4S1OA

Structure of mycobacterium tuberculosis nadd in complex with nadp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
197
structure length
175
Chain Sequence
RRLGVMGGTFDPIHYGHLVAASEVADLFDLDEVVFVPSGQPVSAAEHRYLMTVIATASNPRFSVSRVDIDRGGPTYTKDTLADLHALHPDSELYFTTGADALASIMSWQGWEELFELARFVGVSRPGYDALTLVEIPALAISSTDCRQRAEQSRPLWYLMPDGVVQYVSKRRLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable nicotinate-nucleotide adenylyltransferase
publication title Structure of Mycobacterium tuberculosis protein
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 54
structure length 175
sequence length 197
chains with identical sequence B
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4s1oA00
1JEEA 2PFSA 1F9AA 4P2BA 1H1TA 3HGMA 1FFYA 4QREA 5J59A 1YULA 3I05A 5TEWA 4EG1A 4I6JA 2H29A 1N78A 3VRHA 3RK0A 1EUYA 3RBAA 1ULHA 2J5BA 4MWDA 4MW4A 2DR2A 3A05A 3ZUGA 4YBRA 1OBHA 1U3DA 1TYDE 3SZGA 3TS1A 2OV4A 4G5YA 3UOWA 4HJXA 1VBKA 3KT6A 1XNJA 4YP6A 3KT3A 3CLTD 3IOEA 1N3LA 4AQ7A 1NSYA 4MLPA 1WZ2A 3RJZA 2YXNA 4ZT7A 1O0BA 1JECA 3MLBA 1NUSA 5DASA 5IJXA 1NYLA 3D6UA 2XRZA 3TQIA 4XFJA 1Q11A 2AZXA 2EJCA 1GTRA 1MBZA 1A8HA 1PFUA 3L92A 1O6BA 1T9GS 2A88A 2DXIA 3SZ3A 3BL5A 1Q77A 4QRDA 2X1LA 3DO8A 1N1DA 2JA2A 1M1ZA 3M5WA 4I6EA 3PNBA 5TS2A 5LLTA 1Y42X 3G6KA 5JBNA 4ARIA 4U8HA 5AHWA 1JZSA 4G6ZA 1I2DA 3RK1A 2RD2A 2X1MA 3CLUD 2GM3A 1NUPA 2J4DA 4DJAA 3CVUA 1WY5A 1WXIA 4NDAA 4EG8A 1V47A 3PXUA 1XNHA 4MW6A 2VTBA 2AKEA 1IQUA 2IP1A 4MUHA 4L2IA 3QTTA 1P7PA 2GKSA 1GPMA 2QJFA 1KP2A 3ZXSA 5FNZA 4ZCSA 4DLPA 3K32A 3H05A 3PNVA 3QTBA 2J07A 5H7XA 4KR6A 3X1JA 4KKVA 4YP5A 4WNYA 2DERA 1OWMA 1MJHA 1PFWA 2IJGX 2Z09A 2YWBA 3GUZA 4MUEA 1TQ8A 1EUQA 1K92A 1OBCA 3CA8A 1YIDA 4CDMA 4PBSA 2CSXA 1HYBA 3ZJTA 1O96B 2YY5A 3P0HA 1TYBE 1WXEA 2A1UB 2JANA 1M8JA 3CR8A 3H97A 1VL2A 1T6YA 1N2GA 4MUGA 4MUKA 3L93A 2O5RA 4MAFA 1N2OA 4DDHA 4DE5A 1O95D 2D54A 4JXZA 1DNPA 1F7VA 4JXXA 3ZJUA 1RQGA 1KP3A 3IVCA 2E18A 3HV0A 4J75A 2X3FA 4KPUB 4ZT4A 3SEQA 3A2KA 2A7XA 4ZT2A 4K0RA 3IMCA 1GN8A 4EFKA 1IQRA 4PBTA 3RHSA 4K03A 5BNZA 4MWBA 1O5TA 4MUNA 1K4MA 2PZAA 3N9IA 1KAMA 3ELBA 4KR7A 1JIIA 1KH2A 5LFAA 3K9WA 1O94D 2V0GA 1OWNA 3ZXIA 3IOBA 3MLAA 1EJ2A 5J58A 3ISJA 1QTQA 2D5BA 4EG4A 4EG3A 2HZ7A 5KCMA 3UY4A 3NBAA 4GU5A 1Q15A 1EXDA 3CLTC 2CYAA 1LI7A 4RUKA 4ZCQA 1WOYA 1H3EA 3S3TA 1K4KA 3FDXA 1OWPA 3HFJA 4MW2A 3CLRD 1QJCA 3AL0C 2HGZA 1QQTA 4BWVA 3A04A 4XFDA 3KT0A 4ZCTA 3IVXA 1KR2A 2YWCA 4YP7A 1EFVB 2QTMA 1YI8A 1U7DA 1WKBA 2GOYA 1EE1A 1X6VA 2CV2A 3H99A 4U7JA 1WXGA 5DK4A 1MRZA 1M8KA 3IUBA 4HPWA 1R6UA 1KH3A 1BS2A 2WQ7A 3CVYA 1CT9A 3FIUA 2HMAA 3SP1A 2A1TR 5HG0A 2OQ2A 3ZJVA 4DDMA 3N05A 3OP1A 4CDNA 1ZH0A 3X1KA 4J76A 2E21A 4I6GA 4NZPA 1JZQA 1D2RA 5FO0A 2E89A 1U7XA 3P0IA 5K0SA 1KAQA 3MXTA 1NURA 3KT8A 4F4HA 2A84A 5F23A 1N2EA 5IHXA 2EL7A 3AFHA 2J08A 1PG2A 3ND7A 2BYTA 3P52A 3G5AA 3N8HA 2E0IA 4ND6A 1R6TA 1O96A 1GLNA 1Q19A 3LOQA 3P0JA 1PG0A 2A1UA 3CLSD 4EG5A 5J5AA 2DETA 1OD6A 1NP7A 1XJQA 2H2AA 2C5SA 1EFPB 3G59A 3FNRA 4MW7A 2PZBA 3FI0A 3FHJA 1YUNA 2CFOA 5KWVA 3DLAA 4MVCA 5DB4A 4MWCA 2V0CA 4RPIA 4DNXA 3LE8A 2ZUFA 1R6XA 3MMXA 2RE8A 4AS1A 1XNGA 3FH0A 4KPUA 3HZRA 3Q10A 2QUJA 3HL4A 4HK4A 1F4LA 3ZIUA 3IDFA 1F7UA 3PNYA 3IMEA 4MVXA 3VGJA 1J09A 4R2LA 3JXEA 2PG3A 3D6VA 1J70A 1X8XA 2QUIA 1GTSA 3TQOA 3VU8A 2Z3VA 1G59A 1O97D 3COVA 3SYTA 4OUDB 1TEZA 4Q16A 3CVXA 1O95C 1QRSA 3NV7A 4NX2A 4CT0A 1FYDA 3IVGA 2QUKA 2D13A 4X0EA 4F3RA 4NAHA 1NUQA 1T6ZA 2ZP1A 3E27A 3INNA 4ZT5A 2CV1A 4ARCA 1NI5A 4MW5A 2QTRA 2NSYA 4ND7A 1MC1A 1N75A 4JYZA 1ZJWA 4MQ6A 4MUIA 3ILVA 1IFXA 1OWLA 3Q4GA 4ZCRA 1G8FA 2IELA 1G8GA 1O94C 4S1OA 3AIIA 1MOPA 1MB2A 3GMIA 1N77A 3COWA 3COZA 2QJOA 2I1LA 3IMGA 1QU3A 2O8VA 4EG7A 3ZGZA 4MVYA 3NBKA 1EFVA 2XRYA 4A91A 3DPIA 4WSOA 1J21A 1ZH6A 4FZJA 3X1MA 1OWOA 3C8ZA 3PRHA 2CUZA 1NZJA 1J20A 5KHAA 3IODA 1N2IA 3FG9A 4H3SA 2ZUEA 2QTNA 3SEZA 3AG5A 3FETA 3CLRC 1V8FA 5K0TA 1G8HA 5LM3A 3U1VA 1H3NA 1M83A 5HUJA 1TFUA 1VBNA 4R0NA 2A1TS 1PFYA 1SURA 3QE4A 2G36A 1IH8A 3FWKA 3A4IA 1T6XA 1ILEA 2NZ2A 3TNJA 1I6LA 2DUMA 3CVVA 5TEVA 1I6KA 3F3MA 4MVWA 4E1AA 4JZYA 4ZT3A 1KH1A 4G5FA 3IUEA 4TS1A 3TZLA 1MB9A 5TGTA 4KR9A 2CT8A 2B7LA 1S4MA 1EFPA 3ND5A 4R2MA 3CLUC 3OTWA 1M8PA 1IVSA 1COZA 4MW0A 1QU2A 1N2BA 4MUFA 2CYBA 1QRUA 4ZT6A 3N2YA 1O0CA 4NAUA 1GZUA 4QBTA 3FY4A 5FO1A 1YIAA 3COYA 4MUJA 3CLSC 1IHOA 3HMQA 2J09A 2Z08A 2QUHA 5HUHA 1U0BB 2A86A 1JHDA 4MW1A 4MWEA 3CVWA 5EKDA 1WXFA 3H9CA 4OUDA 1PFVA 1IQ0A 3LCJA 2DLCX 4UZEA 1TYAE 2PIDA 2DEUA 3FOCA 1JILA 2JAXA 3DV2A 4UZFA 1N2HA 1WJGA 1JEDA 1UFVA 2WB2A 1T9GR 3MUEA 1J1ZA 1GAXA 3Q12A 1M8GA 3AKZA 3AG6A 3KFLA 2BTEA 4PY2A 4HJRA 4CQNA 2PXHA 1IRXA 3UK2A 1JIKA 2CYCA 1YUMA 1TYCA 1O97C 4PBRA 4Q93A 1KQNA 3UMVA 1KQPA 2DPLA 4JFAA 1WQ3A 2TS1A 4YMIA 2AG6A 2QJTA 1K97A 3RFFA 4U63A 3H9BA 5H16A 1ZUNA 4MULA 1J1UA 2WSIA 1U3CA 4GRIA 4XSVA 2A4MA 3ND6A 1M8FA 1B6TA 1MAWA 1NUTA 2X0KA 1QRTA 4DDKA 5DEOA 1JIJA 1KORA 4EG6A 1H3FA 2VXOA 1MAUA 2VTBB 1LW7A 1NUUA 4OJMX 1WXHA 3UC5A 4EF6A 4L2IB 1JMVA 1KKUA 1QNFA 4MW9A 1N2JA 3TZEA 1KQOA 2CV0A 4ZCPA 1LI5A 1WQ4A 3IH5A 2PZ8A 2R5WA 4EGAA 3GLVA 2WQ6A 3IOCA 1I6MA 4NATA 1VBMA 3SDBA 1JGTA 1VLHA
