9B 4KV9A 1M7BA 3W3ZB 4EPXA 2IYWA 3ZVLA 4RD2A 3T5GA 2VH5R 4DLXA 3AVPA 1Q22A 4C2TA 4D2IA 5FOSA 3SHFA 3J81k 5KSYA 2HLDD 1GTVA 3CKLA 2QQ0A 4HZUA 5JI2E 2GVDC 3RC8A 2VP4A 4LSGA 1H8HD 4M1WA 2IWHA 2ZSBA 4OHXA 2GK6A 5BYKA 5G40A 1Y63A 3ASZA 1W0KD 2BKUA 3C15C 3T15A 2GCPA 2NOAA 3BS4A 3IIJA 2IXFA 4DIEA 1LTQA 3SC3A 5AUPB 1UDWA 3THXB 2W6JD 1CR2A 3GMTA 4HAXA 5K8LA 1ZM9A 4JL8A 1DO0A 1J2JA 2GILA 2ZI7A 2Q9AA 2WWFA 2QG6A 3GFTA 1J7KA 1RKBA 4DBLC 5CM9C 5DSZA 5EE9A 4NTZA 3WY9A 1FUUA 3ZZTA 3IKJA 1L7VC 4NL4H 1YZKA 2IUUA 2HUPA 2D3WA 4E22A 5A5GA 2B6HA 3GPLA 1AGPA 5CB6A 2CK3A 3ZDQA 5J5CA 1I4LD 2WWWA 1DAGA 1G8YA 1JECA 2DHRA 4O2LA 3QF7A 4OQNA 1Z6GA 2BJVA 2C96A 3RSLA 3HR7A 4QM6A 1QHGA 3U3KA 4QBFA 4A8JB 2WWIA 2XTNA 1W2HA 4JVLA 3UXMA 2YVUA 1ZNYA 2YHSA 3B8HA 3K0FA 1G17A 1CRQA 3TSZA 1W4RA 4JLNA 4PC7A 2GESA 4B33A 1ODFA 4IJMA 1A1VA 3ETLA 3GEHA 4PSKA 4MKGA 3DL0A 2DCUA 1G18A 5DHFA 4JKIA 3W90A 3A6PC 2H18A 4Y0AA 4LYJA 4TYQA 3CX7A 3GLHB 3PITA 2GK7A 2R9VA 2RMKA 4MITA 1JEEA 1RW4A 4Q18A 2WSSD 5JWHA 1QDEA 3TMKA 1TTTA 3EZ7A 2Q0HA 5KNDA 4ABYA 4B71A 3M1IA 4M2LA 3W8RA 3HP1A 3PVSA 4NE2A 1U0JA 1Z6XA 4OHZA 3EA0A 1BIFA 3QG5A 3BERA 3DZDA 1PJRA 1Z0FA 1AS3A 3EASA 3U7EB 4XWKA 3VHLB 5CYPA 2DWQA 5CIWA 2FSHA 3T12A 2OBMA 1N6KA 3TJZA 1DAKA 1QHHA 4MYHA 1WE2A 1IN6A 3ZIAA 2R6DA 4AYWA 5C2JB 1MR3F 4KCGA 2W6IA 2ZJ2A 3I32A 4TMWA 3I61A 3LW7A 1E9AA 1DG1G 1N6HA 4CZ2A 1KGDA 4TL9A 4YC7A 3AVQA 3BFVA 2O8DA 2V6JA 1ZYUA 1TEXA 3GEEA 4TTQA 1SKYE 1RZ3A 2YWHA 4QBHA 1XJQA 5KTYA 1G41A 4CW7A 4QJ5A 3AGPA 3QQ5A 4M8NE 2O8EA 1X8KA 3JZAA 1NJGA 1II0A 2ZRPA 4HYYA 4V0OA 4DCUA 3AM1A 3QPVA 2HV8A 5E95A 4DLTA 2C99A 3KJIA 4QL3A 2ZRAA 4AKIA 3BK7A 1QG4A 2J46A 4K81B 3RS4A 4Q01A 3TLXA 1UFQA 4WBSA 2MMCA 4FXPA 2XNSA 1E2HA 4WZ6A 4ERNA 1E2FA 4MDFA 1FNMA 2KE5A 1R2QA 1NJFA 2R2AA 1XMVA 2XAUA 3U7GA 5EE0A 4GOXA 1TU3A 2QAGB 1N0WA 3A4MA 2HLDA 3FOZA 4FMCB 1CJKC 4BLOA 3TSWA 1G6HA 1BYIA 4KU4A 4RKFA 2O0KA 1DS6A 4PTLA 2AX4A 4C3ZA 1H8HA 3K0AB 3M4YA 1MO4A 3GJ6A 4FMCF 1LF5A 3AF4A 5AUQA 3VR3A 1U98A 1T3LA 2DFKB 4WXRA 3QBVA 4D4LA 5CM8B 1SGWA 4TLDA 4Y0VA 3VTKA 4LPSA 3TAHA 2R6CA 4XIGS 2BEKA 3REFA 1G1MA 1OV4A 4A8JC 4DUGD 5A0FA 1AKEA 1YZTA 1NF3A 3SJCA 2PT5A 4WAUA 4HZUB 1N6PA 4PZZA 1EFHA 2XTZA 5KNCA 1ZCAA 5GADl 1SVMA 4BLSA 1HEIA 4US1R 4XD7A 3O8DA 4DHEA 3F8TA 5AJXA 4XOIA 2D2EA 2WAYA 2P5SA 1AK2A 4OK3A 1E79D 1KSFX 3SE0A 4X8HA 1KI1A 3GJ3A 3D6TB 3BH6A 4JS0A 1S0UA 3BC1A 3K1JA 4G1UC 3T5DA 4BRUA 1GDDA 2PEZA 1E94E 2ORWA 1YZUA 2HT6A 3L0SA 3K9GA 3I8XA 4IOJA 3MWJA 1RE0A 4TQ9A 1RYHA 4V03A 3NTUA 3JZMA 3EWSA 1GSIA 2GZAA 1E9EA 3IIMA 1M34E 1BMFD 2QMOA 3ECCA 3FHTA 2IYYA 4DDTA 3R9WA 3OFND 1O3YA 3CRRA 4O2RA 1ETUA 3A1TA 3WBKA 1QBKC 2F6RA 3B5JA 2ZI4A 1IOZA 2KWIA 2ONJA 3K0FB 3ZS8A 2ZRHA 3BXZA 4EPVA 2ODNA 4FWIB 3AKDA 1SXJA 3F3YA 2IYSA 1D2EA 3O8CA 3VR4A 1UKEA 3Q8XB 4RFSA 1J8YF 5EE1A 1MRSA 2G77B 4RD1A 1OFTA 4WZAE 4DCVA 1IXRC 3TE6A 1E9SA 1J8MF 1Z5ZA 1GRQA 4LBWA 1K6MA 2BEJA 2GRJA 4Q4JA 3T1TA 4NYJR 3ZYCA 2QU8A 1Z6TA 4V0ME 5TXGA 3V9PA 1NVWQ 1XTQA 1OH8A 1FW6A 1FX0A 3BE4A 2DWOA 1SHZA 3WP0A 5G53C 4HI0E 1U81A 2VHTA 3TW8B 3U7FB 2FEMA 2IHYA 3NHAA 4L4UA 4D0GA 4Q7MB 1ZC4A 5CLLA 1EX6A 2E87A 3K0SA 1XCMA 2UKDA 4CGZA 4C4PA 3EC1A 1ONBA 3LRPA 4AI6A 1NVVQ 1QHHB 4F7WA 2VIIA 3C14C 4OQFA 1UBEA 2GF0A 4Q4HA 2CE7A 3GFPA 2AKYA 2N42A 2QSYA 2GHIA 4B6EA 3QIAA 3H0KA 4GP6A 4P33A 3WBJA 2O8DB 3EZ6A 4QXAA 2NO7A 1NSTA 3VKHA 1P9NA 2WJIA 1JNYA 4XSHA 2REOA 1U0LA 1P7CA 1Q3TA 1Z22A 4HLUA 1CLUA 2O8EB 3GFOA 1G4UR 4LY6A 1KKLA 3IDQA 2QPTA 3H86A 3WYGA 3L8ZA 2J87A 4LYHA 1NLZA 2QI9C 4TMTA 5FTLA 3U60B 2ZJYA 3SJAA 4B2IA 2VYFA 2KBEA 5HKKD 3K70B 1K5GA 2VP2A 4P3YA 1KDOA 1Z29A 2ODEA 2RB4A 1E69A 4Q4AA 4WA7A 3BGWA 2GAAA 2RAPA 1UBCA 4FCVA 5EP2A 3RVBA 4HUQA 4AG5A 1NY6A 3UWOA 2CHQA 4J0QA 3T06B 4ZV4A 5K8TA 4OL0A 5KDOA 2D06A 4JYBA 1X8JA 3KKPA 4K46A 2B8TA 2G1KA 3AVYA 2QGZA 2W00A 2RGNA 3RS7A 2O8CA 4UNQA 1JAHA 3CF0A 3CPHA 4B2PA 1KO5A 1D9XA 2WOJA 3BWDD 4HB4A 3WMGA 4Q7LA 2G0TA 3W8NA 1E0KA 3CF6R 3LBNA 1HT1E 4IKEA 3AP1A 2C77A 3B1YA 5FPSA 2JDIA 2HXYA 4C2UA 3TR5A 1QVAA 2C04A 5JRJA 4BZQA 2ZU6A 1NP6A 1T0HB 4M1TA 5FTKA 4KAXA 5FI1B 2F43A 3PG5A 2PH1A 1V5WA 2CL6X 1J70A 1NL3A 3QF4A 4FCWA 4IDQA 2CLSA 4QFMA 1HURA 1GUAA 2IEZA 1T4GA 2IHBA 2W0SA 3OEHD 2JASA 1N0VC 1R5BA 3D31A 3QY0A 1LY1A 2RGXA 1ZU4A 2V1XA 4HLDA 4PQYA 2DY1A 3ZD7A 4JT2A 2JLZA 5IF9A 3AB3A 5SZIA 3VU9A 4D82A 5B64A 2YOFA 4A82A 5DE3A 1Z0DA 3B13B 1BMFA 3OIVA 4XJXA 4QRHA 4OYHA 1ZIPA 3L0OA 1IY1A 2D74A 3U61B 4OK5A 3QXSA 1N5LA 5JEDA 1W36D 2VP0A 4C7OA 1XD2A 2ZAMA 2YC2C 3KB2A 3KTAA 3OEEA 5FBRB 4ZCMA 4QHYA 1U8YA 2IS1A 2CCKA 1WBBA 3B85A 3NIBA 2QZ4A 3K9HA 2IC5A 2PZGA 2B7BA 3TBKA 4IEEA 1ZD8A 3SS8A 4DDVA 4PQFA 5DI3B 4QNRA 3ZLJA 4Z54A 3DKPA 621PA 