1X86B

Crystal structure of the dh/ph domains of leukemia-associated rhogef in complex with rhoa
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
180
structure length
180
Chain Sequence
AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 12
publication title Structural determinants of RhoA binding and nucleotide exchange in leukemia-associated Rho guanine-nucleotide exchange factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/membrane protein
total genus 52
structure length 180
sequence length 180
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2004-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1x86B00
3M6AA 1W36C 4B3GA 4RVCA 1RPZA 2NZ8A 4KFUA 1UKYA 3KKOA 4UXHA 3QSYA 1DARA 2ZJAA 3QEJA 3C7KA 3UPUA 2NZJA 4BLTA 3FGNA 3K70B 521PA 4LHWA 4LYHA 2VIIA 2W0SA 2A5FA 4GOKA 2HF9A 2JA1A 1W49A 3BIFA 1NJFA 1VYTA 1TNDA 3OESA 3T61A 1OHHD 4Q4AB 1JAIA 3C41J 5CK4A 5KNDA 3K0SA 3L0OA 2ZRBA 1XDBA 2ZEJA 1YZNA 1CRQA 3EASA 3LAWA 4GOJA 1NIPA 1L7VC 4LK2A 1OFHA 1IXRC 1GSIA 5FBRB 4CEJA 2WAYA 4KITB 2QL6A 2FMXA 2OFXA 2XZPA 5FTLA 1ONBA 4LJ8A 3DM9B 1G4UR 3DDCA 4BLSA 3SN6A 2C2HA 3I73A 3IBGA 4IOKA 4QJ4A 3ASZA 1YRAA 4QGAA 2WJYA 4JT2A 2A5JA 2DCUA 3IQWA 1JB1A 1P5ZB 2J41A 5D3MB 4LRWA 2XZLA 1KDOA 4MA4A 2BHRA 3MCAA 4G5QA 3W9YA 1VIAA 3QXSA 1EX7A 2XJ4A 4Z1MD 4M21A 5HE9A 4RD0A 3A6PC 3HPQA 4DUGA 3CPEA 1IJEA 4DCNA 1Z2CA 1DVRA 3HWSA 2CXXA 1CR2A 1GDDA 3CX8A 2IEZA 5J4VA 2F43A 2J0QA 3ZD6A 3LH5A 4TT3A 3C8UA 5L3QB 1AGRA 2XZOA 4UNQA 1J7KA 1UDWA 2FH5B 3V4RA 1B0UA 1V5WA 3AH8A 4ILEA 3GJ3A 1DAFA 2WSSD 3TKLA 5KHOC 3RANA 4NCHA 3RS0A 4DZZA 1XD2B 1LS6A 1P62B 4V02A 4A8JB 4A2WA 3REGA 4PSVA 1II9A 1OFUX 1F2TB 4OHYA 3QG5A 5H1YA 3K9HA 4KV9A 1E2JA 4B6FA 3UMRA 2YHSA 1NI3A 4C0JA 1MRNA 1N5IA 4PC1A 1EGAA 1EFRD 2VYFA 1E9FA 3NH9A 5BYJA 1J2JA 2HYIC 1G18A 4DSTA 2ZSEA 4IVRA 2PCLA 1HT2E 4IOJA 1TU3A 1SKYB 2IYWA 2Z6VA 1T5LA 3LRPA 2HT1A 3KX2A 1TUIA 1XD9A 2QAGA 5GADl 1W4CA 2GBLC 1BO6A 2A30A 3QUSA 4LPKA 4JSYA 3TLXA 2NO1A 2QN6A 1C1YA 2H1LA 3VKWA 1G3RA 1E2HA 1NL3A 3CX6A 3QVVA 1SKQA 4Q4HA 3UIEA 4GMDA 3R8FA 3CONA 4L4UA 4EAQA 2DWPA 2ZRMA 2WWFA 1FNNA 3EPHA 1E9AA 1U8AA 3SQXA 4NMMA 4XSHA 1KSHA 3JZMA 3UXMA 4LJYA 3SOPA 1E4VA 2RCNA 3EIQA 3IDQA 2CL6X 3PUXA 1W5TA 3R20A 4LC1A 4LSGA 5KTYA 1NN3A 1YRBA 4JT4A 4V0MA 5CJ2A 3GJ5A 4NCKA 8OHMA 1SVMA 2FN4A 1Z08A 4Q9KA 1E2KA 1E99A 4IVPA 4RD4A 4YDHB 1U0HC 4DT1A 3LBNA 4ITRC 3BH7A 3CRVA 3ZVNA 4X8LA 2ZJOA 3NEYA 2LKCA 3N70A 1OB5A 2BJWA 2VBCA 2O5VA 3T06B 1E3MA 3GLIE 4BECA 2ZANA 2K5UA 1KK3A 1G7CA 2RGXA 4TTQA 1Z0AA 1XXHA 4MKIA 1Z06A 3S1AB 4TMTA 3MRSA 4WBSA 1FZQA 4XWAA 4R9UC 2E87A 1KYIA 2AK3A 2N1BA 3ETLA 3QG1A 4C2UA 2OCYC 4A1FA 2QORA 3KQUA 1T6NA 4P4UA 2O8CB 3CH5A 2ZRDA 4MRNA 3ND8A 2P3SA 4DCSA 4LBWA 3CZQA 4V0OA 3RS5A 4LC0A 5EE3A 2RGAA 4B3XA 1QHYA 1ZM7A 4E07A 3I62A 2BV3A 4XJXA 1EXMA 1RYHA 2J46A 2IWRA 3Q8XB 1CULC 1P3JA 3CNNA 3SHFA 3AVXA 1E79D 3EWAA 5AUNB 2NIPA 1LF0A 2BWJA 3LW7A 3H4MA 4QGFA 3Q7PA 2CL7X 1TF2A 2UZ3A 1OB2A 2WJVA 4JS0A 2G9NA 3C4JA 2C9YA 4MYTA 3I72A 3K0FA 2QP9X 1E1QD 3OAAD 5C2JB 2D74A 3SZRA 1HQCA 3PITA 2QMOA 2GZDA 1MOZA 5CK5A 5B64A 4R2HA 2GZHA 1E94E 4FMDF 5TY0A 4EUNA 2EFDB 3B1YA 2ZSAA 4IDPA 2QQ0A 5AJVB 3BS4A 4EJSA 1GRRA 4RCYA 4DSOA 1KY2A 3C5HA 3LFUA 2H8KA 1XJCA 2P0EA 1FMJA 3KXIA 5E95A 3DKPA 1DPFA 3JZAA 2ZSBA 2IEYA 1HTWA 2CCJA 3LNCA 4TMZA 5GVRA 3MWJA 3H1TA 4EFNA 1YQTA 2QTFA 2VP4A 2F55A 3NBZC 4PHFA 4OQLA 3SC3A 4YXWA 5P21A 2O0HA 2VP5A 4LBVA 1WXQA 3PUYA 1KTVA 5AJWA 4Q18A 3L0IB 1GITA 4BFXA 1QG2A 1YZQA 3ZIAA 2YZ2A 1A7JA 2IW3A 2I1QA 4TL6A 3RSLA 2A5DA 3VAAA 3K0AB 3AM1A 1AQYA 2BDTA 4OQXA 2Z4SA 3DHWC 3BERA 4QC2A 4IXNA 4QFMA 5J40A 3AEZA 4WW0A 1JBKA 1MO4A 4QHTA 5AK0A 1FW6A 3KKPA 3SQWA 3FFAA 3BB1A 4ZI3A 1SGWA 2F6RA 1DAKA 1GL7A 2ZAMA 1XBTA 2VO1A 2ZE6A 4WIAA 5C18A 1RJ9B 3FHCB 5KNCA 5DI3B 2V55B 3HDTA 2LCFA 4ZDJA 1TF5A 1QVAA 3A36A 5LD2B 1N2CE 3TE6A 1I4DD 2MSEB 3QXJA 2CNWA 4OHZA 5DSZA 2J0VA 3RVBA 5JLJA 4DLXA 3O8DA 3PFIA 5CM8B 3HR8A 3X1DA 2KBEA 2R44A 3I1FA 5TV2A 3AB3A 3MLEA 2BM1A 4K8OA 2IX3A 4ZDIA 3R9XA 2IS2A 1MRSA 3FOZA 4WAUA 5AUQA 5HKKA 5KDLA 4PC7A 2WWXA 1YR8A 3FKSA 4MITA 1FTNA 2BM0A 3A58B 2UKDA 2NO6A 3GQBA 2CE2X 4CEJB 2B8WA 2JLRA 4ZV4A 1BYIA 4CT4B 4HLCA 1KNQA 2JDIA 3ZJYA 4HDOB 4EIWA 4TYYA 2GCNA 2J0UB 2YC2C 1BIFA 2Z4RA 4XVQA 3PEWA 2D7CA 1AKYA 3K70D 5EE1A 2GHIA 4HDCA 1WMSA 1TQ6A 2OT3B 3T5DA 3IBYA 5BWMA 3PJRA 1SZPA 2FFBA 3BH0A 2JJ2A 5FOSA 1P75A 4DLYA 1N0UA 5KUTA 3FHOA 4URWR 2CJWA 3MJHA 4PQFA 1P9RA 4KO8A 4ZCIA 4PSKA 2N42A 3WRYC 1X1SA 2F43B 3QKRA 3RDPA 4BASA 4R71A 3P27A 1OH6A 3THYA 5BXQC 2XITA 1JEDA 4NKRA 3NKVA 3E1SA 1N6HA 3WMFA 4HAXA 5IK2D 2ZI6A 1FTSA 3W34A 5FBVB 1CR1A 3IIJA 1G8HA 4II7A 2WPDA 5J47A 4WOPA 1RRPA 3B6EA 3WYGA 4EPVA 3BBPA 1XCMA 4Q19A 4LBZA 3WBKA 2J1LA 4CDGA 2ATXA 4TSFD 5TB5A 3AKYA 1VHLA 3E70C 2WMOB 4YMSA 2IYSA 2WKPA 1Q3HA 3KFVA 1U98A 1AKEA 2DY1A 3U2QA 3ZQJA 6Q21A 2ZS9A 2Q6TA 3QF7A 3T34A 3D31A 4PZZA 3HP1A 3LO5A 5C4MA 2C95A 3TQCA 4GSYA 5CYPA 4PPFA 2J45A 5L3SA 2JEOA 1G3IA 4BZQA 2QAGB 5KYKA 1H8ED 1XEXB 1H8HA 3REFA 2V7QA 2DWQA 1G41A 3PEVA 1W0JD 5M04A 4MGZR 1GUAA 3GLHA 4BLPA 4Q5IA 3V9PA 