4S1OA

Structure of mycobacterium tuberculosis nadd in complex with nadp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
197
structure length
175
Chain Sequence
RRLGVMGGTFDPIHYGHLVAASEVADLFDLDEVVFVPSGQPVSAAEHRYLMTVIATASNPRFSVSRVDIDRGGPTYTKDTLADLHALHPDSELYFTTGADALASIMSWQGWEELFELARFVGVSRPGYDALTLVEIPALAISSTDCRQRAEQSRPLWYLMPDGVVQYVSKRRLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable nicotinate-nucleotide adenylyltransferase
publication title Structure of Mycobacterium tuberculosis protein
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 54
structure length 175
sequence length 197
chains with identical sequence B
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4s1oA00
1NURA 2JANA 1OWPA 2Z3VA 3IUEA 1V47A 1O96B 5J59A 1XNGA 1VBMA 1B6TA 3CLRC 3KT8A 2E18A 2G36A 2EL7A 2GM3A 4MWBA 4EG6A 4DDMA 5HUJA 3P0HA 4GU5A 2VXOA 3K32A 3SZ3A 1JHDA 2B7LA 1S4MA 1M8KA 1U3DA 1EUYA 1MB2A 1TYBE 3G5AA 1J1ZA 1IFXA 3ZUGA 1K97A 3FETA 1NP7A 1KQPA 1JILA 4EFKA 4JZYA 1O95C 2V0GA 2E0IA 2IELA 3CVWA 4JYZA 1YI8A 3LCJA 4MUGA 1F4LA 1IHOA 2Z09A 4CDNA 1JEDA 4ND7A 3E27A 3N2YA 3CLRD 2DERA 5TS2A 3PNVA 2DR2A 3L92A 3MLAA 1HYBA 2A84A 1IQRA 1CT9A 4MUKA 2D54A 1M1ZA 2CFOA 5KHAA 1PFUA 4MVCA 1N2GA 3DV2A 1COZA 4ARIA 1GAXA 1O0BA 1H3NA 1T6ZA 2DLCX 3VGJA 1U0BB 1Q19A 2JAXA 4S1OA 1G59A 3ELBA 1O95D 1J20A 1J09A 1F9AA 1NUTA 2J07A 2PZAA 2HGZA 3IOCA 3SP1A 1H1TA 2R5WA 3KT0A 1K4MA 2AKEA 3ILVA 3FIUA 3IOEA 3AL0C 3UOWA 4DLPA 1ILEA 1O5TA 2BTEA 2NZ2A 2J5BA 4PY2A 3HFJA 1KORA 1MAWA 1JGTA 3CR8A 3CLSC 3MMXA 1VLHA 3FWKA 2A1UA 3ZGZA 1M8GA 5FO0A 1DNPA 1GPMA 1N2IA 1PG0A 1WQ3A 2AG6A 3HL4A 1QJCA 4MVYA 2PZ8A 3AIIA 1TYAE 3ZJTA 1U7XA 4MUFA 5DK4A 4AQ7A 2J09A 4EG5A 2CT8A 1NUQA 1YUMA 1J70A 3CVVA 5H16A 1KH2A 4KKVA 3S3TA 1D2RA 1N2OA 4TS1A 1VL2A 3C8ZA 1NUSA 2PXHA 4J75A 4J76A 1YULA 3CLSD 1F7UA 1KQNA 2AZXA 4MW6A 1EUQA 1FYDA 4JFAA 1MRZA 2QTMA 4HJXA 4DDHA 4EG3A 4PBRA 3COVA 4NZPA 2DPLA 3RJZA 1WJGA 2A4MA 2QJTA 1NZJA 3NBAA 2WSIA 2GKSA 1MB9A 3F3MA 5DEOA 2OV4A 2QUKA 1VBKA 3A4IA 2CYCA 4MUEA 5H7XA 1IRXA 4G6ZA 4ND6A 1RQGA 1QNFA 1O0CA 1KH3A 3NBKA 1SURA 2I1LA 5TEWA 3RFFA 2RE8A 5AHWA 3CLTC 5LM3A 2TS1A 1G8GA 2WB2A 1WXHA 2CV2A 3Q4GA 1LI7A 3FY4A 2X1MA 1WXEA 4ARCA 1TYDE 1IVSA 3A2KA 4QBTA 3INNA 1WOYA 1IQUA 4H3SA 2D5BA 4MW1A 4X0EA 4CQNA 2A88A 4E1AA 2QUIA 4MW2A 1O94D 2QJFA 1EJ2A 3MLBA 4Q93A 2VTBA 1X8XA 3JXEA 4YP7A 4PBSA 3IOBA 4XFJA 1OBHA 3FDXA 3IVGA 4EG7A 2ZP1A 1KAMA 2BYTA 3CLTD 3P0JA 2RD2A 1ZJWA 3FH0A 4YP6A 1N78A 3SEQA 4ZT4A 1LI5A 1N2EA 3FOCA 1G8FA 4XFDA 1XNJA 3VU8A 4Q16A 1QQTA 2CYAA 3N9IA 4R2LA 1NUUA 4MW9A 2OQ2A 5K0SA 1PFVA 1GTSA 1YIDA 4MUJA 2J08A 4DNXA 3U1VA 4MW5A 2DXIA 1OWOA 3IVCA 4OUDA 3PNYA 3CVUA 1T6YA 1YIAA 5TEVA 1OWMA 3IUBA 2A1UB 3CLUC 3A05A 1JMVA 1FFYA 1LW7A 3M5WA 3N05A 5LFAA 5F23A 4I6EA 1A8HA 4NAHA 3AKZA 1BS2A 3HGMA 2CUZA 1J1UA 2EJCA 1TEZA 2J4DA 3HZRA 2DEUA 4AS1A 3FHJA 4MW0A 3D6VA 1N1DA 1KQOA 3QE4A 3KFLA 3H9BA 4DJAA 4P2BA 2E89A 4MLPA 3FI0A 4MW7A 4ZCSA 4EG4A 3UMVA 1G8HA 3GMIA 3VRHA 2QUHA 4MQ6A 3GLVA 3COWA 2IJGX 3CLUD 1V8FA 1WQ4A 4ZT5A 1IH8A 1N2BA 3MXTA 4UZEA 3ND7A 3IMEA 1U7DA 5LLTA 3H99A 4UZFA 4ZT3A 3PXUA 1JIKA 3P52A 3TNJA 3FNRA 4MWEA 1Q77A 2WQ6A 3IMGA 2A1TR 2HMAA 5EKDA 3DPIA 4ZT2A 3A04A 3AG6A 5J58A 2X0KA 3TQOA 3UK2A 1GTRA 1VBNA 4YBRA 4ZT7A 3DO8A 1GN8A 3K9WA 1Q11A 1NUPA 4ZT6A 1KH1A 4DDKA 5DB4A 4MAFA 2YWBA 3IODA 1ZH6A 2CYBA 1Y42X 2V0CA 3G59A 4G5FA 2DUMA 5J5AA 1PFYA 3P0IA 1IQ0A 2IP1A 4NAUA 4CT0A 1I6MA 3PRHA 4ZCQA 3IMCA 2JA2A 1KP2A 3COYA 1EFPA 3Q12A 3X1JA 2QJOA 3LE8A 1O94C 5HG0A 1OBCA 4NDAA 4KPUB 1EFVA 4JXXA 3RBAA 2VTBB 3H05A 1PG2A 5TGTA 3IDFA 3N8HA 1T9GR 1MBZA 1I2DA 4MVWA 1JZQA 4ZCRA 5FNZA 4ZCPA 4HPWA 4F3RA 1WXGA 3ND6A 1WKBA 3BL5A 3UY4A 1ZH0A 4KPUA 1XNHA 2CV1A 2YWCA 1TFUA 1K4KA 2XRZA 4OUDB 1NSYA 4YMIA 1QRTA 3CA8A 4L2IA 4I6GA 1GZUA 4MW4A 1K92A 3CVYA 1UFVA 1N2HA 3TZLA 4MVXA 1WZ2A 2PIDA 2E21A 5KCMA 4OJMX 4YP5A 5DASA 4PBTA 4CDMA 4HK4A 4RPIA 1QTQA 1H3EA 1QU3A 5JBNA 1M8FA 1N75A 3H97A 1KKUA 5HUHA 1TYCA 1QU2A 1O96A 2ZUFA 1P7PA 2QTNA 2WQ7A 3ZXSA 3UC5A 1MC1A 3OP1A 3IH5A 1F7VA 4U8HA 4EG8A 1NYLA 3ND5A 4EG1A 2QUJA 4KR6A 2Z08A 1O97C 1M8JA 1R6UA 3L93A 4G5YA 2X3FA 4DE5A 4MUNA 2X1LA 3ZJUA 1GLNA 2A1TS 4I6JA 2D13A 1N3LA 3ZXIA 5IJXA 4QRDA 1WXFA 4F4HA 2O5RA 5IHXA 1OD6A 3RHSA 2NSYA 3QTTA 4NATA 1NI5A 1R6XA 1KAQA 3NV7A 5KWVA 1J21A 2DETA 3OTWA 3ZIUA 4FZJA 4K03A 4MWCA 3FG9A 2C5SA 3SYTA 2ZUEA 1OWLA 2H29A 3LOQA 3HV0A 1WY5A 4U63A 4KR7A 1Q15A 3HMQA 4ZCTA 1O97D 3GUZA 1OWNA 4RUKA 4HJRA 4K0RA 4QREA 1EFPB 3TZEA 4KR9A 4WSOA 4MWDA 1KR2A 1MOPA 1M8PA 1X6VA 2H2AA 3COZA 3PNBA 3ISJA 1ZUNA 3AFHA 1EFVB 3KT6A 2O8VA 2PFSA 1MAUA 4XSVA 4R2MA 1T6XA 3KT3A 4R0NA 5K0TA 1O6BA 3DLAA 1JECA 1QRUA 1T9GS 2QTRA 2A86A 1EE1A 4A91A 4GRIA 2YY5A 1KP3A 4EF6A 1EXDA 4MUIA 2CV0A 1QRSA 1H3FA 5BNZA 3IVXA 3I05A 4MUHA 1JZSA 2HZ7A 3H9CA 3QTBA 3X1MA 1R6TA 3ZJVA 2XRYA 1N77A 1MJHA 4JXZA 3AG5A 3SEZA 1I6LA 1YUNA 1XJQA 4NX2A 3D6UA 3G6KA 3SZGA 1I6KA 3TS1A 2PZBA 3RK0A 4MULA 1WXIA 1PFWA 1U3CA 4U7JA 1N2JA 4EGAA 2PG3A 4L2IB 1JEEA 3CVXA 2CSXA 2GOYA 4BWVA 3X1KA 1JIIA 1JIJA 3Q10A 3TQIA 5FO1A 2YXNA 3RK1A 3SDBA 3MUEA 4WNYA 1M83A 1ULHA 2A7XA 1TQ8A