4M1MA 1F2UA 1GFIA 2HEIA 2J1LA 1ZC3A 2ZRCA 5J40A 2OO7A 1PLLA 4IEIA 4H1UA 5HPYB 1SKQA 1ZUHA 2GJKA 2JEOA 4JBXA 2QBYA 2NPFA 4UKDA 1JXOA 2IA5A 2J59A 2O0HA 2ZR7A 5IHPA 5BQ5A 3U3RA 2XSZD 4LJ5A 3A37A 3ZZ0A 4MUAA 2ZEJA 2WV9A 1T6NA 1CR1A 1HYQA 3HDTA 1OE0A 2PJZA 3W3AA 4Q4JB 1Q12A 4TL6A 5GVRA 2XJ4A 1G5PA 2LCFA 2C5LA 4RSGA 1H65A 3FYHA 1OXVA 1FX0B 3K70C 1U8AA 1BKDR 2IK8A 3EC2A 4LWZA 3GLGB 4BLQA 2IEYA 1XTRA 5DI9A 3KQHA 1HTWA 3KQKA 1E0JA 2X77A 1P9WA 1XRJA 4CDGA 3KQLA 2P6RA 2I1VB 2ATXA 1W5TA 2QENA 3I3SR 3TH5A 1NN1A 3QSYA 4L9SA 1OKKD 1TQ4A 2R6FA 4QGFA 3U2QA 4HEJA 4Q7KA 1T8TA 3I92A 2H17A 1ZMXA 2RCNA 2B8WA 1O87A 2EFDB 2RGDA 4G5QA 4N0EA 2ZS8A 4IXMA 5HKKA 4OI2A 1XNJA 2ZRGA 3LVRE 2NO6A 4AY2A 1NMZA 1A4RA 1OH5A 4PAQA 4M9XA 1ZNXA 2A5YB 3FHOA 4I4LA 4KSBA 3A36A 4X8OA 3GLGE 3S1AB 1G7TA 1W4CA 3QXJA 2IUSA 4G5SA 3VR1A 2AK2A 2G3YA 5D3MA 1EK0A 2NIPA 2KB0A 1US8B 1IM2A 3P1JA 4DZZA 3CR7A 1SQ5A 4F92B 4LGMA 1PLKA 3EARA 4Q4AB 4EQ6B 3MLEA 1RJ9A 2HT1A 4HUQB 4ZCLA 3TNFA 3PEVA 2JCSA 2YWFA 3N2EA 3EZFA 2OXCA 1DAEA 2FMXA 4NYIQ 3QNUA 3RABA 2O8CB 1M6NA 4URYR 2IBMA 4DJTA 1JPNA 4NBSA 2VRWA 4DRZA 5KPJA 1M1YE 3V4RA 1ZVQA 2JIZD 4PX9A 4CEIA 3DOEA 5DYGA 5C4MA 2CHGA 2G83A 1CBUA 4DLVA 5M04A 1Z2CA 2J7PD 5JMTA 5F98A 1OXSC 1TQDA 2QP4A 1E1QA 4KYUA 1RPZA 1E1RA 1P2VA 3LAWA 1P75A 1FUKA 1S2MA 4TMVA 2Q3HA 2QQEA 3NH9A 3QF4B 4HB2A 4R2IA 4C0SA 3THXA 4ESHA 5FOUA 1NIPA 4NDZA 2IS2A 2V3CC 5LB2A 2NZJA 1SXJC 2E1RA 5HE8A 4AWXA 1GRRA 1XCPA 3VU9B 3H1TA 4MKIA 4R98A 2NGRA 2UVQA 4X8LA 4DLZA 2CXXA 4PSAA 2H16A 1LS6A 4XVRA 2BCJQ 2OILA 2FOLA 1XMJA 3NEYA 4LV8B 3SZRA 2EYQA 2W2XA 3BJIC 5DO9A 4QJ3A 2Z5FA 1E6CA 3ZD6A 2ZYVX 4US0R 5SZJA 3I4LA 1RFLA 1WQ1R 1XJCA 3KTAB 5FBQB 1R0WA 4XH9B 3KJEA 4MYUA 4A8JA 4Q1BA 3VR6A 1DOAA 2FDCA 4F4JA 3IUYA 2VSOA 3E5HA 4Q21A 3IGFA 3ZGXA 3FKSD 4LDJA 1MRNA 821PA 2PZEA 3KXIA 4L15A 4R2HA 1XX6A 1M7GA 2PL3A 4IVRA 4TZ0A 1VMAA 1QHNA 4ITRC 4MQBA 3RSOA 3CF2A 1F48A 4QHTA 4PPNA 5JBQA 4D25A 4CF7A 5E4FA 3TRFA 4D6PA 5L3SB 1OH7A 1GKYA 1EG7A 2QMUA 4TLBA 2IUTA 3GCGA 3QKSA 2ZRDA 4NCJA 3RLFA 3A58B 3I73A 2WZQA 1G5RA 2JJ2D 3Q5DA 4HB3A 4Q7JB 5JCZA 2VHCA 3VX3A 1UPTA 4HLUC 2F3RA 2OLKA 2FZ4A 1Q0UA 3AQ4A 2PZFA 1GM5A 1VYUA 5HTKA 2AKAB 3LD9A 2IT1A 2ZYTX 4DIDA 4D81A 4FD2A 1U0HC 3HYRA 3ICQB 1X6VA 2JLUA 1DELA 4NP6A 4NONA 5KOYA 1NBMD 4ASUD 4B3FX 5EXSA 5L3VA 5C18A 3BH7A 3IIKA 5H70A 4R9UC 3B1XA 1X3SA 4WXPA 4TLCA 3ZVRA 4XTRA 2UZIR 1EXMA 2RGNC 5B57C 1BH2A 2RGCA 3CX6A 5KSPA 1Z3IX 1XMIA 4YXWA 2EFHB 4UXJA 2QT0A 1EFRD 2WVJA 1VIYA 2ZAOA 2QTVB 3D3QA 4LOAA 4TT3D 1LVGA 1VCMA 3PV0A 4QHSA 4BQSA 1A2BA 3AEZA 1QRAA 3TIFA 1UADA 4TLEA 3IHWA 1GL7A 2C8VA 5HCNA 3FKQA 3IHLA 3MD0A 4BFSA 1EWRA 1LV7A 2GAOA 4M9ZA 5CB8A 4LJAA 1FTNA 1Z0KA 2OCAA 3H84A 2BCGY 1AS2A 2JLRA 5D3MB 2ZVPX 1E2DA 1U2RA 3I1FA 2QAGA 2JIZA 2WPDD 5JHHB 3SFVA 3VQTA 5DYIA 2NZ8A 1XEXB 1GWNA 1GKIA 3W6PA 3K0AA 2PCJA 2QORA 4GFDA 1T9HA 2DB3A 4NPHA 4CIDA 3P20A 1GNRA 2RGAA 1W4BA 2ZJ5A 4KJZA 4ZCIA 4BEJA 4BLTA 3CRMA 3KL4A 3NHBA 3KB1A 5GVSA 3BAFA 3LBIA 4PHFA 2VO1A 4R7ZA 2OZEA 4LYFA 3O8RA 4TQAA 4CEIB 2ZJOA 2BWJA 2FWRA 3MWLA 3ONWA 3UIEA 2X2FA 1P2SA 3KUDA 1WXQA 2FNAA 4P31A 3R8CA 5K8IA 5DN6A 3GJXC 1G8PA 1HUQA 4IDNA 2V4ZA 3AVXA 5EQTA 4PO1A 2CVFA 3DEFA 1NKSA 4Q47A 1W36B 1L4YA 3X1WA 3M0EA 1U8ZA 1AZSC 1CXZA 1VIAA 3AKCA 1LS1A 5FPHA 1FOEB 2A3RA 5KSZA 3BIFA 3NBFA 3VHXA 3W34A 4F4CA 1YR6A 2ZJZA 3TVTA 4PANA 1KOFA 2OE2A 2XTMA 1Z28A 4K8OA 3N2IA 1MKYA 3GD7A 4EDHA 1VHLA 1MO5A 2OCBA 4DT1B 4NYMQ 3BORA 2FN4A 4O3MA 2Z4SA 4DSNA 4L9WA 4O0MA 1SVKA 1P62B 2BKEA 4QGAA 2J45A 5KO2A 2FSGA 1RYFA 1MO6A 3RRZA 3SEAA 4ZI2A 3AVWA 4TYYA 2E9SA 1W0JD 2ZUCA 2BOVA 4V0MA 4BFWA 2WOOA 3CNLA 2QA5A 3G5UA 3CRQA 1AN0A 4HZIA 2F1HA 1Z6AA 4MRPA 2JJ2A 3B2EA 3AH8A 3IILA 2ODWA 1H8EA 3PFIA 1NG1A 4B48A 2RKOA 5DISB 1KSHA 3ZQJA 3DDCA 2JJ1A 1DEKA 1T0JB 3OE7D 2IYLD 3VAAA 4DCNA 4RZ3A 4DEYA 4ZDJA 4BUJA 1B23P 3FFBA 3A8TA 1NMXA 3DM5A 4C9BA 4ASUA 4QG7A 1FQKA 3QKSB 2AK3A 4MKFA 1KO8A 1SKYB 1DO2A 2CHVA 2PT7A 4XTCS 2WJVA 1VYTA 5FPYA 4TSFD 4NCIA 1RRFA 3QEJA 4PHGA 4A2WA 4TYNA 2F1RA 1L4UA 5SZHB 4CEJB 1CJUC 4BLPA 1RRGA 2WMNB 1OJLA 1ZW6A 3RYTC 4QKQA 4W7SA 3B9QA 5D3QA 3L0IB 1J90A 4JVNA 3TKLA 1OYYA 1CJMA 2PCLA 4EAQA 4WOPA 1JQLB 5KDDA 1EFRA 5AJWA 3VX4A 1C9KA 4Q4LA 5DNYB 3CZPA 1MABA 2RGEA 2IWRA 2BVNA 4Z1MA 3UG7A 4URZR 2PJRA 3QXXA 5GJBA 1W5SA 4PAMA 5FUXA 4B35A 3HR8A 1Z06A 3FMPB 3RNLA 1G21E 2QPAA 1E3MA 2BBOA 2VQSA 4PFSA 1YKSA 2D4HA 4A15A 4KYIB 1B0UA 4Q1DA 3MRSA 2XNDA 2OHFA 3OAAD 3B60A 4OKSA 5JS7A 3Q7PA 1YE8A 2GJ9A 2WPDA 4AKHA 3PUXA 1R0YA 4JT4A 4RCYA 4I1VA 1ZD1A 5IRCD 5J4YA 1D9ZA 5BXQC 3OHMA 2IS6A 1GNPA 1XP8A 1GAJA 1TU4A 2C98A 3VR5A 2XJ9A 4Q9IA 3A1WA 2YZ2A 2W2VA 2JA1A 5TB5A 3TR0A 3WNCA 2O5VA 5LD2B 1CS4C 4C30A 