4S1OA

Structure of mycobacterium tuberculosis nadd in complex with nadp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
197
structure length
175
Chain Sequence
RRLGVMGGTFDPIHYGHLVAASEVADLFDLDEVVFVPSGQPVSAAEHRYLMTVIATASNPRFSVSRVDIDRGGPTYTKDTLADLHALHPDSELYFTTGADALASIMSWQGWEELFELARFVGVSRPGYDALTLVEIPALAISSTDCRQRAEQSRPLWYLMPDGVVQYVSKRRLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Mycobacterium tuberculosis protein
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Probable nicotinate-nucleotide adenylyltransferase
total genus 54
structure length 175
sequence length 197
chains with identical sequence B
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4s1oA00
2A86A 2O8VA 3S3TA 2VXOA 1O94C 3FIUA 3H9CA 4K0RA 2JAXA 3IUEA 4MWBA 1YIDA 1Q15A 2IJGX 3COWA 5IJXA 4NAHA 2RE8A 3COVA 2X3FA 4KR6A 3FNRA 2Z08A 3CVVA 1XNGA 1XJQA 3PXUA 4EG6A 1H3NA 4CDNA 2WQ6A 4NATA 4EF6A 4CDMA 5EKDA 3CLTD 4XFJA 3VU8A 3ZJTA 5H16A 1JEDA 1NURA 1NUTA 3DPIA 1KKUA 2WB2A 2J5BA 1EFPB 4EG5A 2HMAA 1O95C 1VBKA 2QJTA 2YXNA 3LOQA 1MRZA 2DERA 1G8GA 2DETA 1J09A 3DLAA 4DDMA 2CV0A 1TYDE 1JECA 1OWMA 4QREA 4MW7A 4J76A 2E18A 2X1LA 1TYBE 1EFVB 1M8FA 4YP6A 5FO0A 3ZJVA 4NDAA 4PBTA 3M5WA 1QU2A 3SEQA 3QTTA 4YMIA 3D6VA 3FHJA 4ZT3A 4MVYA 1QRUA 3D6UA 2AG6A 1MBZA 3VRHA 3N2YA 1IQ0A 3IVCA 1WQ4A 1JILA 4ZT2A 4XFDA 4WNYA 5LLTA 4EG8A 1MB2A 1N77A 1WKBA 4MW4A 2J08A 4MW9A 2AZXA 4MWCA 4AS1A 3DV2A 4EFKA 3GUZA 1EUYA 1JGTA 2QJFA 4NZPA 3MXTA 4DNXA 4ZT4A 3VGJA 1IVSA 2I1LA 1V47A 3GMIA 1TEZA 1QJCA 1EXDA 1MJHA 4EGAA 1J21A 4OUDA 4MUNA 1WXIA 4Q16A 3P0IA 3L93A 2QUIA 2OQ2A 3MMXA 2VTBA 2QUHA 1N3LA 1ZH6A 4J75A 1IHOA 4DJAA 3IMGA 3RHSA 1QQTA 1N2IA 3HV0A 5DEOA 1WJGA 3F3MA 2A7XA 1PG2A 2CYBA 3UY4A 3MLBA 2R5WA 4MW6A 3FETA 5TS2A 1ZUNA 1HYBA 2A1UA 1M83A 4MUGA 4ZT7A 1JIJA 3COZA 1KH2A 4G6ZA 2A1TS 1XNJA 2X0KA 4EG7A 3UMVA 2JANA 1R6XA 2EJCA 1LW7A 1GZUA 5JBNA 1NYLA 2HZ7A 3Q10A 4MQ6A 4MAFA 1WXEA 2DUMA 3CLUD 4MULA 1OWOA 2QTNA 1IRXA 3I05A 1QRSA 3X1KA 5IHXA 4OJMX 3NV7A 2CFOA 1YUNA 3OTWA 4Q93A 4ND7A 4UZFA 5DK4A 1COZA 3OP1A 3U1VA 1OWPA 2GM3A 3RK0A 3TZLA 1Q11A 1KQOA 3RBAA 1PFWA 2RD2A 3Q12A 3PNBA 1N2HA 1JZQA 2QTRA 1WZ2A 2EL7A 2WQ7A 1JIKA 3IOBA 3CVYA 3CLRD 5K0SA 3H97A 1U0BB 1M8PA 4MUKA 3TZEA 1N2EA 1F9AA 1VBNA 3INNA 4U7JA 1OWLA 2XRZA 2PXHA 3FY4A 1N2BA 1ZH0A 3H9BA 4ARIA 1O97C 1U7XA 1MAWA 3IVXA 1PG0A 3AKZA 4ZCPA 4HPWA 1N78A 3MUEA 1O96A 3TS1A 1KP2A 3CLSC 3JXEA 4I6JA 3QE4A 2PZAA 3GLVA 3X1MA 1GLNA 1GN8A 1ULHA 2PZ8A 3FOCA 1PFVA 1YIAA 3QTBA 4WSOA 1M8KA 1IQRA 1N1DA 2CUZA 4ZCQA 2E21A 3C8ZA 2PG3A 3ND6A 4EG4A 2BYTA 5J59A 5HUJA 3MLAA 1LI5A 1EFPA 1IFXA 4NX2A 4MW0A 1G8HA 3P0HA 4S1OA 1GPMA 1JEEA 2D5BA 2OV4A 3L92A 2A4MA 2CSXA 2XRYA 3KT3A 5F23A 1DNPA 3HZRA 1J70A 2ZP1A 4X0EA 1T6XA 2E89A 1O94D 2IP1A 3CLRC 5H7XA 1OBHA 4ND6A 1H3EA 4I6EA 3FI0A 4MWDA 1VBMA 4MVXA 3H05A 1F7UA 4JFAA 1YUMA 3IUBA 1KAQA 2YWBA 1O97D 3FDXA 1TYAE 3CLSD 4P2BA 1XNHA 4QRDA 1KAMA 5HG0A 4DE5A 1VL2A 2V0GA 1BS2A 3A4IA 3K32A 4RUKA 1KP3A 1M8GA 3RFFA 1NI5A 2YWCA 4PBSA 1F7VA 2Z09A 1MB9A 1J1UA 3A05A 2A1TR 4BWVA 1VLHA 4FZJA 4NAUA 2WSIA 2DPLA 1RQGA 1QRTA 3IMEA 4HK4A 1O95D 3CA8A 3IMCA 1N75A 1Q19A 1CT9A 3TQIA 1WY5A 1R6TA 3NBKA 2QUKA 4L2IB 3CR8A 1JIIA 4EG3A 4JYZA 1EJ2A 4ZT5A 1KH3A 4MUHA 2PIDA 4YP7A 1EUQA 1J20A 1QTQA 1J1ZA 3X1JA 4G5YA 1LI7A 1N2GA 3CVUA 1IH8A 3ND5A 1K4KA 5KWVA 3BL5A 1QU3A 1K4MA 3IH5A 3UC5A 1MC1A 4ZCRA 1OD6A 4F4HA 3HL4A 4JZYA 1K97A 2GOYA 5FO1A 1TQ8A 2PFSA 3N05A 1OBCA 4MUJA 2H2AA 5LM3A 2Z3VA 1N2JA 1G8FA 3RJZA 1WXHA 3AIIA 5LFAA 3K9WA 1N2OA 1U3DA 1NSYA 4ZT6A 3ISJA 4OUDB 1NZJA 1I6LA 2A84A 2TS1A 3IDFA 4PY2A 2ZUFA 4UZEA 4MVWA 1FFYA 3ZUGA 1H1TA 2DR2A 3G59A 2DEUA 1U7DA 1KORA 4ZCTA 3PRHA 5HUHA 2VTBB 3PNVA 3ILVA 4KR9A 1UFVA 3HGMA 1KQNA 4RPIA 2CYCA 4KKVA 4DDHA 3TNJA 1EFVA 2C5SA 2DLCX 1JZSA 2QJOA 3Q4GA 1X6VA 2A88A 4MW1A 1FYDA 4HJXA 1O0CA 1ILEA 2E0IA 2JA2A 3LCJA 4H3SA 4ARCA 1T9GR 3COYA 3AG6A 4K03A 2G36A 2NSYA 1I6MA 2AKEA 3FWKA 2A1UB 1JHDA 3KFLA 4U8HA 1Y42X 1G59A 3ZXIA 4R0NA 3ELBA 4YP5A 4U63A 1YI8A 1Q77A 2ZUEA 4R2LA 5TEVA 4EG1A 5DASA 5J5AA 3IVGA 4I6GA 3SP1A 1V8FA 3G6KA 3ZJUA 3H99A 1NUPA 4E1AA 4GRIA 1NP7A 2H29A 1GTRA 2J07A 1TFUA 1WXGA 4A91A 3N8HA 3G5AA 1X8XA 1T9GS 3IODA 5KCMA 3CVXA 2V0CA 1GTSA 1I2DA 4ZCSA 4MWEA 2B7LA 3ZXSA 2J09A 2QTMA 3SEZA 4JXXA 2YY5A 3KT8A 3AG5A 5KHAA 5J58A 4QBTA 1O96B 1KQPA 4L2IA 3ZIUA 3HMQA 3A2KA 4MW5A 1QNFA 5K0TA 3ZGZA 3CLUC 2DXIA 1U3CA 1B6TA 3LE8A 2PZBA 5TEWA 4MUEA 3AL0C 3P52A 1A8HA 1WXFA 3FH0A 3ND7A 2GKSA 4MLPA 2HGZA 3P0JA 3NBAA 1T6YA 3A04A 3DO8A 3SDBA 1M8JA 3SZGA 2IELA 5FNZA 4MW2A 3IOEA 3N9IA 1R6UA 4G5FA 3PNYA 1WOYA 5AHWA 4YBRA 1H3FA 3HFJA 1NUUA 1PFYA 1T6ZA 4KR7A 1MAUA 4KPUA 2O5RA 1MOPA 1PFUA 4GU5A 4MUFA 3UK2A 2CV2A 4MVCA 1NUSA 4HJRA 1TYCA 1O0BA 1F4LA 4F3RA 5BNZA 1NUQA 3CVWA 1SURA 1WQ3A 1I6KA 2J4DA 3SYTA 1EE1A 3SZ3A 4DDKA 4CQNA 2CT8A 4CT0A 2D13A 4MUIA 3KT0A 4KPUB 3CLTC 1K92A 1KH1A 4XSVA 5TGTA 1OWNA 2X1MA 1S4MA 3FG9A 1M1ZA 1KR2A 1JMVA 3E27A 3UOWA 1O6BA 2CYAA 2CV1A 4DLPA 2NZ2A 4TS1A 1O5TA 3IOCA 1ZJWA 4PBRA 5DB4A 3TQOA 1IQUA 2BTEA 4R2MA 4JXZA 4AQ7A 2D54A 1YULA 3RK1A 1D2RA 3KT6A 2QUJA 1P7PA 3AFHA 1GAXA