chains in the Genus database with same CATH superfamily
2XXJA 4TQGA 2XCRB 2XB2A 4OYLA 3BBPA 5I9LA 3W3AD 1DT3A 1IE3A 1XMIA 1N6IA 4R1NA 3R1IA 3GY0A 1I36A 3FW1A 2NG1A 1OLSA 3LLVA 3OCXA 2WF5A 4NCJA 1XNGA 1VBMA 2J9RA 3DR3A 4Z49A 1A97A 4F2HA 2REXB 3LDFA 4XYMA 5IJ0A 2DPXA 4QATA 3UWSA 1HBJA 4OQZA 1MH1A 1UPXA 3SIXA 3UA3A 4A2CA 4A10A 2WINI 1H2ZA 3DAYA 1DTWA 4HNHA 4KDFA 1RD4A 1YC2A 1L5HA 2DMRA 5EIAA 1OA0A 2ZI5A 2SBTA 3AM3A 1A7KA 3OT1B 3U60B 4KVGA 4CM9A 2OGWA 2H54A 2UVPA 4G4GA 4E2XA 2QYTA 3RFCA 4HADA 2PV7A 2JEOA 3HPRA 3OZRA 1CUXA 1FFHA 3BTSA 3EHEA 4L3OA 4U39A 5C1IA 5IAOA 5JXJA 1VL1A 4RM2A 3VSCA 4MS1A 1KP9A 5CJPA 5DSZA 3UK1A 2O5CA 3R7LA 5FPHA 1DJPA 1ISMA 4XEUA 5EC8A 2RGEA 4FLEA 4FE7A 5G3YA 5LMUB 1BGXT 4GUDA 2JF0A 4C20A 1WZCA 4R83A 1JLSA 2GSDA 2XOKA 3BWEA 3CUVA 1ECLA 4NU5A 2D54A 2GNPA 3R0IA 1LPSA 3DXYA 4GLBA 4A23A 4NBVA 3ROPA 3ZWWA 4D0GA 4RBNA 1W4RA 3DLPX 2QYSA 4QBFA 3F5DA 4F96A 2ZI6A 2AYXA 4ZAGA 2UV8A 3IIJA 5F9MA 4O0MA 3NI2A 4IR7A 4CTMA 2F00A 1KGDA 4CMKA 2H5JA 4OOFA 1Y48E 1G59A 1S2GA 4HH3C 2DSTA 3QBTA 1S2IA 1GQFA 1Z33A 1V16B 1UXGA 4N82A 4PV7A 4DCPA 4ETWA 5JNRA 3TBKA 5FA6A 3NP7A 3G6WA 3RSGA 3N7AA 4J1QA 1N32B 3G7SA 5GJBA 4YMSA 3RASA 3IBFA 1PVOA 1F38A 1EXNA 4AQYB 2Y1FA 1G21B 1OB2A 1WHTA 4O4HB 1RRPA 2REQA 3D6NB 1L5RA 1NBWB 4FP9A 1UC4B 2UVQA 3BGOS 4HMOA 4TZ0A 3B1JA 4ALKA 1EFAA 5F3RA 2GYUA 3MSCA 4YQFA 1JU4A 4PLFA 2JGRA 3K0HA 4A0FA 2D74A 4UOEA 4HDMB 2H1WA 1F0PA 3FD8A 3FSEA 5LZ2A 1P0PA 3PX3A 1JYSA 3BJRA 3ECCA 1PJ8A 4E11A 3GNTA 3SSAA 2KQUA 7REQB 3AUUA 5IXYA 2W83A 2EBHX 1CRQA 3ICPA 3NYIA 3MIZA 4QEZA 4IPTA 4JLSA 4RZIA 3AIIA 4UQOA 3BXOA 1Z0FA 1TM1E 4DV5B 1UIRA 1QVRA 1ETHA 3GR6A 4FC7A 1YZVA 4LV8B 3M82A 1VLQA 5KX5F 4CDRA 1U7XA 1YB5A 2NO1A 2H9YA 3H2BA 5HKBA 1Y8RA 1DQSA 4YRDA 1J0XO 1AXGA 3F9CA 3BB1A 1IBMB 1YJBA 5IJAA 2Q5HA 4EOGA 3KZ1E 3T7AA 1X74A 4IDAA 4O1HA 1ODFA 4FPXA 1E9EA 2V7QA 4Z1MA 3VC2A 4CMHA 3KKNA 2A9JA 2CVOA 4GPZA 4H7DA 4QJ3A 2W6JA 2L18A 5EKTA 1FTSA 5HF8A 3ZHBA 3E4CA 5EHZA 1XNRB 1AE1A 1ZEJA 2WIBA 3G2QA 1X70A 1B42A 2H00A 4BN4A 4D3SA 1RAHA 3N70A 1PZXA 2COUA 5BSTA 2GZHA 3DF9A 4N8SA 3N53A 4YUYA 4QNNA 4WA7A 4NS1A 2G6BA 1RPJA 2WJ6A 1J1IA 3BCHA 4P81A 3V3TA 1SEVA 5LUAA 1CETA 4FIZA 4NZPA 3MT7A 4BDSA 2EFGA 2D2EA 2HIMA 4C7XA 5CG2A 2C9ZA 2BC9A 1SGWA 3NHUA 1ISFA 5AUQA 3DZGA 2I1WA 1GTMA 4RA9B 3IMFA 5J2TF 4E12A 2C31A 1NTOA 4FQ7A 1C7ZA 1J00A 1J49A 5DHPA 4JP3A 1XEAA 2SKDA 4DCMA 4P86A 4EYOA 4P7FA 3VU9A 5DNDA 1NGSA 2FP4A 1XGKA 2W2KB 4G2NA 4J2TA 2PMEA 5CDFE 5KTRA 4PC3A 4G36A 2CHGA 1U1DA 2OBYA 2WKSA 3RAJA 3I9JA 2BKEA 2BGJA 3I92A 1GIAA 5CVJA 4WGFA 1K7SN 2BP7A 4IIJB 1CVIA 2BFWA 2SECE 3FY4A 3O8DA 2A0YA 4KIUA 4P4TA 2CUNA 1PL8A 1YVUA 5HIMA 4ZKEA 1FX0B 4G8JA 4FN5A 4LDZA 4Q1CA 3G17A 1QGOA 1XMPA 3RTAA 4MINA 1OI2A 2WC1A 2ZRPA 2VQDA 1VCNA 3JQAB 5TPWA 1DELA 1GFIA 2P11A 3ENNA 3O8QA 4EABA 5CB4F 5KNCH 3W5VA 4FFVA 2FHSA 4BFXA 4K9PA 1T9ZA 4RVDA 4E3ZA 3Q2KA 3VZQA 1SHTX 4H35A 4A0RA 2JARA 2RSLA 3ANTA 3E5NA 3ZHQA 3LT5A 2HBYA 2I6XA 3LLCA 1DB3A 3QX7A 1M33A 3SG0A 2ZP1A 3MWDB 3KQVA 3OIUA 2IHJA 4IHJB 5DBOA 5FV4A 4BRUA 3KKMA 3JQBA 3NT5A 3AO0B 4LBWA 1N78A 1H4QA 1C1HA 4YY3B 1JDVA 2HLHA 1ZNQO 2O7SA 4DR7B 1RLJA 4DEXA 1G8FA 1NHGA 1KJ8A 1YB2A 3UGTA 4UBIA 4PFKA 1XQ9A 2CYAA 4GI3A 2QZJA 3HB7A 5EEGA 1T5BA 2Z5LA 3I76A 2Z8YM 4X9XA 3EVCA 4BO7A 2QM0A 2IWRA 3W2EA 5A03A 4OSOA 2FR0A 3QKRA 4UNNA 5CPFA 4BQNA 4PGAA 3ZQ4A 1E1DA 1E5VA 5ITVA 5LP6F 5E3JA 3SX2A 3Q2OA 1NC1A 3PG5A 1Q1NA 2QUZA 3AHCA 1V8OA 3JATB 3ORFA 2X1VA 4GP9A 3RRJA 2ID9A 3SF8A 3CUWA 3MMZA 3ZGOA 2JLZA 2CB0A 2DBQA 1S1MA 2F1KA 4OO3A 4WCVA 1QQ6A 1EBBA 4MEJA 3VPAA 5B7PA 4R1PA 1WHSA 5A3JA 4OXQA 4DPLA 5LVAA 2ZREA 3N7TA 2WHEA 4ZQHA 2MSWA 3QEKA 1BS2A 1FDTA 5DOVA 5GTDA 2H0RA 3NWPA 4OMFG 1TDJA 2ZCUA 2J87A 1KETA 3VMMA 1TXGA 4D9GA 5C1BA 5M5BA 3K1YA 1HM5A 4P3KA 1YGPA 3A11A 4MHSA 3KYBA 1WPRA 1V5FA 2UUOA 3H5RA 1ZINA 4QTTB 1Z7YA 3X1YA 4BEJA 1TKCA 4EG4A 3C6XA 1ZVJA 3I9OA 2YX1A 1C3JA 2QUHA 1VYTA 3BF7A 5KTSA 4KYIB 1JFFA 2YUIA 2Q6OA 1DKRA 3WNDA 3RS5A 1GGNA 2NPIA 3KYJB 2EOAA 1HDOA 4TVOA 3G8DA 1EK0A 1H0RA 2ID7A 3OZSA 4PYIA 5LZ7A 5LQAA 4G1EB 1O9HA 4AF7A 1UBMS 5T3UA 4J1SA 4F84A 5BOSA 2RC6A 3QX3A 4DC1A 3EJ6A 5HQJA 1YH3A 2FWPA 2VJBA 4CNQA 4ERNA 5JD4A 2HWWA 3SBOA 2WT4A 4ZMRA 5C9ZA 3VU3A 1TW3A 2PS1A 4GI2A 4IG9A 1RBZA 4WXYB 2ZUDA 1G6Q1 2WQ6A 1F51E 2G28A 2GCIA 3TEMA 4BP8A 1A9XA 2PGXA 1TMYA 4BRZA 3KPWA 2IITA 1UZNA 1DQPA 2PTHA 2RB5A 2VZEA 1GKKA 1RXWA 2QENA 1KC1A 3PE4A 1X42A 2XYVA 3TIXB 5F4BA 1JJ7A 1QVWA 3KOUA 3KDAA 1Q11A 4XB1A 3EVDA 1MCZA 3CZRA 1EM6A 4OEHA 1XTSA 2XLBA 4I4CA 3ZZNA 5UKDA 2M6RA 3PQ4A 4MVJI 1L5YA 3C6YA 4HB3A 2DUMA 1CJMA 3S2YA 5BUQA 3D5TA 4Q9HA 2RG1A 3SJBA 1KO4A 2FA9A 2IZ0A 1SU4A 5K1ZA 5HIKA 3AXTA 5FUVA 3W79A 1EQ2A 1PZNA 2FGKA 3AP1A 3JD4A 4UATA 1WKCA 5E0OA 3U62A 3ITKA 3RYHA 3QVGA 1DAPA 3EXHA 3HDHA 3P20A 4L0DA 4NG4A 4PAOA 1N33B 3PIRA 2ATIA 1ZPDA 4QQKA 4TMTA 4WACA 2P9YA 2FPUA 1SKYB 2UXCB 1F2DA 5CNJA 1QYRA 2XIJA 3IUNA 2JFFA 3TQTA 3KS9A 3WIEA 3EVEA 4BKMA 3U7FB 1YJXA 3LX6A 2OAP1 1YB7A 2WHRA 2WUDA 4RK4A 3COPA 2MSKA 3HJCA 1A9ZA 4CTJA 3KCQA 1Y9JA 1WETA 4WECA 4D4HA 3TD9A 