1AKYA 3R7WB 4MDEA 2LKDA 3SFZA 3X2SA 2RGGA 4URWR 1JEDA 4HUTA 1IN7A 1ZM3A 3L0PA 1R0ZA 1DAFA 2C9CA 1EX7A 2GEDA 3PUWA 4KO8A 2I1QA 1CRPA 5TDHA 5BN5A 1W0KA 3EX7C 1E2PA 3SYLA 4QBIA 2GCNA 1AA9A 1OXTA 2OFOA 1FZQA 2W6JA 1E4YA 3DKVA 3NKVA 3UK6A 4GP7A 4GI7A 1OYWA 1KKMA 1KMHB 4KBGA 4UNRA 2IYTA 4LJ4A 3MAAC 1NVVR 1W46A 3VR2A 4ZDKA 1RIFA 4M53A 4B3DA 4EUNA 4TZ6A 2YWGA 3PEWA 1VG8A 2DYKA 5CITA 2ONKA 2NO1A 5EJEA 4KFUA 2Q9BA 3PUVA 2XOKD 2FV8A 3C7KA 4B43A 4FINA 1TF5A 3GJ7A 3K0CA 1Q1BA 1HQYE 4HATA 3GEIA 1XPUA 2ZRBA 2GDJA 1W0JA 4Q48A 2GBLA 3GP8A 3EPLA 3KQUA 2OV2A 1LF0A 4B2LA 3SOPA 4IFBA 4Z8YA 2XX3A 3LBHA 3A4LA 5IDVA 1M74A 1VTKA 2NTYC 3BRWD 1UEIA 1P9RA 2CVHA 2ERYA 4W5WA 2FU5C 2DPXA 1PUJA 3TQCA 3I8SA 5CK4A 3OIYA 1XEWY 5KPDA 2JGNA 5DI3A 4HB0A 4MRNA 2WSSA 2FX3A 4LYAA 5C1BA 3KZ1E 3W5IA 4UNSA 2ZE8A 1AM4D 1G8GA 2CL7X 2OM2A 2Z83A 1HQCA 2ZUDA 3UMRA 1F60A 1GRNA 2WHXA 4KFRA 4QGHA 3BD9A 5JHGB 1JR3E 1P4SA 1CKEA 1E9BA 3QKUA 3K53A 3VMFA 3A4NA 2AR7A 3CH4B 3I5XA 3EIQA 1VCNA 2F1JA 4TMZA 1EWQA 2FSFA 2KI5A 3GLIE 1WDTA 2JATA 3T61A 3TGPA 4OI4A 4JVSB 1P3JA 8OHMA 1VHTA 1LB1B 4RY2A 4B44A 1ZUIA 2FEOA 1DBSA 2ASEA 2IF2A 2ZPTX 3CBQA 3EAQA 1RRPA 3QOFA 3KKMA 4A6XA 2HYDA 4LHYA 4PC3A 1G19A 2Y8EA 2C9YA 1ZM4A 3P32A 2ZE6A 3GLGA 4EJSB 4PXAA 5FBWB 5LD2C 5BW8A 2G1JA 3K09A 3EW9A 2QM7A 1LNZA 3L2OB 2OT3B 3NEJA 2QAGC 5TY0A 4GDFA 2CEAA 3KXKA 2WIAA 2BDTA 2ZI3A 3FE2A 3SJZA 1DARA 1MH1A 5FPTA 4F93B 1A5TA 1T3HA 1MABB 3CR8A 2WM9B 1YRBA 4M1KA 4B76A 3TUZC 4PC1A 3N5CA 3IPYA 1NBME 1KI8A 3SR0A 1E2KA 2OEPA 4IHQA 4JLVA 3FVQA 4JSYA 4WIAA 2CLDX 1Q44A 2AWNA 3BB4A 1JJ7A 2WAXA 2Z43A 2OSBA 3S1AA 2X2EA 3KX2A 1HE1C 5AJZA 2WJGA 3BH0A 3OESA 4M1YA 1N6RA 3LQQA 1UBGA 3AV0B 3CNNA 2YJTD 1WMSA 2PX0A 4MGIR 4Q02A 1US8A 4OHVA 1G6OA 4FIDA 2FH5B 1FTSA 2IL1A 3CB4A 3LLUA 4EQ6A 2MSDB 3EIHA 5JWOA 3B1WA 4JLOA 3BB3A 1D6JA 5TVKA 4DCSA 1KI3A 4DUGA 4S2EA 3HU3A 721PA 3PEYA 1UKVY 4ZDIA 1SVOA 1VDZA 3U44A 1XBTA 3LQRA 5CDFE 4ACBA 4HLQB 1VG0B 4BFZA 4AKGA 4D26A 1FP7A 3THYA 4PHTA 3SBDA 5ANRB 1CP2A 2VLIA 2QTHA 5G3ZA 1SHKA 1E79A 1XDBA 1ELOA 5JJKA 3NXSA 1VKJA 1XEWX 1JB1A 4ILEA 1TMKA 2XITA 4L5BA 1I2MA 2PMDA 2P6UA 5EXTA 3LV8A 1G3IA 3UPUA 1XXHE 4QGGA 2O8BA 2CJWB 4B74A 5CIQA 1ESMA 1R8SA 1QHYA 2GCOA 4KITB 1XTSA 2EFCB 2P67A 2J41A 1XB2A 4POAA 1F2TA 4HSEA 2B92A 2X8AA 4JLPA 2JJ8A 2MSEB 5F9FA 3QI2A 4CEHA 2YYZA 3QENA 421PA 3HPRA 3OFNA 4YMUA 1QHSA 3X1XA 2VHQA 3MCAA 4NHOA 4ZIRA 1R6BX 1DTSA 5EE5B 4Q1AA 1E0SA 1N6LA 1SVSA 3LXXA 1Z2AA 4BFXA 3CW2A 2NG1A 4FI3C 2BBWA 1YHNA 2H5EA 1E96A 4GZLA 4NKRA 5KDLA 1YRAA 2FF7A 3DVLA 5E7IA 1KK3A 5FPKA 2HCBA 1KNXA 2CE2X 3DPUA 2YOHA 3Q9LA 3T1OA 1XTJA 2IYRA 2V55B 3MJHA 4HAWA 4DSOA 4YMSA 5BWMA 1R5OA 3LDAA 1BOFA 1RVDA 1XWIA 1T5IA 1C4OA 2ZSAA 4P4TA 2EVWX 3B7GA 5AR1A 1VECA 4NYIR 5L3SA 5FH9A 3SBEA 2F55A 4C0HA 2Q3MA 2ZS9A 1DG3A 2KBFA 5EP3A 3MG9A 1RRCA 1R8QA 5JWRA 2ORVA 1XTIA 4XWAA 221PA 3EZ9A 2GJAA 4DXAA 1UJ2A 1VG1A 2FFHA 1IONA 4PO9A 4YDSA 1COWD 4I1UA 2DFNA 3CUEF 2F9MA 3NVAA 1G291 3THOA 2KSQA 2ZRLA 1ZU5A 1Z8FA 4RD0A 3HU1A 1OB5A 4JKYA 1E4VA 1E98A 3F0TA 4JLJA 5IK2D 2I4IA 5FOWA 2QEQA 1W4AA 5JSZB 4Q9KA 4LV5B 3MFYA 1A82A 4IXNA 1WB9A 1KTVA 4NCHA 2XZPA 2H57A 1TADA 2NO0A 2IF0A 1NG9A 1AQYA 1KJZA 1SVIA 1JR6A 4O25A 4JYCA 3BBPA 4M21A 1OB2A 1R4AA 4NCKA 1HH4A 4YONB 1QZXA 2QE7D 3RS5A 4NMMA 1GL6A 2SHKA 3K9LA 1G16A 4E03A 4UNNA 4Q1EA 1T3SA 1VYVA 2F1IA 2FGJA 5B58C 1ZNZA 3FHCB 5IT5A 1NVUQ 3C41J 3P26A 1IJFA 5CLQA 1XEXA 5AUNB 2OAQ1 2O0JA 2ZJBA 4TMKA 5L3QB 3K0CC 1P73A 3WMFA 3VKWA 5FR1A 3V4FA 2ZRJA 3CONA 4FMDB 1ZBDA 1TF7A 2GBLC 1P5ZB 2HJGA 3U6BA 3VNUA 4YMTA 1GITA 2ZM5A 3EG5A 2ZIAA 3B1ZA 4M22A 3OEHA 2BMFA 3LX8A 4M4SA 1E99A 3U44B 3TK1A 4B32A 1E2IA 5FOTA 3TSOA 4FWTA 3U3OA 2D7DA 3NDPA 2A2ZA 1L2TA 3THYB 4KLZA 3RWMB 3IO3A 2FZLA 3ND9A 1G64A 2A5GA 1NNEA 2ANBA 4JJZA 5CJPA 2VBCA 4PPFA 2WWXA 4N3NA 2CDNA 1UKZA 5KSOA 1II9A 2R6GA 2BM0A 3DM9B 2QMHA 3CO5A 4JLAA 2TMKA 4PZLA 4D0LB 5F3WB 1XPRA 4LC0A 1ZM2A 5G3YA 1IAQA 1KY3A 2O8BB 4F91B 5P21A 1ZIOA 2RHDA 2JLWA 5AJYA 2GCOB 5TMPA 1F2TB 1FMLA 3LFUA 5B2ZA 4DT1A 4NU0A 4DVGA 3GLFA 3AF1A 2FFAA 4CEHB 1KHTA 3THWB 1ZM7A 1KI7A 5CK5A 1ANKA 2ZR9A 4CVNA 2R8RA 4ZIRB 2ZU0C 3R9IA 1W7AA 1OXXK 5JEEA 3GJ4A 1U94A 4GPTA 4ZO4A 1JR3D 3ADKA 4RKEA 1JJVA 1P72A 4A92A 2XXAB 4PO8A 1HY3A 3EXAA 1W1WA 1Z63A 1Q3HA 2AXPA 2ZVQX 2CBZA 2GJSA 4B6FA 3K09C 5FL3A 4BGDA 2XSZA 3D8BA 3SYNA 2OBLA 4GSYA 5AK0A 4LHVA 4JBYA 4G0NA 2P65A 1FFHA 1WP9A 1CIPA 2XZLA 5K8UA 1OW3B 2F7SA 1YR7A 2R65A 4OK6A 2NPIA 2IYQA 4RD6A 2ZXUA 3GJ8A 4G3XA 4URXR 3Q85A 1MV5A 5SZKB 2W0MA 3BFXA 3BFKA 3SQXA 1ZP6A 4MKHA 5H68A 5HE9A 4JLKA 4Q1FA 2G6BA 4Q9JA 4OJQA 5FFMA 3C5HA 4W9MC 2WWHA 4CEJA 4FN5A 3QKRA 2OBNA 5F2EA 1OKKA 4MYCA 2Z0MA 1XU4A 5EP4A 2CK3D 