chains in the Genus database with same CATH superfamily
3WZ2A 1M6YA 2D4AA 2IODA 2WYHA 3NDJA 5TB5A 4BIIA 2VNHA 4K6KA 2NYUA 1SD1A 5DYWA 1JEQA 3R7BA 4IIYA 3QKIA 4ZU6X 2RCNA 3ZE0B 2MU1A 4DLTA 5C18A 4IIBA 3MYRA 4INAA 4OXXA 4NONA 2JFOA 4FINA 4LXIA 2Q3MA 4OYRA 3D4NA 1NXPA 3L7NA 4MP3A 3RNOA 2XKKA 3BT7A 5AK4A 4YRPA 3SC2B 4P84A 4KMSA 9GPBA 2PLRA 4JQZA 2ZJ8A 1HXHA 2W11A 2EKPA 3RS2A 4KNVA 2GJ9A 3QYJA 3PZRA 4HAIA 1K2VN 5KOHA 3SYKA 4A23A 1DV1A 2IKQA 5ILQA 3JSXA 1JA9A 3TF5A 1NM5C 1YRHA 2BHLA 1Z37A 2Y0CA 3O8BA 1AVTA 3KT3A 4G97A 5BSFA 4N5LA 2JA1A 1Y5MA 1LY1A 1XXLA 2H1CA 3V1KA 1KSGA 3A9UA 1NUSA 2FMHA 4JN6B 4O02B 1JDSA 3NCHA 5AXCA 3I0ZA 4HDSB 3EF1A 1E9FA 1VYTA 3NHSA 3NP9A 4J0DA 1O6GA 1FRNA 2FLVA 4NIMA 4R3NA 4AJKA 3CNLA 5BV7A 5JCJA 1YJ8A 1PJBA 2YVUA 5K20A 5LWQA 1E3WA 3VMFA 4RORA 1RRGA 4DR1B 2J7PD 2NO7A 4RF2A 5AIBA 5A9TA 3EIUA 1X77A 2OYRA 1CS0B 2R8OA 4EUNA 5B4TA 4ISBA 5HUQA 4CU5A 5G0VA 2VXCA 2O0KA 3T1YB 1JSZA 4Q7LA 2ZBUA 3IESA 2V58A 4F9TA 4OOEA 4EBFA 2BDUA 5BXYA 5K45A 3IMKA 3CJQA 3NZEA 3OEHD 4Y1EA 4KQIA 1XEXB 4DWWA 1H9BA 3QMVA 1BKSB 3ZPXA 3VNSA 4CKXA 1QCZA 2COEA 2QRZA 4KE7A 5FKJA 4V1CI 2QJRA 1GU1A 1NFRA 1K27A 2Q1WA 2R8XA 3O8QA 4JB2A 4PCUA 4YRCA 3ZCVA 2ZUUA 3C6XA 2VUIB 1UEJA 2RGDA 5MGNA 3HNPA 4RL6A 4GNKA 3C85A 3HU3A 1CDDA 1U98A 2H48A 1PQWA 1XNHA 1NUHA 1N1EA 2LIPA 3PXUA 4CCAA 5BQXA 1IULA 2NM0A 2ZVJA 2BFMA 5DX0A 5KVVA 4KPYA 1HUQA 1V37A 1II8B 2C92A 1ESCA 1W36C 3LTNC 1VIYA 1IOLA 3WHIA 1W8DA 3Q9SA 5T6BA 3I9FA 3W9UA 2AA3A 1VE6A 5E9JA 4FW8A 4UHCA 1QG6A 3SVTA 1OIWA 1SXJE 4DMUB 3GZJA 1GQYA 2FPOA 4DEYA 5T4FA 5FNZA 2XRMA 4ITRC 2Z43A 4C89A 4DLPA 5KJFA 5DJ5A 4NKRA 3IQIX 1AZTA 5I7FA 3A58B 1QS0B 5BQPA 3W5HA 1DKPA 4G8DA 1UBHS 1DMSA 2FZVA 4LBYA 3WLPA 4B6GA 1I80A 4I8IA 5AD1A 1H4QA 1Q57A 2CXSA 1Y82A 4KR6A 4D9GA 2Y1GA 1AKNA 3BK1A 2OBFA 2PMWB 4KKVA 2AH5A 1ZN8A 4H18A 2BC9A 2E6UX 3S40A 5HF8A 1DJMA 1E1NA 3U3XA 3BK2A 4M9ZA 1CUAA 3TW4A 2JFBA 3WRXA 16PKA 3GRZA 1ADGA 1CHNA 2WYUA 2A5FA 3GEGA 3K8QA 2P9TA 3ANTA 4FBLA 3PWSA 2EDAA 4N6OA 3G9QA 4TXHA 5ALSA 3RO7A 1ZY2A 1ZXLA 3ZE7A 4CCSA 1XZCA 5LDHA 1VJ1A 5JMOA 2O7SA 5K6AA 1JG7A 1SVMA 3NXSA 5EIOA 3GA0A 4FCCA 3VR4D 3WR5A 1M1UA 1LF5A 2D1YA 4MUKA 1MB3A 4FFLA 2BUCA 3VHXA 1P1FA 2GEUA 3OE4A 1OX4A 1PW7A 1MQ9A 2FZ4A 3SLKA 2FR1A 4KBYA 3AJEA 4PG4A 1RJDA 3ZJUA 2DULA 1QSGA 5EPEA 5JSFA 2GO1A 5IJ9A 1UBTS 1B0ZA 2Z0MA 4JX8A 1SXJA 3IGFA 1T3ZA 3IRUA 1QYCA 1C1XA 1CERA 1QG0A 4M37A 4TMXA 3KQYA 4WL0A 1C9YA 4PXYA 1GNQA 4PLTA 3TIIA 1OT5A 1APBA 4MUNA 5HQ3B 2O2ZA 1HFJA 2O5EA 1LQ2A 3HYRA 4AJ1A 5BYKA 1CY1A 5E7QA 2I3AA 5DIZA 4QGSA 1OB2A 4YJFB 2RB4A 3M6AA 3F6SA 1NU6A 2IDZA 2JEOA 3TPCA 4DBLC 1IM5A 3PVZA 4K8OA 1RRCA 2OHHA 5I7VA 3ISJA 5DHRA 2BT4A 4DM3A 1UANA 4NZOA 1GO2A 4QJ4A 1Q0PA 2G63A 4MSUA 4NWIA 1XQ1A 1S89A 1ZZEA 1A7KA 2OFXA 5EESA 4E1VA 5BV2P 2JLRA 3KL4A 2HD4A 3NVKI 3S8YA 3LUBA 1JIUA 3I3OA 1V5IA 3R9WA 4RY8A 2V5VA 1Z56C 3V5NA 2Z9BA 1S2OA 4MW2A 4LK2A 2VBCA 3OIUA 4BMYA 2W8BB 2ERCA 3NHFA 1BRMA 4P7FA 5AW6A 4AO6A 3UJ7A 4C87A 3E9EA 4PINA 4UM7A 4I81A 2JIMA 3SOPA 4CV1A 3CPJB 3KT0A 2M1XA 4WY8A 1NF9A 3HJCA 5HVNA 5IT5A 4I36A 3DF9A 5A3SA 4EBBA 1TUBA 4TXJA 4CF4A 3CF6R 3EXFB 5F7XA 4URFA 3ZCRA 3ITDA 4IIJA 3WE7A 1SKMA 1E2DA 4DG9A 4MMZB 1QP4A 3I2KA 3PK0A 5G3ZA 2H8GA 5FQOA 1VDMA 3RJTA 2O6LA 1FZQA 1Y7HA 3HUTA 3K2EA 2JFXA 4KN6A 4UAVA 1R6UA 2I4NA 521PA 1KZ6A 2BKEA 4UUOA 1JXAA 1GRRA 1PVDA 5EWLA 4A2CA 5JJKA 3INTA 5B37A 2X1VA 2BFBB 1E8MA 2YRXA 3BKWA 3FUXA 1R2QA 4KRGA 1U2SA 3X1KA 3CPSA 2XNHA 5HOEA 4IWNA 1J90A 3DDWA 2VTEA 2WIGA 3QXCA 4H9GA 2ZCUA 5G4LA 2HJ9A 3T15A 3DGEC 4YT4A 2PBZA 1F0KA 4R40A 5B1IA 3RSCA 3STHA 4RTOA 1PK8A 5FNVB 2GHTA 2HEIA 3QVSA 5E6RB 3SK0A 2FW7A 1CP3A 5CA1A 3AFHA 2X4GA 2O5VA 4BKMA 4M2LA 2F7SA 2BYTA 3P52A 1B14A 3RROA 4AK9A 3G5AA 4MS1A 5KKCA 2PH7A 5FJJA 4LF6B 1L7EA 3CF4A 3G13A 1JT9A 1HQCA 1Q19A 1E3DA 2ZTMA 4MP6A 3CMMA 3O8OB 4MQFA 5ALYA 4Z4FA 5HX7A 1K7XB 1H66A 2VAXA 3MWLA 1ORIA 1RKUA 2AXPA 5FLEX 5IW8A 2E4VA 4BU1A 4C2TA 3EEQA 5JPCA 2WJ4A 2QSUA 2V7UA 3OZFA 2W4IA 4DCGA 2PZBA 3IKMB 2DBVO 2P67A 1H2ZA 3PEEA 2WA2A 2WHPA 4YYEA 4A4DA 2E49A 5DTJA 3GEBA 1H1DA 1W9HA 1WF6A 2ZTHA 1NLUA 2YMQA 4ETMA 4QASA 3MMPA 2WC1A 4X84A 5K0NA 3S27A 3N8GA 3HZRA 5LMZA 4PRZA 4BFUA 1MIHA 1LX6A 4INOA 1UM8A 2D59A 2F67A 5BVGB 2RB5A 4X1YA 3IMEA 1Z25A 2VDRB 3DFZA 3ETNA 4WV3A 4XB1A 3WLOA 3S81A 5LJLA 5A9RA 2C59A 2A9PA 2HK7A 4M1TA 1GTSA 4PPNA 1T6NA 3KSRA 2Z2JA 3BSYA 1VA4A 3NLLA 4R1LA 2XQFA 5DI9A 2JIZA 4FR5A 4FZ5A 3HJTA 2D2XA 4LYHA 4ZTBA 1J56A 4P82A 3WLHA 3E9NA 5LMNB 2FRXA 4UHHA 3ND9A 5KTMA 3MJCA 3HUDA 1ORDA 2B37A 1RTTA 4M55A 1C14A 3ZY2A 2CV1A 4HRAA 2DUWA 3AHIA 3LHSA 2Y92A 4F5DA 3KS9A 4K2AA 1NBHA 1TEVA 4NQRA 2P4HX 2C1XA 2IDMA 3ILVA 4TXNA 1SPBS 1V4NA 4LE0A 1TVKA 2PVPA 4JB3A 1D7AA 2ALJA 3WWCA 3AFGA 3BXHA 4U00A 3W1WA 4PSUA 1RPNA 3HXTA 2KBFA 2PBRA 3OFND 3COZA 4GECA 5B12A 5IKMA 1LZKA 1XDDA 3IR7A 3I8XA 3FR7A 2D74A 2VLBA 3NBKA 3PKZA 4PLWA 2HRDA 4BO0A 1OZGA 7ABPA 1ZH6A 1QIDA 3QNMA 1X2EA 2FB9A 5AKGA 4OHVA 3SLGA 2OAEA 4D96A 3EGXA 4IJ5A 3DUWA 3LCUA 1D8AA 4H3SA 1SHUX 2PNJA 1E2PA 1ZN2A 3DDHA 3UH0A 4HRYA 1W35A 1W88B 1A5SB 