4QM7A 3S70A 4AUNA 3HRHA 2W43A 3EH1A 1VI2A 2AE2A 1PWZA 2IXBA 4OXKA 1U04A 3T8YA 1Y4SA 3WLHA 2PLRA 4PO8A 3WHLA 3GVIA 1UPUA 4UULA 2LR0A 2ZR9A 1ICEA 2I4IA 2OGSA 2XUGA 2Y9PB 1ZBDA 4IIGA 2QZZA 4C6TB 1NI3A 3U49A 2AN1A 2FLKA 4YJKA 2G4LA 3KCNA 3AUKA 4MX8A 3LKVA 4FGWA 5ESXA 1Z7WA 1U8UA 3Q5EA 2W2QA 3CB4A 1BRTA 3WRXA 1PNVA 2OXIA 2Q3CA 3Q9UA 4E5SA 1RHUA 3A7DA 2TYSB 3FYUB 3H19A 1KKMA 4ZYLA 4L5CA 2FPPB 4HHEA 5CLGA 3P9ZA 2XHZA 1Q3HA 1WUIS 4G0ZA 4MQ4A 4X97A 3LS2A 1QZZA 2WF6A 3TZLA 3I5YA 4ABYA 2XY4A 3NVMB 1BH2A 4XJTA 1GARA 3GUVA 4E4TA 1EUDB 1X3SA 2A8YA 2WSYB 2HGSA 3W3AH 4CDMA 2X13A 2NO5A 3LWNA 4XTRA 4RJIA 5IANA 1JAIA 1Q1QA 2Q3MA 3AOEC 3K30A 4ADSG 2AG0A 4Y1RB 1QU3A 1ORVA 4M83A 1AZWA 2ZVJA 3INGA 4R54A 5JAUA 5KTTA 2E4YA 1J2TA 2QSYA 5E9JA 3W5DA 4M0MA 4UU7A 4LYAA 4KDRA 1AF7A 1E0KA 2REOA 2BE9A 1AKQA 2E55A 1E2MA 3QNMA 4K9QA 4CQJA 5L95A 3O3MB 2I4LA 2PK3A 3M3DA 1J0BA 3DMYA 3JALB 3VAZA 4JB0A 3KQPA 1CUYA 2BMJA 3EOBI 3FXAA 4RD3A 5FBRB 4B81A 1XLVA 1V7QA 1CCWA 2AJ8A 3UMMA 3L8GA 4A03A 1XEWY 5C52B 4KR6A 4P5PA 2NVOA 3PB3A 5IUNC 3AUJB 4UM9D 1Z15A 2YJ4A 3CXUA 2N46A 1WDLA 3IHTA 3PC6A 3C1AA 3HNPA 2B8JA 4HS9A 4P83A 3FLAA 4QPCA 2ZYTX 4RL6A 3T3OA 2YV1A 4NBWA 3S44A 3TLAA 3LPMA 3WDSA 2P0YA 4ZAYA 1UPFA 3WLKX 4RABA 3PFFA 5IDQA 2VQFB 3F6PA 4FYVA 3ZWPA 3HJAA 4MEAA 1Z7GA 2PD3A 3WC4A 5IHXA 3C6QA 4ZI7A 4DZZA 3OIGA 4DBLE 1BJRE 1E5LA 4JT8A 4JNCA 4D9FA 1KAQA 2BF7A 5H8WA 1S6YA 2OFPA 5AM1A 1JVNA 2WD9A 5CNKA 4Q3NA 1FFGA 2C5SA 3SYTA 4XD7A 1Z6YA 4IFTA 4E2FA 4RU1A 4B45A 3ETNA 4AECA 2B4YA 2EZ9A 4L73A 3KSAC 3RIHA 3G5TA 4ID9A 2QTWB 4DHWA 5HX7A 2WM9B 3IE0A 3ZDCA 2JKZA 2QG6A 3B36A 3GQBA 3VDNB 1MOPA 2R8YA 4W9NA 4LDNA 1USIA 4TKVB 3KVVA 1HDYA 3UB2A 1FSPA 1DT5A 1RVDA 3VUFA 1N0HA 4PPNA 4OKNA 2M6KA 4GSLA 4V03A 3CZMA 3ZBTA 5ECWA 4YJFB 2VPWA 1DOAA 2Q4BA 3HACA 5AWFC 5JQWA 5KNDA 3S2UA 3L1IA 1PKEA 1XRPA 3HU1A 3M1AA 5DBEX 4ZGGA 1BEZA 5AW3A 3LUHA 3ZIDA 1SVIA 1EWVA 2A86A 5B7GA 3C3MA 1Z4PX 1RU3A 4KIWA 5M3BA 1EXDA 2VJAA 4PIPA 4EA7A 1Y9AA 1C81A 1H3FA 1KZ1A 2V7TA 3T9DA 5J63A 1U7OA 2AZMA 3WLEA 1JQKA 2HJ9A 2P75A 4WT7A 4C2AA 3OEHA 3E3AA 1NFFA 3ETCA 4ZO7A 4G5RA 4OL9A 1V48A 1YBAA 3B7WA 4BLOA 4I5FA 3UHJA 5BUSA 1Z2PX 3QMPA 1YIOA 5IBCA 3KAJA 4EZBA 1E4YA 1M3SA 1E3TA 4EY6A 1L4FA 2BM0A 2I6GA 3KHTA 1K8RA 1O5IA 5AW0A 3CRNA 3RJ5A 1QJ4A 1N2JA 3OE7A 5KHLB 4OKSA 5DW3A 5ALDA 2N3ZA 2HKIA 2WAYA 2ATEA 5KJ6A 2YOHA 3FPBA 1I0LA 5AW5A 3GRUA 1P0CA 2EKLA 4I19A 3A10A 3F9RA 1UXOA 1OTYA 1ZAYA 1N5IA 3L1VA 1NVUQ 1V7PC 1QFMA 3MS7A 2ZS8A 2P3SA 4F4DA 1KNQA 5FO1A 5LA6A 4CF3A 5KYXA 2WYOA 1RHQA 1JDZA 2C20A 4G1FA 5DI9A 5EMNA 1AC5A 2RFLA 3VNRA 1RKBA 5B53A 5CVEA 4IUDS 1NURA 2YS6A 3HEAA 1ITZA 3E9QA 4ARZB 1PJCA 3ZH2A 2CVPA 3EVZA 2P62A 4JU9A 5FOWA 2G83A 1H8ED 3DJFA 5ALWA 4GDMA 4PZPA 1KZ4A 3DV9A 5F7XA 1NIPA 5WRFA 3ZE1B 3AM1A 2IYLD 3BA6A 3T9BA 1N2ZA 2R48A 1I7DA 1G63A 3O91A 4ZWNA 2TMYA 2AW5A 4RCYA 2H11A 3PUIA 2GN6A 3I72A 2P41A 5ENVA 3LBFA 1I4OA 5IAEA 1OAKA 3IIIA 1XXHE 3TZ6A 1S4MA 3U4HA 1M8KA 2VK2A 3D9QX 3RYIA 5CFNA 2CZGA 3I2KA 4L8GA 1XZIA 3EFEA 1GCUA 4Q03A 3U3OA 3AUXA 4DOMA 2HNAA 3A1TA 1KQPA 4YPOA 4L6IA 3U4AA 4KO8A 4Y6RA 5BSFA 4F4CA 3OJCA 3UJ3X 2HQ1A 4PTYA 4QUGA 3GLKA 4MWGA 2I78A 3E2MA 4F38A 2BZGA 1UC5B 3SJ7A 4GZLA 1LPMA 5DWDA 1PT8A 5DYYA 4BLRA 3GEHA 1YFLA 1D2CA 5EE1A 5FOTA 5EJ6A 2C04A 1LX7A 2IT1A 1XHLA 2RH5A 3CV3A 4DBVO 5JNWA 1E5DA 3ZQ6A 1Y1SA 3SHVA 2WAAA 4V0KA 1TCAA 2BTQA 3KZMA 4JEMA 1ZM9A 1XE3A 3ZU6A 5I7HA 3TIFA 2J9ZB 1HMPA 4D4MA 1THMA 1T0BA 3RVNA 3HKBA 4QYSA 1EBFA 1JBQA 2OEPA 3EXEA 3KG2A 3L05A 4CF7A 4F8YA 4PQEA 3PXCX 1JQAA 1K8QA 3N2KA 4J16C 3WGOA 1Y4AE 1Y8QA 5ADWA 3T3NA 3K09A 4DSZA 3D6FA 2X3YA 3GIWA 3LBIA 2WJIA 1CB7A 4DIBA 5LZ9A 3Q7PA 4DQLA 1HEIA 2O07A 4BJHB 1RZRD 4NS4A 2K7FA 1PTKA 2QOEA 1D0SA 3U61B 1BW9A 1PQ4A 1BHSA 2FW0A 2J07A 3IBGA 4M1EA 5T5QA 2IZ5A 3IOCA 4X7MA 1J2EA 2R6CA 3H11B 2QU8A 2OG2A 3SYKA 2JH9A 3GPIA 2WRZA 1WP9A 2GF2A 3G0HA 4V0RA 2Q5CA 3KJIA 3S2EA 1TVEA 2H17A 2X8WA 3U4CA 3UOWA 4ZK2A 2X76A 4B7CA 2B0JA 3JWEA 1I2BA 3AR4A 4EEZA 5HR5A 3HXMA 4QGHA 3PUJA 1O6ZA 2DE0X 3C5VA 1GUDA 4YGXB 4FEAA 3DNFA 3C4VA 4JP2A 3PHIA 3UHFA 1NJ8A 3ZK9A 4GX1A 2H1HA 3FX2A 1HZJA 1BXZA 2IVFA 5TQ0A 1YVEI 1I5EA 3CWZA 3I37X 3RR2A 3TGWA 2Y1DA 1W5TA 1H69A 2Z1MA 3AI1A 2DRIA 2H5LA 3ZJTA 1Q12A 3TOSA 1U6KA 3O9ZA 5SZJA 2UZ1A 1XQ1A 2Q6VA 3BE4A 2ZAIA 1W1IA 1JS1X 2CJXA 2J46A 4LVUA 1P18A 4TYMA 4FGUA 4W6QA 3O8BA 4RTPA 2W42A 3HBAA 1J70A 1UT6A 5F7ZA 4YFYA 1UMDA 1VJ5A 5BYJA 1Y6GA 1QFYA 2XYQA 2JFHA 2ZSIA 4GH5A 5J2UF 1GAEO 2IL1A 4A0GA 2P9HA 5AVVA 1NVMB 2Z5VA 2IQIA 3FYHA 5B1DA 1V35A 1T8YA 1FVOA 1H65A 3HB9A 2GS9A 4MW6A 1XKTA 1ZD5A 5AI8A 3O4GA 4E07A 2JPDA 4EJSB 1A96A 4X24A 4M9XA 4CU5A 1C7QA 2ZIZA 3SC6A 3TN7A 5KI6A 2POCA 4L5IA 2CLLB 2OUIA 3OU6A 4ZOLA 2GD2A 2VZ0A 3EW7A 2RBKA 1YZNA 3NRBA 5CNIA 2Z4RA 3U7IA 4RFSA 3LK6A 1R0RE 3GMTA 5E1MA 4N49A 5EXEA 4DIMA 4MUEA 5A04A 4V1CA 3HO1A 1JWAB 2HWYA 3FHOA 4PC1A 1Y37A 1I9GA 1KH3A 3DMHA 2VJLA 3NBKA 5DIZA 5IXJA 4YUZA 2CEAA 1MEEA 2VO1A 3QKWA 2WSLA 4G0YA 3GFRA 4GQIA 4XX0B 5TEWA 1RRCA 1K68A 3OJLA 5I3CA 3BHNA 5LM3A 5EWJB 4KSYA 5EHQA 2OGZA 3ZWAA 5LQMA 4YCCA 4P6VF 3SLKA 3NHFA 4ENWA 3KJGA 