5HCIA 1IN5A 2VP6A 4JZKA 1KIMA 1M8PA 1R0XA 4WVFA 2WSMA 4BLRA 5LBIA 1GG2A 5JJLA 2GZHA 1NIJA 3U4QA 2BMEA 2EYUA 1QG2A 3QG1A 4AC9A 1P6XA 1Q21A 2QSZA 3FTQA 3MGCA 4UQOA 1FQJA 3SU8A 3T34A 3UANA 5JI3E 5KUTA 2QE7A 4DC9A 3U5ZB 1EESA 2CLCX 4LJ7A 4ZKEA 1ZCBA 3GJ0A 1TUIA 1SZPA 4TL8A 2FSIA 4NYMR 2C78A 2C9OA 1N6NA 4MRSA 4FMBB 2GXUA 2AHOA 1LFDB 3ZS9A 2YC4C 2DFTA 2J5XA 4IDHA 5J4HA 1OFUX 1OH6A 1Z0IA 1II8A 1Q1ZA 1XJ0A 1WCV1 2L0XA 5JZVA 3PUYA 4A0FA 3W6NA 4GBMA 3RC3A 3SNHA 121PA 4QJ4A 4TN1A 3E70C 5FTNA 3PCRB 5AJVB 3REGA 4BRWA 5A4JA 3AVVA 3R7WA 4Q5IA 5HZHA 2FPLA 2IW3A 1MO3A 4PC2A 2O8FB 3OF5A 3KXLA 1N2CE 1PV4A 1BO6A 3ZIAD 1Y3AA 1XTKA 5GJWC 1N0UA 3O8BA 4N1AA 3SQWA 2HF9A 1IN4A 1G8HA 2J7PA 2OESA 2W6ID 3I72A 4LX0A 3EWAA 1A2KC 3FB4A 4KHZA 3CZQA 1S1MA 2QN6A 3LXRA 5F9HA 1GKUB 3DMDA 3LVQE 1PVOA 4KXFB 3RAPR 2AFHE 4MGKR 3ZJYA 3LA6A 1OIWA 4IFEA 2HJVA 1KAGA 3CWQA 1KMHA 2BV3A 1QVRA 1PLJA 5JLJA 2C03A 2ZSEA 3FPAA 2QRNA 4BFUA 3T1VA 4CT4B 3PEUA 2FPKA 1G7CA 5TV2A 2FGKA 3TAUA 2GWHA 1G3UA 4IVQA 1Q57A 3LO5A 4JMPA 1D2NA 1E9DA 1X8LA 1GL9B 1KDPA 1TEVA 5HZKA 2GA8A 2IS4A 1NI3A 1IY0A 4YMVA 3RS0A 4LBYA 1CF4A 5UKDA 4HAYA 2V6IA 4QNMA 1JR3A 5J4VA 1S8FA 1ZRHA 3QKTA 4A0RA 3AP2A 3AGQA 4D4JA 4AYXA 4DKXA 3FKSA 3EA5A 2YNMA 3GLFB 3OIWA 3GLIA 1DE0A 4RZUA 1CEEA 4A36A 5DHAA 3H2YA 3LY5A 3RRYA 2LWIA 2ZI6A 3ADCA 2QNRA 4PAOA 3RRNA 1AS0A 3RHFA 1QHXA 4HDCA 5ELXA 1E2JA 2J7KA 4KODA 4GT1A 4V02A 1YZQA 4B75A 3IEVA 4GMXA 1YJ5A 4D0NA 1JAIA 3DHWC 2ATVA 4XD7D 4NH0A 4B3BA 2GXSA 1NKTA 3WHKA 4A2PA 3GLFE 1D8TA 1OIVA 1YU9A 1Z83A 2WJJA 4JSTA 1X86B 2H1LA 6Q21A 4C0KA 2V8OA 1NBMA 4DLUA 1P2TA 1GVNB 3Q3JB 3A1VA 4B73A 4PC6A 1DAHA 2OFXA 1S1CA 2VF7A 3O47A 5EUQB 3P4XA 1AIPA 1CR4A 4C0QC 1UAAA 4EJSA 3QKRB 4A4DA 2ECKA 2AWOA 4QOSA 3SI7A 4BFVA 3KKQA 2F3TA 2ZE7A 1W44A 3KFXA 4B3XA 1PZNA 1CTQA 3QXHA 3HU2A 4P0TA 1GP2A 5CJ2A 3CPEA 4TT3A 5B30A 4HAUA 3NH6A 4OQMA 4IOMA 5JRZA 2I3BA 2F9LA 4N0DA 5H8WA 3U4QB 2A9KA 1IXZA 1N6OA 1TF2A 1L8QA 5FUWA 2HF8A 3N70A 2BM1A 2ZYWX 1SXJD 2IYVA 2GNOA 3JVVA 2G9NA 2FG5A 1CULC 3DOFA 4DDUA 2C2HA 1J99A 2QM8A 4OI0A 2A7QA 5CDFA 3FFAA 1WA5A 3WYFA 1E2GA 1WF3A 5BYJA 1NMYA 3K0EA 1AJEA 4Q9HA 2AXNA 3GLHE 3U3MA 4PSVA 5KNBA 1II8B 1OIXA 2XEXA 1G3QA 1SVWA 2N46A 4KI0A 1HT2E 3NDBB 5JECA 2H8KA 4CRWB 3ADBA 1GIAA 4GZMA 3MUFA 1E32A 1W49A 1OHHD 2FJUA 4IDOA 4RZ2A 2BBTA 4AD8A 1W36C 4LCBA 1TUEA 2GTPA 5LPNA 1U9IC 1XXHA 4EPWA 4AG6A 1S3SA 3ZZUA 2ZREA 1LW7A 3G82C 4EIWA 2HCJB 4IOLA 4PPGA 1UDXA 2EFEB 2ZRFA 3NBYC 1NN5A 4LHZA 4ESVA 1X1SA 4F38A 2GEVA 2Q9CA 1KJYA 4P4SA 2W58A 2W2TA 3SN6A 4MUBA 1XPOA 4B34A 4LBZA 3EIEA 1NY5A 4OBEA 2ZITA 3FMFA 1G5TA 4GRAA 1E2LA 2G0NA 3RANA 3U6KA 1D2MA 3C8UA 2A5DA 2V7QD 3SHWA 1KI2A 2WKRA 3UKDA 4BZXA 2EU8A 2QAJA 3PJRA 2ZETA 2CJWA 3WNDA 4Q19A 4UXHA 1TQ2A 2QUZA 4QBGB 1HV8A 1XFAA 2H7VA 2X19A 2WJHA 4QC2A 3QVVA 1JQJC 2ZR0A 1G3RA 1QHIA 4P4UA 1RC8A 2J0UA 1G20E 5CYOA 1XZQA 4E5UA 2FPMA 4KBFA 5LDDC 1CU1A 1N5IA 4YMWA 3TQFA 2GEUA 3WRYC 2PEYA 4DDWA 1FPMA 1F6BA 3MSXA 3LW8A 2GXQA 3ZQ6A 3IBGA 4C0BA 4MYTA 2ZANA 3W6OA 5H1YA 2OAP1 1ZJ6A 2ZTSA 3GLIB 1ESNA 2VSXA 3QE0A 4L16A 3CH5A 2QGNA 4LBVA 3OE7A 2JDID 4M1SA 1EFUA 3SYKA 2WJYA 4AYTA 4GNKA 1KAOA 4C0AC 1HA3A 3L82B 2OFWA 5KYKA 3PUZA 3ZVMA 4DLSA 1JI0A 1KI6A 3IBYA 4BEBA 2QT1A 2GXAA 3JVUA 3Q72A 4TSFA 1OPXA 2DBYA 1I4TD 1E2MA 3QPWA 1VPLA 3D7MA 4LK2A 4LPKA 2J9RA 1S4QA 1T91A 1KSJA 4JVMA 4V0NA 3LX5A 3MMPA 3WYAA 2OCPA 1MOZA 3EPJA 2WICA 2QMEA 3L8YA 1KJWA 3OIUA 4AKEA 3F5FA 4LV6A 5JCPA 3CWZA 4WZBE 2C95A 3EPHA 3OEED 4HDQB 4LHWA 3LNCA 1U99A 5E7JA 2UZ3A 4IOKA 4H9GA 3QEOA 2D62A 2GVZC 4Q9LA 4IW3B 1WBDA 2IYXA 1TAGA 2BMDA 3OAAA 2V54A 1NRJB 5FUYA 4R71A 1KK2A 4BPBA 5JSZA 5HR5A 2ZS7A 3DMNA 3CNOA 3FGNA 2CNWD 1R7RA 2DWPA 2YWEA 1IHUA 3AP3A 4C0JA 5J4KA 5E7MA 2ZJ8A 4EKDA 2NMVA 1D5CA 3K8YA 3WHLA 1JBKA 1AGRA 5EXXA 1QF9A 1CJTC 1OHHA 4NZYA 4A0HA 3MWKA 2WKQA 3W9YA 2EW1A 1R10A 1N25A 4TYWA 3H4MA 1Q1QA 3KFVA 3R20A 2O52A 1XEFA 3PQCA 3K9NA 4LJ9A 4URUR 2MSCB 1N5JA 3AUXA 3RDPA 5LB4A 4TTPA 1S96A 1YR9A 1KDTA 3CRW1 1I4DD 2ZE5A 5L3QA 4BZPA 4TMXA 1N5KA 2VTKA 521PA 5DLQC 3QJYA 4OI1A 4P32A 5FOVA 4G5GA 1FP6A 1T5LA 1XXHB 4XSGA 4EPRA 2MMGA 4YQFA 2ORIA 4F4IA 1V43A 2V7QA 4V0KA 4CYMA 2D7CA 4JLBA 1EFTA 2VP9A 1UM8A 2KJQA 3HJNA 2WWYA 4DEXA 2AFIE 3RRMA 3B9PA 4P4SB 1IBRA 1TX4B 2XOKA 4OHWA 4LJ8A 3PENA 1N6IA 3CM0A 2GF9A 3LH5A 3L43A 2V1UA 2HYIC 1N3BA 4IVPA 1VCIA 3CPJB 3T35A 2G88A 4W5HA 3UMFA 4I1SA 2WKPA 1GZSA 2FFQA 4EPYA 5EZ6B 2JLYA 2ZYUX 3TW4A 1ZUNB 1UEJA 1UKYA 4TL7A 2QRZA 4ZDWA 2QTFA 4WW0A 3TVDA 5EE3A 2ANCA 3CIOA 2NQ2C 1OT3A 2J0UB 1DVRA 2P2LA 3B82A 1CJVC 1YZGA 3DZ8A 4S35A 3THWA 2VP5A 2IXGA 2IYUA 4NYJQ 4KFTA 2R6AA 3X1ZA 1I2DA 1P60A 1Z0AA 1Z47A 2PLFA 4ON9A 4AURA 3A1UA 4UJ5A 