4Q4HB 3B1XA 2FFAA 4DLSA 2BVNA 2O0JA 4O2LA 4Q9JA 1KZ7B 3BXZA 4D0GA 3UMSA 4PO1A 2QE7A 1JXMA 2H7VA 5GVSA 4TYPA 3TR5A 1QDEA 1O87A 2WSMA 5JI2E 3NEJA 1JR3D 1JQLB 1M6NA 3IPYA 1KJZA 4JMPA 3TJZA 3B5JA 2YINC 4GT1A 4A2PA 2PZFA 3GP8A 2P6UA 3OIYA 2MMCA 2GBLA 4FD2A 3BFKA 5FOVA 1G6OA 2ZJ8A 4DLZA 1OSNA 1CKEA 4LX0A 4OQNA 2GZAA 4D26A 1HA3A 1HUQA 1KK0A 4C0KA 4IDNA 3U5ZB 1WF3A 1P2TA 3RAPR 3O8CA 4Q9IA 1I2MA 1XXHB 4LJ9A 4GMXA 5FFMA 1WQ1R 4JBWA 1OH8A 4UJ5A 3SFZA 1NY5A 1S1MA 1R7RA 1JPNA 2PEZA 4PO8A 2GCPA 4ZKDA 5E7IA 3WHKA 2QGNA 4V0LA 3K1JA 3GLGA 4Q9LA 3TUIC 4DXAA 4Q1CA 2QTVB 1JR3E 3QF4B 2ZJYA 4B33A 2OAP1 3WMGA 4TL8A 4FMCF 1SKYE 4NYIR 1FNMA 2BMEA 2BBOA 3ZDQA 3I3SR 1J99A 1Q20A 4MQBA 4B35A 2ECKA 4KBGA 4HATA 2MMGA 4IKEA 1Z0KA 1IAQA 3K0FB 3AF4A 1TU4A 4B48A 1KI4A 2A9KA 5TMPA 3Q3JB 1Y63A 3L82B 4BFTA 4D0NA 1UM8A 3SBDA 1XTIA 4M9QA 2GNOA 4CVNA 2VSXA 3GFTA 1GTVA 1XTSA 1P72A 4JIMA 4HB0A 1VKJA 2YOGA 4EJSB 5FPHA 3DL0A 1YJ5A 3EXAA 2BC9A 5CM9C 5LDDC 3I4LA 2JLXA 1XPUA 3HU1A 3K9GA 1E2PA 1XPOA 3UATA 1IN6A 1NMYA 2PMKA 3RC3A 4KVAA 4RZXA 4JVNA 4C0AC 5GJBA 1Z83A 1LV7A 3E2IA 1PLLA 1R5OA 3AP3A 1ZU5A 2WHXA 3FMIA 4PTLA 3RABA 4F38A 4KYUA 5FI1B 1Z07A 3A8TA 1G3QA 2ZREA 1W0KD 2IXEA 4LPSA 4LYFA 4NE2A 5A4JA 5DLQC 3CX7A 4RZ2A 1S9HA 3D8BA 1F2UA 4K81B 3B8HA 4RY2A 3FYHA 4Q02A 1RVDA 2KJQA 1G8GA 1UFQA 3NBFA 3P32A 4XWKA 4AIIA 2A5GA 1AIPA 4ZKEA 5JI3E 4BZXA 4PPGA 5EXXA 5KU1A 3K0CA 3AF0A 4TLAA 3FTQA 2J0SA 1ZCAA 3K9LA 4XVRA 5ANRB 3THXA 2EFCB 3RYTC 2JLUA 1XP8A 4HLQB 4P4TA 3VFDA 1Q12A 4DCUA 2H16A 4DLVA 4W7SA 4LGMA 3Q85A 1G7RA 4JLKA 2Z5FA 1NLYA 4ASUD 3I8SA 4G0NA 4DWJA 1JI0A 4JKYA 4C0LA 1XX6A 2F7SA 1MO3A 2REBA 4E03A 4B32A 1XEWY 2F9MA 2V4ZA 3KXLA 3ZQ6A 2O8FA 4HZUA 2JCSA 3CLVA 4QG7A 1KDPA 1Z6XA 2BMJA 3NTUA 3RS2A 1Z0DA 3GLFA 1YZLA 1FUUA 2REXB 2IUSA 3AKCA 5EP2A 2AFIE 3FFBA 4ZDWA 1OH5A 1Q21A 3TW8B 4C3ZA 3B1ZA 3CRQA 2ZRFA 2P5SA 4B43A 3QVUA 3NH6A 4JJZA 4TTPA 1QVRA 3OFND 4Z8XA 3ZS9A 4B6EA 4G1UC 5JZVA 1P7CA 1SVOA 2QMUA 3QI2A 1MO6A 2FPLA 2ZETA 4IDOA 2FX3A 4EPWA 3TNFA 4GP6A 1F60A 4BZPA 1R2QA 4NYMQ 2IC5A 3RRZA 3BWDD 5CIQA 5FPSA 4PFSA 5EE0A 1W4RA 1FMLA 4GP7A 5FTMA 4A36A 2RGBA 1SHKA 3MMPA 4L5BA 1E96A 2CJWB 3A4MA 1EX6A 4BE7B 5L8VA 3FB4A 2QROA 4C7OA 3TH5A 5B58C 3FMOB 4V03A 1KI6A 1TL7C 3IHLA 1NSTA 4RFSA 3QKRB 3RSOA 4LDJA 2RHMA 1DAMA 3THYB 3CR8A 3CM0A 1OFTA 4DKXA 4PHGA 3L2OB 3WP1B 1U8ZA 1OW3B 4RD1A 1KZGB 3VNUA 1GL6A 2QUZA 4P31A 1TEVA 3KZ1E 2ZE5A 3P20A 4TN1A 1UPTA 1W7AA 1G8FA 3UKDA 2X2EA 1R0YA 2XSZD 5HCNA 3GMTA 2IHYA 4FI3C 4JVSB 1XZPA 2XJ9A 1YR6A 4A6XA 1ZRHA 2WM9B 4F7WA 2C98A 4IJMA 4K46A 3CZPA 2AXPA 1UEIA 4GPTA 1FX0A 1E9EA 1G9XA 1PUJA 1Z22A 5G53C 2ATVA 1DAIA 5EXSA 4Q7JB 4DSUA 4TT3D 4RD3A 4EPYA 1G19A 3CIOA 2F1RA 3CRW1 1NBMD 2NGRA 3B78A 5L3SB 5AJYA 4B3FX 1UKZA 2BIFA 1TQ2A 5G40A 1WA5A 2GVDC 5FR1A 4Q4LA 1D2NA 1W2HA 3GLHB 4LJ5A 2IUUA 3QEOA 5AJZA 4C0HA 5IRCD 2IS1A 1XEFA 3AV0B 4G5GA 1Z6AA 4KAXA 4KYIB 5FOWA 2GWHA 2WAXA 3SNHA 1NN0A 3ASYA 4JBXA 1AS0A 2AHOA 3U44A 4CEIA 4KODA 3I92A 2RGNC 3V4FA 2VP0A 1IN5A 3VMFA 1ETUA 1UKVY 4E22A 4RJLA 2EFEB 2F1JA 3PUZA 4KJZA 1U8YA 1IONA 3KXKA 4KFRA 2OSBA 1YKSA 2OV2A 2RGEA 1NBME 1QHXA 2IXGA 2I4IA 2ONKA 2WBLC 4DDVA 4Q1BA 5SZHB 5JHGB 1NVUQ 1U2RA 421PA 1G3MA 4TLEA 5SZKB 2R6AA 1SXJA 3UG6A 5FTJA 3O8BA 1XJQA 2PMDA 1N6LA 2JGNA 4TL7A 4AG6A 5JFGA 2G77B 1GAJA 3AF2A 5LB2A 4URYR 2XNDA 1T8TA 3GJXC 2ASEA 1E2IA 2FG5A 2CK3A 2NO9A 2QSYA 3MUFA 2AXNA 3OEEA 5A0FA 3NVAA 4B3CA 1ZVQA 2F3TA 4HB3A 3BE4A 3PIRA 1D9XA 2C77A 4KHZA 4BFYA 1E2QA 2CCKA 1NVVR 1ZUIA 2GJ8A 2GEVA 3MWLA 5E7JA 1G5RA 3L0SA 2HEIA 4US2R 1QBKC 5JS7A 2FOLA 2G0NA 2JLVA 2CDNA 3AVVA 1CR0A 4MRPA 1FFHA 2ZPTX 3WYFA 4OYHA 1AS3A 2DYKA 3T15A 3U3KA 2ZU6A 1QRAA 4XD7D 4DIDA 4QJ3A 5FOXA 3FMFA 2V1XA 4B73A 4U02A 4MGIR 1XCPA 4N0DA 2WKQA 621PA 1KSGA 3O8RA 2GXAA 4I81A 1C4OA 2VHJA 3TK1A 2FPKA 1D6JA 5CJPA 5B2ZA 5ELXA 1XMIA 1VG9B 3EX7C 4NP6A 1W44A 2ZUDA 2W2TA 3AP1A 1E4YA 4GFDA 4NL4H 4V0ME 3TSZA 1I4TD 4CEHB 2GJSA 3QENA 4JJKA 1NN1A 2W83A 1DE0A 4BRWA 3BB3A 3SJZA 4PQYA 1ZIOA 2PLFA 3P26A 4V0NA 2HXSA 5EUMA 4PQRA 5C4GB 1US8A 4PAQA 3SS8A 3X1XA 4HUQA 1OJLA 5JCPA 4MKGA 3LXXA 1BMFA 5B30A 4P4SB 2ZRCA 3QKSA 5JEEA 4F4CA 2VF8A 2V8OA 1F2UB 3KJIA 1VCNA 3BH6A 3B82A 5FL7D 3T12A 3TVDA 1XXHE 5J4HA 2YWEA 4NDZA 2CVFA 2IYTA 2EVWX 2QMHA 4LCBA 3EA0A 4ESHA 4EKDA 2GETA 3PUWA 1HV8A 3SDZA 2OXCA 2W6IA 3BAFA 4X8OA 2CL0X 1DADA 2OESA 1R0ZA 4G3XA 4LYJA 3UWOA 3CRRA 4YONB 4MDFA 4FINA 3KQKA 3THXB 4DCTA 4H1UA 3BRWD 5LPNA 5EP4A 4P3YA 4NZYA 4F4IA 5L3VA 2J7KA 1S4QA 1LFDB 1ZD8A 3GJ6A 2AD1A 2DPXA 3DKVA 5DN6A 5FUXA 4YXWD 2PCJA 4ZDKA 1OIVA 2WJIA 3W8RA 3EC1A 1A4RA 2YOHA 5HR5A 1A1VA 1UBFA 4NYJQ 1CJVC 4POAA 4AKHA 3ZIAD 4L16A 5H8WA 3MG9A 2HCJB 4JLMA 2OZEA 2BCGY 1A5TA 2FFQA 5EZ6B 4HUTA 2QENA 2ZRKA 4M2LA 3VR1A 2IYZA 2ZRAA 4JYBA 2O8FB 2G1KA 1FL9A 2XXAA 4GRAA 4QL3A 2WJGA 4M1MA 4QM7A 3K70C 1VCMA 2OHFA 4ZO4A 3OIWA 3QNUA 3NC1C 2F1IA 1OHHA 1TUEA 2VSFA 4B3DA 4QBIA 1Z0JA 1N25A 4AKIA 2IBMA 4BEJA 3CWQA 4YMUA 1AZSC 3WNBA 3LA6A 1ZNYA 4D0LB 3BK7A 1NLZA 2VHTA 1P2UA 2C99A 5FH9A 1UEJA 1YE8A 5JECA 4JLBA 1MV5A 3K09A 1QHNA 5J4LA 2AWNA 2NTYC 5BN4A 2WZQA 3DOEA 