4S1OA

Structure of mycobacterium tuberculosis nadd in complex with nadp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
197
structure length
175
Chain Sequence
RRLGVMGGTFDPIHYGHLVAASEVADLFDLDEVVFVPSGQPVSAAEHRYLMTVIATASNPRFSVSRVDIDRGGPTYTKDTLADLHALHPDSELYFTTGADALASIMSWQGWEELFELARFVGVSRPGYDALTLVEIPALAISSTDCRQRAEQSRPLWYLMPDGVVQYVSKRRLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable nicotinate-nucleotide adenylyltransferase
publication title Structure of Mycobacterium tuberculosis protein
rcsb
source organism Mycobacterium tuberculosis
total genus 54
structure length 175
sequence length 197
chains with identical sequence B
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4s1oA00
2DR2A 1N1DA 5FO1A 5LM3A 4YBRA 2A84A 3NV7A 3SDBA 1PFVA 4J76A 4I6GA 1N2OA 3IVGA 4MUGA 3HL4A 1QU3A 4I6EA 1KQNA 4TS1A 4ZT6A 1GAXA 2H2AA 1PFYA 1MAUA 1KAQA 5DB4A 1N2BA 2A1TS 4EG7A 2Z08A 3TS1A 3FOCA 4HJRA 1JZQA 1NUPA 2PXHA 1M8PA 4MW9A 3P52A 5J58A 2X1MA 1TYAE 2PZBA 1O0CA 4MUFA 1N2HA 3AIIA 5J5AA 5F23A 2J4DA 4MW7A 5H16A 2A1TR 1EUYA 3QTBA 3FWKA 1YI8A 2QUJA 4G5FA 1NUUA 3H97A 3IMGA 2WQ6A 1Q19A 1KKUA 3FIUA 3ZXSA 3K9WA 3LCJA 2WSIA 3AG6A 3FH0A 3CR8A 4ZT2A 3RHSA 3RK1A 1EFVB 5K0TA 3ZJUA 3FG9A 1I2DA 1F7VA 3COWA 2DETA 3U1VA 3IODA 4JYZA 3CVUA 1M8FA 1IHOA 4MW5A 3FI0A 4XFJA 4BWVA 2A88A 4MULA 4PBRA 3COVA 2TS1A 4EFKA 1O6BA 3TQOA 1M1ZA 3SEQA 4R0NA 5EKDA 4J75A 1N2JA 5DEOA 4NATA 3TQIA 3FY4A 2DXIA 2J09A 4FZJA 5K0SA 1LI5A 3ZJTA 3GUZA 1OBCA 1I6KA 1VL2A 2QJTA 1M83A 1VBNA 4ZCRA 1DNPA 3CLRC 3C8ZA 1NYLA 3N9IA 4OUDA 4OJMX 2QJFA 2A1UA 1MJHA 1ILEA 2O8VA 2CT8A 4KR7A 2PIDA 2C5SA 3CLUD 3MXTA 3G59A 1T9GS 2VTBB 1EXDA 3Q4GA 2AKEA 1LI7A 2IELA 3KT3A 2GOYA 1NZJA 3PXUA 1WXHA 3PNBA 4EG6A 1H3EA 2PFSA 4XSVA 2H29A 3GLVA 3CVXA 4QBTA 4R2LA 3TZLA 1GTSA 5DASA 1J20A 4MVXA 2NSYA 2J08A 4JFAA 1D2RA 2CYCA 1F4LA 4YP6A 5IJXA 1WKBA 1HYBA 2QTNA 3H05A 1PFWA 2ZP1A 2CV2A 3IUBA 4JXZA 5HUHA 3PNYA 1MAWA 1WY5A 3ZXIA 1TYDE 1N78A 3H9CA 2O5RA 2AZXA 3G6KA 2D54A 3LE8A 4MUKA 1OWLA 3CLTC 4PBTA 3ELBA 5KWVA 1GPMA 4RUKA 4OUDB 2A1UB 1WXFA 3DLAA 1WZ2A 3CLSC 1QQTA 2QTMA 5JBNA 2DEUA 5HG0A 1KAMA 1KR2A 4KKVA 1S4MA 1T6XA 1OWPA 4NDAA 2BYTA 1K4KA 3GMIA 1EFPA 3VGJA 1EJ2A 4E1AA 1XNJA 2JAXA 3KFLA 1JZSA 4WSOA 3FHJA 2V0GA 1XNHA 2JANA 2VTBA 1ZH6A 3UY4A 2OV4A 1O96A 2X3FA 1KH1A 4DNXA 1XJQA 1A8HA 4MW0A 1OWOA 3IMCA 2I1LA 1J1ZA 3COZA 4K0RA 3MLAA 1KQPA 4GU5A 1JGTA 4PBSA 4AQ7A 2XRYA 1JMVA 4MVWA 1PFUA 1WXEA 1G8FA 4ZCQA 4MW2A 1U3CA 5IHXA 1GZUA 1RQGA 2ZUFA 4EGAA 3AFHA 5FNZA 3ND7A 4DJAA 1OWMA 4UZFA 5KCMA 3IUEA 3E27A 3TZEA 1WQ3A 4MWEA 1KH3A 2R5WA 1O95C 3P0JA 3A4IA 4ZCPA 3AKZA 2NZ2A 1TQ8A 1OBHA 4MVCA 2X0KA 1QNFA 4MUJA 3ILVA 3VRHA 2WB2A 1F7UA 3LOQA 2YWBA 4EG4A 2HGZA 4G6ZA 3UMVA 3IDFA 1BS2A 4H3SA 3OP1A 3N05A 3HZRA 3AL0C 5KHAA 4PY2A 1U3DA 1O95D 1EFPB 4EG3A 2E21A 2CYAA 4MAFA 1G8HA 1GTRA 3ZGZA 2OQ2A 1KQOA 4MWCA 2AG6A 4ZT4A 3OTWA 4DDMA 1IFXA 2GKSA 1K92A 1G59A 3I05A 1JECA 2D5BA 2WQ7A 1JEEA 2QTRA 3ND6A 1U7DA 4NAUA 3ZJVA 3CLRD 1O96B 3M5WA 4MVYA 1LW7A 1JEDA 3S3TA 1YUNA 4MUNA 4WNYA 4YP5A 1R6TA 4S1OA 3SP1A 4MQ6A 1VBMA 1J09A 1JHDA 2EJCA 1IQRA 1T9GR 3UOWA 1N2GA 4CDNA 1UFVA 4G5YA 4U7JA 2CV1A 3COYA 2PZ8A 2CV0A 3SZGA 1OWNA 1TYCA 3X1KA 3BL5A 1ZJWA 3QTTA 1JILA 1N75A 1KP2A 3H9BA 2GM3A 2XRZA 1JIKA 1O94C 3RK0A 4KR6A 5HUJA 1QJCA 1X6VA 1KORA 3D6VA 3FNRA 3JXEA 3L93A 3INNA 2QUIA 3IVCA 4F4HA 2RE8A 1IQ0A 4JZYA 3KT8A 2V0CA 1MBZA 1Q77A 4XFDA 2HMAA 4K03A 2RD2A 4F3RA 1KP3A 3IOBA 3N8HA 4P2BA 2DPLA 2E89A 1VBKA 1J70A 1N2EA 1NSYA 1QU2A 1M8KA 2A7XA 3Q12A 5AHWA 1YUMA 3Q10A 4YMIA 1OD6A 3UC5A 4MLPA 3CVVA 2PG3A 2J5BA 4DE5A 2A86A 3TNJA 4CDMA 2CFOA 4U8HA 1WXGA 1O97C 3CLTD 2ZUEA 3FETA 3D6UA 3NBKA 4MUEA 4RPIA 4ARCA 3ISJA 2CUZA 4QREA 5LFAA 3CLSD 4CQNA 1FYDA 3DO8A 3KT6A 4ZT5A 3MMXA 1MB2A 4ZT7A 1IVSA 1O97D 4MW4A 1ULHA 4UZEA 2QUKA 4EF6A 4X0EA 4HPWA 5TS2A 3X1JA 1NP7A 3SEZA 1H1TA 4MW6A 2HZ7A 4NX2A 1FFYA 1T6YA 1VLHA 3HGMA 1COZA 1IQUA 1TFUA 1JIJA 4KPUA 3ZUGA 3ZIUA 1QRUA 3K32A 4ZCSA 3IMEA 1GLNA 3ND5A 3HFJA 1B6TA 4Q16A 5DK4A 5TEVA 2E18A 4L2IA 3X1MA 4EG5A 1QTQA 4DDKA 1EUQA 1KH2A 4KR9A 2IJGX 3CA8A 1U7XA 1R6UA 4GRIA 1MOPA 1V47A 1MRZA 1WXIA 2Z3VA 2Z09A 1Q11A 2D13A 2G36A 1F9AA 3PNVA 1NUQA 2DERA 4NAHA 3RJZA 1Y42X 3P0HA 4MWDA 2CYBA 3RBAA 1YULA 1R6XA 1NI5A 1WQ4A 1ZUNA 2EL7A 1SURA 1WJGA 3FDXA 4AS1A 3A2KA 1G8GA 3SZ3A 4HK4A 1GN8A 2X1LA 3IOCA 1M8JA 1M8GA 1JIIA 4ND6A 4EG1A 1NURA 3NBAA 3QE4A 1O5TA 1P7PA 3G5AA 4MUIA 4R2MA 1H3NA 3CLUC 1IH8A 3VU8A 1TEZA 3IVXA 2QUHA 3F3MA 1XNGA 4MWBA 2DUMA 3MLBA 4EG8A 4NZPA 5TGTA 5BNZA 1I6LA 4JXXA 1PG0A 3MUEA 1PG2A 3DPIA 3H99A 4MW1A 1YIDA 2J07A 4DDHA 4KPUB 4QRDA 2QJOA 1QRTA 5J59A 2BTEA 5TEWA 1Q15A 2YY5A 1MC1A 2CSXA 4A91A 3RFFA 3A04A 2PZAA 4ND7A 4ARIA 1ZH0A 3SYTA 4L2IB 1X8XA 1N77A 3KT0A 3PRHA 3IOEA 3HMQA 1K97A 3IH5A 1H3FA 1NUTA 4ZCTA 4I6JA 2YXNA 5H7XA 3CVWA 4YP7A 5LLTA 1WOYA 3UK2A 4CT0A 1NUSA 3AG5A 2JA2A 1QRSA 1MB9A 1TYBE 1I6MA 4Q93A 3CVYA 1O94D 2B7LA 3P0IA 1IRXA 1V8FA 1EE1A 1J1UA 1EFVA 3A05A 1N2IA 2E0IA 4MUHA 4DLPA 4U63A 3L92A 5FO0A 2YWCA 3DV2A 1CT9A 1U0BB 3N2YA 1J21A 1N3LA 1T6ZA 1YIAA 1K4MA 1O0BA 2A4MA 2IP1A 2VXOA 4HJXA 2DLCX 3HV0A 4ZT3A