4BWYA 3WMEA 3WXMA 2REXB 2JAQA 1Z0JA 3IQXA 1M2OB 1Q20A 2IYZA 1XF9A 3LLMA 2DFLA 2XXAA 1KI4A 2A30A 4EJSC 2AN9A 1KDRA 2XB2A 4TWZA 3UWKA 2H92A 5AWFC 3NWJA 3NBZC 4OQLA 5DIFA 4B3GA 1E1QD 1E1RD 1VG9B 4ACAA 2REBA 1SVLA 3AF0A 2J0SA 1KI6B 1NLYA 2BC9A 4BFYA 3FWYA 5FBVB 4XWOA 2B7CA 1C1YA 4EFLA 2NO9A 4UJ3A 4X8MA 2QY9A 1Z08A 1K5DA 3E2IA 4PQRA 3Q7QA 4KVGA 4RFVA 1IN8A 3UMSA 3M6AA 2CNWA 2QROA 2V9PA 4MGYR 4ARZA 3KKOA 1W48A 4A2QA 2OG2A 1OSNA 2WMOB 4DSUA 1G7SA 1XZPA 2WBLC 2YINC 4YLGA 5EZ5A 4KLNA 3QBTA 1YR8A 4RZXA 1SXJB 4EFNA 4U5XA 1G8FA 2A5FA 4OJKA 3E1SA 2FA9A 4JLDA 4D80A 1K8RA 2RHMA 3X1YA 1TL7C 2P3SA 2VEDA 2ZSFA 4RFSB 1G3MA 1SULA 3FMOB 4I1OA 1S9HA 4Z51A 4MA4A 2HDNB 3NBXX 4LZZA 2ZRNA 5FL7D 4AK9A 1U90A 2QP9X 4US2R 3I62A 4ZKDA 3R9XA 4JL5A 2ZRKA 4RD3A 1IJEA 3KKNA 1KO4A 2BBSA 3PXGA 3X1DA 1S3GA 2BJWA 4BASA 4V0LA 4II7A 2QPOA 2OXRA 4XVUA 2AD1A 4L8GA 4XVQA 2ZI9A 3VKGA 1HE8B 1SXJE 5FUVA 1TQ6A 2JLVA
chains in the Genus database with same CATH superfamily
1DJQA 1UDBA 4FB5A 5J5VA 4G4SO 1X39A 2JLSA 4Q4HB 1NAHA 2O8FA 1P77A 2VL7A 3OZXA 5FTJA 1JDPA 1NN0A 3IQFA 3MTAA 3QPUA 3CRNA 4AL4A 3IBFA 3AVUA 2HOQA 2A0XA 4HK4A 3AY6A 1TK2A 4C08A 3AKEA 1FFSA 2FRDC 3I1JA 1FP4B 2Q4DA 1LJLA 4TTRA 1EEHA 4A1FA 4Z8XA 3F7OA 2QN8A 5LL6P 3R8FA 2LZ0A 3CVXA 4C20A 2IJGX 3VJKA 1XTVA 2CLKB 2HSEA 2JHCA 4LGYA 4Z9YA 5EP1A 3UV6A 2BLNA 1NVKA 2WIJA 2AC4A 1TNDA 1D03A 1KL7A 1RXEA 2GD6A 3C3AA 5CBKA 4ENTA 2O3TA 4MR7B 2CCGA 2PXAA 3ITDA 4NZOA 3TPFA 2ERXA 4OBBA 2JGKA 4D8VA 3LHSA 5CAEB 1RAIA 4DLPA 4PZAA 5EXPA 3U3JA 3P2EA 4QXMA 3NG1A 2BMVA 4WFIA 4EG8A 1VMEA 1VKRA 4ZQHA 4DCMA 2F8SA 3IERA 2JFBA 4DR3B 3JQGB 3DLBA 3DZFA 4MUHA 5EHNA 4LXUA 5LDGA 5IVDA 1YC5A 3B9RA 4INZA 3DF9A 4K9NA 2R85A 1TKBA 4A0GA 2YJZA 1TAUA 3OE5A 3ZKWA 2PLAA 4MRRA 4BNIA 4PZYA 4CL3A 3VBCA 1W19A 2P6NA 2D1TA 2X7XA 5MGNA 3U7HB 1OR8A 3DW1X 1L8OA 4BBJA 5HKAA 1MNQA 1W47A 3QFFA 3WRXC 1BRMA 2P1DA 2Q4BA 2GETA 1FC0A 4A26A 4D5GA 1P3Y1 3ABQB 3GQBA 2WHRA 3CLTC 4HWPA 4C06A 3OZFA 2PE5A 1TVCA 1UBNA 2F43B 4DBVO 3JARB 2X0KA 2JB9A 4HDOB 5E4JA 2N47A 3CE9A 2WTUA 4ZI3A 2AFRA 3JRXA 3ZE8A 2ZRIA 1H6AA 3UATA 4X7MA 4Y6GB 1Z17A 4R31A 4AIIA 1MC8A 4FCTA 1BYUA 1Q1EA 1YK1A 2PX3A 3AHEA 3OMWA 4RJIA 4YJ3A 3RODA 1XRQA 3VVLA 4KX5A 2W83A 3K5WA 4N12A 4C29A 2Q4EA 4ZGBA 4RTLA 1FDWA 1WPRA 5IKOA 4DB2A 2JH9A 1E9FA 2V4MA 3ITNA 1YB4A 4EYEA 2CL0X 3H2IA 1O0BA 4R1PA 2BIFA 3JTMA 3QVUA 4YIHA 2IKQA 3CINA 4JZYA 4DR5B 4C21A 4QBTA 5HCUA 4Z3DA 1RAEA 1WXHA 2IY8A 4H1VA 1SRRA 1P8AA 1Y1KE 4MI6A 4U02A 4ZP1A 9LDTA 4FHGA 3N7AA 2IOYA 2DFVA 4E7OA 2BGJA 1JALA 1K8YB 4KX3A 1RCFA 2CMKA 4LC1A 1C14A 2Y1WA 7GPBA 4HX9A 4U00A 3PFCA 2HKIA 3OY2A 4IG4A 4E08A 5JJIA 1ZD9A 4UNPA 1G4AE 3HFGA 5JALA 1SR8A 1E3TA 1H2ZA 1YZLA 2K5UA 2PNFA 5IXSA 1OXMA 4JP1A 1XJ5A 3A1SA 1YZ3A 1WV1A 1HSZA 1YA4A 3W06A 4NCXA 5K0NA 2I3GA 3QBDA 4MR9A 5AVTA 2BR4A 4TPKA 4O5AA 2I1WA 1K7EB 3CRVA 3FMIA 3ILVA 1AQUA 5DWQA 1NONA 1XQ9A 1KZ7B 2FW7A 3M5DA 2OD2A 2YY7A 4M0LA 4YGXB 3ZHZA 5IS2A 2IZ1A 2QBYB 2FZKA 5CX4A 4KVAA 1N78A 4OQEA 5BN3A 3CLRD 3HEMA 3K1YA 3UM9A 2VHJA 3R7DA 1FXSA 3BOSA 3IPXA 1ACLA 1H8ED 1V35A 2X13A 5FFNA 5CVEA 4HAVA 4W6QA 2JLQA 1DRKA 1D5WA 2FQYA 2H11A 2VSQA 3AERB 2WIBA 4RF3A 1FIUA 2JJ1D 3PJFA 1IXSB 1KEZA 1EUDA 3LL7A 3OLYA 4ZCQA 1WVGA 2FDRA 4MGZR 1B7GO 1NN3A 1DBRA 1IEQA 2PU5A 1T5BA 1KZGB 3T95A 4AT1A 2AR0A 4YR9A 1LU9A 2Q8QA 2ASVA 2NTVA 4HLCA 4S1WA 1RNLA 1KVUA 5FWYB 1VL8A 2V6BA 3T9FA 2B4QA 4XR9A 5F51A 3ZBPA 2UXDB 1SOMA 4F3NA 4MWCA 2PS1A 2ZUBA 1CJCA 3P4YA 3DEAA 4UXIA 2C4TA 2G8LA 1EINA 3E7PA 1NSFA 2Q49A 1TECE 2CLHB 2ZXEA 4PXSA 3M82A 1T3ZA 4G1CA 2ZXFA 1INLA 4MRVA 4AZVA 4EGQA 1F9EA 1WXXA 1GNQA 1P18A 4G84A 4N7BA 5LMZA 2B5OA 4G25A 3RS3A 4WBNB 1IQPA 2GPSA 1AGNA 4RL4A 1YQXA 4M38A 1SCUA 5J47A 1KJQA 3MUNA 4PBSA 2B21A 4LJ6A 3ADDA 3NHPA 4XX0A 1NVXQ 1LZKA 1RKVA 3AZQA 1Q92A 5CVCA 1WCXA 1YJAA 2JK0A 2IQ5A 2GHRA 1VJCA 2P5TB 4LUCA 2Z4RA 1QZ3A 2QD3A 1YZYA 2F48A 3QMPA 3SEFA 5EMKA 2HA0A 3V2GA 2ILVA 3CX8A 2J3QA 3W0LB 1Z6YA 3K2BA 5AUOB 2IEBA 3D4BA 1SIWA 3L9WA 1E58A 1E9RA 2RC6A 5J5AA 1W25A 3VH4A 3R7NA 1YVDA 5LZ2A 2H2FA 4FZ5A 1IDOA 4HDKB 4B47A 1U8TA 5JV5A 2HLHA 2YWCA 2AL7A 2WYVA 2ZSHA 4OA5A 4G5YA 2HXSA 2E6UX 2RAVA 1EVZA 5TARA 1NXVA 1E9CA 2H63A 3K70D 5A4MS 3K4PA 2FF5A 2C2ZA 2J3LA 2Q5QA 2Z2YA 2NYUA 4K2HA 5C4GB 1UF9A 3MQFA 4KV9A 3BXPA 5FFFA 3NO4A 4EUSA 3ZVLA 3EVZA 3H3JA 2D1SA 2VBIA 5J43A 3A10A 4OP1A 3QU5A 1B6GA 3PZBA 3Q7RA 3R9KA 4BNMA 4DLXA 4WN3A 1JSXA 1F12A 5FOSA 4UU7A 4BAZA 2HLDD 5I9MA 1GD1O 3NT4A 1AQLA 1KAQA 1ZNQO 3RC8A 1SUEA 2IWHA 2C9DA 2Z8XA 1HFKA 1JKMA 3BGVA 3OU7A 5TQ0A 2GK6A 2HQOA 3M3PA 5G40A 3CCFA 1Y63A 3ASZA 1XC7A 3D8UA 2GCPA 3FNHA 4L76A 3SBXA 1FXWA 2QM0A 2QLTA 3OCCA 2PSJA 3QQPA 1E2BA 4OFWA 2W2KA 1RLOA 1UDWA 