2VL7A 2GESA 2JJ1D 1GILA 1X3SA 3ZH9B 1ZBDA 4AC9A 3VKGA 2BMDA 1XCGB 2GJKA 2Q0HA 4GNKA 1UAAA 2GXUA 2ZUCA 5KPJA 4C7OB 2PH1A 3FKSD 3LQRA 1E9SA 1U0JA 2FGJA 5D3QA 1KI6B 1PV4A 2NPFA 1FQJA 1GZSA 4URUR 1FP6A 4RFSB 221PA 1W4AA 2BKEA 1T8UA 1I4LD 2R65A 3MWYW 5CLQA 5EXTA 5FI0B 3DMNA 4IXMA 5DH9A 4TMVA 5JHHB 2ZE8A 1JJVA 2JDID 1AN0A 1Q3TA 3D6TB 4MKHA 4UNPA 4NCIA 3HYTA 4UXIA 3CH4B 2PBRA 4OI1A 4Q03A 4BPBA 3SJBA 2GKSA 2HJVA 5EQTA 1R5NA 4F93B 1J8YF 2ZRJA 3EZ2A 4TQUS 4A92A 1DELA 4Z51A 2R6GA 2WSSA 4G5SA 4OJKA 3RS4A 3TAUA 1U94A 3U7HB 2HUPA 2CHQA 2ZI4A 3ZS8A 4HEJA 4KLZA 1JEEA 4QJ5A 1FPMA 1KKMA 4TL9A 2GILA 3QBVA 4A8JC 4AD8A 4A0GA 4GZLA 4E5UA 2IYXA 1MH1A 1NKTA 2AN9A 3SR0A 2O8DA 5K8LA 2GXQA 5JS8A 1FX0B 1IJFA 3OEHA 2QRZA 2J7PD 2WWGA 2WJJA 3GPLA 4LV5B 1S8FA 1SVLA 4RD2A 1SQ5A 4HDQB 4QRHA 1A2BA 3EPKA 1YZKA 3EPJA 2GEUA 3A1WA 2ZYUX 3VHLB 5F9HA 3WBJA 2WPDD 3GLIA 2QT1A 2A7QA 4ACAA 2QGZA 2ZTSA 4B74A 4WA7A 1Z3IX 2BBSA 1EFCA 5G41A 4EFLA 2PT7A 1RZ3A 2HDNB 4LJ7A 4DB4A 3VKHA 1J90A 2WIBA 3NXSA 1CLUA 3U44B 4HAYA 1OKKA 5G3ZA 3SHWA 1NVWQ 3DZ8A 4IEIA 4O25A 3ADCA 3LD9A 1AS2A 2EW1A 1F3OA 2BBWA 2QZ4A 1N6NA 1Z0FA 3Q72A 2B21A 4W5JA 5UKDA 2BJVA 3GEEA 1KY3A 4BLOA 1KSJA 1RKBA 2HT6A 3QPVA 4KI0A 1G291 1H8HD 2V7QD 3BJIC 1SVWA 5CDFE 2ODNA 4O3MA 2GRJA 2XOKA 3QXXA 4KFTA 1XMVA 3AVYA 1SXJB 3KQNA 2D06A 3VQTA 1QHHA 2O8BA 3KJEA 2Z43A 1DAGA 1YZTA 3GJ4A 3AKDA 1ZNZA 2FDCA 3H86A 1D5CA 1UF9A 3KB1A 1M1YE 2VHQA 4XTRA 4JL5A 4R7ZA 1TX4B 1XMJA 3RRYA 4ESVA 4FMDB 3UWKA 2HXYA 1DBSA 1G6HA 1Q0UA 2OFOA 3DPUA 1Z6YA 2VP9A 3PQCA 5JWHA 2V6JA 4O0MA 4MDEA 1JALA 2H92A 2LKDA 4PC3A 2IF2A 2IYRA 4NPHA 3EW9A 4ON9A 3P4YA 2H57A 2V6IA 2ZUBA 4OI2A 4EFMA 1CJMA 4OI0A 1JQJC 1R10A 5JJKA 4GZMA 4LY6A 4MGKR 1E79A 1G16A 4P0TA 3VX4A 4C0BA 3N2EA 3WY9A 2IXFA 4UKDA 3GLHE 3R7WA 3ECCA 4DDWA 1HYQA 3U4QA 4TYNA 2IYQA 1XF9A 4DHEA 1E1QA 5FPKA 4OK5A 2JLWA 3SYKA 1R4AA 2R2AA 4Q00A 1Z63A 1UBEA 3UK6A 2HLDD 1QHIA 3QQ5A 1DAEA 1W2GA 4G5RA 4MYHA 4B47A 2JASA 4D4JA 5CB8A 2OCPA 1EFTA 2KWIA 1RW4A 2GA8A 2W2VA 5BN3A 1VTKA 2C5LA 3T1TA 2KBFA 1ZM2A 2H5EA 1HY3A 1DTSA 1US8B 2VP6A 3M4YA 2MSDB 2FWRA 4HUQB 3RC8A 2MSCB 1CJUC 3QKSB 1G7TA 5FTNA 1LY1A 2HV8A 3TQFA 4DCVA 2J9RA 4Q48A 3OIVA 5J5CA 1DG3A 4DB2A 4C2TA 4NYIQ 5AUOB 3QJYA 1M7BA 4KSCA 4DEYA 4M1TA 2OO7A 2EYUA 4PSAA 2O8EA 4BUJA 4FXPA 1ZC3A 1Y3AA 2P5TB 4QGGA 5LB4A 3F0TA 4MYUA 4Q4JA 3J81k 2KB0A 5FPYA 1GM5A 4JSTA 3R9IA 4F92B 1KIMA 1NMXA 5E3HA 4PHTA 3PV0A 4GL2A 3M1IA 1VYVA 4M1SA 2J87A 4DLTA 3THWA 2B6HA 1KI2A 2AL7A 4OHXA 4AK9A 3RWOA 1JPJA 4DC9A 3IHWA 5LD2C 1FUKA 4B75A 3QIAA 1NIJA 1P2VA 3LW8A 3BOSA 3EZFA 3UMFA 3EG5A 2O52A 3QY0A 1XWIA 2V3CC 4WZBE 2XXAB 3A1TA 3RRMA 4QXAA 2D7DA 2ZAOA 4DT1B 1NRJB 4Z8YA 3KFXA 2AFHE 2XTNA 3A1SA 1AA9A 5EE9A 4EPXA 5DGXA 2ZYWX 3KUCA 3PEUA 4XTCS 2DFTA 2GF9A 2Y8EA 2H18A 4QOSA 5KOYA 3TUZC 2IF0A 3QXHA 5CIWA 2JIZD 3GFOA 4YMTA 2GCOA 1CTQA 4JLPA 4W5HA 1G20E 1HEIA 3KQLA 1RRCA 3HU2A 1GWNA 2CLDX 4HAVA 3HPRA 3A4LA 1RRFA 2F9LA 3GJ0A 2JLYA 3EA5A 4KSBA 4BQSA 1R8QA 2QPAA 2ZITA 1IQPA 3I32A 4DVGA 2WTUA 1WE2A 4H1VA 2GF0A 3L43A 5H70A 4ZI2A 5K8TA 2XB4A 3KTAA 2VHUA 3RRNA 1TTTA 4YDSA 1N6RA 1ESNA 4QHYA 1PZNA 2F3RA 1G8PA 1Z47A 2VA8A 3LLMA 3NDPA 2HJGA 4HB2A 4URXR 5K8IA 4W9MC 1NF3A 1E32A 3MAAC 4BFUA 2IT1A 3AVOA 4LJAA 4I1VA 3SE0A 3A4NA 5IK2A 1E9DA 3CNLA 1T3HA 1XTQA 4N0EA 1AM4D 2JAQA 1MKYA 4M0LA 3IQXA 5BQ5A 1ZM3A 2ZRHA 5FL3A 4URVR 2XTZA 3IPXA 4S35A 1XTJA 1II0A 1U81A 3Q9LA 1IN8A 1FP7A 2P65A 1JJ7A 1G5PA 3T35A 4B71A 2G6BA 5JSZA 1T4GA 3ICQB 2ONJA 1Z8FA 5EUQB 3ND9A 3N5CA 1EFHA 3ZGXA 4WZAE 1HURA 1KGDA 4RKEA 3U7EB 4C0SA 2ZVQX 3L0PA 3U6BA 5DI9A 2NOAA 3GLIB 3I61A 1CR4A 1ZC4A 3KKQA 4BFVA 4Y0VA 2VLIA 2ZSFA 1SHZA 4JLNA 1T0JB 1OYWA 5JRZA 2P6RA 3NC0C 1VCOA 1F5NA 2FA9A 2UZIR 3T5GA 5FR2A 4XWOA 2QT0A 1D2MA 4JKIA 2GTPA 4NBSA 1UDXA 1NKSA 4IHQA 3FPAA 3RS3A 2ZJ5A 4EDHA 1X86B 1HT1E 1U9IC 3PUVA 1IM2A 4NH0A 2A78A 3WNCA 2XTMA 4QNMA 2W6JD 1PVOA 2GJ9A 4FMCB 5DHFA 1GKUB 2REOA 2ZIAA 2C03A 3WHLA 3B13B 1KI8A 2QPOA 2RB4A 3HU3A 4CW7A 1E9BA 2Q21A 1QHHB 1E0AA 2O8BB 1KO5A 2QI9C 3FWYA 1OIWA 1S9DA 1RYFA 4Q1AA 1CS4C 2ZJZA 1PLKA 3BB4A 1E2FA 3PXGA 4OBEA 4OL0A 4KFSA 1DEKA 1E2LA 2VTKA 2GK6A 2DFLA 1VECA 5E4FA 3VR5A 3OZXA 3AVTA 3AGPA 5HZKA 1ZU4A 2R6DA 1N6OA 3JVVA 2NPIA 5SZIA 1W36B 5KSOA 2BBTA 4Q7MB 4B76A 1VG8A 1NVXQ 2EYQA 3W5IA 5GJCA 3CF2A 4IEEA 1N5KA 2UVQA 4DDTA 1GKIA 1Q1BA 3GD7A 3TW4A 1P60A 2WMNB 4LOAA 4Q7KA 4Q9HA 2GEDA 1SXJD 3VNVA 4UQOA 4QKQA 3R7WB 4QGHA 1QHSA 2VRWA 3U4QB 3UG7A 1DG1G 2XNDD 3V00A 2FEMA 1XB2A 1R0WA 2EQBA 4MUAA 3OF5A 3K8YA 3OEED 1OF1A 3H2YA 1EESA 4JVMA 3U3JA 2C78A 2J5XA 4IW3B 4CT5A 1T3LA 2FZLA 3IGFA 4YQFA 1RC8A 4FWTA 3ONWA 3PCRB 4Q01A 5IDVA 2ANBA 3AF1A 5EXPA 5EJEA 2W00A 2CCGA 2J3EA 1IXSB 1E1RA 3B9QA 4EJSC 3SI7A 2E9SA 3CPJB 2C9CA 2WJHA 3SYLA 5F9FA 1P9WA 1BKDR 4RSGA 2G88A 1F48A 3U3RA 4Y0AA 1SXJE 4JZKA 3EZ6A 4DUGD 4JBYA 2ZI5A 4TQAA 1P61B 1NVVQ 2ZVPX 3T1VA 3E5HA 1COWA 3N2IA 1UADA 4A9AA 3EWSA 4DJTA 1RFLA 3B1WA 4RFVA 5DISB 1KAOA 2YC4C 4JLOA 4I4LA 2BEKA 4AYXA 2W58A 3I8XA 2O8EB 1E69A 5AJXA 2QP4A 5E7MA 2CHGA 4ZIRA 2ZQ5A 4IOLA 4U00A 4Q4JB 1WBDA 2YV5A 2VSOA 5IHPA 1YZGA 3IIKA 