1X86B

Crystal structure of the dh/ph domains of leukemia-associated rhogef in complex with rhoa
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
180
structure length
180
Chain Sequence
AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 12
publication title Structural determinants of RhoA binding and nucleotide exchange in leukemia-associated Rho guanine-nucleotide exchange factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/membrane protein
total genus 52
structure length 180
sequence length 180
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2004-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1x86B00
1Z2AA 4OKSA 4DCTA 2E87A 2JLSA 1N6OA 2FU5C 1N5KA 1G5TA 1TQ2A 2ZR9A 3SE0A 1E1RD 4QC2A 1OH5A 3BH0A 5TDHA 4TL6A 4OI0A 5CDFE 3EG5A 3FMOB 3LBIA 3CZQA 3K9GA 4B76A 2WWXA 1A5TA 3OF5A 3MJRA 3PR1A 2YZ2A 4Q4JB 4AK9A 1P72A 1P75A 2JA1A 3DOFA 3HJNA 4QBGB 4LSGA 3BERA 3GLGA 1DS6A 4TSFD 1ZUHA 1MRNA 2HXYA 3QJYA 2WHXA 4L9SA 1MABA 1ZM3A 1HTWA 1E9FA 2UVQA 5JS7A 3VR3A 3WHKA 2NGRA 4DDWA 1W0KA 2HDNB 821PA 5G53C 3PCRB 1OFHA 3EIEA 4EKDA 3NBXX 2O0KA 1RRFA 2KWIA 3CKLA 3FMPB 5SZIA 1EK0A 3SJZA 5CB6A 2F1HA 1E94E 1K5DA 1E2DA 1GL9B 3C7KA 5DN6A 1QHIA 3FWYA 4AKIA 4Q21A 5GJWC 1WF3A 5FBLB 2X19A 4DVGA 4YDSA 3I92A 1LV7A 3IBGA 2VTKA 3AVOA 2CCGA 3LXRA 2VHCA 2RGNC 3EXAA 4X8MA 1TU3A 1R8SA 1AQYA 3AVPA 1ZC3A 2WMNB 4LI0A 2O5VA 2X2EA 4FD2A 3LRPA 5AJZA 3NHBA 1IXSB 1GG2A 3FFBA 4URUR 5HCNA 4EPYA 1JXOA 2ZRIA 4PFSA 4AYWA 5FTKA 1ELOA 2DCUA 2VHTA 2CLDX 2J59A 1X86B 3P4XA 4IEEA 4A8JB 2JJ1A 1DADA 5G40A 1F2TA 1E6CA 3I8XA 3I32A 2OILA 4IDOA 2E9SA 3TR0A 4TTPA 2C95A 1T9HA 2P5TB 1QVRA 1X6VA 4CW7A 3NVAA 1UBEA 2GWHA 2NO7A 1YR8A 2HJGA 1SXJB 1IONA 2JGNA 4OL0A 2BBSA 1VCNA 1KYIA 2GF9A 2AD5A 3ADBA 1XTJA 2JLYA 1GITA 4HB3A 5DIFA 4O2LA 2R44A 1W0KD 4Q9HA 4BEBA 3R9XA 3L0PA 1FQJA 4EPRA 3THYB 2ZYUX 4FMBB 1XMJA 4JLDA 3K0AB 1KKLA 2PCLA 5DI3B 4OHZA 5DN6D 2QZ4A 4M9QA 2O52A 3I5XA 3MSXA 2WKQA 1QHHA 2IYSA 3IPYA 2BJVA 3M0EA 4OQMA 5TXGA 4O0MA 4V0LA 4BLRA 4EPVA 1IAQA 1VIYA 1OF1A 3AH8A 3QF4B 2WJGA 2KB0A 3THOA 1OPXA 1ZD1A 4M1OA 4D82A 5D3QA 1DTSA 4ITRC 5FL3A 2GZHA 2J7KA 3G82C 3CZPA 4S2EA 1G16A 3B13B 1FOEB 4B48A 1P7CA 5IDVA 1ZNXA 3K0EA 2H57A 4OBEA 2JJ1D 3GLHB 1Q3TA 3U6BA 3AF1A 2CEAA 2OBLA 3BFKA 3AF2A 4A0FA 4JBXA 4RKFA 4E5UA 2XXAB 1DPFA 3DM9B 3N70A 5A4JA 2AXPA 2WJYA 1QDEA 1A2BA 1HT1E 4V03A 5KNBA 5FI0B 3OE7A 3GCGA 1E4YA 1KGDA 1N6KA 1XP8A 2ZS7A 2F1JA 5ANRB 5FOSA 3MWJA 1KK1A 3GJ6A 4ZIRB 2QNRA 4TT3A 1Z6AA 2WOOA 5J4HA 1XPRA 1Q20A 1NVVQ 4XWKA 1OFIA 3K53A 3QXJA 2G0NA 3SOPA 2HCBA 1NKSA 4ARZB 3NWJA 4PR0A 3QKRA 1G8FA 3EAQA 3GLIE 3GJXC 2I1VB 1XXHA 1G19A 1VCIA 3SNHA 4BFTA 3TKLA 2ZSEA 5FOVA 3LVQE 1IQPA 3SJAA 4JL5A 1UBGA 4DWJA 2EYUA 1GKYA 2VHJA 4URVR 4A2PA 1M34E 2A5DA 1TQ4A 4NCHA 1NVXQ 1FFHA 5FOTA 3CH4B 3B7GA 3QY0A 4RZ3A 3P32A 4A0GA 2WJJA 3OAAD 3EPJA 1JEEA 2ERYA 3O8RA 3GLFE 1IN5A 1E79A 1GRQA 3HR7A 3CIOA 1Z3IX 2CNWA 3QKSA 2YINC 3P20A 5JHGB 3TQFA 2O8FA 1DAEA 1OLOA 2C98A 1CU1A 1AM4D 4DB4A 4HYYA 2ZRHA 2V8OA 3V4RA 1OKKA 2KI5A 1P9WA 4JLKA 1NJGA 3GFPA 3BFVA 2ZJAA 1QG4A 4F7WA 4A6PA 1JEDA 3WNBA 3K70B 2AL7A 1M7GA 1Z0AA 3OE7D 1EG7A 4C0BA 3RS3A 1RC8A 4GL2A 1VIAA 1FNNA 5CYPA 1CS4C 2IYTA 2HJVA 2IXEA 4KO8A 2ZRJA 3C16C 2AFHE 2PZFA 3EZ2A 1TUEA 4US2R 1VYTA 4P32A 3T12A 4Z8YA 3DO6A 6Q21A 2H17A 3BK7A 4LJ9A 3VMFA 4AURA 3FHCB 2GCOA 4TQ9A 4BFVA 3IEVA 4EFMA 5C4MA 5IHPA 4R2HA 2OFWA 2ZRAA 2Q6TA 1HA3A 4WW0A 4AKGA 3NC0C 2RGAA 3OIVA 4I1VA 4I4LA 2ZI4A 4G5QA 4QL3A 2GZDA 4R7ZA 3EWSA 3THWA 4Q7KA 1HT2E 3ICEA 5AUQA 1AJEA 3QNUA 4QBFA 3TVTA 5EXXA 3I8SA 1MO4A 4X8LA 3TSZA 4F4CA 5HE9A 3LLMA 1R0YA 4D25A 4P4SB 3KDSE 4B34A 1JQLB 1A1VA 1B23P 4M1SA 2W00A 4UNSA 4ZCLA 5DHFA 3VR1A 3OFNA 3I4LA 4C0JA 2CJWA 1E79D 3LY5A 2FFQA 2CNWD 4XVRA 5JECA 1RRPA 5JRJA 4P4TA 2CLSA 1NVWQ 1U0LA 3CNOA 3T61A 1DAMA 2BJWA 5JWRA 3AKYA 1NG9A 5IK2A 2QORA 3TVDA 3PJRA 2H16A 3RSLA 4B35A 2P6RA 3T1OA 4AKHA 1A2KC 4DC9A 4LBYA 5GJBA 2DFKB 2W2TA 1L4UA 2ZAOA 3EARA 2D62A 2DHRA 2GBLC 4JYBA 4K8OA 2H8KA 1FL9A 1GIAA 2WWHA 4DSNA 2QP9X 3ICQB 4CEIB 1ANKA 2X8AA 2HEIA 1T6NA 5FBWB 3GMTA 1KJWA 4PSKA 1BMFA 2IBMA 5DISB 3SHFA 2B6HA 5FPSA 2XITA 1E3MA 3WYFA 1S1CA 4LYFA 2BKEA 5E7JA 2IT1A 3PXGA 2ZI7A 1GNPA 3ZGXA 4JJKA 4EQ6B 1E0AA 1UDWA 2H92A 3PV0A 1OXVA 3IQWA 1M2OB 1P2TA 2VEDA 4M53A 4KXFB 1NLFA 4XH9B 1E99A 4EFLA 4B43A 1XTIA 4W7SA 1MH1A 2GILA 3Q5EA 4PZZA 5BN3A 1N5LA 2F9LA 2RCNA 5J4KA 1H65A 1I4DD 2QPAA 1N3BA 3ASYA 1GUAA 1JQJC 2PL3A 4UXJA 3DDCA 4G5RA 1W0JA 4QM6A 5JSZB 5AJVB 1Z0IA 2RGGA 4BE7B 4WA7A 1Z0JA 3BH7A 3HDTA 1N0WA 3TNFA 4QGFA 1ZU5A 1Z6GA 2W2VA 3FPAA 2RAPA 1JJVA 4Q1EA 5GVRA 2CE7A 2PBRA 2ZI9A 4WXPA 1EX7A 3FOZA 3R7WA 1FTNA 3U6KA 3W3AA 1GNRA 4PQFA 2IF0A 3RVBA 1WDTA 5IK2D 4V02A 4IFEA 2IUSA 3ONWA 2ERXA 3QEJA 4EIWA 4EPTA 1TTTA 1Z22A 2AR7A 5EP3A 2G6BA 4D4KA 4XD7A 1LW7A 2AXNA 3T5DA 1BKDR 1E2MA 4NYMQ 2VQSA 3K70D 1BMFD 1MRSA 2QT1A 4K46A 3WHLA 2FDCA 1G1MA 1WCV1 2WJHA 5C1BA 4A8JC 4QKQA 5CM9C 2P0EA 5J4LA 2QM8A 2VP4A 3U3MA 3ZVRA 4JLAA 2I4IA 3KZ1E 4CEJB 1Z2CA 2W83A 4BZXA 5JLJA 1ZNWA 5L3SB 2QBYB 1P9NA 3CPJB 1EFRA 2UZ3A 1YJ5A 2F43B 1KMHB 