1X86B

Crystal structure of the dh/ph domains of leukemia-associated rhogef in complex with rhoa
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
180
structure length
180
Chain Sequence
AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/membrane protein
molecule keywords Rho guanine nucleotide exchange factor 12
publication title Structural determinants of RhoA binding and nucleotide exchange in leukemia-associated Rho guanine-nucleotide exchange factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 180
sequence length 180
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2004-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1x86B00
1TF2A 4DDWA 5K8TA 1E2HA 1QF9A 1KK3A 4TYQA 3FFAA 2WTUA 2XOKA 4L9WA 1G3UA 1Z6GA 2V7QA 1S3GA 5JWOA 1JXOA 1LVGA 4K8OA 1E9AA 1OXTA 1Z08A 2FU5C 4R9UC 4S35A 5BW8A 2ZREA 1E0SA 2HDNB 4LGMA 4PPQA 2OHFA 2VH5R 4PHTA 1OW3B 1ZUIA 2D7CA 4LJAA 4DLVA 2WMOB 1H8HD 5K8IA 2PLFA 1VCOA 1QBKC 2ZYUX 2Z4SA 3GD7A 5FL3A 3TR0A 2D2FA 2YZ2A 4C0HA 4AKGA 3A6PC 1SXJB 2J7PD 2KBEA 2GESA 2GEUA 2GCOA 2OBMA 3OEEA 4M1SA 3MJHA 3ZZ0A 4BZQA 3DM9B 4EPVA 1XX6A 2QRZA 1J8YF 5ELXA 4TYYA 1P73A 3I61A 1SXJA 1WMSA 4LJ6A 3TAHA 5FR2A 1X6VA 2J0QA 3QVVA 3P4YA 4DCVA 1KJZA 3R7WB 1EG7A 1O3YA 3EIHA 3IQWA 3W9YA 4EQ6A 3R7WA 3QG1A 4L8GA 2AXNA 4A6PA 4O25A 2C98A 2GDJA 2PBRA 4WXPA 4LHYA 1TQ6A 1ZC3A 2REXB 2UKDA 2YC4C 3WYFA 4NP6A 4NYIR 4YMWA 2QPOA 1Q1QA 2IYTA 4IEEA 3KJGA 4TLDA 1W49A 3PCRB 4AYTA 3EPLA 4IXNA 5FOXA 1W4RA 1ANKA 2R65A 1FUUA 5JSZA 2V3CC 3LLUA 4L9SA 1HQYE 1YJ5A 4EUNA 1G5TA 3CO5A 2G9NA 4OI4A 3ZQJA 1LTQA 1IHUA 2ORVA 2GEDA 3FYHA 1KO8A 2NOAA 4A0RA 4DDVA 5KO2A 3QXJA 5AJXA 3K0AB 5FFMA 1OFUX 4B3BA 2R6GA 1DARA 1QG4A 4MYHA 1N6IA 5A4JA 1YVDA 2RGBA 5F3WB 1XPRA 4LYJA 3RANA 3SZRA 4TN1A 2OBLA 1GWNA 2I1QA 3GLFB 1DAMA 3BFKA 4NZYA 3RRMA 1N6HA 4M9XA 3CWZA 4C2TA 4FN5A 4N0EA 1CP2A 4LV5B 3GLFA 1K5GA 3U7FB 1JECA 2P65A 4Q4AB 3X1XA 1DAIA 1N2CE 3F8TA 2V1XA 4PPNA 1MKYA 1UKZA 3CRRA 4Q7JB 1DAFA 4HB4A 4Q4AA 2WBLC 3IHLA 3NHBA 4KU4A 4OBEA 3VNUA 3A4NA 1ZBDA 2ERYA 3CX7A 1W36B 1TMKA 3PJRA 4D82A 1OHHA 5GJVC 3AQ4A 3HYRA 5TARA 2BVNA 4DHEA 5CJPA 1GG2A 2JLRA 1XD2B 5SZJA 3U44B 4RSGA 4FMCB 2F9MA 5CM8B 2JDID 1OPXA 3LY5A 4D4LA 3B6EA 1XD2A 2IHBA 3U44A 4M1WA 4S2EA 1EFRD 2B8TA 1XWIA 3FHCB 3QF7A 1CBUA 5EE0A 621PA 1A82A 1DG3A 4QOSA 3WBKA 1BMFD 2FPKA 3FMFA 1KJWA 4A2WA 4QM7A 1PLJA 2JJ2D 2J45A 4FWIB 4L5BA 4JIMA 4NDZA 2G83A 1T6NA 1GKIA 4B44A 5F9FA 2VSFA 1NVVR 4A15A 1FZQA 2ATVA 4HAVA 1AS0A 4PO8A 4A6XA 3ND8A 2BC9A 4IHQA 1E99A 2A7QA 3MLEA 3A1UA 2QN6A 4KFTA 2CMKA 5CYOA 5G3YA 3EC1A 5FBVB 1L8QA 2EVWX 5K8LA 1FTNA 2CDNA 2HCJB 4AC9A 1NP6A 1X3SA 4MYTA 4B3DA 2XZLA 4PFSA 4PSAA 5EXPA 3LXXA 4HB2A 2ZJZA 2ODWA 4E03A 4FI3C 1XCGB 3LAWA 121PA 2IYYA 3BB4A 4MRSA 3PIRA 2Q21A 3BRWD 3D3QA 4JVSB 4D4JA 4QJ3A 3GLIE 5P21A 3OE7D 4LJ7A 5EP2A 1T0JB 1TUIA 4QHYA 2QY9A 4N3NA 1SHKA 3SOPA 5HKKD 3AVXA 2XNSA 1KI3A 3R20A 4I81A 3NG1A 4CIDA 2GHIA 1U0JA 4B2IA 5JEEA 4I1SA 5IK2A 2B92A 1AIPA 5KYKA 3W6PA 3BWDD 5DHAA 4RD3A 4EPWA 4OHWA 1FNMA 2F55A 1IQPA 4KSCA 1EWRA 2RB4A 5DISB 5C4MA 3PG5A 3ZD6A 4BWYA 3QBTA 1ZMXA 3VAAA 5B64A 3FDIA 4DEYA 1UKEA 3VX3A 5DO9A 4YLGA 3BAFA 4C7OB 1QVRA 1G5PA 3JVVA 1M2OB 3CNOA 5K8UA 5FL7D 1Z3IX 3TIFA 4NBSA 3C16C 4A2PA 4EFMA 3SFZA 4D2IA 2CNWA 2W83A 4C7OA 4NCJA 3RAPR 2FPMA 4LK2A 3LX5A 1E96A 3SN6A 2N1BA 4A2QA 1IJEA 1R5NA 1K5DA 5JMTA 4KITB 1XD8A 1WDTA 3VFDA 2J0UB 4LJ8A 1E0JA 1GUAA 4X8LA 3WHLA 4XIGS 1KAOA 1S3SA 3A58B 3EA0A 3PV0A 5FI1B 3U60B 2J0UA 4G01B 5D3QA 3MWJA 1KYIA 2OCPA 3NBYC 2YOHA 1MOZA 2C99A 1FTSA 1U0LA 2W6IA 1VCNA 3AVWA 4LDJA 1KDPA 3RYTC 3FMPB 1DAGA 2ORWA 2HUPA 4OJKA 1H8EA 2B7BA 2OILA 5FTJA 4O3MA 2CHGA 3VHXA 4GMDA 3UK6A 1TADA 3B1WA 4A0FA 1IONA 4P4TA 3PFIA 3GPLA 3KFXA 4RD2A 3X1WA 2B7CA 1KY3A 4HZUA 1Q1EA 4KFRA 5TVKA 3EA5A 3EX7C 4OI0A 1I4TD 3NDPA 3AF0A 4JT4A 4US1R 4Z51A 1AA9A 3O8DA 2JGNA 1DADA 4HLUA 3GLIA 1HEIA 3N2IA 4HEJA 2O5VA 2ZRCA 4EPYA 2GZAA 3SJCA 4LHZA 1W5SA 2JASA 3BORA 4II7A 1KSHA 1VMAA 2QMEA 2QM8A 4A82A 3ADDA 3JVUA 3NXSA 1SXJC 5KUTA 1ZYUA 3WRXC 2AX4A 2H57A 1SVMA 1KAGA 1XNJA 2NO6A 2F1IA 4PPGA 2D7DA 3K0FB 2ZRNA 3LBIA 1X1SA 2ZXUA 3AV0B 3VMFA 3RRNA 4Q48A 2PEZA 3K0FA 1U98A 4OK3A 4JLAA 4UNNA 3GLGE 3UMFA 3QEOA 5L3SB 4B75A 5E95A 2OZEA 5EP4A 2FPLA 4KV9A 5JRZA 1XTSA 4KO8A 5E7MA 3W8NA 4Z8XA 4A4DA 4AYXA 2O8FB 3NWJA 1RVDA 5L3SA 4B3GA 1QHHA 1GM5A 4QM6A 1H8HA 3EG5A 4QC2A 3U3MA 5E4FA 5D3MB 3MSXA 5DE3A 2FEMA 1HYQA 2O8FA 3BC1A 1N5KA 1B0UA 5C2JB 2VPPA 4K46A 2XB2A 3EWSA 4NTZA 2WKRA 5H1YA 2GNOA 4O0MA 1RYHA 1OH7A 5EXXA 2PJZA 4ACBA 2FDCA 1T8TA 2IW3A 4IXMA 4OL0A 3LBHA 4XJXA 3ETLA 1K8RA 4CRWB 2Z4RA 5UKDA 2HLDA 4TLEA 2UZIR 3JZAA 2CCGA 2C78A 3PVSA 3WBJA 2ZE5A 3ZIAA 2W2XA 1SZPA 3KFVA 3EPKA 2W6JA 1XP8A 3MWYW 3C8UA 2P6NA 3EPHA 1EGAA 3NTUA 2IX3A 2CL6X 1OB2A 3WMFA 2MMCA 2ZUCA 1AKEA 4BFWA 2ZE6A 4TYNA 1ZNZA 2BOVA 2MSEB 1GIAA 1HURA 5GJWC 4DT1B 1RIFA 4Q18A 3Q9LA 1E3MA 5DLQC 1YU9A 4B6EA 5EP3A 3LVQE 3WNCA 4DT1A 3W34A 2F7SA 2IUTA 4ERNA 3UKDA 4TTQA 2JJ8A 4RZ2A 1JR6A 4Q02A 1GRNA 4M8NE 3VR6A 1C9KA 2ZJBA 4GZMA 1KO4A 4LBZA 1AZTA 2ANBA 2BBTA 3O8BA 6Q21A 1S0UA 