chains in the Genus database with same CATH superfamily
2ZWPA 1N1DA 2FMKA 1T8TA 5FO1A 3UO8B 1QO9A 3SE0A 3NV7A 2X9LA 1PJLA 1YE5A 3EGEA 3ZCTA 2PYZA 2VUSA 3I2FA 3KTAA 1DTSA 4HQ6A 4LMBA 1Y7IA 3A4LA 3D8NA 4F2WA 4DV2B 2HTFA 4BX2A 4BP3A 1OFUX 3DGEC 2HU5A 1Z29A 1ZGAA 3NOQA 4OIMA 1SIWA 1P4AA 2NXNA 3FUUA 5LYJA 5BSVA 1BYIA 3EXIA 5I6DA 1CIPA 1R0BA 4NV3A 5IJZA 1VPTA 1DJOA 4MIYA 1CE8A 3QYPA 4MW9A 1P5JA 1E18A 1HE4A 3N53A 5AVWA 4WW0A 3E82A 5BW4A 1O87A 3PE4A 2VUIB 2AWOA 1Z35A 4EUEA 4J90A 3AM4A 5GINE 5FH9A 2A1TR 1TAHA 1NBHA 2VHQA 4XWWA 2CDAA 2R4UA 3P8ZA 3FWKA 1ZLXA 5K6TA 1FTYA 1PDWA 4D3YA 3K30A 1E2IA 1NMZA 3AOEC 3H97A 4B0OA 3QYFA 1E6KA 3ZXSA 4S05A 3RREA 1S89A 2A33A 3FZEA 1BMFA 2A7QA 1H23A 1ZCFA 2C99A 4LOJA 1T3HA 1CJTC 3LX8A 2D59A 1SU4A 5K0TA 1RYHA 3L4BA 2ZE6A 4C4TA 1VE1A 3AVTA 2DMRA 4MQ5A 4QPPA 4J0CA 3IODA 5AP9A 5BPFA 1HQKA 1ZOIA 4BEVA 3NEPX 1B42A 2JD0A 1RJGA 1L6RA 2YZ7A 3NUQA 4G8DA 3HSSA 4MW5A 1PN3A 1JLHA 2W6MA 4HNUA 3PLAE 3UXYA 4KACA 2O8EB 4L57A 1JS1X 2Q6TA 1LZLA 3N7UA 3U0VA 2FP4B 5BRNA 5I7UA 2C1XA 4I9UA 3GLQA 2PSSA 2X5NA 2PGDA 1U2ZA 4F45A 2VK4A 2XZLA 1Z0JA 4IUYA 3KWJA 4PPFA 3L0IB 3ICPA 3QFSA 3ZKWA 4HNSA 4QHSA 4F3KA 3LNCA 1KHTA 1JG3A 5K0SA 4RZSA 3X1DA 3BRWA 1OBCA 3H4TA 3PGJA 2CMKA 3OX2A 4NFLA 5DFAA 4BV3A 3PJRA 4R31A 1PNRA 1KNQA 1U63A 3AVWA 1T3SA 1YIOA 1Q1QA 1NVKA 1BWPA 2GPWA 5TARA 5DCYA 3ROEA 2O8DB 2VDWB 1Y1TA 3JS5A 3PLRA 2ZCUA 3TR6A 5FFMA 2WWWA 4R6WA 2Y27A 1R4ZA 3DD5A 3FVTA 3T9CA 1I30A 4UTXA 4J0FA 2OSVA 1KO1A 4O4IF 3GJTA 2C5AA 4EQ6A 3VMMA 1GZHB 1GP2A 1XAJA 3CLUD 1DUSA 3ORYA 1NI4A 1R5OA 1Z17A 2QSYA 2IXTA 3ENZA 3QU7A 3DUFB 3O6VA 4DWWA 4FZRA 1QKIA 3MCTA 4J2HA 2G67A 3DDZX 4ASUA 3IIMA 1IMJA 3EPJA 1PK8A 1WU8A 3C1TA 3QXCA 4Y6PA 1ZRMA 1IXYA 1D4ZA 4GI7A 3U44A 3NHLA 1XT6A 5CLIA 3G0BA 3PNBA 1HEIA 5A4IS 4DRZA 3GFFA 2Z8XA 1E1NA 1QUFA 4JP2A 1ID1A 2W4QA 3A27A 4ABTA 3OH8A 4OKIA 2JAWA 3SDSA 2PH3A 2GZ3A 1JBQA 3LSTA 5HUQA 4D9GA 2QD2A 1WY7A 1MO2A 3RB8A 4BO4A 1JDNA 2V7XA 4ZU6X 4CM8B 2IQIA 4DR3B 4G5QA 2PTHA 5BW5A 4H4EA 2P9CA 4B32A 4BFZA 2BOVA 2HADA 2BGKA 4N3NA 2ZJ0A 3AYXB 1WKBA 1L1EA 1YWGO 2IEAA 1XU4A 3EXFA 3M6WA 2QTNA 3P0RA 3A7EA 2MYTA 3F90A 1DBRA 1ACJA 1QVAA 4C2BA 2Q1WA 3EVBA 1T1RA 5F1OA 3WK8A 4BJ1A 1J39A 5L95A 2PZEA 4N3CA 2Q2OA 4AROA 4UPDA 2WB2A 3AIOA 2QZ4A 2UZ1A 4LXUA 4YO7A 1KZ1A 1KU6A 4YRSA 3E61A 3ZBQA 3SN6A 3PQ5A 2O5RA 4CM3A 4I9NA 2J8ZA 3G6KA 3ICEA 1XVUA 4ZEMA 3CW9A 5IC4A 4WINA 4Z7OB 1S2NA 3OETA 2V3CC 2N1BA 3EISA 2VIIA 1DLJA 3HMKA 3ZG6A 2R8PA 1G8JA 1YNSA 2RDMA 2W2KA 3R5JA 1L5ZA 2A0KA 4XEHA 3DLAA 4UAGA 1IVYA 3B3FA 3FVWA 1VP3A 1LWNA 1KAMA 1YOVB 3G7NA 1FDOA 3OHSX 1BXGA 1A8SA 4P3OA 1KERA 1UEJA 1K4KA 2Q07A 2B98A 4MYRA 5ICFA 2D6FA 1C29B 3EDYA 4HSGA 2BONA 2RI6A 5JXGA 1KRXA 3VPBA 3R24A 2NU8B 4GYWA 3KDAA 4KXNA 4US0R 1SY7A 3HCNA 2GZ2A 4BV9A 3RT7A 1GNVA 3HKDA 2QM3A 1E2EA 1PJ2A 2CVFA 2VDQB 4RDXA 4V24A 5CB0A 1E3EA 4IILA 4ENTA 3TRDA 1HQYE 2YBDA 3TNYA 2G8LA 5KTOA 4DBLC 4LV6A 4OX9Y 3DDHA 4OF4A 4R8VA 4JUBA 2GD0A 1C3XA 4O25A 4Q01A 4RETA 5HF8A 2WIJA 4BVEA 1D4AA 2YWJA 3WLRA 1I4DD 1LBHA 5IK2D 2EFHB 3ZU4A 3TE7A 3PD7A 4QBGB 3JAMA 4XUDA 4C4AA 1ORHA 4W8HA 7REQA 5D5QA 4GI1A 4DLKA 1JGTA 2PT6A 4LHWA 1JMVA 5IW8A 1P72A 2HUPA 4G81A 1G8FA 2WEKA 2PYIA 5ALPA 4BCBA 3RROA 3C41J 2OE2A 1CUGA 5LA6F 3BB3A 3V42A 4BNLA 3AFHA 3KXIA 4YRQA 3UXMA 5AESA 5DV9A 3H0CA 4KRGA 3E27A 3BSYA 3G6WA 4WK4B 3H18A 3VZSA 4FK8A 3JARB 4IVRA 3KFVA 4BO2A 2X42A 2JCSA 3AKCA 4CDRA 4E51A 3NM4A 4E07A 1W49A 3AJ8A 3TQCA 5I4KA 2ZRJA 2IPNA 3TIFA 5EUCA 4ZKDA 1RJFA 4NU0A 5TMEA 3T7JA 2DF8A 3IDFA 5AW6A 1G0NA 2RJ3A 3CH7A 1YJ8A 1IUOA 4WCVA 1XQXA 3A4VA 4PY2A 1EWVA 4PF1A 1U3DA 3E5MA 3T0FA 4BNWA 3T9AA 4E31A 4PYOA 1URPA 2P9GA 4Q4HB 5DMXA 2R85A 3TXAA 2Q6OA 2G4VA 4OFZA 1FVOA 5IM4F 3LW7A 2AI2A 2PZFA 4DEYA 4PZEA 3TTXA 1P3Y1 2IHUA 2JFQA 2OQ2A 4GMXA 5CB6A 1XB2A 4QUBA 3DM5A 3CZPA 5DW0A 2XQJA 5JCOA 3B1WA 3G85A 1J8DA 1EDOA 3K9NA 4Z0HO 2N46A 3ZJVA 4YXWD 4MVYA 3LUKA 3BWBA 4DN6A 4TYPA 1TI7A 1T2EA 3O1HB 4R7ZA 1XMSA 1Y48E 2NU7B 1XCPA 1R10A 5AHXA 4HYYA 2IW1A 3I3OA 1VBMA 1I7PA 2OXEA 4I9HA 1RWKA 1IZZA 5KC9A 4F4JA 1TU3A 1PR2A 2ALJA 1T9GR 3KKEA 1QWSA 3EPRA 3E3OA 4JT9A 4B84A 4GSYA 3KOWA 2D2FA 1GYQA 2G72A 2PZ8A 3LF1A 4LSGA 4DQUA 2PX0A 1JH9A 3TNFA 4N01A 3GA0A 1ZJWA 1WM1A 5FV7A 2FN3A 3LGXA 5SYNA 5GVSA 1XTIA 3IYLW 2GM3A 4P8RA 3GFBA 4BFSA 1SUDA 5EEGA 2VHUA 4A03A 2CJYA 2Q1YA 1KRHA 2FDRA 4KXYA 1TQ2A 3I1JA 5D85A 3B7WA 1MU0A 3B6IA 4IICA 4BKRA 3MRTA 4TOIA 1J8FA 3LO8A 5GGXA 1FDIA 1Z0AA 1ZNYA 2YNMD 5CLGA 2OXCA 1TD9A 1DAFA 2RGCA 1FP1D 1H42A 4Z54A 4GLOA 4A8JC 4PNPA 2HOQA 4FUTA 3GGSA 4MB2A 5LQAA 1MBZA 1KBOA 2EZ9A 2ZUVA 2OL4A 3Q7IA 3VXKA 1ODJA 1XXHA 2BFPA 1JLSA 1G4UR 2F3QA 4N0DA 1XV5A 3EBPA 2R6DA 3H5TA 4XLLA 1Z8HA 3ML1A 2YOHA 4IXTA 1QOZA 4BZZA 1UJ5A 4FMBB 3C1AA 2C4NA 2O07A 3L1UA 2JCGA 3Q10A 5HE9A 4TUYB 1XTKA 3HCBA 3UPTA 4OOFA 1E4VA 1NFFA 2FI1A 3GCZA 1CQPA 3QLJA 1T8SA 4KPYA 1F8YA 4L95C 3I9OA 3ZXUB 3H5AA 2HA5A 1M2KA 3KKPA 1IU9A 4DV0B 1ZL0A 3VZPA 1PR1A 3FKQA 3HN6A 4GPD1 2HTEA 4GRAA 4P5EA 3UMYA 3MIIA 4ZQBA 1QK4A 4N76A 4CEJA 1JLKA 1IZYA 1E9BA 3GZNA 1HYHA 2X6QA 4LRQA 