2A7QA 3RAPR 2ORWA 3LLUA 5TY0A 4IOMA 1NY5A 4JVSB 5DSZA 3EC1A 5K8LA 4CF7A 1W0JD 2GVZC 3RRZA 2ZU6A 4PC1A 3Q72A 3AKCA 2ZRFA 1O87A 2QRNA 5EE9A 4URYR 2A30A 4TMTA 3VQTA 4FCWA 3AM1A 2H7VA 4NCJA 1GKIA 4A2QA 2PLFA 3O8DA 4IVPA 2IS2A 3JZMA 2IYZA 4D6PA 2GHIA 2IS4A 1PZNA 4B2IA 3U61B 4Y0AA 2VSOA 1TF7A 2FFAA 1U94A 3VAAA 5JCZA 1E2QA 4B3XA 1G3UA 5HTKA 5H70A 4GSYA 4UQOA 3L0IB 1NY6A 1CULC 3AB3A 3K8YA 4FCTA 2BEKA 2OLJA 4V0KA 1C9KA 2XAUA 2VBCA 4XD7D 3B60A 5JHHB 2HLDD 2PZEA 4Q1DA 4M22A 3O8CA 4TYPA 2B7CA 2Q9BA 3QPUA 2HF8A 4E09A 4YLGA 2JLWA 3IIMA 3MWLA 2QPOA 1W1WA 3T34A 4V0MA 3TUJC 5CITA 3E5HA 4HLQB 2W0MA 1N0UA 3Q3JB 1II0A 2P65A 3Q7PA 3KFVA 4TQAA 3Q85A 1XPOA 2OBNA 4YMSA 4ESHA 2V6JA 3AQ4A 2IYVA 2JCSA 2EWVA 3N2EA 3U3RA 2PT5A 1EFRD 2QBYA 2AWOA 1VYUA 2BM0A 2ZYTX 1X3SA 3KXKA 3PUYA 1RW4A 4MYCA 4A2WA 2RB4A 4ZPXA 3CRW1 2WZQA 4BEJA 721PA 3QF7A 2GXUA 4PSVA 4B74A 2FSHA 5A5GA 5J4YA 3MD0A 1G8YA 1US8B 2A78A 2C5LA 2J46A 1SVWA 1VG8A 3SQWA 4A1FA 1VYVA 1OXSC 3L8ZA 1TX4B 5EE1A 1XEWY 3B1XA 3R8CA 2JIZA 2XX3A 5AUOB 4U7DA 3DEFA 4KLZA 1Q0UA 1NN3A 1BOFA 1KI7A 4UKDA 3LAWA 1M1YE 3CPEA 1JECA 1Z28A 4DRZA 1JXMA 2CVHA 3TW8B 4AYXA 2XSZD 4AWXA 2NO9A 2OSBA 5KU1A 1G41A 4MDEA 4MKGA 2O8EA 2BBTA 2XTNA 3EC2A 2YWFA 1EFTA 3TAHA 1NF3A 1PUJA 2BBOA 2ZSDA 3T5GA 5JI3E 5B58C 5HCIA 1YKSA 3CF2A 1S9DA 3H2YA 3F3YA 5CIWA 2ZI3A 3VR4A 3W6PA 1EWQA 2MSCB 4NPHA 1G4UR 4DT1B 4Q4AA 4RJLA 1TF2A 4N1AA 3BBPA 4GZLA 3TH5A 4CYMA 1D8TA 2XJ4A 2VIIA 4RFSA 4NYIR 5KSZA 2RHMA 2OLKA 1FMJA 2JLZA 4CGZA 3FDIA 1G8PA 1Z29A 3IIJA 3KKOA 3K70C 2QU8A 4Z1MA 2ZJZA 4P33A 1YZUA 2BWJA 2CL6X 4KFRA 1M7HA 1UEJA 2IHYA 2IYRA 1ZMXA 5KPDA 1ZJ6A 1G17A 3B9QA 1KO1A 3SR0A 1KJZA 4Q9LA 1II8B 3EA0A 2YOFA 2ZANA 2B8TA 1SHZA 2FPMA 2GK7A 4DLTA 1SKYB 3RABA 2JIZD 3IILA 3RNLA 4CVNA 3RSOA 4Q47A 2GEVA 4GNKA 5FPHA 1BO6A 1IBRA 4PQYA 1AGPA 3E1SA 3B5JA 1E32A 2F3RA 1E2FA 5KDOA 1HY3A 3SZRA 3L8YA 4ABYA 2WWFA 1ZCAA 1U81A 5KOYA 3UK6A 1QHGA 1HH4A 1Z0DA 3KJEA 2QEQA 3QPWA 3B2EA 1MKYA 1X8KA 2ZVPX 5FTJA 4Z8XA 1M8PA 5J4VA 5JRZA 1NIJA 4MRVA 2ONJA 4JLOA 2WICA 4LHXA 1RKBA 4HATA 2XNDA 4OHVA 2B21A 4TMZA 1NNEA 3RC3A 5F3WB 2G1JA 1NLZA 3M4YA 2WKRA 2B8WA 1W4BA 1T5IA 3CX6A 1G6HA 3CRMA 2XJ9A 3EASA 4BASA 4DDVA 4HEJA 1TMKA 3L2OB 5GADl 2TMKA 1W36B 4JVLA 3FMFA 2GZAA 5CK4A 1E69A 5KDDA 1S4QA 1ZNYA 3GLGB 5J40A 3H1TA 4GT1A 5FH9A 4X8OA 1QHSA 1XBTA 3X1WA 2FPKA 1G20E 5L8VA 1XD9A 1MABB 1ZBDA 1KO5A 2GJ9A 3SYKA 4DDTA 1GILA 1SULA 1X8LA 1KOFA 3TE6A 1MO6A 3FHTA 2VLIA 4OHXA 1U98A 2C03A 3WRYC 4G0NA 4L5BA 3W8NA 5CDFA 1J70A 4C0AC 2OUKA 5FTLA 1E9DA 3MLEA 4XTCS 5JWHA 5C4GB 2IXFA 2VHUA 1W5SA 4P4UA 2FSGA 4HDOB 4IDPA 4H1VA 3ZVMA 1NG1A 1RVDA 1YU9A 4AY2A 2GXAA 2GEDA 5FI1B 4C0QC 3I62A 1KO7A 4OHWA 1VHLA 2Z4SA 4LGMA 3TIFA 4UNRA 1G3MA 1NBMD 1G291 1H8HA 4DCSA 2IHBA 1EFCA 5E3HA 2Z0MA 5CM8B 3EZ9A 4PHTA 2ZRGA 1LS1A 5C2JB 3NH6A 2K5UA 2QAGA 2VP2A 5E4FA 2WWWA 4PAQA 3LD9A 4FN5A 2VPPA 1VECA 3K9NA 1AGRA 2D06A 2XOKD 2VSXA 1F2TB 4F91B 4LPKA 4TMWA 4ZCIA 2OV2A 2ZSAA 4HAVA 1GZSA 1LFDB 2D3WA 4OQLA 2NO6A 2C78A 2UKDA 3D3QA 3KUDA 5UKDA 1IJFA 1GAJA 2CK3A 1S2MA 1XMSA 4QGAA 1II9A 3BWDD 4W5JA 4Q01A 1KI2A 2FJUA 3VNVA 3B8HA 3GJ8A 2V3CC 3IIKA 3MGCA 3WYGA 2ODWA 3FMIA 2O8DA 2ZJ2A 1AS2A 2GRJA 1GRRA 4ZDJA 3A58B 1KKMA 1ZC4A 1LF5A 2WWIA 2Z83A 3SEAA 4B2PA 1U0JA 4Q00A 3RS5A 1Z5ZA 1QHHB 3MWKA 4QBHA 2CCKA 2WMOB 3GJ4A 5JEEA 2LKDA 2QROA 1BYUA 4TWZA 5LB4A 1C4OA 4OK3A 1KDRA 3FKQA 2IS1A 5JZVA 2JLRA 4DLZA 4PANA 4QJ4A 3B78A 2QAJA 3WP0A 5JEDA 2AK2A 4F4IA 3PFIA 3SS8A 4JLVA 3VKWA 1PUIA 4KFUA 1UADA 2LWIA 2OO7A 5TV2A 4BRWA 4MGIR 2OBMA 4Q4HA 2V54A 3TUIC 2QQEA 4B3GA 2OE2A 2XNSA 1OXXK 2P2LA 1DAKA 1ZINA 1Q44A 1ZNZA 4B3CA 4BFWA 2HCJB 121PA 1I4LD 1RIFA 1ODFA 2AX4A 2V7QA 3ND8A 3SC3A 4AKEA 1XCGB 1D9ZA 2F1RA 4I99A 1W2HA 4C9BA 4E07A 1N0VC 2DPXA 1RJ9A 3SHWA 3CX7A 1W36D 1KY3A 2ZRMA 5M04A 3RS7A 2DBYA 3B6EA 5H1YA 3LNCA 4EAQA 3WRXC 4EJSA 2CK3D 1U99A 2CVFA 4HLUC 4LV5B 4IDQA 4PPNA 2ZS9A 4JLPA 2F6RA 2N42A 4RD1A 3O8BA 2QI9C 4Z54A 1QHXA 3KXIA 2B92A 1CRQA 2A5FA 4I1OA 4JLMA 4MYTA 2QMHA 5HZHA 3CWZA 4Q19A 2J0VA 1B0UA 3S1AA 4B71A 4TQUS 4U00A 4UJ3A 5KSOA 4AG5A 5FOXA 4D2IA 3QKRB 4TYQA 1CR0A 1FTSA 4AC9A 2NZJA 3AGQA 2LCFA 5AR1A 1AA9A 3SYNA 4KYUA 2I1QA 1XXHB 3WMGA 3ZZUA 3ADDA 3CO5A 2C9CA 1XTKA 2GEUA 1IOZA 3E70C 3LXXA 4NP6A 2DR3A 3K0FA 2G9NA 4C2UA 2ODEA 1G9XA 3H84A 3IEUA 4TLAA 1QBKC 3ZLJA 2QSZA 4N0DA 1PJRA 2R6AA 4GP6A 2REBA 2IYUA 5KSPA 3UG7A 3QKSB 3ZZTA 2ZVQX 4NL4H 2O8FB 1JI0A 2CBZA 5EXTA 5FR2A 421PA 2RGXA 2WKPA 3U3JA 4BFXA 1KDTA 4LJAA 2FFBA 1Q1EA 4MGZR 5AK0A 3T1VA 1ZCBA 2ASEA 4M2LA 1F48A 2V7QD 1VG9B 4CT4B 5FL7A 1LNZA 3G0HA 1FNMA 4TZ0A 5F2EA 3GLIA 2R62A 2GXSA 1LTQA 4DCVA 1E9SA 1YHNA 3CPHA 4A9AA 2A9KA 3JZAA 1H8EA 3OEHA 4JLBA 4LHZA 2X1VA 4KYIB 1R7RA 3GPLA 2YV5A 4NYJR 1CJVC 3GLFA 3PIRA 1XJCA 4BFUA 2FMXA 2NPIA 4KAXA 4M9SA 4MUAA 5CJPA 5LDDC 3ZD6A 4I1SA 2GCOB 5AJYA 1Q1QA 2UZIR 4DLVA 4MITA 1W2GA 4DLUA 4I1UA 4TTRA 2EFEB 5JJLA 5L3VA 4PZLA 2FX3A 1UAAA 3U44B 3ND9A 3MG9A 4YC7A 3UMFA 1BYIA 3THWB 4FI3C 3AUXA 1CIPA 3AUYA 3V9PA 2ZI5A 1E0KA 1NMXA 4PPGA 1D5CA 2IL1A 4URWR 2RGBA 3CRQA 4IKEA 4TLBA 4IXMA 4YDHB 2A3RA 2BEJA 5EZ6B 