chains in the Genus database with same CATH superfamily
2PD4A 4HB2A 3ZLTA 1KJJA 4MLDA 4F9TA 2Q9BA 2R00C 3EGVA 3FIUA 2O3JA 3LIIA 4LSWA 1N2CB 5EIHA 3WYEA 16PKA 3W8DA 4D81A 4F8YA 4E5YA 1J06A 1PLJA 3AYXB 4QWMA 4N47A 3T3IA 5EE5B 1ONPA 1OLXB 2N9UA 4WOJA 2TYSB 5EPUA 3FNRA 4HGRA 1KP9A 1ZJYA 3ZCPA 3BZUA 2QZZA 2WJAA 4Q1BA 4Y2YA 4CL2A 3BX1A 4HVTA 2YQ4A 3DXZA 3R9XA 5A02A 1GGNA 4CDNA 1TO6A 3TQHA 1QOPB 1G1AA 3EMDA 1UT5A 1E3SA 3AKYA 3HCPA 3H9QA 4YJHA 2XQKA 1UDBA 3JWIA 4IF4A 3Q8KA 1U1DA 1H6AA 2OVFA 1GGHA 2XJ4A 2ZRAA 3ADPA 2WB2A 1K8ZB 2WFLB 2C7BA 2FZWA 1LDEA 5B12A 1N33B 5K8CA 1USWA 2NZ8A 3OIGA 2WD7B 4BN4A 3AUKA 1WDKA 5JNTA 1WKVA 4PAQA 3MQFA 1HFKA 3TOZA 4LTNA 4LCEA 1SBTA 2C2HA 2C8JA 1GZVA 2GN2A 2HU2A 4OSPA 5BW8A 3PSHA 4KXYA 2R48A 5E0KB 1M5RA 1XTIA 3FXAA 4D3YA 4Y0VA 3DMNA 3IIMA 4YUXA 1SY7A 1XYVA 2BZGA 4MVJP 1SQGA 2VJNA 1VZ3A 3IQZA 2I4TA 2EV9A 4V0NA 2RK4A 4B40A 2TRSB 3DXFA 2BEVB 2X8JA 4Y1RA 2JLWA 4Y2TA 3L0PA 1PDWA 1QDUA 2XKBA 4WZBE 1CUVA 4X00A 3T7RA 1M6HA 3IJPA 5BYAA 1UJ5A 2O7SA 3NTLA 3Q3EA 1YO6A 4REMA 5JYDA 5KO2A 4FBMA 1J0CA 4I8DA 5BQOA 4HDNB 4W7HA 2ZSBA 4LA4A 3U6BA 3VR2A 3ZZNA 5I7OA 1ZG3A 1XG5A 2G1AA 1QCDA 1VG0B 1CVLA 3U39A 4HN2A 3AVOA 4M0LA 4B32A 3DV2A 2E1RA 3TRJA 2O4CA 3D4PA 2OP0A 4RBNA 3GU3A 3RJ5A 2HB6A 2GHIA 2AJDA 1JSXA 3OETA 5E1MA 2E4ZA 4EHJA 1I5EA 1PEAA 1UXOA 1S0UA 1CB0A 2ZAOA 3JAWA 3QLUC 1MO2A 2VP2A 2ZUCA 4O4LB 1K7FB 1P2DA 5BSGA 3JATA 2HYIC 5CVEA 3RWOA 1VL5A 2WNHA 3M9XA 1TA0A 3RR2A 2HSEA 5F78A 3WDMA 3SHFA 1ONOA 1YL6A 4GUAA 4TWZA 2HQBA 1IWOA 2RHBA 3ANYB 4GWLA 3DJFA 2O05A 4KNWA 2QQ5A 3IUQA 2CEAA 2QTGA 5LZ4A 4FI3C 4YY3B 3B3FA 3SJ7A 2WF5A 1TK3A 3VJRA 2IU6A 4WY8A 4V2IA 4P0QB 1KL7A 1TZKA 1EIZA 1EJ0A 5JPDA 2CLSA 1PJTA 1ADGA 1I1NA 1E18A 3PQFA 1F0KA 3SX0A 5JMWA 4U1RA 2QZPA 3CUEF 4L15A 1G2OA 3B85A 1ECFA 4FZ3A 1ZD2P 4WDQA 5CYFA 4B46A 3K70C 3C98A 1H4SA 3T7AA 4ZK2A 3VX3A 3M1IA 4LOLA 1Y6GA 5HKOA 3GLHB 4JEUA 4WUTA 4IVNA 2XBMA 5FTWA 3E22B 1D7AA 2JC3A 5DNCA 4ZI7B 1AXEA 3W7BA 5JEDA 2QAGC 1UPTA 3OQBA 1ZK2A 2EG9A 4LDJA 2J1LA 2A1UA 1M83A 5EKUA 4XIFA 5KOJA 3HFGA 3COZA 3IQIX 2XRMA 1PYDA 2Y1XA 4PX9A 4U0KA 4W8HA 4AUMA 1SA0A 3W06A 3BWDD 2XLCA 3C3XA 3LYLA 4BKMA 1U99A 1B0PA 3HACA 4G6ZA 2GB4A 2AQ8A 1VL8A 3GRKA 1NJGA 2HL6A 4P53A 3TRKA 2Q5FA 3L0SA 3A32A 1DRJA 2J87A 3AWDA 2VQEB 4X1OA 2O19A 2OLEA 3DMRA 1ATZA 3GUYA 3ORQA 4GBMA 4DC1A 5BV0A 1XEAA 1YQXA 5I7VA 5BN5B 2PTGA 3NALA 1NMXA 2C8LA 2GZRA 4GPZA 3H2YA 2UV8A 2GAJA 4GI5A 1ACLA 2UVDA 4WADA 4YACA 3PKZA 4WBNB 5TF0A 1NW5A 1X94A 1K6XA 3TH5A 2NSDA 2PY6A 4MULA 2CHUA 4P32A 4A36A 1NMQA 3FB1A 1FSFA 2YFYA 3X1KA 4YTEA 1EFTA 3CZPA 4U9IS 2YCLA 5C7LO 1Y81A 1BTOA 5M7EA 1LDNA 2WHQA 2IVFA 2IK8A 3SC4A 1Z0JA 1D03A 1GKUB 3LLVA 1AY0A 1OWPA 4PGAA 2GM3A 3U1VA 1UBJS 3ZR4B 3P2MA 2YFQA 1HYEA 2G4LA 2O7VA 4PSUA 3UMJA 2EL7A 3AW9A 5IC5A 2XITA 2B6NA 4FX5A 4LHEA 3EPJA 3GEMA 2NV6A 5DI3A 2CJFA 1P77A 3QFTA 1KJ8A 1QUFA 3K09C 4HX5A 4KRXA 4QDUA 1D9ZA 2DBRA 1WSAA 1GSIA 2ID7A 3LSYA 5E1OA 5GQSA 4CT5A 2PXHA 5D86A 4DIUA 1X1EA 2I0FA 3QLEA 4IP0A 3H9BA 4RF5A 3ROEA 3TZQA 1UP7A 5AM2A 3EPLA 3FOZA 5DNWA 2AR0A 4IDPA 1OFGA 2HT6A 3JASA 4E31A 4RULA 4C5CA 1JALA 1NRJB 4FWBA 5C1PA 2XVMA 2XYPA 4B2YA 3WP0A 1JBQA 1QBGA 2BFDA 2GNOA 3ZJ5A 4EABA 4EUEA 4BNXA 4YUYA 1ZI9A 4LPSA 5DM1A 1A9XA 3DUFB 4OU4A 4YRCA 3I39X 1C9MA 5J9FA 1IJBA 1Q0QA 4S0XA 1IQRA 4E1VA 1H2WA 3CUUA 4TL7A 2VHWA 3ANNA 1E60A 5CHYA 4CV0A 3W3AH 4AZ0B 2UZ0A 3IQWA 4NL4H 1EP1B 1SG0A 2CXXA 1KSJA 3CINA 4YRKA 3AKDA 3AL2A 3R5KA 1PI3A 1R27A 3NT5A 1IL0A 1YZYA 3ABZA 4BTLA 1O77A 4DG9A 5CDFE 4IXDA 3DFZA 3TK1A 3OE7A 6Q21A 3T0IA 2SKEA 2A94A 4MJLA 4TLAA 2A5DA 1AH2A 4ZA2A 4E08A 4X0EA 4F2PA 1R16A 5KC9A 2P6UA 4RQTA 5FHRA 1C9JA 3E9CA 4N1AA 3GLFE 4YAWA 4YJ2F 4EW2A 3JARB 3ZWQA 1TPYA 1E3WB 2DG2A 4XDHA 4C6SA 5JAMA 3KP1A 5BO5A 3QEJA 1M54A 4FGUA 4EJ0A 2MR5A 3UV7A 4E2ZA 2EKPA 4JYBA 3VMFA 4UCFA 3SC3A 4A6EA 4BUJA 3I23A 3FUTA 2HPZA 3TWOA 3W2GA 3IO5A 3QU4A 3I5AA 2BELA 5KBYA 3MQ2A 1N1MA 1N0WA 4HYTA 4M1WA 2O48X 4QO7A 4J4TA 4W4TA 5IWAB 2H0QA 3DE2X 1CUCA 4YV0A 5DGCA 3EJWA 1CR1A 2GK4A 4TVBA 3RFFA 3IXMA 4P0TA 3PGMA 4OJTA 4UCXA 4G07A 1Y3IA 4IH9A 1K3UB 1FFCA 1A3CA 1RQGA 3LWDA 3TIGA 2NV0A 1E6EA 1CY0A 1TQ4A 2FZGA 2O2YA 2XUQA 3DMGA 3GARA 3IMCA 3PR1A 3UJBA 1SN7A 1N36B 2ZBQA 4QEKA 2CE7A 2CVZA 2FZVA 2OCDA 5TMDA 4CMEC 4WZAA 2Z1DA 4PYIA 3GP8A 2L17A 4PC7A 3RC9A 1RAAA 1JN0A 3IE1A 4ZT5A 1OB2A 4FMPA 1F9EA 3T7EA 2FN4A 4GMKA 4OAPA 2ZTMA 1YBAA 3UJ7A 1ZONA 3P7MA 4X3PA 3WYFA 2PR7A 2J0VA 4NFLA 3QE9Y 3IEUA 3A9CA 1GRQA 2QM0A 4CKZA 2G6BA 3UMYA 4FYXA 1G19A 2Q5QA 2OBFA 1X9HA 5HKKA 3TNYA 1P3DA 1R9GA 1ENZA 3INGA 1BMTA 5T6BA 3ZDXB 5JWOA 1GRNA 3ZE0B 1LZKA 3LLUA 2Q49A 4MQBA 2CSUA 1YZGA 2GOYA 2WI8A 2AVNA 3LO8A 4AO8A 5KREA 3DV0B 3CJTA 4TXLA 1M6EX 4BNZA 2QN1A 2AXNA 2I22A 3H13A 2A2ZA 4XE5A 5BQFA 3VR3A 1SBZA 2JA1A 4EYOA 3AB7A 3RSZA 5DI9A 2ZIEA 2FOIA 3D0KA 2AWOA 3K31A 3ZGXA 5ADWA 2VDUE 5L4NA 4OUDB 4BJ1A 3EK2A 3JQFA 3LP5A 4ZCMA 1SXJE 2Q45A 1GPYA 1FPQA 3X44A 4BNIA 3ZIAD 3ZUGA 3FMOB 2ZI4A 3KQTA 1J0EA 2R62A 5B4VA 1WD7A 1YJ5A 3LNCA 2PZKA 4MJXA 3ILVA 2FMHA 4NV0A 4HNRA 3IEXA 3PUYA 1Y4AE 2CYCA 5DT9A 5CAEB 