1ZOOA 4ZQEA 5HIMA 3BDIA 2CDCA 3SLKA 1XFAA 1QIDA 2VJMA 4GR9A 4G5XA 1FYDA 3DO8A 3ADCA 1I2AA 1N32B 3CG0A 4B6EA 4OP2A 1Y98A 1UAGA 1ZOPA 2C78A 3P2EA 1UXKA 3EK2A 2QL6A 1Q84A 2HEIA 2V4UA 3FFWA 3UH0A 2OGSA 4EYQA 4ZEVA 3KPWA 2WTNA 1H69A 3CMCO 5I7SA 4KQKA 1XC7A 4JGIA 5C53B 4MRVA 2C4UA 3NZEA 1PEDA 2JK1A 4LRXA 2K6GA 4B2PA 3VR5A 5JZBA 1BS9A 1VLHA 5E6SA 4UMEA 1EA5A 1P2SA 1EFTA 3LBYA 4JUDX 4ACAA 3MBIA 2NUAB 5I7WA 2E4XA 1VKOA 5KX5A 3I5MA 2XD9A 4K9SA 4KE8A 5FOUA 1XRSB 1N0VC 2I3ZA 2HJHA 3F5QA 3NC0C 4MJ7A 3MLEA 2OVFA 5CBPA 3BQNB 2V7TA 2RGYA 4EENA 3SQXA 3L18A 1FNSA 5BWCA 3TZCA 2IJGX 3A25A 1SZJG 2VF4X 4GS5A 2ZJ3A 3G23A 1MOPA 1Q7EA 1W0CA 4AZ0A 2W00A 2XA9A 2ZUEA 1JWLA 1W9HA 3VBCA 1FBNA 4DABA 2Z5FA 3UB4A 2ATXA 1B93A 4GMGA 1ESDA 3HYSA 3K0CA 2NACA 3TTUA 1Y89A 2D5AA 5CVTA 5GIPE 2SKDA 3OVMA 2XKJE 5THXA 3RJZA 3WMWA 4Z4CA 4LXHA 3VZDA 4MWDA 1OQAA 3LPMA 1QC5A 1R6XA 1WQ4A 5CFRA 3NHSA 1Q0PA 4W7SA 3U0BA 4CFYA 1NKTA 5ES4B 5HZKA 3GLGB 1OH6A 3LOPA 4YWJA 4HH3C 4IDPA 2PBZA 4MAMA 3UT6A 4MWTA 1GN8A 4L7QA 4RHXA 3I9V1 3PL1A 1J5XA 3G89A 1ISJA 4X5OA 3U48A 3ZHCA 2BC9A 1ENZA 4A0QA 2ZDHA 1XRLA 1B76A 3CS3A 1JLLA 3B5JA 3THOA 1PS0A 2C0QA 2OCDA 3D4LA 1K6XA 2IYOA 3FYCA 3DYVA 3RUHA 3LT0A 4CQJA 5JPDA 2EERA 4KQIA 1JSZA 1BGWA 5IF3A 1NXSA 2JEOA 3M6IA 2JFFA 4TZKA 4TXLA 4C3OB 2OCBA 3ASZA 4GGPA 2BKXA 4K5QA 4WZBA 1L5GB 2GBLA 3WGNA 1J56A 2R1VA 3T7IA 1LBEA 1MO4A 3S2UA 4JXXA 3JV7A 1KYIA 1VKNA 2FG6C 3BD9A 1PR6A 2YW2A 4EIWA 5LYYA 2V7VA 4QRDA 3ADPA 3GEPA 1QVZA 3LPAA 5JI3E 5MFPA 1O8CA 5DI3A 4WY2A 3FOEC 4HQKA 1PNOA 2YY5A 2FMHA 4IGFA 2UXDB 4BY9E 1MGPA 1R6DA 2MSEB 3N1UA 4BVGA 3DDCA 1DJLA 2B1JA 3NRBA 4UXJA 5FNVB 5JXJA 3FNHA 5CCEA 1C8BA 3GLIE 5FFFA 1JDTA 1N34B 2PJUA 2WYOA 3F71A 2Z58A 1EQ2A 3P5SA 2NU9B 2OKCA 1E0KA 4ENUA 4Q3BA 2Q8PA 3D9QX 2IEZA 4FHZA 2V6JA 4UEWA 3JZFA 1XDDA 4MZXA 2JB9A 1J2UA 2ZAGA 4HFJA 4WGGA 4X20A 4D9IA 2GHRA 2VJOA 2WMDA 4N6GA 2XW6A 4QTXA 1KY5A 4R9VA 4O4HB 3RWOA 1Q20A 1V8BA 2RGNC 3HDVA 3LC1O 2AG0A 1UP4A 3ZDYB 1L8LA 4GBGA 3LHKA 2XEDA 3UAOA 2BM0A 2BLNA 2FPSA 3L0OA 3V8MA 4EPWA 1VIVA 2VZEA 3EZNA 3PKIA 1SKAA 5KNDD 3LKBA 1EE1A 4HY3A 2OQVA 2CE2X 1Z2DA 3PJEA 1JKMA 2ZBGA 4B47A 2EXXA 3KSUA 1XU7A 1ODSA 4AX8A 2C3PA 4Z3KA 3MELA 1AN9A 1E1RA 2FUEA 1PLJA 2YWCA 3DV2A 3FAZA 3IUSA 3TE6A 4D6XA 1KYZA 5KS2A 2GK7A 1J90A 2HJVA 4D8TA 2O14A 4XXHA 1RM4A 2C9CA 1YF3A 2AN1A 1SUSA 2ET6A 1BWRA 1LK5A 1S1MA 2GTPA 2DWUA 5IBPA 5I9MA 5AVYA 1HDGO 4D4GA 2IE8A 4HDCA 1LK0A 2JPDA 2JGEA 2PLFA 1VPEA 4MDEA 3UQYS 3IVGA 4AWAA 4WD3A 2YJZA 1YQEA 4YEDA 4X61A 1CNMA 1E2KA 1PZEA 2C9DA 2Y3IA 1TCCA 3KUKA 4GE3A 4LTDA 4AJ2A 2WJYA 1M1YA 3IVRA 4O2AB 4XZ3A 4CEHB 3JQEA 1P9LA 2E82A 5K4GA 3RHTA 4W5OA 1IBRA 1W47A 3TDNA 1DEXA 2QKYA 1MT0A 4RNDB 1CUXA 5J2TA 2O2CA 1PGJA 1P5HA 2PL1A 2W2XA 3P2JA 1RWVA 2PXHA 4D9HA 4DIOA 2FN7A 3CIFA 3FHTA 3KQKA 3MRVA 4BO8A 3SZRA 5EIXA 1TYAE 1XHFA 1OW3B 3ECAA 4WXPA 4MGKR 2Y1LA 2J4DA 1YVDA 1L7AA 5C1DA 2NGRA 4IVPA 5U1PA 2ZJZA 2RBKA 1V5FA 3ZH2A 4FFBA 1NXQA 2QTVB 4L5IA 1KEZA 3CUEF 5AICA 4CM4A 5AVTA 1PHRA 3U7GA 4LF5B 2MDTA 1EGHA 2NZXA 4PFKA 5FPYA 1DARA 1XZJA 3NWPA 5K2MA 3VU3A 1S2GA 1KARA 4HVLA 4REMA 3OM0A 3MBOA 3WRWA 4PYKA 4C29A 1TE2A 1W88B 4J91A 5EJGA 2IYFA 1HDCA 2D0DA 2MSLA 1RFGE 4OM7A 4EL0A 3MXOA 3ADKA 2I91A 3KJFA 1ZD9A 3COWA 2R6GA 4LJ8A 1AKEA 1DOZA 5FTMA 3VNQA 1H9CA 1A50B 1H6BA 2HF8A 2VPPA 4HN9A 1C1YA 1UFOA 4LSZA 1FC0A 4UTZA 2C2OA 2FMIA 2XA2A 3JQGA 3AV3A 1YMUA 1RLTA 4NMHA 1U1CA 1X42A 2WILA 4GPIB 2ZR0A 5EJ8A 2UXBB 3L4SO 5D86A 2PQ0A 3HI4A 4TRRA 3PGA1 1RQXA 1J5PA 1HDEA 1NP3A 1ZW6A 3K05A 2PBRA 3OA2A 2QD1A 2ZRGA 1QQAA 5HFAA 3SX4A 4FB4A 4GDFA 2DXIA 1ZLYA 4FVTA 5FUQA 4C43A 2OC9A 4BVAA 3KTAB 2EX1A 3C85A 4DMHA 1EIWA 4YRFA 4DPKA 1EKXA 1GYRA 3B89A 4EA6A 3HYRA 3L7NA 3CW8X 1M83A 1GV1A 2DFPA 1H0RA 2ZLBA 3NM6B 3P19A 3QUAA 3N07A 2QR2A 3EXIB 4P4NA 4Q03A 4TQAA 4F4IA 4X62B 3CLRC 2F1IA 3WZ2A 5L51A 1RJ9A 3K0FB 1CE8B 1XQYA 2H31A 3OJLA 2R7MA 1U0GA 4HXEB 2PD4A 2KS6A 1ESEA 4LCBA 3PEWA 3PQCA 1TL7C 2WIBA 3IBSA 1HYQA 3WWCA 2C5SA 2IRWA 5IZCA 3HBJA 1X3LA 1RC0A 4II7A 4NYMQ 2HCFA 5C8DA 2RHMA 5TPZA 1GSIA 5H02A 5JAQA 5J43A 3F9CA 3QVTA 4CNQA 1U2QA 4I8IA 1TIKA 4Y67A 2QLFA 1O5OA 3O94A 2FXIA 1PL6A 5EIEA 3ELUA 1G5FA 2CZCA 1GHTA 4KGXA 4M8SA 1PHPA 3OD5A 1Q17A 2OCLA 5HQJA 4DXHA 1SB8A 4B3IA 2UYGA 3TXXA 1YL6A 4R2KA 2X14A 3H4IA 4FOOA 4LJAA 3R5XA 4X00A 4JI5B 4Y8VA 3RI3A 5JSHA 4YJFA 3LYAA 2RONA 3NPAA 3C4VA 4YT2A 2PDAA 3T7SA 1Y9DA 5F52A 4YGYA 5BOVA 3GOQA 4I66A 3R77A 3D7RA 1F4LA 3WZLA 3MOIA 1SKUA 3REFA 5JJCA 1L3IA 3Q6NA 1GGHA 1BEZA 2NLOA 2VPYA 4BQQA 4QJ3A 2IYRA 4KIJA 1M0EA 2PS1A 1UKBA 4ZRNA 3ZY5A 3H5RA 3W2TA 3U7IA 3KLNA 4LHEA 1FDVA 4PIMA 3BFXA 4JBWA 1PBNA 3V4PB 3D54D 3T9FA 1LLDA 3BX1A 1MAWA 1W46A 4HAYA 4RL4A 1TM4E 4OI1A 3ZKWB 4E4TA 3U1BA 4OHBA 4QLOA 5KQRA 5FKJA 3IHWA 3U3DA 4QUEA 3DZCA 3I42A 3QV2A 2D54A 3IAM6 5D1NA 1EBFA 1BROA 3D4NA 5EHIA 5CFNA 5D3ZA 2AOWA 2CLFB 3EZLA 4YCSA 5A71A 1D9ZA 5IVDA 3SICE 3LP5A 4U7PB 4KPGA 3NIFB 4KV9A 4MO2A 2P4QA 3JRXA 1UM9A 3BZUA 3MS2A 4ZJYA 2QK4A 3EGCA 3H6KA 4L74A 1L7DA 3Q5GA 2ZSHA 4B3FX 4EQ6B 4CMIA 3I5YA 1GXSA 4ACBA 2XWPA 4PGHA 1NI4B 3VSBA 2I87A 5LR6A 3WJ7A 3ZQJA 3E8MA 