4Y0VA 4XWAA 2KE5A 2RGEA 3I32A 2ZR7A 3QG5A 4OK6A 4ESVA 5JBQA 1W36C 1RJ9B 3OZXA 1GZSA 2HJVA 1KZGB 4RD0A 1PZNA 5HZKA 4CW7A 4PANA 5JS8A 2KJQA 3FKQA 4BLRA 1RJ9A 2CHVA 3PUWA 1QHIA 2D2EA 4FIDA 3GLGB 2G6BA 4B73A 4O2RA 5EE1A 5TY0A 3FPAA 2FA9A 1VDZA 1E98A 3GLGA 1FOEB 3CIOA 3V00A 3B1XA 2EFGA 3CM0A 1NSTA 2CLCX 2FNAA 2LCFA 2XAUA 4ZI3A 2ZVPX 4DLWA 2LKDA 3VNVA 3HDTA 3QKRB 5LB2A 3W3AA 4TTPA 1JPNA 4Y0AA 2EWVA 2PX3A 2WKQA 3QKRA 3BBPA 3AKCA 2BMDA 3TGPA 3UPUA 4DLXA 5L3VA 1AKYA 4UXJA 4U02A 1P2SA 2PJRA 1T9HA 2RMKA 1LY1A 2OEPA 4NH0A 2HT1A 5TV2A 2JDIA 3VKGA 3AVUA 2QTVB 3KZ1E 2ECKA 1SQ5A 4GDFA 1TPZA 1SVKA 2GJAA 2IYQA 1G8YA 1TNDA 2R8RA 3BIFA 1NRJB 3NH6A 4NKRA 2C5LA 4HDQB 4U00A 3QXCA 5KSPA 2BIFA 1US8B 2RGCA 2KI5A 4TLCA 4Q1BA 2BM1A 3OAAD 2JJ2A 3X1ZA 4M9ZA 1Q3TA 1US8A 4XTCS 3AB3A 3PEYA 1ESNA 4D26A 4TYPA 1KK2A 3SHWA 3UG7A 2ZRHA 4B76A 5JZVA 4HATA 4B48A 1E9BA 1Z47A 3AKEA 2ZI5A 3A1TA 4QHSA 2BMJA 2WSMA 3SNHA 3T5DA 2D4HA 2VHJA 1KDRA 1G9XA 1HE8B 2YOGA 3VKWA 4LY6A 2IS1A 4QFMA 3ZZUA 4BRUA 1XJ0A 4TZ6A 1OKKA 5B30A 2BKUA 4YXWD 2YV5A 2RAPA 3WYAA 2CE2X 3KJIA 4DB4A 4CGZA 1FQJA 2ZRJA 3BD9A 1LS6A 3ASYA 1DAEA 3QF4B 3AVYA 3IDQA 1DO0A 2RGAA 5EZ5A 5H68A 2HV8A 3FGNA 1NVUQ 4XOIA 5CLQA 4F38A 4OHYA 4OK5A 2ZPTX 1M34E 2PCJA 1QHXA 4PPFA 2FG5A 4HYYA 2UVQA 5HKKA 2ZTSA 1S9DA 5SZKB 5G41A 2JCSA 4TT3A 3L8ZA 1E69A 1MO6A 4DVGA 3K0EA 4J0QA 3T1OA 1TTTA 5IF9A 4NYMQ 3FFBA 1YE8A 1IM2A 4DSUA 3AUXA 4HAXA 3RSLA 3ECCA 3SJZA 1N0UA 3AH8A 3MRSA 2WWXA 4LC1A 4LWZA 4MDEA 4MITA 3MG9A 3GCGA 4IOMA 4A1FA 5GJBA 4CYMA 2GKSA 2Q9CA 3AGPA 4Q9LA 1IN6A 3VR5A 1HQCA 5J4LA 3P1JA 3OEHD 4L15A 4UNPA 4WZBE 3BERA 4H1UA 2YINC 4QHTA 4LHXA 5FL7A 1BO6A 1M74A 4GOKA 3TVTA 2FGJA 4UXHA 3TBKA 3IBGA 3K70D 1P6XA 3QVUA 4TMXA 4QJ5A 1UBGA 4FMDF 5TDHA 4Z1MD 1MRSA 1BKDR 3B1ZA 3VU9B 2H1LA 1OH6A 2QAGA 4DC9A 1KI1A 5DYGA 3D31A 2DWQA 1U8YA 2QTFA 3RWMB 1N6LA 2VP5A 3VU9A 4C2UA 4HLUC 5CITA 2CVFA 2ZRLA 4Q1CA 3F5FA 1N3BA 1Z5ZA 3KJEA 3OIWA 5CIQA 4B74A 1Z8FA 1VYVA 1II0A 1ZD8A 2O8BB 3CPHA 3IIJA 2GAAA 3MD0A 1W2GA 4NONA 4NCKA 4V02A 3TVDA 1M7GA 1XZQA 3JZMA 3L0IB 2ZS8A 2O8BA 4M21A 4LUCA 4DKXA 3NIBA 1KSJA 3QQ5A 4KLZA 4MQBA 3A8TA 4RFVA 1IBRA 2FN4A 1SVOA 4FWTA 2ZSAA 3LFUA 3H86A 4Q66C 2OESA 4B71A 2QZ4A 4WW0A 1LW7A 2ODBA 4MUAA 2XITA 2V9PA 5AJWA 2QA5A 2GXQA 3KKMA 5JEDA 5JCPA 1CR2A 4RKFA 2F3RA 2VHQA 3CRVA 1W2HA 1AM4D 3T35A 3VQTA 3EZFA 2VF8A 1MABB 4CT4B 2GVDC 2YWFA 1KI8A 4NPHA 5CB8A 2YYZA 3QENA 4ACAA 4HDOB 3KX2A 3U5ZB 3BFVA 4GFDA 1MABA 3QXXA 1U94A 4OKSA 1PJRA 3LV8A 5AUNB 3U61B 1KK1A 4E09A 1EESA 3T12A 1U8ZA 5L3QB 4NYMR 4F93B 3LBNA 5FPKA 3L2OB 4Q9IA 4F4IA 3B7GA 5H70A 4GBMA 4ZO4A 4PR0A 2IXEA 4JS0A 1P2UA 4DCSA 4AKEA 4F4CA 4URXR 1G20E 3VTKA 3MJRA 3AF3A 1Q21A 3G5UA 1NBMD 4DDTA 5FPYA 1VPLA 1Z6YA 3OFND 5KSOA 4A0HA 2CL0X 5DH9A 3SI7A 3DHWC 1OE0A 4KYIB 2V55B 4LJ4A 3R9WA 1CR0A 3L8YA 5DN6D 4OQLA 5LB4A 3NVAA 4OQMA 3REFA 4C3ZA 1VIYA 1W5TA 1G16A 1S1MA 4L16A 3ZJYA 3DKPA 3E70C 1NF3A 1TQDA 3BB3A 1VYUA 1Y63A 2VBCA 2QSZA 1GKUB 4DUGA 3HP1A 4BPBA 1JJVA 4D0NA 1SULA 2F1RA 5B58C 3I4LA 1E2FA 3QXHA 1A4RA 3EC2A 5FI0B 4OJQA 2WWIA 1JBKA 2ZI4A 3RS4A 3ND9A 1KI7A 2JA1A 4PHFA 2CL7X 2PX0A 4LI0A 4OHXA 3RABA 2OAP1 3O8RA 3P4XA 4QXAA 1N6PA 4GOXA 4CEJA 1GTVA 1W4AA 1L4UA 4M1TA 2VHTA 3KQHA 4F92B 2GCOB 1OFHA 1P7CA 1XRJA 3M1IA 3P20A 3I72A 1LFDB 3EZ6A 2G1KA 2AK2A 2DFNA 2NZJA 4C0LA 3E2IA 1KI2A 1ZU5A 3PQCA 1NNEA 3L0PA 3PUYA 3SS8A 2JATA 2RH5A 2EFCB 5IDVA 4PHHA 1E2IA 4GP6A 3WXMA 2DR3A 2ZJYA 2ZJ8A 4BEBA 4JLNA 4BFXA 4EQ6B 1FW6A 2EQBA 2WWYA 3ICQB 5CDFE 5J4HA 1ZNWA 2WSSD 2C04A 4WZ6A 5TB5A 1IN7A 2REBA 1BYIA 5A0FA 2ZRAA 2XZPA 1PVOA 1KMHB 4A8JB 4ILEA 1EXMA 2W0MA 4IOKA 4U5XA 1I4LD 3WNBA 2R6AA 2WWFA 4XWKA 4XVQA 1ZIPA 1ELOA 1KMHA 2NO9A 1UDWA 1FX0B 4A8JA 1MR3F 5JSZB 3UMRA 3BGWA 3ICEA 1VCIA 2CVHA 1D2NA 2OUKA 1FX0A 2D3WA 2CHQA 2AXPA 1ZU4A 4URVR 4C9BA 1E1RD 5J47A 4TMWA 4TMTA 1KY2A 1M7HA 3KUCA 4BEJA 1W47A 3B9QA 1E79D 3PXGA 4LJ5A 4ZDIA 2VHCA 2IF2A 2N42A 1COWD 3EARA 1E2GA 1E9EA 4I1OA 2Z83A 1R5BA 2BM0A 4LYFA 1E2KA 4OQFA 2GA8A 1UBEA 5EP1A 2OO7A 1MO3A 1WBDA 4RVCA 2E87A 2YWEA 3OIYA 3ZDQA 5F98A 3AVOA 5ANRB 1ODFA 2BKEA 2J46A 2YWHA 1GAJA 3RDPA 1J2JA 1E2EA 5CB6A 2ATXA 1AZSC 4POAA 4V0ME 5LBIA 1XTIA 4GI7A 5FUWA 1MO5A 5BQ5A 4ZKDA 2QEQA 4D6PA 2AD5A 3F0TA 4PSVA 1T5LA 4M4SA 3TUIC 2Q3MA 3VR1A 3ZZTA 2ASEA 5G3ZA 2DWOA 2V54A 3NBXX 3RVBA 2P0EA 3I8XA 4MGIR 1QG2A 2VP9A 1W44A 1T5IA 3NBZC 4RCYA 1QHGA 4DSNA 4M1KA 2C03A 1NLFA 3AVQA 1NL3A 1WB9A 1GL7A 2W2TA 4XD7A 5JECA 5FBQB 4DXAA 3U6BA 1G21E 1YZGA 1FP7A 4Q7KA 4FCTA 4WA7A 3CF6R 3ZD7A 5JJIA 3EIQA 4YXWA 4GZLA 1DTSA 4URWR 5HE8A 3FVQA 1AN0A 4TLBA 2YWGA 2XSZD 3RRZA 1EFCA 5CLLA 1N5LA 3CF2A 1NG9A 4IOLA 3EIEA 5CDFA 2OLKA 2P2LA 4R2HA 3GFPA 2ZSBA 5HZHA 3MWKA 3ZVRA 5KHOC 1B23P 3SHFA 4JL8A 2FWRA 2WJGA 2BV3A 1V5WA 2ZYTX 3QOFA 5KDLA 2ANCA 1W0JD 3CPJB 2QAGC 2F9LA 1NY6A 2BCJQ 5L3RA 3GJXC 4JBXA 1BIFA 4MUBA 2DBYA 4A92A 4AG5A 2G0TA 4WVFA 1U90A 5IRCD 3IUYA 4RJLA 3A1SA 3B85A 1NBME 3X1YA 2ZJAA 2ZROA 1RW4A 2L0XA 4DLUA 1LB1B 4P31A 2QT1A 3AP3A 2BBWA 2P3SA 4UXIA 3D6TB 1RYFA 2C77A 2ERXA 3DM5A 3HU3A 5GJCA 3TSZA 4QG7A 1G19A 1R0XA 2HYDA 1NSFA 2YOFA 4Q4JB 