1VMDA 4G0NA 4B6JA 4ENWA 3BL6A 3DAFA 1T91A 2ZYUX 1R00A 4BMVA 1M6WA 1ZFNA 1Z4KA 1IULA 2R8OA 1E4EA 2WIAA 2IIBA 2Y1GA 1JDTA 2Z98A 4TL8A 1XROA 1ZRNA 1DIOB 2YQZA 1QZZA 2Z3WA 3ETGA 3WGQA 3M7IA 3LC1O 4QUEA 4UEJA 1RYYA 2XADA 3ADOA 3TZ6A 4CHGA 2E5LB 3LCJA 4HDMA 1A4XA 4KBGA 4L9RA 2Q5HA 3CYFA 4AS2A 1Y98A 2EF1A 4JJ4A 3BMOA 1JHDA 1L6RA 2PSFA 2QLMA 4N49A 5T57A 3MTAA 4PZDA 4UHBA 4EYGA 1GAWA 2Q4BA 3QVMA 4G1EB 4QXMA 4BKOA 4HFJA 1RRKA 4YV1A 1Y5IA 1DPGA 1A7UA 1VYHA 2R1UA 3H6HA 2VKQA 1MRNA 5DTQA 2UXBB 1GNVA 3DXXA 1EDBA 2BUAA 1AUVA 5LU9A 1IBLB 4GR4A 1OF1A 5DBHX 3L0YA 3H1PA 3II6X 3IVGA 4QDXA 2J48A 3T5DA 4QDKA 3UIEA 3WZ2A 2JLXA 1GAEO 3I9FA 3MCZA 4KK3A 5I7AA 5C32A 1EZZA 1NP7A 1KO8A 2VF4X 4XGIA 4E13A 1P18A 2XA9A 1BE8A 1H05A 1CHNA 2BKAA 5TB5A 2ZOSA 1GG9A 2HJRA 2ZI9A 2IXGA 3DOHA 3JVEA 3SKYA 1QVZA 2AG0A 4GBJA 5B7QA 3GVPA 13PKA 1LSSA 1FQJA 2JGKA 3WNZA 3OX4A 3RU3A 1AJEA 4WACA 3I4FA 2QXUA 5CLLA 4CTNA 1CZUA 1M74A 2WM3A 4EYQA 4D79A 3FSGD 1QYXA 1SXJC 1DBSA 2W6ZA 1DMRA 3KJHA 3WR5A 4DAOA 5FWYA 1FRQA 1VBFA 2AJBA 4W9RA 4ZP1A 2YV2A 2GPTA 1JQBA 2VJLA 4O29A 3P52A 3DNMA 5KQPA 3L7AA 1FDSA 1ORTA 2H1LA 4JR0A 4FEYA 3INRA 4CIVA 2HQRA 1G5PA 5P8WA 1QAOA 2IEZA 2Q3HA 1GDHA 4RNDB 5BMVF 2I7CA 5F5XA 4MPPA 5MN4A 2O8CA 1H6DA 3TAHA 2COUA 3UTCA 1XVIA 5FLEX 4C04A 1R0KA 1KGSA 2AZ4A 2CBZA 1KWGA 3AVPA 1YGYA 2W58A 1F4PA 3QI7A 1U8UA 1A72A 3W04A 2FQWA 3K2EA 4RHUA 1U2QA 4S2EA 3IAFA 4OBXA 2VBGA 5GZ1A 3RG8A 4BVBA 4GEGA 4E4TA 4KR7A 1QGDA 2YTZA 2O5RA 5H3CA 3D4IA 2QL5A 2P2NA 4EHAA 2IIVA 2BI8A 3K0AB 4JLDA 2HWYA 3A25A 3F74A 4X6UA 4KK4A 4BJ6A 3YASA 4JJZA 3H5AA 1OXUA 1KS9A 5ALTA 5FOVA 4CF4A 2QTVB 4BNMA 10MHA 3SR3A 3P27A 4KQJA 3PUVA 3GH1A 3KKQA 3LYAA 1NN0A 4IKOA 3EZ7A 4PFQA 3HXMA 1Z5PA 2CLOB 5DZSA 4JYAB 3M6WA 3TW6A 1XQ9A 1A98A 3FVRA 1IZ7A 4KFRA 5J40A 3TX2A 1JNXX 2IYXA 4CT0A 4F9FA 3U3RA 4QKQA 4RD1A 4B3HA 1K6IA 2UDPA 5IG2A 4BVLA 3F7OA 4JROA 5JOQA 2RG7A 3E27A 5LLDA 2P3OA 1K6MA 4A0HA 1P0IA 1HE1C 1MXHA 3IQDB 2QRJA 5DYIA 1KHTA 3N7TA 5BW5A 4ZZ2A 2Z9DA 1P5HA 3C6BA 3E6AA 3A9SA 3HDGA 4INJA 3BMQB 3WA7A 1NPTO 1XTTA 3BGSA 3T5AA 2PRKA 1BFKA 2Q2NA 2Q6VA 4JSTA 3K96A 1KI6B 3WWYA 2JAWA 3B1KA 5JZVA 1QHNA 4DM7A 4BEBA 3FOEC 2I6TA 4O5OA 1W0CA 2JFVA 2FSHA 2VRCD 1ZN2A 1A5AB 3OHPA 1PEYA 4NH4A 1HR0B 1HSZA 2HJ9A 3QSYA 2Q7OE 2EJUA 1JVNA 1PVDA 2G9RA 2JK1A 2FZLA 4PYLA 5JT1A 2O6HA 1DBWA 1YDGA 3REGA 4Q66C 4CCYA 2QN9A 1IB6A 1P7PA 1G42A 1VLQA 3BZWA 2BUCA 3DHYA 4ME6A 4L8LA 1SA0B 5GJVC 1Z7WA 4UPVA 5KAMA 2CLCX 3UAXA 4CNBA 1ZZGA 4F86A 6PFKA 3DAPA 4RFSB 4H17A 1KIFA 3ZQUA 1HNXB 2B36A 4XLZA 3PDUA 4TMYA 3AVUA 1TGYA 2R6GA 4H7IA 3ENWA 3F7MA 4UBOA 2HRQA 3EGOA 3NNDA 3ZU6A 2Z8ZA 3GD7A 2H1RA 4CWAA 2E55A 1AO0A 2ZSUA 3KOZA 3PX3A 2VATA 3AY6A 2OV2A 2XI4A 1P9NA 2HCRA 1L5LA 2DWQA 1ULAA 2FSFA 3PC3A 4NATA 3VHQA 1Z0SA 3E7PA 3VVMA 1E2HA 3O8LA 2WUVA 3G13A 1A76A 3QLTA 1D1SA 2P79A 3CNHA 1UODA 5IZCA 1DL5A 2GSDA 1UIMA 5B58T 1SZDA 1XZDA 1B2RA 1YBVA 2J67A 3ENNA 3MTIA 4GPAA 1HURA 4EEZA 1FP4A 4MCAA 4PSVA 4JENA 3NOQA 1B16A 2P67A 4ND1A 5FOSA 2DKNA 1E1DA 2EZTA 3QBJA 4TL6A 4EUSA 1JECA 1TU0A 4MDEA 4G1BA 3BAZA 4DLBA 2H31A 4QICA 4WCFA 4ZQEA 1RTKA 2ZSEA 2ZZKA 2P30A 3PQ3A 3D3EA 5DV9A 1DBVO 1VA4A 1EFVB 1JXQA 1KYWA 1ZVQA 2C5HA 2EKBA 2VJBA 1KZ9A 3GLTA 3IUPA 4YP6A 1Z47A 1RE0A 1TM1E 1S89A 4PBTA 4FNOA 4YMWA 1NPDA 4F71A 4RH3A 1XK6A 2ZYGA 4HH1A 1G63A 3L6OO 5K6AC 4FS8A 4JYPA 4YT5A 2H65A 4XWKA 5LVAA 3PKJA 3DO6A 3QWBA 1WXXA 4A0GA 5ADVA 1F2DA 3FWHA 3HBMA 4G4GA 1HQKA 1GCAA 4KN8A 2E5FA 4RK0A 4TTJA 4XYGA 5DLPA 1WEKA 3CX7A 1Q57A 2FR1A 2UZAA 3FCAA 4MWCA 2AZXA 1ZLYA 3LO5A 1UK9A 4EFKA 3VYWA 1XU7A 2FPRA 3NG1A 3OM1A 4R1OA 1Z7GA 1JBEA 2BEVA 2NW6A 2X8JB 4S0ZA 5IULC 2GS9A 4HOYA 4ZVLA 1SCQA 1P62B 4GZMA 5LDDC 1TCCA 4F2HA 5CG1A 3C8HA 2J0UA 3JALA 5E4JA 1AZSC 3A06A 4FGKA 1QJCA 3KPWA 2EAUA 5AI5A 1MJHA 2W6IA 4R2WA 3N8NA 1YHZA 3RAEC 4WZAE 3H4TA 2V98A 3LGSA 1THTA 3ST7A 3HJFA 2ERCA 4PG6A 4QOGA 4DLUA 5AK3A 4CKWB 1DBRA 3T1NA 2DHRA 1G16A 1N5RA 3K6SB 4LRYA 4YUWA 2MOKA 1DINA 1P2VA 1MG5A 3L7NA 2O2DA 4ENSA 1E69A 1TTPB 2CWWA 3NUQA 3BMCA 4TRJA 4R68A 3WMRA 4D9HA 8ATCA 4EQ6B 4L74A 4LGVA 1IHUA 5U1PA 3KX2A 5MFPA 2Y1WA 4UUPA 3WNBA 5IFKA 2EDCA 5JMOA 3K92A 5AKLA 3HLKA 5KNCA 1EDEA 4WINA 1TUEA 1ULSA 2CLEB 4ID3A 2GRJA 3R0QA 1CZKA 4A6DA 1YFJA 2BEJA 2R5WA 3S1AB 3E7FA 3TMAA 1DJMA 5IMSA 4Z0NA 3P4UA 3G68A 1QSGA 4Q3BA 4XTCS 5KYTA 5H4GA 2R6AA 4TVOA 4ARBA 1Y7HA 1EWQA 3CRZA 3E3LA 1F5SA 1JL3A 4YECA 3N0WA 1VI5A 5ERGB 5JAHA 3NFRA 1KH2A 2AR9A 1FU8A 3B8HA 2J45A 2JIRA 5EJ9A 5E9JA 2BY4A 4HAZA 2W98A 3COSA 3OSZA 2GZMA 2EWWA 4KC0A 3EGEA 4E5PA 3J7AC 2PZEA 1JAXA 2JJ2A 2HNBA 2I99A 4MQEB 4JBNA 3U2QA 4ILEA 4ZOLA 2J3KA 3M49A 1R6XA 4O2AB 4N3AA 5EHNA 3C8MA 1WA5A 1XZFA 2JJYA 2VUIB 3WIDA 3KCQA 2Y9MB 1ISRA 3EWNA 2P41A 1XRLA 1QWOA 2RH5A 3PYLA 4MAFA 3Q6NA 4CR8A 3H75A 4JLOA 2BP7A 3VKFA 1N2ZA 2Q28A 2QRPA 5JYBA 3EIXA 4AF7A 3C70A 3B1YA 5EN4A 3W5UA 1E4YA 3GFGA 3Q7TA 5JJ5A 1L1QA 1BU5A 2I4IA 2IYSA 1XEWY 4M0MA 3V5NA 4B7ZA 4OGGA 3BXPA 3O3NB 2VWPA 3MS2A 3GGSA 3GLKA 1JEJA 3HCAA 3MAGA 4WI1A 1FP2A 1OTXA 3RTEA 3TOCA 5ESXA 4ND7A 4UU8A 5D85A 1TXGA 1ORVA 1UMDA 3K94A 3TKYA 3M6LA 5KSOA 4N0EA 1GCOA 