4P3YA 1EJ2A 1E0SA 1JDSA 1V96A 2DC1A 3W5VA 4A16A 1KVUA 1H9AA 1PJZA 2YWDA 2ZR8A 1IK6A 3U44B 1P1HA 2YN2A 4W1PA 2QRPA 3FPFA 3QELA 2AX3A 3N70A 2L82A 1GZ4A 2J87A 3R8CA 4EJ6A 1XKXA 1KMCA 1OUMA 4HRVA 1W1WA 4URUR 5FTJA 5AXAA 1EK5A 1RC1A 5ENDA 2XKBA 2C2GA 2CLEB 3DVAA 3IQGX 4IRMA 1O96A 1D0VA 4D02A 2A5GA 3H2HA 4HZIA 3ZVKA 3ABZA 1E0DA 3EGIA 3UW3A 1RABA 2CZQA 5THQA 2FW6A 3ZGLA 3EZ6A 3FSEA 5BRJA 3KZOA 1E62A 3HSKA 1PTKA 3DXYA 3EMBA 3EXFB 3GH1A 5DWDA 4EH1A 1AB5A 2V6FA 4NYMR 3FCUB 3P2KA 4YALA 3HN2A 4P32A 1JR3E 5IG2A 1J8QA 2OHVA 2HWWA 5DISB 5ESDA 2JS7A 3MWGA 4IDFA 5CRIA 4D26A 1WW2A 3D4BA 4Z9XA 1YBVA 1U04A 2UZ1B 1IG3A 3GAFA 4QX6A 2NO6A 4JIMA 2R8OA 3ZIAA 4CV0A 2IDKA 3DQZA 1WQ3A 1WUIS 3FCYA 4ZTBA 3A28A 1DEAA 1JIXA 2FSVC 1W52X 3F6YA 3V7YA 4C3UA 4K2AA 1BVUA 3A4IA 4HB3A 4H27A 2WIKA 4TN5A 3U9TA 1Z0KA 3SSMA 3WK6A 5KHLB 3HO6A 3BRSA 1NP6A 3FYUA 1XQ9A 2II6A 4PZZA 2W2KB 1ZG3A 4DMCA 2VDMB 4ZIRB 5B4TA 1ST3A 2I4NA 2EX4A 2YIDA 2IDJA 1E9VA 1T9HA 3OPXA 3ZOKA 3KXKA 5HKOA 1BXGB 2R6ZA 2ZSUA 3OSUA 3HXTA 4UUMA 5CH8A 5FI0B 2VTDA 5HGJA 4QPNA 3R7DA 1N6RA 3P4UA 4O0MA 2C2HA 1IUKA 3PUYA 2OHIA 5EC8A 1XVIA 5K8UA 2NT3A 4GYKA 1A69A 1N2CA 2BFDA 4AX4A 4OGKA 5EIOA 2C29D 3HKDB 1WZCA 2AG6A 1R4AA 4F72A 2XA1A 5KIAA 5FHQA 2DWPA 3MJSA 3TIVA 1DBVO 4QO8A 3H83A 1YA4A 3GCWA 2OXFA 1KU0A 2DY0A 2XUJA 4F7WA 3OFND 4U5QA 1MC8A 1PKXA 3ZZNA 4YMGA 4ZYYA 3L77A 4MUNA 1YNOA 3Q3IA 4LCJA 5KSWB 1WW3A 2XZDA 1JAHA 3I92A 3STUA 1CB0A 4PLTA 3VHXA 5IKMA 6ADHA 3OG9A 7REQB 1JG1A 5H3HA 2B7BA 4HGZA 3ZDFA 1GL7A 1T6NA 1UFVA 1N9ZA 2CV0A 2JFGA 3PWZA 1IY8A 4G0MA 1NBME 4BNIA 4PXYA 5B1SA 4UKDA 4KRYA 4FMDF 4TT8A 2GSWA 3A1FA 4BNXA 1H2AS 3FNIA 1RBQA 4O33A 4DA9A 2FJ0A 2JBWA 1N6LA 3AEUA 3DNFA 3UOGA 5HVNA 2P8JA 3RUDA 4WZBE 4CIYA 5DTIA 3PSAA 1OA1A 4K87A 5B1IA 3K8OE 2M32A 3OM1A 1QJCA 4RPLA 2EDAA 1X6VA 3C5EA 4DCOA 4E22A 4CHGA 1W30A 2VDPB 1EWTA 3LUGA 2QUIA 2RE8A 2ATVA 1TKCA 3BN3A 1PBTA 2JFVA 4R2XA 1SC9A 2OCXA 2VP0A 3BXZA 1HDIA 3UHAA 2FZWA 3FSRA 1FDUA 2BW0A 4NYIR 4X63A 5EE9A 1XCJA 3SHTA 1R15A 1UT5A 1IWPB 1MMFB 3FNEA 2HMAA 3O2SB 1MAVA 4FGUA 3TFWA 2NO9A 2JBAA 2XKKA 1QYCA 1V3VA 5HRAA 3TOZA 5B3KA 2QIOA 1A9QA 1C1DA 2QY9A 1OHHD 4M89A 4CMEA 5LZ9A 1Z47A 4J0QA 1AC5A 1M1XB 1GGMA 2XOEA 2Y4OA 3FI9A 4V0QA 4Q12A 2ZIAA 2P2GA 5CDSA 1YCHA 3KOZA 3PQFA 2IT1A 4OBWA 1I1OA 3KQUA 5EZSA 4DE5A 5C1PA 1U2GC 2JD1A 8LDHA 1RI2A 2W83A 4DCNA 4JLAA 1CDEA 3V80A 1WMBA 3SYNA 3EVEA 4AUMA 2QRJA 3KPYA 3ZVRA 5KNDH 3V8QA 4LWZA 4TYWA 1TVMA 1C7EA 2B4RO 4WX2B 2YS7A 4IGAA 3NHJA 4D44A 2C7GA 1H2WA 1OAOC 2HN9A 3JQ9C 5TJ9A 4HQRA 4ZT5A 1ZNQO 1J9EA 1F3LA 2FPUA 1MB2A 3TQRA 2HWYA 2GQ0A 3ETNA 1SOAA 2XCLA 3HCRA 3M89A 4QYWA 5JSKA 3ZXYA 1U28C 2D2EA 4G85A 5EUMA 2FR0A 2JIDA 3G2HA 3OEHD 2VSOA 1SCKA 5JZOA 5EXEA 3SEZA 1MN6A 4E03A 1H1TA 2DLDA 4KGVA 2G4LA 4QT0A 3AR3A 1LLCA 4UNNA 2ECFA 3LWBA 3T0IA 8GPBA 2TMGA 5AKKA 1VB3A 4KQMA 2QZ9A 2Q29A 1TFUA 4MNTA 3G0GA 4QE3A 4PRLA 4FIZA 4PC1A 5CGQB 4KO2S 3KVYA 5SYMA 5HJ2A 4IH9A 4BBAA 1TPYA 3AU9A 4QUIA 2GPSA 1KJ8A 3PIIA 4JT2A 4XB2A 5HRCA 3A9CA 4JNKA 1NKSA 1YASA 2XUAA 2WKPA 3UV6A 3KLBA 4L72A 4Q16A 4H6VA 2IYTA 5TEVA 3A31A 3PUXA 3QF7A 4LHSA 4C0WA 1ESMA 4RTMA 4ZVOA 1X19A 2XUZA 1XXHB 1FYWA 3JZIA 1CUSA 1T3LA 1Y3IA 3BC1A 4FOPA 1A3CA 4C4RA 1VLJA 1TU0A 4RHCA 2D13A 4WN9A 1F9AA 1Z2PX 2XKAA 3BK1A 2HMYB 2VAWA 3PNVA 5AVJA 4DNPA 2M98A 1DXQA 3DMPA 2JHPA 2PX5A 2QR5A 1OX4A 3Q85A 4NAHA 3CY6A 3S2ZA 4ZZ1A 4V3BA 4CJXA 2PMBA 1XMVA 3SF0A 1ATZA 1DWUA 4YPFA 1CD5A 2R84A 4RIIA 3OQPA 5JZ9A 3AB7A 2Q5QA 4IDHA 4DR1B 5ES3A 2ZS8A 4RM2A 4GG1A 2FMTA 2AK3A 2X1LA 1X87A 2E6UX 3DLTA 3E22A 4BLRA 3SIRA 4K9PA 4CEJB 3KWMA 3GZNB 4AUNA 3T7EA 2H1IA 4XUCA 4LVCA 2GHIA 3A6ZA 2VJMB 1JIIA 1RLUA 1UK9A 4UU7A 4J29A 3H0KA 1AQYA 4AZSA 1OROA 2WAMA 2Y6VA 4MUIA 4UREA 3FUVA 4L8FA 4V3CA 4FD2A 2D5IA 1ZUHA 4KR2A 5F3WB 1P61B 1XZFA 1SVOA 4R8KA 1XNGA 3RAEC 1R4NA 3W4KA 4YRBA 2OVBA 3AEKA 2BP7A 2I2DA 3CUVA 3QJ5A 4JBGA 4QGGA 5AKLA 5GWXA 1FRVA 2G9QA 4W6ZA 5COQA 3U3JA 3DEIA 2WLSA 5E6SB 2P0YA 1EQUA 2FFHA 5DGDA 1PG2A 1X38A 3SEAA 4NZNA 4E1VA 1JA9A 4QATA 1CJMA 2QN2A 3U5ZB 3Q8WA 1R9JA 3DEJA 5KX5B 3KSMA 5DOVA 2C9BA 3FMOB 3INGA 4O4JA 1WKCA 4UQOA 4X95A 2G17A 1CLUA 1WPGA 3IQDB 2FAXA 2GEKA 4FE3A 1VMIA 2ENUA 2FPLA 2GFHA 4K28A 4A10A 4B6GA 5CBPB 3PUZA 1N8TA 1XMOB 1EDBA 3GEIA 3G2OA 5C4GB 3VKGA 3D3NA 1HQCA 2D06A 3U80A 1Q50A 4J3FA 2DOKA 3TEJA 3V8EA 5B1YA 2F9FA 4NV0A 4PYRA 1N7GA 2IODA 2CLKB 4AZ0B 2YWXA 2QSUA 3WB9A 4BWGA 3A4YA 1PK7A 2A9FA 2DHCA 3M6AA 1OIXA 4L4YA 4YRKA 1INLA 2JA2A 3TI9A 1B8NA 2UYQA 1A2QA 3PF8A 5KINB 1R37A 2BV3A 1ZXLA 1SC6A 1GM5A 1REQA 3GMDA 2YUTA 4IINA 1JAZA 3PNKA 3LAWA 4GXTA 3NTVA 1QC5B 1XZBA 2FH5B 1VYVA 3RS2A 2AMJA 4DY4A 1ZXXA 2W6OA 3RYTC 2FWNA 2HJGA 4M0EA 2F8MA 4WV3A 2WJZB 3L1IA 3L6DA 3FGNA 4KN6A 5FBQB 3U7JA 4GBED 3LPNA 1XN1A 2VYFA 4Q93A 4X6YA 1RI5A 4NY1A 2GNOA 4TTRA 5BYBA 3VC1A 1JLLB 1I9GA 3ZZMA 3ADDA 4Y2XA 1TZCA 3MBKA 1EX6A 2X1HA 3GGGA 3OZUA 4RACA 1UDAA 1GG9A 2PZMA 1H6AA 2EFJA 3KZMA 1T26A 2J3HA 1SRQA 4MWSA 1MW8X 1MJ5A 2AYZA 1OV4A 3S8EA 1L0BA 3D6JA 3DAGA 1UKVY 3QBVA 4GKAA 5BT9A 4WZBB 5M34A 2R1TA 4HAZA 2IIVA 3R7BA 3L7DA 4YR7A 4HYEA 3VO2A 2R1VB 2W6ID 