4JI2B 3PICA 1CR2A 3KVOA 3ZJ5A 3EGIA 5CT5A 3BQNB 5GGYA 6REQA 5K8LA 4WZBA 3KZNA 4IRMA 5DJ5A 1YDMA 1THMA 2GILA 2ZK7A 3QELB 2Q9AA 4KMRA 3O4GA 2NSYA 5C32A 1MTOA 3EWIA 4TOIA 3WY9A 3OU6A 2X5KO 2ZATA 2X4IA 1L7VC 1XKLA 1M8FA 4X7RA 4FYIA 5CFMA 1V9CA 2IUUA 2BUCA 2VUTA 3C3MA 3NATA 4YJFB 1QFMA 1WXFA 3MGKA 2Z3VA 2ZIVB 5A4FS 1CERA 1AGPA 5A5GA 1G2PA 1VBKA 3PGLA 1ESZA 2NZ2A 4BNHA 1N75A 2WWWA 1JECA 2BR5A 4OQNA 1U9YA 1Z6GA 2BJVA 5DTRA 1ILEA 2R84A 3Q88A 1FJXA 4F72A 3TDMA 3QFSA 4RH0A 4ENUA 7ADHA 2WWIA 1OZFA 2XTNA 3ML1A 2DR0A 1X7XA 3K8ZA 4JVLA 4ZQCB 5ARDA 3U9SA 3G0GA 3U5TA 2YHSA 5BN4B 5DMHA 1FJ2A 3GUUA 3K0FA 1G17A 3I23A 1J07A 5DOZA 4PC7A 2GESA 4IJMA 4X20B 3UH1A 2V96A 2PRZA 3B51X 4YV1A 4MRAA 1MENA 2DCUA 4IH9A 4JKIA 3UOAB 3WIDA 4HMPA 4B7XA 5A1TA 3A0UA 1E3DA 3G9QA 1P6QA 3GLHB 3PITA 4LRUA 5AVSA 2R9VA 3IP1A 3PRHA 1KQ3A 4MITA 3TE7A 4Q18A 4CM8B 4DG9A 1VM6A 2Z6QA 3A2KA 1U3DA 1ZH2A 3EZ7A 2Q0HA 5EJGA 5EKTA 1M1ZA 1J8DA 3LJKA 1I3NA 4ABYA 1UZNA 4M2LA 1SQ6A 3PVSA 1I4OA 1HDCA 1VKOA 3RT1A 1KQFA 4OHZA 2Q1SA 3EA0A 3A9TA 3T3GA 3QG5A 1OWLA 3KQPA 5E7QA 3BERA 1FUEA 1J39A 4AQDA 3LOUA 1X7YA 4DEVA 4XWKA 1PP4A 3WMWA 5HRUA 4XCXA 4XCVA 3I6ZA 4FOPA 5CIWA 2FSHA 4YJGA 3T12A 2OBMA 3HY3A 1U3WA 3IXLA 4RDHA 5CXSA 5AKHA 4MYHA 3OOSA 2JRLA 2A9VA 1N7HA 2O14A 4KI7A 1R18A 4CTNA 1ECBA 4ICIA 5I9LA 1LC3A 2ZJ2A 1ISMA 4PN3A 4JI5B 3ENQA 3TINA 4Y1RA 5AO9A 4C4AA 1E9AA 1DI0A 1QORA 3W5BA 2ZBFA 3AVQA 3E15A 1JVBA 2JJQA 4ARVA 3SSAA 4MV1A 2DUMA 1SKYE 3HDHA 1EVJA 4LVCA 2XUPA 4M7WA 2CXHA 3RJZA 1SVNA 4M8NE 3UCFA 2H00A 3JAWB 2O8EA 4V0OA 4GYKA 4DM3A 3AM1A 1HNXB 2HV8A 4J2TA 2C99A 2GBFA 4AKIA 3WLHA 4IZ6A 3DHEA 4NZNA 4C4XA 2FKNA 5JTUA 4O3FA 3TLXA 1MAVA 2X3YA 4CM4A 1QUEA 1VC2A 1NUAA 2GLTA 4QOEA 3WGHA 4ERNA 1E2FA 2VPZA 4F86A 5IYZB 2GYUA 4LYYA 4GR5A 2JLWA 2R2AA 5K0GA 1YGYA 1TUGA 3U7GA 5IT9A 3N87A 2XUDA 4UHJA 3DVAB 2ZJ1A 1Z15A 4PNHA 3V4VB 1ONOA 5IYZF 1CIVA 3WB9A 1CJKC 4BLOA 2O7SA 3U49A 2O0KA 4FK8A 3WWCA 4KQCA 2DKOA 5GOZA 1H8HA 1U0BB 3PYXA 3ZY3A 5AM2A 1YAHA 4YCNA 1BZYA 2PQ6A 1H4SA 1ICIA 3GJ6A 1NNI1 3VDXA 1KAMA 3V55A 1X13A 2KLBA 3LO8A 2E7ZA 1T3LA 2EC5A 3L5OA 4WXRA 5REQA 1WCWA 5ETJA 5LYJA 5CM8B 3T7AA 4AO7A 1JBQA 4TLDA 2CV0A 1YMQA 1HYBA 4XIGS 1KVRA 3BXOA 3QTBA 3I9OA 2VOJA 1E8DA 2TSYB 5A0FA 1IDN1 1TM4E 3QYJA 3SJCA 4MLDA 3I6YA 3FRJA 1NZJA 4K9PA 1EDDA 3BCHA 1M2OA 4NCBA 1T6YA 2A0YA 2NSLA 3PXEA 4RPGA 4EUEA 4DWVA 3HFSA 1EEXB 2VATA 1DRWA 4BLSA 2EJUA 1PT5A 4PQGA 3NDJA 2IU0A 3V3TA 3ZDAA 5AJXA 4D3XA 2D2EA 3JZDA 2YHBA 3FR8A 4OK3A 1E79D 4U3JA 5K51A 4E30A 5A6VA 1DOZA 3GJ3A 2WB4A 1DBWA 1JIIA 3ZDFA 2JRCA 3K1JA 1RFGE 4OM7A 3T5DA 2BZ1A 3OZBA 5IVKA 1GDDA 3M6XA 1PDOA 4UBNA 2WINI 3VTZA 5DIZA 4G81A 1T43A 2NYAA 1E6EA 1RHQA 3MQ4A 4RMNA 4OY3A 2ZB8A 3IUJA 3REQB 1RE0A 4ZVQA 1RYHA 4WZAB 2Q1UA 1JWBB 2AEFA 1A50B 1E9EA 1HKUA 3IIMA 3TIVA 3WJ1A 5M34A 2QMOA 3Q5GA 3DZKA 1X87A 3G2JA 3R9WA 1W96A 3OFND 2ETVA 1V1RA 2Q3BA 4BWVA 1AHPA 1E64A 2H1CA 1QFJA 5K6AA 3A1TA 3KTDA 4NK4A 1QBKC 5TLSA 3FOBA 5E6RA 4A73A 4OB7A 2KWIA 3ZGNA 4E5PA 4KWEA 1KDYA 3TL6A 3UOWA 3HDYA 2OMKA 2HEGA 3ZJTA 1Z25A 3IDSA 2LR0A 1WUTA 4RD1A 1F0NA 1OFTA 1UBLS 4QTUB 3O0TA 3TE6A 1DWUA 1E9SA 4EW2A 1J8MF 3NXKA 1Z5ZA 1GRQA 2O2GA 4M9RA 4LBWA 1KYQA 3VH3A 1K6MA 1GADO 1O95C 2BEJA 2GRJA 2IE8A 2QF7A 2JGRA 3D3WB 1OWMA 2FWAA 3R5XA 5EN4A 3T1TA 2QX4A 3UW3A 1K7XB 2NW6A 3K32A 2VQEB 1OH8A 3S7ZA 1XTQA 2HRQA 1FX0A 3BREA 4XASA 3TW8B 4CU2A 2IHYA 3NHAA 3E9MA 3FOFC 4JWKA 4KRXA 1RAAA 3R2JA 3S44A 2E87A 2YIVX 5KTPA 4HGYA 2QTNA 2SBTA 2UKDA 4CGZA 3K8OE 3LRPA 3H2SA 1C81A 3RIGA 3ET4A 5B6IA 5KIAA 1T1RA 5LQSA 2FHSA 4KREA 3ZDXB 3IHKA 4IZIA 1YB1A 1O0CA 4IQ4A 1PD0A 4B6EA 2DERA 3H0KA 1FYXA 4DJFC 5U9CA 1Y34E 4P33A 3WBJA 2P4EA 1JFFB 3ER8A 5CR9A 2O8DB 2FEKA 4GRIA 3DGFC 3WWPA 4QYIB 2AKEA 1RYNA 2ECFA 3WKAA 5FADA 4EKEA 1U0LA 1GZVA 5B1EA 1Q3TA 1ZKMA 1PR1A 3FZYA 3OPNA 3EUFA 4HLUA 3HA2A 3GFOA 1G4UR 1TIPA 1T9GR 2BE7A 2QPTA 3WYGA 4B8WA 4NH4A 1JH9A 2J9XB 4D96A 4B7UA 3SJAA 2CSUA 3I34X 4MI9A 5CT8A 3EE6A 1K5GA 2ADFA 2ILTA 2VP2A 4TV9A 3VBEA 2RB4A 2ODEA 3PGXA 3K31A 1E69A 4HQNA 3D8SA 5JVDA 4N6OA 1UBCA 3I04M 4OP3A 5EP2A 3RVBA 3FYUB 3MLBA 3PVCA 1K4MA 1ZN9A 2I66A 1LQUA 4J0QA 2E0IA 4Y1EA 4OL0A 3U0VA 2QWXA 1X8JA 3DXYA 3OQOA 4OIMA 2B8TA 1AE1A 3A1EA 1CUHA 4YV0A 3AVYA 4HEHA 3CF0A 4UOZA 1CB0A 3BK2A 3ZZMA 2AMLA 1ST2A 4ZPJA 3L8GA 2FY8A 3Q6IA 4F6CA 5LZ4A 1HT1E 4IKEA 3CGGA 3GVIA 2JDIA 2HXYA 3IXQA 3OU2A 4LDZA 1QVAA 1IRXA 1QYVA 1R15A 5LA6F 2YWRA 5I7OA 2QTBA 3SSNA 2G1PA 2BFCA 3NHUA 3S4YA 1JHQA 2YW9A 1NZDA 1CYDA 3ONVA 4ZC8A 1AQIA 5ITSA 1PFWA 3ZDDA 4MWGA 1B0PA 2W0SA 3OEHD 1F20A 4G8JA 1ZVMA 4NU8X 4I1IA 1LY1A 1UFOA 5CPBA 2DY1A 1YQUA 4UBJA 1DBPA 1OVMA 3CEHA 5CDTA 4D82A 1ZK1A 4P0PB 3IUNA 3KOOA 2YOFA 