5CIQA 4BFYA 1U9IA 1W49A 1YVDA 5K8TA 3BC1A 4NKRA 4QM7A 1Z08A 1OXTA 1Q21A 2CJWB 3D31A 4FIDA 4MUBA 3UWKA 1MT0A 4HUQA 2GNOA 4WXRA 1GKUB 1NLYA 3VR5A 1AKYA 3PQCA 1M74A 4PX9A 4JSYA 4PC7A 3UIEA 1YZNA 1XF9A 1RFLA 2GDJA 3CWQA 4RZUA 3FFAA 1OB5A 3QEOA 4N3NA 1XMIA 1U8ZA 2P3SA 4JT2A 1HQYE 2ZE6A 4BUJA 2VF8A 3A36A 5LPNA 3W8RA 3ZQJA 2KBFA 3Q9LA 1SXJE 3B82A 3OEHD 1Q3HA 2QAGC 2KJQA 1Q12A 1P4SA 2MMGA 2ZJYA 1LF0A 1UKEA 3I73A 1UM8A 4G5SA 2J9RA 4MKHA 1NSFA 2VP6A 2HF9A 4RD4A 1OFUX 1XNJA 1N2CE 2DFLA 4D4LA 4KITB 2D7DA 4A36A 4TT3D 3KB1A 1QRAA 3ZS9A 1XEXA 1W36C 2ZREA 1FP6A 1PLKA 2ZRBA 2REXB 3QUSA 1ZD9A 2C8VA 5FPYA 4LZZA 1E2JA 2J41A 2HXSA 3BS4A 5KUTA 3U44A 2VRWA 1DEKA 2BCJQ 1KJYA 4TL9A 2EWWA 3LW7A 1P5ZB 1ZYUA 2R65A 1F2UA 2IYWA 2EQBA 2Q21A 4O2RA 3W34A 4I81A 2GESA 2WBLC 3LH5A 1HQCA 4TLEA 3QVVA 5BQ5A 3Q8XB 3FTQA 2J0UA 4B3BA 1VMAA 2QENA 3AP2A 4BWYA 4ZKEA 1WXQA 2A5JA 3WMEA 2XZOA 3BB3A 4IDNA 1G3IA 3PENA 4OQXA 1ZD8A 2AFIE 1AK2A 4LJ7A 3SJBA 3R7WB 2GXQA 3GQBA 2L0XA 4D0LB 1IJEA 2CL0X 4B75A 3GLHE 4RD3A 4NU0A 3A4LA 4DEYA 4JKYA 1SVLA 3KQLA 4F4JA 2D74A 4JVNA 4TMKA 1KI9A 4PXAA 1OKKD 1YZTA 3KFXA 1ZU4A 2NTYC 2R9VA 4PC2A 4XVQA 4AD8A 4DUGA 3K0SA 3PG5A 4AG6A 2Q0HA 2SHKA 2J7PA 2VA8A 1COWA 3BD9A 3SU8A 1AIPA 3V00A 3U7GA 4F93B 4IVQA 1OW3B 4QFMA 1OH8A 2ZU0C 4UNPA 1SGWA 1XD2A 1E9RA 3LV8A 2YWHA 4GZMA 4RY2A 4RSGA 3KQHA 1S9HA 2VP0A 2Q9CA 3I72A 2FEMA 3IO5A 4A4DA 2GETA 3WXMA 2OXRA 2QMEA 2PMDA 2AHOA 1T4GA 4C30A 4EJSC 4M1MA 3BXZA 1CR4A 2BVNA 2HT6A 3IKJA 3OZXA 1Q22A 1SZPA 5TMPA 5TB5A 1CR2A 4FMCB 3U4QA 4JJZA 1RYFA 3GJ0A 2AK3A 4JLNA 3OHMA 1FX0A 1G8GA 3ETLA 2W6JA 621PA 2R6GA 2DWOA 3BE4A 2D2EA 3P4YA 1ZAKA 1GP2A 3LO5A 1SHKA 4D4JA 1DOAA 4KHZA 2Q3FA 1AN0A 1E0JA 4WVFA 5E7MA 3U3KA 1TEVA 2ZSFA 3OFND 2OESA 4QGHA 3X1ZA 3ADCA 4DKXA 3TSOA 3VFDA 4KBFA 4DIEA 3L43A 2ZI6A 3QBVA 3LFUA 3AVVA 2J0SA 5A0FA 3SYLA 4CDGA 4M1TA 1KK0A 2XTZA 1E2KA 4IOJA 5F98A 3B1VA 5EUQB 2OG2A 1N6RA 3T15A 2QMUA 2QUZA 2WVJA 4DUGD 1NN1A 4IVRA 2NPFA 1COWD 1HE8B 1U8AA 3IHLA 1VG0B 4BLTA 4G5OA 4LY6A 3DVLA 1E2EA 5EUMA 5GJCA 1XMVA 4Q7JB 4WAUA 2KBEA 4ZI3A 1CP2A 1E9EA 1P60A 3PVSA 4URXR 2OFOA 1R5BA 1ZM4A 4A0HA 4HB0A 1R0WA 2DWPA 2IS6A 2Z6VA 1G3QA 4R9UC 2Z43A 2J45A 1T0HB 1D2NA 2G1KA 5EP2A 5BWMA 3NG1A 1U8YA 3H86A 1G21E 1DBSA 2YKGA 4N0EA 3AV0B 3REGA 4NTZA 3TAUA 1P6XA 4KODA 1E98A 3AVWA 4JL6A 3CF6R 4LC0A 4MRNA 1ZIOA 2FWRA 1S1MA 1OV4A 2W6JD 5J47A 1NIPA 2FGKA 3VKGA 1JB1A 1ZIPA 4KSCA 5GJVC 4ZI2A 2VP9A 5CB8A 3NEYA 3D6TB 4PHGA 4JZKA 1AKEA 2O8CA 2FSIA 3GFTA 2VF7A 5DI9A 3C15C 1KSHA 1P3JA 4A0RA 1ZRHA 4YMUA 1CTQA 4KLNA 2CE2X 4Q7MB 1XRJA 3GJ5A 3LQQA 2CHQA 3BFXA 4O25A 1D9XA 1FW6A 1FMLA 1LVGA 2O8EB 4OYHA 2QRZA 3NEJA 5ELXA 1OSNA 2RMKA 2GAOA 4Q1FA 2O8BA 2QL6A 2W0SA 3VHLB 2ZYVX 1DAFA 2GVDC 2NG1A 2V6IA 2JJ2A 1C1YA 4JSTA 1CJUC 1DAHA 2YJTD 2FA9A 3GP8A 2CDNA 1G8HA 2FG5A 3DKPA 4M8NE 4QHYA 2R2AA 5DNYB 1CRPA 3RRYA 2EYQA 4Q4AB 3QKUA 4AYTA 4RFSB 1DAIA 1YZGA 1E2HA 3C5CA 1G4AE 4HUTA 1T0JB 1Z6XA 3CH5A 3WNCA 4MRPA 4BPBA 3SBEA 4XJXA 5C18A 2YC2C 1A82A 2EU8A 5FBQB 2PMKA 4Z51A 3PEVA 8OHMA 4B6EA 4NHOA 1TQDA 4LK2A 4K81B 1VDZA 5D3MA 1SKQA 1EWRA 3ZDQA 4BGDA 1UEIA 3X2SA 4LCBA 4L16A 3ZD7A 2P67A 4G5GA 4EPXA 3IQXA 2P5SA 5TVKA 3MJHA 1P2VA 2CCJA 4XSGA 2FZLA 2BV3A 3ZIAA 2ATXA 1KIMA 3H0KA 3EW9A 3KKMA 4P3YA 1U2RA 4C0LA 5H68A 3GJ3A 2C99A 4MYUA 3U5ZB 1YRBA 4TMVA 2IA5A 2WWYA 2NZ8A 1TAGA 3AEZA 2GCNA 3NIBA 4HZIA 4UNNA 5TARA 1XCMA 2XTMA 2ZYWX 4RVCA 2J5XA 3W5IA 3NHAA 4LBZA 4Q9JA 5CLQA 2ZIAA 4KFTA 1CXZA 2JJ2D 3ZVNA 1IY1A 5EP1A 1UJ2A 2ZTSA 3KQKA 3ZH9B 2CHGA 1GVNB 4TYNA 1DE0A 5L3QA 2EFDB 2WPDA 4KU4A 2HUPA 4TMXA 2ATVA 3HU2A 3QENA 3A4MA 4GOXA 2IEZA 4EDHA 5AUPB 4LDJA 1V5WA 2D2FA 4KI0A 3LVRE 1WBDA 4PTLA 2IC5A 4CEHA 3D7MA 1J2JA 2J1LA 1E2LA 1G7TA 3VHXA 4FMDB 2ZROA 2V1XA 4RKEA 1RYHA 5B2ZA 1J90A 3A1TA 4ZO4A 2E1RA 4OI1A 4BFSA 3B1WA 3IHWA 3M1IA 3WP1B 4JKIA 4BZPA 4DLRA 2CMKA 4B32A 1NRJB 4WZAE 1XTRA 2WIBA 1FQKA 4HB2A 3AVXA 3OIWA 4ZDIA 3AVQA 5DYIA 4NCNA 1UBFA 4HZUA 4RZ2A 1GSIA 4NCKA 3QXXA 3UANA 1WE2A 5IRCD 4O3MA 4QG7A 5G3YA 4HAZA 1XJQA 4IEIA 3RYTC 1Q57A 4IDHA 5B57C 3HR8A 4B73A 4KFSA 2ZITA 3AGPA 3C5HA 3ZIAD 3KJHA 3VU9A 3OEEA 1T8TA 4YONB 4DIDA 4A15A 1GM5A 2IYYA 1P62B 3A6PC 1LY1A 2CHVA 5KDLA 2F55A 2ZS8A 1OB2A 4IJMA 4Q03A 3CR7A 4D81A 3TSWA 2F3TA 3O47A 1E9CA 2QAGB 2Z4RA 1VPLA 3DZDA 2EVWX 3X1YA 3RDPA 3UWOA 3OESA 4LOAA 2YWEA 2IEYA 3CB4A 4TL8A 3X1XA 4OJKA 3NBZC 5HE8A 5LD2C 3TRFA 2QGZA 1UKYA 2Q3HA 2Q3MA 4JBWA 4E03A 1KTVA 1IY0A 2RGCA 1JR3E 3IGFA 2QSYA 3EZ7A 1D6JA 3ECCA 3AKDA 1XZQA 4QNMA 1KI6A 1Q1BA 1TU4A 2QY9A 3PEUA 1N6IA 1YZLA 4Z1MD 4Q7LA 1W5TA 2O8DB 3BJIC 4A92A 4GFDA 1NVVR 3G5UA 1ZP6A 2ZM5A 4XIGS 4LJ6A 2ZSBA 5FFMA 1FUUA 4LYHA 2IW3A 3CX8A 5KNCA 3HYRA 5DLQC 1OYYA 2ZR0A 4DJTA 1GDDA 4LV8B 2PH1A 3PEYA 1YZKA 1YR7A 4JL8A 3UXMA 2RGEA 2ORVA 4DCUA 3EPLA 4Q1BA 4GMDA 5FUXA 1NBME 1NMYA 3NBYC 3OIYA 1ONBA 2IYQA 1TADA 3KUCA 2W6IA 1UPTA 2O0JA 1AZTA 3OEED 4GOKA 4L15A 5F9FA 1AQUA 5FBVB 1KDOA 3I3SR 1G6OA 3LBHA 1XFAA 5BN4A 4Q4HB 2AKAB 4MRRA 3Q5DA 1HEIA 4JMPA 3R20A 2JATA 2CXXA 4Q4LA 4II7A 1A7JA 2XNDD 1XWIA 1FUKA 1TUIA 1OHHA 3P1JA 1GWNA 4C0KA 1MOZA 2P6UA 4R98A 