2FK8A 2R2AA 3TVYA 5F9HA 1E0DA 1OPXA 3L1HA 1AKNA 2YIMA 3NBZC 4HZIA 3HLTA 2F48A 1Z25A 5G3YA 3TDKA 1GGJA 1P4AA 1JVBA 5PNTA 5ALXA 2WTNA 2WR8A 5JDIC 1TT5B 2B8EA 3H97A 4M3NA 4OA8A 2CCKA 3C15C 4QNNA 2ZBEA 3R8CA 1NSTA 4F91B 3O03A 4IWYA 3TKAA 3VZQA 1VBNA 4TMXA 1G21B 4YWJA 1ZW1A 3GFBA 2R6CA 3HJUA 2H2GA 3JD2A 2QVGA 2PWAA 1TEVA 3K0CC 3W3AD 4RHTA 2AFVA 3R6DA 4PFSA 3WDLA 4UNSA 1JE0A 4X94A 2C2ZA 2WIFA 1QE5A 3EA5A 4LXYA 3Q7EA 3EARA 1UFRA 3IVXA 2DFKB 4R31A 4RJIA 2WTAA 1ZJ4A 2I9PA 2P2CA 4HYYA 3C7DB 4P36A 1A82A 2OCKA 4JP8A 2UYHA 4V3BA 2EF0A 3UG6A 3G0HA 5DHPA 2HBQA 3DDZX 4W7IA 4OV6B 4F4JA 3DCNA 1GN8A 4ZARA 2AC2A 4CN8A 2ZAIA 4MVJA 2CHEA 1GA4A 2IYQA 1PFVA 1GG8A 2RGNC 4WA8A 3TPZA 1MABA 1PT9A 3AW8A 3P20A 3DLTA 4BNDB 1ZA1A 3H8SA 3C8ZA 3L6BA 3LYHA 3U7JA 4Z1OA 4BUZA 4PYKA 3LCCA 3MLAA 2CHVA 4YJ2A 2J46A 2OILA 1NI3A 1U9IC 4V39A 5ICCA 5KNLA 1HE8B 3F1LA 3DMPA 3R3ZA 4MYUA 4R54A 4S1OA 1W36D 1T8UA 3AR6A 3QPDA 5LYJA 1EX7A 3TW4A 3VHRA 4AM8A 3JQDA 3OZDA 1PSZA 3EPPA 3KT3A 5IDYA 3M1YA 3B3GA 3HZRA 3SI7A 4RADA 3K2BA 3HKBB 1Z4LA 2XA1A 2SCUA 4NG4A 1A71A 5FULA 5AK6A 2ZP1A 1U3WA 3JASB 3QNUA 2WVHA 1XWIA 3ABRB 3PQ7A 1M10A 3Q7RA 4J1TA 2QMUA 4ETMA 2IP1A 2JH8A 3CLRC 3ICOA 2AZDA 5H7XA 4PYRA 3DZBA 4KPYA 3IOYA 3S2ZA 3TB4A 1GZ7A 4PNZA 3Q7IA 3OBIA 3EXFA 3R3VA 1M7HA 2YIJA 2I3BA 1G8KA 4LDAA 4M0CA 4OGLA 4XRGA 2ANBA 1KI6A 2A8YA 4IFTA 1KAQA 3W6OA 4MCIA 2I3GA 3DZIA 5ALYA 2ZQ5A 3FDXA 1C9YA 2D74A 2FHPA 4ZAVA 5F4ZA 2AFHB 2FGKA 5DGDA 4FCVA 3HM2A 3S28A 1S8FA 1VL2A 5GGXA 3PJFA 1X9GA 2GT1A 1S4QA 3I2GA 3QPUA 5CK5A 3RC3A 3C1UA 4G2NA 3L8EA 4WXPA 4Z0HO 1MA0A 1SQ6A 5M2QA 4A27A 1BGXT 4KXXA 5KNBD 2WSIA 2GVZC 1X1SA 3RBXA 2VDJA 1GKIA 3BXXA 3KAKA 4HLUC 5AXBA 3K8ZA 3PWKA 2G83A 3KKLA 1PU2A 4XA8A 1R6TA 4Y7CA 4IUBS 4B6GA 4OHRA 4AJIA 1X1DA 3TZCA 1FUIA 2PDAA 1JS1X 1RYFA 3VDNB 1PR0A 1PTJA 3I28A 3B1VA 1CEXA 3DOUA 2CJWB 4NBKA 2OCIA 3LXMA 5H5JA 3IBYA 4RGVA 3KZCA 2XB6A 2X86A 2ONZA 3KYCA 1GXSB 4ZEOA 1Y1SA 4WOKA 2NVOA 4J3JA 3FSRA 2IYYA 1BQ3A 1O4VA 1QU3A 3GLRA 3N2EA 3THWA 1XDWA 1F1JA 4G8JA 5KOHB 4QTYA 4OB7A 3BCSA 4MUBA 1D6MA 2HHJA 4AN1A 5AVOA 3B3QA 1AO3A 1OXTA 4IOJA 4P84A 4BNJA 2HTFA 1GADO 1NY6A 1V95A 2O3SA 2PFSA 2AYZA 3QOYA 4QUAA 2WA2A 4RJKA 5EE9A 3TDMA 4OHOA 3AB3A 4HSGA 5T7BA 1OR8A 4P3YA 3NIWA 3CFYA 2ENWA 2EWVA 2IOYA 4PANA 5COQA 2H59A 5IT9A 3ZD8A 1YA4A 2PGDA 4D42A 4YROA 3SM9A 5K6AA 4KNYA 3AVWA 3PGA1 3PE4A 4D9KA 4EW3A 3HADA 2CZQA 2QMYA 1ESEA 2J9FA 4CKYA 1J22A 3JVVA 1H1TA 4M76B 1ACMA 1OZFA 2OR3A 3EODA 4G1FA 2Q9UA 4JP1A 4JT4A 3HZOA 3CZCA 3PNVA 2KM1A 1AK1A 3EZYA 1J0BA 4KWTA 3X1YA 5HRAA 4NE9A 5KHOC 4UAVA 3IAS1 4FNAA 1FJGB 3UMRA 2JD1A 1MDFA 1NQ5A 3PXBA 3Q4GA 1O03A 2R1VB 3EGDA 3WQBA 3DQZA 3IP6A 4C7OB 1V4BA 3OAAA 3WRXA 4D8YA 1KQFA 4MRAA 1G5IA 2O8FA 3RB8A 3LXRA 3EIQA 2PUAA 3G9QA 1A97A 2BFFA 3H4MA 4PQGA 3L1UA 5A71A 2AXPA 2G5GX 4ZZ3A 4WLVA 2PQMA 3KZXA 2ACEA 4H1HA 3WLRA 4K6KA 2G76A 3K8QA 3D6FA 1ZOPA 3QNWA 2ZM5A 1PKXA 3STHA 5J1SB 5JNSA 4X3OA 1UEXC 4YJFB 1DX9A 3ZWYA 5EJ7A 2RKBA 3C74A 1XZBA 1T8TA 4WN3A 4ZVVA 5DM4A 4TZ0A 1CUWA 3P9KA 1XA4A 5J5AA 2LPMA 1W75A 4KYUA 4F5YA 5K2OA 2OMEA 2W2LA 2GM9A 2JI6A 1LY1A 3OEHA 2OV6A 1M75A 3GVIA 5JANA 4GX5A 3L4EA 1EFAA 3NWJA 4BZZA 3OPYB 4PO9A 3UW1A 4ZJZA 3HXPA 3VR6D 2YHBA 3IODA 4U0JA 1GJRA 3GMSA 2BMFA 2GVNA 1CW2B 4R3NA 4QTUB 2LTAA 5FBVB 4HN9A 3NTXA 3CVXA 5M34A 4GQIA 1XZLA 1UKZA 4UUQA 4LNHA 1W2HA 4M1OA 4ZVKA 2D00A 1XJ5A 1RU3A 1U94A 1NNUA 2VTDA 3KT8A 4O2RA 5KHAA 3IKVA 4NKRA 2B98A 4S3MA 1GEGA 1M1YA 3NXSA 3V6MA 5CFNA 1JBKA 2LCFA 1SMKA 3OU2A 1UMCB 3ZGZA 1F48A 2BKUA 4JJ7A 1ELOA 4MRNA 1ZK3A 4I9GA 5AXAA 2GAFA 2Y05A 1YU9A 2WUEA 1HDZA 1BEEA 4BNLA 2C07A 2X77A 4JEHA 2BM8A 2FWMX 3OHMA 3QUTA 4LPKA 1E3TA 3OE7D 2O1WA 4IGIA 1Z63A 1N9GB 3AUFA 3LA8A 3OZIA 4BB5A 4ETNA 5AVWA 2GEJA 1HBJA 2ZUDA 2R7NA 1IUKA 2IYLD 4X20B 5BUZA 4LW8A 3SHWA 4W9NC 2ZSIA 2XYGA 1G3MA 1NJ6A 2XXBA 1MQSA 1KZ1A 4IVPA 4LWOA 2BHTA 4BYMA 3FTFA 3AXSA 2GD6A 4F3TA 2YINC 1EB8A 4HUJA 4MRMA 4N7MA 4U5QA 1VLZA 2BFBA 4B83A 2CLMB 1PFYA 3ROZA 1Y7TA 5CD9A 4P5PA 5FF9A 1PR3A 1CZNA 3C6QA 1QV9A 4KPUA 4MARA 4Q9JA 4IIGA 3UV6A 1Q5PA 1PFUA 3H3FA 3MILA 4UM9B 1JEYA 5AW3A 4D44A 1CG6A 3H5VA 1OHHD 2JDIA 1AS0A 3LZCA 2IEBA 1D0IA 1NGSA 4XVUA 4BLTA 1FFEA 3L4JA 5D6NA 1T2FA 5TQ2B 3NEPX 1F4LA 4OK6A 3Q5GA 1VC2A 3F97A 3GUCA 3ZI7A 4JB3A 4ZTUB 1Q2XA 4TKVB 5E6UA 4BE4A 5AHRA 4IIVA 2KWIA 5EWJB 1SBNE 2RB4A 3OFND 5FA6A 2IEIA 2EW2A 2HWKA 4R5HA 1KNQA 4CQLB 5A4DA 1U9ZA 1X1BA 3CNLA 3EVAA 4IMIB 1MQ8B 4RD6A 3KG2A 3CKKA 3VSBA 2JB9A 2AD1A 2NU7B 4I5GA 4EPVA 1LVGA 3UYKA 4ALKA 2LV8A 4QEDA 4HNAB 4D56A 1GPNA 3WK4A 2PKXA 4OSEA 5EXEA 1N5KA 2Z58A 4M53A 1I94B 4R2MA 4JXZA 3U19A 4LOIA 1YMVA 5JZOA 3C4JA 1OFVA 1Z22A 4FN5A 5LQJA 3ZHSA 3W2EA 1EVQA 2H54A 1FA9A 1XLTA 1PJAA 1IZ8A 4M0DA 2BR5A 1AKEA 5EG5A 1Z7BA 4C4RA 1ZCFA 2IY9A 3T5PA 1WXQA 3HCEA 2O8VA 4M83A 2AHRA 4MRVA 1JU9A 1GKLA 4RK6A 4U6QA 2DFPA 2M1XA 4RGYA 2A0UA 1VPVA 4YJHB 4OBBA 2B1IA 3LUAA 1VP3A 1NXOA 2A0YA 3I9JA 1KK2A 1P2TA 2P1ZA 3T95A 4E5VA 3LW7A 1MTZA 2F1KA 2IUFA 1W1WA 3CRVA 2ZRBA 3E18A 4XEUA 3TLGB 4L4RA 5AKHA 5T4EA 1X70A 1ORDA 1HK7A 3R8XA 3JVDA 3SJZA 1XNGA 2B2NA 1W4BA 1OXMA 1XXHE 