5FPQA 3AUSA 4RKWA 1BMFA 4D44A 3IQIX 3DV0A 4B6GA 4YA6A 1DP4A 3FN4A 4UUOA 5IKEA 1DDIA 5ALNA 1IY1A 1X1DA 4C01A 1KZ6A 1QCDA 5E6SA 4DMRA 1F38A 2AT1A 5DM4A 2HM7A 3QXSA 2O6HA 1P5RA 4FZRA 4NFHA 4ILKA 3LOQA 4JUIA 2O5EA 4AW9A 4H4EA 1ENPA 3CUWA 2QZ4A 2PZGA 1L0BA 2P7IA 3AV3A 3JQQA 1YI1A 2QIOA 2B1JA 5AH0A 4LZLA 4D79A 4RVSA 1ZD8A 2OV4A 3LPDA 2EJBA 1X70A 3OOWA 4ID3A 4ER6A 2WWTA 4Z54A 621PA 4MARA 2WJ3A 2FMHA 5IDQA 3KETA 2FPIB 2XH8A 3NT5A 2H2AA 1ZC3A 5BVHA 2HCRA 1QVWA 1TCCA 2QR3A 4IEIA 4Z0TA 3DULA 3QM1A 4A6EA 3U62A 1LBSA 1PQUA 5C80A 1SBQA 3IIEA 1P91A 1TVKA 2V6MA 4BVGA 2Z2IA 5AW5A 2VDWA 1Q7GA 2YBDA 2IA5A 3TTWA 5BYBA 2ZR7A 5BQ5A 3SYTA 4Q93A 3PRKE 1MA3A 2M32A 2VJDA 1DC5A 2XSZD 1MX3A 5FJJA 3ZD8A 3PQ8A 4AS2A 4MUAA 1A9QA 2FCAA 2GEBA 2WV9A 1JTVA 5L4NA 4L27A 4NS4A 3HDTA 1D4FA 2XB8A 4NAHA 4X1YA 2C00A 1LK0A 4IM7A 4C89A 1BD4A 4JMLA 4Q4JB 2OB1A 1Q12A 4TL6A 4ERXA 4MLCA 5E9AA 4BFLA 1ISFA 2RARA 1ZIXA 5HWSA 3ONFA 4CMIA 1N1MA 1OXVA 2X5JO 4IDFA 4BQOA 5B3JC 1DKMA 2IK8A 3EC2A 5JANA 4GL4A 4LWZA 2P4SA 2JAHA 3D6FA 3FYUC 1ODIA 1E92A 2X0DA 4RESA 3KQHA 3HVIA 3KQKA 2X77A 2P6RA 1XRJA 4CDGA 2C9MA 3GUYA 1W5TA 1P1CA 4QUHA 5FEMA 1NN1A 1ZUWA 3L6BA 4L28A 4QTTB 3AETA 3DWIA 1QJ4A 2EZ9A 1VLZA 2OA0A 1IC6A 5EYPB 1NV9A 3NBKA 4CCSA 4XIJA 1E3IA 1ZIDA 2RCNA 1ZMXA 4ZZ1A 2N1MA 1D0VA 2RGDA 4KFCA 1BE0A 1AVTA 1HNNA 2E4UA 2NO6A 3DTTA 3FZEA 3S5UA 3E3LA 1GGEA 4IIFA 4M9XA 3JPWA 3KE8A 2OVBA 1E4EA 4MQEB 4F9FA 4Z5XA 4KSBA 3GLGE 4V3CA 4WGFA 2BFEB 5LIPA 3W8EA 2YASA 2X58A 2XZTA 5EHZA 1T1SA 2O05A 1U65A 2IUSA 3ND7A 4IJQA 4B31A 4MKZA 3DTVB 2PIDA 3QFCA 3VGPA 4DQVA 4E46A 2NIPA 1WMDA 1GVHA 1O4VA 3TCXB 1IM2A 3NBUA 3HJRA 3F6YA 3CR7A 3TIIA 2DT8A 4F92B 3I0ZA 2CDCA 8AT1A 2FHPA 4GMFA 3KQSA 3HEBA 3VOBA 3MLEA 2HT1A 2H31A 2PMCA 1O58A 3UT6A 1L4FA 4HDSA 1MDFA 4YACA 2YWFA 2OXCA 4EKGA 1MVNA 1TKAA 5ENZA 4NYIQ 1VA5A 4IIGA 1UBTS 2IY7A 4I8DA 3QNUA 3KVVA 4F4FA 3F7NA 2HIGA 2VDLB 4URYR 4AJKA 1JPNA 1P5FA 4NBSA 3RSZA 4JXZA 4DRZA 5KPJA 1UEXC 3TDKA 2A94A 3ESQA 2X8WA 4J4TA 4JQZA 4PX9A 1PGQA 3PC2A 1C80A 5FLEX 1O94D 3W79A 2Y1EA 4ME6A 2Y27A 3D3NA 3EQ9A 3V34A 3T3IA 4DLVA 5CM2Z 5JMTA 2X8JA 3L79A 4YDRA 5BWLA 1UXIA 5F98A 1BS9A 1H2XA 2YXDA 4KYUA 1E1RA 4N5IX 2YIJA 3EC7A 5B1SA 4DA8A 3BWYA 1SD5A 1UFRA 2I33A 3LU1A 3NHZA 1GCAA 1USUA 2EBHX 2ENUA 5GV7A 1K0UA 3U19A 1SXQA 1P0FA 3QF4B 4PBRA 2BMWA 3KQMA 3DV9A 3Q8KA 2NZJA 3HEAA 1M75A 1B6TA 1SHTX 1UK9A 3TGWA 2ZWMA 3H83A 4MCIA 4ZVTA 1N2OA 1UBHS 4GVPA 3H1TA 4MKIA 5EPOA 1T36B 2UVQA 3DBLA 4OGGA 2AUNA 3EUEA 3OPVA 4X8LA 4TWAA 4PSAA 1KOJA 2H16A 1LS6A 1T9KA 3DE6X 4XARA 1JMKC 2A1TS 3HJTA 3SCZA 1XMJA 1MOQA 3FFWA 2JVKA 4QPNA 3IB3A 3BJIC 3JZIA 4BNKA 3IVCA 1L7DA 4US0R 2WG2A 1QGAA 3EZXA 3A05A 3H9BA 3I4LA 5SZJA 1HLDA 1VLVA 4DJ5X 2DF8A 1U9CA 4ZO9A 2I2AA 1E6WA 4XH9B 1ZS9A 3PR3A 3I42A 3RAGA 4A8JA 4ZMSA 2JIOA 4Q1BA 3N2GA 1VA4A 3VR6A 2XCIA 5B1DA 5IF3A 5U1PA 4Z4QA 3A6DA 3E5HA 4HWKA 3GLTA 3U31A 4B6QA 3TO5A 3UWDA 1MRNA 3JR3A 3OM1A 2PZEA 2VZEA 1KMNA 2PL3A 1H9BA 4ZVOA 3HVHA 1NXSA 3C6ZA 5HF9A 1FU4A 4J0IA 4GSKA 1QHNA 4Y6SA 3RSOA 1BSVA 5TE9A 2PDAA 1F48A 5B37A 5JBQA 5CA0A 4HY3A 3N6VA 4XYMA 13PKA 3TRFA 1UFVA 3W2IA 4B4UA 4WOCA 1COZA 3ILYA 3H97A 3ILHA 4TLBA 5L3SB 5GIOE 2IUTA 1ENZA 1YBFA 2X8BA 3GYBA 3GPBA 2XV1A 3QKSA 4NCJA 1S8OA 3A58B 3K5IA 3I73A 3QY9A 2WZQA 4R0NA 2FWIA 1U0OC 1ZKDA 1EG2A 5LU8A 3LYAA 3L06A 4YRIA 2VLBA 1A04A 1P4HA 3PYLA 2IHNA 2PZFA 2NTNA 5K3FB 4NEQA 1VYUA 3T8YA 2AKAB 1QU2A 5DNEA 2ECPA 4ARBA 4DIDA 3HI4A 3UAVA 4FD2A 2P3OA 3HYRA 3ICQB 1M6VA 4YMIA 2JLUA 1PR6A 3WWDA 3RJ5A 3EIXA 5DM0A 3PDHA 4DJDC 2XE7A 4ASUD 4B3FX 5EXSA 1MQ8B 5EY5B 3WL3A 1C3EA 2WIFA 1PJCA 3KDPA 3BH7A 4LRYA 5JZSA 3OZRA 2A9QA 4JYPA 4R9UC 5LOVA 2HSDA 3OX2A 3KLNA 4MV9A 3WLLA 4X92A 1VXOA 4QFDA 2VTBA 4OHMA 1V6AA 2J8ZA 5AHKA 2FPSA 2RGNC 3D8TA 3AUTA 4TYMA 4DVJA 1AKVA 1JLLB 2YRFA 4G89A 2EFHB 3GFRA 5F35A 3UFXB 3EF3A 1HLPA 3JAKA 4K9DA 5LQDA 1V5IA 1C7JA 4WV3A 5IT0A 1EFRD 1T6BY 1XE3A 2CGEA 2O4CA 3STWA 3HL0A 1LVGA 2E5FA 4ID9A 2W2LD 4P22A 4LS3A 1A2BA 2WSLA 1EHIA 1JP7A 3K30A 1J2TA 4QU8A 1T5OA 1TA0A 1WMFA 1W94A 3IQDB 4H7JA 5HCNA 2B5WA 1DIRA 1PX2A 2OC4A 5DKFA 5AM0A 4YALA 1ISPA 4NBKA 4RA6A 3T9DA 4YYZA 3VPFA 5CB8A 4AECA 4KL8S 5JMWA 3H84A 3A9VA 1AS2A 3FGZA 4MQFA 1L9XA 3GRCA 4BTEA 1VBNA 1V16B 1ULSA 2JIZA 2QAGA 4E14A 2C7GA 1KXZA 3CR3C 2V58A 2FZWA 3EXG1 2XTAA 2YYYA 3J7TA 1A9XA 1D2HA 1GWNA 2EBUA 4JUBA 4DV5B 4QIHA 4N8EA 3SXPA 2DB3A 1K9VF 4K3UA 5E3JA 2VDJA 1W4BA 4RAQA 2ZJ5A 1AURA 2BM9A 2JI4A 3ISVA 3USCS 4IIUA 4BLTA 3Q3VA 1K3TA 2Q3JA 3KB1A 3NHBA 1P7WA 3HO8A 3JASB 2FG7C 2VO1A 3BL5A 2FCRA 3LYLA 1YS1X 5DEOA 3O8RA 1DO8A 4R9SA 4TQAA 2AG5A 4FOSA 4CEIB 3QWBA 4ZO8A 1FS5A 1TYZA 5TPZA 2P6PA 2V7XA 3MWLA 1RPJA 5K3BA 4UTVA 5BQ3A 1ORVA 