5AJWA 5SZHB 1G64A 1RJ9B 1PVOA 3BAFA 4LJ4A 2BMJA 2OFXA 1GOTA 2FE4A 1T3SA 2FSFA 4EJSB 1F6BA 1SVMA 4GMXA 4PAOA 3FB4A 1RPZA 2JLVA 3GEEA 3PUWA 3VX4A 2OAQ1 5CLLA 2QTHA 1KAOA 4HI0E 1K5GA 1N6NA 2ZJOA 4URZR 5JBQA 2PX0A 2IWRA 3NXSA 3IO3A 3RC8A 1MO5A 3KTAA 4YMTA 1AS0A 2OCAA 3HU3A 4LX0A 3RRNA 4CT5A 4YMWA 3A37A 3P27A 4J0QA 5FPTA 3VR2A 3KJGA 2WOJA 3SJCA 5IT5A 2XEXA 1HURA 2V1UA 1KI4A 1JPJA 2ODNA 3BORA 3JVVA 4M1WA 3S1AB 4XWOA 3U3OA 4ZDWA 4Q1CA 3THXA 1SKYE 4JYCA 5EQTA 1OXUA 3GD7A 1XCPA 3L0SA 2JLUA 3EPKA 4C7OA 1ZM2A 2ANCA 4RCZA 4NDZA 1QG2A 4C4PA 1K8RA 1TEXA 2ZR7A 1RE0A 3K0FB 2BMEA 2R8RA 2W6ID 4V0NA 2PEZA 1CJKC 4PHFA 3ADKA 1OYWA 4ASUA 2H1LA 2QGNA 4ESVA 4LBWA 1H8HD 4QJ5A 3QQ5A 1IXRC 4WZ6A 1RRCA 1JJ7A 1E2PA 3QSYA 2ZRLA 3U7FB 1DELA 5LBIA 4TL7A 5JFGA 4OI2A 4TLDA 4GRAA 4JBYA 1NN0A 4NONA 1OHHD 1KO4A 2R6CA 4LHYA 1XEWX 2HV8A 1CF4A 1F60A 3GLIB 3GLGE 3W9YA 3AF4A 3J81k 4DLYA 3B85A 4RFVA 2C77A 3RANA 2J87A 2W58A 3T35A 4DSTA 1KI3A 2ZRCA 3C41J 2GBLA 3QG5A 2IYXA 4MRSA 1KSJA 2X77A 4H1UA 2YC4C 2J3EA 4YQFA 3CBQA 1E0SA 3GLFB 3LA6A 5FUWA 2FN4A 1Z06A 2JDIA 3N5CA 5DHAA 2BKUA 4HAUA 1W46A 3AP3A 3MRSA 1E4VA 2D7CA 3AKEA 4M9XA 3EX7C 1NP6A 1NKTA 1ZM7A 4IXNA 3GFOA 2OXCA 4Q4JA 3D8BA 5HPYB 4FCVA 3AF3A 3UG6A 4CRWB 5CYOA 3U2QA 2PJZA 4A82A 2V55B 2KSQA 1NVUQ 4NYIQ 4D26A 2ZEJA 5AJXA 2CLCX 2QTVB 1P61B 1VHTA 3FYHA 3RS2A 1R6BX 2C04A 4S35A 3ZZ0A 1WQ1R 2QQ0A 3PITA 5CK5A 2GCPA 2GF0A 4ASUD 4D80A 5EXPA 3ZS8A 4NE2A 2G3YA 2IYLD 3I1FA 2DB3A 4TTQA 3A1VA 4HUQB 2ZUBA 1G7RA 3CM0A 3BGWA 4CIDA 2DWQA 2ZRPA 1G5PA 2P6NA 2R6FA 3HPRA 3K0CA 2ZAMA 3ZVLA 1OIVA 1W48A 4D0NA 3A1SA 5E95A 4EUNA 1JR6A 3VTKA 4ZKDA 1MV5A 1IXZA 2ORIA 1TQ6A 3QXCA 1R4AA 2VSFA 3K09A 4TYYA 4IFBA 3A1UA 4M0LA 4BFZA 1SVIA 1WP9A 3RLFA 2BOVA 5JMTA 3LX5A 3T1QA 2OEPA 4DCNA 4DLSA 2BDTA 4NYMR 4UXHA 2FZ4A 1MO3A 1GL6A 3OAAA 1P2UA 1FZQA 4U02A 4W5WA 5EZ5A 4U5XA 5G41A 3B1YA 3L0OA 5EE5B 5H8WA 221PA 2QP4A 1UKVY 2XGJA 3TR5A 1IN8A 3B9PA 3H4MA 5FPKA 2JDID 2VYFA 3MAAC 4B2LA 2WIAA 2IWHA 1WMSA 1XEXB 4ERNA 1ETUA 4ACBA 4A8JA 1QHYA 1R10A 1J8MF 3B1ZA 4JS0A 2J0QA 1KY2A 5J5CA 3QOFA 5DH9A 3VNUA 1KI1A 2IUUA 2GJ8A 4KBGA 1W4RA 5HKKA 1HV8A 1KK3A 1F2UB 1TNDA 2FNAA 2I3BA 1SXJA 4Q9KA 2NO0A 1DAGA 3A8TA 4MGYR 5DYGA 5KSYA 2V4ZA 2J0UB 4ACAA 2BHRA 1SQ5A 3THYA 1CKEA 3CUEF 4HAXA 5L3RA 1SVOA 1R0ZA 5JCPA 3K0AA 5DI3A 3DMNA 3X1DA 2NO1A 2FPLA 1N5IA 2GA8A 2ZJ8A 1GFIA 2D4HA 4YMVA 2ZRNA 1HYQA 3TMKA 3PUXA 4QHSA 5BXQC 1T3HA 1OE0A 1OT3A 2C9YA 4L4UA 4L9WA 3REFA 4C2TA 3CNLA 4LHVA 1UFQA 4P31A 1XD8A 4Q18A 1KHTA 4B47A 1W4CA 2W2XA 4QOSA 3DHWC 3KKQA 5FBRB 5FL7D 4X8HA 5EJEA 4DZZA 3FE2A 4LUCA 1PLLA 5EE3A 4UJ5A 3QF4A 2AWNA 4Q48A 3AVUA 3IPXA 2C96A 1SVKA 1H8ED 1XD2B 3CR8A 5FUYA 4OJQA 2LKCA 2XZPA 1S3SA 4G01B 1XPUA 1EX6A 1XB2A 4DBLC 4LJ8A 2A5GA 1WA5A 1X1RA 2OCYC 4XOIA 5P21A 2GTPA 4L8GA 1CJMA 3LW8A 3W6NA 5FOWA 3NBFA 3KX2A 3GLHA 2ZRDA 4BQSA 4RCYA 2QPTA 1NI3A 1UKZA 4BLSA 1DVRA 1XZPA 2WM9B 1Y63A 1YZQA 3CLVA 3U7EB 2XXAA 3GEHA 4BLPA 5JS8A 2FFHA 1XXHE 4POAA 3U4QB 1P2SA 4FWTA 1X1SA 5DE3A 5HKKD 3NKVA 1O3YA 1FX0B 3HP1A 4IW3B 1SXJD 3R8FA 2G88A 1D2MA 3M6AA 4MYHA 4ZIRA 5K8UA 4KVGA 2FH5B 1N6PA 3GEIA 3QI2A 3SBDA 5HR5A 4MDFA 1S3GA 1XX6A 2ZUDA 2WAXA 5KNDA 4PPFA 3NTUA 4F92B 1EFHA 4HB4A 2OZEA 5FOUA 1V43A 1FPMA 3CW2A 5E7IA 1XDBA 3PUZA 2QN6A 4C0SA 3TGPA 2F7SA 4ARZA 2YVUA 3EPHA 3QG1A 2MMCA 3QIAA 1HE1C 3NDPA 4NH0A 5LD2B 2IUTA 2GJKA 3SQXA 4IRUB 4Q9IA 1YR6A 4QXAA 3NH9A 1BH2A 4HLCA 1Z8FA 4QJ3A 4XSHA 2XZLA 2ZUCA 1DO2A 1Y3AA 2Y8EA 4LHWA 4FINA 1DG1G 3HPQA 1FP7A 2B7BA 3WBJA 3WYAA 1YRAA 2DYKA 3QE0A 4KV9A 5JJKA 3T06B 4HAWA 3EWAA 3UMRA 5EP4A 2FEOA 2RGDA 1ZVQA 2DFNA 4F38A 4DSUA 4MA4A 2BMFA 4TLCA 4HAYA 1Q1ZA 1F5NA 2N46A 2GJSA 2QE7A 4WIAA 3TQCA 1CEEA 3GJ7A 1Z0FA 1VG1A 4IOLA 2F1IA 4PO8A 1OIWA 2BC9A 2H5EA 3JVUA 2YWGA 4NZYA 4R2IA 1YE8A 2BIFA 1A4RA 1KI8A 1WRBA 4E22A 2YOGA 5KTYA 1Z6YA 2QG6A 4AI6A 1PLJA 3KQNA 1CR1A 4MH0R 2V9PA 1K6MA 2DFTA 3QXSA 1UF9A 1IM2A 3F8TA 2YOHA 4PSAA 5EE0A 5G3ZA 1VKJA 2O8CB 1JAHA 2OCBA 4LWZA 2JASA 2WJVA 1ESMA 1KSGA 3QKTA 3LX8A 3RHFA 1ZUIA 1EFUA 2MSEB 4HDCA 4PZYA 1AZSC 1Z83A 2WSMA 3U60B 1LS6A 2RH5A 3DPUA 4OI4A 3W3ZB 4LBVA 4GP7A 1EXMA 4D0GA 3T1TA 3BIFA 3ZYCA 2O8BB 1W7AA 3KB2A 2QMOA 1KAGA 2J7PD 1G5RA 4P4SA 1DO0A 1G3RA 5BW8A 3K0CC 3UPUA 2A2ZA 3BOSA 4P0TA 4KCGA 3ZQ6A 1KNXA 4W5HA 1YR9A 3K1JA 2C2HA 4B33A 4JVMA 5F9HA 3K09C 1GL7A 3SFVA 3E2IA 1IN7A 1R5OA 4OK5A 3KJIA 3KKNA 4B3DA 4DSOA 4ZV4A 5B64A 3TUZC 2REOA 2QE7D 2OCPA 1J7KA 2OT3B 3QXHA 5AWFC 4BLOA 1KZ7B 4UXIA 2HLDA 1I2DA 3SI7A 4R71A 1N6HA 3OIUA 1JBKA 2QT0A 1KDPA 3UMSA 1IN4A 4CEIA 4BECA 1R2QA 3TW4A 3VX3A 4NYJQ 1P73A 4PAMA 5KO2A 5D3MB 1CLUA 3DKVA 1U90A 3AVTA 3MUFA 1E2IA 4PQRA 2IXGA 4PO1A 2NIPA 3UKDA 4KSBA 1VCOA 2C9OA 1KSFX 2KE5A 3EA5A 5B30A 3BRWD 3SDZA 3EIQA 2G0TA 2ZE7A 3IDQA 2FGJA 2BBWA 4FMCF 3RS4A 4EQ6A 2JLXA 1UBCA 1KZGB 3KXLA 2R6DA 5CJ2A 4XVUA 1GNQA 2WWGA 3WMFA 1NSTA 4Q66C 4NCIA 3WNDA 2OM2A 2PCJA 3DMDA 4LYAA 4RZXA 2XB2A 3F5FA 4BLQA 1S0UA 3RWMB 3BB4A 1SXJC 4B3FX 3W90A 2NOAA 1T3LA 2AN9A 3LBNA 3I5YA 1WBBA 3CF0A 4Q02A 1E2GA 3EIHA 5JSZA 2FF7A 4DHEA 2VP5A 3A1WA 2HT1A 2IF2A 3QPVA 3NDBB 1U9IC 3RWOA 