4X8HA 2FE4A 1XU4A 2AR7A 3CF0A 4TQ9A 4B3BA 2WWIA 2RKOA 3B85A 3TMKA 1BMFD 4LHXA 5J4KA 5KNBA 3THWB 3NBXX 3NIBA 1L8QA 4ZCLA 1M74A 1LS1A 5B57C 5C46F 2D62A 4LZZA 4JL8A 4HAZA 1X8JA 2PLRA 1E2NA 1GL9B 3VX3A 1ZM4A 3BFVA 2YJTD 5FBQB 2W6ID 1U0LA 4M9SA 4NCNA 5JJLA 2D2EA 2H17A 3QKUA 1XTRA 3L8ZA 3KKMA 4I1UA 4JVLA 5FUYA 1V43A 1L2TA 2AKAB 2PZEA 2DWOA 2DBYA 5DO9A 3IKJA 2Q9CA 3AVQA 5DN6D 2OXRA 4NYMR 1OYYA 1T9HA 3ZVMA 2QU8A 5DI3A 2ZJ2A 1OFIA 1WP9A 3CWZA 2IYUA 2ZJBA 2GCOB 2OM2A 5TARA 2VPPA 1Z29A 1IY1A 1IBRA 3OFNA 4CGZA 4AI6A 4MUBA 3ZVRA 4C30A 4HB4A 1NJGA 3MSXA 3IEUA 2CHVA 3GLGB 5EP3A 2FZ4A 5FOUA 4OK6A 4AURA 1JAHA 1GP2A 5L3RA 3U3MA 1G21E 1L4UA 4C9BA 1OXSC 3NWJA 1M7GA 3KTAB 2QM7A 5FOTA 3PG5A 1WBBA 3LDAA 1CIPA 1G8YA 4L8GA 4DEXA 3LXRA 2QA5A 2YWGA 4ARZA 3LBHA 1EK0A 2B92A 2YOFA 4QBHA 2ODBA 4WXRA 4GBMA 2X1VA 4JYCA 3SU8A 2IHBA 1Q22A 2YWHA 4B44A 4D81A 1Z6TA 4LV8B 1XNJA 2PX3A 3VR6A 1OT3A 4D4KA 2Q9AA 2J0UA 1D9ZA 3HR7A 3MJRA 3OE7A 1QG4A 3BD9A 1ZNXA 4LHZA 3X1YA 4JLJA 1DO0A 1KI1A 2ORVA 2X19A 1U90A 4M9XA 2XSZA 1CJKC 2Q3HA 4G01B 1E0JA 5AUPB 3ICEA 1KAGA 3FE2A 2FEOA 3NHAA 3K9NA 5JSZB 3BC1A 1N6PA 2ZYTX 3EIHA 3NG1A 1N5LA 1E6CA 4PZLA 4URZR 3FMPB 4M1WA 1T5IA 4ZCMA 3W8NA 1UJ2A 4MRSA 4A0RA 1NBMA 1D2EA 1XFAA 3IO5A 3QPUA 2EWWA 5FUVA 2RGCA 3LWNA 3DMDA 3DZDA 3A37A 2JJ8A 3THOA 3KB2A 5KSYA 1YR9A 1S2MA 3KQHA 3NHBA 1G64A 2XNSA 1D8TA 1X8LA 3B9PA 1NG9A 1MABA 1SULA 1W48A 1PJRA 3OIUA 1Z0IA 4LJ6A 4YC7A 4A2QA 3OEHD 2PT5A 4C0QC 1UBCA 1OV4A 1ZUHA 2OFWA 1S0UA 5JWOA 1G17A 5FUWA 2OBLA 1F6BA 1N3BA 4TLBA 1Q57A 3U7FB 3W90A 3ZZUA 2YVUA 1VCIA 3DOFA 1TPZA 3QKTA 4HZUB 1XEXA 3FDIA 2PL3A 4Q7LA 4RZUA 1P9NA 5DIFA 1ZMXA 3TRFA 3PR1A 2ZRPA 3GLFB 3Q7QA 4DLWA 2Z0MA 1OKKD 1WCV1 4KLNA 3D3QA 4V0KA 4RKFA 1KO4A 4O2RA 3KJGA 1HH4A 3AVPA 3M0EA 1U9IA 4WXPA 4QNRA 2ZRIA 1DOAA 1VYUA 4PC2A 2ZYVX 5AWFC 1XMSA 1JECA 1Q44A 2WKRA 1ZINA 3KL4A 1GFIA 3CRMA 1KDTA 4US1R 2CNWD 2NQ2C 2FJUA 4XSGA 4ZPXA 4D6PA 5JBQA 4D25A 1KJWA 5K8UA 1UBGA 3RLFA 5JMTA 4LHVA 4P33A 2XOKD 2WWYA 4Q66C 4HSEA 1IN4A 4HI0E 3U6KA 2OE2A 2B7BA 3AUYA 2NO7A 1K8RA 2ZR0A 4KU4A 3T1OA 3TUJC 3TR0A 2ZI3A 5HKKD 3AP2A 2OBNA 3GEHA 4Z1MA 2FV8A 2RGGA 4XD7A 4CRWB 1QZXA 1XJ0A 1GRQA 1AQUA 4H9GA 4BGDA 5IF9A 4AYWA 2QBYA 4FW9A 1KMQA 2QMEA 4PO9A 2PEYA 5GJWC 1EWQA 121PA 1KHTA 3CPHA 2G1JA 1P4SA 1W36D 1IN7A 3VHXA 1PUIA 1OH7A 4XVUA 4NU0A 1T0HB 2N46A 1LB1B 2GVZC 3F8TA 2XGJA 1N6IA 2AWOA 1T91A 3C15C 4AWXA 4L9WA 4B2LA 3QF4A 1W46A 1AGPA 1GNQA 3K0EA 2QQEA 4BFZA 4A4DA 3SJCA 2ZE7A 3ZYCA 2JJ2D 2PX0A 1KKLA 2NO0A 3NBYC 4XH9B 4A15A 3AVWA 5DYIA 1OLOA 2DR3A 5JCZA 1WB9A 2R6FA 4JL6A 5AR1A 2C9OA 1LF5A 1PLJA 5JWRA 1E9RA 3CO5A 1EG7A 4OQFA 4OJQA 5FL7A 3TSOA 3EAQA 1KOFA 4TLCA 3W3ZB 1N5JA 5H68A 4EQ6A 1EFRA 5KSZA 4HAWA 3ZZTA 2AX4A 1CRPA 3IIMA 2YYZA 3LVQE 3EZ7A 4ZIRB 4NYJR 3IILA 4TLDA 4BFWA 1MT0A 4BLQA 1FOEB 2ODWA 3K0CC 2A3RA 4M8NE 1VPLA 2FNAA 1ZW6A 2XB2A 1SVIA 1G1MA 1TADA 3SEAA 1NP6A 2RAPA 2WOJA 2G3YA 4TZ6A 3KUDA 3VR2A 3CUEF 4HLDA 4CEIB 1S96A 2IYVA 3SBEA 3KJHA 2WWWA 2O0KA 1CXZA 1LW7A 2P67A 2R62A 2ERYA 3A1VA 2E1RA 2QG6A 3DVLA 4N3NA 4PPNA 3B7GA 2IS4A 3GEIA 4R2IA 3X1WA 5IT5A 1YU9A 2XX3A 4UNRA 1X1RA 4I99A 3Q5DA 2ZSDA 1GNRA 4IFBA 4PPQA 2ZI7A 1BOFA 1II8A 2JLQA 3WYAA 1GIAA 1SVKA 4QBGB 4PR0A 4Q47A 4WZ6A 5G3YA 5DYGA 5EZ5A 1KO1A 4MGYR 4BRUA 1OXTA 4J0QA 4PAMA 1JXOA 4TYWA 2RGNA 2CVHA 2QE7D 1YR7A 4X8MA 4NHOA 3VU9A 1W5SA 4TWZA 1ZP6A 4MRRA 5DNYB 5JJIA 1C9KA 3LLUA 2VQSA 4OK3A 2G0TA 2NMVA 4CZ2A 5BW8A 4UNSA 4GDFA 4PANA 5LBIA 2JJ1A 5EP1A 4PHHA 2FSHA 1TMKA 3RNLA 3LX8A 1U99A 3CKLA 2VH5R 1Z6GA 5F98A 3HYRA 721PA 1VMAA 4US0R 2QM8A 3MD0A 1S3SA 1I2DA 1W47A 1GNPA 1K5GA 2BEJA 3Q5EA 5FPTA 3ZZ0A 1Q1ZA 2YNMA 1VHTA 2VEDA 3DM5A 4KXFB 1S1CA 4ARZB 4F4JA 3C5CA 4DSNA 1JR6A 3G5UA 4DRZA 1DO2A 3R8CA 2ZS8A 2IYLD 3OAAA 1GVNB 2CLCX 2B7CA 2CMKA 1XEWX 2QAJA 2RGDA 1J70A 2ZR7A 2IWHA 2VF7A 1H65A 2ANCA 2ORIA 4NCJA 2OILA 3A1UA 5CYOA 1OXUA 4I1SA 4A0HA 5CITA 4DLUA 4PAOA 1QHGA 2WWHA 2EFHB 2HYDA 2R6CA 3DO6A 2IS6A 4XOIA 3U61B 2ZS7A 4E09A 1M2OB 3SJAA 4D4LA 3UANA 3U3OA 3GJ8A 4B2IA 3BORA 4B2PA 4QBFA 2ZU0C 3WNDA 1KMHA 1GRNA 3PEYA 3H0KA 1CP2A 2J7PA 2RMKA 3W3AA 2OAQ1 3IEVA 1VDZA 1A82A 1OPXA 2RHDA 3W6NA 1K6MA 1YVDA 4AKGA 3BGWA 2EU8A 4M22A 5CDFA 1NLFA 1P2SA 4DIEA 1ZUNB 4LV6A 2YWFA 4JLVA 5FBWB 1T3SA 2FGKA 4MH0R 1SVSA 5BYKA 2KI5A 4IDQA 1E2EA 4NONA 2IK8A 1L4YA 2BOVA 1KK1A 3U60B 4TYQA 1ZJ6A 3DEFA 4A82A 3GLGE 3CW2A 4LWZA 3WXMA 1E0SA 4N1AA 2AD5A 1MABB 2QTHA 2PJZA 2D4HA 1IY2A 1N0VC 2JLSA 3GFPA 4U5XA 1LTQA 4D82A 1CBUA 4HLUC 2OLJA 3EIEA 4FCWA 4CYMA 4YMWA 5GJVC 4W5WA 3SYNA 4M1OA 1G5TA 4HYYA 4M1KA 2OLKA 3AGQA 1TAGA 3LY5A 2PZGA 2C8VA 3C16C 3SFVA 1ANKA 4QM6A 3WRXC 5F2EA 1K5DA 4EPRA 1KI9A 3K53A 4L15A 4Q21A 4P32A 3CB4A 4HZIA 2WOOA 4M4SA 1P73A 2WVJA 1UKEA 1KO8A 1CU1A 4EPTA 2OBMA 1LVGA 3AF3A 3WP0A 2QSZA 1SXJC 2ERXA 4AY2A 4AYTA 3PENA 1VG0B 5HTKA 3TGPA 2QY9A 3ZVLA 2ZRNA 1G3UA 3ZLJA 2ZM5A 2EFGA 2J59A 2B8TA 2AKYA 4D2IA 4UXJA 2DFNA 3RHFA 4OQMA 4PZYA 1S3GA 1RRGA 3HJNA 2IA5A 4MYCA 4CF7A 2PJRA 3LQQA 1Z28A 4KVGA 1MO5A 5TDHA 1XPRA 3AUXA 3H84A 3MGCA 1W4BA 4JLAA 3P4XA 4A0FA 3AVUA 5TVKA 2RH5A 2HCBA 1Z2AA 1EFUA 