3SYLA 2OCBA 2CBZA 4QGGA 1E4YA 3QBVA 3I5XA 1R0WA 1P62B 2QPTA 4Q4JA 4TTRA 3D7MA 2J5XA 4Z8YA 5DI9A 4Z1MA 4BUJA 4UQOA 1Z2AA 2O0HA 3IIKA 4JBYA 3D8BA 4TL9A 1G8PA 2YNMA 3KXKA 1E9FA 2NGRA 4GP7A 3THOA 2XZOA 2BCGY 1A2BA 5KDOA 1KOFA 2OFXA 2A30A 3T06B 4QBIA 3Q3JB 2WJJA 1NKTA 4TSFD 1NMXA 1F2TB 1WXQA 3AKDA 1XMIA 4FXPA 1IOZA 3B82A 3PEUA 521PA 4MRRA 1G6OA 2IXFA 4M2LA 1F2TA 2QUZA 2ZJ2A 4E22A 3TUZC 1NJGA 2GJ9A 2IBMA 1E9CA 2O52A 1X8JA 1ZUNB 3HPQA 1R5OA 1YRBA 2PLRA 5F2EA 2XEXA 2WVJA 1CLUA 4B32A 1G41A 4FCVA 4JVMA 1ZIOA 2ZU0C 3TH5A 1KDOA 1EFHA 2BJWA 3ZYCA 2EFDB 3L82B 4O2LA 1UFQA 1G18A 3AP1A 3QXSA 4Q9JA 3QKTA 1LF0A 1AK2A 3V9PA 2QP9X 4YMUA 2PMKA 4UJ5A 3BJIC 2DPXA 3I92A 2I3BA 3BS4A 3H2YA 1SVWA 1DEKA 1NN1A 2ZI3A 1SVLA 2GXUA 2A9KA 4TZ0A 3THWB 1GL6A 2WPDD 2A3RA 1T3LA 3PUXA 4MH0R 5J4VA 2AKYA 1GNPA 4FMDB 4KFSA 1HH4A 1CULC 2IHYA 3IILA 3K9GA 4URYR 3UATA 4C0QC 3THWA 2FZ4A 1UAAA 4LSGA 1OLOA 3W6OA 4PC3A 2WWHA 4PHGA 4V03A 4H1VA 4HZUB 3BXZA 3OFNA 3TQFA 3SE0A 4F4JA 1SKQA 3WMGA 4YMSA 1XPUA 1CJKC 4ZV4A 2CK3D 4PC2A 5DN6A 3QJYA 2IYXA 1MT0A 1D2MA 1FP6A 2BEKA 2Q3FA 4PQYA 2HXSA 3N5CA 4NL4H 4BE7B 4MGYR 2BJVA 2HYIC 2ZI6A 3GLIB 1N0VC 5G40A 4DB2A 4ASUD 2V1UA 1NJFA 1Y3AA 3HJNA 4DLYA 2KSQA 2MSDB 2JLZA 3W90A 4HUTA 1VECA 2FSHA 2C9OA 3W5JA 1UPTA 4IJMA 3Q5EA 4R7ZA 4W5WA 1G64A 3KL4A 4DIEA 2J0SA 1XMVA 2NQ2C 4ESHA 3Q8XB 2VL7A 5BN3A 1JXMA 4GT1A 1UJ2A 3CUEF 2REOA 4DCUA 4V0LA 1OXUA 2JEOA 1Z6XA 1OH5A 2ZI9A 5HCIA 1J99A 3CRQA 1RRFA 2XXAB 3H4MA 3T1QA 1YZKA 3UMSA 2IEYA 5FBRB 2ONKA 2GWHA 1ZJ6A 3V4RA 4IDPA 3HYTA 5BXQC 1QHHB 2IYSA 4GSYA 5CM9C 2XXAA 4HDCA 3EZ7A 2ZIAA 5DGXA 3OHMA 2J1LA 4D0GA 3KQKA 1XMJA 2R44A 2O8EA 1TEXA 4MYUA 4GL2A 4ZPXA 3AM1A 2R6CA 4PZZA 4A8JC 4C4PA 4LBVA 2ZAMA 1II8B 4C0SA 2CCJA 2OCYC 2J7PA 3CR8A 1GKYA 5CK5A 4WBSA 2PEYA 4XVUA 5EXTA 4M1YA 1II8A 2WMNB 4TYWA 4QRHA 2PH1A 1N6OA 3FE2A 1LNZA 1DPFA 1FUKA 3CBQA 3CX8A 3CRW1 5CIWA 1Z0FA 2VF7A 4IDOA 4N1AA 1L7VC 3FKSD 1YR8A 2IEZA 3TNFA 4B47A 1OXVA 2XTMA 1SVSA 5FH9A 1XF9A 2FZLA 4RCZA 5EXSA 2J0VA 2GJKA 3A36A 1KMQA 4Q21A 1WF3A 4LOAA 4TL7A 1P9RA 2DFLA 1D6JA 2GETA 2GBLA 2Q6TA 2IYZA 3ZH9B 2IS6A 2IWHA 4FW9A 1R4AA 4AKIA 2FEOA 2ZSFA 3KKNA 4AI6A 3LH5A 4OHVA 2JLWA 1E1RA 3TSOA 2QSYA 5AUPB 2VIIA 2V7QD 4V0OA 4KI0A 1E79A 1PV4A 4BASA 4GRAA 4V0NA 4URZR 5AUOB 2PZEA 1YR7A 5KTYA 1COWA 3NEYA 5FOTA 4DIDA 3Q7QA 2QU8A 4U7DA 1YR9A 3QIAA 1GILA 5FPSA 3TW8B 1KJYA 4LHVA 5FTKA 1W0KD 4HAWA 4N0DA 4BFYA 2GILA 4D81A 2N46A 2NZ8A 1EX7A 4Q47A 4HLQB 5LPNA 1KI9A 1ONBA 3OEED 2BDTA 2QPAA 4CEHB 2TMKA 3P27A 4OI2A 1XEXA 1TF5A 4IVPA 1NIPA 1QZXA 4RY2A 1F2UB 2R9VA 5EE3A 1SXJD 2C8VA 2MMGA 4TMKA 4W5JA 4CEHA 5H8WA 3SC3A 1F2UA 1Q44A 4FMBB 2P6UA 2PZGA 3PR1A 3TKLA 2NTYC 1E2QA 2VRWA 1QHYA 2J41A 1FFHA 1R10A 4JL5A 2QI9C 3NHAA 1VHTA 2DFTA 3B78A 1FMJA 3DL0A 3FMIA 3V4FA 3X2SA 1YR6A 2PMDA 4M1OA 4YMTA 4LPSA 3KQNA 2OM2A 2OLJA 3L0OA 4IEIA 1G5RA 5KPDA 4NHOA 1N0WA 2MSCB 2WWGA 2XSZA 3REGA 1VIAA 2W00A 1BOFA 3E1SA 4Q19A 3CW2A 2J3EA 3W8RA 2OXRA 1VG1A 1EFRA 4G5QA 3MMPA 4QGFA 3CNLA 4MKIA 2A5DA 4K81B 2J59A 2Z43A 1HT2E 3GLHE 4AIIA 3T1TA 3TUJC 2HEIA 1BMFA 2AR7A 2VQSA 1R0YA 4KYUA 3WRYC 4GPTA 1VKJA 4DEXA 2RHDA 2J87A 3U3JA 2WJYA 4LBYA 1CJUC 1HE1C 2OFWA 1W0JA 3TAUA 4CT5A 1F60A 3NKVA 3B9PA 3UANA 4RKEA 821PA 1JEEA 1I4DD 1UBFA 3TMKA 1ZCAA 2W2VA 4Q1DA 1XTKA 2ZRDA 4QL3A 4AD8A 2O8DB 2VLIA 3BFXA 1FL9A 1D9ZA 1P75A 3VX4A 5A5GA 2O8DA 5J4YA 4JZKA 1CR4A 1G291 2KB0A 5JJKA 4PSKA 2H7VA 1SHZA 1LV7A 3IGFA 2H18A 2WJIA 4IFEA 4IVQA 1Z22A 2I4IA 4YC7A 1Z0KA 5AR1A 4XWOA 1SKYE 1KO1A 1D9XA 2CLSA 1XXHE 3UG6A 4JVLA 1DBSA 3OE7A 2DFKB 1OHHD 2GF9A 2RGDA 4RFSB 2X77A 1JNYA 2YHSA 2OSBA 4CEIB 5EZ6B 1IXSB 2DWPA 3SFVA 1FNNA 1A1VA 1E2JA 4M0LA 4RFSA 1Q20A 5DHFA 4CEIA 3CB4A 3GP8A 5JHGB 3NH9A 1G3QA 3QEJA 4AYWA 2AFIE 3LD9A 2I1VB 4IW3B 3DMNA 1DG1G 3AUYA 3RS5A 3GJ7A 1KI6A 4MRPA 1NMYA 4ZDKA 2XTZA 3QPUA 4HB0A 4BGDA 2GEVA 4KFUA 2OXCA 2Q9BA 3K9HA 5FOUA 2AFHE 1HA3A 4CVNA 1E0AA 2ZRFA 5CYPA 3BK7A 4IDNA 1F48A 5GVRA 4RZ3A 1X86B 3AEZA 4Q4LA 2IF0A 3KXIA 3CNNA 4KBGA 3AF1A 2Y8EA 1OV4A 3DMDA 3DZDA 3EWAA 2QROA 4I1UA 1A7JA 2QGZA 3LWNA 1RE0A 3IPXA 2HCBA 1L2TA 4AURA 1R8SA 1X8KA 1RRGA 3H0KA 4MKHA 1GOTA 2QAGB 3GLHB 1ZM9A 2YC2C 1JQJC 5DI3B 3RS3A 2JLQA 1XTRA 2ZR9A 3NEJA 1W4BA 1Q1BA 5KPJA 3GLHA 1Z06A 2AN9A 1XTJA 1T4GA 2GTPA 5DI3A 4JKYA 3IEUA 1Q3HA 4RD1A 1F6BA 2WPDA 3L43A 4X8HA 5AK0A 4RD4A 1VG8A 2D74A 4EIWA 2QMHA 4HSEA 2WV9A 1TL7C 3RS7A 3TQCA 2B8WA 4FCWA 2IYRA 1XEFA 4QBGB 3CRMA 3KDSE 2G1JA 3M0EA 4FD2A 4Q03A 3DOFA 5DIFA 2H16A 1UADA 1CJVC 4LBWA 4EFLA 2FH5B 1DAKA 3KQUA 1XDBA 4JKIA 1ZNYA 1RKBA 2CK3A 3U7GA 3H84A 1X1RA 4BFZA 1P72A 5IK2D 2VP6A 5M04A 4DSOA 1XPOA 5EJEA 2V6IA 4DCNA 2PCLA 4UNRA 2QT0A 2HT6A 2G77B 4ASUA 1XBTA 4CDGA 4B3XA 2IA5A 3IQXA 4C30A 1CJTC 4D0LB 2EU8A 3PITA 1U99A 3QNUA 3SQXA 5FBWB 1W7AA 4EJSB 1CS4C 2AD1A 2IUSA 2O0KA 4V0KA 1R2QA 4BFTA 1YZQA 2GJ8A 3EPJA 4EJSA 2CNWD 1RPZA 1TQ4A 3IBYA 4P0TA 1IN4A 4P33A 1Q1ZA 3U6KA 4JT2A 4LV8B 1SXJE 2VO1A 4Q5IA 3PENA 3IIMA 4QGHA 1IN8A 1KI4A 1KKLA 2F43A 2NPFA 5CK4A 3ZGXA 2VTKA 4DDUA 1MO4A 3M6AA 1UM8A 4C0AC 1DOAA 2X19A 5B57C 2H92A 1RRCA 3KKPA 1TAGA 1DELA 2ZUDA 