1G7SA 4PC3A 2VO1A 1OH6A 1P9RA 521PA 1I2MA 1VCMA 1G7CA 4M4SA 1M7BA 5BYJA 4GI7A 3CRRA 1T8UA 4KVAA 2MSDB 5L3QB 1G18A 1GTVA 5HZKA 5K8IA 2QTFA 4JT4A 1XTQA 4H9GA 4ZDKA 2XSZA 1NMZA 5DO9A 4US0R 2Q9AA 1E2NA 3I61A 1OFTA 2WSSA 4CEHB 4EPWA 5LB2A 2YYZA 2GKSA 4DXAA 2PEYA 5JJIA 2FV8A 3MFYA 5DGXA 2VH5R 3WY9A 2JLQA 1N6LA 1ESNA 2ZETA 1ZM9A 2ANBA 1T91A 4DLWA 2RKOA 1DARA 3QBTA 1W47A 3DL0A 4RD0A 2RHDA 3LWNA 4BZQA 1S8FA 1X8JA 4HZUB 4Q5IA 4DLXA 1GRNA 2WTUA 1OIXA 4WOPA 5GVSA 2PZGA 5KPJA 4G1UC 2PX3A 3AVYA 3C14C 4CEJA 3ASZA 3BB1A 2ZE5A 3HWSA 4TZ6A 5L3SA 3FHOA 3BH6A 2ZPTX 3CONA 4OHYA 4Y0VA 1YQTA 2GJAA 1AS3A 4TN1A 3VU9B 2ZE8A 2WJIA 4LJ5A 2F43A 1KMHA 3CNNA 1HUQA 2YNMA 1N5JA 4MKIA 4DDUA 1QHNA 3DM5A 1S96A 2EFHB 1IHUA 4AIIA 2RGNA 5AUNB 4KJZA 2XB4A 2QA5A 2EW1A 1JNYA 4D4MA 1R5NA 2OHFA 2F9MA 2G77B 5KYKA 1BIFA 3RS0A 3LQRA 4LJYA 4V0ME 1RRGA 1VTKA 1XJ0A 1JALA 4JLJA 4OQNA 2ODBA 3TJZA 4HSEA 4OQFA 2O0HA 2JJ8A 3VR6A 3C4JA 3K9LA 3C8UA 4PO9A 2WSSD 1CJTC 4Q1AA 1KI6B 2JEOA 1EGAA 4GBMA 4EFNA 3FGNA 3R9WA 2N1BA 4GPTA 1DG3A 2NQ2C 2WV9A 3N2IA 2FOLA 4HLUA 1UDXA 3CRVA 3K9HA 4M1YA 2BCGY 1U0HC 3HYTA 5SZJA 5C46F 3QVUA 1TL7C 3U7HB 2PJRA 4M9ZA 2ZRKA 4RD2A 1M6NA 1QZXA 3MCAA 1J8YF 2GK6A 1L2TA 2VL7A 4CZ2A 1BS1A 3ZJYA 1T5LA 2A5YB 3TK1A 2QP3A 4NMMA 4B6FA 2X2FA 1TF5A 3KL4A 3PEWA 3MMPA 1IN6A 3V4FA 3W5JA 4QHTA 5SZKB 2BM1A 1JR3A 5JI2E 4QNRA 3VKHA 3W6OA 4RD6A 4B44A 1TPZA 1L4YA 1RZ3A 1EESA 3FKSA 4GDFA 1IY2A 1D2EA 2ECKA 1W44A 3Q7QA 1Z6TA 2IK8A 2ZJ5A 4G3XA 1XU4A 1L7VC 3NC1C 2EFGA 2ZXUA 3SFZA 1Z07A 4ZCMA 1WB9A 2BMDA 1Z63A 1NJFA 1US8A 1ZW6A 3DOEA 1F3OA 3LDAA 1NN5A 3PUVA 4ON9A 4LRWA 4IHQA 4M1KA 2Z5FA 3R9IA 4WBSA 1E96A 4XWAA 2EFCB 4IOKA 2WAYA 4JIMA 4WZBE 1E1QA 1NL3A 5FUVA 3TLXA 4QBIA 4W9MC 4LC1A 1L8QA 4YXWA 2WPDD 4HLDA 3AP1A 5JWOA 1JAIA 2CL7X 4M21A 1NBMA 2G83A 1N25A 1KK2A 1OH7A 1QF9A 3A4NA 4HDQB 4ILEA 4UNQA 4LYJA 3KKPA 4C3ZA 1SVSA 4C0HA 2ZJBA 1E1RA 4DEXA 4FWIB 5BN5A 2QM7A 3KTAB 2JAQA 2IX3A 4MKFA 4MGKR 1Z0KA 3FVQA 4BRUA 1R8QA 2YHSA 5EXSA 3RRMA 1W4AA 3EZFA 1QVAA 2XOKA 3HU1A 2ONKA 5FR1A 1E9BA 2GAAA 2PLRA 2OAP1 4PHHA 3TBKA 4A6XA 3THXB 1LB1B 1KO8A 4FMDF 1CBUA 1XEFA 3UATA 4DT1A 4GOJA 4DB2A 2DY1A 4NBSA 4C7OB 4TSFA 1Z47A 5KHOC 3IUYA 3MWYW 4PPQA 1PV4A 3DZ8A 1JR3D 5FTNA 5BYKA 4OK6A 5IF9A 3IBYA 4MQBA 1ZUNB 4US1R 3FKSD 2HYIC 2PT7A 2ZQ5A 3AF0A 4QGGA 1J99A 4FXPA 1XTSA 2AKYA 3P26A 1MR3F 4TYWA 1E9AA 2AD1A 2HYDA 4PC6A 1KMQA 1II8A 3F0TA 1I4TD 3WBKA 3KQUA 4FW9A 1KNQA 1E1QD 3L82B 1JPNA 4LV6A 1OJLA 4XTRA 3SN6A 4YXWD 2H18A 2NMVA 2VHQA 3EZ6A 5FTMA 1R0XA 4LPSA 4QRHA 4V0OA
chains in the Genus database with same CATH superfamily
1AUVA 3K1YA 4MPJA 1Z2AA 4YP6A 2E87A 2YW9A 2QZZA 4O2BA 5K9ZA 2FTKE 1N6OA 1TT7A 3SE0A 4BNLA 3GXBA 1E1RD 3OPNA 4HDNA 3ZHZA 4MNTA 3KQOA 3BMOB 1E7RA 4LNUA 2CN1A 3C3JA 3FMOB 3L0ZA 3EZYA 3GRZA 2VNJA 3C1OA 4KV7A 4RXUA 3DG9A 1AXGA 4MUXA 2CWWA 4QXOA 2JI7A 1EXDA 4OHFA 3KHUA 2YZ2A 3EEQA 5EWMA 3W7VA 2DG2A 3PNQA 4MEJA 4XAQA 1P75A 5FRDA 3UJHA 2XY4A 3FNBA 3DOJA 4F12A 3SDBA 1VMEA 3SZUA 1DS6A 4XB6B 4TSFD 4KAFA 1G6KA 1ZUHA 2J9FB 3VVMA 4D9BA 3E18A 1YONA 3QA3E 3RF7A 4PLHA 2JB9A 5F3DA 2I6FA 2PUWA 2H00A 1ZM3A 3EVDA 2UYCA 4RMHA 5KAPA 1USGA 2HHAA 4UU0A 3VR3A 1W0KA 2HDNB 2GS9A 4RF4A 3R0ZA 3RREA 5BSGA 4HXFB 2TECE 4GYWA 3RT7A 2KWIA 3FMPB 4B6SA 1EK0A 3DOCA 3SJZA 3FWKA 1Z26A 1K5DA 1E2DA 1E2UA 1GL9B 3C7KA 3V4SA 5DN6A 3FWYA 3V4LA 1WB4A 3BA1A 4P7KA 2XWSA 5GJWC 3SJ7A 3WWYA 4RHXA 1EX9A 3MT0A 1QCYA 3U48A 4P84A 2V7TA 4QXPA 1CQWA 5TIIA 3LUAA 1DJLA 4B84A 1XT6A 5H5JA 3EWIA 5LXTB 1YXMA 2GSDA 2VZ9A 4W8OA 2VTKA 3CBGA 4XM0A 3ONDA 1CFZA 1A27A 5EWJA 5EZSA 1TK2A 1E6EA 3PFBA 3TMAA 1FRZA 3EXAA 2RH8A 2WUEA 2XHEA 4RPCA 1R8SA 3OFVA 4DR2B 2HLNA 2E37A 2HMTA 1L8XA 1JU9A 3AVPA 2BDEA 1L4FA 3D2BA 4QAJA 1G38A 3IVRA 3LRPA 3TLYA 3O1JC 2FR8A 1RQXA 1KIFA 1IXSB 1GG2A 3S8MA 2QKYA 1GLVA 1JXOA 5C5CA 1EUYA 4UCFA 1PO7A 4K8RB 3B9RA 5FTKA 4LZPA 4AYWA 3CVXA 2DCUA 2CLDX 3H6GA 4RK6A 1X86B 3P4XA 2IV3A 4BATA 4A8JB 2NLOA 1U2DC 3TQRA 3KLBA 2G5GX 2VPYA 3L7IA 3I32A 2OILA 4IDOA 3TR0A 1XCLA 3CVUA 3L4BA 4TTPA 3UAOA 3A3NA 5JCOA 3SEZA 4CM4A 3VNRA 1OYOA 4Y8VA 1BGVA 4D3XA 1K7EB 4R7GA 4YRDA 1X6VA 5IP5A 4O8ZA 4CW7A 1I7SB 1Y6ZA 2P2GA 4L8YA 4DGSA 5FUMA 2NYAA 4R8MA 4V2IA 3VKFA 2HJGA 4HL6A 5LQUA 6YASA 1VCNA 1KYIA 2B20A 1VHJA 3R5SA 1UK6A 2XCRB 1SOMA 1RWKA 5DIFA 3VU0A 4EHNA 2R44A 3CWCA 4C4SA 4BEBA 1QDLB 1FQJA 3VPHA 1Y3FE 2ZYUX 3D0OA 3QE3A 1KKLA 1E4EA 5DI3B 2JFFA 2QRLA 5TT1A 5ALNA 4RKQA 2HWYA 3QK7A 2OHJA 3I5XA 2WT8A 4RJJA 3GFSA 2COKA 4RC9A 1QHHA 1UT5A 1VRVA 1E1CA 2IYSA 4AAYA 4OQMA 4NZMA 1XAJA 1QAQA 4V0LA 1MB3A 4J1TA 4BLRA 4EPVA 2WLSA 5CP8A 2AYXA 2NNWB 4X64B 2RFLA 3O4VA 1OF1A 1P1KA 4ZMSA 2PAAA 4OA5A 2WJGA 3NQ41 1GAXA 3FTPA 3THOA 4IFTA 1PG0A 4N9QA 4AUMA 1PT9A 2QTGA 1P5JA 3ELYA 4D82A 2XADA 1W5FA 3KQYA 4I0WB 5D3QA 2JFXA 4F5EA 2GZHA 2J7KA 2FUCA 4PXSA 3KO8A 1WMAA 1XJ5A 1XZAA 2EJVA 2VUHB 4KR7A 1ILWA 2AN1A 2GYWA 3IDOA 3TM4A 4S2UA 1MW9X 1U8FO 1V8DA 2CFTA 3IAUA 4EA7A 1AHHA 4EW3A 5BVGB 5C1OA 5CFOA 3O95A 1O9BA 3D8RA 5IDVA 4A91A 4AJPA 4IM7A 4OBEA 4BVJA 2UV8A 1IZ9A 5AFSA 3U6BA 3BL5A 3BFKA 4FEEA 4KO3S 4PW0A 3KOZA 2JRLA 