4AKEA 5A5GA 1ZNWA 2FF7A 1N6KA 2Q3FA 2VHCA 3VR3A 4KCGA 4PXAA 4Q4AA 2L0XA 1TF7A 1ZAKA 3X1ZA 3PVSA 4U7DA 2QBYB 3ADKA 4FCTA 4OHWA 3EPLA 3VTKA 3W6OA 4TMWA 2HLDA 4RD6A 1M34E 3D7MA 1CF4A 3BFXA 1NNEA 1BS1A 3QOFA 1ZD9A 1XZQA 4FCVA 1E2MA 5KDDA 5HCIA 2WIAA 1Z5ZA 1TEXA 3KDSE 4QHSA 1ELOA 3U7GA 2IUTA 2C96A 1KJYA 1WRBA 1XD8A 4RZ3A 5D3MA 2D2FA 1WDTA 3KKNA 2FU5C 4IOMA 1GOTA 2GDJA 2I3BA 4OKSA 4TSFA 4R98A 5J4YA 2O8DB 4BLRA 3TVTA 4FMBB 3CNOA 2EWVA 3LVRE 3AQ4A 3GLFE 3R9WA 1ZIPA 1YZUA 1NN5A 1ZD1A 2XEXA 3RWMB 4EQ6B 3WMEA 4BEBA 2JLZA 2CE7A 1MR3F 5L3QA 1ZCBA 2DFKB 1E1RD 4BWYA 1H8EA 2LWIA 4GI7A 4CEHA 2C04A 2I1VB 1Q1EA 2ZROA 2QAGC 5HE8A 2OEPA 3G0HA 1GG2A 5SZJA 1W0JA 4DDUA 5CB6A 2FSFA 1XD2A 4A8JA 2ZRLA 2WICA 2KSQA 1NY6A 4P4SA 1OIXA 1QF9A 4TMXA 1F2TA 2Q9BA 1CJTC 2GAOA 1KSFX 4S2EA 5FBLB 2IYYA 1COWD 1NSFA 1G7SA 2QP3A 3LV8A 3T1QA 4A6PA 5BN5A 5KDOA 1IY0A 4IRUB 2GAAA 1E2DA 2R8RA 5JEDA 1W1WA 2BMFA 2X8AA 1JR3A 1N0WA 2VP2A 5TXGA 1OXXK 1II8B 3W6PA 1X8KA 1KDRA 4LUCA 2DHRA 3ZD7A 2XAUA 2CEAA 3F3YA 2ODEA 2X77A 2GXSA 4YLGA 4C4PA 2JATA 5HZHA 2KE5A 2BCJQ 2YKGA 3GJ7A 2ORWA 3B1VA 4CIDA 2A5YB 1G4AE 1KI3A 2A2ZA 2P6NA 3P1JA 4HAUA 2OCBA 2OCAA 3VU9B 4JLDA 2JIZA 1TQ4A 1M8PA 1E98A 2DB3A 4Q1FA 5KSPA 4D4MA 3EC2A 3K09C 4B34A 1YHNA 4TMKA 4ACBA 1E9CA 2TMKA 2GJAA 1R6BX 2V9PA 3B2EA 2AK2A 1DS6A 3O47A 1NG1A 1HQYE 3FKQA 5EE5B 4ERNA 1ZM9A 3QPWA 1Q1QA 4FIDA 5DHAA 3W5JA 4M53A 4F91B 1FQKA 3ADDA 1ODFA 3TAHA 1E0KA 4FWIB 3EARA 3FHTA 1XRJA 4PX9A 5F3WB 4LJ4A 4TZ0A 2Z83A 1EWRA 5DE3A 1AK2A 4AG5A 1E2GA 1KO7A 3I5YA 1BYUA 1ESMA 2GK7A 4BFSA 4GOXA 3EZ9A 3S1AA 3RS7A 1AJEA 4PC6A 2CK3D 4MKFA 5KPDA 2SHKA 1RE0A 3CBQA 2W0MA 4OHVA 1DAHA 3QBTA 5CLLA 2O8CA 821PA 1OE0A 1IHUA 5KO2A 4OI4A 1AZTA 2G83A 4LI0A 4D80A 2QPTA 4NTZA 3ADBA 4M1YA 4IDHA 2QEQA 4UJ3A 3OHMA 2Q3MA 2ZRGA 3NDBB 1KMHB 2R9VA 1XTKA 4ABYA 1JNYA 1M7HA 1HE8B 1KNXA 1R5BA 1W0KA 5JRJA 1VG1A 2NG1A 3QXCA 2HF8A 3CR7A 4I1OA 4Q1DA 4LYAA 2X2FA 1J8MF 2V1UA 3F5FA 4LHYA 2P2LA 2OG2A 3GCGA 4M9ZA 2W2XA 3OE7D 2FPMA 3B60A 4LBYA 1NMZA 2QNRA 1R0XA 1KI7A 4KBFA 3LX5A 1GKYA 1ZYUA 4UNNA 4YMVA 2IL1A 1HE1C 3LBIA 5C1BA 3AKEA 1R8SA 1OXVA 4IFEA 4DLRA 2CBZA 1X6VA 2BKUA 2OUKA 1BH2A 3L8YA 4L9SA 4XIGS 3TSWA 3CF6R 4ASUA 2ZI9A 2QRNA 2FFHA 3IO3A 4TTRA 1TQDA 2WV9A 1LNZA 1IXZA 1VIYA 2FSIA 4RCZA 2W6JA 3TBKA 5HPYB 3G82C 3QE0A 4G5OA 3K0AA 4DBLC 1CEEA 3IUYA 4IVQA 1IOZA 2F1HA 1P6XA 2V54A 2ZR9A 1RIFA 2D3WA 4WVFA 3VR4A 2FSGA 3FVQA 2CLSA 3X2SA 1O3YA 3MWKA 4HLUA 4Q1EA 1B23P 1RJ9A 3I5XA 3C14C 4Z54A 3MFYA 4FN5A 1A2KC 5FTKA 2ZXUA 3JVUA 4MRVA 3TIFA 1KK2A
chains in the Genus database with same CATH superfamily
1TA4A 3CLTD 4RVCA 5A04A 1RPZA 1MFZA 1UKYA 1G5IA 2G9QA 4DRXA 4F5YA 1WZ2A 4RXMA 1A96A 2PO5A 2AOVA 4YMIA 1DEOA 1ADYA 1NTOA 2VIIA 3EXHB 3KYJB 4LHWA 4O4HA 5K3BA 3FN4A 4XR9A 2JA1A 2PO7A 1NJFA 1UT8A 3KKEA 5KREA 2JCYA 1A3CA 1TNDA 5IJWA 3ZCVA 1JAIA 3UHOA 4LXTA 4AICA 1LLDA 5KNDA 3L0OA 4HDKB 2Q29A 3RRFA 4G0MA 1XDBA 2ZEJA 4YUAA 3EASA 4GOJA 4G0UA 1T25A 4DJ5X 4U7HA 1DTWB 4LJLA 2Q2VA 4DIFA 4EYSA 2IGBA 2NU6B 1CERA 1NW9B 1GSIA 2X3FA 3LY9A 3PQ5A 1PKEA 4CEJA 4KITB 4Y2RA 4QXMA 2ZXEA 3MTIA 1X74A 1CV2A 2W2OA 1BJTA 2ARKA 4AJKA 1BCRB 1G4UR 3DZKA 1YJBA 4G23A 3TI7A 3SN6A 5FNZA 4GSLA 3ASZA 5EHNA 1JB9A 4JT2A 3OZWA 3KQPA 5HBGA 3TXXA 4OKIA 2ID8A 1MAUA 1YVRA 4EDFA 1BA2A 1JHPA 4MA4A 3KOOA 2E6KA 3STVA 3TSCA 2BHRA 3MCAA 4G5QA 1VLHA 1RWWA 4KXLA 4MAFA 4R4JA 4LY3A 4MKRA 5CLIA 5ALSA 3WQHA 4F96A 2XJ4A 2ZULA 3QP9A 3H05A 3PQ3A 2RKWA 5GV8A 4RD0A 1UK6A 4Q3KA 4HC4A 3HPQA 3OI7A 5FO1A 2RB5A 4JUFA 4DUGA 1IJEA 1EM6A 1ZD5A 2NPOA 5ALIA 4DCNA 2VDPB 3F9RA 1Z2CA 2M9MA 3HWSA 4QLAA 3GG9A 2IEZA 3MUOA 3IOCA 4UDYX 5E4YA 1GFWA 4TT3A 3C8UA 2AFHB 3H83A 5LP6A 2O8NA 1AGRA 5FUBA 4HQ0A 1BTOA 1Y8ZA 2AE1A 2GN8A 1K75A 1IMOA 3PYXA 1E2UA 5DHTA 4D9NA 1V5WA 1PTJC 1BS9A 2Q7XA 2I87A 2MSWA 2XNKA 3AH8A 4ILEA 3EFOB 4JHLA 3RS0A 1NHGA 3HGMA 1P62B 5F64A 4WHMA 4A2WA 1XCLA 2RBGA 3FGZA 2DUJA 1CQIB 1G20B 1Y3IA 3DE7X 2C4WA 1OFUX 1NZFA 2QZ9A 2ZTHA 1P1IA 1IZ0A 1UPBA 3EFEA 4HQNA 5J1TB 3QG5A 4AMZA 4CG1A 4KV9A 3CYFA 2I2FA 5BN5B 3UMRA 2YHSA 1NI3A 4X20B 4C43A 4CU2A 3TLGB 5TLSA 1CR6A 1JDZA 1SVNA 1SCDA 1EGAA 2C2GA 3U4IA 1JX6A 1E9FA 1Z5OA 3AL2A 3NH9A 4HPJB 1VJ0A 1J2JA 3GB9A 1JDBC 2XKKA 4DSTA 2HYIC 1WMBA 1A8PA 2G5CA 3GL9A 3H99A 3JYLA 1HT2E 4PYMA 1TU3A 5DP2A 5EWMB 3UK2A 2IYWA 2XHZA 1F4PA 1EM8B 2AH5A 3ILYA 3KX2A 4K6CA 3V4VB 4BTVA 5ALYA 2QAGA 2GBLC 3CT4A 5DXJA 5ERXA 3D5EA 3NYIA 4FLMA 1BO6A 1YNSA 1AG9A 1SPBS 2C4KA 2HPVA 3C3XA 4LPKA 4M0FA 4RMIA 4L3OA 4H1WA 1JU3A 4IP0A 4EHLA 4C3OB 1L7BA 4E5PA 2OOSA 3CX6A 3QVVA 1P4GA 4GS5A 4PV7A 2BTEA 4N5LA 4L4UA 2POQX 2H85A 5I47A 1JI3A 1RHJA 2ZRMA 1IM8A 3IVRA 4OQYA 3SQXA 2JIQA 4P80A 1IUNA 4NAUA 3CY6A 2V7GA 2GCGA 4FX5A 1E4VA 3HMKA 3R20A 3PUXA 5AKYA 1AUPA 2I2AA 4ZOLA 4PZCA 5CJ2A 2RHOA 3DLIA 4OM7A 2O7NA 4BCBA 3I9JA 1SVMA 1RM3A 2FN4A 2Q1YA 2VWPA 4YDRA 4LK3A 5J2TB 1Z4LA 3NCTA 4HT3B 4DT1A 4ZQHA 2ZIGA 1RAEA 4ITRC 3BH7A 3VUEA 4EW6A 3ZVNA 1AHIA 2LKCA 3N70A 1QE5A 2Z8XA 4K9KA 4JIGA 2OORA 2GFIA 5AHRA 3ORHA 1TC2A 4BECA 2K5UA 2PDAA 1MOSA 4WUTA 1KK3A 1XSEA 2CJYA 2RGXA 4TTQA 1BZYA 1TCUA 1Z06A 