2GD2A 3LVQE 2BGMA 3LVBA 1UPUA 4KQHA 3SYRA 4Y7DA 1VSVA 1ZJJA 2XBLA 1P8JA 3Q9SA 1DAHA 2VSYA 4Q05A 1H1DA 5A5DA 5LA6A 1JEDA 3ES9A 1NUTA 4BO8A 2NZYA 3LM8A 3VKHA 1SEPA 2ZRPA 4I5DA 4UDXX 4K6HA 5J2TF 4DMLA 2DQZA 3COPA 1MG0A 4LFBB 1X0XA 2V6MA 1JAZA 1DIHA 4G0XA 4DUGD 2AC4A 2YXNA 3LZ6A 4LJRA 4ETWA 3M4ZA 5GJWC 2DETA 1OMOA 2F1OA 2OV1A 2WHEA 4MUXA 3DLAA 2FG7C 4BU1A 5B1YA 5J4YA 2XWQA 2WD8A 3T4XA 1M6VB 1TEXA 2CNLA 2JGEA 2ST1A 3LFUA 1OWMA 1E6UA 1MGPA 1K27A 1ZXLA 3A6KA 3OM0A 4G9GA 4IGAA 4RLSA 5CIQA 5F33A 1ZCAA 3RSLA 3CNNA 1L6IA 1L4KA 4KX5A 5LZ8A 1V25A 3BKWA 3QZUA 2OG1A 4OI1A 4WHMA 1YJQA 3K0BA 4I4LA 3W05A 1O8BA 5IW8A 1Y8QB 2V7EA 4EB6B 3R5FA 1N3IA 3WLEA 5EUMA 3OTIA 4FFDA 4OYHA 3QYAA 3PA6A 1GCGA 4K9KA 4IHQA 3RYFB 4IXNA 1G17A 1P2SA 3WO1A 2O2CA 3VRHA 2YNMA 1U4NA 3W34A 4XDGA 1IQ0A 5IARA 1JDUA 5ALMA 2OL4A 3DOIA 4UM7A 5LOVF 4OX9Y 1UINA 3ZCQA 1USVA 2VDWA 3TD6A 3AIMA 4GPTA 1N77A 4FSHA 4ALIA 1Z74A 3REQA 4FUTA 4YJFA 3JQ8B 4G1MB 4DMFA 1MFPA 2K87A 1ZCZA 4RPGA 5LA6B 3BTSA 4LE0A 4P7KA 4NZPA 1BNCA 4UNPA 1ISGA 4MDYA 3HMKA 4RPCA 4KITB 2Q5OA 5FEUA 2ZETA 4QU0A 1SUIA 3LHFA 1ZH4A 1OBFO 3L7DA 4KXNA 1QG0A 3QUSA 1AV6A 3DE3X 4DCOA 4Q4JA 5KMGA 2VVTA 2JJ8A 5K2MA 1V7ZA 2R8EA 4J2HA 2AOUA 4ZZ0A 2XUZA 1D04A 3GBVA 3WLAA 4BKUA 1QLHA 1UIRA 3JQBC 4EECA 3MCTA 4F4UA 5IABA 1P2GA 4AUKA 2G9NA 2R751 3GP5A 1WZIA 5CH5A 4MVJE 3WNDA 5H9VA 1ZINA 2I7DA 3QXCA 2DFTA 1XVAA 4YNBA 4ESHA 1TM5E 1ZI8A 5SV2A 4NY1A 1K2VN 2O6LA 4FYYA 1KVTA 2YHAA 3O8OB 4HXEB 4A8PA 4BWFB 2CXTA 1I7LA 1I32A 3R3SA 4LYJA 5FWDA 3AVXA 1L7DA 1UZMA 4YRDA 3KQVA 1E9BA 5BQ3A 3FLBA 4A8TA 5FR2A 4JLUA 2HMUA 1VE9A 1Z2NX 4UAJA 4LI3X 3UCEA 2YBDA 2A7XA 3EXIB 3V9PA 2PJRA 3K53A 5DTEA 4Q21A 1P6XA 5AUOB 1A2KC 2G6TA 1JFFA 2QMZA 5A2QA 3JQCA 1TTQB 2GD0A 1I4TD 1Z3IX 2VHJA 3PENA 4L3VA 4Y9DA 3RC2A 5J3JA 4QGBA 4RK4A 5DRYA 1WXWA 5EHGA 4FCWA 2Z43A 1IPFA 1XMVA 4FYMA 3WMWA 4BQRA 1GD1O 1CRPA 4X1YB 4D0NA 1T8WA 3HUUA 1JV2B 2FAXA 2WIDA 3AP1A 5FTNA 3L7OA 4OREX 4C6HA 1DXYA 3G17A 4BFLA 4FR5A 1II0A 3IC5A 1YOVB 1L5KA 3D31A 3E53A 4LDZA 1XNJA 4DYDA 3Q3GE 5AH0A 2JANA 2IZ7A 4UBNA 4KE7A 1GR0A 1CJUC 2ZRFA 3R4VA 1KDYA 1OXSC 5H8WA 1L3CA 3BE8A 1N1GA 2VTVA 4FMDB 3ZIDA 4ONEA 4Q3LA 1XDSA 2Z4TA 2NVWA 3Q10A 5CA1A 2Q46A 2Y67A 1U0JA 2D0IA 3ZK9A 1WO8A 1JEYB 1I0ZA 4F3YA 4OCZA 1U8ZA 2VK4A 4KQXA 3ELUA 4ZU1X 4K9MA 5BOVA 3G49A 2DPHA 3H8JA 5E3IA 1WB9A 2E4UA 1DC5A 5BQ5A 3LF2A 2P78A 4K6CA 3KC2A 5KTYA 5ENDA 5KVAA 2J5KA 2BL4A 5IBCA 1J1IA 3CEHA 2FW9A 3EIOA 3I6IA 4TMWA 5C4GB 5LMZA 4FP9A 1I01A 1W88B 5DMXA 1AE1A 2PL1A 2W93A 3KDSE 3RBAA 4NE7A 3RABA 1PR9A 1N2HA 2QTRA 4Z4CA 1G1MA 2UZ1B 4KKXB 2CCGA 4C0WA 4A5OA 3U7HB 3H6GA 4YGXB 2FPMA 3A7DA 3AESB 4R2HA 4X93A 5LP6F 4HPXB 1F0NA 3ZWKA 2JJ2D 3OPVA 4X9XA 4HWRA 2C1EA 4HEA6 4TGLA 3WKBA 4HSEA 4R01A 1D6NA 5ALPA 2IYTA 2YUTA 3IT0A 3QEMB 1ISFA 2AJ8A 4Y6SA 4N48A 2HD4A 4YHBA 4JC0A 3RIMA 3FY4A 1PW5A 4MAMA 2X0JA 3WXMA 4W9MC 1GNLA 3A4VA 2C83A 2VP5A 3ROPA 2EZ9A 3FUVA 3QU7A 1VLJA 1PJZA 3MAJA 2PMDA 4ZCPA 1HXHA 3IEMA 1M1YB 4QIHA 3S55A 2IL1A 4B3MB 3AM1A 4BNKA 1KYZA 3FGZA 5GADl 1J2JA 3L40A 2H1SA 3PR2B 2HFKA 3ON5A 1P72A 2PZ8A 3Q0EA 1KBOA 1NJ8A 2W90A 2JBHA 4MYRA 5ICFA 3ECAA 4KAXA 3CU5A 2V7BA 2MDTA 4IDHA 1O6FA 1J2YA 1QX4A 4AJNA 1VKNA 5KJCA 2HLNA 2QDXA 5CCEA 2AZMA 1A5SB 3ASVA 4Y6LA 4ZMRA 3G0DA 1KSHA 3T99A 4BRSA 4UPEA 3HYCA 3SOZA 2X2OA 3LD9A 4IO0A 1NFQA 2J5XA 1H5NA 3VGPA 7GPBA 1KRXA 4TVSA 3L92A 1T3TA 3B6MA 4C4XA 3NDRA 2XRYA 4M7RA 4J1TC 3NDJA 3BDVA 4HMPA 3ITKA 4V0LA 5IAKA 3VTZA 4HVLA 3M3PA 3UANA 1Y9ZA 1XZCA 1J70A 4K9QA 1T6XA 3WAKA 4WY2A 3CNBA 2P2SA 2FW1A 4LQCA 3OEEA 1PR6A 1GPBA 3FYTA 4NEHB 4ZQGA 2DTDA 4L3OA 4E21A 3N5CA 1HDIA 4FKZA 4I50B 3OO1A 1DIRA 2ODQA 1YK0A 4CM9D 4YJ3A 4FOTA 3LT0A 1TUBA 2P4QA 4V1CI 5IVPA 4N6NA 4X7BA 4ZYZA 2OAP1 1KAEA 2DLDA 4V0KA 2GRAA 2OZLB 2IS2A 1E6WA 3FHOA 2WHPA 3HJAA 4QYXA 1U3FA 1OGIA 4EF4A 3FGOA 2HDNB 3QHAA 4L95C 5KJ6A 3GEIA 5EQDA 5KKNB 1BRMA 1M34A 3PQDA 5A0TA 4LRTB 5TQ0A 2RGBA 2QZ9A 1VGRA 2X9VA 2W6ID 3WZMA 4KP7A 1L5HB 1U8AA 3EIEA 1UBHS 1VLHA 2Q3CA 3C1TA 4L6CA 4Q4HA 4RJLA 4MPRA 3GRRA 1P0PA 3TZHA 1F20A 4WV3A 1LRJA 1WR8A 4NESA 1IG3A 1R4AA 1N75A 2WHYA 3N70A 4JH0A 2H5IA 4BNWA 1MOSA 3RS9A 2F7SA 3AYZB 3NBKA 5ILGA 3GWZA 2FTKE 2C4MA 1PBTA 1JDSA 3HJCA 1O57A 3LQKA 4MS1A 4N0QA 4RSHA 5DHUA 3VC3A 5JRDS 5KQSA 4HQNA 2Y1KA 2PIDA 3PHBE 5DWQA 4BX3A 1U90A 1UJ2A 1AT1A 2H2HA 2ONJA 5C4MA 1G59A 3LQ4A 1ZPDA 2AE2A 4GX1A 4CEHA 3FFXA 3OESA 5AOVA 1GLVA 1EVJA 4G5OA 4B9EA 5BURA 2I91A 2A3NA 1YS2X 1Q0LA 2ZJ2A 2E4VA 4KXMA 3UUFA 5JMPA 3LMKA 4B6EA 2VHQA 2YBEA 4Q9NA 1UZLA 4EJ2A 1SOUA 3LU1A 2QGZA 2WJHA 3RRFA 5K01A 4GSKA 5CJJA 5JYCA 2O7NA 3GPBA 3I0MA 2OYRA 5I45A 1J9GA 3LUPA 3NWPA 3FFBA 4F7WA 1H85A 1I1OA 1CQJA 2G9UA 1H4QA 5A1TA 4IYJA 1V39A 1V1RA 3QMVA 5BV1A 2QQEA 2Y0DA 3ZHUA 2V8OA 4D74A 4YMHA 4LF7B 3K0KA 4AMVA 3D3WA 1TCBA 4DCVA 9GPBA 4OLAA 4MO2A 2A84A 4PY2A 4KH0A 1JPNA 5B3KA 3LW8A 3UXHA 3AF0A 2GPAA 2C4WA 3G2QA 5GINE 3MJRA 4ZI2A 1ACJA 5ARDA 1EFUA 3CZAA 4IIJF 3W6ZA 4Z6KA 3DC2A 3V7UA 3PF8A 2A59A 5HNKA 2BSXA 1DX6A 2PVCA 4FZ5A 4LYHA 4ESOA 2IQ5A 1C0EA 3GT3A 4FHFA 4LUCA 3ZV3A 2AJLI 1L7XA 4WKCA 2J9ZB 4WJLA 2JASA 1QZXA 