4ZQCB 1DPFA 5EWLB 4G85A 4B31A 5A4JA 1FJHA 2AXPA 4PZCA 5DDIP 1CIJA 1Z4NA 1QDEA 1ZRSA 2EQAA 3RHSA 1WLYA 1HT1E 3JQ9A 1QIJA 2DSNA 1GSHA 3G9UA 1N6KA 4G41A 1FMFA 3DAPA 4F96A 4J76A 4AZTA 3L6RA 1PFYA 1YULA 3HI4A 3H1FA 1X7ZB 3ILYA 5CFRA 5ALHA 1GGNA 2NQTA 3GUHA 2W2LD 4C4RA 5BMVB 1JSXA 4YGYA 3SC6A 1OFIA 2O54A 2VZ0A 4ZREA 4BX2A 3QXJA 4BB5A 5K6RA 3BD8A 5L7TA 1GZ3A 3FCCA 4IDDA 1GCGA 4PR0A 4TLMB 3QKRA 3QYJA 2JAHA 1VYHA 2H7XA 4DMCA 5HKOA 2XECA 4MS4A 4LRQA 3GLIE 1ULZA 3GJXC 4G4JA 3R3WA 3SNHA 3KETA 3TKLA 1LLUA 3LVQE 4DZTA 1T2DA 2XDWA 1F4PA 3T1HB 5CIYA 3AC0A 2VHJA 3B1KA 1DUSA 1JSZA 1M34E 4HQFA 1RWOA 4MQEB 2I0FA 4OP2A 5A1JA 5FOTA 3V4PB 5G0TA 2HPAA 2NXWA 1QH0A 3EPJA 4BNZA 1JEEA 2YMQA 5E8RA 1FDRA 3D3NA 1GRQA 1WZEA 4HNHA 2B4TO 5L4LA 2CNWA 3TQOA 1SBHA 5ESDA 5EG5A 3DMYA 5FNVF 3TQFA 1C5KA 1W8IA 2V6GA 1G0NA 1NX6A 4IGAA 5BVGA 4HYYA 3G2HA 2ZRHA 1R8JA 5CNJA 3V4RA 1OKKA 2RHRA 3GFPA 1MQ8B 3KKEA 5EGNA 3BFVA 3ZGLA 1LNQA 4EOGA 5I4CA 5JDIC 4F7WA 4EGSA 1VPDA 4BCCA 1C50A 1KEEB 4BNTA 5KNBD 2AL7A 1Q1GA 4YPVA 1H9CA 5F33A 1EG7A 1UBKS 4F9GA 1RC8A 1THGA 4OGFA 5DLDA 1VIAA 4GL2A 2JFYA 3EQ8A 1CS4C 1RQRA 2HJVA 3N0WA 4JIGA 3ST7A 2OK7A 2W37A 4FE7A 2VAXA 3PQ4A 1K08A 3EZ2A 3CH6A 5JIBA 2IIVA 3T12A 5DHTA 1EU1A 2H17A 3EQ9A 3E35A 3FW1A 1R6DA 3VMFA 2GCOA 3DAOA 5T3UA 1XO1A 5DTEA 1WR8A 3ZWBA 5C4MA 4R2HA 1EK6A 1JGTA 2HBYA 1TMOA 2CMGA 1O58A 2GB4A 3O8LA 4I1VA 4G5HA 4UBJA 1K7XB 4R7ZA 3U4CA 5KOHA 1Y37A 3IBFA 4FB4A 4KIJA 3BCHA 1SJ9A 2WTXA 4QQ8A 5AUQA 4UTNA 4YP1A 1AJEA 3QNUA 3TVTA 4MVJD 1ORIA 2OHOA 4LVNA 3TSZA 5ALQA 2GKOA 2HU2A 1OGJA 2JIDA 4FYIA 1CETA 3S55A 4XLTA 1A1VA 2W00A 4JB3A 4UNSA 5DHFA 3AY6A 3A2NA 5TC4A 1J2EA 3OFNA 3I4LA 1CK4A 3MK31 1PF7E 1QH1A 3JALA 4L76A 1MRZA 1E79D 2Q5IA 3C8ZA 1RAEA 5J1TB 1KAHA 3CT6A 1CUGA 2FFQA 3LY5A 1IHOA 1CG6A 4X41A 1L4EA 2C1EA 3PHBE 3HZRA 4IS2A 3T61A 1YBFA 2UYOA 3ILXA 2TMDA 3L6BA 3AKYA 3UWSA 1NG9A 2ZUSA 1RBQA 3T7CA 2H16A 5I51A 2XRZA 3T1OA 1A2KC 2XWBF 4GYJA 1UJ4A 3H05A 2W2TA 5ALUA 1NF8A 2GOYA 4FZRA 4JYBA 1E3DA 4IHJF 3K7EA 1FL9A 2PYDA 2Y9PB 4YV1A 1ANKA 2DH6A 2HEIA 1EYZA 2P9JA 4IMPA 1P6QA 2GFQA 2ST1A 1IBKB 2OBBA 3RM3A 1CZOA 5CT6A 3HJFA 4I2NA 2C0PA 1P7WA 5FPSA 3VBCA 2WYOA 4OHOA 4Q34A 3DZHA 4QDUA 3IURA 1E3MA 3WYFA 4YRGA 1S1CA 3EB9A 2I54A 5E7JA 3PXGA 2ZI7A 4Y2VA 1KXZA 1N8TA 2EG5A 4N8EA 4JJKA 5K51A 2IGBA 3ZGXA 4EQ6B 3PV0A 1KIAA 3IQWA 4B6GA 1V3QE 1JHDA 3E48A 3LVBA 3UHOA 5CFLA 4PRKA 4ZT5A 5C8YA 4BVAA 4EFLA 2IJGX 1T4CB 1SBQA 1Y9EA 5ELMA 4OXQA 4EB8A 5FWXA 5IASA 2C7QA 3Q5EA 3BK2A 3RVSA 2F9LA 2O1EA 5HF5A 1D6NA 1H65A 2B4AA 1I4DD 1U1EA 2DTXA 1N3BA 3GK3A 4P35A 2J4DA 1WUTA 4WKNA 3UICA 3DDCA 5LYJB 4HEHA 4PBRA 2ZB8A 1O03A 4OHKA 2JS7A 4I9FA 4WA7A 4BE7B 4CLEA 2CL5A 4IWXA 2PKRA 3WVNA 1E18A 2IKQA 4YRLA 1S02A 1M67A 1FLAA 1QIHA 1KE2A 2R8YA 4BN5A 1NOKA 5KMGA 2GLUA 4LKOA 3FPAA 4FSXA 2DRIA 1JJVA 4JB8A 3ED1A 4Q1EA 2X0DA 2C5BA 1FW8A 2FMIA 1GLNA 1P2FA 3CLUD 3H5OA 4WXPA 1C3VA 4EO4A 1HF3A 1OAAA 5F52A 3H0CA 5E6SB 3U6KA 3W3AA 2CXRA 4IDGA 4JGBA 5LC1A 1KFBB 3RVBA 4BN0A 5IK2D 1RQLA 2V0GA 5TQJA 3O6VA 2ERXA 3QEJA 3W8EA 1TTTA 4XFJA 1B8VA 4C6RA 2YX1A 4D4KA 4KQ2A 3QMPA 2GO7A 1B1AA 4U63A 1DP4A 1I7PA 1BKDR 1U28C 1EXWA 3WFJA 4BVGA 3WE7A 1UJNA 2VQSA 3K70D 4ND6A 4RO0A 1TAUA 3UK1A 1G1MA 3K3PA 4CKWA 4D0SA 3PBKA 4XPZA 3HCAA 4QKQA 5LOVA 5M5BA 2GTHA 3GEDA 4RELA 1BZYA 2FPWA 2XYHA 3RIEA 1Y6GA 3ICCA 3MIZA 1TFUA 2MYNA 2O6LA 4G5YA 3O9VA 4R8LA 3R3SA 1ZNWA 1AKWA 3KS9A 2VAVA 3EXG1 4NZOA 3NO4A 3DV0A 3QV2A 1P9NA 3R3JA 2O48X 3QFCA 4EK9A 3AL2A 5AXDA 4EHFA 1TT5B 2A7QA 2F43B 2ORWA 1U0NA 2JH8A 2O2EA 2X5KO 2ZTHA 3V6LA 2IZ1A 2G4CA 5K8LA 3VPFA 1W0JD 1X3LA 1ZH6A 4WK0B 3RRZA 3Q72A 2ZRFA 2QRNA 2DLNA 3DWGA 5I4BA 5NLLA 1VPEA 2AFVA 3B7WA 3JVIA 1XDGA 3VQTA 3N9IA 4J9VA 4QXRA 1N8NA 4FW8A 3AM1A 5C8ZA 1SC6A 2CXQA 2P77A 3O8DA 4KHPB 4P5EA 4IVPA 1NJ8A 2JCYA 2G6TA 3JZMA 3L46A 2BT4A 3ONNA 2GHIA 4LK3A 3OTHA 4RMJA 2OTCA 4N5DA 2FF5A 2GVNA 1OY1A 4O4JB 4DBZA 4CLHA 4E1VA 2YV1A 3OZFA 1T8PA 3TFOA 3ZY2A 5JCZA 4GYYA 2VTVA 4Y2JA 1E2QA 1XZBA 2BEVA 5DWDA 2J3HA 3L84A 1PIWA 1WO8A 2P8SA 4RETA 5B1DA 3ZQ4A 1YV9A 3L0IB 4F3KA 4NPAA 1YB5A 4PQEA 1KTIA 5ICFA 4L28A 2GM5A 2BEKA 1C3JA 2P40A 1EXNA 2VK2A 3A1CA 4FCTA 2J9GA 4UM9D 4CTJA 4MHTA 3JYLA 2EJWA 1QGAA 1FXSA 2B78A 2V74B 4MAFA 3I34X 3QPUA 2XRFA 1UFKA 2IY9A 2FQXA 4YLGA 5EZQA 2JLWA 1N7IA 3L7DA 3OZEA 4XDZA 3QLUA 5K0LA 3T34A 3GDHA 4I6EA 2BFNA 2VQFB 1CHDA 4GEKA 4HLQB 5AM0A 2P65A 3Q7PA 4QRDA 4TQAA 3Q85A 1XPOA 1QYDA 3ZJTA 4B85A 3JQGA 1M2VA 4ESHA 1L9XA 1XELA 2XRYA 3AQ4A 2IYVA 1M54A 1OR8A 2OCKA 2VLBA 2BFFA 2XEDA 3AHIA 3TNJA 4DJDC 2PT5A 4HGQA 2ZYTX 1MB9A 1PJ2A 1RW4A 4A2WA 1YS7A 1EI9A 2FMKA 3A4IA 4Q12A 1JLKA 2PGDA 3CRW1 4M86A 4R83A 3B38A 4HWKA 2XD4A 2EDAA 2Z56A 4FFVA 4H0NA 1ZK4A 4NG5A 2FSHA 3TG2A 3IKTA 2ZIZA 2FXVA 2WQZA 1YNSA 1G8YA 3MD0A 4L0CA 3GR6A 4MQ6A 2DQZA 4GG1A 2VCEA 2FJPA 4MW0A 3IODA 1WU8A 3ZH2A 1A9ZA 1VYVA 3INGA 4WJZA 3TDMA 1TX4B 1K98A 3ML1A 3SF8A 4UUAA 3WHIA 4PF1A 5AVWA 1WEKA 4P36A 4BO2A 1GPAA 1O95D 1A9TA 1VFPA 4RQAA 3K5IA 4O4JA 4CTMA 4LYDA 3MFQA 4U1RA 4DDMA 2DP4E 3PFFA 4CQMB 5J43A 3O91A 1G41A 2V7BA 1N0IA 4QYIB 4U4AA 3STXA 4AL4A 1ZRMA 