1OBVA 1QU3A 4JJ7A 4P34A 1QOQB 4X41A 3CT4A 4L0MA 2HJWA 4HPJB 2YJ4A 4KYVA 3EIQA 2ZKIA 5DI3B 4HLDA 1OU0A 3DKPA 5IAAA 4FQ5A 3HFSA 1FB5A 2AWNA 3E18A 3NBUA 4I5GA 3T52A 2A59A 2Q4DA 4IJMA 4K6HA 2Q5FA 3U7HB 3F5SA 5J58A 1YB2A 2ETXA 3L6UA 4YRDA 1HZJA 2QTGA 4YAKA 3CF2A 2X8BA 4JUCA 3ZVNA 1TFRA 3ZNNA 1MHTA 4TL9A 3QPVA 4IDGA 1Z82A 4PZLA 1QFSA 4UHFA 2BFWA 3DE1X 3RFTA 1YS6A 1J2YA 5DSZA 3HU2A 4X20B 1HL3A 1R00A 5LQMA 4RTRA 1N33B 1RAHA 1Z18A 2EHJA 1Q91A 5THKA 1KFJB 1SEVA 3I2GA 2AUTA 3HKEA 3IMGA 1QXSA 2BGIA 1AIPA 2NPOA 3C6YA 1W34A 1ECLA 3K9WA 4XRGA 3GNTA 1TYEB 4ZP1A 5KKAA 4OXNA 4NH4A 4OB6A 5JUWA 1NW7A 1LLFA 3VYRB 2Q1XA 3WDMA 3ZJUA 1RRPA 4V0KA 4HLCA 3WR5A 4G97A 4QYSA 1DAKA 2M9MA 3JQFA 3LSYA 5C0OE 4PLWA 1FDTA 1VYTA 2QYSA 3IP5A 3LXUX 4TXJA 4ZYXA 1ZK3A 3NV9A 1JF8A 1RJWA 4MVJF 2J3EA 1TRKA 2ASVA 2GSDA 3E1SA 3NTQA 4FYMA 1V16A 5IEJA 2VDNB 2J0UA 1QO0A 2QN9A 1Z4OA 1W36B 1YVUA 1QIFA 5E3JA 1CKEA 2AC7A 4HVTA 4R0NA 1NTRA 3B70A 4LQLA 1KJIA 1NHGA 5LQSA 3RF7A 4NATA 3WOVA 4Q7KA 2ZIWB 8OHMA 5AXDA 4BNHA 4UUQA 3B6MA 3NYWA 2B2XA 2Z8YA 3CYFA 1G6KA 1IMOA 2NTYC 2YZ2A 4A8TA 4GMHA 4CLRA 1EHYA 4PN3A 4JJAA 3G13A 1M1YB 1Y4DE 3MJDA 4CV1A 2H06A 5GZ1A 3G2QA 4JP1A 3OFSA 1IBKB 3NWEA 2DFKB 3SDZA 3V6MA 3L0BA 3WGLA 3ZTTA 5J2TB 3N9IA 2I4TA 1LBSA 2TMDA 5B6JA 2VDLB 2OZPA 4LPKA 3WWYA 1RRKA 2P3SA 3BXHA 2OP1A 2PZLA 3TTYA 5ALEA 2XT9A 4G36A 1XCMA 4GLJA 3WMEA 3UFXB 4YR9A 4QO7A 2COUA 3OOEA 4X44A 3PGMA 3RTDA 1R0YA 1E5DA 1U7TA 1NVVR 2PV7A 3MCAA 1VGVA 3O8QA 4FFBB 5B4UA 1OB2A 3KR1A 2QTAA 5FXMA 4CM4B 4Y7DA 4DLYA 3PPIA 4FYKA 5TMBA 3AUFA 1D2CA 3ZY2A 1JSXA 4L3WA 3ENKA 2X6TA 3S2EA 3OZDA 4Q3AA 3Q9LA 4EL5A 2QTWB 5KTKA 2YJGA 3KD3A 1FX1A 1XYYA 3DEHA 2QX6A 1SCDA 3ILYA 2GJ4A 2W93A 4R81A 2Z43A 5CDUA 3OIYA 5K99A 2ZAMA 4FS3A 4ZAGA 1L1FA 4R2LA 1C7RA 4NONA 4CU5A 3GLHA 4C6SA 5L3VA 3I52A 3LUFA 3H87A 4KO1S 3FTNA 4UHCA 4P31A 3Q8KA 3JQGB 1V43A 4Q1DA 5ERXA 1DXOA 1KVQA 1YOBA 1U2DC 3DD1A 1B8PA 4TVOA 4UTOA 5B30A 2RHOA 4N03A 1SM4A 4S1WA 2VPTA 3OQJA 4L73A 2V7QD 3LPLA 4H4DA 1GZ6A 1AO3A 1QAQA 2ZE5A 4E4RA 2WHRA 3O8LA 4OSEA 2XTJA 4D3SA 3H9CA 5KYGA 4DYVA 1E2QA 2HBQA 3TZBA 3AR9A 4XM2A 2YVLA 1IG0A 4MUKA 5EI5A 4QLBA 1O4WA 3NFYA 4EJSB 2IX9A 3PJFA 3R0VA 5JCOC 2LUOA 4PZ0A 5CNMA 4X7BA 1QX4A 4YUXA 1RJ9B 1FJ2A 3FSGD 3QXJA 4MA0A 5F2NA 5KSZA 2BHLA 4FZVA 4JGBA 3EODA 5KYNA 1LNQA 3A6JA 2RGDA 2ZI9A 2PVCA 3GMTA 1R16A 1W4BA 2JJMA 4HQFA 4AAYA 5IX8A 4LZAA 3O4IA 4QELA 1K08A 1V3UA 1SZPA 1A98A 4W99A 2FQYA 4R1UA 1U3WA 3UTCA 5IJ0B 3GXOA 5DYNA 3M4ZA 4WA7A 4N12A 5E1DA 4XYBA 4E1AA 2ZYIA 5FWYA 2AEMA 3LUAA 3WLQA 1FDSA 2PXXA 3F8TA 1DDIA 3GFQA 3EVZA 4E6PA 1YK1A 2ZYDA 1XDBA 3Q9NA 2FEKA 4DLSA 2EFDB 2ADFA 1V71A 1SVIA 2Q6LA 2X3UA 4RLHA 5C32A 2V0GA 2V7UA 4YJFB 3C6ZA 1HT1E 4EPXA 4F9TA 4YQFA 2CLSA 4YJ2A 1EZ4A 2HR1A 4BFLA 1IBMB 4LX0A 2RSLA 5CW2A 1P0QA 3A3YA 2YIJA 1XJQA 1Z6ZA 3HB1A 3PBKA 2D4AA 1U3FA 2OYRA 4A7PA 3K70D 1RKUA 1TVKA 4YV7A 3EG5A 4HDOB 1VZ3A 3QKSB 2X41A 1U8XX 4I3GA 1U4NA 5F33A 4PBSA 3KVOA 1DIGA 5P8WA 1U8YA 1YQXA 4YO8A 1P2TA 3OUUA 2OXIA 1GPDG 1Q95A 1W8IA 3O7MA 1QPGA 1U5CA 1I3CA 1GCOA 2RAPA 1PNVA 2W2PA 4IIEA 5K45A 4A36A 1NBIA 1RXYA 2ODWA 4ID9A 1FIUA 4KXLA 1WF6A 1G7TA 1QWOA 2J5KA 3K9QO 4DDTA 4MWEA 2ZB4A 2ID9A 4OQZA 3JZAA 4CKCA 4MV0A 3RAFC 3U4IA 3I0ZA 3KDSE 4JLNA 4B0PA 2P2LA 1CUUA 3K31A 1A95A 4GZLA 4DA4A 1QNFA 3GDGA 3VRHA 1I1HA 2XSZD 2Y76A 4WAUA 4EDFA 3DF7A 4XIYA 3R9XA 1UM9B 2W5UA 5E9JA 2HGZA 1VA4A 1UBEA 1W2GA 4HAXA 1JVNA 3ZNPA 4H3SA 1E5TA 3I1FA 4CMIB 5FEMA 2Q7OE 1GXSB 2QLMA 4DWOA 5IJAA 1GT6A 1RYYA 5DBGA 1BNCA 3K1TA 4TV8A 5K4AA 4Y2YA 3GJZA 1R5JA 5DX1A 3S2SA 2I2XB 1ZIDA 3NHAA 3FMVA 1MZPA 2ZRDA 3QG1A 2ORYA 1ECBA 3UXHA 3F73A 5KOHA 3QELB 1VXOA 4JJFA 3A32A 4O63O 4EMUA 1JSRA 3EC1A 2JGJA 3GVPA 1YJ5A 2V0NA 2QF7A 4F1JA 4MPJA 2YRFA 3UC9A 3DVAB 1JUDA 4DC9A 2VHVA 1J42A 1O96B 1CEXA 3N8IA 4GZ3A 3H4MA 4ALJA 4WZ6A 4GRDA 4US2R 3D2AA 1U0FA 4U6SA 3GJYA 1OXVA 3K6SA 2HCBA 1MFPA 3OZRA 1DX6A 5FOVA 1YTUA 3EARA 4PVDA 1Z6PA 2IEYA 5AXBA 4UARA 5EA2A 5EXPA 3UOWA 3BD8A 5ALDA 4OXRA 1H8HA 5JCPA 1TKRA 2A9VA 3GG2A 5AM2A 1XL0A 3BB4A 3L6OO 1KETA 1OWNA 1CQIA 1YQQA 1SCAA 2O05A 3H7AA 1KBZA 4WCDA 4Y3UA 3PQ6A 4B71A 2B92A 3C6BA 3K1JA 3RFUA 4NG4A 5LU8A 1WWKA 5FI3A 2YX1A 4GX1A 2H7YA 3Q0TA 2XDWA 2ODEA 2A9QA 1QYXA 1KORA 1K5GA 4RADA 5K2OA 3Q6MA 2BF7A 2J0VA 2V5VA 4J1SA 2LBPA 2WE8A 4YRAA 3QVLA 3SF8A 2J7PD 1ODIA 5L6LB 1ENOA 3IQIX 2ZUSA 3TM5A 5DGCA 2OEPA 3K09A 1SVLA 2XE6A 4C89A 2FGJA 2WT4A 2R00C 1YDGA 3WGVA 4IJKA 1I14A 3MGCA 3IOBA 2ZRIA 2ZUWA 3FCOA 3N8HA 5C5IA 5H70A 2MU1A 3THRA 2J3KA 3EMVA 3WL6A 1BS1A 2D7CA 4TZTA 4KXXA 3ET4A 2AF4C 1N2CB 2BFDB 2R2GA 2A7XA 4II3A 4PLFA 2I3AA 4QICA 5AHWA 3ZWNA 1LTKA 2GBLC 4ROTA 1OD6A 5JJBA 4AUKA 2PEYA 2J5BA 1U31A 4CDMA 3Q7SA 1X7XA 4CL3A 4P7JA 3OTIA 4LAFA 2MSCB 3DPSA 4RV5A 4UCXA 1ZWLA 3AFGA 3CCFA 4KQGA 5COBA 4LDJA 3LFTA 5ALHA 3W6OA 1HDZA 4KIGA 3UHOA 2EJBA 2R6JA 4RPIA 1SZDA 1X9GA 4RO0A 3ZWQA 4EYSA 4D25A 4B73A 4QASA 5M3BA 3VHXB 4D9MA 3NJ4A 5EVCA 1FJHA 1YONA 2WLTA 3TD6A 3WI7A 1XZHA 1RM0A 5K3BA 5CVUA 3T3HA 3M4XA 5G41A 2GJAA 1TK3A 1NYTA 3TK1A 1FZTA 2BZ0A 2X4IA 4J7UA 4HPWA 3OJFA 3O91A 1VDZA 2Q7DA 2H5JA 4AMVA 1IZ7A 