3GMTA 3WMEA 4CZ2A 2GBLC 2UZ3A 2EFHB 1ZAKA 4G5GA 1U8AA 1XFAA 3PEVA 4LHWA 1L4YA 4DLRA 4TMVA 2A5GA 1Z6TA 3HPRA 4XTRA 2ZAOA 5DSZA 3Q5DA 2ONJA 4EPRA 2J7KA 3FHTA 1KZ7B 1H8ED 2W58A 1CR1A 2IYLD 2WZQA 4I99A 4P4UA 2P5SA 1WP9A 3ADBA 2WHXA 4BLOA 3SEAA 1Q57A 1R8QA 1E94E 1Z0DA 4NYIQ 1OF1A 3J81k 3CF0A 2X2FA 1ZVQA 2A5FA 2FFAA 4KVGA 5AUQA 3K0SA 3FKSA 1P2TA 2C96A 3UWKA 1CF4A 5BWMA 3QPVA 4M9SA 2R6DA 1VCMA 5JFGA 4PAMA 5L8VA 5FTLA 2QTHA 3LX8A 1UBCA 2CEAA 4TWZA 5EUMA 5JWRA 4CEJB 1CRPA 3TSWA 1JR3D 2ZE8A 1M7BA 3GJ4A 5FOVA 3PUZA 1G6HA 1WBBA 1ZUHA 1E2MA 3FTQA 1QDEA 4PC7A 4EDHA 1IY0A 1OFIA 1NIJA 1T8UA 1U9IA 4JLBA 1BH2A 1YZLA 5HTKA 4R2IA 4KJZA 2QP3A 4CF7A 4PTLA 2GK7A 3B8HA 4US2R 3GLFE 4HI0E 4HB3A 2EFEB 2XNDD 4HUQB 2RKOA 4DWJA 2ZANA 3TW4A 1AQYA 2AWOA 1YKSA 1TQ2A 2ZRBA 4HUQA 1W0KA 3BB1A 3BH7A 3I1FA 4WIAA 4PQRA 721PA 3WNDA 1TU4A 3WP0A 1UEIA 2WOJA 3NBFA 1N6NA 4GMXA 4EFNA 4DZZA 1S4QA 3EAQA 3P32A 2R6FA 4LYAA 3UWOA 4EKDA 4M9QA 1E2PA 2VA8A 2HLDD 3LRPA 3RS2A 3ZIAD 4TLAA 1LS1A 1XEWX 2ZYWX 3GJ5A 4QBFA 3NDBB 4BLSA 3MUFA 2W6JD 1CRQA 4B3CA 1OYWA 3GFOA 1EK0A 1Z6AA 2ODEA 3QPWA 1PUJA 3KJHA 5FOSA 1J70A 1IY2A 4NCHA 1XCPA 3N70A 1NLZA 1JEDA 3A1WA 1ESMA 1P60A 3FHOA 4B6FA 1CEEA 2FSFA 1EWQA 2AL7A 2BHRA 2RCNA 5JI2E 2BMFA 3VHLB 4B2LA 2HXYA 1ZW6A 3ZLJA 1Z28A 1V43A 4MDFA 3IPYA 4F7WA 3TRFA 2RGNA 4B2PA 4G5SA 1P9NA 1AQUA 2QNRA 2ZEJA 3RRYA 1Z63A 4OQNA 4ITRC 4JYBA 1NVVQ 3DPUA 4JLDA 4NCIA 1NY5A 3EZ9A 2ZM5A 2C2HA 3QSYA 3OAAA 3ZVNA 3AVVA 4JLPA 4MGZR 1CU1A 2GCPA 2GZDA 3GJ8A 4B35A 1Q0UA 3A4LA 2JJ1D 3KKOA 3B60A 3RHFA 1XB2A 4HAZA 1EX6A 3TLXA 1PUIA 2IYUA 3AGQA 5J5CA 5JLJA 2IXGA 3IO5A 3K0AA 3I8SA 3BOSA 3DZ8A 4BZPA 4ARZB 2BEJA 2WM9B 2OAQ1 4Q1AA 3TK1A 4Q7MB 1IJFA 2FSGA 1P9WA 3GJ6A 2QL6A 5G53C 3DKVA 1QHSA 4ARZA 2D06A 1NI3A 1S9HA 3PUVA 1ZRHA 5FBLB 1KHTA 3ADKA 2YKGA 1DVRA 1Z29A 3ASZA 1NMZA 1ZC4A 3O47A 1W46A 4IFBA 4JLKA 1EFUA 3RWOA 1HY3A 2QM7A 4Q4HB 3WHKA 3R8CA 2FJUA 1JI0A 1JAHA 3IHWA 4JJZA 4KHZA 2W0SA 3ZS9A 2O0JA 5AJVB 2JLVA 2Q0HA 4Q4HA 2QE7D 2Z6VA 4TL6A 3S1AB 4MRVA 2IC5A 3FB4A 2PT5A 3KXLA 1AGPA 2E9SA 3I3SR 3I5YA 4AKHA 3K0CA 3W5IA 2GVZC 5KNBA 3QE0A 2NG1A 3S1AA 3U7EB 1GRRA 1D8TA 2X2EA 4BRWA 4IOJA 3B2EA 2ZR0A 1NVXQ 1KDTA 1A2KC 4XVRA 4KODA 4B34A 2Z5FA 1RFLA 4DBLC 3BH0A 1YZTA 4R71A 2KWIA 1KKMA 2GJSA 4GNKA 4Q9HA 4TMZA 3T61A 3DOEA 1S1CA 5IT5A 2JLXA 4QNRA 4BLQA 1GITA 3OF5A 3OEHA 4JLOA 4TL8A 5JWHA 5E7IA 2IWRA 2WOOA 2ZITA 3K70B 4LRWA 4LJYA 3T15A 2EYQA 2H8KA 4M22A 2G3YA 1F5NA 1J8MF 1D2EA 1WRBA 1DAHA 2X8AA 3C14C 4V0MA 3C5HA 1MH1A 4ZDJA 1OKKD 2HF8A 2B6HA 3C41J 5HCNA 2XB4A 1S96A 4PZLA 1NN0A 3P26A 3AP2A 4HZIA 1OT3A 1MV5A 3OESA 2A2ZA 4KCGA 4A36A 1X8LA 1DO2A 4EJSC 1J90A 3SJAA 1JR3E 5FTNA 2WAXA 1W1WA 2WWWA 1P5ZB 3R8FA 4W7SA 3R9XA 5KSYA 3AVTA 2WIAA 2CE7A 1KK0A 3SBDA 1M1YE 4I1VA 2ZRPA 5JI3E 4TT3D 3GQBA 3KUDA 2F6RA 4D25A 4RZUA 2VYFA 1JALA 1QVAA 2XX3A 2ZS9A 4E07A 1CXZA 3R9IA 3CH5A 3SQWA 4M53A 1GVNB 1KSGA 1U81A 4MA4A 3DDCA 4PXAA 4TQUS 1XJQA 1R7RA 3LQQA 5FUXA 1SVIA 2CXXA 4NE2A 1OYYA 1KNQA 1Z0JA 3SDZA 4BLPA 4US0R 3I73A 3A37A 2VSOA 2ZJOA 1YRAA 2EWWA 2RGGA 4EAQA 5TXGA 1JB1A 1G7RA 3GJ3A 1XZPA 1IXZA 4OQXA 5BYKA 5J40A 1TU3A 1Z2CA 4G5RA 1T3HA 3GEEA 1NBMA 3MGCA 4Q1FA 4WOPA 1CJMA 2OT3B 1J7KA 4JL6A 8OHMA 1NVWQ 3CLVA 3CPEA 2NPIA 1G1MA 1GFIA 4XSGA 3ZS8A 4D80A 5SZHB 3U2QA 4DCTA 1BYUA 1U2RA 2FMXA 2IS4A 4HAUA 4MGKR 2H17A 4UKDA 4BFUA 4YQFA 4Q9KA 1NN3A 3KTAB 1PLKA 1GNQA 2AKAB 5KNDA 1RRPA 1GDDA 1U9IC 3K1JA 1ZM4A 1S2MA 2FX3A 2QG6A 2HJGA 3KTAA 1G7CA 2ZYVX 3CH4B 2ZETA 3CONA 3LLMA 2A5YB 1G4UR 1G7TA 2NIPA 1ZM2A 2O8CB 2BBOA 1CIPA 2Z0MA 4W5HA 4H9GA 1O87A 4D4MA 2ZSEA 2JIZD 2O8CA 2PZFA 2C95A 5IHPA 4BFVA 4M1MA 2B21A 2VHUA 1AGRA 1E9RA 2FF7A 2DHRA 1HV8A 1N6KA 3O8CA 5KOYA 4ZIRB 1UDXA 2O8EB 1P4SA 5E3HA 5EUQB 3N2EA 1A5TA 2AK3A 2YVUA 2ZU6A 1JR3A 2AHOA 2HF9A 3GJ0A 3SR0A 1ZM7A 4ZIRA 2FSIA 1E2LA 1E1QD 3HU2A 4E5UA 2OCAA 1OFTA 4JSTA 3RSOA 3ZVLA 4F91B 2Q9AA 3C4JA 5LD2B 2QMOA 3ZVMA 3CX6A 3TJZA 1TX4B 1G17A 2YJTD 4I4LA 5HE9A 1KTVA 2WJVA 3WYGA 1M6NA 4ZCMA 3A4MA 4PQFA 3W3ZB 1S8FA 1OH8A 1Z0AA 2XNDA 1XJCA 4OHZA 1KIMA 1E9DA 5KSZA 3T5GA 2WSSA 4X8MA 4ZI2A 5JHHB 1G8GA 4AG6A 1Z07A 2CCKA 3CR7A 4Z54A 4DLTA 2OV2A 3HWSA 1E9SA 3EXAA 1OJLA 4LX0A 4DJTA 5D3MA 3RLFA 4B3FX 1GNRA 2GRJA 3SBEA 4JVNA 2RGNC 3MFYA 3B13B 5BYJA 1YZNA 3QY0A 4LZZA 4AY2A 4DUGD 5GADl 3RNLA 3SU8A 4A9AA 5J4KA 2P5TB 3OIVA 3PEWA 2ZI7A 2BMEA 3TR5A 1VYTA 3M4YA 1KSFX 3AVPA 3LNCA 3LVRE 2VSXA 3U7HB 2A5JA 4ZDWA 4PAOA 3MCAA 1E2NA 2XOKD 1UKYA 5JRJA 4NYJQ 3B1YA 4QJ4A 1T0HB 5FPHA 2IUUA 1Q12A 1XCMA 5C18A 4UNQA 1RC8A 2R2AA 3HR8A 3KB2A 1UKVY 1RZ3A 4JJKA 3GFTA 5KDDA 3K09A 5AJZA 4LYHA 2VP2A 3CKLA 3WY9A 1UEJA 4ABYA 1DE0A 1R6BX 3I62A 1G8FA 2DY1A 1XEXB 2V6JA 1YHNA 2BBSA 1IY1A 1ZM3A 2NO1A 3LA6A 4HLDA 4NMMA 1NLYA 4G5OA 2QMUA 2F1JA 1I2DA 2ORIA 2Q3HA 4QNMA 1FQKA 2ZVQX 3X1DA 1KO5A 3B1VA 3C7KA 4Q1EA 5C4GB 4KLNA 3EASA 2JJ1A 2E1RA 3EW9A 3B5JA 2C9YA 3K0CC 1AJEA 3W6NA 1DS6A 3LXRA 5E7JA 3U3KA 1E4VA 3FMOB 1EFTA 4KAXA 2DCUA 2H5EA 1KO7A 1E32A 1G3RA 1OIVA 1P61B 4WAUA 1T91A 2EW1A 2DYKA 2FGKA 1XMSA 1OXXK 3SJBA 1AS3A 3ZQ6A 4XSHA 5FOWA 1N5IA 3F3YA 4BZXA 4Q00A 4RZXA 