3G0OA 2YIMA 2BBTA 2PMCA 3EC2A 2ID7A 3WRXA 5JFTA 1NF3A 1PUJA 2YXNA 4M76B 1ZSNA 1EE1A 2ZSDA 3R41A 1RZVA 3ESYA 3MRXA 3T5GA 5JI3E 3A6LA 3MTAA 5B58C 3W5AA 4MCJA 5KTRA 7MHTA 2FR0A 4L4ZA 5TGTA 2JVIA 1ULHA 2AEFA 2G36A 2BP7B 1C8VB 5JAUA 4WKCA 5MDHA 3IQGX 1ZN8A 2G28A 2SKCA 3T9DA 1G4UR 1R6TA 5DBHX 3ROKA 4N1AA 3RE1A 4CM8A 3DZJA 3UJAA 4BNHA 1PKXA 4X66B 2ZIGA 4MJ7A 1FMJA 1QMPA 5CURA 3V1LA 4AN4A 5BUSA 1GPNA 3LG2A 3I2JA 3OIGA 4FZJA 3IIJA 3S2FA 5IKMA 2E5LB 3PFKA 5JS2A 4P33A 4DTCA 4HFMA 2CBXA 1M7HA 1UEJA 2OKGA 2W6CX 5EEHA 1Y7PA 2XE7A 5KPDA 4O2AF 1YRYE 3TSAA 5DLQC 4Y1RB 2HRRA 1EAYA 3LDHA 5FXMA 3I6ZA 4LGYA 4F3YA 4YAGA 1UZUA 4FGLA 1WABA 3CKKA 3EA0A 4G6ZA 4CT0A 1Y7IA 1SHZA 3CE6A 4H16A 4OG2A 3RU2A 3JYQA 2JIZD 3GDGA 3FSGD 4AS3A 2WZBA 1ZGGA 1DX6A 4CVNA 4Q47A 2GEVA 4GNKA 4UOEA 1M8FA 2W8BA 1CYEA 1ZXBA 2IU3A 4MIEA 1AGPA 2O2YA 2F3RA 1E2FA 3OT1B 3HM2A 5KDOA 1AQNA 1QPZA 1MHTA 2W22A 3GVIA 2C9ZA 3FPLA 4NG4A 2WWFA 3G0IA 1I51A 3Q98A 3UK6A 3M3DA 5AW6A 3E9MA 2X9LA 5LQDA 5ALZA 3OJCA 2E49A 4Z8XA 3CVVA 2HMVA 4JLOA 3PQEA 1RKBA 1F9EA 4YAEA 1FXWA 1OVGA 3LDFA 4O4IA 1D4FA 2JAWA 2XCIA 1OFGA 4Q3KA 2PA0A 4UE2A 4H31A 1OZHA 3KYDB 3N75A 2PNFA 1B6RA 2WF5A 2B8WA 3HBJA 4Z0PA 1I33A 1DKPA 1T5IA 3CX6A 3ADDA 2BHSA 2QTTA 2BP7A 2AJBA 3EXIA 3EQ6A 5AJTA 4JI1B 5JQGF 3V9AA 5J23A 5KDDA 1EB8A 1GA6A 2AN4A 1S4QA 3GLGB 1N34B 1ZVMA 2VJMB 1HDCA 4QPDA 4GT1A 1RLUA 3VO1A 1QCDA 1XBTA 4G1FA 1TD9A 1G20E 2IPMA 2G9QA 4OVKA 1WXDA 5L8VA 1HR0B 4DLAA 5GONF 2NTNA 4WKBA 4DDTA 5DHUA 1L3CA 3AHFA 3IAS1 5EEGA 3TE6A 1R12A 1MO6A 2ERCA 2YYYA 3HKEB 4NAUA 4QTUB 1PG5A 2XB6A 3ETGA 3FHTA 2ZTVA 4J16A 2QAIA 3OJLA 4EG0A 2Y66A 5KVVA 3TBFA 1F06A 4L5BA 2IZ7A 1ND5A 4K6FA 4ZRMA 5CDFA 1J70A 1Q2UA 1P8AA 1FS5A 4NJOA 4F6RA 5FTLA 3FOFC 2FUKA 4YR9A 2P68A 4O4LF 4WPGA 2PH7A 3SOZA 4AJIA 5AVSA 5C7LO 4HNGA 3WOVA 3Q8LA 3D7RA 3HLYA 3IPCA 4J7XA 1U1GA 3VXKA 3SFTA 2VHUA 3DDSA 3TNLA 2WP0A 1U65A 4FR5A 4HDOB 4IDPA 4WNAA 4MI3A 3WB1A 1JILA 1B4DA 1RVDA 3PT5A 1ABEA 2BFDB 4ZCPA 2ZIUB 2GLXA 2GEDA 1T8WA 3TZEA 4BPRA 2ZXFA 3TPCA 2Z4SA 5B7QA 2JGIA 2YHAA 3K73O 1KR2A 2Z30A 2AW5A 3TTXA 3VO2A 5I4KA 4BKUA 4HH1A 1H3FA 1G291 5JECA 3KD3A 2IX9A 4ZOAA 2VTDA 2R11A 2JEZA 2Z0MA 4MAMA 4HDKA 3ITNA 1RCFA 3D6AA 4JU9A 4WBNF 4TTSA 1LS1A 5C2JB 3NH6A 1DKMA 2K5UA 3I0ZA 3NOOA 1S3IA 5CEJA 2QAGA 3HXOA 1U1IA 2VBIA 2ZB2A 3L41A 3IAHA 2RI1A 4PAQA 1MGOA 4RLSA 1NXVA 3BZWA 5DM4A 1N1DA 2VPPA 3I2GA 1AGRA 2V5UA 5EIEA 1MT3A 1GAEO 4F91B 1ZLXA 4HEQA 4LPKA 4ZCIA 4B7AA 4F56A 3LDGA 4OHRA 4QA9A 2RCYA 3DYBA 5CHEA 1H22A 4YMLA 2H54A 1WUHS 4Y0NA 5E6RB 1LWOA 3A70A 5BSHA 5UKDA 5B1HA 4JUAA 1NU8A 2W11A 2RC6A 1XFDA 3BWDD 4JBGA 1E2BA 1RWVA 3VNVA 2RHWA 4Q3LA 3TOXA 3MGCA 3N53A 3WYGA 2Z08A 4Q3BA 4G8BA 3R9XB 3FMIA 3GT3A 5LQJA 1SRRA 2D4AA 4ZDJA 2XLCA 1SOUA 2EX1A 3MNFA 5J4KA 1R88A 1L5RA 3ENWA 3ZV5A 4LMBA 5J2UB 1WZUA 5K20A 2JW5A 4Q00A 3RS5A 1KYTA 1Z5ZA 4LDNA 1QLWA 4OU4A 1R9JA 2IHKA 3O93A 4FILA 4C1BA 4EECA 1MMFB 1DQSA 2ZWPA 1W9MA 5BPHA 3OZGA 4PR3A 1ORHA 1A1SA 1UKBA 2Z58A 4TWZA 4TV9B 5LB4A 3BA6A 1U1CA 1ZEJA 4DQLA 3C5EA 2QMZA 1KDRA 3FKQA 3NNNA 4IUBS 4QO7A 3SR4A 1M73E 2IS1A 2P7HA 4HNAA 2BRUA 4HP8A 3UGJA 4XPIB 2QRVA 3LJKA 4F9FA 2BI4A 1I7NA 1P1CA 3WP0A 1F51E 2AK2A 3AIMA 5KWEA 1UP7A 4PYOA 2X23A 4R2JA 3SS8A 4U3JA 5ICEA 5TV2A 3BIJA 1ENPA 1GG5A 2B94A 2EHJA 2PHZA 1VQ1A 2UXBB 4LRUA 2Z2ZA 2C29D 1CDOA 2PMWB 1M76A 3FCXA 4RK1A 4YT8A 5KQSA 4B3GA 1ATIA 4ZVSA 1UBOS 1R4NB 3BK1A 4IWYA 1JHYA 121PA 1I4LD 2JJMA 1RIFA 1ZJZA 3O2NA 5TQ0A 3VOBA 2V7QA 1C81A 1HXHA 4NLLA 1M33A 1X19A 4Y9DA 2F1RA 4I99A 1N0VC 3FFWA 4HR7A 2YMMA 2ILTA 2DPXA 5REQA 4BX3A 5C4IA 3KXPA 1I7DA 2DKNA 2ZRMA 4IDFA 5K3DA 1NYLA 3WWDA 5H1YA 4DRXB 5JCJA 1PTJA 4D44A 5CBPB 2CVFA 4HLUC 1B0AA 5THKA 1R18A 3LBFA 1O6ZA 3NDJA 1GADO 3PLRA 3QQPA 4QO8A 5AI5A 2ZS9A 4TKVA 2F6RA 4DIMA 4WY2A 3X0DA 3BJMA 4FFNA 4P81A 2PBFA 2B92A 5P8WA 4OAPA 2VBGA 3RJZA 1QIIA 2YWCA 4OBWA 1CRQA 3CLTD 4DVJA 1UJ6A 2QVXX 2BFCB 2QLFA 1RZRA 2O59A 3H1EA 2F1KA 1LUAA 2ACKA 2J0VA 3H13A 5IAEA 1B0UA 5LIPA 1DBVO 5KSOA 1K9VF 4WEOA 3EVAA 5FOXA 1KFEB 1I3LA 3UBTA 1FTSA 1JWBB 2NZJA 2Q6KA 2LCFA 1D7AA 2BN4A 2LRHA 1EFKA 3EGEA 5AR1A 1YCHA 1AA9A 4BLUA 3P9IA 1KMIY 1WX1A 4KYUA 4D5EA 3QELA 1V1RB 1QTRA 4DL9A 5EHNA 4QYWA 1XTKA 1L9KA 3CMCO 3E70C 4NP6A 1IVSA 2DR3A 3JQEA 3AR9A 3K0FA 2XCOA 5FLEX 3P9KA 3ZJ5A 1UMBA 1DRUA 1RXSA 1PUXA 1GPBA 3H84A 2PO7A 3R0VA 1T6YA 2AFHB 4FJ0A 4M8IA 5CDTA 1W85A 4J3JA 4RVOA 2QSZA 4WACA 3E23A 3BIOA 3IOEA 4FFPA 2XWJI 4M83A 4PZ0A 1U7PA 5KSPA 3ZZTA 5LJLA 3HCWA 3N86A 5AKXA 4WJLA 2WKPA 3AW8A 4ZAZA 1DBQA 3HEAA 4YXFA 1HTBA 3EAFA 2ASEA 4POOA 3S2IA 3RYCB 4CT4B 2R2GA 4EYOA 2ZWVA 2WHPB 1CC1S 3H9CA 1ISGA 2GRAA 4OQEA 5JCPA 2R62A 4TZ0A 1SBTA 3G5AA 1ZK1A 1CUYA 4D1YA 3CPHA 4A9AA 3GGDA 3H8VA 1FSSA 2QUAA 3OEHA 4RVSA 5DTJA 3I53A 2YV5A 3PFGA 4CUZA 2E4UA 3O1IC 1EWYA 1WXWA 1Z2EA 2JBHA 3HI6A 4M6WB 3GLFA 1BMQA 1XJCA 2ILVA 2FW7A 1PS0A 5IBCA 4MUAA 2B30A 2HSZA 1RE1A 5LDDC 2BTQB 2I1WA 5K3EA 4MITA 1NVFA 2G07A 3G9ZA 4DLUA 4AP9A 4UULA 3KAQA 3R3VA 4RWZA 1EVZA 3WWOA 5I9LA 3F5SA 3FPFA 4MINA 3VZDA 2RHOA 5IAGA 3ND9A 3MG9A 1KH3A 4E33A 3T3OA 4X1OA 3EVTA 1JNXX 1I01A 1S7GA 