3S1AB 1TLLA 1RBMA 1FZQA 1X15A 3AR3A 3H18A 4XWAA 5BWLA 2XZDA 3KDAA 3QG1A 5D1NA 5K05A 2OCXA 2WHQA 1AQ6A 4ZVRA 3D8NA 5GOZA 3PXEA 3KQUA 1T6NA 1FRZA 3DMHA 1GZ5A 4XWYA 1F5SA 4IXWA 3ND8A 2BTQA 4YIKA 2ZIZA 3CZQA 3VVBA 1Q7RA 5EE3A 2RGAA 4E07A 3O8QA 1UC4B 2B0CA 4L8YA 1JBEA 3PKZA 1W8DA 2IYAA 3A0UA 4FEGA 1CULC 2GPWA 1HI9A 3CNNA 1MQ9A 3GXOA 3QTTA 3OD5A 1LF0A 1R8YA 5COAA 3C70A 3C45A 5IF3A 4QGFA 3SIWA 3OT5A 5LSAA 3HO1A 4LDQA 4RHYA 2UZ3A 1IHPA 3E3LA 4JS0A 3K5WA 4LNUA 2G9NA 2RHWA 3F6EX 4FYWA 3T4XA 2ZGVA 4YRKA 3I72A 5AHWA 2OHXA 4OD0A 3DDHA 5C2JB 1V4BA 3PITA 2IXBA 2QMOA 3DT9A 4BQFA 4DANA 4ABTA 1E94E 4A1OA 3AB8A 4ZEOA 1O4VA 1GFZA 1KXZA 2AG5A 3BE5A 4I5EA 3ZW8A 1PYGA 3ECSA 1EJ0A 1FLDA 3R0IA 1IQRA 4CV3A 5L4LA 3C5HA 1QU3A 1XJCA 2HIGA 2CL5A 2J3DA 1ZKMA 3E8MA 2ZSBA 3LVFO 1QAQA 2CCJA 1MD9A 1ZMOA 4GYKA 3RGGA 2CXNA 4MQEA 3H1TA 3OKAA 4QEZA 3MT9A 4OUDA 1V9LA 4YREA 5KJ6A 3SC3A 2WI8A 4HRAA 1HEYA 2O0HA 4ZVSA 3OUTA 4TZKA 1BGWA 1WXQA 1KTVA 4RK1A 1RLJA 2GAJA 4Q18A 1OZAA 5TGDA 1A2QA 3RJTA 1J24A 2X9QA 4KXVA 1JIJA 2OY0A 2O9JA 3ZIDA 1A7JA 4ZAVA 5KYUB 3QLJA 4JXKA 4BY9E 1HL3A 1EI9A 3TLKA 2LGJA 3PC4A 4OQXA 2VUIB 3B6JA 3BERA 1GQYA 4HDAA 1K66A 3IODA 4M83A 4QFMA 1C5KA 3G2OA 5DXAA 5FI5A 4WL0A 3RS8A 5AK0A 3N3AC 3VH1A 3KKPA 4MWEA 2PQMA 1OI2A 3ILVA 3A6FA 3IV6A 1U3DA 5LOVA 2F8MA 1GL7A 3JSXA 3NTQA 1UBHS 2VK4A 4ZALA 4RPKA 2CF6A 4ZOCA 3ME5A 4RKQA 3FCEA 2WQZA 1CSEE 1TE2A 2LCFA 2D2XA 2EJCA 3I39X 1TF5A 3E81A 4BGEA 3A36A 5A4FS 2QL9A 1UZNA 2XVZA 3DF9A 3JQAB 3ODPA 3QQPA 3DV2A 5A0VA 2PN1A 4EH1A 3L7LA 5JD4A 4BNGA 5D8DA 4KQHA 4HGOA 2ZDQA 1YIOA 4MCIA 1P18A 4OHZA 4YYEA 3NOXA 4OFBA 1V1RB 3RVBA 5KOIA 3O8DA 5CM8B 1ADJA 1Q0QA 4AF8A 4CMEC 2OHIA 4HVAA 3KYDA 3BCHA 1RAFA 4NBRA 5C4IA 4AY6A 4DZRA 2BM1A 4Q3OA 5THXA 3R9XA 1RAIA 3FWNA 2IS2A 1JKFA 1MRSA 2X2PA 3UOGA 4UFNA 1X80B 3HJBA 4WAUA 4O33A 5TT1A 5KDLA 4PC7A 5KJ1A 2PSHA 4P93A 4M8IA 1HFEL 1FTNA 1JHOA 5DW3A 6NULA 3GQBA 2HWXA 3OBIA 4L50A 4CKYA 1SBYA 13PKA 4HLCA 1B2LA 4HEQA 3ZJYA 2AGVA 2JHAA 2PH3A 3L1KA 4C7VA 3DUWA 1EU1A 5LXTA 3TN7A 1E20A 1HXHA 4XVQA 1BIFA 3SQNA 4F71A 1A7KA 3E3OA 3K70D 3RIEA 2AC2A 2EP8A 2GHIA 3OCZA 4FHDA 1BRMA 4H7HA 2P1DA 1TQ6A 3OZSA 4RIHA 4RY8A 2ZOSA 2FFBA 2JJ2A 1JEYA 3ANNA 4WK6A 2LE0A 4DLYA 1U7ZA 2Y71A 1C30B 2DTEA 4WNCA 3RJZA 5FADA 2PBFA 1P9RA 1QTNA 1HDOA 5B1YA 1RJFA 1S7CA 1WNTA 2IHJA 2QLNA 4IJUA 3DWGA 2B20A 5CX1A 3IQEA 1A9QA 3N59A 5T67A 3RKRA 3NUQA 4C29A 1JR4A 3P27A 4IS3A 5BXQC 3AF6A 4YCDA 3O5AA 1IJBA 3L07A 3VOSA 2ICAA 3QHPA 5HF5A 3U4QB 2G71A 4HWOA 4LF5B 5CHYA 1S89A 2WFZA 4BQQA 5IK2D 4RMNA 4MVYA 4BNMA 3NNSA 2VI5A 5K0NA 5AW7A 5LQJA 3WQSB 3IIJA 2WPDA 5J47A 3V1NA 2V4UA 3SHVA 1V39A 2HD4A 5CA1B 4H15A 1PVDA 1XCMA 1YL5A 3WBKA 2X42A 4M0UA 1KMMA 2O06A 2XUPA 4B17A 3DDUA 2Y0BA 3I5MA 2AUTA 3IRVA 3E70C 4YMSA 3JARA 1PS0A 1RMYA 4I66A 5KVCA 5BURA 3U2QA 3ZQJA 1H2XA 3O4FA 2Q6TA 3L6CA 3QF7A 5B3AA 3O2JA 1ZRMA 4MJ7A 4BZWA 1JHZA 3HP1A 3KO8A 1DKRA 2QXYA 3O9MA 2C95A 2UVPA 2Z2ZA 3TQCA 2CVOA 3G9QA 3HG7A 3PHLA 4TX1A 3O2QB 4L57A 3TFQA 3REFA 1FYXA 4FLEA 2CLMB 1CZRA 5M04A 3PIDA 4WXYB 4IGKA 5DLEA 4Q5IA 1U3CA 3F49S 4EM6A 2FFAA 5CLGA 4DLSA 4MTLA 5ED0A 1J21A 1YWGO 1LRKA 2QX7A 3E3AA 4Q9JA 1CS0A 1KZ7B 4OAOA 5D51S 1U3GA 2CN1A 5GONF 4E2XA 4PO1A 3NBMA 5B2EA 2QU7A 1JXMA 5J2UF 5GVSA 4AFNA 4K05A 4G4IA 1A4IA 2ZYDA 1T5BA 2RK4A 2ZWVA 3BTUA 5AW3A 1F2DA 1L7RA 3NEJA 3RSGA 3M2TA 5AW8A 5KKCA 3COPA 2WU3A 3U31A 3VYUB 1WUKS 1EVYA 3D8SA 4GT1A 4RNDB 3F7TA 2I22A 3G0BA 3GP8A 4W5RA 2MMCA 3PJDA 4OB7A 2VTBB 3BFKA 4ESOA 1YZYA 1OSNA 1EIWA 3OLVA 1G59A 4PYRA 2K7FA 2NUAB 1EAMA 1TYZA 2G04A 1SWWA 1VMKA 3GZ4A 3RT1A 4D8TA 1CDEA 1UFKA 4Q9IA 3ASUA 3ZWMA 1I2MA 3ONEA 3SXPA 3D6NB 2BI8A 4FI3F 4HNRA 1CZOA 4I50B 4JN6B 2C5AA 4QDJA 5FFMA 5IYZA 1PWEA 4YA6A 4C4XA 2CD7A 3M34A 3AEQB 1R74A 1DWOA 2OZLA 2PX8A 3W7AA 1S1MA 1SG6A 3DVSX 4LOKA 4KPYA 5JISA 4E7OA 1O95A 2PEZA 2JH9A 3K96A 2REQA 1NOJA 4CLEA 1KDZA 3WHKA 2QGNA 1UL1X 2ECPA 2ZJ1A 3K1JA 4V0LA 4Q9LA 5EKTA 4Q1CA 4DXAA 3GLGA 3QF4B 3CVJA 3OMXA 1M2JA 3V7FA 2EOAA 2XECA 5AJTA 4FDVA 3PQFA 4IMPA 3PWTA 4K9RA 4MP3A 1FNMA 2C3MA 4V0QA 1L4EA 3ZDQA 3NIDB 3D2CA 3I3SR 1J99A 1Q20A 3OFJA 1YE3A 4BKRA 3QU4A 1E3WA 2QUHA 5HG0A 4FDUA 2M6RA 3ISTA 4C6RA 1P7YA 1U2DA 1YRLA 3AF4A 4RQBA 3FOEC 4DTCA 1JQEA 2E82A 2RONA 3EXFB 1DEXA 1L7PA 2D7JA 2PL1A 3LYAA 2UYOA 4M9QA 3MYYA 2J4FA 3OLXA 2YWBA 4JOBA 2DT8A 4U9UA 2I6UA 4X84A 4OHRA 4PLFA 4YRJA 2ID9A 1OFUA 1U7UA 4DNQA 2PFSA 3BMQB 1XTSA 3WKAA 1H2BA 1U5BB 4JIMA 1VC2A 2VPIA 1MXHA 4MR7A 4W9NC 4N0QA 2YOGA 3WNQA 3HM2A 4ZYWA 2Y1EA 4ER6A 5I4KA 1AMNA 2BC9A 5KWIA 1S2NA 2FQYA 3I4LA 4U7PB 1L4MA 4X63A 4Y2QA 4LVCA 2R68A 1T9GS 3H16A 4YAGA 3FX2A 1XPOA 1A5AB 2KQUA 3HXQA 3RC3A 1LK0A 1PI3A 2OVFA 2DBQA 2G70A 1TAHA 2ZJ7A 1TJ4A 2DOKA 1UH5A 1NX9A 1R5OA 2W2QA 1ZU5A 2WHXA 3AP3A 3FLEA 5D7BA 1DJLA 3RABA 4B85A 5FI1B 4HX5A 2A0WA 2ZREA 1HRDA 3MJVA 5DLQC 4Y2UA 1XALA 3AEKA 2QTZA 3FJ1A 4UU0A 4ZGWA 1NW5A 1QGYA 1UDBA 1ST2A 2POCA 3OJWA 2B4KA 3FYHA 4B87A 4L02A 5U4XA 1RVDA 3JQ6A 5A1TA 2BGGA 2IELA 5HZGA 3TL3A 4B6GA 3BSSA 4U2CA 3M6UA 1EDBA 3CUVA 4FOTA 4IKOA 1J2TA 5SICE 4ZKEA 3KD3A 2PG3A 5K99A 5J3JA 1P9LA 1TVMA 