3TQFA 2Q9BA 1TTPB 4RHEA 1KBZA 4HDRB 3NOOA 4P7JA 2XNCA 5C31A 1ISIA 1M34A 3TI7A 1Z2EA 4J4BA 5IYZB 3JRXA 3OE1A 2ZIFA 1WOYA 1C9DB 1N1MA 2B5WA 1YJ8A 4X20B 3VOAA 4B82A 4UUMA 3UJNA 3ZS9A 4DLBA 2I03A 5AYVA 1V6AA 5KJFA 1Z36A 1UBTS 3EZFA 2A0FA 3QHAA 4MW2A 1BDIA 4WLNA 1T29A 5KNLA 3GT4A 3TOXA 3TZCA 1PRYA 4FYPA 2MYPA 1KZ7B 1U7HA 2HIHA 5BWMA 1YTLA 1ZVMA 2PLNA 1YZTA 3MQ2A 4U7GA 2JI7A 1NFQA 1YB4A 1ZRMA 2QLTA 1DC8A 1K06A 2Q2OA 4MPTA 4RS3A 3LA6A 4CKZA 2V6FA 2R84A 2QPLA 3CGGA 4MGKR 4OP2A 1ISGA 5C80A 3AHGA 1FNBA 3RU9A 4BQSA 3KQQA 4PHTA 4UE6A 3V6LA 1E6UA 1OYWA 2ZXFA 1KYWA 5K0FA 1AQ6A 2EKZA 3EZYA 1T2FA 4GXNA 1VBFA 2RI1A 1H22A 1S9DA 2GEFA 1V8DA 3ZV6A 1XTKA 1C1DA 4M22A 1Z35A 2VWGA 3FCOA 4EPTA 3K92A 2W11A 1JI3A 1UJ6A 1WSDA 2FN8A 3CX3A 4P98A 3E35A 3P45A 4J0GA 821PA 3FI9A 3A06A 3B1KA 4G4SO 5HPYB 1N6LA 3E84A 3GLGE 2WZQA 4IIBA 3ACCA 3VDQA 3N05A 1FDRA 1ZHOA 2J6HA 4GYJA 4QWWA 4UXHA 3VPSA 4S1WA 3O92A 2WM2A 3ZGLA 1QCYA 4XA8A 2ZJAA 3L01A 1U1CA 3JY6A 2ZE5A 2R44A 3LQ2A 1KMIY 4MZDA 2OHVA 1N8SA 1NNLA 4FJ0A 3IBTA 3RQIA 2L69A 1QTIA 2C2GA 4DLYA 4LDPA 4TT3D 4XWOA 3GMSA 3P0EA 4C0BA 2ILTA 3UWOA 1M1YE 4QUBA 3DZDA 5D5QA 5HRCA 5LD2C 1D2NA 1Z0IA 4CG0A 3RI3A 3ETGA 1JKMA 2YYSA 4EJ6A 2J45A 4AQDA 3TAXA 2QBYA 2G8LA 1UPBA 1US8B 1E7YA 2JJYA 1D1PA 1DCTA 3DOJA 2PKYX 4Q3LA 1JR3D 5DJ5A 5BV0A 3I8OA 1P5RA 4RLQA 3BS4A 1PV2A 2V5VA 3JQGB 3M2TA 2RI0A 2VWHA 3H9EO 2J3EA 3AETB 4CQLB 4RKQA 2RAVA 1FBTA 2W4QA 2ZEJA 4FSDA 4XB2A 2CJFA 4CF5A 2G40A 1FRNA 4UMVA 3DCNA 3OFVA 4MA5A 5ARBA 4KNWA 4TL6A 5JYBA 1T1JA 4ZEVA 1QFXA 3RAEC 3RIXA 2O2SA 3VOSA 1GTRA 2KHZA 2QAGC 4IW3B 4L76A 4JEUA 5KTPA 4Y2JA 5TJ9A 2H4HA 5JAPA 4HDSB 5EE3A 1SB8A 3VFDA 2GDJA 4MICA 2YWEA 4OQPA 4B3MB 1HE3A 3G82C 4FU0A 1XA3A 2VP5A 2ZYDA 1KK0A 3G2LA 1XHEA 5CYPA 3PRHA 2RKBA 4H4DA 3V9AA 4EF5A 2FMKA 2YH2A 2REBA 3CZAA 2BCEA 3P97A 4LIPD 2BM9A 4RMGA 2X0RA 2AI1A 4LDQA 1T91A 5EHGA 1QO9A 3B48A 4D3DA 4MNTA 1DXOA 1C30A 2VRBA 2AH5A 3DOUA 3I64A 3L9WA 3LZ6A 4HPXB 4L02A 1I7SB 3VC3A 4NJOA 1BKYA 1SG0A 1TEVA 2DC1A 1CPYA 2ALJA 3GP5A 2XWJI 2IHVA 1I3CA 5JRDS 1SXIA 2NTYC 1U99A 2WD7A 2W6CX 1Y3DE 5TGTA 1KWGA 3PK0A 3O3OB 3T3GA 2UUAB 2HHHB 2ZTLA 2RBGA 4D8TA 1T9GR 2BHRA 3V4ZA 5JQGA 2DWOA 4NU6A 1R0WA 4JJGA 4OYRA 4Q7JB 3RANA 4D6YA 3FWYA 5JLJA 3GLHB 4ZJYA 4US1R 2MTBA 2PKCA 2JBAA 1ZCJA 4W8OA 2GQ0A 5FNZA 4AG5A 3JQ9A 4EP1A 3HZZA 1ZK4A 2HRDA 2OWDA 3C3KA 3DPSA 1NW4A 3GPBA 5ENDA 5IC5A 4AMUA 1K4YA 4BIIA 3LECA 3RBVA 3GP8A 1T4CA 1N7GA 3TD6A 5KEIA 3IUMA 3U17A 1DJNA 4EY5A 2D59A 3MWLA 3TCKA 1DUVG 3OZBA 2HCTA 3VZSA 1RCFA 1F2TB 1TFUA 2HMWA 2SKCA 2WIDA 4M2LA 4DBZA 1CF2O 3NEAA 2CVFA 2FPRA 3R9XB 3ZDFA 1NMXA 1RWVA 1Z5OA 4MO9A 2BJVA 2G9VA 3BERA 4GXQA 3FFXA 4L4RA 2C07A 4R8KA 2ZBVA 1UMBA 1GZSA 2ODAA 2BMEA 3DO6A 4Z9FA 2PRYA 3L7MA 4ZQEA 3DONA 1LWOA 3I2HA 3ADPA 4C7OA 3AVPA 4LZPA 3DV0B 3OT5A 4MIOA 4K6CA 1LPAB 1Y3FE 1M6VA 3GT3A 4YQZA 5DASA 3WQBA 2W7TA 1U1IA 4NCIA 1EFLA 3F1LA 2WTNA 3C6KA 2BH2A 3ZCVA 1KMHA 1M8FA 3B82A 4PZEA 3NWJA 3OQJA 3FVWA 3LLMA 2Z1DA 3W1VA 5JWOA 1KKUA 1TZ2A 4RGQA 1HT0A 5JHHB 1C4WA 3TXAA 1DAMA 4C4OA 1QE3A 2PX0A 1XAJA 4OK6A 2YVAA 1QU2A 3BMQB 2D1FA 2ZJYA 2I2AA 1DRWA 2IYOA 2HPAA 3CEMA 3G0GA 2WM3A 1ZRHA 3KELA 4WJZA 4C6SA 4DYHA 3IDOA 1J97A 1NNI1 2VDVE 4Y1GA 5AW9A 1GXSA 3DHWC 3P2EA 5JTTA 1VHQA 3C5WP 1NA5A 3GN1A 3AM5A 2Q3HA 3L6BA 4GPIB 4BNVA 3EOZA 2IDZA 2C2ZA 1V71A 2OGUA 4MUNA 3RARA 4MDYA 4TSFA 1GLNA 3QYJA 1N3LA 1HETA 3L02A 3ZXIA 3JVVA 4MP6A 2GWRA 3IDQA 3QEJA 2WEKA 3GRPA 1BHO1 1JEYA 4RS4A 1NI5A 1KTIA 1EB8A 1NXWA 1YR7A 2BGGA 3UAGA 5J4VA 3GGDA 5ALOA 1IIBA 2H51A 4B6EA 3ZX4A 1U7TA 4JR2A 3C4JA 3L1HA 5JFGA 4ZYTA 2PX4A 3DZKA 5A2QA 2H29A 2ZROA 4U63A 2G4VA 2O19A 1V43A 1TNDA 1EDBA 3W7BA 4DCTA 4QU0A 2HCFA 2RHWA 2GT1A 4GEGA 3OSUA 4IQGA 3IBYA 3EH2A 4OHKA 2Z2KA 3TB4A 4WGGA 1YC5A 5C3UA 3WWZA 2WYWA 1B0ZA 4FK8A 1SXJA 1Q0TA 4BTVA 4L4SA 1TD1A 2HHLA 1Z0UA 2JGIA 2OHFA 3M8KA 4UHDA 5ECGC 3A6GA 1YL6A 4I55F 5CR9A 4DNFA 2WI8A 1IUPA 2VEDA 3L41A 4LRTB 4HN2A 4PGMA 4Q4AA 4IZ6A 4EK9A 1RQRA 2AZDA 4EDFA 3IAM6 1PJQA 3H4VA 1V25A 1RSZA 3KT3A 1NXSA 1Y81A 3BJZA 3SHQA 3STXA 4XM0A 4BQQA 4F4IA 4OATA 5JCJD 1TX4B 1IOZA 1JECA 1A82A 2CXOA 2VLBA 4H60A 3VKWA 3U4MA 3LYHA 1C5KA 1E8NA 3QQPA 5ELLA 1KP3A 1BFKA 5JDCC 5CA1B 5IC6A 1MFPA 5HJ5A 5MHTA 2CV0A 4OX9Y 1JBKA 1S3IA 2QSZA 4KXFB 3GLIB 1JEAA 1XL0A 3AR9A 1LZKA 4PPYA 3UOAB 1J2RA 1E1RA 4XSGA 3X1MA 2CMHA 3UENA 4LXXA 3BHMA 3H1EA 1SM4A 2N9UA 3EGEA 1BAPA 3SEZA 1YR6A 2JJMA 2FZLA 3HO6A 1KF0A 4M1ZA 3RV3A 1YB6A 4E5KA 1XJQA 2O4CA 5J58A 4GKKB 4FFRA 3AKCA 1KDVA 3DOCA 2ATCA 1P72A 3GZTB 5B7NA 1C4OA 2OZLA 4IFIA 5A7GA 1WF3A 3L0PA 4W5NA 1R4ZA 2C3UA 1WXIA 5SZHB 2ZBPA 1XPJA 3AUFA 2PG3A 1AK2A 3OT4A 2ODBA 2DH6A 2XVZA 2ONKA 1DAHA 1Q7BA 4IQ4A 4BWVA 4EHHA 2VH2A 3ECAA 3IVAA 3G9UA 1CF9A 2YV2A 3HA7A 5IKMA 1PJ2A 4MPDA 1XKQA 4YK7A 1FYWA 2OGTA 1NMZA 2QWXA 3NYWA 3RT9A 4BP9A 4YO8A 3TQIA 1UFOA 3O4RA 3RK1A 3STUA 1ZVQA 2W6PA 2ZGVA 4FFBA 2IS2A 1SVUA 4CXMA 2PGIA 3NTQA 1PCXA 3QUSA 3DBRA 2JANA 2Q7DA 2ZRCA 4Z4CA 5KAMA 2GN9A 4KQCA 2MU1A 4A15A 1PJAA 3M6IA 1MZVA 5D5PA 4HB4A 4WOJA 5HKOA 5CCXA 4R2IA 1TE2A 4YXWA 2ZBGA 3LKBA 1FW6A 1NLMA 4YJHA 4Q4HA 2W0SA 3CKKA 