3FPGA 3OM8A 2BM1A 3V9AA 4YRZA 2P62A 2DCUA 4S0ZA 3S6JA 4FGSA 3SX0A 3V5NA 3OC0A 3EIEA 3MERA 2FV8A 2IKSA 3K1YA 1PL8A 2PLWA 1JIJA 3LC7O 4F97A 2P2CA 4OATA 1UT6A 4QPZA 4Q9LA 3ZCXA 1THMA 4YCAA 1FQKA 2I7DA 1XDWA 5JLAA 3ZQ4A 2RH8A 3VAYA 5EJ5A 3GJ8A 5HTOA 5BSRA 4Q3KA 2V7BA 4ANFA 4DJJA 2CLCX 4ROSA 4C76A 2FE1A 3BIWA 3IT1A 3NAZA 1MP0A 3QOYA 1F0NA 4D0GA 1LFDB 2VAXA 1ZC3A 2X5KO 2BHSA 4R5MA 1D8AA 1XD2A 1N0UA 2JBAB 2ZRCA 3DE3X 3ETCA 4J4HA 4U0JA 4CIBA 3HJNA 4IJUA 3IEMA 4EZBA 1SU7A 1V39A 1C1DB 5A4KA 3A4TA 3TLKA 4IY1A 1BHSA 3A9VA 3NHZA 4AF6A 2Q2VA 4QQFA 4WVFA 3RIXA 1SKYE 3OZ7A 4IXWA 4RD1A 3AXTA 2ZVQX 4BBZA 3FCEA 4M98A 3DDSA 1QFYA 3V2UA 1DC6A 2OK8A 1NRXA 1Y42X 1D07A 2GAFA 3WP0A 3RKRA 4QGSA 3CXUA 3FLAA 5K8CA 4TL7A 2FRDA 1UBKS 3DB2A 2YMPA 2FEAA 2JVKA 3T35A 2Y92A 4AMYA 4CN8A 1M2GA 2PUHA 1A4XA 4JBXA 2P6MA 1DRVA 4RHUA 4IOKA 4MEBA 2ISCA 1FXUA 4H16A 2XCRB 3U39A 1EJBA 1DKMA 4L9AA 2VRNA 4PZUA 2COEA 2O6HA 2P67A 1NURA 2NN3C 3QW2A 3T94A 3TW0A 2C83A 2C42A 1E7RA 3BUSA 4IMRA 4G0UA 3ELYA 3L7MA 4R6XA 3PITA 4WCFA 1H93A 1SOVA 3IUJA 3QM1A 3RK4A 1WUJS 3JR3A 4HDSA 3WE7A 3X2EA 3B1KA 5GONA 1T1EA 3HBMA 1G8YA 5LDHA 3SC4A 3P9RA 2RGEA 4LV5B 4E12A 1YU6A 4TL6A 5HF5A 1PG0A 3KXPA 4PRYA 3U17A 3W06A 1A4IA 4UU0A 2EGGA 5ALIA 1IE3A 4P7FA 4HWPA 1M2VA 1U0TA 4URZR 3KB1A 1Z7EA 3DEKA 3GN2A 4QVKA 6AT1A 3GZTB 1OT3A 1Y4ZA 3GCXA 3TSZA 4D9CA 4QOEA 1MNQA 4FPXA 3UEOA 4W5QA 4DDVA 1J99A 1UBTS 3OT1A 2FSSA 1KO8A 4ND7A 3UT5A 4AQYB 5CNKA 1N77A 5AI5A 4GOXA 5CK4A 1TTPB 1ZZEA 1CUFA 1OBOA 2HRZA 3QBDA 2JIMA 3W34A 4FBLA 5FBVB 4XOIA 4EO7A 5BORA 3WFZA 2QTFA 4NYJQ 1W76A 2I6SA 4OSPA 2FWAA 5U4XA 4MCHA 4CMKA 4EABA 2J9RA 4EJSA 3PXXA 3EGOA 4WN9B 4UBMA 5EMMA 3EY4A 4DLAA 5CA1A 1CUYA 5KYWA 4N7BA 3TB4A 2QPAA 4UAJA 3S81A 3ZE9A 1E9EA 1NQVA 1K88A 3O38A 1MB9A 5IK2A 2QG4A 2XT6A 5FTLA 1DZIA 1MG5A 4PGGA 1YBMA 4JYPA 2XLCA 4QA9A 2NZWA 4KQ1A 5A5DA 3TINA 3TOXA 2FSPA 2GN9A 3S1LA 1EM6A 2V9CA 3WKCA 4PO9A 3N87A 3S1SA 1NI3A 4EJSC 4KE7A 3CT6A 3E22B 4BZPA 4ZOCA 1ZR4A 3JD0A 5CA0A 3LQRA 1F17A 4YGXB 4AKHA 1T8WA 1OY1A 1G8PA 4ETNA 1QG0A 3CGWA 1YJAA 1N3LA 3OQNA 2QMOA 1TQ4A 1RIIA 3UV7A 4IHQA 2JLBA 1CLEA 5ECDA 1NM5A 3E9DA 3WRXA 1GPNA 1G2PA 1KI4A 3TZKA 3C2QA 3DKIA 5AM5A 3WB1A 3VR3D 5I9IA 2FZCA 2G82A 1V4BA 1R4NB 1H0SA 1BAPA 1UK8A 2ZSEA 2BP7B 2F64A 3AEKB 1FP7A 4LPSA 1OPRA 1W0JD 2C07A 1EA7A 2A78A 2PRJA 1E2LA 4NOLA 2AIRA 4K9LA 4MUGA 3G2IA 4ER6A 4JHXA 1M0WA 4IHJB 5EAIA 3PLNA 5CHYA 1IC6A 2NG1A 3BBPA 3W9UA 2BKUA 2OFWA 4JQCA 3STYA 5FF9A 4O4JB 4JCOA 4BQRA 2FN9A 1MH9A 5DBEX 4LUCA 2VPWA 3D4PA 4G1BA 4ZZ0A 4JWTA 2ZJ7A 4RVGA 1VJCA 4KQWA 2C4KA 1WVMA 2JIZD 2VLIA 4HFRA 5DYIA 5B3AA 3L82B 3ROZA 3UJ7A 1KSJA 3CX6A 4F46A 2X76A 4JC8A 1N0IA 2PR2A 3AWIA 3ZJ5A 3PGXA 4HAOA 3IQHX 3QG5A 4CCAA 4EHNA 5AJXA 2FJPA 3QKWA 3FWYA 4HG2A 3KLPX 4PX3A 1IM5A 1JDJA 1GRQA 2JFOA 3QTBA 2XBLA 3OKCA 5I51A 1AGYA 4P84A 2VNAA 2QUJA 2QQ0A 3ZK8A 4MHTA 2OZKA 1C80A 5LCXA 1TQDA 1V5WA 1REQB 3FWNA 4NU8X 5DOZA 1A96A 1YRLA 1ECFA 4DLTA 4AL4A 3K6JA 1CUIA 1M1NB 1MC4A 3LHSA 3NH9A 3OJ0A 3RYFA 4Z4HA 1GKYA 2NQ2C 3DVQX 3CR8A 4ZT2A 4CKEA 4HF7A 3ZHBA 2H48A 2I22A 1DE0A 3IEPA 3IT2A 4PAQA 5B3JC 3MQ4A 5GJWC 4XGIA 2HXSA 3OURA 3RWBA 2A8YA 3GPIA 3U1VA 1YA6A 4KN9S 5ALGA 1M8FA 1LNSA 3ZZ0A 4XQ0A 1JHXA 3SFVA 1LSSA 1SQFA 2WKQA 5TMDA 2VVTA 4QFDA 3HCOA 2WMYA 3LI2A 4NYJR 1WRBA 2VT6A 1NF3A 4GIBA 1M5UA 3UMJA 5ADUS 5HKAA 3R7AA 3HTXA 1M1ZA 2IY8A 5FD8A 3NOOA 1MOZA 4WTOA 1JDVA 2BHNA 2UUAB 2BFCA 2OENG 2R1TB 2ZQ5A 3GEHA 3SKVA 4JI7B 1NLFA 2ZWMA 1K89A 2FOXA 4U7HA 4F21A 1ULSA 2P30A 1EFKA 2EEZA 4QNRA 2H7XA 4OGGA 2KPOA 4HI0E 5B1HA 4JC4A 1E6LA 2QYTA 4EG0A 5DXJA 3OTOB 1WSDA 3AHIA 3KYDA 4FS8A 4M0UA 4BLVA 4FMCB 3GFGA 3VC7A 1I0IA 2IITA 1W5TA 3FPHA 3DMGA 4KTVE 1NQXA 2BZ1A 2FOLA 3PFWO 4JUIA 4S1NA 5DZSA 5FRDA 2VQFB 2XODA 3S7TA 2J3LA 3H9UA 4GVXA 4TYMA 1I3LA 1RRVA 4DMKA 3KJIA 2WNIA 3OIUA 4ND3A 1ILEA 1AS2A 1U8EA 4DMFA 4QULA 4TMVA 4FFVA 3VX3A 3NEAA 3FPEA 3VZCA 2Q4EA 3SHFA 3W2GA 1T9GS 4RVUA 2BGRA 4K05A 2AC2A 2VTBB 1SIUA 4LJYA 3O75A 5H80A 1MEOA 1JV2B 2YWFA 4N18A 4KMMA 1A9TA 2PM8A 2ZULA 2R5FA 2REQA 4NSNA 2Q62A 2BM8A 3S40A 5DTEA 2ZAIA 3PTLA 5TRTA 1EESA 2YDXA 1H3EA 3GP5A 2PFSA 5F98A 4JVNA 5E8JA 4TSRA 4TM7A 3OZXA 3RVNA 5AJHA 1I94B 1J20A 2QDKA 3FYUC 4FOTA 2O48X 1HE5A 3M6FA 4ISBA 4BB5A 1HUQA 3DCNA 4A8HA 4YP6A 1VYUA 1MX3A 4OI0A 3IJEB 4I55A 2H0AA 3UENA 4YUVA 4WXEA 1V16B 3QXXA 3SLGA 4CUJA 4DQXA 3MMZA 3JX9A 3WLPA 1CUVA 2NNLD 1ISFA 1HYBA 2R1ZA 3ORRA 2FOIA 4LEIA 4E5YA 1LLQA 1ZRHA 5KTMA 2V55B 3ZHXA 4BUJA 5C8ZA 4LRYA 4FKZA 1EB9A 1TJ5A 1KDPA 1U2TA 1XDUA 2NAPA 1EBBA 2W58A 2WMOB 4ND1A 3IUBA 3T95A 4DRYA 4BZQA 1Z73A 2FG5A 1VE6A 4MCJA 4AJKA 2OGZA 4TWZA 3ZI7A 4U9IS 1X2EA 4CLRB 4E5DA 2AZXA 1BVRA 1PLLA 4FX5A 1SWWA 4NK5A 4PICA 2VYVA 3OMLA 1SVWA 4NP6A 4BKMA 3RE1A 1GG8A 1MOSA 4UASA 2PL3A 4CF3A 4DYDA 4RTLA 3HB0A 1RACA 4WKNA 4F4HA 3LT5A 4XW2A 1MGOA 1GUYA 4X8MA 1FBTA 2VP4A 4QXPA 5BSWA 3SVLA 1WZ2A 3IQFA 1JPNA 4PHTA 1KDOA 1PT8A 2AD5A 4C7XA 4E21A 2LV8A 3TJMA 4YRGA 3O8QB 1OJ7A 1UADA 2NWQA 1EFPA 1FFHA 3VGJA 2H51A 3ZDCA 3G88A 2GGSA 4RGYA 3WFJA 1UQTA 2BFNA 2MSNA 3T9EA 3A4NA 3A1VA 3QVOA 3U4HA 1Z5VA 2QRKA 2ZS7A 