4XH9B 4NU0A 1FPMA 2C9CA 1P2VA 1XTQA 2GF0A 4URUR 4FMCF 3GEIA 4KVAA 2EYUA 3BE4A 4HAYA 2RHMA 4JLJA 4BQSA 3VR4A 4UNSA 4JSYA 1P3JA 2IK8A 4JYCA 1HTWA 2QE7A 4ZCLA 2XTNA 3K70C 2QQ0A 1U0HC 2ZUBA 3SYKA 1OSNA 4B43A 3LDAA 3LQRA 1MRNA 4AWXA 5JCZA 4IRUB 4MKFA 4MYCA 1N6RA 1GRQA 3KB1A 4UJ3A 2QENA 3U3OA 2IS2A 1VG9B 4G3XA 3THXB 4PZYA 4DSTA 4WXRA 4TQAA 4NYJR 1VG0B 3TE6A 1ZNXA 4PO1A 5KNCA 3T34A 2NO0A 3HU1A 3THXA 5TMPA 2OE2A 5KU1A 1HUQA 1H65A 1JQLB 4PC1A 5DNYB 2WAYA 4DLSA 3UXMA 5FUYA 4JBWA 2JLUA 4LJ9A 2G0NA 1E6CA 1SGWA 4LPKA 3THYB 2IT1A 4KBFA 2X1VA 3CWQA 3K53A 4L4UA 4JLMA 4QGAA 2V8OA 2R62A 3THYA 1QRAA 4XD7D 4YONB 1R0ZA 4D4KA 5SZIA 5F9HA 1W36D 3K9LA 3KQLA 4Q7LA 1JJ7A 3DVLA 1KI6B 1XEWY 1M8PA 2ZQ5A 1D5CA 3C5CA 4YMVA 2J9RA 4GOJA 2FFHA 2IYVA 2DB3A 5AJYA 4TSFA 1WCV1 1GSIA 3FOZA 2FV8A 4WZAE 3C15C 3QF4A 3QUSA 1W4CA 2ZS7A 4PAQA 2NMVA 2WIBA 3MWLA 2A78A 2GK6A 2FE4A 5DYIA 3DO6A 4BLTA 3AKYA 5C46F 2QP4A 4ZCIA 3K8YA 1LF5A 3BH6A 1ZD1A 1OXSC 1XD9A 5FR1A 5BN4A 2IYWA 2IL1A 4MKGA 4NCNA 2GCNA 3NC0C 4QBHA 2FOLA 1G3MA 4LV6A 2P6RA 3G82C 3ONWA 2ZRIA 1ETUA 1GL9B 1OIXA 1UF9A 2WICA 2ZRGA 2QGNA 1I2MA 3WP1B 5BN5A 3VR2A 2JLYA 4DLZA 1OB5A 2LWIA 4X8OA 3Q72A 1YZUA 2PT7A 1WA5A 1VHLA 4PO9A 3CZPA 3KKQA 4BFSA 5FPTA 2LKCA 3QKSB 2V4ZA 5FTMA 1JPJA 1KNXA 4Q01A 1II9A 1CTQA 1Z0IA 4P3YA 3K9NA 2OBNA 4IVRA 4EPXA 2GXSA 3QKSA 4RD6A 4C0BA 1SKYB 4TQ9A 4ON9A 1WQ1R 2JLSA 1XXHB 5GVSA 5C1BA 4ZKEA 2QAJA 1E0KA 4P32A 5HPYB 5CJ2A 4YDSA 1XXHA 221PA 2K5UA 3LO5A 2VEDA 4AK9A 4B33A 1OIWA 3E5HA 3QKUA 1AS2A 1NKSA 2GXAA 5EQTA 4KSBA 4PC6A 5LD2C 1G7SA 2G88A 2ODNA 2XGJA 3T1VA 2KBFA 3Q7PA 4OYHA 4R98A 4P4SB 2ZE7A 1TEVA 2JIZA 1FMLA 2FFQA 1KGDA 2VP4A 1ZCBA 3L0SA 4MRNA 3RS0A 5LDDC 3Q85A 1WE2A 4DRZA 3DEFA 1IXRC 2F43B 4P4SA 1VTKA 4LC0A 4BECA 4JLVA 3IO3A 5B2ZA 2GAOA 2XJ9A 5AWFC 2PL3A 2QQEA 2QORA 1CKEA 1G4AE 5EE9A 1N5JA 1W48A 2P67A 4FINA 4PX9A 4IDHA 2CLDX 1ZINA 1E1QA 1Q22A 2ZSDA 4HLCA 3HR7A 3MAAC 5FUVA 2FFBA 1T3SA 1NN5A 3ADCA 1F3OA 421PA 4C0JA 4G0NA 2W6ID 3U4QB 3SYNA 1K6MA 1PLLA 5L3QA 2WJHA 1IN5A 1YQTA 3IKJA 2F1HA 2RGXA 1QHNA 1NG1A 3VKHA 3U4QA 2VP0A 3AF2A 1G3IA 1TF7A 2OG2A 1JAIA 1TUEA 3VR3A 1N25A 1ZP6A 2GZHA 2ZRMA 2ZJ5A 2BWJA 2NO7A 2D62A 4IDQA 1GP2A 2XJ4A 3G0HA 3IEVA 4IKEA 3AF4A 2SHKA 3K09C 4W9MC 4YDHB 1BS1A 3EZ2A 3NC1C 2AWNA 4EPTA 3LW7A 1XU4A 2QBYB 2JAQA 2F3TA 3U3RA 4JMPA 1G8HA 3CZQA 1IAQA 3LW8A 2ZRKA 1ZD9A 4OI1A 2QRNA 4LCBA 4C0KA 2WKPA 4G1UC 3RC3A 3H1TA 2OFOA 5JS7A 2QBYA 3GEHA 1E2DA 1Z83A 2CJWB 4KXFB 1C1YA 3A1VA 5JJLA 5HR5A 3QI2A 3UIEA 1C4OA 1HT1E 5EE5B 4A0GA 2CJWA 3RC8A 3FWYA 4QKQA 3OIUA
chains in the Genus database with same CATH superfamily
2Y0BA 2A67A 5HYVA 3MZ0A 1E2HA 5K8TA 3FFAA 4B4KA 5HP4A 1G2PA 1G3UA 1BVUA 2D2IA 1T2NA 4KKXB 3G1UA 2HA2A 5JWOA 3O9MA 1JXOA 1DHTA 4R1TA 3HCOA 1E9AA 1U4OA 5EJFA 3IOMA 1Z08A 4QRDA 2G8NA 4FDTA 1AXRA 4Z99A 5BW8A 4N5DA 2HDNB 2V96A 3MB5A 4IV5A 4Y98A 2PWBA 3LC1O 3UWMA 5LQCA 5KINB 5C51B 1I0LA 4S04A 4DA8A 3KQSA 4DLVA 3LFTA 7GPBA 3HVUA 2PLFA 2QHXA 2P4EA 4JOCA 4QDZA 3TR0A 4YREA 1UCFA 3Q8MA 1WUIS 3LT4A 4C0HA 2KBEA 2GESA 1P7ZA 3MJHA 3IVGA 1XK6A 2QRZA 1ZO8A 2Y92A 3T4PA 4I8DA 4C4ZA 1IZYA 1P73A 2ON6A 3OY7A 4DG5A 4JU9A 3DE4X 1AKMA 3WRXA 3TAHA 1P29A 1X6VA 1N7HA 1MJGA 1TZKA 4K2AA 3AEXA 5FJJA 1DAOA 1V5IA 1EG7A 1L4KA 1COZA 4ZI7B 1ZCFA 4FGKA 4UAJA 4CLHA 1EFPB 2VAXA 1YQQA 1TO1E 4A6PA 2M6SA 3KE8A 1QHEA 4ZI7A 4YJ3B 4J1QA 1C8LA 3A6KA 1ZC3A 3BMOB 5A0TA 2AC7A 2YC4C 1RE1A 1EFPA 1LPAB 5AI6A 1V5EA 1VL2A 3BUSA 3WWYA 2HK7A 1R4NB 2QPOA 2C97A 3JQCA 4YJ3A 1PU2A 2YTZA 3YASA 3BMOA 2NLOA 5I7VA 5ESDA 2XMPA 1PAUA 1LWOA 4AYTA 4PYRA 4ZCPA 1L3IA 2R86A 1R4NA 5IVKA 4W8HA 1XZHA 4GOLD 4Q15A 1ORIA 1W34A 3T7EA 1ECFA 4GYKA 3EG9B 1C8VB 1DFIA 3DMFA 4P35A 3GNTA 2EJVA 5B5SA 2ZWIA 4RIHA 4P2GA 3PGA1 1GTJ1 3WZLA 4EUNA 1H4TA 1QKJA 3MOIA 4K28A 4LQDA 4IGEA 3K5IA 3OHPA 4OI4A 3QK7A 4WKOA 5HF6A 2G9NA 3DE7X 4LSWA 4CV0A 1LTQA 1IHUA 1H1LB 2HRDA 1ARZA 2RKWA 4Y2QA 2E5FA 3L7OA 2NOAA 3F6CA 3FNRA 3CLTC 3VKFA 1BFDA 2ZTHA 3K0AB 3V97A 1H1LA 3Q2OA 1TCAA 3SBOA 4J4BA 4PVCA 1WTCA 2R6GA 1BS2A 5JH7F 4MV3A 3RKRA 3SZRA 1XPRA 5JDCA 3LA8A 1JEOA 3E8XA 4HEA6 4O3FA 1DAMA 2O3SA 5C35A 1IQRA 4OA8A 2X3YA 2EWMA 2MCFA 5B1YA 1UXOA 4LV5B 1UBJS 4N49A 1DAIA 2BEWB 4UBJA 3BJRA 3FLAA 3TL2A 3IODA 3E81A 2MINB 3DULA 4XYBA 2AS0A 3TQSA 1MKYA 3ZTTA 4Q7JB 1DAFA 5EZ5A 3AVVA 4RIFA 2BEWA 2CXOA 3RG2A 3PTAA 1I6KA 2MINA 4QTXA 4I2NA 4D82A 1OHHA 1VP3A 3HYRA 4U4AA 3N7AA 4C7JA 4Y2TA 5BWBA 3LI2A 3UH1A 3JPWA 4WWHA 4DHEA 1GG2A 2DULA 3GRAA 5K09A 4RSGA 1A2OA 2V5AA 4FMCB 1I5RA 4X1IB 1E61A 1I01A 2JDID 1LDBA 2PKQP 1VM6A 1U0FA 4C4YA 2IHBA 4PV7A 4NPCA 3HXPA 1DJPA 1FY2A 2Q1WA 3NHPA 4X1IA 4X6XA 3ZXUB 3FHCB 1CBUA 2AOWA 3FR8A 5EIHA 4RADA 3GBVA 4ZAGA 4MQ6A 3WBKA 1D4ZA 3U44A 1NQTA 1V8BA 3I53A 4ZMSA 5KX5B 4A2WA 1EVYA 5KTNA 3L1JA 2C5EA 5BV1A 2JJ2D 2VK8A 3ZKWB 1B93A 3MJSA 5KX5A 4EM6A 1A71A 2JFYA 3G5AA 4B8YA 4JIMA 2GA9A 4JWTA 2WM3A 5IXJA 3ZKWA 2YFYA 4G9GA 4EGAA 4EW1A 1IOVA 1JA0A 2K4MA 3GDHA 5K2MA 3ZR4B 1YHYA 1G9SA 3WTBA 4AL4A 4EHHA 1QJ4A 2VR1A 4UTVA 4G0QA 2BC9A 2GUWA 2A6PA 2Y9PB 4LTDA 5GZ3A 3MLEA 2HAEA 2VUHB 1U1DA 1H0KA 1UR5A 5CGZA 1W88B 5G3YA 