2QORA 5IAJA 1BVUA 3WL6A 1JQEA 1E6WA 2O7RA 3WICA 1N1GA 1MABA 4UHCA 1M75A 5I9BA 4JKYA 4PAMA 3VR5D 4O2AA 4RGBA 4WKPA 2V98A 1RWQA 3E9NA 5HUJA 3ORQA 2Q21A 1Q2UA 4IF6A 4BMDA 3SZ3A 3ZU4A 1NJGA 4I5EA 5E9WA 3C14C 5L3SA 1IM2A 4L78A 4EPXA 2C03A 1R5BA 3KV1A 1J1ZA 2A6PA 2R25B 2ZJ2A 1LWNA 2E7ZA 4AZTA 4DMUB 4DCJA 2XEXA 3MB5A 4XR4A 4LY9A 3PT5A 2GLUA 2C7RA 4FT4A 4TXNA 4JZYA 2P1ZA 3PTZA 3Q98A 2I7CA 5ANRB 2O8FB 2BM8A 4ZYWA 1ADGA 4ZAVA 3ZYCA 4YCSA 1JEDA 2HRBA 2AW3A 4Y6LA 1TEHA 2J9YB 2Z5GA 1V4NA 2V6BA 1Z4MA 1HZZA 2WMOB 2ZYAA 4YT4A 5CIWA 1LDYA 4US0R 4O4HF 1E1YA 4U7HA 4JJEA 3L43A 4MKFA 2GZAA 3UT5B 4ZV4A 4HVAA 4R9RA 5KHAA 1BE1A 1O6CA 3DMRA 2W71A 3D6JA 1KZYC 5MGBA 1ENPA 2QVXX 1IZ0A 3OHMA 1O8BA 1BXKA 3EFHA 3FDZB 4HN9A 3ZBQA 2A1IA 1D03A 2Q2WA 5TC4A 2YXLA 1UBCA 2YWHA 1ZUHA 1ZUNB 4H9GA 4YT2A 2WHYA 4BNDB 1G8PA 3C8DA 4FLFA 2QGNA 2PBFA 2QJRA 3MOIA 3DEHA 1EIZA 1VFPA 3FCSB 2UYQA 1F9AA 4HNAB 5EJFA 4MR9A 4D42A 3WKAA 5BORA 1RRVA 3EQ7A 1M7GA 2DKNA 3ULKA 4EZIA 1BEUB 2JZCA 3GDGA 4BHTA 1QHSA 2PZAA 2V6IA 3HVIA 5HZGA 3L7JA 5HDBB 5E7JA 2I33A 3GYBA 1OI7A 1K4MA 4LJYA 1XEXB 1B41A 4CT5A 1SHJA 4QVKA 1D04A 3VNVA 4W1SA 4WOPA 1MW9X 2JCGA 3UEOA 4AB1A 5DGHA 2KJQA 3IAEA 5EZYB 3SOPA 4C3UA 1M7BA 2DTXA 5CXQA 3J81k 2P3LA 1LNQA 1J33A 2O0KA 2GZDA 2R6ZA 1JB1A 1ULUA 2HNBA 5EMHA 1BNCA 4B6RA 4M54A 1RJ9A 1PWHA 1UADA 4Q37A 4DV6B 1CEQA 1U1GA 2Y6VA 3MYRA 5CEJA 2XAUA 3E3LA 1KBOA 1V16A 2NW6A 4R71A 1PG0A 2JK0A 3OQ1A 3PFCA 4KMSA 5EUMA 2YHBA 2B4TO 1GYPA 1T3HA 2CVQA 3M1LA 4KX3A 4R8MA 4Z0PA 5H80A 4TT8A 4ZD6A 1C4KA 5IKEA 5DK4A 2G1KA 3UMBA 4EG5A 4O4IA 5DXJA 4O4HA 2CT8A 3N2NA 3JQ8B 2AXQA 2PXXA 4FGKA 2Q3BA 4HNGA 1TA0A 1P9WA 2YJGA 4R98A 1RKVA 4Q6WA 1GG8A 3HBMA 4E6PA 1R9NA 3IBSA 1F0NA 4GS5A 3C8ZA 5JXIA 3LY9A 3Q1LA 4ZXPA 4BMSA 5FRDA 4YR7A 2Q3LA 4EHNA 1Y7LA 5GGYA 3W6OA 3ZLJA 2PKRA 1PL7A 2D5CA 1TLTA 4IIJF 1XFAA 1PBNA 2F8SA 4IMPA 3U4GA 1Q50A 4MCJA 3H2JA 3V8EA 1U0LA 1FP4B 3OFNA 4ZRDA 1XZMA 1MC4A 4RVHA 1D6NA 3C3BA 4Y6QA 1P2BA 1P77A 4A8JA 4E70A 1X0VA 4BC0A 5F3WB 2RGDA 2TRSB 3KZKA 4LOKA 5JD6A 1N2CB 1NR5A 1R0YA 5TMEA 1OASA 2OV4A 4H1WA 5L3QB 2IBSA 2CXPA 4QHSA 4ETIA 1IRXA 2KLHA 1WKVA 1K5GA 1EGQA 4G37A 1JR3E 4JEHA 4WLEA 3W78A 1CUHA 4GPAA 2I3BA 3GUHA 4XTCS 3PI7A 2Q6IA 2H16A 5A4IS 1NVTA 3MQFA 4GX0A 4IHJF 3DHYA 2FPMA 2XMGA 3UH0A 5BYAA 5HGXA 1Y6FA 1ZWLA 4Y2QA 3AFGA 1NQXA 1TJYA 3RKRA 3NHJA 5CDSA 4TXJA 3GBSA 4L07A 2GN8A 5FULA 1EH5A 3TLKA 1K0FA 1T8TA 4RA9A 2D2VA 1IWOA 2W48A 2WJZB 1XX6A 3OLYA 2YQ4A 4GZ3A 1ACMA 2C54A 4GD3Q 2PVCA 3IPRA 2QUIA 3AB3A 3TOZA 2FEPA 1WBJB 2R8BA 5FI1B 5HF5A 3FCCA 3RRNA 2VT7A 1GGMA 4CQMD 1SKQA 4Q93A 3GJRA 1N6PA 3WLAA 4KE7A 4M86A 1VA5A 1DBPA 1TAGA 4Q5IA 1S8FA 5L4SA 4KUHA 2QW8A 3OKCA 3IKJA 4JVMA 2XF8A 4L08A 3NJ4A 2QP3A 2UDPA 3MM4A 4JYBA 1T8SA 3QPAA 4DUZB 1OC4A 2X7JA 5C8DA 1ANKA 5ALGA 3IKVA 4ZT4A 4JBWA 3EGCA 5EQDA 2D2IA 2EYUA 2R6DA 4YB8A 3RVDA 2P9JA 3WK7A 3N9IA 3GPCA 3TLMA 1FE8A 3F6EX 1G18A 1L5MA 3KUXA 4CKCB 4LOHA 5LDGA 1OX4B 4RD4A 4W1PA 1ID8A 2B20A 2WVGA 3ETEA 1YIDA 1PFQA 4P3NA 3THRA 4CL0A 4CYMA 1RCTE 2Q0SA 1FU4A 1Q57A 1WVGA 1CZUA 3EULA 4TTAA 5A05A 3U1TA 4KR2A 2Q3EA 3AR3A 5B2EA 3PNYA 4R1TA 4ZHQB 5TEVA 1QNLA 3IUBA 4PYNA 3ZV3A 2A1UB 2WVJA 4BBZA 5KTOA 2XUFA 5ISMA 1AGRA 2PNJA 3EXFB 3Q7RA 4ESEA 2JL1A 3S6JA 2JVKA 4RORA 1APBA 3WZMA 1E0JA 3FOFC 3ROFA 4IV0A 4HGRA 3AKZA 3ZU5A 5AW6A 5CDYA 1L1EA 4OJYA 4V0ME 4K40A 4ALIA 1GCOA 1K6MA 3A27A 4LMBA 3SF0A 3W4KA 2IS6A 1CJVC 4F45A 1NXQA 2CLHB 2PH5A 5JDIA 1E1KA 4WBXC 3UMYA 4Q1DA 3WLNA 1M73E 4BMOB 1MB0A 2LW7A 3CT4A 5DSXA 1V1RB 2B4QA 1OGYA 2CD7A 3MF4A 4OHVA 1GTZA 1RXYA 3WLSA 1FTYA 3PV0A 3ZNPA 5HKAA 4LXQA 3EY4A 2HRZA 4QPNA 4LNHA 5M34A 1W4CA 1MX3A 1ZDMA 4X54A 3DT8A 3JQDA 3RVLA 2J7KA 1B3RA 4N7JA 3R7WA 1T5OA 1JV2B 1FRVA 1N7HA 3EUWA 1OU4A 4BVHA 5KDLA 1MXFA 3OFJA 9GPBA 3ES9A 1KPHA 4OHOA 3DAHA 2PGDA 3NKFA 4PYLA 2JGNA 4AP6A 4GGMX 1VRWA 4L4UA 3IKTA 4BB5A 1QG4A 1RDFA 2Q2NA 4Y98A 3A3NA 4B7XA 5LQDA 4PZLA 2B8TA 4EPYA 3P26A 3FNRA 1YAJA 4RW0A 4A4DA 1E2BA 2OV2A 1E63A 2PZMA 1IPEA 3UICA 1XPRA 1MJGA 2PBLA 1E66A 4EVQA 1OAOA 4N18A 1V1MB 3KLNA 2QM7A 1JHUA 1VBNA 1X9HA 3HRKA 5AH0A 4Z51A 1EQUA 1H1DA 1GN8A 1RYEA 4A73A 4C5AA 4ZT6A 2XITA 3WWOA 2G04A 1B0PA 1T3TA 4AX4A 4DNQA 5ABPA 2P5UA 3B9BA 1CK4A 2IU3A 3EYAA 4DNOA 4JR1A 4L85A 3WTBA 5U4QA 4PLPA 2ONCA 3KAQA 5F9FA 2J8ZA 1QMPA 1EFPA 1TKRA 5FBWB 3RJTA 4RA6A 3SJUA 2JFZA 4GQBA 3IV7A 4OMDA 1QDLB 3R6GA 4OP1A 1AN0A 4TKLA 2ZSJA 2HHAA 4PSDA 1YA4A 2JAPA 4KJXA 2PSHA 4ALLA 5IT4A 2GJSA 4LGYA 5TXGA 3ZW7A 2XGSA 4G24A 4CLOA 3OEEA 4X8HA 3UUEA 3K1ZA 1E9VA 2EGHA 2DQKA 2MWMA 2O57A 2Q1YA 4R0MA 4OP3A 2YBEA 4X93A 3G8BA 5CT6A 3SX0A 3BGSA 4FOTA 1N9ZA 2XMRA 3GK3A 3QX9A 4AN1A 4C6HA 1IOVA 4IWXA 1UP7A 2AQIA 2ONZA 3JQFA 3O0DA 3PA6A 5K05A 1OIXA 3THXB 3IQXA 1FFEA 4IIVA 4YWHA 1GLGA 4EQZA 5CB8A 2QTVB 4F4FA 3R8FA 5U4XA 3H5NA 5JXWA 4QE3A 4BFTA 3B5EA 3FTQA 1KSFX 5LMNB 3PC3A 4QHTA 5SY4A 3WMWA 5HZMA 2IW1A 2J3QA 4EB6A 3ZCQA 4D45A 5REQA 1SBYA 3H75A 3VHRA 5CFZA 2MJLA 3PIDA 3IKMB 3C74A 1VYHA 4KAAA 3OPQA 5DP2A 4UOQA 5ALYA 4BIMA 3CZ4A 1KYYA 3C3WA 4TUYB 1EE2A 1IN5A 1U8EA 4OUDB 4RXMA 3GFSA 4LF5B 5IJ9B 3NOXA 4G67A 2OC9A 4PO9A 