1UDCA 4OHCA 5C37A 3H1PA 1V8FA 3Q11A 4RS4A 5EP3A 3GT4A 4I3FA 1Y5RA 5EUCA 3TH5A 4CFZA 4ESEA 8ATCA 2CB0A 2R96A 4A8JB 2DWPA 3SYNA 1AT1A 1HE8B 2UAGA 4UTOA 3P2JA 2I3DA 4CKBA 3WLAA 3GELA 1KSFX 4PIPA 3G9ZA 3ETJA 5BT8A 4BX9A 4ZIRA 4LMAA 3CXUA 2DUMA 3ISVA 4RDCA 2O7NA 2RHDA 1UP7A 2B82A 1JQEA 2R9VA 2YJ6A 3LC7O 3EOAI 2EJUA 3N87A 4X20B 4PTLA 4F1JA 2KE5A 3U7QA 2D2IA 2F1HA 2OXEA 2WF6A 3VJRA 4H60A 5IC6A 2V7WA 4HGZA 1SOWA 4KQMA 1MB9A 5J4VA 1XD2A 1LFAA 1TXGA 1VXRA 1SQSA 3E7FA 3T9AA 5CA0F 4TKZA 3WA7A 3MUNA 4B0PA 2HPAA 1H42A 4MEBA 2VQ6A 2PLWA 5IFLA 4INPA 4GKAA 4BVBA 1JEQB 1D0VA 1G98A 3V2IA 3NHZA 2HHJA 3PYXA 4MW0A 5A6VA 1ACLA 3AUAA 3F6RA 3LA8A 3U4IA 4EABA 1E6EA 1GTZA 5JNSA 1BJTA 3JQ6A 3KEFA 2FX5A 3KJZA 3UBMA 1K8YB 1T9CA 5TJHA 1GNPA 1T0UA 4AECA 4KYVA 3H0CA 2GZSA 3HXOA 3T38A 3SVLA 1DKQA 1DL5A 4MA0A 3NBUA 5KOHB 1E63A 4JUFA 3KKOA 5HUHA 2QQ5A 1Z0FA 2EP7A 3FOAA 3Q8KA 4M0DA 3BGSA 3DMTA 1Z39A 2YDXA 3LHFA 4N4AA 4C1BA 3IS3A 3TGWA 1WIWA 3GJ8A 3AFIA 3OCJA 4JT9A 1ECFA 3F5SA 2ZZNA 2H6EA 5G1OA 3TMKA 4D9MA 1W73A 1KI3A 2PZFA 4MPTA 5IAOA 5LXTA 5TMEA 4JHXA 1JWAB 1DIRA 2JFYA 4BHTA 3K9BA 1X1AA 3VZRA 1KKMA 2IV3A 3Q3GE 2GI4A 5DBIA 1E3WB 3ZZ0A 4BX3A 3AKZA 3NDIA 2VDLB 3OA0A 1N9GA 2DQSA 1VP3A 2Q3FA 3UK2A 4AUMA 4G8JA 5CDFE 1C9KA 1O97C 2GVDC 1VJGA 3HFGA 1FXWF 1Y9EA 2V6FA 3T3OA 2WVHA 4A8HA 1OXVA 5AFSA 5KUTA 2CD9A 3DO6A 3U40A 1SA0A 5KO2A 1OPRA 4J0KA 3NVAA 3PVSA 4XD7D 4D9JA 2UUCB 1V5EA 1BFKA 3H5TA 4MULA 3B2EA 1OI3A 3V6MA 3GEEA 4K7JA 3GVCA 2I7VA 4B31A 1IXYA 2PAAA 4UM9D 1COWA 3OY2A 2JFNA 3O8QB 1SCKA 3BJIC 4J0HA 2ZGVA 4XARA 4OH7A 4MHOA 1I6WA 4JLKA 2CLIB 3ZCXA 3FRIA 2XB4A 2Z3ZA 2C2XA 3UTCA 1E8DA 5JQWA 1GD1O 1QC5A 3ICCA 2C4HA 1YZ3A 2PMCA 4UTXA 1QG4A 2FSUA 2Q1TA 2RONA 3DLBA 2WHRA 2XMBA 1OBFO 1UDXA 4OQEA 1B16A 3EXHC 2YV2A 1Z5ZA 4BO3A 2IEZA 2JHPA 2XVZA 4XSGA 5FA8A 2NVBA 1RAHA 2V7XA 4WT7A 4L76A 5DRYA 2XCIA 1UC5B 3RWOA 2HU5A 3E23A 1QAQA 4A9AA 3IDZA 5K0EA 1QNLA 1SWVA 5ALOA 4IJMA 5FOSA 4CETA 5ARCA 3RANA 1SG6A 3B7WA 1ULBA 2W2KA 1VCIA 2JFWA 2P6UA 4B3DA 2HT6A 2Z6VA 4RY9A 5AJWA 5AVXA 1E2NA 5IZ4A 3TECE 4YQFA 1H6CA 4KX3A 1L6IA 4GWGA 1MR3F 3V4LA 4WLUA 2KPOA 3UGTA 2PS3A 3K1AA 4L4RA 1R4ZA 5A4JA 3FBTA 2AHRA 3R0XA 2PBFA 3JQ9A 4H08A 4JIMA 1V8OA 4KGZA 4LHVA 2YZ2A 3ODGA 1KKLA 1E0AA 2FPSA 3OJXA 1L3CA 4KH0A 3QVGA 1WABA 4GUDA 3DBLA 1T1GA 2FUCA 1VKZA 2H2WA 3P9YA 4G0VA 1RYEA 2HC9A 5CBKA 4W9MC 3PDJA 1ORVA 4IM7A 4IQ0A 3RCBA 1EAMA 2IZ1A 3A70A 2X5JO 1OAOA 2PX8A 3VRHA 4OQDA 1V0JA 7MHTA 4H27A 1LRJA 2QM7A 3GVXA 4YJ3A 4WEQA 3VHXB 1UBFA 1QPZA 1OX4B 2GPTA 4C0JA 1SPXA 1ZITA 4DIEA 4YUXA 3QFRA 4I66A 2I22A 2JVKA 2D2VA 3JAWA 2WVJA 2GX6A 2BF7A 3C5VA 4V02A 5FYDA 3N7TA 1VBKA 3WGNA 2VP4A 1Y8QA 1M75A 1JJBA 1SXJB 1XCLA 1P75A 4Q4AA 1C1XB 1BWRA 1RWNA 2J9ZB 2GYVA 2IXEA 3FB4A 4GM1A 4TYWA 3RC9A 4IF6A 3GD5A 2FZEA 3CLHA 1JECA 2XCSB 3MLBA 4MWTA 1KARA 1F3LA 5JLJA 5IJXA 2JCVA 4XYLA 4IIUA 1BYIA 2OC9A 3QUCA 1XFDA 2YWGA 3KEQA 4R1UA 3AESA 3EWSA 5DCYA 2ZVDA 1P0CA 1ECGA 1FDTA 1P5HA 1XVIA 4N0DA 4AJOA 4B3MB 3ED5A 3EA5A 2J6CA 4LHXA 5LKAA 3KAQA 4UTNA 4NAVA 1TAGA 2AZXA 3QOFA 2ZULA 5JBQA 4AD8A 4U8GA 2ZIXA 3A6DA 1E5DA 1Q77A 3ANNA 1MO6A 4QRDA 3DEFA 4OYHA 3DO8A 3TJRA 5D51S 4GPBA 2AR9A 5BOVA 1UMCA 1OU4A 1ZJYA 3DMDA 1UC4B 2GJKA 2O6HA 2V4ZA 3AEQA 1GG9A 5CCEA 1C3LA 3ORSA 2H07A 3NB0A 3SHVA 4A3SA 1B6GA 3A3YA 4O5OA 5ALLA 1A9TA 1YQQA 3CURA 1QK3A 5FPYA 3SNHA 2FWRA 4UCQA 2G0AA 2P9FA 3HB1A 2J5RA 2PLFA 2V5AA 4MVJM 3DTNA 1G20E 1BE0A 1HSZA 2C04A 5GJCA 2OXTA 3VJKA 5ICEA 121PA 1U8ZA 4D3FA 4E4TA 3VV2A 3ZOKA 4L9SA 3SJAA 2Z30A 3HJBA 4NDAA 2Z6UA 2NACA 2ZR7A 5F52A 5NLLA 1TUBB 4GYKA 5EHNA 3UAGA 3AI2A 5EJIA 3UK0A 3EIXA 4E5SA 3HSKA 4IIJB 1TAQA 3L6CA 3ZLUA 4BMZA 5A9SA 3LDHA 3L8YA 2NUTA 2FG6C 2QU8A 1BWPA 1TUEA 3QTTA 2JLVA 3LXRA 1Z82A 3F5MA 3O0DA 4ATNA 3ZHUA 1AV6A 2AN4A 4K81B 3HG7A 3HYCA 1KP2A 3QEKA 4WX2B 3WC4A 4ZCSA 4J0CA 5EWLB 3IA2A 3OOWA 2QBYA 4LFAB 1D09A 4MIEA 2Y3IA 1RCUA 1TQ2A 2XOKA 4RJJA 1KY2A 4LSZA 3PNVA 4MEAA 5JNWA 1KO8A 3NNSA 2VHZA 3EDOA 3QXHA 1ICEA 1LXCA 2J07A 4JQYA 4BVGA 2JCYA 3R74A 3AP3A 3WYDA 3RRZA 4YEDA 3A2NA 4FIDA 2BI7A 4BJ5A 2ODNA 5A1JA 1JFFA 1J23A 1H2FA 1TQ8A 1E9SA 3CEHA 3TAHA 2H63A 4Q9IA 2BBTA 4IP0A 3W2TA 4WOBA 1TO1E 4D1YA 5CDTA 4MS1B 2H7VA 2IYFA 1YIDA 4PO8A 1IJEA 1G20A 3WWYA 2HWXA 4LF7B 4OU4A 4RVGA 1YMQA 2KM1A 3CRNA 4KZPA 4MQFB 2VJLA 4WADA 5MN4A 1N5JA 4GOXA 3L06A 4TTTS 2OTCA 3V8PA 2ZR8A 2VKQA 2C5EA 1G17A 2Q4DA 4WERA 2PL9A 4Y6GB 3R3VA 1SRRA 5ALXA 3W2HA 5A5GA 1C7RA 3ZWCA 2WHPB 4IKPA 3IBFA 1CVLA 4IG4A 5IZCC 3DAHA 2VH5R 3H5IA 3L77A 3PIDA 1TKBA 4QBHA 2IUUA 3G88A 4TZ6A 4J75A 1HYQA 3N7UA 1PZGA 4X1KA 1E7WA 3A2KA 5EWJA 4YCSA 2F2TA 4KG7A 4X1YB 4GBGA 5DBOA 3FDIA 3FPHA 3K0HA 3IEIA 5HJ7A 2I54A 3MOGA 1K4MA 1B42A 1SFRA 4BVJA 4TL7A 4C7KA 4FD3A 5B2FA 2I4LA 1T2CA 3IDQA 1GCOA 4GZ3A 1G1MA 3O4GA 3R7WA 1JH9A 3INGA 1ATIA 2RHLA 2IOQA 3BWVA 1RYZA 3IOBA 2EF1A 5IAKA 1RRMA 5T4BA 1T1EA 1SC6A 2RBGA 3HBNA 1U7TA 3DFIA 3EUAA 4W5WA 1M1YE 3A8TA 3PWZA 4N9WA 3B1JA 4RUKA 2CYAA 4ZAVA 1TE2A 4OTZA 3DP7A 5JJCA 4Q3NA 3DNMA 1NBMA 4M60A 2G9NA 1BH6A 1TJPB 4F5YA 2X0RA 4LGMA 4ZVRA 2Q7DA 1TVKB 2Z2XA 5H0IA 1OWPA 3FGPA 2QTVA 1USKA 