4AMUA 2QX6A 3QWHA 5ESWA 3AR2A 1AKYA 3R75A 4LS3A 1XCBA 2I2DA 4B2LA 4CKEB 4FFBA 3HY6A 2ZJ0A 3QVKA 4RFLA 4WXEA 3B13B 1KZ7B 1R9NA 3CXRA 1L5OA 1IATA 1JUDA 1VYVA 1Z12A 2GFHA 1DTEA 1WBJB 2P11A 2VNKA 1E2IA 2ZLBA 3CTMA 4LMBA 4Z9BA 1IEVA 1Z6PA 3BJEA 2AXEA 3L1JA 5E4TA 1D6SA 5L7TA 3HQ4O 3GPCA 5JG7A 3OPYA 4B3CA 3LT2A 1A8UA 2Q07A 3UGKA 2GDJA 3LUJA 4CTKA 4H4DA 2R60A 1T6NA 1SC4A 3OQ1A 1KBZA 2VF8A 3MBOA 2ZXEA 3BH7A 1C4OA 3BWMA 4FDUA 4HFRA 1USUA 5BRJA 3AR4A 4F97A 5IKEA 4TS3A 2G7ZA 3RTBA 5IHPA 2A9JA 5NLLA 2RH9B 2H00A 2UYGA 3F6BX 4M8LA 1Z8NA 5HEKA 1NN5A 1BXRB 1BGVA 1CVIA 4KIUA 1GPH1 3OZTA 4AIIA 3CONA 1YVEI 2BEUB 1C81A 5FWYB 2SHKA 4IIYA 2MMCA 1DV2A 1F6BA 4CU5A 2FKNA 2VP3A 4OQDA 3TCNA 2FETA 3MWDA 1KYIA 1LXCA 3EEIA 3PZBA 1SXPA 4RDIA 4OVKA 4XWGA 3TLKA 3O84A 4W63A 1CS0B 1JG7A 4IMPA 3ZGOA 1E20A 1GVHA 1PK7A 3HU2A 5ECWA 4JXXA 4HYQA 3JAKB 5FUQA 1GQRA 3QVGA 3QUBA 5ARBA 3K6RA 3SMQA 2C8VA 2NT4A 5L3VA 5B3JA 4HX2A 4W1QA 5JS1A 2GEVA 3DLCA 4RZ3A 1E9VA 3IEIA 3ACBA 4J9VA 2DQSA 3AFGA 1RS0A 3JQPA 4LHXA 3S2IA 3VPFA 1ZGGA 2Q2OA 2ACWA 4XWTA 3HWX1 1NQWA 3PEUA 4E14A 1DOZA 5F2OA 3KZMA 4IZHA 1A8HA 4GM0A 4L5BA 3TBFA 3PIDA 2WAXA 4HDKA 3EXG2 4XAQA 3EQ7A 2EKQA 4TUYA 3K4PA 3KD3A 4D97A 3U44B 5EHIA 5AOCA 4QGGA 5T5QA 2DWPA 2OCYC 3HB1A 3LBNA 1HETA 4XGNA 5JMTA 3ECCA 2EBUA 4Y30A 1V8OA 2J33A 3K4HA 2XXAA 3GFRA 5DYYA 5AJTA 1X7WA 3PNYA 2A58A 4H6VA 4TKVA 1E1CA 4R6XA 1IDN1 2OA0A 4BRUA 5BN4A 1KZ6A 5IT0A 2HMVA 4HN4B 2C00A 3IRVA 1BKDR 2GEKA 2N75A 3C5CA 4JI3B 2WJJA 2XD9A 1FOEB 3VDQA 4RL4A 1QVWA 2AFIE 1APBA 2R4UA 4GECA 1U2TA 1T4BA 2P5UA 3GV0A 2BW0A 4CGZA 4LV5B 2QQFA 4I1YA 5JLJA 1NW7A 5EJIA 4YRRA 4HNSA 1NYTA 5HDBB 3HSYA 4YR9A 5SZHB 1NUQA 2W6QA 1DX4A 1U2EA 2YXEA 3G2LA 3ONEA 5CNIA 1YQDA 2RH4A 5EIAA 8LDHA 1FYEA 5HJEA 2AMLA 1EE1A 2QM8A 4XQCA 2YMLA 2CLLB 4QODA 2XUPA 1NE7A 2XDAA 4ETIA 4BGVA 1NATA 3ZY4A 3GEEA 4NAVA 4B6SA 4GDFA 4YDRA 3NHFA 4MUIA 3ABIA 3WGKA 4KPUB 4V38A 1QCZA 2ZRNA 3GEPA 3HA3A 5IUKC 3W8NA 4DBLE 5J2UF 2P9FA 3HVUA 1QE3A 3GDGA 4GSLA 2VCYA 3BICA 4TWIA 5B3AA 3GLIA 2WC1A 2KYRA 1YR2A 4XOIA 1RKBA 1T5IA 3BA1A 4XWYA 2WDZA 2WYIA 3T7JA 4CDRA 4DTCA 4G5XA 4YK7A 3HUFA 4IG9A 2HLPA 1E92A 4X8HA 4DC0A 3RE1A 4XSGA 3EYAA 221PA 2JCBA 4EENA 3TTXA 5CVUA 1HORA 3NLLA 1U7WA 5ED0A 2XNDD 2QG6A 3NZEA 4YCDA 2PA3A 1QNLA 3KCNA 1IN7A 5CT4A 2D54A 5EXSA 1NG9A 3KOWA 3HVIA 3RK1A 5C1OA 4O59O 1ZN7A 4W1RA 4DAEA 5FOQA 3GGDA 1ESZA 3K9GA 5BV7A 2P7IA 3FMIA 1KR5A 2FKAA 1GAXA 1XJ0A 3P9SA 2FN7A 3SLKA 3OTHA 5L3QB 1MGOA 2R87A 2OWEA 2YWEA 2OE2A 3BK1A 3OWXA 4JI4B 1DMSA 4NAHA 5DHQA 5JROA 2DYKA 4L9SA 4LGYA 3DBLA 1BWSA 1OU4A 1D1QA 4KYIB 1JYSA 4U2FA 5COBA 2ZSKA 1H8HD 3AU8A 4DNPA 4XGRA 4G5QA 2H4WA 1PR2A 1S8NA 4NOMA 4YXWD 4EG6A 4D98A 1P75A 5CDYA 5DE3A 5IF3A 4CDMA 5AVQA 3L9XA 2IDKA 5CPFA 3BXHA 3H84A 3R6LA 3PXXA 4OQXA 2PUGA 2NUPB 3X1DA 5KNCD 3ECSA 1OU0A 1GARA 4BXOB 4PQFA 5IBQA 3SYLA 1G7SA 2Q5CA 4KI7A 4ZRDA 4U7FA 3GLSA 2CJYA 2VQ6A 3V55A 3BMQA 1G5RA 3OT4A 4D8XA 1U02A 2PS0A 3B6JA 3NC1C 4I08A 1FFWA 1A5TA 2VTEA 4JT9A 3RIEA 3QPVA 4D4LA 2H3EA 3ANTA 2JRCA 4CKXA 3QI2A 3DR5A 4Z8YA 2O8DB 5REQA 3KKMA 2NU8A 1NRIA 1ZL0A 3UKJA 4BIIA 3HZZA 1Q95A 4IZIA 2Y71A 5EWMB 3WK9A 3W9SA 4UBLA 2X1LA 4NJEA 5JVDF 1NXSA 3I6QA 8OHMA 1WSBA 2Q3DA 2IZ0A 3NJRA 1MU0A 3RAJA 3TL3A 4C3ZA 4URVR 1NG1A 4NDAA 4KQ1A 3ZGLA 5B4UA 4UHKA 4CKBB 3A6DA 2YHIA 3DBIA 2JIOA 4NFYA 2BEWA 4RSRA 5HBRA 4D8UA 5AVZA 5J43A 5INTA 2W2KA 3BJIC 1E32A 3C3KA 1Y8CA 1TLLA 3MT8A 5TE9A 4KE8A 3V9AA 3KB1A 3GELA 1SUPA 3L18A 3GYBA 1BA2A 3NTQA 5KNCH 1JILA 1SD2A 1HTTA 2V0NA 3CMMA 3FN4A 2H9YA 4GXNA 4HTFB 1YQ9A 4PHGA 521PA 4YPOA 5JS7A 3UPDA 1JA9A 5CMLA 4AKEA 5CX4A 1Q0TA 4Z54A 1G5FA 1AZTA 3U7QB 4RTPA 2HIHA 2Z8YM 3M6IA 5JCOA 4AS1A 1GPWB 4Z4GA 4E70A 4C2TA 4DNXA 3OIFA 3SJCA 2P5TB 1T9KA 2OFWA 2FJPA 1PZXA 2ZRLA 3A6GA 3N86A 4F84A 5HUQA 4X65B 1KC3A 1TK2A 3BJZA 3N0TA 4OHMA 1XPJA 3KPYA 1WW3A 3DAYA 1EXDA 3D2AA 5HYVA 4WY5A 4FI3F 4XWAA 3MGAA 2P4UA 3PPWA 3UQZA 1FRZA 3N75A 4RMHA 4DDTA 4CUKA 5IT5A 1WXIA 5K7SA 4CXMA 3H83A 2AMYA 2OORC 2QSUA 4A92A 4QA9A 3SIXA 1VB3A 2XDQA 3KRTA 2VZ9A 1YWGO 4F5WA 5I9IA 4LE1A 2F90A 3L93A 1PV2A 2QUIA 1DXOA 4OG2A 5F76A 5T64A 3UBMA 2OXTA 3THWB 4KDFA 1ZH6A 2O07A 3SYNA 3ZLBA 3GEHA 1GG5A 4BZPA 1ES9A 1NQXA 4C03A 4KCGA 5BYKA 4ERXA 2HNAA 4WEQA 1BDBA 4OI4A 2FA9A 1C30A 1YS4A 1W4CA 3ASZA 3CNQS 3EAFA 4RELA 1JKXA 5HA5A 3EW7A 2ADFA 1PGQA 3BSSA 4UDYX 5EWLA 4X3CA 3E84A 2ZSAA 4PPGA 2CDRA 2GLUA 1QMGA 2GGSA 3JQ6A 2J9XB 2HDWA 3VU3A 4EYKA 5IAGA 5CA1F 3T52A 1V9LA 4R1TA 4KIGA 1M2KA 2B4RO 4UEOA 5AJYA 4ZYXA 1HL7A 3VC7A 3TRHA 3AX6A 4POOA 5TJ9A 5TNXA 5FORA 2AFIA 1DAKA 1ADFA 3SQXA 4GPEA 4LVOA 1K7XB 5JNLA 5THKA 3UMVA 1E6LA 2JVIA 2B3DA 4KQEA 1TAHA 4KLNA 2B0CA 3WRXC 621PA 3KVNA 3GFTA 3IP5A 2AOTA 3EF1A 2V3CC 4BB6A 4OQ4A 1B3RA 2C7VA 4BMZA 2RHLA 4FGWA 3T6KA 1SVIA 2AHOA 4BZXA 1F3OA 3ZC3A 4PO8A 3SLGA 3STYA 4P58A 1E7QA 5CLQA 3AQ4A 1M6NA 2IBSA 3IJEB 2G1PA 3GOQA 4H08A 3CO5A 4H3HB 1WQ1R 3AONB 4LHZA 2QBYB 3W5IA 4F06A 5EJ6A 1AGYA 1VXOA 4S1PA 3TTWA 5D5PA 1F6WA 4H1VA 3P71T 4R1QA 5BOSB 1R8QA 3OTWA 4IDOA 1KK0A 2OKCA 3JQGA 4QYSA 1VMEA 5CPBA 4X91A 3RIXA 1K98A 2VBCA 5BN3B 3C3EA 3T35A 