2O2JA 1PEYA 3CUUA 3PXEA 3UJ7A 2BKLA 1W5BA 2GRAA 1PZFA 1ENZA 3ZDDA 3BWCA 4AMZA 1RQ2A 3BWXA 1WZ2A 1FQWA 4M9CA 1C0LA 3VPDA 2NZYA 4C43A 2XUDA 1XD2A 3DDWA 4GI5A 4KQIA 2QN6A 1WOMA 4PBTA 4WXRA 2B83A 1UP4A 3NBMA 2NUTB 3BIOA 1D1TA 1T9KA 3U5TA 4PYOA 2R8EA 5C34B 2B94A 4F97A 4DC9A 3D3NA 1M2FA 2D0IA 2QLNA 3D54D 4NYMR 2DSNA 4LS3A 1W4LA 4X6YA 4K9LA 1EK1A 4XJXA 3V8RA 3L6OO 3KNZA 4PQRA 2HMYB 5G3ZA 4Q9AA 2EEPA 3VR5H 3ZG6A 1SA0A 3V7UA 3BYZA 2WLTA 4Q7MB 4EG8A 3T54A 2H7XA 3KWJA 3EXG2 1NXTA 4NU0A 5LP6C 5BV8A 2IC5A 1JIVA 1N25A 1QP0A 4TTJA 5FBKA 5DRYA 1EUDA 2B8NA 2OE2A 1HE5A 3SE7A 3WNZA 5FUXA 1XLTC 1U28C 3NO4A 2X15A 1J23A 4AN0A 4ZQCB 2V97A 3KOOA 4JOQA 5IHPA 1S0UA 2AOUA 5FEUA 1Y1TA 1QH8B 4M9UA 4QUAA 3R7SA 1G3QA 2PPLA 3PHHA 1UKYA 2I67A 4PEVA 2OBLA 4HWKA 3RS3A 5E6RB 1OD6A 2YOFA 5T8KA 3OQOA 3C8MA 1Q7CA 3KP1A 3QTTA 2UZ0A 3IAAA 5K3OA 1R0CA 1PT6A 2R87A 2F8LA 3ESRA 1FVFA 3QPDA 4N3CA 4BNMA 4BS9A 4RTOA 2C0QA 4K03A 2PT9A 2Z57A 3DQZA 3F2IA 2DWUA 3OOSA 4RHUA 1DGQA 3N2LA 1E98A 4PNPA 3VKUA 2HA3A 4OG2A 3HA5A 1P2GA 3I8SA 1S02A 1W73A 1WS6A 4HPJB 2HUPA 5A9SA 2YIDA 2AFIE 3H6KA 4L22A 2Q9UA 1I10A 1BMQA 2MR5A 1ZMBA 4GF5A 3EIUA 1JLKA 1YWGO 1DARA 4I1IA 2W22A 2Y9MB 3RHFA 2X6QA 4YCLA 2ZCJA 3ISJA 4IEEA 4DKXA 1KE1A 3NW9A 3OEWA 3HKDB 2XNHA 1E3SA 2O8VA 1WUJS 2I9PA 1PO7A 4M0KA 3NM5A 1ZK3A 5EPOA 2GYYA 5AO9A 3ZGYA 1VDZA 4HZUB 4MITA 2KYRA 3WLLA 3TRJA 2ZM6B 3A6EA 3N8NA 5B36A 1G20B 2J3MA 4OUKX 4CM1A 2XCSB 4F8EA 2HPHA 4QUDA 4X64B 1Y89A 2XJ9A 1UOPA 2DY1A 3AEUB 3BRWA 1OSNA 3ROXA 1BMFD 2G5GX 5DWVA 3OTHA 3A1EA 5AKYA 1QIGA 3BK2A 1VIDA 2Q6TA 3T7TA 4FFDA 2XZOA 4QNMA 4HUQB 2X3UA 4TKVA 3AVVA 1XA0A 4H0FA 3QJYA 1OFTA 2RARA 3OF2A 4YAKA 3T1YB 2ADFA 5K0GA 3L8FA 3D6UA 4ZDIA 4OLAA 2V0NA 5DV9A 4F04A 2ORYA 3SZGA 5IS2A 3HR4A 4CF6A 2YV5A 2H52A 1NQVA 4E5YA 1RXVA 4NULA 2QLJA 5DMHA 1XQXA 1JTFA 3N74A 1CY0A 5ALKA 4LQ4A 3QWBA 1JSXA 1FIUA 3N07A 4PRKA 3DMNA 3OG9A 1UMKA 3LCRA 3RUDA 5KYXB 3UMFA 2YVUA 4JLMA 4PHCA 5ICFA 1EZZA 2YXNA 1PWYE 4OMUA 4PPFA 4RHFA 1BJTA 1M83A 3GJ0A 3P71T 5JZSA 1U7UA 1N6KA 3H1GA 4RF5A 3ZI7A 1QCDA 1FJXA 3A3OA 4MQBA 1W36C 1SVKA 1HNWB 5CHYA 2XMZA 1SUIA 4GECA 1X7XB 1NASA 3WGIA 2IXGA 4LDRA 3JARA 4JLOA 1V47A 1SEPA 2WJAA 4DQDA 3HXLA 4RHTA 1CS0A 3A9VA 1L5KA 4YCNA 4L51A 4OH1A 5F33A 3VHLB 5EMKA 1LPPA 2PU7A 4PSUA 1UWLA 2IYFA 2JLAA 4UHEA 3X2EA 3TIIA 2FQ1A 1T6NA 4LC1A 3RFVA 4YT8A 5CT9A 4HBGA 5AIBA 1RYYA 3T7KA 5EHNA 3KB1A 1X80A 1W96A 4LGCA 1YS2X 1Z74A 4PG4A 4XGNA 4BGDA 2HOQA 1L4KA 1Z68A 1L8XA 2VXYA 2XTMA 3G89A 3K5IA 3MPUA 3ZE2B 1ZM7A 1Y3AA 4H6WA 1UWVA 1MB2A 1IZZA 1S2MA 2OCDA 1XJ5A 2OESA 4IS3A 4LJSA 3RFXA 3UOGA 5K3FB 4IVNA 5AJXA 3HR7A 2A5GA 1BWPA 4PX9A 2AHRA 5AJZA 5H9VA 5T4HA 1G7CA 5E2AA 1JILA 2V0GA 1JBEA 1I13A 2YV3A 3WBKA 4JYZA 3NHYA 1W75A 2EWWA 4ZAXA 3PCTA 4NH0A 4Q19A 3ZNOA 4AZ3B 4B87A 2BEVB 2AWNA 2GEVA 2P1RA 2PR7A 5AVTA 5HUQA 2HC9A 4MI9A 1V9LA 2VDPB 3LRXA 3PA8A 3HFRA 1BCRB 2GX6A 3QY9A 4IFEA 4IO1A 2FYTA 4JODA 3OSZA 5E38A 1TM3E 3PNVA 3ZHOA 1YFZA 2QE7D 5EGSA 4BMCA 2Y0BA 2C61A 2YFKA 3L92A 1L5GB 4ZC8A 1ZONA 2FF5A 3GI1A 5FWNA 4ESHA 2H2DA 4ENRA 1H8HD 3J7AC 2QL7A 1EX1A 2WIKA 1NBEA 3AFNA 3NZEA 4N54A 1QHHA 5IDYA 3V2IA 2JAUA 4MVCA 5C37A 4YRSA 1W5EA 3QKTA 1N2GA 4LJ8A 4PRLA 2FG7C 3MTBA 5ECDA 2ABWA 3C3YA 5HW0A 5KYKA 4JZKA 3ED1A 4UM9B 4KFUA 3R0VA 3AUSA 3KLMX 4MGZR 2BONA 3EQ6A 1ZXLA 2DLCX 3C7TA 2JAXA 4G0OA 2WKRA 1HRKA 4MVJF 3ELBA 2WB4A 3PFIA 4EA8A 3DYVA 3ROQA 4H18A 4U6QA 2G63A 1XSEA 5MN5A 3OZCA 3H2ZA 3W34A 2BM1A 2JH3A 3JD0A 1VP3A 3ZHVA 5I8PA 2GK7A 4G89A 4II7A 4TWJA 1OF1A 2HU8A 1HV8A 3UKJA 5JCOC 2V7EA 2GEJA 3KLPX 3AL0C 1JYEA 3D6AA 1T2UA 4QU8A 4B17A 4GAEA 4YMVA 1NQAO 2NZ2A 1ZEMA 1QSGA 1ONBA 4JITA 1YXMA 3UAZA 4J1TA 2BV3A 3BORA 4BLSA 2Q1XA 3GFGA 3PFWO 4P7GA 4OHXA 1QQBA 1PGOA 1JG1A 3TBHA 1L5OA 1VLHA 2O2YA 3FWKA 1DZ3A 1ZD3A 3CW2A 1WG8A 1TQ4A 4FKMA 4BFLA 1NV8A 1F20A 2D4HA 4D4KA 4CMCA 4MKRA 1KEEA 2GCOA 4Q4JB 5DBIA 3L7LA 2UYOA 3E22A 2BFDB 3N8GA 1Y6ZA 2W00A 2B34A 1ZFNA 2CNBA 5HQTA 2PBRA 2YR0A 1VIYA 3GHHA 5JT1A 2RHLA 4V0OA 3QWIA 2F3SA 3KO8A 2ZBQA 2WMNB 2HA4A 4X41A 4BJ6A 1F60A 2RGAA 1DJMA 3EF3A 1BVHA 1FBNA 2BI4A 3U31A 1HQKA 1CJCA 4UOZA 3FFAA 4F5WA 3M6AA 1J0DA 2Q1WA 2QNRA 2XDWA 2ZG6A 1AQYA 3EGIA 3LFUA 4D6PA 5FFFA 1BN6A 1UKVY 2PXHA 4LE0A 4R1LA 1ES9A 2OVFA 4TX1A 4XCXA 5CJ2A 5KKCA 4X90A 2QRUA 1N0IA 2WYUA 4JLJA 1CY8A 2OC4A 3I61A 4CHTA 1EUQA 5A5EA 3N3BC 1W2GA 5FI3A 4JBLA 5JSHA 2H7CA 1SU6A 3FSGA 1X19A 5ICEA 3T94A 5IYZF 2OQIA 4KWTA 1VB3A 3E82A 2QJTA 1A5BB 3FPCA 4JC0A 4WASA 4QDUA 1ISHA 2CZCA 1N3BA 1VPWA 2CLKB 4NMXB 1W48A 3IAS1 4J0HA 2OCIA 2Z9BA 1NN1A 3IP8A 4AU1A 2II6A 3WO0A 2NUAB 4ISBA 3ZHRA 1ICIA 3P9KA 4JQSA 3U81A 4W5JA 2ZK7A 1SURA 5EZQA 4MV3A 1RTKA 3O03A 3QLJA 4HXYA 5I7UA 2YJ6A 1EK6A 1GGEA 4UFPA 1MO3A 3O2NA 3U3JA 4ZJUA 1FP7A 1W0KD 5CURA 1JR4A 2NXEA 3BB4A 1Y80A 3GROA 4HB0A 4HYYA 5T6MA 4B4OA 2WPDA 1GQRA 2R00A 4ZODA 1YR2A 4ER3A 2RJOA 3H5LA 3LU1A 1Z82A 2Z83A 4JQZA 4Y3UA 5HIIA 2ZIAA 1CEXA 1KZ6A 2JFBA 3LIIA 3CWQA 4P80A 4BXOA 2HBZA 4K87A 3C39A 2A5JA 1LF5A 1JHAA 1IHDA 2VRCA 3D2BA 4L15A 1X8XA 3LT4A 2VTBA 4XX0A 3BXFA 1NYQA 1RXEA 3L0CA 3G7UA 3WJ1A 2X0EA 4GOMD 5E6SA 2QM3A 