2QJWA 3UB4A 3IELA 5C5DA 3THWB 3J7AC 1CIPA 1RP1A 1XCOA 4J0GA 3LT4A 4MA5A 4NX2A 3C7DB 4IKPA 2ZI5A 3RI3A 5BRAA 1BQ3A 3C98A 1FTQA 1Z68A 1N7HA 1D5CA 4PPGA 2EEPA 1EZZA 1QGUA 2CLFB 1E3WB 2I8LA 3DKRA 4ZOLF 1SOVA 3TDKA 4C4AA 1FFGA 2A3RA 2BEJA 3CQ9A 3LCMA 5IS2A 5EZ6B 3EUAA 2IODA 1WCXA 1U9IA 1W49A 2H4FA 1SUWA 1YQEA 1Z08A 1MT0A 2HKIA 1R8YA 4LXGA 1I9GA 2NSYA 4PZDA 3WLHA 4RTOA 3LUCA 3EYWA 3WMXA 2G0AA 3ELUA 1EE9A 2NSJA 4UEWA 3IEIA 2EJUA 5FUBA 1SURA 3IB3A 4RPIA 4CI0B 1HDOA 3LOPA 1RFLA 4NRDA 3FFAA 3ZN2A 3CS3A 2XE6A 3KQTA 4KR6A 3HZHA 3I83A 2PKWA 3L04A 3C8DA 4JR0A 4UMDA 5E9JA 3RKRA 3V48A 5AW8A 2R6ZA 3QLEA 5LPNA 4ZEXA 3ZQJA 2KBFA 1P45A 2PV7A 4AJEA 3B7PA 4LC9A 4WL0A 2JAPA 2GBCA 2QRMA 1GPUA 1IATA 1T6ZA 2UVPB 1Q3HA 1SEVA 1MC8A 3PJGA 1C80A 1R4ZA 1FUEA 1TZJA 2ZJYA 5C7OO 3USES 4AF6A 2X1MA 4AMZA 3I73A 1MJGA 1FFEA 4DTIA 2O8NA 2GRUA 3ND7A 1OFUX 2WIGA 4LF4B 4D4LA 5T64A 2X6QA 4UVEA 1C9YA 3RIHA 3KB1A 4KXYA 1W36C 3C3BA 1N2JA 4Y6RA 1QVWA 3ORRA 4MWSA 3RG2A 3FWPA 3FXAA 4LCJA 2QUJA 1ZD9A 3EF3A 2AMLA 2WD8A 5C34B 1RYDA 1C30A 2GPAA 3RU9A 1UANA 3WB2A 3NGLA 1SG9A 2FPXA 1TK9A 2IHVA 1ZYUA 3GT4A 2W5UA 5IDYA 2EQBA 2Q21A 2DX7A 4O2RA 1CF9A 1V9CA 3KZNA 4I81A 3T9BA 3TB6A 3LH5A 2DPMA 1MC1A 2HGSA 3Q8XB 1HMPA 2J0UA 3B5IA 2QENA 3HRKA 4MUIA 4DHWA 4MS3A 4ZKEA 5EIWA 1WXQA 3I9OA 1FU7A 4FFBB 3TCXB 3ZGNA 1SHJA 3ABSB 3REQB 1I5OA 2WJZB 1WLSA 4NBTA 1G3IA 1E92A 2PRYA 1ZD8A 2AFIE 1AK2A 2NX2A 2PWAA 4MO2A 4YP7A 3JCZA 4A26A 1DPGA 1NQ5A 2XBLA 3GQBA 1J0DA 5I01A 1IJEA 3Q7IA 2CFOA 1D5WA 1E7WA 4B3JA 3JQAB 1S5PA 4NU0A 4ZAFA 1SVLA 3KQLA 1DDIA 2O9JA 2I5PO 3QNWA 2D74A 4G5FA 2WFLB 1U5AA 1JFFA 2WVHA 3LS2A 1OKKD 3I04M 1ZU4A 2NTYC 1UBMS 2ZIWB 3KD2A 4XVQA 1QO7A 3VZQA 3PG5A 3LT5A 4UM9B 1DCTA 3BD9A 4NWIA 3FTFA 1L5WA 3F78A 5DJ5A 1RM5A 4QFMA 5ER6A 5KYWA 1U2EA 1SGWA 1XD2A 1Z4PX 3LV8A 3UAXA 5MN6A 2B83A 2YWHA 4EBBA 3O0DA 3H5LA 1JEQB 3IQFA 4GZMA 2QD4A 2PSHA 3OCZA 4RY2A 2BKXA 1PN3A 2BDUA 1MZPA 3EGXB 4YV2A 2FEWB 3FWZA 1XIVA 3IO5A 3TX2A 2GD0A 3IH5A 3BEOA 2GETA 3DDWA 4TXHA 3WXMA 2C3OA 3CCCA 5TPWA 2AJCA 4CMGA 3QMMA 1NV8A 3KSUA 4CXMA 2AHOA 4NQZA 5LZ7A 1MX9A 4M1MA 4PG8A 2B34A 1M0EA 3GJZA 3JS5A 1MHPA 3LT1A 1Q22A 1SZPA 3P9CA 2XQKA 1PWHA 4FE4A 1BG6A 3EEIA 2FPIA 3OZWA 2AR0A 3GJ0A 3A2LA 2NN3C 5FJIA 3V1KA 3A26A 1OBCA 3E8SA 2J85A 3Q15C 1G8GA 3D8TA 3M3PA 3LLVA 4KN9S 2WE7A 2D7JA 1QH9A 2NT3A 2R6GA 3A1NA 4NZZA 3V3KA 1PFVA 5CXUA 2AOVA 5L7YA 1XVVA 1I0LA 1NLUA 5KS2A 2OO5A 5CXSA 4AX4A 1OROA 3R4CA 2Q3FA 2ZUUA 4WVFA 4KQCA 5EJGA 4AF8A 3I5YA 4LWPA 3U3KA 4P38A 3IUJA 2WU1A 2ZSFA 3OFND 3RVNA 3SZMA 2Y1GA 5ICSA 4QGHA 2EFYA 5MFPA 2PZ8A 1DJOA 4MEBA 3ADCA 3QU4A 3VUEA 4DIEA 3IV9A 5A4KA 3I42A 3ZG6A 4UARA 1RXIA 3AJAA 1KK0A 5EHXA 5F98A 5EUQB 5JE8A 1DRWA 1R0CA 2OG2A 3B8EA 4N8SA 1L4MA 3KELA 1B42A 4ENPA 5A5VA 3TOCA 5CA0F 3OOJA 4BEVA 3K9WA 1YOBA 4PLFA 4RF2A 1C7EA 2Z3ZA 1JFTA 1BX3A 3STYA 1SIBE 3P0JA 1Y8QA 3V33A 1T0IA 3HO6A 3KEFA 2KBEA 1PVDA 1E1LA 2Y93A 1WTCA 3CEHA 4GWKA 4I14A 1BDIA 1KHHA 3LL4A 1IAVA 5FORA 1UH5A 1JEQA 2G40A 4JT9A 4WD3A 2GA9A 2P6MA 4I7EA 5B3JA 2KLBA 1R5BA 2ONZA 3E6AA 2LZ0A 2VCHA 4AUNA 5IJWA 1L7DA 1EUQA 3NUQA 5A3SA 1PRYA 5TJHA 1T3GA 4WHMA 2Z6VA 1QU2A 3SR3A 2X4DA 2Z43A 2J45A 3EISA 3R0QA 1T0HB 4X6YA 2GXAA 4W7IA 1RXWA 5AHRA 3F7OA 5M7EA 1QH8A 3RSFA 4CM7A 1YL6A 3VPGA 3GB9A 3H86A 1L7BA 1JVSA 1DBSA 1NOIA 1OX4B 1QIKA 4HKTA 4N40A 1ZXLA 4I1YA 4NTZA 4YJ3A 5ELLA 3Q3CA 1OILA 5IC4A 3CF6R 4RJIA 2AZDA 2QX6A 3FFXA 3KLMX 5LZ4A 1IBMB 1S1MA 3PK0A 4BB6A 1NIPA 1SG0A 4UBIA 3VKGA 1JB1A 3L7OA 1W1IA 1SN7A 1YGPA 2XA1A 2P91A 3FD8A 3SVLA 5CVTA 2VP9A 3LUDA 5B5SA 4PAWA 3C6YA 3EA4A 3NEYA 3D6TB 3EVZA 5HWSA 3VNBA 1ZMOA 4UW9A 4G67A 3PVZA 5EQJB 4RHYA 5K5EA 3GFTA 4V0RA 3HV2A 1LLQA 4GR9A 5DGTA 1FDWA 3C15C 1AKRA 5MN4A 4Z53A 4P34A 4HQRA 9ATCA 1J2TA 2H65A 3E2PA 2OCDA 3MAJA 1QV6A 3GJ5A 4IV8A 4X3PA 5JPDA 2ID8A 2ZZKA 4YALA 1F14A 1LVGA 1QZZA 4FFLA 3NEJA 3K9CA 3NXSA 2OGSA 2C94A 5ALTA 3VYVA 1NKVA 3K1AA 2XBUA 3UJ6A 3UNXA 5IAKA 8ABPA 2DBVO 1OI3A 2V0NA 4PX3A 3WRWA 3L8GA 3NAQA 4QU9A 2CDNA 1ZJYA 2EF1A 1IMJA 1RU3A 4M8NE 1CUIA 1QV7A 5JR3A 5KOIA 5B4VA 2R2AA 1T9BA 1QHFA 3QKUA 4LDRA 3U7QA 1N1EA 4RFSB 5HYVA 1DAIA 4DV6B 4FYPA 1UXIA 3PC4A 4ZT4A 5JSKA 1C1XB 1PL8A 3UUGA 3U31A 1Z6XA 3S5JA 4MRPA 3VKUA 3TMYA 4BAZA 10MHA 3KALA 3UKOA 5ILQA 3ZWNA 4Y6GB 4GXTA 2HEGA 4QATA 4E5NA 3T3EA 1RAHA 2JFBA 3F6CA 1FVHA 1K06A 4F86A 1DAOA 1LBIA 2BELA 1D2HA 1K75A 3LZ6A 4XGNA 4XGKA 1NFFA 1FU8A 1A96A 4QE3A 1QOPB 4X84A 4OXKA 4X9XA 2J3DA 2PBZA 1I4OA 4RZIA 4Y2TA 1JEYA 2TMYA 4IF4A 4MQMA 4UUOA 2YHIA 2HHCA 3N6VA 4NIMA 3X2SA 2CD9A 4LCBA 1V41E 3ZD7A 2DWUA 2P67A 3OX2A 1OWMA 2B1QA 2UDPA 2ZK7A 4RIEA 5HMLA 3ZCTA 5HGXA 5JXJA 4ZN6A 1PR1A 2CCJA 3P71T 4V3BA 2DKOA 1ARZA 4H15A 1EVEA 3K1TA 5TR9A 1JHOA 2QRQA 3B3JA 3EW9A 4P3YA 2ADMA 3SSOA 3T3PB 1SCQA 4CM9D 5ECYA 2O5RA 3H5NA 1PQPA 1C3EA 2C99A 2ZT7A 3MXTA 4MYUA 1YRBA 3U5ZB 2NZ8A 4D3YA 5J3JA 4UNNA 4HZIA 5COAA 4OUDB 5IYZB 3W5IA 1RBMA 3NHAA 4CODB 3CVJA 4Q9JA 3QI7A 5CLQA 3V8QA 1Y7HA 4KFTA 1CXZA 2WM3A 4C9BA 3PWSA 5EKUA 1ZL2A 2Q3LA 3DMRA 4ZJPA 4GF5A 1O0SA 1BW9B 1ZHHA 4TWAA 4D42A 3QP9A 3KQKA 3ZH9B 4JDUA 4GE3A 3MCUA 1GVNB </