1G20B 3TTSA 2NU9A 1QYIA 2BT4A 3VNQA 3SSAA 3VKGA 1V48A 1JR4A 4LXQA 4H16A 3OICA 5K8IA 5FHQA 1JPUA 1E5XA 3GRUA 2NQ2C 1GIAA 4DJJA 1KOJA 1VG9B 3D6JA 1C0LA 1LW6E 3C7CB 3DEZA 1SUBA 4JAVC 3IHLA 5G0TA 2OTCA 3R7AA 2QNIA 1UKVY 2H1FA 2V6FA 4GLFA 4HYEA 4L85A 4KDRA 1OWLA 3GX1A 2I4OA 4MZDA 1PIWA 4KSBA 2WF8A 5EZSA 4BO2A 2WT8A 5H83A 2AE1A 3TFQA 3AKZA 2HO4A 3AHEA 3EC1A 2XCSB 3C87A 4Z4QA 3QE0A 4ZHQB 1ZHOA 1KP2A 4XIJA 5K8JB 2C3OA 2Y92A 3F5SA 1E0SA 4GRDA 1NOJA 4I6JA 4NU0A 1YVPA 2ISQA 2PZAA 4HG2A 2DT8A 1XDGA 1USGA 2H18A 2JFBA 1TQ6A 2NPIA 2Z2YA 4UBIA 4BNNA 2VBIA 3HDVA 4HDMB 2IYOA 4XM0A 5E1BA 1E99A 2BFEB 4XI9A 3FVVA 3BK2A 5K6TA 3NX4A 1RRFA 4GPD1 2AFHA 1B8VA 1AKUA 5ADHA 4MCHA 2DSNA 1GZ5A 1IFXA 2IHZA 3DKKA 3AUXA 4KGDA 4LRQA 4NX2A 5EVJA 3TX6A 1ORWA 1OFTA 4WUVA 5F9MA 3BCHA 3PPVA 3EEBA 3LPCA 3VKVA 1W1IA 2D5BA 4YDHB 1YBFA 4FQ5A 3ZE1B 1G3IA 1FC0A 1T1JA 2QX7A 2VFAA 3CRMA 4LV6A 4CMHA 5EJ5A 4DNOA 1MLDA 1Y80A 3BT7A 4M8IA 5DSTA 2HK6A 5ALJA 4QQFA 5BV2P 1HRDA 3OFKA 5A1JA 5I7RA 2R00A 1RZRD 2F1IA 4FDLA 4JC4A 1K6JA 4C4OA 5E6RA 1V11A 3EN0A 5HZGA 1WX1A 3QWFA 5TQ0B 3UA3A 3HYSA 4A8JB 3R3JA 1U5BB 5HJ7A 4ND6A 1B00A 4BX9A 3V00A 4ZRNA 5LD2C 3NVMB 4OX9B 5LWHA 1E2UA 3VNSA 2YWBA 4KQFA 1ND5A 3EF3A 1GXSA 3MRXA 3ROXA 3CLSD 3HN2A 2HJVA 4IH1A 1ZOOA 3F90A 1AB5A 1B8PA 4FE7A 2E82A 1QIJA 4KMOA 2IXFA 3A4IA 4C0HA 2AGVA 4MA0A 4WZZA 3W9YA 5DX1A 3I1YA 2JLCA 3MA0A 3T4EA 1NA5A 3F4BA 3NHKA 2YWCA 2QSJA 1KI8A 1U2RA 4UHFA 3N7AA 4NNOA 2GZHA 4WXHA 3K1YA 4JXJA 1EGQA 1KU0A 2ZRIA 3SBEA 4NAUA 4BKRA 4DCJA 4EI9A 5K8UA 1FUUA 4JJFA 3PCRB 2LUOA 4HK4A 5KB3A 3S2YA 4ALNA 1MKYA 2V7QD 3ZV4A 3WY9A 2H07A 1U6IA 1NW8A 1TMOA 2OVBA 3BXOA 4PO3X 3PTZA 4F9EA 4C7VA 1P44A 3PJGA 4PHFA 3K8YA 1GFIA 1U65A 5EIBD 2XHZA 3NUGA 3LECA 1JIQA 5IZCC 1N8TA 1R0SA 1WY7A 4RIEA 3S2SA 1YJBA 1J1ZA 4XZ3A 4M6WB 4H7JA 3DR3A 3U4GA 3UGQA 3KXPA 3N0VA 1NSFA 3C5EA 4LKOA 4HHEA 5CW2A 3O1HB 4B35A 5JYEA 2WWYA 2QD3A 4YRSA 3IERA 4D3ZA 2VDKB 3MF4A 2X15A 1T9CA 1Z8DA 1MC1A 4OGFA 5AK5A 5CVVA 5AMXA 2GN9A 1F6DA 1E3IA 3BWCA 3HSKA 1E3JA 2ZVQX 4JZYA 3M89A 4TXMA 3DBRB 1ULZA 4PAOA 1UDWA 3UEOA 3NM6B 2FSVC 2Y1CA 1N7JA 3C7KA 1NJ5A 2EFDB 1IHXA 3BG5A 2YC2C 3E9QA 5AIAA 2OQIA 1KERA 3Q41A 4UEWA 3ZWCA 5A4JA 2W70A 2YW2A 4GICA 1T3LA 2WM8A 1GU7A 3DUWA 2V4UA 4GM4A 2AT1A 4H7FA 5BNFA 4N5MA 2FE4A 1U9JA 3ISTA 2ZUFA 1MC5A 3F0TA 3TF5A 4DV2B 3FR8A 2BZ0A 3M4XA 5C51B 2FWNA 1QUEA 1V4VA 1KVQA 4TXNA 4AIRA 3PRHA 5EJMA 2IGTA 4DLZA 4UUNA 3OFSA 1K0FA 1J8DA 1XZHA 1UFVA 2I80A 5DWVA 3OPXA 4HNGA 4UEKA 4E2YA 2W2QA 4M0UA 1RYBA 1R4MA 3IULA 1XAJA 5YASA 2ATVA 3SXUB 1WV0A 1EFVA 4IVRA 1JZSA 1Y3BE 3AHIA 4ZAGA 3OA0A 1BVRA 1IIBA 4GMXA 3MAAC 2QLFA 5F7JA 1BQ4A 1QP0A 4TXHA 1ILEA 2GXAA 3VI4B 2GZDA 1TD1A 1BMQA 2RJNA 2W4MA 4QT4A 3N2ZB 2J0QA 4NJEB 1E6MA 2XQVA 1T13A 1T9GR 2XGMA 3P2OA 4KYTA 4R05A 2ALJA 3DE6X 3DL4A 4FYPA 2ZREA 1UM8A 1XTZA 2HBYA 1XYGA 3IGFA 3FWKA 3GUHA 3NHZA 1CE8A 4PLWA 4R41A 4CKBA 4D3FA 1E9DA 1YB5A 3BKXA 2XXJA 4RH0A 4PRLA 5DYWA 2Q6LA 3KKZA 1W8IA 1RJ9B 1RLTA 2A4KA 1G9XA 1JQEA 3DM9B 4DDWA 1YF3A 1KFBB 4PRZA 2ISCA 4BLVA 3PUKA 5P21A 4WESB 1B15A 5B2EA 3RTCA 1A77A 1QFYA 3IIJA 1UMBB 2HMWA 3QV2A 3HA5A 4CG1A 4HR7A 3BE4A 3WL6A 3LI2A 3FPCA 1XXLA 3GIDA 4LAFA 4U4AA 5FPTA 2I3ZA 1JLLA 4EKDA 2NM0A 2IUEA 4GOXA 1DBPA 1G20E 4AZSA 3FNEA 2RARA 3O8BA 4X6YA 3BJRA 5MGNA 5MN6A 1SZCA 3OZCA 1JQLB 1F2TA 4CM6A 4L1KA 2KX7A 2EJTA 2N47A 1ZW6A 3ZEIA 2J09A 4GX0A 4RGBA 4FC6A 4RSGA 3CRW1 3L7IA 3E9ZA 5IH3A 2YV3A 2A9RA 2F9MA 4QFBA 1QP7A 4L2IA 4XVHA 3Q0IA 3HMQA 1VL1A 3A2KA 2XCLA 1VCIA 1UOEA 5CIYA 1JNYA 1M2FA 2VDLB 3KQMA 3FW1A 3D6NB 3WBFA 4JWTA 1GILA 5F2KA 5EIEA 1QOQB 3V32A 4DWVA 5TVGA 1A5BB 4LYFA 3UJHA 4FFVA 2FFRA 3WMFA 1LDMA 1NU6A 1U4SA 4O2BF 4PZZA 4TYPA 1L5GB 3RFVA 2EXXA 1EKXA 2G0TA 2Y66A 3DZ8A 1SD1A 3HO6A 2ODNA 1URPA 4RY8A 2WFZA 5EEHA 1G8AA 3ROFA 3EY4A 1Y37A 5HIIA 4UTRA 4CIYA 3PC4A 4W9NA 1EK5A 1LGYA 4C29A 4Z4IA 2Y99A 1W2GA 3SDBA 5J2UA 1RQNA 1T2CA 1C0KA 4FW9A 1QFMA 3CZ5A 4C5AA 1WB5A 5C8YA 1KEEB 2IELA 2RJOA 2ZWMA 3SE7A 4WW0A 2ASEA 4JL5A 1WCXA 4RF4A 3NBMA 5EPOA 3NNSA 5A0FA 4BV2A 2J32A 5CRIA 2QP3A 2JJMA 4RZQA 1F14A 1RMTA 4WKGA 2FEPA 2C2KA 1PCXA 1CS0A 1X8LA 3EW9A 4YBRA 3VHXB 2AR7A 2W42A 2QT0A 2H1CA 1BWQA 2Y0PA 1IK6A 2NPOA 3N59A 3HLYA 3KWFA 1UBLS 1R50A 1X7HA 5CYOA 4ENRA 3D5QA 2JFWA 4K8OA 5L8VA 2H7YA 1Q7TA 3A3KA 4L22A 2WIJA 3DWEX 1LU9A 4UTZA 4DWWA 4G8DA 2DZDA 4YN3A 1Z33A 1I51A 2H3HA 1VG8A 4GF5A 3LL4A 3QVOA 2CHQA 3ZY3A 2CT8A 1KO5A 2KPOA 4L72A 3VZCA 3BSYA 3GJ7A 3CB2A 3KQSA 4GZ5A 2QZ4A 2QT1A 3VPSA 1P91A 1SXHA 1DARA 1OFIA 4DDVA 5K0EA 1RC0A 5FR1A 4B34A 3A3YA 2ATEA 2GCGA 3E3AA 1FRVA 1UFOA 4PZ0A 1QH9A 1ZM4A 3U80A 1E5VA 4DBZA 2ZRGA 1ITZA 2WMOB 1CR2A 2VUTA 2NNLD 5AXDA 1IQUA 5DO9A 4R2KA 3OCJA 1DKNA 1B8UA 1AGPA 2CF5A 1R1DA 1V6SA 4AQ7A 4G0MA 3MLEA 2WTEA 2XE8A 5EP4A 4IM7A 1IVNA 1DWPA 1XTBA 1IN6A 3FOAA 3V1LA 1XRJA 4XWWA 4MIEA 1KYYA 1P19A 4MR9A 3GQBB 3EVBA 4RANA 1BH6A 4DL9A 1XAGA 4MRSA 4IWXA 1Q20A 2A86A 3LC2O 4PYQA 1PF7E 3S3TA 1TAUA 1R6DA 1X15A 3KELA 2OGTA 1YS1X 3N8KA 1T1SA 1N8NA 1SU4A 2UUCB 4RXMA 4JA0A 1IONA 1WP4A 1MX9A 3X2EA 2AQHA 2PV0A 1W96A 1X0VA 2O1SA 3MT0A 4B3DA 3M1AA 1E94E 