5T57A 5C7LO 2H2HA 3O4RA 4QUIA 4AC9A 1NP6A 4DN6A 1X3SA 2B94A 1LI5A 1LU9A 2NSLA 2P77A 4MYTA 1HYGA 4B3DA 3DL4A 2FOIA 3LXXA 4QX6A 2XHEA 3OX2A 2AOUB 2OWEA 4E03A 5AK6A 1BE6A 1SA0B 121PA 1DHRA 2IYYA 3GLIB 1TKRA 3N0TA 3PIRA 1E1DA 2D0OB 2ISSD 3R3YA 3GLIE 4QFBA 1SA0A 3PPYA 3AOEA 3FTEA 1HLDA 2QY9A 5FWDA 2Q46A 1SHKA 2FEWB 1A8SA 5HKKD 4RVNA 1O9HA 2WAOA 5ES3A 2IEBA 3AVXA 2EV9A 1QP8A 4I81A 2YBDA 4TROA 3LECA 2GHIA 4R8VA 5FLYA 3JQAD 5IFKA 4JP5A 3C6QA 1NF8A 2VZ8A 4TM8A 4N8EA 2XBLA 3W6PA 2YW9A 4N65A 5DHAA 4PCUA 4EPWA 2JD1A 3URMA 1IQPA 4HVTA 2M98A 4KSCA 3WDSA 1EWRA 2RB4A 1KPGA 4F5WA 5C4MA 3ZX5A 2ISCA 4UEJA 3ABRB 1ZMXA 2PA0A 3H5VA 4HPWA 3V1MA 3DAGA 3VAAA 1BN7A 4DEYA 1A9SA 1BFUA 2I6UA 4OSPA 4K9DA 4N6OA 3FUVA 3ZHBA 4JB3A 1PG2A 1QVRA 3STWA 2Y4NA 5K4HA 1KXZA 3CNOA 2Y6UA 4LTMA 1HNNA 1R9JA 4ND2A 5FL7D 3TM5A 1KR5A 3OMLA 4F9EA 3BYZA 1PSDA 3RAPR 2J3DA 4DYHA 3T1YB 2QIPA 3M6UA 4TTVA 1A9XB 4ZOBA 5J1TB 3WNVA 3ZLBA 4DMLA 1O8BA 4BP9A 2GK3A 3Q9SA 1IJEA 4Q37A 1ZD5A 2UYGA 5JMTA 1A9XA 4CQMB 1XD8A 3SYTA 4E2WA 4KPEC 4Q1VA 5P8WA 3K72B 1V2HE 2D0IA 1YHZA 2QYOA 2J0UB 2V6BA 2WTXA 3MGGA 3K6KA 3S1LA 1KWKA 5ENDA 1E8MA 4CQMA 4G23A 4F7WA 2IKSA 1I36A 1EDDA 1P1IA 4NCAA 3EA0A 5EIAA 2XI4A 2J0UA 2W71A 5D3QA 3ME5A 3MWJA 1DSSG 2XGMA 4NMLA 1P0CA 1DZIA 1JF8A 1MOZA 2W6IA 1U0LA 4FT2A 4MNTA 1T2AA 1VCNA 3OZGA 5BMVF 3RYTC 3AL0C 1W73A 1XZGA 5CT4A 3FMPB 1W5EA 2ORWA 4GQBA 5M7EA 1KC1A 3RUFA 4AB1A 3GX1A 1CJSA 1H2WA 4UAGA 2O8NA 3KDPA 2F17A 2CB0A 1TADA 1ZRSA 3B1WA 4Z4QA 1IONA 4P4TA 4RD2A 3K4HA 1KY3A 2AMYA 1ZESA 4HZUA 1XZMA 4JJGA 4KFRA 5KQPA 4Z9YA 3EA5A 1WUTA 5IYZF 3EB9A 3ODGA 4G0PA 3ZJTA 1VSTA 5JVDF 2FRDC 5LFAA 3OZSA 3RSHA 4ZAWA 1FTGA 2MYPA 3VPDA 3ELDA 1SRQA 4JT4A 4US1R 4RV4A 3O8DA 1UAGA 3UWPA 2JGNA 4PYIA 5BW5A 1PFKA 2DPGA 5IJWA 2A0XA 1X92A 3MMZA 1K88A 4TV8B 4YASA 1UANA 4LHZA 4A82A 2C92A 2FN9A 3R2JA 1D2HA 2QMEA 4QUDA 4XIIA 4EGSA 2ZJ0A 4OVKA 5A5EA 3F73A 2DECA 4YRFA 4D3YA 5KUTA 2UVPB 4TV8A 3OVMA 2P79A 2F8MA 3T9FA 4F71A 2LW7A 2O23A 1MPTA 2DUJA 1XNJA 2VUSA 3FCCA 2F1IA 4GKBA 5HQ3B 4TPKA 2ZRNA 3VYVA 1X1SA 4FZRA 5CVTA 2UVPA 3EIWA 3D43A 1SHTX 3RRNA 3VMFA 3UXYA 4Q48A 4COOA 5F52A 3KLOA 5FHRA 2Q7XA 2PEZA 4CIWA 1U98A 4OK3A 5T3UA 1MCZA 1FX1A 3GLGE 3OMWA 4OP1A 2X9QA 2OZEA 4KV9A 1QWOA 4L27A 1DC4A 1XTSA 2QNIA 5EYPB 3W8NA 1MC1A 2F90A 1DO8A 1KY5A 3C6MA 3GBSA 3GPIA 1U4NA 1QUFA 3JQ7B 3KQPA 1RVDA 3NWJA 1SAYA 3R4CA 5JLAA 1ISPA 5EYPA 4IZHA 2ZB8A 4I55B 2UXCB 5EINA 2X76A 3JQ7A 1HYQA 4FFVA 3SE7A 1N5KA 4ARUA 3ZQ4A 3OU6A 4L4XA 5C2JB 3SS7X 4I55A 2VT3A 2I2FA 3IKLA 4QU0A 1K3UB 3WB1A 1F8GA 3WZMA 4DOMA 4O0MA 3HCCA 3HCNA 2PUGA 2C2MA 5KREA 3PNPA 2IW3A 2GVNA 4IHJB 2I7XA 5DK6A 2IIVA 4BWGA 1K8RA 3WOVA 2VCHA 4IIHA 2UZIR 3G85A 2C78A 4KQIA 3WBJA 4ZT4A 4Z86A 7YASA 1ENZA 2R96A 2R6ZA 3G8DA 5TC4A 3NHZA 4B4WA 1NJ5A 3OC0A 3AEUB 1MT3A 2FEAA 2CUTA 5EEGA 2CL6X 4TRRA 4FKZA 3G0BA 3M1YA 3AEUA 3O7WA 1WX1A 2B9VA 2ZE6A 5AJUA 4BFWA 4B9EA 1NBWB 1ZNZA 2MSEB 5JYDA 3WLLA 1PBNA 2A3NA 1NE2A 2H54A 2YJ5A 1GPWB 1M2EA 2B2CA 4WLFA 4MAFA 1FDIA 5DLQC 3ONDA 1QB8A 1YU9A 1YO6A 3SR4A 2VDPB 4C4OA 3WB2A 3DB1A 4F3KA 5B55A 3WNCA 4KMRA 3W34A 3NRBA 1ZCJA 3LSYA 3P2IA 2Q3DA 4INOA 1ZN2A 4BRZA 1JR6A 4BNNA 1GRNA 1Q77A 3D1JA 1I3OA 2PWZA 4M8NE 2VTVA 4GZMA 3T7AA 2I99A 3GU3A 4A6EA 1XVAA 3FOAA 2KE5A 4HAOA 1X14A 3WOHA 2C2KA 3M34A 5DW3A 4QQ8A 3A70A 2AF3C 2IHUA 2P35A 1GYRA 3KOOA 2VQ6A 3V8MA 1TJPB 3UKJA 1PRYA 4IBOA 5DWQA 5KWJA 4L57A 1XF1A 4RD0A 3NWOA 3WL6A 3RB8A 3ND7A 2TMDA 4D96A 3FKQA 4BLRA 3K5PA 3F90A 3DEZA 4H16A 4FS8A 2D2EA 3N8GA 4UHKA 3TW8A 4O2RA 4XRGA 3LIIA 2FXVA 5FUBA 1Q7CA 3NTRA 3CXUA 4R9SA 4Y67A 3FPAA 5TY0A 3UJNA 1ZXLA 4U3JB 2FA9A 1WCXA 2VAVA 3P52A 1E98A 2CFOA 4UTPA 4G0VA 4L02A 1NUTA 3DE2X 3ZLTA 1IZ0A 2HCTA 4LRYA 4JEIA 3V32A 1NSTA 2CLCX 2LCFA 4U3JA 5D1NA 3S99A 3A6JA 3MS7A 4GRIA 3A25A 5IULC 3ROPA 3SKXA 3VNVA 1RD4A 1KR2A 1L4LA 2E6KA 3R3UA 4BV8A 1RRVA 1KP9A 3L8CA 4D9IA 1K63A 3VZSA 1C3JA 1Y6RA 5DKFA 2WKQA 1X9IA 4UCFA 1YQWA 3V1YA 2DRIA 2VT2A 4Y9RA 1XWWA 5L3VA 4D42A 2PJRA 1ZFNA 1ATZA 3OOHA 1LY1A 1I0ZA 1NX9A 3P2KA 2CZGA 2HK8A 2CFIA 3MCZA 4JN6B 2Z6AA 4FU0A 4HPXB 3ICPA 3KZ1E 5J5AA 5CCEA 2EC5A 3JYOA 2Q4DA 4N8DA 1GD1O 1OFUA 3WFZA 5BXYA 1U2PA 3DKKA 2QI9F 2AJBA 2PM8A 4KUGA 3VPSA 1YS9A 3PR3A 1BMDA 4F6LA 1FJXA 4GS5A 2OPBA 2C5LA 3ENWA 5KTOA 3QFSA 5CVVA 1RWQA 4RPCA 1Z7BA 3KQYA 3RVJA 5E0KB 3UJ3X 3JCZA 3A0RB 4YAFA 4MTLA 2Z3VA 4ZEMA 1Q3TA 4AX4A 3BXPA 1U8FO 3TZCA 4XTCS 2VRCA 1ESNA 1KMIY 5JH7B 5FWXB 1KK2A 1MORA 1RWOA 3LP8A 3UG7A 5JZVA 4HATA 1RR6A 5DULA 5EPUA 1E9BA 1FSZA 5JH7A 3VDNB 5BNTA 2CEKA 1FRZA 1GJRA 2JFOA 5FWXA 4EMTA 2ZI5A 5BPHA 2O2HA 1YXMA 1JB9A 2G70A 1HNXB 1G9XA 4Y2YA 4GI1A 1GARA 2KLHA 2LR0A 1BHSA 1XJ0A 2HIHA 1JR4A 4K87A 4BRUA 2BKUA 2EL9A 4ZU6X 4YXWD 5FNVF 2C0PA 1E3TA 4KVZA 2B25A 4CGZA 1S2DA 2F3SA 2X13A 1UZNA 3BD9A 1UMCB 3ZE2B 1LPMA 4UCQA 3UT5B 1MD9A 3MGBA 4MXDA 3QF4B 3W2IA 4Q4CA 2RGAA 3BE6A 4ZJYA 2ZSKA 5HHTA 3PC7A 1IU9A 3QLVC 1UMCA 2C9BA 2DKNA 3ENVA 1D4AA 3UT5A 4XOIA 3AW8A 1PO7A 4Q34A 4C6RA 2IV3A 4ND3A 4PPFA 1B0PA 2EKZA 3GLQA 2FG5A 4IDGA 3SLKA 3T5TA 4YRNA 1BE1A 2KM1A 3FNFA 1PWXA 1V16B 3D5EA 3HB5X 5EIBD 3RC7A 