4B87A 2OBXA 3KSAC 1IIRA 1L5VA 1SXJC 3F98A 3IVMA 1QGZA 3OC6A 5I45A 3ACBA 3IJPA 5A0VA 1QU2A 2GASA 4B7XA 3AUKA 1FSGA 1ZSNA 3GLKA 3PX3A 2AW5A 1KZ4A 2IIBA 4NBNA 4B4UA 3OQOA 4LDAA 1T2DA 3GLHB 3WL3A 1NKVA 4TQ9A 4PG7A 4ETMA 4DNXA 2ZZNA 1JHPA 2ZBUA 3O21A 4DVJA 5HQTA 3SC6A 1YB6A 1CZLA 2R79A 1SAYA 2RGGA 1IN8A 2JFNA 3EUWA 3MLAA 4UC0A 1D2MA 1KI6A 4AD8A 3UJAA 3BSSA 5ALJA 1CY1A 4KK4A 1KOLA 3DZJA 5EJ9A 4WESA 5BYKA 4RY9A 4X60A 5IARA 2PRZA 1U3CA 2ZE8A 3OE4A 2W98A 1JAIA 3JQCA 5DLEA 1XKLA 5E7JA 4DJAA 1OWMA 2C7OA 2IZ6A 1X92A 1EFUA 3GJSA 3MCUA 5CTJA 2FDXA 1SOWA 1KZYC 3KZNA 4JP8A 1IPEA 1ISMA 2BJHA 2OHJA 3GVHA 5BWMA 1E2JA 5K03A 1ZVVA 2RIRA 3AUAA 5I7OA 3ZYZA 4QVIA 1KPIA 3MYRA 3TLEA 1OI4A 5T57A 4EW6A 2P2DA 4NMXB 1CC1S 5K1ZA 1QHFA 4YP1A 1E9SA 4NE2A 3M2PA 5I3CA 5JQGA 1MVLA 3CH6A 4BEJA 2R6HA 5JCJD 4XE5A 3HJAA 2Q8QA 4HS4A 4J0JA 4PNEA 2HPVA 5KHAA 2G76A 1JWBB 3OQ6A 4ZU1X 4CIWA 2MINA 4MVJH 4EJ2A 1P9OA 3TRKA 5FWYB 1E79A 1XZMA 4RQBA 4E32A 2H4YA 3K2BA 1S8OA 1FU7A 3QLVA 2JC3A 1B41A 3G7SA 1GTRA 2NVUA 1PV2A 1TJ4A 1AQIA 1ZSVA 2IEGA 2LKCA 4LFAB 3KLOA 3DE4X 4LYEA 1L7BA 1EK2A 2NXJA 5JO9A 2BH9A 5LYJF 4B1FA 4OK6A 4XKJA 2I2AA 3ONVA 3T1YB 1E2FA 3H2BA 4YJ2B 2FWMX 4WDRA 2AG8A 2VCEA 1YJQA 4QUGA 721PA 1PUJA 2ZGVA 3CLRD 5E8RA 4A73A 2I67A 3N5KA 5LQNA 4OQLA 3VZRA 3J81A 4AKGA 4F38A 1U80A 4RKRA 1JG2A 1FF9A 5EERA 1XCGB 2IEDA 4HLUC 4U0KA 3TTSA 2H1VA 3BK2A 4LRWA 1B2RA 4R05A 4RELA 3UH1A 1N3IA 2QXTA 3D2CA 4K3VA 1G3IA 4CDNA 4RDIA 2CV1A 1R4MA 1PYGA 1SHUX 1ODTC 3FJYA 2O19A 5EZ5A 3H84A 2I6TA 2Z8ZA 1ZVMA 2QPLA 2ZVJA 2PX2A 4JLKA 4O2BF 3VTKA 4CL2A 4LMRA 1QDLB 4HUTA 3MWLA 4QEDA 1FYEA 4IKOA 2EKLA 3ILHA 1USIA 4CKCB 2WF9A 1MTZA 3CUKA 5LC1A 1BGXT 3F2IA 3MMSA 3ZZUA 4U2FA 5JMOA 5IKXA 3IXMA 4GVLA 1ELOA 1WQ1R 3JXEA 3UHFA 1E2HA 2EZ4A 3PFCA 2D5CA 4JBIA 3R9XB 1YB5A 3S27A 1NJ6A 2I5PO 4M1QA 4JY7A 3QXHA 4LYAA 5CDFA 4MP3A 1SFRA 1YCFA 2C8KA 4I08A 5EESA 4FFWA 1GAWA 4FDUA 3FPJA 4KW7A 5FI5A 3SZLA 1I4LD 3H1EA 4IJ5A 4LGMA 4UU1A 1QIMA 4EHFA 3U62A 1DO0A 3G2KA 3P20A 4TV8B 5BQFA 1K7CA 3E9MA 1QCCA 3E05A 2V3VA 3MS7A 4HNGA 4AY5A 1P44A 3IIIA 1X7ZA 3PWTA 4M49A 4RDHA 1Y5LA 2ZUUA 1ULZA 4K9OA 4YFVA 3RVKA 4HNRA 4D1YA 3B3GA 4ZDKA 3K4HA 2I6UA 2P11A 3UWDA 2XVMA 5KOHB 3PHHA 1L3BA 1U9CA 1NSFA 3F7NA 5DGXA 1EUCA 1S3FA 3FVVA 4U8HA 3JWGA 1O54A 1QZUA 2X22A 4L08A 4WKPA 1ZSYA 2QG6A 3O82A 5AOBA 4OXQA 2PBFA 5F2OA 4C5AA 2WJ6A 3CB4A 2XEXA 5BMOA 5AW2A 1CVLA 1WF3A 1XELA 5LD2C 4KUHA 1YZHA 4FW8A 3OKAA 4RPHA 5EQFA 5L4NA 2J6BA 4GX5A 4CKBA 4IXDA 1J23A 4NCKA 3L8ZA 1F4VA 2GFIA 4U00A 3K6SB 4LXIA 1HEUA 1D6SA 2PE5A 1RTKA 2Q3DA 4BBPA 2HU2A 4ZCLA 3PXGA 5KNBA 5BQXA 4KLNA 4ABYA 2ZB2A 1E6MA 3VPCA 1E6WA 1RPAA 2ZI6A 3ET5A 2QVGA 1CQIB 3D5TA 3I64A 1CF4A 1J49A 1DFGA 3RTCA 4DC0A 1Z45A 9LDTA 2D8MA 1KEWA 1HLFA 2EQBA 4GKKB 1QE5A 3ZD9A 4M83A 3ZS9A 2PKEA 2HMVA 3LQ4A 3AP2A 3N76A 1ZBDA 2H4FA 4BQPA 4BB9A 4DCTA 4A3SA 4G25A 2XT0A 3SXJA 2PT7A 1Y80A 4Z9FA 5IS2A 3OZAA 1S8NA 3PPWA 4K6OA 4EFLA 5ICEA 2GLTA 2AJLI 3OMWA 2WSYB 5JECA 4ZCSA 1LRJA 2QD4A 2H2FA 1SHTX 3NVDA 2CJWA 3SF8B 3SHOA 3AYZB 4U9UA 1D8TA 2Z6AA 5LBTA 1ITZA 3VNBA 5BV8A 1JLRA 1Z13A 2NSHA 1UBMS 4X1YA 2IP2A 2OXRA 3CA8A 1U9IA 2Q46A 3DOUA 4OUKX 5J2UA 2OV1A 5DTMA 5I48A 1JI0A 1A2KC 1MRZA 1UBHS 3L49A 1QB8A 4IRUB 4RSHA 3UWOA 4D5GA 5LOVF 4JENA 3MUOA 4ME6A 2QW0X 1CVRA 3O31A 4B8ZA 2IC5A 2GFQA 3RUAA 5LJIA 3V1LA 1YGYA 3VO8A 1VP9A 1GNSA 5AI6A 3JQBA 4LC9A 3S70A 2B4QA 3RT9A 4WH0A 1MA0A 5ECYA 1V37A 2EL7A 3TEMA 1RLMA 4F9GA 4L4RA 3EUEA 5B58T 5I7EA 2JJ2A 4ZO7A 3OJWA 4D43A 5FLEX 5F73A 5I9TA 3DOOA 4PQYA 2HDOA 3KYIB 4IAOA 1K5DA 5JI2E 1Y9JA 3AFIA 4KH1A 3JVEA 2PUEA 1QUEA 1YMQA 4Z51A 5CYPA 4FFDA 3T61A 2CBZA 1FU8A 3PFBA 5AJYA 2F2TA 2IUYA 2QZJA 2WHEA 4MRAA 1VRVA 4O2LA 1C4OA 4QECA 5I9NA 1VLZA 4P80A 5AK6A 3T3PB 1OFIA 5B7GA 1DBIA 1PDOA 1UR5A 2QTZA 2ZBQA 5F7XA 2P8SA 1RYNA 1PK9A 3FTFA 3ZDZB 2PGAA 2ZZKA 1DUVG 3ZR4B 4BV8A 1MQ8B 2DBYA 1UPFA 1CP3A 3EF0A 4XRRA 3FCCA 2J3QA 4HYTA 5G1PA 2HA7A 1KYWA 2V7WA 5T7BA 5A4FS 1H2HA 3R4VA 3FJ1A 1RP7A 2P1RA 4G2TA 3JQDA 3GZ4A 2XE8A 3IP9A 3PCXA 4RZXA 5T8KC 1NAIA 2XUPA 3I9JA 3PQEA 5TX7A 2VYND 3I45A 3UJCA 3OECA 4F7DA 1X8XA 1Z4KA 2CF5A 1N25A 3KOMA 3MFQA 2XBMA 2RHWA 3BE5A 1QHHB 5C8YA 3RF6A 1GGJA 3H13A 2NSLA 1JB9A 1J0DA 2ISQA 1D2GA 1T15A 4QU5A 5CYGA 3F78A 3KBBA 5IC6A 2ZKLA 3DZIA 3NFRA 1VL5A 2BAGA 3QI7A 3OHMA 4CU2A 3UK2A 4YMWA 4H6PA 3PE3A 1DMSA 4G07A 1DJQA 2MMCA 3OT4A 4G1EB 2DUWA 2LCFA 2OCAA 1XMJA 2CUNA 2ORIA 1Q7GA 1TYBE 3CU5A 5HA5A 5BRAA 3F4KA 3ZTYA 4XM0A 4RSGA 1B6GA 3HLYA 4XH9B 4RY2A 4EA9A 1HZZA 1Y9AA 2CWWA 4B3JA 1V8FA 1VKZA 1WR8A 2W2OA 4C6RA 4TV9A 5CH5A 1VBFA 2OO5C 2D1TA 1ZGHA 3WLTA 2RHDA 3EZYA 4UNSA 1J33A 3QFFA 2EP7A 3MN1A 4WOBA 5A6VA 2JCVA 3ABIA 1P17A 4IH4A 4ZQHA 4S1VA 3RU2A 3O2NA 3SC2A 4BNTA 5K0GA 1WP9A 2ZI4A 3ASVA 5HKLA 5D84A 1K4MA 3DNMA 3QIVA 1U1IA 2O9JA 3IAS1 4EYEA 1WS6A 3N58A 3LWNA 4FEEA 1NTOA 1CS4C 1UBLS 4N7MA 4DPLA 2CCKA 5E3IA 1U65A 2BR5A 5HQ3A 4HDSB 3SQDA 5H1YA 5GONB 5HHTA 4YY3B 3AHDA 1XZIA 1LPPA 2XZPA 5LL6P 4RTKA 3HG7A 2DYKA 5C1BA 2O2JA 3FMFA 3TAUA 3QWIA 2VDRB 1VMDA 4OQXA 3CNEA 3VV2A 4G0NA 4AIIA 1M2VB 1PFYA 2EZ8A 3HZOA 3ZHUA 2DHDA 3F0TA 