2R00C 1IEXA 3NM5A 3PUKA 1WV0A 1Z2DA 1TOAA 3PFBA 3UXMA 5C8YF 4JITA 1K4YA 1AC5A 2Y2VA 1QQTA 1YGPA 9LDTA 5LLDA 3PPWA 5JNVA 1UXKA 5LBUA 2O3TA 3ES9A 1BN6A 3JX9A 3QHAA 4BNUA 3I0NA 4QXRA 4J4HA 4TZTA 3K35A 1PEAA 4KU4A 4C30A 3UAVA 421PA 4E5YA 2O8BA 3EY9A 4PWZA 1XRRA 1E62A 2XCQA 2VIIA 3L8ZA 1CUJA 1HT2E 2I71A 2L2QA 3F6PA 1I2MA 4H3KB 4CMEC 4E7OA 5BOSA 4AZTA 1JE1A 3EGXB 2TMYA 3ZVNA 1RAEA 1N2ZA 1ZIOA 3LO5A 3UJDA 1QYRA 1C3JA 3DP9A 1JJIA 2XBUA 1E9VA 2GN0A 2ILTA 3LCMA 4L16A 1HC7A 1NTOA 1IOWA 4ZPJA 3DHVA 3PIRA 4GKBA 4H16A 2GKOA 4C1NA 1PRYA 5EJ5A 1BVUA 2WJJA 1I30A 2ZYTX 3V4PB 5JANA 3L4JA 1YNOA 3HC7A 4FMCF 4S24A 4B84A 1G60A 3BQMB 2NAFA 5C35A 4D8UA 3LT4A 5K3DA 3RS9A 3P4XA 1DQNA 1UZAA 2Z2KA 3DHEA 4GFDA 4D7AA 4CKBB 1Y9JA 1T0PA 2DBRA 4M89A 2VYFA 5A7GA 1D2HA 1PDWA 4JOSA 1Q16A 3V2GA 4F2HA 5AYVA 4MPRA 1H9CA 1NNI1 4ZIRB 3SX4A 3AILA 4GVLA 2OCIA 2Y66A 2ZFUA 3OKFA 1P74A 2VWGA 4BN5A 3W3AA 1OXBB 1X8LA 2WKRA 1ZESA 4G0UA 4JLSA 3E53A 3BHIA 4G0OA 3U7QB 4NS1A 3W8FA 5P8WA 5AJYA 1KK3A 1HLFA 3Q72A 4KI0A 4IXTA 5I01A 3GEIA 1XD2B 4I3HA 1N5KA 1DOHA 3VVBA 3R3UA 3EDYA 3R7SA 1P9LA 2FLKA 2TMKA 2F9MA 4UOEA 2YIVX 1PJQA 3DUFA 2YV5A 1A9SA 2ODAA 4NMLA 5A5DA 4O2BF 3LKZA 4M22A 1Q7BA 1AGPA 3FMVA 1DFIA 4R9SA 4DLVA 1TIPA 3A1TA 1OTXA 1P6UA 1Q0ZA 2JK1A 5AICA 3IIJA 1IZ9A 4YUWA 1YQWA 5B30A 1A3CA 1S3GA 2FW6A 4EHHA 4JC4A 4JVLA 2EOAA 3W4JA 1E79D 3GRRA 4NICA 3RAEC 3VJMA 2QN2A 4OK3A 4EHNA 1JG2A 1L4YA 1N6HA 5D00A 3JYPA 3ZHOA 2HRZA 5EP4A 2I65A 1JDJA 1WXWA 1M5RA 1NNEA 5K8TA 1SNYA 4P36A 1XTRA 2WIKA 1U2GC 1RWKA 4HTFA 3SYTA 3AP1A 1GDDA 2OESA 2REXB 3D2AA 3NPMA 1UBNA 5K3SA 3SBXA 3SHWA 1U5CA 3IOYA 3B9QA 4RTNA 2YJNA 2ZPAA 3C87A 3D31A 2B4AA 1NKSA 4XUCA 3DXYA 3L4BC 1I3CA 3HV2A 5JDIC 1GGKA 4D9CA 5K3CA 3PJDA 1V35A 1NUQA 4WW0A 5LXTB 3VPXA 3OCZA 2UYCA 1XCJA 2ZWVA 3QHPA 4OXRA 2CFSA 4ONEA 2JGIA 4DMMA 1DQSA 2ZJFA 2J85A 4WBSA 3RT1A 5KC8A 2ZRBA 4XYGA 2HLNA 1XEWY 5DM70 1RXUA 4O59O 1N9GB 2C2GA 4V0MA 2JHFA 3GRFA 3Q4GA 1H85A 5FEUA 4DEVA 4D45A 3EGCA 2AG0A 2XSZD 3UKJA 4AFNA 4OU5A 1J2UA 4M53A 2HJSA 2YDYA 4LOJA 4QXQA 2I1LA 2ZI4A 1BKDR 2MSLA 3QUTA 1TZKA 1J8QA 3HXKA 4EG7A 3B36A 1SA0B 3ZWVA 1HEYA 2VUTA 3ET4A 2PXAA 4N7JA 1W6RA 1DG9A 4QYTA 3U1BA 4MAFA 2CNWA 1GU7A 3KAJA 2QRVA 3PRHA 4EI8A 5BQ3A 4D25A 2NXCA 4FC6A 2ZBRA 3ON5A 4ME6A 4EFDA 2POCA 4QRIA 4IIFA 4KQ6A 3DEIA 4KIJA 5HGXA 1E0DA 3KYJB 4HZGA 5IC4A 1FJXA 3FWYA 1I7DA 2RDMA 3ZEAA 1CJKC 3F71A 1A8PA 4JI2B 1QC5B 3ZK7A 5BV0A 3THOA 5F7JA 1JLHA 2BSAA 4C08A 4NYIQ 1FQOA 1Q14A 4AJEA 4MIYA 4R0NA 1CHDA 2CFRA 4BVFA 5KYGA 3LUFA 1Y6GA 1G9TA 1Q7EA 4E3ZA 1YB5A 4HDKA 3TK1A 1ZU4A 5EJGA 4EY5A 3QE4A 3ZE9A 4DQLA 4GKKB 1AXGA 4I4IA 1W0KD 2C4NA 2QHXA 4EKDA 5AKZA 1T6XA 2PRIA 2B78A 5BMOA 3P8ZA 4PCAA 4GI1A 3LVRE 4KQXA 3T3HA 3E05A 2W2KB 1KH1A 3G8YA 3TZLA 3OQ1A 3SC4A 1KAEA 2H18A 1BVRA 1Z08A 1QPGA 4MP8A 3WYGA 3SD7A 2BMAA 2QDKA 1E3TA 4DADA 1PQUA 5ETJA 4HQFA 4DR3B 4CNBA 3ROMA 3OZSA 1LEHA 5LOVA 2EKBA 3U3ZA 3PHJA 1M8PA 1VLJA 1OT3A 1RM4A 1H2HA 2FFQA 1AF7A 3CR3C 3DBLB 3LZDA 3QVGB 4RPLA 5F3RA 4ZOBA 2XE4A 3O21A 3EZNA 3I1JA 3PHCA 1PEDA 1ZMBA 4KFUA 2DR0A 4U7DA 3GZNA 4OFZA 5LUAA 3O4FA 1IK4A 4YJ3B 1KRXA 1KK1A 2HA6A 4K40A 2ZSUA 4FE4A 3KTOA 2M32A 4AF8A 4EW3A 5JTTA 5CD1A 2NO4A 4RKRA 1KQFA 3KTFA 3PUJA 3TQQA 4LECA 4B3TB 1VI5A 3UC9A 4RD1A 3GUHA 5B1YA 3JAWB 2GN2A 1XCBA 1DO0A 3HK2A 4HOYA 1M1XB 1PUXA 3CVWA 4FB5A 1Y8QB 4V38A 4YAJA 4C0SA 4LN1A 3G7UA 4Q4AB 4X7BA 3VISA 1RIIA 2IYOA 2VOEA 4QNRA 4HNUA 2A5JA 1CX9B 2R7LA 3WMFA 1IHXA 2ZWPA 1NVBA 4PZLA 5IWAB 3MT0A 2FKNA 3KSZO 1ECLA 2IZ6A 5DCLA 3WK6A 3S8MA 3AESB 1W47A 3LH5A 4YPVA 4KFSA 1DEXA 4TLLB 4ZRDA 3V2UA 1QCYA 2V7QA 4CTKA 2NV6A 5I7OA 2LCIA 3G0DA 2E7ZA 3I6QA 2D1RA 3ENVA 2PGXA 1M8GA 1YS7A 3Q12A 3L4KA 2DTDA 3BXXA 1XALA 4NR0A 2PXHA 2ZIXB 3NI2A 2G1KA 2WU8A 1FFXA 1R6VA 4O0MA 4KIFA 3WLEA 4IMIB 2Z5VA 1UMCB 2DPLA 4KQ9A 4ZVTA 1Z5UA 5ALHA 1WQ3A 1CWUA 1FXWA 3VNRA 3UJ3X 1F17A 1QK4A 4PX3A 4EWLA 2QGNA 3FPEA 4KLZA 5E3HA 2UYHA 4UBLA 1ZK1A 1TK9A 3T7JA 4ZYUA 5C7YA 1K7YA 1GL7A 2CNDA 3RC8A 1L0BA 3CH4B 4O2RA 5I4CA 1IZYA 1J2TA 1MXHA 3EZ2A 4LTMA 4LRXA 2IEGA 2VRBA 2PWAA 3ENQA 2H65A 3E3NA 3ZGOA 4BVAA 4I55F 1H1LA 5DISB 3D7SA 1MV5A 1ZZGA 4R2KA 2QRLA 3PQCA 4WRRA 3DKPA 3MT8A 4L73A 4URUR 4HN2A 3I0MA 1H8ED 1JUDA 1FTNA 3AF0A 3M6MD 1FSGA 4YAWA 5CX4A 2IQIA 2XNKA 1Z07A 3RKRA 1LPOA 4YCCA 5A9SB 4WN3A 2V9ZA 4BJ6A 2P30A 4IVNA 2VPTA 4QHTA 4BB9A 3TZEA 4HRVA 1LI5A 2XVYA 3UB3A 1RZRA 2QBYB 1QZXA 3M2PA 4WFJA 1RWVA 3ZH2A 3R9IA 4ESOA 3WRYA 1X1QA 4ENTA 2IYEA 4BEJA 4E14A 4X94A 1N3BA 1SBIA 1YK0A 2JFHA 3AF6A 3BFPA 1RHUA 4NH0A 4AJ2A 5K8IA 1FLVA 4JP2A 4Q03A 1BTOA 1D5WA 3BQ9A 4G65A 3SQOA 3C5EA 2VK1A 3CU5A 1M67A 4P3XA 4ZQBA 5IK2D 4TS3A 2FWBA 1U3WA 1VFPA 4LKOA 3W6UA 2W71A 1JFFB 3HI4A 1IZ7A 3NM4A 4W1RA 1MXFA 4MRSA 4IEEA 1GVNB 1OLUA 1C2TA 4FYPA 1FBTA 6NULA 4BLVA 1E58A 1YZHA 3OX1A 4MR8A 1G20B 1GGMA 3CJTA 3IFSA 5FV4A 4REOA 4QTZA 1PNVA 3RIGA 3C70A 2C9YA 1Q1AA 3TVTA 4I6JA 3B2NA 2H29A 2UUOA 2ZQZA 1XKTA 2AFIA 3C24A 4P3OA 4HQ6A 2YFHA 2J5BA 1FYEA 3DVQX 3PZBA 4B3CA 3NCTA 3WMEA 5JJIA 1GGHA 4AC9A 1R7RA 2V7GA 2H8KA 4XE5A 3SC6A 3EVFA 3T5AA 3D8UA 2QYOA 3KYIB 1OXKB 3TS1A 3DT6A 3TGLA 