2QRKA 1M3SA 4YRFA 5ECDA 3AF0A 3PBKA 4QUHA 3HXMA 3MTJA 2H29A 4REMA 1A4XA 1ZCAA 2BFDA 3RYTC 4KACA 4AZ3B 4RTPA 2NO4A 4EZIA 3AILA 1DIOB 3BK2A 3HJHA 1R4ZA 1OREA 3Q85A 5CCEA 3FDFA 4JLKA 1SXQA 4NOKA 1M34A 1NLYA 3AY0A 2IPLA 2XQIA 3EHDA 4M54A 2MINB 3HLKA 4Q3CA 5DLYA 4V2UA 5FD8A 1L4NA 4C0LA 1XX6A 2F7SA 1Y9ZA 3BGVA 1MO3A 1WZIA 1J5PA 5K3DA 5F5LA 1Z2EA 3AI2A 3QITA 3SHQA 3UVEA 3O4HA 5HQ3A 2BDUA 2X4DA 4DRYA 1EGQA 3KXLA 5FKJA 1B0ZA 1P45A 2R6JA 5BOSB 2TMYA 1QLWA 1KC3A 1PBTA 1QFMA 1S02A 2JCSA 1TW2A 3CLVA 3EDOA 3FPHA 1A95A 1F8FA 3DCYA 3IXMA 5JIBA 2BN4A 3RS2A 4UUPA 3VR4D 4EQZA 4NS4A 1CY8A 2EZ9A 2Y1FA 3Q8WA 2G7MC 2REXB 4WESB 2BKAA 3I1IA 3AKCA 3K0BA 5EP2A 3UEOA 5IJ9B 1Q21A 2XRZA 2P4SA 1WVIA 3TW8B 4C3ZA 1CW2B 2JGEA 2VUTA 4JJGA 4JBLA 1XMQB 4B43A 5IC6A 4U6QA 4TTPA 3X3HA 3IPCA 3LHFA 5KB3A 3ZS9A 5A5FA 5AW6A 1NVTA 1PJ8A 4NV1A 1PS9A 1D2RA 3ZBQA 1U9YA 1NUQA 1X14A 2ZETA 1X7HA 3IR7A 5TF0A 3TNFA 1F60A 2BEUB 4DYDA 3RRZA 1YTUA 2IC5A 3RKUA 3IJ5A 4WSOA 5K0TA 3RUPA 1F3LA 2AN4A 1M6WA 1ATIA 1OLSB 4G65A 4MVJH 4A36A 1KC1A 2QG9A 4GWLA 2CJWB 4IR7A 4BN4A 4C4YA 3DTVB 3J81A 3LYHA 4YIHA 1CDZA 2COUA 1ZHFA 2ZSUA 1M67A 2BUBA 4GVLA 4DDHA 2CV1A 1FYFA 1XZHA 2BW0A 2P77A 1NSTA 3QKRB 3RSOA 3AQIA 3R6WA 3TXYA 3THYB 4YRPA 3QPDA 4CBVA 4DM4A 1A1SA 1J0EA 3NX4A 3AZQA 3E22B 3L2OB 1JIVA 4JROA 3WP1B 2K6GA 1FU8A 1OW3B 1U8ZA 4XRGA 1Q95A 1FE8A 2GRAA 1TUBA 4WNAA 1GL6A 2IVFA 5IG2A 2QUZA 4N49A 3V8VA 3DT8A 3ZWDA 2PYIA 4CMGA 2MYNA 1CUEA 1YDFA 4RA9A 1R18A 2WVAA 3WRVA 3DEJA 3HJTA 5JMWA 1KAEA 1QYCA 4TN1A 2XUGA 3P9PA 4ZU1X 2WEKA 4D45A 2HUNA 4AUKA 1J49A 1JEQB 3OPYI 3NTOA 4MR9B 2JH3A 2XSZD 1VJTA 1G2OA 1Z4KA 3NVDA 4ARAA 1QG0A 2BDEA 1GZ4A 2XJ9A 4ZTBA 2NUBA 3JD2A 4A6XA 2VYND 4F7WA 2A1UA 4F5ZA 4BO9A 5IXJA 3QLUA 1UEIA 4ZYTA 1FX0A 1L8OA 2D6FA 3LRXA 3BXGA 2ATVA 1DAIA 1C9JA 2TECE 3JS5A 5EXSA 4XPIA 4HYQA 4EPYA 5LM3A 1G19A 3TQSA 4RH0A 3CRW1 4B3FX 2RH8A 3L41A 3U37A 3CU5A 1JLLB 3X2FA 4ZN6A 5KQRA 4Q3NA 5BW4A 4ZC1A 2VJKA 3MEQA 1HTBA 1W2HA 4Q4LA 2ZJFA 2IS1A 1NZDA 1NR7A 4QQNA 1WU8A 4ZC8A 2IUEA 3FZYA 4HH0A 4Z0PA 5CYGA 1NW4A 3HY6A 5A0TA 4KMMA 5JATA 4WPGA 1E5LA 1FJ2A 1UOEA 4TTJA 2DFPA 3C1UA 2WAXA 3SNHA 1N33B 1USWA 1Y8QA 4H31A 3UN1A 2HQOA 3RPEA 3RO7A 2RGNC 2EDAA 3C3EA 1T1SA 2MHCA 4R3UC 3TNLA 2TMGA 3CZ9A 5GWXA 2EFEB 3PUZA 4FQ7A 2HU5A 3AR4A 1U8YA 4KJZA 4OGWA 1IONA 5EG5A 1ZQ1A 3KXKA 4G67A 4HN4B 3ZTTA 4NEQA 4QRIA 2OSBA 1S3IA 3VC1A 3V8BA 1K5HA 4AJ1A 1A88A 1WUYA 4ZT7A 4NNJA 4MW4A 2I4IA 1E6MA 1W9MA 2NU9A 2WBLC 3JAKA 4PFJA 4Q1BA 4RW0A 4X45A 3CLSC 1GA4A 1VSQA 3HKEA 4TLEA 1DCTA 3BL8A 1M5TA 2CXQA 2VJMB 3MJSA 1NMEA 3IQGX 3L7YA 3O8BA 3QE3A 5FTJA 4EF6A 2NAFA 2QLBA 1CRZA 3QEMA 2JGNA 4TL7A 3BXFA 1NXTA 4FFPA 4G5HA 2GOYA 1NXPA 3FOAA 1DHTA 1YO6A 1I14A 3AF2A 4C6HA 4URYR 4EVIA 3JU3A 5KOJB 2XNDA 3VU1A 1Q7CA 4FB4A 4OQDA 4DCPA 2ASEA 1R5JA 2NO9A 2CK3A 4BQOA 1YJXA 1DQSA 2BEVA 3INYA 4CQLB 4OUKX 2O3TA 2HIMA 1ZVQA 2INGX 5KTNA 1V45E 4ATNA 4GKBA 3B1FA 5HIJA 4YPFA 1CUFA 4BFYA 4WMLA 2CCKA 2PBLA 2VP3A 4A8HA 4L5AA 2P40A 3MWLA 5E7JA 2V74B 4US2R 1P2BA 1QBKC 2H5IA 2II6A 4GD3Q 3JWHA 4LG1A 5AHKA 3RIXA 1U1IA 2OYRA 1XDDA 2C5BA 2Z1NA 2JFYA 1CR0A 3NHZA 5CVVA 1VOTA 2ZIVB 4GH5A 5BSEA 4AMBA 4JV5B 2H3HA 3H11A 1FZTA 2C9ZA 2ZU6A 2GSDA 4ZXPA 2O05A 3SEQA 1C4KA 3FMFA 2V1XA 2CYCA 3E82A 3FPFA 5EZYB 5A5VA 4TLLB 3UPUA 4C4RA 3LU1A 2BGUA 1RAHA 3QUQA 2WKQA 3GAMA 5KWSA 1WBJB 5K0BA 2P9CA 4I81A 5B2ZA 5CJPA 4GHWA 1WSDA 3A7DA 2BL4A 4NIMA 5LZ8A 1NXOA 3N74A 4NP6A 2R96A 3OLCX 4DMFA 4GPAA 4OLAA 2ZUDA 3ZE8A 1GPDG 2FUKA 1WUJS 3AP1A 4V0ME 4EOGA 3QENA 2OQVA 2W83A 1DE0A 3MNFA 1I30A 3BB3A 3ICCA 3O1JC 3O4JA 3CXUA 2XHEA 2YBDA 1IQ0A 3P26A 2QSUA 4PQYA 3UFBA 5C4GB 1WMAA 2EAUA 2Q3BA 1US8A 4PAQA 1HTTA 3SS8A 3RC1A 5JCPA 3RCBA 1HLPA 4MKGA 1QBGA 2I6XA 3LXXA 1RTTA 5C5IA 1TOAA 5G0VA 5AM2A 4JENA 4TGLA 2WUDA 3NP7A 2VF8A 3MAGA 2V8OA 1U0EA 1F2UB 5IANA 1DSSG 3OTOB 3BH6A 2OD9A 2BMVA 4FFMA 1DC8A 2BCEA 4YCBA 3TVDA 5CEJA 1A9YA 4HAOA 1A9RA 4FBMA 2CVFA 4HRXA 4KL8S 4RGYA 2AJCA 2VRBA 3UFXA 4LCBA 4C7JA 2AI3A 2I6FA 3EA0A 3RK0A 4ESHA 1ZS9A 5JT1A 3SDZA 2W6IA 4X8OA 2CL0X 4KNWA 3UWOA 3WYEA 4FONA 2GF2A 1E89A 2E3JA 5BNZA 2QW8A 3CRRA 3W4KA 3L02A 1GCOA 5DHPA 1T8YA 3C1OA 1NOKA 4GR9A 4GOOD 5FORA 4KQ9A 3L1VA 4DCTA 3TPCA 3KQKA 1BOOA 5DT9A 4DG9A 3QVLA 3BRWD 2VH2A 2O50A 4P3YA 3WTCA 4JHXA 4MVJM 5AVWA 5L3VA 1S4QA 2CLEB 3IR5A 5DN6A 5BNFA 2DPXA 4CI9A 4IIHA 4YXWD 3HJFA 2WJIA 4GEKA 2RGYA 3OEWA 3W8RA 5AK4A 3MOSA 2Z8YA 3EC1A 1XN1A 5GZ6A 5HR5A 2FXIA 4INPA 5JDIC 4NYJQ 2PVSA 4AKHA 4D99A 2B2XA 3GZNA 4HMQA 2G36A 3GDHA 5HX7A 4MQFB 4UM9B 1VMDA 3MG9A 3U16A 3ZGZA 2VJCA 3F97A 2B4RO 2YR0A 3CCFA 3JVEA 4JLMA 3I4FA 2FFQA 4HQFA 4HUTA 4OSEA 1ZK4A 3NHJA 4M2LA 5ICSA 4KMSA 1TFUA 3RC9A 4QL3A 5JE8A 3V4LA 1Z4JA 4M1MA 4A3SA 2FPGB 2IJGX 2JZNA 3DZIA 3QNUA 2QN1A 4IMIB 2EWMA 1U04A 3RSCA 4RM3A 2F1IA 1TUEA 3OETA 1J1ZA 5BYAA 3KHKA 4QBIA 5L53A 1N25A 1Y1SA 2Q4TA 2R25B 2V4MA 3S6JA 4HR7A 4UU7A 3R77A 2RHJA 3DLTA 3BK7A 4G1CA 1VQ1A 3SC2A 4CXMA 1EFLA 3S5JA 3DAFA 5FH9A 2ZYRA 2CNNA 4L8VA 5L7TA 4JLBA 2AJ8A 5L6MB 2HWWA 3BHJA 3M5CA 5CLHA 2NTYC 4MUIA 3UJDA 1OLUB 4R2MA 5HFAA 1SRRA 1U31A 2PSSA 3LUGA 3R4CA 