1V8ZA 1MP0A 4D8UA 1C7FA 3EQ6A 5D01A 3B51X 2BMVA 3K0EA 1GSOA 5I7AA 3T1OA 3ZN2A 1L7QA 1V16A 2XF2A 3AETB 1YE8A 3AUXA 5FAXA 2WE8A 3SJZA 4D9NA 3TL3A 3UAXA 1L5NA 1P8AA 2WWXA 2EKDA 4LWZA 2AFRA 1ZN7A 2I6SA 2K7ZA 3GCGA 1QQAA 2Q9CA 5AKZA 3VR5A 2BGUA 1SG6A 1SXGA 1LSJA 1YJCA 3P1JA 3E7FA 3T7KA 1F7VA 1D0SA 4H1UA 4QHTA 2YJ4A 3L05A 3R0ZA 5TPZA 1PR2A 3FG9A 4YCMA 4X66B 4RXMA 3UHFA 4FLFA 2K2QB 2FGJA 5BV2P 5LDHA 3C3DA 4MW9A 4QJ5A 4Z1MD 4L22A 1DB3A 1BKDR 1MRSA 2YJNA 2H1LA 5CA1F 2GR9A 1Q0SA 2DWQA 3FH0A 5EPEA 4LCJA 5DNWA 4ZYWA 4NOLA 1U8YA 1VL0A 4KYTA 3L1UA 1N6LA 3HLKA 3B89A 2LNDA 3IC5A 3K30A 3F5FA 4OB6A 1R15A 3DTVB 4Q1CA 4QULA 1Z5ZA 3OIWA 4FFLA 4XGKA 3LQ4A 4YJHA 4HNVA 3M3DA 1VYVA 1IMOA 3PQ7A 4G86A 4O33A 4UFOA 2IUYA 2V74B 3IIJA 4HDKB 4X63A 2GKOA 1W2GA 3DTVA 1CP3A 4PZCA 4NCKA 1DKMA 3OPVA 3TVDA 1FBNA 4O4HF 1GQOA 1EKXA 1PEYA 4HDKA 3UOGA 4D4LA 4M21A 1B26A 1V37A 4DKXA 4A0QA 1KSJA 4KLZA 4PRLA 1WPRA 1I6WA 3E9CA 4HCJA 1FSSA 2VNSA 4HGRA 3SWWA 4LZJA 1SVOA 2ZSAA 3H86A 4M38A 4B71A 1V25A 3STTA 2HJ9A 1TCCA 1AKNA 3UAYA 1KGSA 4B6PA 1EQUA 5KI6A 1E6KA 2J07A 4NRDA 1FQWA 3OQIB 3KK0A 4RKFA 1Z4PX 2F3RA 2VHQA 3CRVA 5JD6A 2OCKA 2I8AA 3VQTA 4EY4A 5CFMA 3Q3EA 3OQIA 4NPHA 3QENA 3QYFA 4P08A 4RVUA 4HNQA 4JR2A 1GY8A 2H1OA 4GFDA 3W5VA 2A57A 3R6WA 2EEPA 2A8YA 3DZFA 4E09A 3G5MA 1DBRA 2B36A 5B64A 4Q9IA 5ICSA 3DTTA 3U3DA 5KYUB 3EQ9A 4DCSA 3LY7A 4F4CA 4QICA 4URXR 1IDN1 3I4CA 4LKRA 4AULA 4B6SA 1Q21A 3L7NA 4BLUA 4HWSA 2AFVA 3PS9A 3QV2A 3IR6A 3LYAA 2IS2A 3VC3A 5KSOA 2XNCA 4WZBB 4A0HA 2CL0X 1EBBA 3D8HA 4LJ4A 4KYIB 2CYAA 1L4GA 4P1ZA 3TEJA 5BMVB 3SBXA 1BJKA 1YCFA 5HMLA 2B3DA 4UMFA 4WZBA 4QGSA 3HL4A 1ZK3A 2E7ZA 3MTBA 3VPAA 3WI7A 5BMVA 1GDTA 2CKDA 4QDTA 4ZICA 2HJRA 2RGWA 2SBTA 1TQDA 4AAYA 2YCLA 4V3BA 1I7QB 3KQNA 1MAUA 4MDYA 2WSBA 1Z6ZA 2QSZA 4CV2A 4LF9B 1GKUB 2H2IA 3LVFO 1LZLA 2VUUA 5COAA 4J3NA 3DZIA 5IYZB 4DUGA 2IH4A 5AVUA 4BPBA 1T5SA 3VU0A 4D0NA 4G1EB 3RVPA 4B3MB 5JVDB 3MUOA 2QXTA 1H93A 4J75A 1A4RA 4MPRA 5IYZA 5M29A 5FI0B 3EZGA 1TAQA 5D3ZA 3HV0A 3HXOA 5JVDA 1KI7A 2OZVA 2XB9A 3OQ6A 4LMBA 2CL7X 4LI0A 4R84A 5TF0A 3RABA 5C8XA 2G5TA 2QU7A 1GZVA 2OAP1 3G89A 2GH1A 4EENA 3ZW9A 4C0SA 4MGHA 4I50F 2J5QA 1TGVA 3DNMA 2VDLB 16PKA 2QJOA 3KC2A 4GOXA 4HDAA 1L4UA 1ODSA 2DVMA 3SCZA 4JUIA 4HFNA 3T3MB 2FZGA 1QGYA 2GCOB 1P7CA 4NFHA 1LFDB 3K94A 2DF8A 2BGKA 1PT5A 2CLFB 1VLMA 3A4IA 3KHTA 1OT5A 3TGWA 1N36B 2W4MA 3HVKA 4KN5A 2BKXA 2HIAA 2AMJA 2P2GA 1KI2A 3AO0B 2MYNA 4OQPA 1ZU5A 2BT4A 3PQCA 4RM3A 5MGBA 4HNHA 1TKCA 3CKYA 2PLAA 3QMMA 5DOVA 3V3TA 4BVLA 4E5DA 2DR3A 4JAVC 4CR6A 3M6VA 4BFXA 4WK0B 5AHOA 4RX1A 2A7XA 2WFAA 4FP9A 5REQB 5CDFE 3IAM1 3K4QA 2WSSD 3PX7A 3IUSA 1PFUA 4Q3AA 2B8NA 1IN7A 3LZDA 2REBA 4R8LA 5REQA 2WKWA 3VZPA 3FUXA 1X1QA 4AX8A 2Q7OE 6ABPA 5DBOA 1KMHB 1EXMA 4EVQA 3P0HA 5SYMA 1J0AA 3CBGA 3RVOA 1IB0A 4Y1GA 1MW9X 1V39A 4QAQA 1KMHA 2NO9A 3AUUA 4B8ZA 1RTKA 3ITKA 3GRFA 3BTOA 1UFKA 3ICEA 1VCIA 3IPCA 1W9HA 4G6ZA 1D2NA 3RVLA 3C7CB 5MDHA 4LXIA 4HWOA 5GV8A 3GGOA 4GECA 2ZIFA 1B8NA 1E1RD 2XYPA 1P45A 4EEZA 5A4IS 3KUCA 1QGAA 5JD4A 2JKVA 1JSRA 2VZ0A 3WBFA 4E5MA 2XWBF 4LJ5A 3UCEA 5HW0A 1ACLA 3H05A 3CF4A 4P36A 4ZDIA 2ZBQA 1PT7A 2N42A 2JGAA 2OENG 3A6LA 5H3HA 4HYQA 3BULA 2PG3A 4OQFA 1PP4A 1WUYA 4PLHA 3MGKA 2GA8A 2GO1A 4FGUA 1W2WB 2J9YB 4BNKA 3IR5A 2AJCA 2DY0A 3DFIA 4U9HS 2EZ9A 2YWEA 1HDCA 2GBIA 2XQKA 1SKMA 5F98A 4EL0A 2BKEA 2B2NA 2YWHA 2ZIGA 3PQ2A 3RDPA 4P7BA 1E2EA 3A1NA 2HGSA 5AVKA 3WBBA 4YRLA 1D6MA 1H6DA 1LDGA 1T3ZA 1H3NA 2WUFA 2XCOA 1XRRA 5JXHA 3F0TA 2FR8C 1MA0A 4BWFB 4GW3A 3ZZTA 1IMJA 4UUMA 5FTWA 4BEVA 2MU1A 2MSKA 2ZLBA 2DOKA 2I55A 4X85A 1KHHA 3D7RA 2P0EA 3KAQA 3RQSA 3L9XA 1QG2A 5E6UB 1JIXA 1IM8A 2ALJA 1QX3A 4LDZA 3KIPA 4LKOA 3NBZC 4RCYA 5E8RA 1QHGA 1L9XA 4KTTE 4DMRA 5K4GA 4B2YA 3DOOA 4ZPJA 4YN3A 2C03A 1NLFA 1KQNA 4WMLA 4WACA 1GL7A 2H63A 4XD7A 2HY7A 5HDQA 1MC5A 1FLNA 4IS2A 1SCIA 3OCUA 3CCFA 3I5AA 4DXAA 1NYTA 1Q16A 2Q5HA 2Z3WA 3EIQA 4Z5XA 5CDTA 1VKOA 4GZLA 3HVRA 1L5HB 4NAUA 1Y3CE 4OHOA 1KVUA 3FVQA 3NTVA 3KPVA 3H8WA 4LOIA 4LY9A 4NOMA 5KOJB 1J5XA 1BJTA 4RMHA 3OTQA 4MV1A 3I39X 3CF2A 3QLJA 1L5HA 2Y67A 3JD1A 1NG9A 1PX0A 4QPPA 4R2HA 4L5JA 3UC9A 3VPGA 5KOJA 2ZSBA 2Q3LA 2AZDA 2R4UA 3HBFA 3VH3A 5HZHA 1YS6A 1B23P 1PJTA 4PE5B 2ILVA 2HO5A 4CCSA 4JB2A 5I4BA 3ZD8A 2BV3A 1V5WA 3LDUA 3L6RA 3GH1A 1W0JD 1W8IA 2PGOA 2I80A 5L3RA 4PU0A 4G5YA 4B46A 1BIFA 4QG3A 3C6BA 3CCCA 4V2IA 1RAEA 3GOHA 4DIKA 3FYUB 2OQVA 3CGGA 3IUYA 2RAUA 2ZIXB 4CJXA 3KV1A 1PTJA 1DRVA 3LDHA 1P1RA 2AEEA 1IXKA 2PZMA 2ZROA 4LMPA 3WB0A 4CODB 5A03A 4L51A 3IVXA 1NUHA 3FYUA 1ENYA 2HNKA 3R0QA 2QT1A 5B7GA 2ZIXA 2P3SA 2ZDGA 3BHIA 3IH5A 1Y6ZA 3TZHA 1MG5A 1P77A 1RYFA 4NJOA 2C77A 2CNBA 5GJCA 2A1TR 1M2GA 4GBED 3V55A 4RJ2A 1R0XA 1WB6A 1NSFA 4NG4A 3SYLA 1PD0A 3E7DA 2O7QA 4H3VA 3FIJA 4KQEA 2Q4TA 2X23A 2CBZA 4QGGA 1R50A 1E4YA 2QXYA 4UATA 4ZXFA 4UZFA 3F9CA 2C20A 3I9JA 3QBEA 2Q45A 1P62B 1JFRA 4FFMA 5D5PA 3D7MA 1NM5A 2J5XA 5FNVB 2X5JO 3NJ8A 2PV7A 1Z4IA 3D6VA 4UQOA 4X7BA 3RBVA 3WIUA 4J7XA 4AUNA 1VRWA 2R00C 3D8BA 1CUCA 4JELA 1VLLA 5FNVA 4QLBA 3BE8A 2CHEA 4BC0A 1T9DA 4RACA 1Y34E 4GP7A 3AXTA 4N7RA 2CW5A 2JH9A 2E85A 