4TQUS 4CT5A 2QF7A 1NJ1A 4BKQA 2R79A 4NOLA 5DLEA 4X1KB 4EEXA 1AKEA 4QG3A 5EWJB 4ZVLA 2C58A 1BWSA 1BX0A 3VR3A 3QE9Y 2PJDA 2K2QB 2VHYA 1ANKA 5CH3A 5HRAA 3TTUA 4O2LA 3T5DA 3EXIA 3T3DA 1W8IA 4XQGA 1PZFA 4HG2A 3RIHA 4F12A 3PJEA 4GMHA 5KTKA 4I1RA 4DSTA 2VQEB 3AGPA 3QU5A 4A0RA 3R7WB 3V1YA 1NVFA 1Y4SA 2FRDA 4UBMA 3EDMA 5E1OA 1EWRA 2J5XA 2WZQA 1KMHA 1LSOA 6YASA 4KKXB 4BMSA 3LFUA 1GV1A 2TMDA 3SE7A 2ATIA 3M9XA 1Y7TA 4OVKA 4Q3DA 5IDVA 4AG5A 2PUFA 1OHHA 1DAFA 1Z6XA 3BH6A 3KQTA 3DW1X 4BNVA 4QFCA 3K9QO 1YZLA 2CXTA 4U7GA 4RH1A 3M3PA 5C7LO 2BMEA 2Q3DA 2W2OA 1KNQA 1ZSNA 3CRVA 1XZDA 1XZKA 5TS2A 1AUVA 2WOJA 1Y42X 5FOXA 2FUG1 1XZQA 2QTVB 3GJ5A 1EBFA 2IIBA 2OC4A 3K5HA 4HNQA 5F12A 2GXAA 3IT0A 5FFFA 4V0RA 5HMLA 5ALKA 3HCEA 4D98A 3MAGA 5EHIA 2IZ7A 4D3ZA 2QEQA 1SQGA 2WE7A 3CT4A 1YDHA 4MDHA 5ENVA 5TSDA 2AMJA 2MR5A 4NCXA 2O8BB 2P4EA 2V5UA 3CRMA 1QR2A 3P9SA 5BOSB 1RCTE 3ENZA 2FW8A 3K3PA 3UENA 1DX9A 1DBVO 3O83A 2JLSA 3RSOA 5BSHA 2JZOA 3CX6A 4FHEA 4QUDA 5A05A 1DELA 3EHDA 1HURA 1DV2A 1XHFA 2UZIR 2HV9A 4ZDWA 2ATCA 3DQPA 1WA5A 4D9NA 1P3JA 2ZDHA 3K32A 4FU0A 4WGGA 1GY8A 4N49A 3AJ8A 2RGEA 4AJ9A 4GYJA 2JGMA 2OR3A 4WZZA 5A0FA 3RLIA 3PPYA 3GH3A 1VL5A 4GSLA 1VRVA 5BUCA 3K70B 1EFHA 3I2FA 3M9LA 1CYEA 2HH9A 1YU9A 5IT0A 3GJZA 1JLLA 1B3RA 2FWIA 3GUZA 4YLEA 2HF8A 2A5DA 5JTUA 2CL0X 5AR1A 5TPZA 3ZXXA 3PGKA 4JC0A 5E9WA 2AEMA 3IELA 4EL0A 2XZLA 2ZJYA 3L8MA 2BWJA 1IMOA 1PWZA 2X76A 3BS4A 3DEYX 4PPGA 5AKEA 4ES6A 4ICIA 1LGYA 3NYIA 1VL2A 2RHWA 3NOXA 2F3RA 2WHYA 4OB7A 2IV7A 5MFPA 4DYDA 2VDPB 1XTZA 2O5RA 3DUFB 1DI0A 1FW8A 4HDMA 4QAQA 2P40A 4J94A 4RF4A 4WY5A 3TXAA 2VZEA 2ZT6A 2GM5A 4HO1X 3W2FA 1Z8HA 1QAMA 1HMYA 1QBKC 3FI9A 5K3OA 1U8CB 4ZJPA 2JI4A 3ET5A 3FF1A 3UNXA 1YVUA 2POQX 4IS2A 3AKCA 1ZYUA 4Q7MB 4ZAZA 3AF2A 2QVGA 3LPDA 3D7KA 3JD3A 1AUXA 3SEAA 3DOCA 4FEYA 4Q47A 1XTJA 5CP8A 4LXXA 4PZEA 3HVJA 2VK8A 3PKJA 5THQA 2XRFA 821PA 3N9IA 5IAAA 3HXMA 4KFCA 1E4VA 3M34A 2FUEA 3NP7A 1XC7A 1PR6A 3NHBA 4HTFB 1Z4JA 3KZ1E 1HDIA 1K8ZB 3CH5A 2NSDA 4W1QA 5A4KA 2OBLA 5D86A 3T5BA 3ZXIA 4UM5A 1DP4A 4WNIA 4CODB 4PC7A 4DZRA 1UKEA 2QSJA 3OPQA 2NX2A 1UJMA 1T5BA 4NRDA 4PXAA 3R76A 2EZ8A 1ZC4A 3CG0A 1X8KA 5CFMA 5J23A 2QTAA 1LI7A 5IM5A 2Z4SA 4MKHA 2EHDA 4UM8B 1UBOS 5K8UA 2AI3A 1C9DB 1YVDA 3HRHA 3VR5A 4NZNA 3FTQA 1Q0QA 3PCXA 1LNSA 1ZL0A 3LC2O 4JK3A 4JXJA 1U2QA 2ZS7A 4IEIA 1NUAA 4ACBA 4GP7A 2HSWA 5ENZA 3O9MA 3T12A 2DH5A 4BWVA 1ZO8A 3RARA 4UVHA 1W25A 1MUUA 1PZNA 2UV8A 2HREA 3U3RA 3ZIAD 4B3HA 7ADHA 4H15A 3MT9A 4E3WA 5ERGB 5EJFA 4HBZA 4G85A 5HCUA 1IAVA 5SY6A 1IWBB 4LZAA 4P0TA 1WMSA 1EFTA 2AQIA 2ODPA 2VATA 3DCJA 5T8KA 3SZOA 4OLAA 2QRVB 2XADA 2OEPA 2OHXA 2R5NA 3AR5A 4M9XA 5FBKA 5TC4A 4A16A 3W90A 4LXGA 2DCUA 1WXGA 4Q82A 5CFOA 5FI3A 1XDGA 1KFEB 2RGNA 3FTDA 3RFXA 4KXUA 1BS2A 1VSUA 2O07A 1BDMA 2QQFA 3NIDB 5H3CA 2WQ7A 3KQLA 1Y6QA 3GMDA 5IF9A 3MGCA 1M34E 3SM9A 1A2KC 4RZXA 4XLZA 3GJYA 3ZJVA 1ZGHA 4HPXB 3EDQA 4QUJA 4IRUB 2OAQ1 2OOKA 3C98A 3LDAA 4BLWA 4KYIB 3ZNOA 3V1UA 2GZ2A 3D8RA 5SY9A 4XUGB 3H4IA 2B8JA 4EFMA 2EGUA 4HDKB 3WMWA 1D2RA 1Q92A 4EOGA 4YUAA 2OYCA 2I4MA 2E89A 1UWKA 1U7XA 1DEAA 3A6PC 1SCNE 1HQDA 4QG7A 2WIDA 2VDQB 2C2ZA 3KT8A 1DBWA 4U2BA 3RIMA 2FEPA 2VUHB 4FOSA 4L75A 3N0WA 1MAAA 1BN7A 5ALUA 5IHXA 2VRNA 5HCNA 5ICCA 5DKFA 2I78A 3TQSA 4Q3CA 2E0IA 1C3OA 1S8NA 1FU8A 4HS9A 1E66A 1LRLA 4IMPA 4Z54A 1T8TA 2FY8A 1GZ4A 5LOVB 1PG5A 3DE0X 4Z0HO 3SKXA 3K9FC 4KI7A 3WRXC 3V8RA 1JI0A 5KWEA 3HVRA 3C1AA 3UAXA 3TTYA 3SBDA 2V0CA 4O3FA 1K6JA 4RSRA 3W7BA 3UPTA 5AI6A 3ZW9A 5K6AC 4KPUA 3PQ8A 3GZNB 3VKGA 3WB9A 3DDZX 1R0KA 1NVMB 1AGYA 1SOVA 2QRKA 3AJDA 1QUEA 4ZVKA 1G6HA 5J4YA 1XMVA 2O3RA 4HAWA 2ONJA 4UHJA 5KREA 1OFVA 1YJQA 5DH9A 1UBEA 1CV2A 4B3FX 3E1KA 1KEUA 1IUOA 4HVLA 1GM5A 4K6CA 2XB9A 3RRXA 3DPUA 3NAQA 1TCVA 1Z33A 2R6CA 4MV1A 2HKIA 2MSCB 2NXWA 3TRJA 2VYVA 3S2IA 3VPHA 1YRYE 5T6MA 1ZH2A 4UHEA 4WUVA 5ECDA 3ZZTA 3O90A 5HXAA 4AJNA 2FA9A 4NAHA 3VKFA 4ZT5A 3R5JA 4WDQA 2GPWA 4EGQA 3LPAA 2H11A 3VYSB 4ND7A 2QTRA 1PJSA 4ZKEA 1N1GA 4PXSA 4RZQA 2R86A 4CM8A 2XUJA 5CB4F 2GAOA 5AUPB 1VB5A 4YT5A 1LPAB 1YRAA 3V32A 1HSOA 4MICA 1AHNA 1FFXB 2ZE7A 3U3MA 2ZQYA 3KLNA 3QM1A 2JH8A 1X0XA 1MB2A 4BRZA 4UEQA 3HEBA 1M72A 3BJRA 5CJ2A 5COBA 1I7PA 3IP8A 1WBJB 3U4QA 1YT5A 4DUGA 2O8VA 2JD2A 1CUUA 4RMHA 4WESA 2QE7A 4H1TA 1E59A 2ODTX 4FMDF 4IDPA 3BWEA 2G71A 4M6WA 1Z63A 1Z2PX 2ZSBA 3C8ZA 4RX1A 5B2ZA 4DCJA 3FNHA 3GLGE 3NDPA 2JK0A 2RAUA 2XLCA 3OZXA 4A0GA 3IVAA 4RIGA 4E1BA 4AKIA 1PR4A 1MABA 2Q8QA 1CNMA 2P1DA 5K03A 1CJSA 1QGYA 2QTNA 3P9XA 2X0JA 1H1LB 2Q6IA 1PTKA 3CLRC 1FFEA 4YXWA 3KKQA 1E1DA 2FTKE 3E9QA 2QN1A 3MJFA 2F6RA 2WHQA 4HADA 1XOIA 5CRIA 1VHTA 1RD4A 7MDHA 3T9EA 3LHDA 4JP3A 3CZQA 1P6XA 3S1LA 3WDMA 3U7GA 2DLNA 1ADJA 4PAWA 4BASA 2Y0BA 3KYCA 4BFCA 4EK9A 3Q8WA 1N5OX 2BFCA 3EC7A 3LYAA 3B5EA 4LPSA 2PZKA 5LCXA 5DYTA 5CFQA 1KVSA 3DLPX 1MTOA 3HLYA 1WX1A 1OY1A 4QDJA 1OZAA 4XM0A 3TOXA 5M04A 3VAAA 3SJCA 1JRLA 2WTEA 3E35A 4JVNA 5DHUA 1FX1A 4GI2A 5JS1A 1VZ3A 4GVPA 4DIUA 4C4PA 4Y1RA 4KR9A 1QM5A 2QYTA 3CSDA 3LBFA 4Y9DA 4ZRNA 3AOGA 5C7IO 1QKIA 2G06A 1HL3A 2I33A 2X5OA 1WETA 3OOYA 3KR2A 3H13A 4H7HA 4XQEA 5DVZA 1NE2A 3CLUC 