4BKMA 1O5IA 1JDUA 1SXIA 1KPGA 1GILA 1X3SA 1ZBDA 3DEZA 4KC0A 4J6FA 4R6WA 4UPVA 5LA6A 4AC9A 4AP5A 4CN8A 4GNKA 4TV8B 3ZHVA 4F86A 1QQ6A 3ZDAA 5EHQA 2C1EA 2ZUCA 5KPJA 4C7OB 1U0JA 1PV4A 1KI6B 5TX7A 4JR0A 4OHMA 5L40A 3CHYA 1U0BB 1FQJA 1GZSA 2CXRA 4N12A 2O3SA 5L3ZA 1ADCA 2ISCA 5LC1A 3S2ZA 1W93A 1W4AA 1DV2A 1T8UA 2HBZA 1EUCB 2R65A 3DMTA 3K1ZA 3VHRA 4IXMA 4C2AA 2PGJA 2P3LA 4TMVA 3RBVA 1JJVA 4AUMA 1AN0A 1Q3TA 3N75A 4CNQA 1CUDA 4OI1A 1NWHA 2I2WA 1W73A 3KVNA 2GKSA 3VH2A 2HJVA 2J0EA 4KN8A 1BFDA 1N34B 1NC3A 1YNOA 3AERA 4CFSA 3WGMA 2MOKA 4N47A 4A92A 4MEJA 1VMIA 4DUZB 3AIIA 3B53X 2R6GA 2J3JA 4KXNA 3TAUA 2ISSD 4RF3A 1DJMA 1NQTA 3KEGA 4RPJA 1H9CA 1BE8A 3V80A 3U7HB 2HUPA 2ZI4A 2VKTA 4BNLA 2P8JA 2GPTA 1JEEA 4MUEA 4QJ5A 5GONA 4AD8A 5LA6F 5J2UA 4BPRA 1T0PA 4LDNA 4R1MA 1C9EA 1OX4B 2IYXA 1MH1A 1NKTA 3DR3A 3DW3X 2QN3A 4PLCA 3SR0A 3IPRA 2O8DA 4GX2A 2R86A 1KVRA 3PGXA 5E6SA 5KINB 1T15A 2HTFA 2J7PD 2QZSA 4XEUA 3ZNNA 1Y9JA 2V7TA 1MMFB 3SS7X 1AQNA 1QV7A 2C57A 4KK3A 1MO2A 1A69A 4G41A 2IV7A 1EUQA 3IE0A 1YZKA 1GL3A 2PKQO 4EMSA 4DA9A 2MWMA 3B9RA 5LYYA 1YGYA 4JUAA 2IPAB 2QX8A 3GLIA 3L06A 1KWGA 4X54A 1HE2A 2A7QA 1C1DA 5F7JA 4ACAA 1QQAA 5I9SA 4B74A 1XFDA 2E0IA 1A5SB 3IBSA 4RU1A 3RVJA 5G41A 1ZHHA 1GXSB 1RLMA 4F12A 3VKHA 5LWHA 4DB4A 2WIBA 5FLEX 3IJRA 1CLUA 2PZBA 2QXUA 4N5NA 1AD2A 4FOOA 4IEIA 4O25A 5JAPA 4ZREA 3LD9A 3MQ4A 1U2GA 4Y6SA 1WCYA 2QNIA 4RZHA 2A8YA 2YJGA 3GPCA 4KWHA 4J7XA 1P6UA 1N6NA 1RBYA 4W5JA 2B21A 2O3UA 5AVXA 3TLBA 5UKDA 2FUG1 1DFHA 1CHDA 4BLOA 4RVFA 3QEBZ 3H5IA 2HT6A 3A9TA 1K2WA 3H19A 4LYGA 5BSTA 1RHQA 3BJIC 3UAVA 5J9FA 1L7AA 1CJSA 1WUTA 5CEFA 2ODNA 2Z9DA 5CDFE 1ECJA 4KFTA 4O3MA 3V46A 1WCIA 3OQ6A 4K7JA 5ARCA 3KQNA 4F04A 1T0IA 2Z43A 4U6SA 5ALXA 5JASA 3MBIA 2A1TS 3PDIA 1APBA 1U65A 2B98A 1MUUA 1Z4MA 4R3WA 4XTRA 4F7DA 1X39A 1Y9AA 2WF7A 4CNBA 3V1MA 4A5SA 1HZZC 1IEWA 1N2GA 2DVMA 2K4MA 4FMPA 4CLXA 4JX9A 4X71A 1Q0UA 5FWAA 1UMKA 1L1QA 4GMKA 2GPYA 4BJ6A 5L7YA 3RIHA 3PQCA 1ZXLA 2JGKA 3I45A 5JWHA 1TT5A 2XDWA 4O0MA 3FRIA 4O59O 3IUMA 1KZHA 4MDEA 2QPLA 5K4GA 2PUBA 2LKDA 4PC3A 1V8PA 4N6OA 1KH2A 3DVRX 4RPLA 1HDCA 4ON9A 2OXFA 5BT9A 4EEKA 1YIDA 4UARA 2V6IA 2ZUBA 1FRVA 4FJ2A 1CJMA 5FRDA 1UXKA 5D00A 1R6VA 2UZAA 5T4EA 3IUJA 1VLLA 3C7AA 1UFOA 4QTTB 2JGDA 2GBCA 2QRJA 4MGKR 4HG2A 4P0TA 3EF0A 5ALLA 4TVSA 2ECOA 2W2KB 3I04M 4QUBA 3R7WA 4OJTA 5HS4A 4DUPA 3K1AB 5J1SB 5I8WA 1EHYA 4BNZA 3ICPA 4YPOA 1E1QA 3MILA 3CUYA 1TK9A 3VC2A 4F9GA 3VPSA 3G7SA 3UNXA 4Q00A 2C7QA 5BSGA 1J23A 2RG7A 2YWDA 4LXHA 3UK6A 2QNBA 4MYHA 3HE3A 1JMKC 4KO1S 3CLRC 3G5LA 3HU5A 4AZWA 4ETNA 1A7AA 2J9ZB 5LYJB 3ER9A 3FPGA 2A6PA 2PT9A 1SFRA 3CKYA 2KWIA 4FDTA 5BYBA 1Y37A 3EQ6A 1XT6A 2G28A 1ACLA 4CL8A 2ZR8A 1SB9A 1ZCJA 3OJ0A 3LUCA 1ZM2A 3CEHA 3GCWA 3M2PA 4FGKA 1LVUA 3E3NA 1DTSA 2WHYA 2I33A 3TINA 4HUQB 4QEKA 2PV0A 1O0CA 1VPDA 2GN6A 4CI0B 3DONA 2H08A 3ZKWB 1JL3A 3W5UA 1HQKA 1FNDA 1ZSNA 3BHNA 4X3PA 4D9FA 2JBHA 2R8YA 5JD6A 2YFKA 1JHQA 2J9RA 5ALFA 4DCVA 3IKTA 1UXIA 1LDNA 3UICA 4NCBA 1GQFA 2VR1A 3RVDA 3PB3A 3PE3A 2XBMA 1KQGA 5A3QA 3L8DA 1CJCA 4OY3A 1M8GA 4Y2YA 2WZBA 3L7DA 4FXPA 1ZC3A 3ER6A 4DQXA 3CURA 3F0TA 2WLTA 3N2KA 1PTJA 2PLAA 4UHJA 5CMLA 3SS9X 3NJ8A 3ZG6A 3TOVA 3ORRA 1YA4A 2R85A 3ELUA 3UB3A 1HSZA 1U0OC 1KIMA 5E3IA 4J6EA 4PHTA 2GSWA 4Z0HO 5FWXA 3AUJB 4M1SA 3FOFC 1M6HA 1YQ9A 2J87A 4LFAB 3V1KA 3T54A 3U09A 1H85A 5F1YA 1PD1A 3DR5A 2B6HA 3IALA 1NYQA 2J6BA 5J5VA 4EUSA 3WNVA 3ZTYA 1ORIA 4AK9A 1K7SN 2NTVA 4OA5A 1JPJA 2W8BB 1ZJZA 4FX2A 3I6BA 2Q1SA 3ONVA 5FQNA 3LW8A 1KY4A 4K9LA 2H1WA 2G76A 4ONEA 5FFFA 5JAMA 5BVGB 5E6UA 3A1TA 3DLBA 3RT9A 2XXAB 4QXAA 1NFQA 4F5EA 1IDOA 3PLNA 1NRJB 1MGOA 4Z8YA 5JMOA 3IXLA 2R1VB 1E62A 3CMMA 1SU8A 1KVUA 5JYCA 1RWKA 4KXWA 5DM4A 5DGXA 3NNDA 3FY4A 3GN2A 1PZFA 3AETA 1OY1A 1CZLA 3L4SO 1FFAA 5MGBA 1SIBE 2ZCUA 3MT7A 1NT4A 4HDMB 3QXHA 1P7WA 2BGLA 5CIWA 1NAHA 2JAOA 2GCOA 4JLPA 2UZ1B 4KP7A 1ZOPA 3GEBA 1PT6A 4M49A 3UGQA 1YD7A 2WKWA 2X40A 4LQLA 1L7NA 2PRZA 2WFLA 3P9YA 4IH1A 1DUSA 1D7AA 1GWNA 4NAHA 2OZPA 3SM9A 1LI4A 4UNIA 2NV0A 1PFKA 3I12A 5CM2Z 3L7IA 3S2EA 1MC1A 4PFKA 4RK5A 3VC7A 2JLYA 1GYQA 1PNTA 5I5GA 4BQSA 3W1WA 1BXKA 1NUSA 2IHUA 2GM5A 1RE1A 2JBWA 2VHWA 2ZITA 4QVKA 2ADOA 3AHDA 3COZA 2WTUA 5K8TA 2G8LA 1J00A 1XVAA 4IIJB 4DQKA 4F56A 4QPDA 1R6TA 4YDSA 1AHNA 3GVIA 4G37A 2IZZA 5TIIA 4CDRA 3ABRB 3WWYA 2NXEA 2P1RA 5IJ0A 2GZ1A 4O8CA 4WH0A 4C7XA 1FJGB 1D6SA 1ES9A 1G8PA 4WGFA 3LLMA 5KCMA 4X1KA 1ZIXA 3TL2A 1GPBA 2P6OA 4LXIA 1KQNA 3NDPA 1ABBA 2GA9A 2HJGA 4L2IA 4HB2A 2C2OA 5K8IA 4CTNA 1RKUA 2LP4Y 3FTDA 1E77A 4RTJA 3AVOA 1KS2A 1BQEA 1GA1A 1TCCA 3A4NA 3P45A 1TI7A 4GQIA 4N54A 4EJ0A 1T3HA 3E03A 2H07A 1AM4D 2JD2A 3GHHA 1RWOA 3IQXA 3IOYA 4KQXA 3WQBA 2YHUA 2ZRHA 3KRTA 4URVR 4OHUA 3IPXA 3VPGA 3G17A 2ACWA 4GBJA 1UKCA 4MYDA 2W48A 4DXHA 5K45A 1IN8A 4CT0A 3VVLA 2MTBA 4ERXA 3SIRA 3E58A 5JSZA 3QBEA 4B71A 2V7PA 1T4GA 2I9KA 4UUQA 3TW6A 3WL3A 1ID8A 2RI6A 3K6RA 4ZEVA 5EUQB 1FYDA 4U9IS 3GA7A 3VU8A 3ZGXA 4HUJA 3P9IA 4FILA 1RIIA 1KGDA 2G07A 3PJEA 2WTEA 2H9IA 3L0PA 3KZKA 3QMWA 2FPOA 5CNIA 5L45A 3TQHA 3ZE2B 1OC4A 4ISCA 5EJMA 2NOAA 3O8OA 4K03A 4RS3A 1ZC4A 2NTEA 2H5JA </