1N2BA 4L5JA 3N0TA 2R96A 4BV2A 3Q3EA 5JV5A 2WF8A 1DVRA 2ACEA 3ESDA 3OT1B 1CJSA 2BCGY 3UT5B 5IF9A 2DECA 3KZXA 5KUTA 3PVSA 4GZ6A 121PA 3M1IA 4NBRA 3O4VA 2IP4A 4ZV9A 2WSLA 5C9ZA 1UL1X 3NVAA 5F23A 1MO5A 4QBFA 4E11A 4Q1FA 3JSAA 5GGYA 3PXEA 4XVCA 2R62A 2BGUA 4UMVA 5H16A 2AFHA 2LIPA 3I53A 3IEUA 1IM2A 3PDJA 2YIVX 3R3UA 5BOSA 5CA1B 5CXQA 5HOQA 5KYWB 2YVUA 3ER8A 2IZOA 3OFNA 1IHDA 2XDAA 2A2ZA 2GN0A 1Z83A 3TCXB 3FIUA 1YGPA 3NAMA 4FGKA 5C52B 4M7WA 5COAA 1ULTA 2EP8A 4B75A 1CUWA 3OQ1A 1MJFA 3CZCA 2IV3A 4X7PA 3B8EA 5K5EA 3UMCA 4Z7QB 2IPAB 2QV7A 4LI0A 2XMPA 5EHNA 5H0IA 4JMLA 3ANYB 4WNCA 3HVRA 2EJWA 1LSOA 1SEPA 3EXHC 4M2LA 1EHCA 3I9V6 4OI4A 1HWYA 5BSGA 1UIRA 4YCBA 3AUYA 4EVSA 4AN0A 1N3YA 4KZKA 2CK3D 2W2LD 5E2AA 3ZD8A 1M73E 1HKUA 1N5DA 2HDWA 3W4JA 5KTSA 1B00A 5BSMA 4GP6A 4PFJA 3TW6A 1GRRA 2GPJA 3JQ6A 4FEAA 5EKDA 1ZONA 4E30A 3VKWA 1CYEA 1QQ5A 2C4WA 2NU6A 5F35A 4CFZA 3OPNA 2V6BA 4WEQA 1MQAA 4YMVA 4AK9A 1UPTA 1WDKA 1JE0A 1F51E 2YY6A 4MLDA 2HSGA 1NVUQ 1QTIA 4IVNA 1SCBA 5D6NA 1VQ1A 1XRRA 3LRTA 3NHFA 2MCFA 4PRZA 2VJYA 4UU8A 3R8FA 2EQAA 4UPVA 3NW9A 5ALWA 4A0HA 4DV4B 2AI1A 2FZKA 3V32A 5EUQB 3G0OA 3KQVA 3ZBPA 3SNKA 3HBAA 3R7NA 2H4JA 1EFHA 1VDMA 1VJ1A 5KJEA 2ZRQA 2QVXX 3P96A 2RG7A 1ZAKA 2PMFA 4F5WA 4BMYA 1V41E 2FRXA 3NTLA 1KPHA 5ADWA 4CZ2A 4XIFA 1TCAA 4BCCA 1XEFA 1XVAA 2HBYA 2TMKA 2VT3A 3QPCA 5EIBC 1NXTA 1UC8A 4PAGA 3TQQA 2UUBB 4D99A 4FW9A 4R3NA 3UOAB 2A5YB 4M36A 4JX9A 3T41A 3KEFA 3KSDO 3OPVA 3I2KA 3I04M 1N5LA 4K3UA 4O0LA 1XEWY 2QVLA 3EIXA 2GWRA 3KT3A 3RYFB 3C4QA 1VB5A 1BMFD 1ONPA 1PWEA 4CKEB 4MUBA 4S35A 3TYXA 2W6CX 4ZQFA 5A3JA 1T8UA 5HS4A 1FW8A 2H29A 5TB5A 5KTPA 4FSDA 1GCUA 3OEHA 5KU1A 2FW0A 4HO1X 4RD4A 1L8OA 3UIEA 4JFAA 2CFIA 2CMDA 2J9YB 1JXOA 1MJNA 5AK5A 3IP1A 2Y77A 5CFMA 3X1ZA 4BJ5A 2JARA 5CGZA 2YHBA 3L5OA 5BSEA 5GJVC 2Q0XA 3C3WA 4IIJF 3CUSA 4PCAA 3O73A 3TJRA 5LXTA 2QP9X 1ORTA 2BFCB 2FEMA 5CNIA 1T91A 4ARAA 4C2AA 1P60A 4HDAA 4Q19A 1FFCA 1RCTE 1OFUA 3PR3A 2E4ZA 4IIGA 4GGOA 2WAAA 3MEQA 3UA4A 2NTJA 4DUYB 3PHJA 1Q6YA 1Z16A 3BRWD 4YP9A 1DFIA 3VO1A 2A94A 1M75A 1DADA 5KTRA 1SUIA 3KYDB 4RTJA 1VI6A 4W5NA 4Z2YA 2YHIA 3SZMA 3G9XA 3C7TA 2HA2A 2IEIA 4MV3A 1FPQA 1SJ9A 3Q6IA 3VJLA 4U7FA 1II0A 5TF4A 2I8AA 5AKJA 5JZVA 3AILA 3FOWA 4FT4A 2EU8A 2QTHA 4XGRA 1WXFA 3CV3A 3I5UA 5D00A 3CEAA 1ZK2A 1F5NA 4EPTA 2ZVDA 4I5IA 3GJ7A 4ZQIA 4FIDA 3V00A 4DFDA 4YRMA 4M7RA 4MDFA 5CDFE 1RS0A 2O7VA 3EZGA 1E2PA 1AS3A 4MROA 4RK5A 2HPAA 1WB5A 2JFUA 2RARA 4GYJA 5TC4A 2C9MA 2GD1O 4ASUD 1NDHA 2Q9CA 2MR5A 3C4JA 3SG0A 1XKTA 4WUVA 3IIKA 2REQB 5LB4A 4DNQA 5TF0A 1MAHA 3KR9A 4F3TA 1UPBA 3WLIA 2A58A 5K3DA 2ZBVA 2DKOA 1GPAA 5DM2A 4QUJA 1PFQA 5BV0A 1R5NA 3GEDA 2B35A 4FNAA 1TAUA 2ZQZA 1NVWQ 5FWNA 4L5BA 3MMNA 4IH1A 2MT9A 4XD7A 1OWOA 4M22A 1DT3A 2GM5A 2I1LA 1G4AE 4I55B 4RVCA 3E2IA 3ZJ4A 1ZJZA 5EJ7A 4L07A 3C1OA 4CIDA 3I6QA 3SYKA 1E94E 3DMFA 1NA5A 3CNLA 2VP6A 4MVJP 5ESXA 4Q21A 2YINC 1NW8A 4L4XA 1AF7A 1TUIA 3GFOA 3Q7TA 4IDAA 4WE3A 3T34A 3WLEA 4IEIA 5C81A 4CODB 1OT5A 1NJ2A 3OT5A 4UZFA 5ER6A 4JI1B 3E4DA 5KVCA 3KZVA 2FQ1A 2ZTHA 2FGKA 4JLUA 3A1WA 1GQ2A 2N9UA 3C3PA 1Y3DE 1NF8A 4EA8A 4OV6B 3IDOA 3SM9A 2HRQA 4DJEC 3IOMA 4LCEA 2QSZA 2EBFX 4LA4A 2F3TA 1KZ7B 4LZNA 3UWMA 1XTZA 1I7NA 2YV3A 4MSUA 5TS3A 3MC1A 1JFSA 3OP1A 4PTLA 2IYSA 2ZFUA 2P41A 4KSCA 5CD9A 3JYNA 1NR1A 5HZMA 1Z4QA 2OY0A 2VWQA 2HFKA 3JRNA 2AW3A 3LVFO 4XTCS 3T9BA 2GX6A 3FTPA 3DLBA 1GSHA 2LWIA 4QNMA 3GAMA 1EFPB 3CM0A 1P77A 4DR7B 3CGGA 4XQEA 2ZSIA 4NCXA 4P81A 5MGBA 5ALNA 1V8ZA 3PD0A 4LHYA 4QSMA 3QLUC 2PZJA 3C74A 4AQDA 4L9WA 2CXRA 4XWAA 3VSDA 4AJHA 2O6LA 3GGDA 5JS2A 4MX8A 4P2GA 2B36A 4QLAA 1ANKA 1V6AA 5T41A 1T5DX 3KVNA 5JEEA 2QY6A 4YHBA 1EUDA 3O95A 4K6KA 4NAUA 2E4AA 1W4RA 4RK1A 4RVHA 1GDTA 1O57A 4E0BA 2PUBA 3IR5A 5A3SA 3UB2A 5I7FA 3HVIA 4C0XA 4U7TB 1LS6A 4W5HA 2G0AA 4WBNA 4YP5A 3B85A 4UUBA 3DE0X 1KI6B 5BR7A 2ZU0C 3N7AA 4CG1A 3BICA 3RU3A 2EJCA 2PX3A 2E5WA 4AJEA 1SXHA 2FSFA 2PXCA 2WFMA 3EDRA 1RAFA 1EWRA 1PWYE 1XQWA 3A4MA 1OZFA 1J07A 3V2HA 4BNZA 2VS1A 2WKWA 3F4LA 2W6QA 4AMGA 5JBNA 1XAGA 1D09A 1B1CA 3A26A 2RFLA 4JASB 5HIKA 1QGDA 1SA0A 1N75A 2WA1A 3CC8A 3JD3A 1RPNA 3KUUA 1NE2A 5DM1A 3H2JA 3RS0A 5MN5A 4P9NA 2ILVA 4LGYA 3BIFA 1KEEA 3WLAA 2ZRHA 4IEEA 3LDFA 4N6OA 5A5GA 2HSWA 2IS4A 5EKUA 2XE7A 3IVCA 2CEAA 4R9NA 1IQ0A 1Z4NA 2FR1A 3DONA 4WZAE 4LYDA 1BJRE 1ZN9A 1TM1E 4D46A 1SXPA 2I8CA 2V0CA 3QMMA 5JQGB 3QU2A 2ORWA 2P40A 2YVQA 1P80A 1TEHA 3NORA 4F3RA 2X0DA 4MS1A 3QEJA 4NFHA 2MINB 1OJLA 3SYRA 3D4IA 1IHUA 3HP1A 2UZAA 4WCFC 3ZDQA 4HMOA 3PKJA 4HH0A 3U13A 1HF3A 3C7AA 3B20A 3DXZA 2LVBA 4C3ZA 4CTNA 3OLCX 4IOJA 5JU6A 1Q44A 4XASA 2NVUB 2XOXA 2IE0A 1LFAA 1DDGA 2R4TA 1P74A 1NQUA 4FBMA 3TPCA 5LLDA 1E20A 5BSUA 3O8CA 3PC8A 1QE3A 3K35A 4BQNA 1O97C 1LF5A 4OCZA 2Q0QA 3FETA 1NLMA 2WG1A 4D97A 1H1DA 3RSQA 4EYOA 3IVAA 1R0LA 4Z7NB 3ACDA 1G8KA 5BWBA 2CJPA 2WOOA 4Y1GA 1R3UA 2QS9A 3VPXA 2QX4A 3G02A 4KOAA 5KQMA 1UKYA 3QNUA 2Q2QA 1UP7A 1W4LA 1TRHA 1AZLA 1U1DA 4NTZA 2NMVA 3F6RA 4JZKA 1JQKA 1R0ZA 1BIFA 4WGFA 1NFRA 2FUG1 4UHBA 2GTIA 4GL2A 4X45A 1WABA 2IGBA 2JLXA 1UC4B 3R6TA 2ZVPX 2ZYRA 1M2OA 4Q4AA 3NPMA 4KKXB 3WGQA 3FPBA 3QXSA 5CYFA