2IX9A 4BX8A 3L18A 1CETA 2OMEA 3OOSA 4FOTA 4CF3A 4GZ5A 4PPFA 1U94A 4CBVA 3DZIA 4MR8B 4J0QA 4UVGA 4HYQA 4J07A 3ROXA 2WWGA 3UV3A 4IHQA 4YDQA 1N2BA 1YXMA 4MUFA 3EH1A 1JKFA 1JU4A 2MWMA 4KWHA 4NDNE 5ALRA 2Y1XA 3ZKWA 3IPLA 1DUSA 1MKYA 2XVMA 2AFIB 4NAUA 4DCSA 4CKZA 5C1IA 1TTTA 4NSNA 2LVBA 2AJLI 1OILA 4TUYA 1KA9H 1JLRA 5EJEA 2SNIE 4G01B 2ORVA 3G2KA 3E8SA 4IGKA 2X5XA 5JY1A 4BO6A 2F8SA 1QZUA 1ODTC 2RHTA 2Y77A 2YXLA 3EDCA 3H9CA 4HH4A 4V03A 2ICAA 3IALA 3K1YA 4LOAA 4RD6A 4UDOA 2DLCX 1R0RE 2DT5A 2YNMC 3VKUA 1UINA 2IDJA 4LMRA 4MPJA 4YVFA 5HOQA 5EJ2A 1V9SA 3AYZB 3C15C 3EXIB 3WGJA 2GEVA 3O03A 5LQUA 1N2HA 3VA7A 4R71A 1DRKA 2Q2NA 3AKYA 2O2SA 1L4UA 3JQAA 1O1YA 1EA7A 1RKXA 5TF0A 1M73E 2WAAA 5CU7A 2W6QA 1Y4UA 3IIIA 1KMHB 4B17A 2AZDA 3ZCSA 4IVQA 4MRRA 5IDXA 3AG6A 4TLEA 4CQNA 4KXVA 4M7RA 4FP9A 5FWAA 4K0KB 4IJ6A 1YCFA 2CYCA 2O8DA 2L19A 3CW8X 4B76A 1XL1A 4UFOA 5HHTA 5JZOA 4R05A 5EE9A 2P2LA 4D81A 1W36D 5D84A 4JFAA 5AUQA 1P0QA 5LZ9A 3B82A 3V4RA 4WN9A 1AIPA 2QJTA 3KQNA 4J2OA 1PBNA 4KDRA 4EKNB 3G2QA 2HNBA 5MF6A 1R66A 2FDCA 3JASA 2BGWA 4JKOA 3GAFA 3OPYI 2D5LA 5DCUA 2P27A 1Y4AE 3OE1A 3ND6A 3QVXA 5IARA 2XUKA 4TROA 1XTIA 1X15A 2ZJ7A 2A0YA 2YXBA 2ZRFA 2AD5A 3F90A 4UULA 3ELDA 2HWYA 2IEYA 3C5CA 1FLAA 1RHKA 2W6ZA 4EHBA 2AL7A 2OHOA 3SU8A 3ZLJA 3OE5A 3FZEA 4MGKR 2L18A 4DS3A 1W9MA 1LSJA 3KYDA 4YJHA 5KBYA 1K7EB 3TG8A 1QNFA 1JNYA 2D7CA 3UMYA 1S0UA 4IQGA 1O5IA 4L3VA 5CT9A 2IQ5A 1JS1X 2ZRPA 4AUKA 4L4ZA 3E1GA 3AETA 4RD3A 3D7LA 5K0GA 1QO7A 2PZ8A 2EATA 4XWTA 5JSYA 3W6OA 3BQNB 4FYIA 5I4KA 1U1IA 2IWRA 3RRBA 2A7QA 3EWAA 1BKYA 4GZMA 4FLMA 8GPBA 1IY0A 1M7BA 1R0LA 1WS6A 2R7KA 5EWMA 1ADCA 3WNDA 3F9IA 1FUKA 4EMTA 1G8PA 1NI3A 5GMOA 4EYKA 5BV1A 3KELA 4B6FA 4K9LA 4UE2A 1JLLB 4FXOA 1UPBA 3L0OA 5DHPA 2P2NA 4UARA 4UBOA 2DE0X 5LP1A 4DJ5X 4I1IA 1VLZA 2FPKA 5LQMA 4HHEA 2ZB2A 1QHEA 3QBJA 3T1OA 1HQYE 2LKDA 4CIYA 1YULA 1HDEA 4R81A 3WLJA 1UUFA 4O63O 5J2UA 3KZCA 1MPXA 2GM4A 3O4HA 4LJAA 1BAPA 2JW5A 3VAYA 4BJ1A 3AU9A 4PQEA 4Q9KA 4B3BA 2FG5A 5B3JA 1ONBA 3ZUGA 4UW9A 4HDMB 3I45A 3L43A 5ALMA 1L1RA 1NF8A 2PCLA 2WYOA 3KUUA 4ILEA 3WOHA 4UAJA 2A9KA 4D8TA 3CCCA 2BKLA 2LPMA 2X2OA 2PA3A 2J6BA 1EK1A 3CYFA 2UXBB 4TTAA 1FOEB 1SR8A 3OT1A 3Q5DA 4DSZA 1WSAA 2VSQA 3FPFA 1RZVA 1AS2A 1LPSA 3ABOB 1E98A 3CNOA 5IJZA 3OAAA 3O94A 1QWSA 3K0EA 1XMQB 3VR6D 1NYLA 3NWEA 2PA0A 4PGAA 3U1TA 4B40A 3CRQA 4BQFA 4Z4GA 3TQIA 4XFJA 3DMTC 3DR5A 2ZRDA 5E2BA 5FOUA 2RJOA 4GXQA 1PWEA 4V0LA 4BP3A 1X7XA 2A88A 1YRLA 3W3ZB 2BCEA 4C4AA 4RV5A 3URKA 4S35A 4MRAA 1RXIA 2CCGA 3K9HA 4AP5A 4IY1A 4EMUA 1YVRA 1P73A 4ZAFA 5D5PA 4BNXA 4G5GA 1GGNA 2R1UA 1I10A 3CUTA 1SGWA 1WCYA 3MB8A 5FD8A 4FONA 5FUVA 3V8MA 4E46A 2UUPA 5LLTA 5JSZA 4YRSA 3LQ4A 3EIFA 4RPCA 5FP0A 3TVDA 2C3MA 2GARA 2BV3A 2R8EA 3H3XA 4TSRA 4DMFA 2VK2A 3UUEA 3S28A 4ZV7A 3OIDA 3SBEA 2BGGA 2JDID 4NBSA 1EDEA 1YI0A 4P93A 4BCDA 2Z5LA 3CUSA 1CEXA 1G63A 4JWKA 3OM0A 2G77B 1RDFA 2IZOA 1HLDA 2AC4A 2YZKA 2IZZA 5KJEA 2H57A 1V3UA 2WV7A 4LRUA 4NS4A 2ADMA 3WBBA 2F1RA 1V9CA 2NW6A 3NEPX 1JMKC 2QTZA 1EGAA 4GM0A 1AS0A 3N3AC 4JMPA 5CLQA 3D4OA 3AP2A 3PD1A 4ASUD 3V8NA 2VJNA 3WADA 4EYSA 2W22A 1MEJA 4CR7A 2VF7A 2FPWA 5C1DA 4QVKA 5MGBA 4HQNA 2VYCA 4QJ5A 4YR7A 3QY0A 3CVOA 2W2TA 1KVQA 2C2YA 1HFWA 3HKBA 3Q3EA 4NMHA 5H82A 4YCNA 1Q0TA 1N6NA 3HDHA 4D4MA 4PYKA 1QIGA 2B21A 3FIJA 5TJ9A 3EUFA 4N0PA 3DM9B 4BLTA 3FOWA 4EPTA 4RVSA 5CB0A 1I4OA 1G8SA 2RHHA 2XXJA 5EJ8A 3DQQA 3A32A 2C7VA 1XZGA 2H31A 2PLAA 3V4SA 2B1GA 4AS3A 1J07A 1GG5A 1XZFA 3LDFA 2CHGA 3QI2A 5HA5A 5JWRA 1NG9A 2JGEA 3A28A 4A6PA 4BMXA 4WOJA 3WK5A 1C3OB 2RAFA 2QIOA 4PBSA 2JCXA 1GT6A 2HQ1A 1KEWA 1XVTA 3KKLA 3OU6A 4FD2A 4G0MA 3UAYA 5TNXA 3A9TA 1T6YA 3NEAA 3HZZA 2XNCA 2VZ8A 4M0KA 4GH5A 2DFDA 2P69A 3B70A 3I34X 4MUGA 3JQ9C 1F5NA 2PGOA 3PQ2A 4RANA 1LVUA 4RLQA 4TSFA 3WQQA 5JJBA 2JIOA 5CA0B 4NPHA 4JLAA 2QU7A 1Z35A 3AEUA 3RKUA 1E99A 3ETCA 1R9JA 2AX4A 1A8IA 1KI6A 1KEKA 3BDVA 4Z53A 3CX7A 4X63A 1KOJA 4HQKA 4ZT4A 1EEHA 3HV0A 3MTGA 4KPUB 1UMBA 2PU5A 2CJYA 1OAOC 4H7PA 4K0RA 1D6SA 3G9UA 4FGLA 1LQTA 5HDBB 4D9KA 2F59A 2X8AA 3U7FB 3NT4A 5I4BA 4WA8A 1Z0SA 2JI8A 1Q83A 1UZNA 2PZAA 3B9PA 3LT1A 5LIRA 5I48A 3C1TA 1QV7A 2ZSFA 2H16A 4HDAA 5MFZA 1I2AA 3U44A 1TD1A 3RKSA 2C99A 1SVNA 3E03A 3PLNA 2H7CA 4KQFA 1KQ3A 1LSSA 4C7XA 4MQ4A 5ICMA 4Z0PA 3H7IA 3NS7A 3VC7A 3PNKA 3WJAA 4ARZA 4BE4A 5ILOA 3AB8A 1CUZA 3FMFA 4ZCIA 2QP4A 4I9NA 3ZZNA 4P86A 1R37A 5AOCA 2DUJA 4PRLA 3SXUA 4A27A 4CV0A 1KVRA 4YRZA 3PE4A 3R5SA 1DHTA 3UZUA 5KTNA 1P0MA 1YL7A 2FEKA 2HU8A 4HVCA 1EZ4A 4RVHA 1F6BA 3BD6A 1B93A 4CM8B 2J3HA 4LY3A 1DBRA 3FHCB 3M1AA 4UXIA 4MMYB 1EVQA 1K8RA 1GA4A 4EMSA 3ZCQA 3BHNA 1XPOA 2QP9X 4B3SB 3N0VA 3FLAA 1QP8A 5C5IA 3MF4A 2R48A 1QR6A 1WB5A 3Q5GA 4L9RA 4NHOA 4B8YA 3U4QB 5IVKA 1NSFA 3E9MA 3H2IA 3OIFA 4JOQA 4HAOA 4YCLA 4WESB 1FDSA 3H18A 3CKLA 4M6WB 3ROTA 1T6BY 2IOFK 3MNFA 1ZJJA 1CRWG 3H42B 2N1MA 5CNMA 1PNOA 3KBBA 1TK3A 1MABB 3UEOA 5FBLB 1MD9A 2JKYA 3SDSA 1Z4KA 4B73A 3QU7A 4JJ7A 2GCOA 3RHFA 3FIUA 2LCFA 4HD8A 3AY0A 1K6IA 3CNBA 2EKQA 1C1DA 5FFMA 1IY9A 4BNDA 1NKTA 3OZUA 3N05A 3RTDA 4QYMA 1AF4A 3L8HA 4CDNA 1WCWA 3BEDA 3ZY4A 4TYYA 2JIDA 3HLTA 4C0QC 