1WUTA 3LRPA 2GJ4A 4E7PA 1CDDA 3CRRA 4IHJA 4UUBA 4Y9TA 3WB0A 3K70B 3RVPA 1KY4A 1T5HX 3F6CA 1QGAA 1OCEA 3HDJA 3R5XA 4O4IB 1UXKA 1QLJA 2EIXA 5DCLA 1RP7A 3MWEA 3I53A 4D41A 3ZD7A 1POWA 3TJZA 2ZW9A 4B43A 2VPTA 3WICA 4DB2A 2XWSA 5EQFA 5G1PA 5HCIA 5HXAA 3L0OA 2HWWA 3E1GA 3B78A 4HH3C 3DPIA 4EW1A 2EGGA 5BSRA 3WQHA 5HS4A 4KR2A 3VISA 1ZIOA 2XOEA 1GSHA 1QR6A 1P0MA 3A6LA 4MS3B 2IWRA 3KKEA 1S1CA 2CJPA 4MGYR 2PJZA 4HLNA 2NZXA 4W5HA 3IP3A 1GTL1 1EUCB 2D7JA 5LZ7A 2QYHA 4N3NA 4CQMA 2FSUA 3E1KA 5JAUA 3R76A 5F73A 1SUDA 2X4LA 3D8UA 1GNRA 3UVEA 3ZUPA 4E5MA 1E1QD 2WYUA 1NV8A 4QPNA 5CFOA 4P81A 3KQOA 3R5JA 1RRCA 2BGNA 2XF8A 5D51S 3WAGA 1GRRA 5D8DA 1XZQA 3SZMA 1HNNA 1QG4A 4YMLA 1YONA 5IJWA 1HNWB 1DFGA 2EX0A 4LNUA 2AOWA 4NU5A 2BLLA 2YHSA 5AHKA 5GGYA 5JCJD 3RS4A 5I4CA 4ZPXA 4ZOQI 4JR2A 1AQJA 1QH8A 3NM5A 3R0IA 4TWRA 4UQPA 1R88A 4A03A 1K75A 1SHJA 3N2YA 1WMFA 2CFRA 4LZOA 4QTXA 4IPTA 1MJGA 5F5LA 2HQ1A 1CF4A 2CBGA 3D8SA 4WLNA 2QA5A 3ZKAA 3BRWA 5A4MS 4R81A 1TMKA 4JELA 2HA4A 2Z56A 3RTDA 1FFBA 1V37A 4U6NA 3UFXB 1X1RA 1S2NA 2JGFA 4MW9A 2D1YA 2FSIA 2HHAA 3QRWA 5G0SA 3TPCA 4ZGBA 3IURA 2Q2VA 1UT8A 1E1MA 5IWCA 1H42A 3C5HA 4FT2A 3E9MA 3GA7A 4XIGS 3CX8A 2XNJA 2KS6A 4IDGA 1UH5A 4DY6A 2ZUTA 3P2JA 2BD0A 4OEHA 3I92A 4LG1A 3M5CA 3E2PA 5LKAA 3IA7A 2VPZA 3P9NA 4N12A 3JQ9C 3JZDA 4QNRA 4ARAA 3OCVA 1NMEA 4WD3A 5KNDD 4YT4A 4RJTA 3GPIA 5LZ5A 3EE6A 3O8DA 3IEKA 4H6XA 4CBVA 1N6RA 1XMOB 2I78A 1E0KA 1E2KA 1CZRA 5K0CA 4HDNA 4UE3S 3F73A 3CUTA 3K9HA 3S40A 4IRXA 2QORA 3QXGA 1EUZA 2A6PA 1W44A 4J75A 4K9DA 4RE6A 3CH4B 3WNQA 3X3HA 5A5EA 2C99A 1FMJA 4RU1A 1QQTA 3ED1A 3S8EA 1VJCA 3IDSA 1Q1ZA 4V1CB 2PR2A 3WYGA 1GDDA 4E33A 1ZITA 2AEFA 2C61A 3OWOA 2GNAA 4O8ZA 4A9AA 4MPTA 4DN6A 4DMGA 5LQKA 3AOGA 4MB0A 2DWUA 5JCJA 1OTYA 4R71A 1I2MA 5FL7A 2ADMA 5ALKA 3GNQA 1HYBA 1KI4A 1Q1NA 3M1LA 4LC0A 2EQAA 4M1YA 4CEIA 1E1NA 1GQFA 6AT1A 1XA3A 1NW9B 3PCXA 4U6SA 3EZLA 5DH9A 3EUAA 3O38A 3BRWD 3PGLA 2JH3A 5GM1A 4O5AA 3H0EA 2XMZA 3TBKA 1XD2B 1U8EA 2C82A 2WYHA 3Q87B 1X14A 4MB6A 4S2UA 2WFLA 1I6WA 5H3LA 3W77A 5CEFA 1DGQA 3NJ4A 3O8RA 1AQYA 2R8BA 5LA6F 1JQ3A 1GZUA 4MXDA 3K9LA 5AOBA 4PSKA 2JFOA 4N5LA 5BVGA 2P27A 1K89A 1ZX1A 2RAFA 3DDCA 4FTWA 4H7EA 4QELA 4JSYA 2C4UA 5EZ5A 5KWJA 5A0VA 2OAQ1 4JLBA 3U0VA 6ABPA 3L8MA 3CLUD 3E0XA 2XMDA 3DDSA 2OFFA 1GRVA 2CK3A 5LQNA 3P5SA 2R84A 3MWFA 2FF7A 5J63A 2SNIE 4O4IF 3RUIA 1QF9A 2JJ1D 4KVGA 1PK9A 4LVUA 3SIWA 4CL3A 3R0XA 4ZAYA 1N2CE 2WAAA 3AZOA 3I9MA 4PTYA 5KDLA 1ESCA 5EJGA 4FB5A 4XUEA 1XP5A 5DK4A 2GJ9A 4WA7A 3VJMA 2XX3A 2QTCA 2CLFB 3EIWA 3FLEA 4FHCA 4FQ8A 3SVTA 4OQMA 1PFQA 2OYCA 4A0SA 3CKLA 4RLHA 3KIPA 3A1SA 3GLFA 4JI2B 2XB9A 3KLPX 4EGJA 1CF9A 1NBME 1VB5A 1LBEA 5A3VA 4G1CA 4UKDA 1M1YE 1ABBA 1YBMA 1F1BA 4CMGA 3OOYA 1HKHA 1SC3A 2QPTA 4OAQA 4PC2A 1BJRE 2C2BA 3KSZO 2DPMA 3NIFB 5DJ5A 2PQ0A 1FDOA 1RQLA 4FINA 4TYNA 4Y1RB 1YOVA 2ONYA 1CQIA 3BE6A 4MLCA 3STTA 2NYAA 3ZTYA 5EJ4A 2JRLA 1XA0A 5FPPA 3ZHRA 5JAZA 2FYTA 3CEJA 1KETA 1MZPA 2YJ3A 1A2BA 1KSFX 4H1UA 1O97C 4XR9A 1DKQA 3PL5A 2AMFA 3DDOA 2ARKA 1J97A 3FCCA 2PGNA 4CV2A 3I5XA 1SHUX 5ICSA 1NE2A 2Z6AA 5I4IA 3WGOA 1D1TA 4EAAA 1F2UB 1WTCA 3MINA 1NUAA 3CLSC 5IXSA 2X22A 3O21A 1DCFA 2WG0A 3JXEA 4NCHA 3NGLA 3QE4A 1Q0HA 1U2GC 1P3JA 1OC2A 2XGSA 2FMUA 3CLVA 4NYMR 3X1MA 1ZWLA 3G2NA 4KMSA 2A0FA 1Z2DA 3PQ8A 4R1LA 5F1KA 3DCJA 5JSKA 3QKTA 2HWUA 1VOTA 3P9PA 5EJFA 4CFZA 4PN7A 2RHGB 5AVKA 2A5JA 4EG4A 2BYTA 1I2CA 1Y9DA 2QIPA 2QROA 1AHNA 3CZ4A 2JGNA 3B53X 3OG9A 1D3AA 3HP7A 4M60A 2LDBA 2WF6A 3FDIA 5E9WA 3GLGA 4ER3A 4DR6B 4ZO6A 4MRMB 2F67A 5HQ3B 1ZS9A 3PBKA 4A6PA 3FNHA 1LDBA 3W9UA 3EH2A 1OAAA 2OV4A 2YJ4A 1GT91 1JAHA 1X87A 2FDRA 2P8JA 3DMTC 2XMGA 3ONWA 4ZU3A 2Z1NA 2FWJA 3I01A 3R23A 2B99A 2XZDA 2XZOA 5FBKA 2IYZA 3OY7A 3TB6A 2JD0A 3IDAA 2GEDA 3TI9A 3MWEB 1O94D 2R5NA 2ZB8A 2Q1SA 3PPIA 4GZ3A 3EGXA 1VKHA 1G6KA 3FX2A 3CN7A 4IR7A 1J24A 4YMUA 3EFOB 4LF8B 3QVWA 2EG5A 2FOXA 2WV9A 1FW8A 3OIUA 4PX2A 5JXIA 5BUSA 2NLOA 2BFPA 3M6AA 4HFMA 2VQDA 1KWKA 1HE2A 2P9GA 1W5AA 2V7WA 4CRWB 3DYVA 4MITA 1E3DA 1NBIA 1T15A 1F06A 4WKBA 3LA6A 5HBGA 3RVSA 4YPVA 5A4FS 4RTSA 5K3FB 2IHJA 2VR1A 2F8MA 3EVDA 4HEQA 4LOAA 1Q0PA 2NU6A 3NBQA 1PJSA 4CKEA 3K32A 3GJYA 3GGCA 1FJXA 1VPDA 3BSWA 2IE8A 2P6OA 3FLAA 1IWPB 4ASUA 1F7VA 3G23A 1T9ZA 4ZWNA 3WBKA 4QLBA 3HKCA 1E3QA 4Z3KA 2FLKA 5FFFA 2D0DA 3MMZA 4CLRA 1QGYA 4I0WB 3HM9A 1OAKA 2IVZA 3CF4G 5DTMA 3H1TA 1BC5A 4EG3A 1YXMA 3H8WA 5KTRA 4JYZA 5IT4A 3EOZA 1C3VA 3GLHE 3H2JA 3SEFA 5KOYA 1CDEA 5DNUA 3A28A 4YP7A 3P45A 5LYYA 3X1JA 2C5LA 2ZAYA 3MM4A 2WPDD 2ZI6A 3I34X 1P2UA 3UXYA 4B82A 4YRZA 4JUFA 1ETHA 5BXQC 2QXYA 3EDMA 2DGDA 2B35A 3NP9A 1TO1E 3TD9A 3BFXA 3E9RA 3IS3A 4LYGA 4PNEA 4PRYA 3ABSB 4FWTA 1BMDA 2Q50A 3UKDA 2C4HA 2NXNA 1OT3A 3BCUA 3BXFA 3R74A 1CUYA 1OQAA 1OLUB 3DONA 4IHAA 3O1LA 2V65A 3DNFA 4GP7A 4MEBA 5IDXA 1OBCA 3KBBA 4LXIA 2H4XA 3H8VA 4YRNA 3TGPA 1L5VA 1YDWA 2AW5A 4PCLA 4QLOA 4EH1A 1NDHA 3FWYA 4RJ2A 5JY6A 5KMGB 4FPXA 4M1TA 4A8JC 4YQZA 1D5WA 3PT5A 1V16A 3N76A 4RORA 4B3GA 4RPLA 4R3WA 5JLAA 1V4NA 3A0UA 4L5AA 4HNUA 2VDMB 3IOMA 5K45A 5C46F 1WZEA 3MRSA 4TT8A 3QVTA 4FM9A 1H9AA 1XAIA 2YN2A 5AI8A 2E5WA 2JAHA