2ZPUA 2V59A 1ZGBA 3KUDA 3VR6H 3AONB 5G4LA 5JY1A 3FNFA 4IJKA 4XYEA 3MWFA 3O38A 3ESYA 5K8IA 4Y2YA 1G8PA 1N2HA 3WJ2A 1RQXA 1MGOA 4IDNA 2XODA 4PO1A 5EAIA 4XQCA 4D3ZA 1QU3A 1VL2A 4CPDA 1L4YA 2XIJA 3GJRA 3X1WA 1U8ZA 1AZSC 1CXZA 4E12A 1ZUD1 3QLJA 2NNLD 4IZHA 4PTYA 1HE3A 3C3JA 3EDMA 2RGUA 3HABA 2EQAA 3HZRA 3LUAA 4KRGA 4QASA 4DLLA 4ER3A 2E37A 3QX3A 4W5RA 1KOFA 4FSDA 3VR2D 2XTMA 1Z68A 2Y05A 2AOUB 4RKQA 2OCBA 3C6QA 2VJCA 3F6CA 4H7FA 4QWWA 3Q3GE 3V2IA 4AZTA 3EN0A 4DT1B 1ZXXA 3OLZA 2HFJA 3A4YA 1GPMA 4LOIA 5F1KA 3TLGB 4V38A 1QLHA 2BKEA 3U7JA 4U6NA 1RXWA 3L0ZA 4V0MA 3CNLA 3KQWA 3FTPA 4H27A 1CPYA 3FB1A 1DX4A 3O1HB 5CXXA 3IP3A 2JFVA 1VHQA 4UCWA 1SN7A 2F1HA 4IUCS 4QSHA 5T5QA 3ASVA 2JJ2A 3B2EA 3PHLA 3FSGD 1H8EA 3CWCA 4EHBA 1LX7A 2J5RA 2LVBA 3I04A 4B48A 5BOSA 4P1ZA 5K3CA 2P9JA 4Y6QA 2JJ1A 4U9IS 1Y8AA 2E85A 4JUCA 4AF8A 1P1JA 5KQSA 5HIMA 3RRFA 2WU4A 4DEYA 3ZCXA 5B58T 1DHTA 4BUJA 4QVIA 4EX6A 1V7ZA 1NNSA 2ZOSA 3A31A 3A8TA 4C9BA 4NCAA 1SBTA 4QG7A 1BRTA 4KEAA 1SMKA 1G21B 2Q6LA 3KELA 1CDOA 1PG0A 1KO8A 1SKYB 4OBWA 4Z3KA 3AI1A 3LQKA 1UP4A 1IG3A 1T6XA 2VOEA 4J0CA 4MV7A 1RRFA 2GNAA 1QYIA 2OHGA 2LXNA 3OM8A 4HDRB 5FCDA 4BNUA 2G09A 1OJLA 1ZW6A 1R4MB 4BDTA 2NU7B 5CB4A 3TKLA 5A9TA 3AEQB 3FNRA 4IJVA 4EAQA 3RVPA 1A4IA 2MYPA 4WOPA 1G0OA 2F17A 3VH2A 1JQLB 1V47A 3JWIA 5AI5A 1JHDA 5AJWA 1KQPA 3NAZA 1C9KA 2VC2B 3CF4A 2IWRA 2BVNA 5EPUA 2F8MA 3UG7A 1DXYA 5DU2A 4PAMA 1NXWA 4N47A 4R5HA 1RVV1 3BT7A 4MHTA 3RNLA 3CNHA 3EGVA 1E3MA 3HV0A 1NVGA 3N2ZB 2D4HA 1ZFNA 1RJFA 2OHFA 4ND2A 3E22B 2J48A 1C30B 1I2AA 2WPDA 1LPMA 3GPDG 4AKHA 1VMIA 4RCYA 1PRYA 5AOVA 2POQX 3G8CA 3OF3A 1R9NA 2XMPA 3Q7SA 5GM1A 3DKRA 5IRCD 2JGDB 1SC6A 3HUTA 3U0BA 2TECE 2ZYAA 3L6CA 3OHMA 4CMEA 1U0SY 1WNTA 1PJ8A 4Z7OB 2G36A 3RVQA 1GNPA 2VXBA 4ZV9A 2I6SA 3BQMB 3GW8A 3OC0A 3VR5A 4E2WA 3DBIA 3QITA 4ADSG 4C30A 5M7EA 3LL4A 3ZOZA 2DPMA 3JVIA 2OCKA 5HS4A 3X2SA 4AKTA 4Q3NA 5BWBA 3IT3A 1RS0A 2QTAA 5DLPA 4HUTA 3NP7A 4X00A 4M8LA 4BKQA 4EO9A 2C9CA 5ABPA 3WE7A 1EX7A 1MJ5A 3HN2A 4HS4A 1NMSA 3JYOA 1ZK4A 3KYCA 4KO8A 5DRYA 1S4MA 1XELA 4WN9A 5FJIA 3PNSA 4NOJA 5AKYA 3V7WA 1G59A 3C7TA 2Z30A 3HJCA 1SC1A 3F3SA 4OPMA 1OBOA 4XSVA 4KR2A 3RUIA 1OXTA 1I10A 4HQRA 5AVKA 2GM4A 1XRRA 3DKVA 3RVJA 3UJ9A 3VZBA 5H80A 3PNQA 5M29A 1JW9B 2I0FA 1L5HA 4EJ0A 1MTZA 3MAAC 1NVVR 4M53A 4B3DA 3JQ7B 1Y1SA 3P9ZA 5HUJA 2C3YA 3VPHA 4B84A 1NQVA 2ONKA 3OX4A 2NO1A 4UDNA 1TUBB 2LBPA 5AW0A 3LDHA 1WO8A 1J1IA 5FWXA 2I71A 1SBIA 2BGKA 3C7KA 3R7AA 4FVTA 4FINA 4KR0A 3UAYA 1TF5A 1HQYE 3GEIA 3I6IA 1WTAA 2KMLA 4DOMA 3ASUA 4M1ZA 4Q39A 3VZRA 5F33A 2IXAA 3AJDA 1R9MA 1W0JA 4MUKA 1XVUA 2GBLA 3BMQA 4Q48A 2MT9A 3UAOA 2OV2A 4WCFA 5SY6A 4EGAA 3BL6A 4UDXX 4B2LA 2HRRA 1KPGA 4NI5A 2DXIA 2D00A 1VL1A 3LBHA 2C29D 1EU1A 3A4LA 3KYBA 3MMSA 4L6IA 2Q6IA 4ODIA 3ON5A 3TG8A 4YROA 2C61A 2G80A 3CNBA 1DKPA 1P9RA 2JA2A 2FX2A 4Y6PA 3AL0C 3HP7A 3L8FA 4CKWB 5KTOA 1GDHA 2QYTA 4AS3A 4KR6A 4LY9A 4DV7B 2CVQA 5EWJA 4YT2A 4HB0A 4AS1A 2G40A 2HIMA 2YL2A 2B30A 2G67A 4O2AF 3KZ1E 4UHCA 3BULA 2FTKE 1TTPB 2IZ7A 3UMRA 4OX9B 2JCXA 1YXMA 3P96A 4KC0A 2OWDA 1U8UA 2WHXA 2Y4OA 3DE3X 3F4LA 1JAYA 1PNTA 3BD9A 4KFRA 1XRPA 3WYBA 1GRVA 1P4SA 2FZCA 3K0BA 4Z2YA 1PNRA 3QKUA 1E59A 1E9BA 5TQ2A 5FQOA 1TZ2A 1WPGA 4BVHA 4YP5A 2XMGA 3NUGA 4PLGA 4EYSA 2WTNA 3GLIE 2JATA 4DCPA 2V7BA 3BEOA 1SJ9A 3M89A 2WUFA 3M4XA 4JVSB 3IIIA 3SC2A 1DIHA 3X2EA 8OHMA 5ELMA 3MHPA 4Z4FA 4RY2A 2BISA 5CFZA 2QDXA 4EG7A 2ASEA 2RHCA 1T4CB 3OUTA 3M6WA 3EAQA 3QOFA 4J0HA 3U26A 4A16A 1DFHA 1F5SA 1G19A 2FOXA 2QQGA 2Y8EA 4LHYA 2OZPA 1HT3A 3P32A 2ZE6A 3IP6A 2R1TB 4EJSB 3GRFA 3N8HA 4OLBA 2FP4A 5DPMA 3MAJA 3VR5H 3DLIA 3Q9UA 4Q1VA 1PJ4A 3L2OB 2Z8YM 2O7VA 4MCAA 5TY0A 2NVUA 1X1AA 2QXUA 2XHEA 2ZI3A 1QG6A 3FE2A 1E0DA 4XUEA 1DARA 1YQ9A 3FZNA 1XQYA 1YB7A 1T3HA 3FBTA 3RJ9A 3CB2A 1YRBA 3ITKA 3PNMA 4KOAA 4PC1A 4RIGA 5KYWA 3PX7A 3N5CA 3WVNA 5KWVA 3MPOA 3SR0A 5HBRA 4WIAA 4FGLA 1TD9A 4JI0B 3QEAZ 1W5EA 3K8QA 1JJ7A 2X8LA 1Z0ZA 1YAJA 2OSBA 1H6CA 3LQ2A 2JIQA 2VF2A 2A8YA 3BZBA 4EHIA 5CT6A 1IWOA 1OI2A 1JDZA 3GP5A 4IJUA 4M1YA 4ZREA 1G8KA 1PEAA 1TO2E 1GUYA 3C6KA 4ZQBA 4D3FA 4CCWA 1SG0A 5JAHA 3SF8B 4Q02A 2XYGA 3GLUA 4C05A 4H1HA 5I6DA 4J7AA 3PC4A 4D6YA 3ZV7A 5JWOA 1RLTA 4E5MA 1P4JA 3FYDA 3LTEA 4MW4A 4TM7A 1A76A 1YGPA 3JAMA 2HMAA 3QLEA 5A2QA 4KIJA 1CDDA 2H2WA 5TVKA 721PA 4RHCA 1O0SA 3KOWA 4LWQA 3JQAB 4ZDIA 1KFJB 1MVOA 4HH1A 2RD2A 5AXCA 1HE4A 1W9HA 2CNKA 3HGQA 1XBTA 3GZ4A 4BYMA 5LXTB 5C51B 4D9EA 3U44A 4J6EA 1VG0B 4S2UA 5BN5B 2QR2A 4FYHA 3P2KA 2KYRA 2PPLA 3DFUA 3SDBA 1Y6JA 2VLIA 1W75A 1SHKA 1E79A 4II3A 1MZVA 1YL5A 3ETJA 5DZSA 3G9TA 3F47A 2B94A 3WDMA 1CVRA 2YHAA 5EIEA 5LQJA 4B6SA 3GBVA 2P6UA 3JTEA 3NDRA 3NRJA 4Z9AA 4ZI7F 1Q0RA 2WG0A 3UPUA 1XEAA