1B43A 3LV8A 5KVCA 4XPIB 2CXNA 2H57A 3ET5A 1P3Y1 2PO7A 1YJ5A 1YR8A 3T1VA 3FH0A 4H7EA 1PJRA 2X2FA 4YP6A 3S1LA 3TWOA 1PR0A 2I29A 3C7KA 3VYVA 4DWJA 1DIHA 2DH5A 4GHWA 2R60A 3TXXA 2FETA 4C1NA 3BB3A 5CXSA 1FQOA 4KB5A 1XVLA 1Y8AA 4X20A 2GGSA 2ZT7A 3C45A 5FTWA 2UKDA 2YASA 3R23A 3ZPXA 4ESOA 2IUFA 3LC1O 2Z30A 1TCBA 2HSDA 3ADKA 4QEKA 2W2TA 1GNSA 1VCMA 3I01M 3BZBA 3BE8A 3VMFA 1QUEA 1UBGA 3MBIA 3W77A 4IDPA 3GG9A 1YFJA 3H8JA 7MHTA 4QOEA 3SVLA 5KQPA 4JK3A 2M6LA 3VR0A 2O0HA 2E48A 1VRCA 3SK0A 1OWMA 4UAVA 5JNUA 1N5MA 2AOVA 4YROA 2ZSEA 1IBLB 3K0CC 4I4IA 5CH5A 1D2AA 1FPMA 2NPOA 1NW3A 3A9CA 2YWRA 1UKCA 3W5JA 3D7NA 4HDQB 5GM1A 4DAEA 3VBEA 3OM1A 3IHWA 3DVQX 3EBLA 4NAHA 3I62A 2GEDA 2YJ5A 2NXJA 1WZNA 5JARA 2CUZA 1OYVA 3FCYA 4LXHA 5AUOB 1WTAA 2IA5A 3NIDB 3OZVA 4JJIA 4PFSA 1LU9A 2NPFA 5KYYA 2NX2A 2GN0A 1W46A 3IR6A 4U8GA 3HKEA 4CCYB 3KFLA 4OXXA 4PLZA 3NB0A 4ZZIA 2DZDA 4ZCSA 4JL8A 2Q62A 3AEKA 1U7ZA 3AL2A 4WN9A 5JSUA 4W8HA 4NENB 2NAPA 2ZTHA 3AR6A 2P4SA 4DR4B 3R77A 2J5KA 2VEOA 5AK6A 2EBFX 3DTTA 1EK2A 5CMLA 4BV8A 4CMIA 1MAAA 1GPYA 3GXOA 5EUBA 1XVAA 4HXEB 2PWPA 1CEEA 3JD3A 3RIGA 1HFKA 1Q6ZA 1FFDA 2AUTA 4FZRA 4GOOD 4W5RA 2WR8A 1LPNA 3BICA 1YGYA 1XF1A 3HUTA 4DA4A 3FUXA 1M2JA 2VR1A 1WMFA 4UBNA 4PZCA 3LXRA 1JKXA 2FQYA 3MERA 2V96A 3TNJA 2G71A 4RSMA 4W1RA 2NYVA 1M5UA 1P6XA 3WKEA 1OLOA 4Q12A 3CX6A 3K9FC 1DO2A 1H4TA 221PA 3PD0A 3OQ6A 2FQQA 1AGXA 4LA4A 1VHLA 2A5DA 2HLDA 3NNNA 4RM3A 3U39A 2GCNA 1YI1A 1RE1A 2EFYA 3O82A 1XB2A 1X3LA 5GZ6A 4YBRA 5BNWA 3HXTA 3CTPA 4JUCA 5P8WA 1AGPA 3IB6A 1QS0B 5DGXA 5KTKA 1JPUA 2JFUA 2VNSA 3T7SA 1K63A 3LI2A 3ZWKA 4IOJA 3NUGA 4AROA 1MO6A 1W2HA 2ODEA 4PS1A 3MZ0A 1C3OB 2X8JA 1YD7A 3PUWA 3Q9LA 4GXTA 4U3JA 1CP3A 2AG8A 4TRNA 4CQLA 4AWBA 2QUAA 3T1TA 2LDBA 1U0TA 2PRZA 2XYPA 3M81A 2C7QA 1KSJA 1QAOA 1GQOA 3BD8A 1LVHA 4H1HA 1OZ0A 2IHKA 1VZ3A 2QTBA 3I42A 3OCUA 2Y6UA 2ZQYA 1O94C 3WI7A 2GD1O 2Y99A 1JQLB 3SXUB 1NKTA 3EDOA 1K1EA 2PS0A 2KB0A 2WJ4A 2W4IA 1MB4A 1YQWA 5AI6A 4DMCA 2YKGA 2HU2A 5HCNA 4DLXA 1IULA 3JZFA 4AKHA 2H85A 4NCAA 5DXFA 4GZ6A 1E6EA 2VYND 4DXHA 5JMWA 1AS2A 2FFJA 3THYA 3LKDA 1Y5MA 4JMPA 1PE0A 2PO5A 3P1JA 4IMRA 4XD2A 5EYPB 4CFZA 4KDCA 5MF6A 3A6LA 1U90A 3OPMA 1TEXA 2PSEA 1XTTA 5LYYA 3T3HA 3UY4A 1DQNA 1M67A 4PO3X 5AHOA 3CLVA 3L2OB 4TWBA 5F3DA 3FSJX 1DAEA 2X7XA 5EWLA 3CNHA 5JYDA 2DT5A 1QPZA 1X1EA 1JHZA 3LPLA 4G25A 5JYCA 1S3GA 3PJRA 2LKDA 2P9EA 2OZEA 1MFZA 1V45E 5TVKA 4JUFA 5KYGA 4TZTA 2QN7A 2G77B 3GLFA 4H3KB 1QRTA 1OA1A 4CEHB 3SD7A 3QNUA 4DUGA 2I6FA 1BFUA 1GZUA 1L7BA 4MUBA 3V8VA 4D79A 1GTJ1 2A78A 3U9LA 2HA0A 3EZ2A 5FEMA 3ZW9A 2FGJA 1PX2A 3HY6A 3LO5A 4YP5A 3W0LB 1Y34E 4GMKA 4OGWA 2WG0A 4HK4A 3ZBUA 3OP4A 2KWIA 1XC7A 4FB5A 1JN0A 2YZ7A 1A4UA 1P7ZA 3RKSA 1QONA 3LDHA 5AJUA 5EJIA 4ES6A 2B37A 3I4LA 5DSTA 2IHNA 5D7BA 5BY2A 1RWBA 5CGQB 1LNZA 3R7AA 1WSBA 4TLMB 5B4VA 4BQFA 4BB9A 2EW8A 3IH5A 1H0KA 1N6RA 3CVOA 2F4NA 3THOA 1CEYA 2I2BA 5ALRA 5BMVB 1FJGB 3EPHA 1X2BA 2C2MA 3JPWA 1I3MA 3ND5A 1H2XA 4S05A 3EJWA 3PDJA 4TLLB 2QQFA 1O97C 1M8JA 5I45A 4N7MA 1AZLA 3UAXA 4IY1A 3D7KA 3JVEA 4E7PA 4AWAA 4RSHA 5PNTA 4A8TA 3JASA 4JOSA 2VK1A 3O2JA 4HY3A 4HYEA 2HHJA 4UBMA 1O08A 5DISB 3FPLA 1XZEA 1LV8A 2IPOA 3WZLA 1ZI6A 4RSRA 3THWB 4OHFA 2G5TA 1CUZA 1L4HA 3E1GA 3FYDA 4DGQA 4MYRA 4UARA 1Z6GA 3DDSA 3BMQA 1I7NA 1BX0A 2V7GA 4HFNA 4Z9AA 1YRLA 2FAXA 1DEHA 2ARKA 1IAVA 2NSYA 4HR7A 4NATA 3RSZA 3TTTA 3AFOA 3QKSB 3OESA 3PKJA 2JD0A 2FKNA 1K7CA 2GBIA 2NU6A 3IEUA 4NPHA 1DKPA 2RGWA 5CA1F 1OLXA 2FSIA 2ZPUA 2F67A 4FZJA 4M46A 3UNXA 3UPDA 4HLUC 3W1WA 4ECEA 4DM4A 1BEEA 4GBJA 3TB6A 4FYYA 4ZCTA 5DHTA 1IXZA 2O6HA 1O97D 1X7ZB 2L17A 1DBSA 1QGYA 2FN7A 2HRRA 3GCWA 3SFTA 2Q1UA 3HJHA 4ZGWA 1JQ5A 2IRWA 4EUSA 1JG3A 1MQAA 3H65A 2WKWA 3V6MA 4A5OA 4E32A 2XBMA 5F52A 3FMVA 1P31A 4ONEA 5HQ3B 4YMWA 5AOVA 2I8CA 4MQUA 3DTVD 3AFHA 2OAGA 4IUCS 1EFVB 4RV9A 5EQJB 4IDHA 5GV8A 3FTEA 5C5CA 3PQFA 2PM8A 4RDCA 5EJ2A 4B09A 3N75A 2C4WA 4Q4CA 3CF6R 5D3MA 2PXAA 4BLWA 5I7SA 3HY3A 2QVYX 5CT8A 4BMYA 1U0RA 4W82A 3BCUA 5IUJC 2JI8A 2ZVPX 3BC1A 3FR7A 2P35A 3M0EA 4FLMA 3ZY3A 2B82A 2G70A 3BREA 4JC8A 5CAEA 3ISVA 3IVXA 4NDNE 5JEDA 1VL5A 1WCXA 3EODA 2ESRA 3LWDA 3C6BA 2XRYA 4H3VA 3ASYA 4UCQA 4GM4A 4O0LA 3DVAA 3LF2A 3K2BA 1OXMA 3ABIA 2J7PA 4WY5A 4JI2B 1KI1A 3FZEA 4GKJB 1JKJA 1GAWA 1P7CA 2PZBA 1RI4A 1YHZA 2MDTA 1U81A 1Z5GA 1UFRA 4RULA 4J94A 3HC7A 3DOHA 1K7FB 2BAGA 1T9AA 4NYIQ 2W70A 4KO2S 5LB2A 4URXR 2UYCA 4DV3B 2N75A 1ZRSA 1E3JA 2WSSD 1P1BA 3TTVA 5EP2A 2QRJA 4EFDA 3GU3A 3LW7A 4UE3S 1JFSA 4ROSA 2HW8A 1LLQA 2Y2UA 1JDBC 4LISA 1G9XA 3IT3A 4XQ9A 1FZTA 1SKBA 3TVTA 2XMPA 5A4JA 4M60A 1YR9A 1ECGA 2P27A 4RANA 3ZWNA 4D98A 1NPDA 3ANMA 3GB9A 2DVMA 3CUEF 3K6SA 1FFXB 1JEQB 3R5SA 3DDUA 3K0FA 1D9ZA 1B74A 4KQJA 2YBDA 2Z3VA 4EGCB 3QVMA 5HBRA 4RWEA 5IF9A 3LQ1A 4AXXA 4S1NA 4H4CA 4AKTA 1TUBB 4A2PA 4BZQA 2I54A 2ZIWB 4TMVA 4JHLA 121PA 3KEFA 4G1BA 2YNMA 1FU8A 1VCHA 2GM3A 2L82A 4CLHA 3LKZA 4EG6A 1TJ4A 2BCJQ 1LBHA 1V1JA 4GRAA 1ZH4A 5EJ9A 4CT4B 4PCVA 3C15C 5IDWA 2A59A 3FHCB 4B73A 3T0IA 1GEGA 3LY5A 1D2HA 2QMZA 4GUAA 3E9DA 1VQ1A 3LHDA 1XCLA 2NN3C 3NM4A 3NC0C 1U3DA 4WCFA 4DA8A 3S28A 3CJQA 2O3JA 3O84A 5GONB 