2XH8A 5I7RA 1B8NA 2FPIA 3EVCA 1YE3A 1JPJA 3KYCB 3RBVA 2Y1FA 4ER3A 2EW8A 4Q9AA 2BFCB 2DFKB 2IL1A 4R68A 3VHQA 1KGDA 4E0BA 2OBBA 4C06A 1JSCA 1DINA 3ZW8A 3C41J 1T43A 1XRNA 2X0DA 3ZWNA 4RY0A 1ES9A 4YQZA 5D87A 1O77A 5CLHA 4IVRA 1O2DA 3QPDA 4AI6A 1PBTA 2J3LA 2IYWA 3AEZA 4Y1RB 4Y6PA 3P0JA 3UGJA 5EUBA 1JU9A 3ZWDA 1O0SA 4MVJF 4J3FA 3NHAA 4S1TA 5G0WA 4HCJA 1GT91 4FILA 1GYRA 1OTYA 3W1VA 3RSHA 2XZOA 3S55A 4MW7A 3UXHA 4JEHA 4NBVA 4Y2QA 3HA2A 1WW2A 3BH0A 4OSOA 4KRXA 1W5TA 4QEDA 1TQ6A 2RIPA 1SBTA 5B3AA 1MB4A 1ZCFA 2JL1A 1JPNA 2V45A 2WJZB 4MVJH 4KHPB 4UE3S 5EIBC 3GJXC 1OZHA 5IJ0B 3ZKWB 2JGLA 1ATZA 1IC6A 2JAWA 2BD0A 3FH0A 2QQ0A 3A26A 1CFJA 3ME5A 4HK4A 5EE1A 3KPUA 4TUYB 5CT4A 3OA2A 1QF7A 1Q84A 1B1AA 5D3ZA 1D9XA 1F12A 4HFRA 1ND5A 4LJRA 5CVUA 1LBHA 3IV7A 1ISPA 2PKWA 3N6RA 1ABBA 1UCFA 4MJ3A 1H05A 5B1HA 5AQ1A 2UZ4A 3WBJA 1O97D 1WCIA 3CG4A 1JR3E 4GQAA 5LA6F 4PG8A 2I80A 4MGYR 1NIPA 3I72A 4J90A 4OV6B 3EH2A 3RWBA 3WKCA 4AMGA 3OP4A 4BCCA 3A7EA 2VFAA 2WABA 2QUKA 3TXXA 1T2NA 3QP9A 5AW5A 3V33A 3W8EA 1MW8X 5HMMA 4BGEA 3IQZA 1EX1A 1HG1A 4R3WA 3CZ4A 3FCSB 2CEKA 4LJ7A 3JQAB 5B53A 3KJEA 1SUFA 2LBPA 2QAIA 4CMKA 2ZYVX 4DYHA 2PGAA 3DBOB 3QPBA 4PNEA 2O20A 3EEFA 4MNTA 5KNDA 4ZDKA 2QR2A 1SKBA 3UJ8A 2KHZA 5ALDA 3GB9A 4H4DA 2O8DB 1UBSB 3PV0A 3TZQA 3B6MA 1DSSG 1OKKD 1XZHA 3FCOA 5F21A 1FA9A 1BMFD 1NJSA 2Z56A 3FF4A 3SIRA 4WN9B 2VUUA 4CUZA 1NOJA 3ZY3A 3KTDA 2K7FA 4ZAYA 5CIWA 4AULA 4RGQA 1J8MF 1R5BA 3JASB 1U81A 5HCIA 3B85A 3SI7A 3VKWA 3LX5A 3PNPA 1WG8A 1TA0A 4C5CA 4LQCA 1PZMA 2HBQA 4EPRA 2CXQA 4DIDA 1EIWA 1D1PA 1VGRA 3EARA 2OQRA 5DE3A 1PD0A 1KI9A 1YDEA 3RC7A 2ZAIA 4NP6A 2KI5A 4F21A 1U4SA 3IBCA 2VDUE 3NGXA 3ZQ6A 3M5PA 2Z5GA 1E7QA 3TW0A 3LL7A 1E4EA 5CFPA 2QLMA 1ZM4A 4BNTA 3KYDB 4LYEA 4NHEA 4YJHB 2ZSAA 1XZBA 1NBEA 1BIFA 1T5LA 1XQ9A 2ZSKA 3GO4A 4Y2VA 1M74A 3GIWA 3MMNA 5DN6D 2G36A 1IBCA 2E6KA 3AB3A 3CPHA 1B15A 3M33A 4KACA 4L22A 4TT3A 1AHPA 3HMKA 2I2XB 1JXOA 2YZ7A 4TMZA 1IXRC 3AETB 5EPUA 2OAGA 2ZUTA 1L4BA 4TV8F 4P38A 4PN3A 3PWKA 4B7CA 3F3MA 4M0UA 2OCPA 3CH6A 4EARA 4CMBA 5JS8A 4G5FA 2DFLA 3MELA 4Z1MD 2O2YA 3CO5A 1FDOA 1GFSA 2FWPA 1X0VA 1J24A 3EVDA 4R7ZA 5TS3A 2VYNA 3DAGA 3PBKA 2FP3A 3DL2A 5EWMB 1G19A 5FOVA 4MDFA 1L3IA 3K70C 4B4KA 1KZ9A 3A4VA 4HNHA 5CGQB 4HQLA 4YJ2F 3DBRA 4A2QA 4CW7A 3RG2A 3C3KA 2SICE 4Z9AA 4OJQA 2E2WA 2Y76A 4I4LA 2RC6A 1ENZA 3C48A 4WGFA 4F3TA 3LW8A 4QGHA 1XRLA 3L41A 1IE3A 1NR7A 1LK0A 2CHVA 1U0TA 2JIQA 5J2UB 3ESCA 1JDVA 4ZT6A 1FNCA 4QBIA 2JG3A 2A30A 3IB6A 1GZUA 1M2VA 1AK1A 3KUCA 1OC2A 2HQSA 2HRRA 2WOOA 3NATA 1OA1A 2QZ4A 3V1MA 1QE0A 4EUHA 1J9GA 1DCMA 1GUBA 2OO5A 1WV1A 1FP2A 2IOFA 4RMNA 3AFOA 4G5OA 1ADBA 1LTQA 1VB3A 2QUHA 4XWOA 4F2GA 1JDNA 3KSDO 1E94E 1YDWA 3FCCA 3M1IA 4PG5A 1ID8A 1XTTA 3JVVA 4DPMA 4X60A 3OT1B 2ZUBA 2WUDA 3LCJA 1UPXA 2FK7A 3PRYA 4OJYA 3RYIA 4QDZA 2XUIA 4BNZA 4N48A 3NFRA 4FFOA 4YCJA 2GESA 1JEDA 4US1R 2NXEA 4R1OA 2X9LA 5EHGA 2Q5FA 1W48A 2IUFA 1EXMA 3ZU2A 5J47A 5KQGA 4UEWA 4YX9A 1THZA 3URMA 3BBPA 4YASA 4K6MA 2JRCA 1Q3HA 4PONA 1X7XB 1HETA 1IRXA 4NZ9A 1ML4A 4ZQCB 2QVYX 5T41A 3BD9A 4JKIA 4TMKA 1H2RS 2VPQA 1C9EA 1KO1A 1NX6A 3F8SA 2AS0A 4U5XA 3SKVA 4L4SA 1KAHA 3ZH9B 1YS1X 3S1AB 2O0LA 5ADVA 3FVVA 1SC4A 3LY5A 5JSZB 4E30A 5BWMA 1EFLA 3H4VA 3O91A 4A03A 1BW9A 1EQUA 3A1DA 4IIGA 2F43A 1USGA 1GCIA 4TRNA 5FL7D 3DHNA 4EP1A 3R5XA 3VNUA 3RW9A 3RYTC 3IMFA 3BGOS 3A3KA 4TWIA 4C5AA 4EKGA 1YZNA 2DT8A 2P11A 2HUPA 2R5FA 2GFHA 3K1JA 3QE2A 1D5CA 3FNFA 3RVOA 4C4RA 2G6TA 1NX9A 4TSKA 1FMJA 1GQQA 3MMSA 4U7HA 1X87A 4C07A 3ENKA 5JV5A 3IPXA 1GPDG 2YWDA 1SWWA 1N3YA 3KNZA 1Z2CA 3RJ9A 1O54A 1YJ5A 1YKSA 2C54A 1KKUA 4HZIA 5F64A 2Z04A 5AQEA 3H6GA 4U2FA 4J4BA 3V1TC 3EVBA 3GN2A 3CM0A 1NT4A 4H17A 1NAHA 3HY4A 3DW3X 1E2IA 1V5WA 4FJ2A 4GAEA 5DM1A 5IMSA 4Q48A 1QB7A 2WYWA 3H9EO 2AF3C 3HKBB 3IJRA 3LHKA 5I9BA 5LYJA 1FTSA 4AN1A 1OQAA 2WQ6A 2UZ3A 2WAYA 4M21A 4D2IA 4C2AA 2XQIA 2XCUA 1JB9A 2JRLA 3QOWA 4AUNA 4CIBA 5IABA 2AN5A 2AMVA 2XF8A 4S04A 4RTLA 1KEEA 3DAFA 2BFOA 2QTCA 2WIAA 1G6KA 1J99A 2ZIAA 5H3LA 1F9AA 1DTWA 3HPRA 2WY2D 5HKLA 1ULAA 3PDWA 2AMFA 3FM9A 2VNIA 4QM7A 1W1IA 2BCJQ 2RK4A 5BNFA 2MYPA 1KFKB 1Q7GA 2CJPA 8LDHA 4BQSA 3U2QA 1LSUA 1SH7A 2HNAA 1GR0A 2WTNA 1CFZA 1CR4A 4RF3A 4A0HA 3NW9A 2UYQA 1VE3A 3OBBA 3OF2A 4CKCA 4G2TA 4DR2B 4D99A 3KWLA 3TB6A 1XU7A 3ETEA 3WV5A 1OVMA 3GU3A 1Z5OA 4DF3A 3JVDA 4LDNA 4XGQA 1TO6A 3AEUB 3W1EA 5I6DA 5I7SA 3AVTA 2PR2A 1VLQA 1N2SA 2OV4A 4J9UE 4MKZA 1KI6B 1XNQB 4HWRA 2QS9A 1UMBB 1XNJA 3M83A 4DCUA 3JYHA 4ZTUB 2I66A 2YYSA 1P9NA 3EW9A 2OKCA 1PLLA 5LQRA 2I1VB 2HJGA 2QROA 1FNBA 3LAWA 4RLHA 3T7SA 3U44B 4YP0A 2HJWA 3FPBA 5IAEA 2YFKA 4LDJA 1Y63A 3V3TA 1JAYA 3V6LA 5CW2A 4NXMB 3QLUA 4BY9E 1KYYA 1XVVA 1SIBE 5TMBA 4GBMA 3RU2A 1OV4A 4RGBA 4ARZB 4LF8B 3JQCA 4DCTA 3G1UA 3OJWA 1WW8A 5FTLA 1H6AA 3L1KA 4EFLA 3UHAA 3SXUB 5KMGA 1O4VA 2BEVA 5CFNA 6AT1A 1L5MA 3GD7A 4YJKA 3UT5A 1M76A 4PAGA 3M5CA 2FJ0A 4LSWA 3VZDA 3THRA 4BBPA 4I4NA 4CLDA 5JADA 2FH5B 4FB4A 4FWTA 5CITA 1KVUA 1OFUA 2RGXA 5BWLA 5J2TA 1AKVA 4EA8A 3L7LA 5L8VA 2C1ZA 3RK1A 1R5OA 3HHPA 1QHGA 5BSUA 2CMDA 2ECQA 3OJLA 4ENVA 4J6FA 1BHQ1 4FGUA 2WJWA 3B12A 4RKEA 2ZITA 5HZMA 