1LPBB 2E6UX 3TLKA 4AN0A 2BCGY 4EY8A 4UOEA 1X7HA 5KDOA 4ZAVA 4FGJA 3E6AA 3K2EA 3N2KB 1YQ9A 1KPIA 4LECA 1WXGA 3Q3JB 4R9VA 1TDJA 5KWIA 1NKTA 4IDFA 4TSFD 5JAUA 4MW7A 5TT1A 3N2KA 4NENB 3OFVA 3PEUA 1V3VA 4BUZA 4Q4JB 1TA0A 3KZVA 3O0DA 4DQUA 2IXFA 2ZJ2A 4CKBB 4NENA 1GPLA 5IT9A 2O52A 1X8JA 1YRBA 3ECSA 4B32A 4YUVA 1CLUA 4PW0A 5LQSA 4RPLA 4FCVA 4CKBA 2WUEA 1JNXX 4OSEA 4XM2A 1UM9B 2BJWA 2HSWA 2HHHB 1DIRA 2W11A 3CN7A 4EOGA 3EGVA 1ZSYA 3QXSA 4CG0A 4FB4A 2H9AA 3ABIA 4JBGA 4R3WA 1BGXT 1PX2A 2PMKA 1UM9A 1NZJA 5D87A 5FLEX 3WKCA 1XAGA 2DPXA 1Z5NA 2I3BA 3BS4A 3DOCA 5H80A 3I1YA 2XDYA 4KPGA 3GARA 2UZ1B 3IRUA 1NN1A 5JMPA 2DXIA 5I7RA 4JSRA 4FNOA 2QR5A 4HGQA 4BFLA 4RPIA 2WPDD 2L2QA 1PV2A 3HP7A 4MH0R 2IXAA 4MR8B 1ECLA 5J4VA 2AKYA 2AN4A 4TS4A 3NYWA 1OFGA 1N75A 3LF2A 3RRJA 5CA1B 1V9LA 5IBCA 1M2JA 3FDFA 3AUFA 3DCIA 3U17A 4MR8A 3V4ZA 4AJIA 1OLOA 3W6OA 4Y2RA 4RAOA 4PC3A 3PQDA 1SJ9A 5CA1A 4DLTA 3OM9A 1MOPA 4ICIA 4I7EA 4V03A 1OBOA 3OFNA 2G1UA 2IODA 3MXTA 2BW0A 3H11B 4EQZA 1AQ6A 3DMPA 3WMGA 2IP2A 1CJKC 4RL4A 1TUBB 3WIEA 3EMVA 5PNTA 1M0SA 2LDBA 2NU7B 1MT0A 2EARA 5ETJA 2BEKA 4IQ8A 2XYVA 3DO8A 2VK4A 3E7PA 4ER3A 1XZAA 4O4HB 1TUBA 3BAZA 2W6MA 2NU7A 1SWVA 1NJFA 3EVCA 3HJNA 2J08A 3LQKA 4O0LA 3PU6A 2JGIA 1TD9A 4O4HA 3SVTA 3RUHA 4NBWA 3UHAA 5BN3B 5ERXA 1HR0B 3W5JA 2EP7A 4IJMA 1TA9A 2Z9DA 3W4JA 2VCEA 4R7ZA 1WAMA 1FLAA 1LQTA 3GG2A 3KL4A 3NWBA 1B4DA 2NQ2C 2DX7A 3D4PA 5EIWA 2Q28A 2VL7A 5BN3A 1XN1A 1OLXB 2I62A 3OOJA 4KJXA 4AJJA 4R2MA 4V0LA 2X9LA 2VI5A 3FSGA 2JEOA 3GLRA 3H5IA 4UTRA 1IEVA 3L8MA 4JI5B 2A5LA 1OLXA 4QU5A 5HCIA 4DQVA 4I5FA 2JS7A 1MJFA 1YZKA 3D2CA 1IYZA 3NHKA 5B37A 2W2QA 2QG4A 4HZGA 4MJLA 4PZUA 5DX1A 2GWHA 2JI4A 2TS1A 3D6NB 1V8PA 4IDPA 3HYTA 4JITA 3Q3GE 2QSJA 3IURA 5CM9C 3UYLA 3EZ7A 4HNGA 1I80A 3OHMA 2J1LA 4K9MA 4NV3A 5CBPB 1XMJA 2VPWA 3ETJA 4F4UA 4ZGBA 3HFRA 3L7BA 2O8EA 5E9WA 4GX0A 4OPMA 2C7OA 3D81A 1KQ3A 4LBVA 3H42B 3M2PA 3JSXA 4N7JA 4NULA 3SMQA 5CBPA 1II8B 5JMWA 4NAHA 1I8TA 1M1NA 2CCJA 1CFZA 2OCYC 1N2HA 3HDGA 5CK5A 4ZQEA 1SXIA 1MAWA 1QSGA 1OCEA 1II8A 2AJLI 2WHQA 4M1YA 1T43A 4WEQA 5I9MA 4AFNA 2PH1A 4CL0A 5CXUA 5BSFA 1ZISA 4RXUA 4EI7A 4LDPA 2ZYGA 1W5FA 1XKLA 3WYEA 1SCUB 1XI2A 2R1VB 1FLDA 2O4UX 5DBEX 5CXSA 2VTBB 1Z0FA 2RH8A 1ESDA 1XYVA 3RJ5A 4Y2JA 1EQAA 1SCUA 2MDTA 2BZGA 2R1VA 1J39A 2XTMA 4QT0A 2P4QA 1X38A 5JFTA 1M5RA 1HDXA 1XF9A 3KFLA 1RDFA 4DC1A 1VSBA 4EB0A 3QHQA 1KQOA 1LC3A 4F8JA 2J0VA 3EGIA 4HWRA 4MQEB 2ZIUB 4KPUB 1K0UA 3T52A 1SQSA 4ZXPA 5SY9A 2F9FA 3UW3A 4TL7A 4TKZA 3ZV3A 2GETA 4CMHA 2RGUA 1EFLA 4MQEA 4O1MA 4KPUA 3CVOA 3WGHA 2E89A 4EYOA 4OXIA 1ISSA 1O6CA 4AKIA 2NXEA 2HDOA 3SF0A 3HRHA 4QPCA 3OJWA 4Y6LA 5JS2A 3UY4A 4MKRA 1P3Y1 2V97A 3LH5A 4HX5A 5IT4A 3OLYA 3TSOA 2VIIA 4LOJA 4HYTA 2V7QD 4XJVA 4I50B 4KI0A 4HG2A 4WZZA 4BASA 1VHQA 3U13A 2FVXA 1H2XA 4URZR 3SHOA 4DG9A 3C85A 4NU8X 3NEYA 3PCTA 4FHFA 2Z08A 2DR0A 2FWAA 4I50A 3Q7QA 5AK5A 1PZFA 5JASA 1Y6GA 1OV6A 2PMWB 2YJ3A 3L0ZA 3IR7A 4AKSA 3LRXA 4LHVA 5FTKA 1W0KD 4HN2A 3ZZ1A 1M2HA 3FNGA 3AY7A 4BFYA 1N2XA 3HA2A 3DT8A 2G1AA 5COBA 4DY6A 1RJWA 3CUVA 5LPNA 3K8QA 1EX7A 4FLEA 4Q47A 1CUGA 4MTCA 5AI0A 1GPH1 5HIJA 3RO7A 2HMWA 2QPAA 1PJSA 2I3AA 2TMKA 3PDUA 1HM5A 1EUQA 3R6DA 2Z5LA 1P2GA 4MVJI 4R2XA 4YRJA 1F2UB 3UEOA 2FSVC 1O57A 4QRIA 5EE3A 1GLNA 3G0DA 4ZK6A 4ED9A 3HDHA 5BMOA 3U7RA 5FV7A 1F2UA 2CUKA 5E3IA 4JBHA 4W8OA 3S29A 2H5JA 2PZGA 3D0OA 3PR1A 3IQDB 3ZDAA 4IIXA 1DOHA 4M8LA 4TXNA 1YD7A 2AEJA 3DONA 1O8CA 1UJBA 1YI1A 1R10A 1FW8A 4KR6A 1KVTA 1C8BA 5AXAA 3NHAA 4J0JA 1HYBA 2OKCA 1Q0QA 1FMJA 1ZL0A 5CVEA 3L3BA 5T4BA 4OU4A 2C5GA 1ULAA 4M1OA 1BQ4A 1B7GO 2MHCA 3RR2A 4AJ9A 4OKNA 1OREA 2H48A 4E88A 3LBFA 5ALRA 2MSCB 3EW7A 1T13A 1JH8A 1BOFA 1WJGA 2A84A 2O6LA 3IAUA 3LQ1A 3CW2A 4Q19A 5T7BA 2OXRA 3MMPA 4I1PA 3PJGA 4MKIA 4HNSA 5DM4A 3N2ZB 3UJHA 1VXRA 5ABPA 3LSTA 1PQYA 3KT8A 1SY7A 1Q6YA 2HEIA 1CY2A 3DO5A 1K2VN 4PBSA 3WRYC 4IH9A 1I1OA 2H59A 3U3JA 2GCGA 2WJYA 1C7JA 1CJUC 1X1DA 3RVSA 3NKVA 1XNRB 1G6Q1 4RKEA 1UEXC 4MZDA 4R8RA 5I48A 3IAAA 1TAHA 2Q9UA 3IAS1 4YP1A 4H6PA 1Z45A 3TMKA 1ZCAA 2W2VA 4Q1DA 4B4VA 3W5CA 4WKBA 1GGJA 1KTIA 2CLLB 3DAPA 3LLSA 5I9IA 3S5JA 4G9EA 1FL9A 3IIEA 1DDGA 3JYHA 3P9SA 3T6KA 4YV0A 3VX4A 3A2LA 1YDWA 4UAUA 3CGWA 4WGFA 1JPUA 5DMHA 1RSZA 3QHPA 4PX3A 3Q3VA 2H7VA 3DPIA 3LKBA 3U4AA 3S2IA 1SHZA 1UFRA 3SSMA 1CDOA 1O6GA 1GADO 2ABWA 4K26A 2VYCA 4D9JA 4XWOA 3L6BA 5KOHB 2OOSA 1K97A 3HFJA 1YMVA 4F5EA 3DQPA 3E2MA 5KOHA 2WJAA 3M5WA 3G9TA 3IT2A 1DBSA 2DFKB 5K3OA 1VC2A 1LBQA 3JQAB 3WLNA 3QHAA 3IMEA 2YHSA 3BWYA 4L5YA 2DWPA 4NHEA 3SFVA 2QTAA 1PJCA 2IOFA 2WILA 4JOBA 3D4OA 1RI4A 5EE0A 5T4FA 3U81A 2E18A 2V98A 1Q20A 3QNWA 3JQAA 4FFOA 1TC1A 1VI6A 5GP1A 1NX6A 1YBMA 3FGPA 5ALNA 5I9NA 5JIBA 3GP8A 3OWHA 3L01A 2P6OA 2NYUA 1CVRA 1G3QA 1P17A 1U2TA 3QEJA 2AFIE 3LD9A 1OFVA 3RS5A 1E64A 1DG1G 1O4WA 4FYYA 3GJ7A 3R6TA 3H5AA 2GHTA 4FOSA 3QPUA 4KFUA 1HX7A 1C80A 4UDOA 2AFHE 3O03A 5K3BA 4EGFA 2HBRA 2ZRFA 3D02A 4IDNA 1GXSB 4RZ3A 1X86B 2XUPA 4BWVA 1ECJA 3COWA 2VNHA 3KXIA 5C18A 4LSMA 5K0NA 1I4OA 4I1UA 2QROA 1AK1A 1GXSA 3BXFA 4UTZA 5CCDA 3QZUA 1ESZA 3DDHA 3KNZA 3SQDA 1R8SA 3H0KA 4J7AA 1CETA 1GOTA