1X7GA 4Y8VA 3KKPA 4FC6A 4HL6A 5ELXA 4X3CA 3MEQA 1AKUA 1MR3F 1R18A 2MSCB 4DDVA 1WV1A 4INAA 5L9AA 1C9KA 1IONA 4MV5A 5HS6A 4N8DA 3LCJA 4Z2YA 3RS0A 4CMIB 5FBVB 2W8BB 3NVDA 1A7AA 1HE1C 1CULC 2I2XB 4ICIA 4EB3A 3MN1A 1YVRA 2AV6A 2FUEA 2XUKA 4K6HA 3TIVA 2IYZA 4JYCA 4AVYA 1ORHA 1JH9A 2WAXA 1E59A 5L45A 1VE6A 2X2PA 5K0NA 1H1LB 5JI2E 3KB8A 3O2QB 4IIDA 3A37A 3MLAA 4KX5A 1N2SA 2F1RA 1T3LA 2RDMA 3DKIA 3N5CA 1EVLA 4X1YB 1I5OA 1DKUA 3OJFA 4TYQA 4U7DA 1U94A 3FPGA 4M49A 2ZI9A 3G0BA 1K3FA 3GNSA 3TLYA 2PL3A 4BKRA 5LP1A 3NC4A 1NLUA 3RC8A 2OCGA 4NQZA 2O2EA 1COZA 2CK3A 1E2KA 3AHEA 2BEKA 1O0BA 4GMFA 3G88A 1V2GA 1G42A 3ESZA 3ESBA 3ADBA 1DOHA 1YQUA 2Q45A 5KNBD 4M6WB 5LQNA 4UBOA 1KO5A 3T5DA 2QR3A 1YMVA 2EP8A 4Q7EA 3E7PA 4WINA 1VE9A 1HNNA 4C03A 1ZJ6A 5C7IO 4MARA 3FVVA 3JQCA 5FR2A 5FOSA 3ETDA 2FRDA 2VA9A 1YKSA 1CZOA 4HWGA 4Y2YA 4E5NA 5IM5A 4B8ZA 5KVAA 1F4PA 1V6CA 1INLA 3AV0B 3D3KA 4DNPA 1D5WA 1X2EA 4EVIA 4Z86A 3NHKA 3VNUA 3CSSA 2PGLA 3Q15C 4B6QA 2IY7A 2JGFA 2VHCA 3FNBA 4IDGA 3K0SA 1LTHR 4WZAE 3D4IA 3I1JA 3QEBZ 1BO6A 4JAVC 3AEYA 4HFRA 2DCUA 4G1CA 3HABA 4JI1B 4BFSA 1DC3A 4F3KA 3CF0A 1I32A 4NFHA 1AB5A 1T2VA 1JNYA 3FUCA 4XM2A 4BO1A 1JFRA 1JG4A 1N2IA 1PS0A 1Q83A 2A9PA 5BT8A 1C9JA 3WGJA 5L6MB 1J9EA 1ONSA 2AG5A 2QN3A 4LYGA 5HA5A 1LLCA 4NKRA 1O77A 4YT5A 5DRTA 3K2QA 2BEUB 5CVUA 3WYEA 2WD8A 4LFCB 4YV0A 2J09A 1L8AA 1PZGA 2GF0A 1YE3A 1Z29A 3GGSA 3AFMA 3MTDA 5DCWA 3ZTWA 3FAZA 4RYLA 2O7VA 4O4JA 3R4CA 5H16A 1IAQA 3BQNB 4BFWA 5BRJA 3RSSA 1ZJZA 5EZYA 1SUDA 5CU7A 1EP2B 4TS1A 3B9QA 4MLZA 3C3PA 4N65A 4J0CA 4I4LA 2FR8A 2O8CA 3WWPA 1PGJA 4ZVSA 1YULA 1ZN8A 1FRZA 1C7RA 2IPMA 4I9UA 5CVCA 4J3NA 4ATNA 3E1SA 3K9HA 2BRUC 4BRSA 2V7PA 5B2FA 5C5DA 5KOIA 1ZOLA 2BFCA 4JROA 5FWYB 2IHTA 6REQB 1PYGA 2GZ3A 3D7LA 4RDHA 3W5AA 4DCSA 4YALA 3E53A 2JIMA 3N87A 1WJGA 3WNVA 1TAHA 4Q66C 1DZIA 4DM7A 2OZPA 4QICA 5M04A 2WTBA 2HA2A 3AWIA 4JT9A 3GCDA 4F71A 1QXSA 1U2DA 3A26A 3BTVA 3JQ7A 2F4VB 1GU0A 2I1QA 3NDPA 3RH0A 1M7HA 2WHQA 4ALNA 3BHIA 4BQEA 4B4DA 2YDXA 5LPNA 3U1BA 2GFQA 3SS8A 3O94A 2IY9A 3KWLA 4URZR 3FB4A 3W5UA 5IRCD 1PLKA 2GAIA 5FPYA 4DSNA 2FNAA 4LNAA 2P6RA 1QHFA 2X5NA 4M0DA 1Q1AA 1OI3A 1OKKD 1Y5RA 4NBRA 5JD3A 4DMFA 1E5QA 2RH9B 1AQNA 3NHSA 2G80A 4BQOA 2WB2A 1QOPB 1NLFA 1XKXA 1R0LA 3NAGA 4OI2A 3VR2A 2E4UA 4UEWA 4HEHA 1YKGA 4CIBA 3T95A 1XL1A 2NYUA 3RRXA 1X7WA 3CNBA 3QPVA 3RADC 3H13A 2OO5C 3OM8A 1QHNA 1QKJA 4J7AA 3UFBA 1R0SA 3WGUA 1CHNA 1LGYA 1T0HB 4MW1A 4X0EA 1JPVA 2OHJA 3OLVA 1WW3A 1NBMA 4WZBE 5SYAA 5AVQA 2JNWA 1X8KA 1JKFA 1A9OA 1TADA 3MLBA 1CJBA 3QELA 4S1VA 3JVIA 1QP8A 5L3RA 2WIGA 1ZP6A 4NYJQ 1CDEA 3WK5A 2PRJA 3TR5A 1GTG1 1L7OA 1OY1A 3OWOA 1EHYA 3DM9B 3LPCA 4D9BA 3SQWA 3K35A 2WUVA 2E3JA 1JNXX 4IBOA 4O2LA 4PHHA 4J7CA 5IAKA 4TN1A 2ZAMA 4WFJA 4J1NA 4QUKA 3IILA 3W3AA 5F5LA 1JXMA 2P2NA 3VU8A 4BV2A 3WV4A 4BZWA 7YASA 2I34A 1M34E 2RK3A 5IWCA 1I2AA 5C1PA 5CH3A 1XDDA 1LDEA 3UQZA 1QV7A 4NTZA 1QP4A 2G9ZA 2CLSA 2A30A 2YWXA 3CUYA 5DX0A 4YYZA 4MUJA 2RKWA 2OB1A 3ANNA 3OC0A 2Z2ZA 2CNWD 5IM4A 1Z22A 4EVRA 3BZUA 4LOAA 1LB1B 3QBVA 4G56A 3DZ8A 4TZKA 4AD8A 4I9HA 1EVEA 2Y1EA 4OGGA 4ZV9A 3VYSB 3C1TA 1MH9A 5DKFA 1A2KC 1LW7A 2JIDA 2BGRA 1CR2A 5GAJA 4L3VA 5F2NA 5EZ5A 2C4KA 1OTHA 1J0EA 2AIRA 1L5VA 2JH8A 4M88A 1DINA 2QT1A 4DREA 4FCVA 1SIUA 2ON6A 2B9EA 4G86A 3SC2B 1J25A 3FHJA 1IU9A 2VHJA 2GFIA 1WABA 1C80A 3NTUA 3PZRA 4G5XA 5BPFA 1RFLA 5EERA 1AGNA 1ZD4A 2EERA 3I58A 5LCXA 2IZ7A 2FZKA 4HRAA 1EGHA 1KWKA 2A0UA 2PXCA 3QXSA 3IDSA 3TKLA 1P2VA 1SOVA 1UQRA 3NTLA 4IZOA 4ZHQA 1Z62A 1QUFA 1U0EA 3TNYA 2ZRIA 2P9FA 2HU7A 3EXFA 3KTOA 1Y8ZA 2AG1A 4RQAA 5JXGA 4E94A 1JQBA 1V5IA 2C2OA 2ZWIA 5EP3A 3WB9A 2C9CA 4XIJA 3E03A 4ZT5A 4UXJA 3PJGA 4UZEA 2NU9B 5K9ZA 2B6NA 4ILKA 1IN6A 3OFSA 2R7AA 1D4ZA 4AULA 5KWEA 1KVQA 1UK7A 3DBIA 4RKWA 3RYFA 4A9AA 3MUOA 4BNHA 3LY7A 1Z8HA 3CSUA 1IB0A 3F96A 4CG2A 3LMKA 1KE2A 4B6GA 5EIWA 2R1VB 5HJ7A 3PDHA 1P45A 1AHNA 2XXAB 1J07A 3AVWA 2C3PA 3SC4A 4AG6A 3ZWMA 3K0AA 1H2HA 3B2EA 1WAMA 1USWA 3O0TA 4KFRA 1VIVA 1NMSA 4RZUA 4OB7A 5EMJA 3C5CA 3UK2A 3C7AA 3ZE9A 4RY8A 4V38A 4RX1A 4RIGA 4BGIA 3K6JA 1TA4A 1A77A 3TDNA 4ZJZA 1U7WA 3A6JA 5U1PA 1A9YA 2EFDB 1JAZA 1VKZA 2JFQA 3RSLA 4LNUB 2CYBA 3ZCUA 4DCNA 4YJ3A 4J0EA 5K6AC 2C4VA 3A25A 4G5FA 3QPWA 1V7CA 1V8PA 3WHIA 3ESAA 4DSAA 3OJ0A 3S1SA 1QGED 4LJAA 3KQKA 1T3GA 2FPIB 1V6SA 1AZSC 1WDKA 2C8JA 1NT2A 3I34X 3AF3A 3KSMA 4C0LA 3A1FA 1H0HA 4LJKA 4POAA 5E0KB 2NVUA 3H1PA 4AIRA 1ZWKA 2ZPTX 2HEGA 3WNQA 4J0JA 4EELA 1JG6A 1V1MA 4KPUB 2OXCA 3NIGB 5A06A 4OHYA 4TUYF 4ZARA 2JJ8A 4NG5A 2HXSA 1PFGA 4KMRA 4A1OA 1AXRA 1REQB 3IQWA 3CG4A 4GMGA 4XOUA 2XOEA 4P08A 4C2BA 2FCRA 2VJKA 4B6OA 3CISA 4L8FA 3DBHA 1VSTA 3DGEC 4B79A 2GBLC 5GWXA 3SZOA 1L4UA 1K6JA 1YK0A 4DMLA 4NONA 1DXHA 3IS3A 1N9KA 3JAKB 4HDKA 4D9IA 1PQUA 2OBXA 5I7FA 1PIWA 1WLSA 2ERCA 3G2IA 1G7RA 2L0XA 1EWYA 1TD9A 5FJIA 4IGKA 4WOKA 5CYOA 3VJLA 4I50B 4UNRA 4Z0HO 3GRYA 2H2HA 2OYSA 3AFIA 1B6RA 3W8RA 4F5DA 2WNIA 3WJAA 1OI4A 1HKHA 4QQFA 4Z4IA 1CNEA 2K2WA 3V5NA 5JSZA 2F55A 2J32A 5J4KA 3CGWA 5LDHA 4J0IA 1OIWA 4QYXA 4OK5A 4Q4DA 3JQAD 1YRAA 3F6CA 1ODCA 1NJ5A 1GUBA 4MDEA 2JI9A 4MW4A 1PR2A 2O5VA 4HDNB