3D64A 1XPRA 2D1TA 2ZJBA 4E5MA 3BWMA 1WXIA 4XVRA 4ZGWA 4ZJYA 4JP5A 1VFNA 3GJ7A 3EN0A 3BYZA 4K9MA 1WSDA 4KREA 3I8SA 4E2XA 1YRBA 5F77A 3KQWA 2HHHB 2SCUA 3FCUB 1JEJA 1R27A 1AO0A 2BGJA 2F3UA 4WJKB 2BFFA 4C4TA 1QKKA 4HVAA 2GCOB 5I9SA 5K6TA 3C6KA 1K9VF 1G8JA 1RJGA 4NBRA 4NG5A 1C1DB 1DOZA 2DFNA 2I4IA 4YCDA 5F33A 4YPFA 4BNDB 3JWPA 4H1WA 2ISQA 4MARA 2YWFA 1F0NA 1TQHA 3LPMA 1U7OA 2QDXA 4ZAXA 3ICEA 3F74A 3M3DA 2FPIB 2PJUA 2GRAA 1R4MB 1AKWA 4K46A 1IUKA 4FXPA 2JAQA 1UPAA 2V7BA 4ZWNA 3ZGLA 2GD0A 5HR5A 2AQKA 1OASA 2ZUDA 2GM9A 2JF0A 3L0IB 3ZS9A 1GQOA 2AMYA 1OBCA 3EOZA 3P9QA 1YBVA 1ZMXA 2HIMA 1MV8A 1X1CA 2VP9A 2XDWA 3KJFA 3R6GA 4E13A 1NF3A 1DC8A 1DRVA 1GAJA 1PV1A 1UQUA 2QVCA 2WDPA 3CONA 3HKCA 3I4LA 4P31A 5DGIA 2HMWA 3PEVA 4HX2A 5AHXA 4MB6A 4YQEA 1XFAA 3PX2A 1PWYE 1T8RA 2I3ZA 3L82B 4BOYA 3AX6A 4MV3A 4ER0A 3H1AA 2ZTVA 1K8QA 2NO0A 3OF3A 1A98A 1ZC3A 1GPWB 3O38A 4LXTA 4DTCA 5BR7A 4HI0E 1JKXA 2HPVA 4YO8A 4TMTA 1DEKA 3ZYCA 1SG0A 5B7PA 2D1FA 2PDAA 3UBTA 1N2CE 2O06A 4XQCA 4CFYA 3K1TA 1MC4A 3ZU4A 3BIXA 4O4JA 5ANRB 3SEQA 2X3FA 3DTVA 3RRMA 5D3KA 4JEUA 3RDPA 3IBGA 4Y2JA 3WK9A 4CM9D 1A1VA 3Q98A 4E2FA 4PBTA 4UMVA 4EHLA 4MWBA 3Q41A 4GEGA 1RWWA 3UHFA 1T2VA 4KR7A 1H4VB 3LFHA 3DH0A 5HKKA 2OZKA 3HB5X 1XNRB 3G0OA 3VR2A 1WCIB 1GAEO 4TLDA 4MAAA 5E38A 5L53A 4JP8A 4ZV9A 4JBLA 3SR0A 2IF2A 3NX4A 1FFCA 3LW7A 4RETA 1AURA 1JDTA 2WIFA 1LC3A 2J9GA 2VBFA 5KDOA 3I61A 1FEZA 4NECA 4HH0A 1ZX1A 1T26A 1EFRA 5H80A 5CH8A 5KQMA 1QZ3A 3HTXA 4BX2A 3IUQA 2J0UA 3RUEA 2YW9A 1Z5GA 4JMLA 4KQEA 2R62A 3R7FA 4FGWA 2DKFA 1NMQA 4YRJA 3MINA 2FRDC 2AEFA 3SF0A 4L8WB 2RBEA 2ZXEA 2R7AA 4XW2A 1TVEA 4CZ2A 5CXXA 3BE6A 3PT9A 3RADC 4HZUA 4JSTA 5ALWA 4EO4A 2PMFA 2EV9A 1QJCA 3LTEA 4KMRA 2VDVE 2QKYA 3MCZA 3KQKA 3OBIA 1Z8NA 4LBVA 5C0OE 3J7AC 2PY6A 3VYTB 4YIKA 1VG9B 2AE2A 4GKVA 2PQ6A 2WWYA 4D5EA 5B2EA 1UKYA 4U0JA 1WNFA 4X5OA 3B2QA 2C4VA 1EE1A 3V8VA 3KD2A 4R1MA 4FMDB 3ZLTA 2YN2A 1PSZA 4GLFA 2NZWA 1ZD4A 1BRTA 2A35A 5AVUA 1XDSA 4WK0B 1L5HA 4Y2HA 2F00A 3UMRA 4MV9A 5DK6A 2AN3A 1KJIA 1FFGA 4OJTA 2ZIUB 4K9OA 1Z29A 4Q6WA 3IUBA 3G5LA 1EUDA 4BBZA 1OGJA 5CDHA 2VCYA 1PYDA 1XLWA 4C3UA 2FMUA 3OPXA 3DKRA 3LECA 4HF7A 4QZVA 1E4EB 2JJMA 3K0AB 2ZROA 2ZI7A 2J7KA 3WBFA 1X38A 1PAUA 4C05A 2VDMB 4ZDJA 4JLJA 4DKXA 4AKHA 3LHIA 4EKYA 3OFJA 4M98A 4PLHA 3RQIA 2XLBA 4IXWA 4DC9A 3Q5EA 3MQFA 3N70A 3WSTA 4Z3OA 4LF5B 2H92A 3B7PA 5BPHA 1C3XA 5K05A 1HDCA 1TT5A 1NVTA 5HTOA 4W1PA 3KOWA 3TUJC 4FFNA 3V8EA 1DX6A 5IJ9B 2VRCA 5KNLA 3A27A 3T95A 4B09A 4KH1A 3T0IA 3CV3A 4AJLA 1GNLA 5CD9A 3OPMA 3GGSA 1FQJA 2CLEB 1PG0A 4EG5A 5JCXA 3T5TA 4BNWA 4LDPA 3BN3A 3DBRB 3I01A 1LUAA 1AHIA 3ZHSA 2P3QA 3P5SA 3MWEA 2BR5A 2EEPA 1GGVA 1L5YA 5B6IA 4QA9A 4EPVA 1XDWA 3EC1A 2CKDA 3RPEA 3KJNA 2XHZA 4U6NA 3SICE 1QOQB 1T0HB 4LPKA 1EYZA 5FLYA 2CHEA 1M2VB 3G1TA 4I7EA 4PQFA 1Q91A 4KQHA 3SCZA 4F5ZA 3SR3A 2GJAA 4HSEA 1BDIA 4YS6A 1SEVA 4EB3A 1TZCA 2XTNA 1E5VA 2F3PA 4EA6A 3TSCA 4OXYA 1FNDA 1TECE 1ZBQA 3PNOA 1J70A 4K6OA 3ROGA 2JAPA 2WJHA 3F3SA 2YIDA 3U4DA 3W79A 1Y1KE 3NBXX 1TJYA 2J9RA 3Q2KA 2D06A 4YRDA 1L3BA 5DTRA 3BF8A 2R8YA 3IHWA 2OGWA 1YQXA 1QGDA 4NX2A 1PKXA 3IKVA 3PF9A 4LJ5A 4A2WA 3RVMA 1YHZA 2Z57A 4V1CA 2JEYA 2OLJA 5JSHA 1MCZA 4QOFA 3WGUA 2Q7XA 1GOTA 4BFLA 5CIYA 3K6SA 1YNSA 2BFAA 3E7PA 1DGQA 4D4JA 3IAXA 1C7EA 2EJTA 5AM0A 2AVDA 1S7CA 2C4KA 1A4UA 2L69A 3Q7PA 4LRSB 4M36A 4M8LA 1XVAA 2B20A 4YALA 3ZHBA 1DAGA 3L7OA 5DTEA 1WMAA 4EL5A 3DVAA 7REQA 1YR6A 1KZ1A 3EGOA 1Z74A 4P80A 4MI3A 1M0EA 5BN1A 4S1OA 2A0UA 3G0CA 3LPNA 2PU7A 2I4TA 3UK1A 1ZP6A 1WHSB 2CNNA 2LW7A 1N6IA 1MOQA 4FGZA 2XXAA 3HBMA 3COPA 1EE9A 3BRQA 3ICWA 1KI4A 5T64A 3EFBA 1J5PA 4OOFA 1A97A 1SCAA 1KVTA 2NV2B 3LBNA 1BW9B 3MJHA 3N6XA 1EM6A 3QXSA 2CN1A 3PUHA 4OJKA 4UMEA 4X71A 5FBZA 1B73A 2A33A 2CVOA 2F43B 5DM60 4DE5A 4YRGA 5JATA 4Y2RA 1LD3A 3C7AA 2C9BA 4JOBA 4PV7A 3TI9A 1YB4A 3KLOA 4ER6A 1JFTA 3IODA 3G8AA 2GT1A 2ZUEA 1Z4PX 2GERA 5DX8A 2RHBA 5I9TA 3Q8XB 3FETA 3O74A 4GQIA 3ZHCA 5IYZA 4B4VA 3UOGA 1HF3A 4RQUA 5K0TA 1M1NA 2QSYA 3D1JA 3GJ3A 1DB3A 3U1VA 1MTZA 1M83A 2VDKB 5T8KC 2FHSA 3UAZA 2C82A 4IDBA 2QX7A 4R6XA 1AKRA 1PLJA 5GZ6A 1JIVA 1O87A 2XV1A 3F1LA 1ZNQO 3EZXA 2W70A 3OEED 5HNKA 1ZM7A 2RGNC 1I1HA 5IJAA 5FAKA 1J0BA 3P19A 2YJ4A 1AB6A 3I92A 3TNJA 4OCZA 4V2UA 1U9JA 3ETHA 2CUNA 3B1ZA 1HEIA 3GR6A 4EVSA 3CVVA 3SHTA 3WB0A 4OFBA 1PYOA 5EAIA 4E1AA 1Y81A 5LYJB 1E2GA 2VF2A 4L85A 4BNYA 4Y6SA 1Z4OA 2JGAA 1P29A 3FWHA 5EKTA 4B3JA 2ILVA 1IY8A 1DBPA 4QPCA 1BXRA 1E2FA 2H1HA 5FUBA 5A4AA 5K9ZA 1DHRA 4G0WA 2B7LA 2EYUA 1YHYA 1J22A 1KEEB 2IHTA 3D3KA 4IOKA 4L74A 4LXYA 3R8XA 4B7AA 4Q9DA 3RODA 3RQSA 1V6AA 4ZANA 3W78A 2PGDA 5SZHB 1DTWB 4QUGA 1N36B 4JJAA 1XZIA 4FYKA 4TX1A 4UBIA 4B45A 1IVSA 4WZAA 1XPUA 4Q02A 1WBDA 4BTLA 4NE9A 1YL5A 4L5AA 4YRIA 2C42A 4O08A 4CKCB 1H94A 4RZIA 4P6VF 4QIHA 5JCOC 4H7KA 1ZNYA 1NMXA 2B2NA 1GQRA 3OIYA 3LU1A 4OK5A 3FY4A 3TLBA 1PL8A 2EIHA 1IB6A 4QEKA 3LF2A 1A2QA 4FKZA 4Z1OA 5ITWA 1TPYA 5LP6A 1BX3A 3LX8A 9ATCA 5EIEA 2FPGA 5ECWA 3ZC3A 3IEMA 1OGIA 4GRAA 2B5VA 4S2EA 1E6CA 1E69A 3LUAA 5I8PA 5DLYA 5DHAA 3RC2A 4P7GA 3REGA 1K66A 1EK2A 2W6ID 2H9IA 4JCOA 2WICA 4AY6A 4DPKA 1E7RA