1JAIA

H-ras p21 protein mutant g12p, complexed with guanosine-5'-[beta,gamma-methylene] triphosphate and manganese
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAPGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-HA-RAS
publication title The role of the metal ion in the p21ras catalysed GTP-hydrolysis: Mn2+ versus Mg2+.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp-binding
total genus 63
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1996-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1jaiA00
3X1XA 1E2NA 1SKQA 1N2CE 2C78A 1KNXA 3QXXA 1DAGA 1ZCBA 3BC1A 3IDQA 2WVJA 3P4YA 4B3FX 3LBIA 3FGNA 5EP2A 4CW7A 5KYKA 2XTNA 3U5ZB 1ZU5A 4Q5IA 5AJZA 3E2IA 1OV4A 2ZE6A 3KKMA 4MRNA 5H70A 521PA 5AUPB 1I2DA 2DWOA 3H4MA 2HV8A 3GJ6A 5BQ5A 4KU4A 2D7DA 2JLUA 5FFMA 4FCWA 2YWHA 3AVVA 4C4PA 2RGNC 1RYFA 221PA 2DFNA 4L15A 5FTLA 5BXQC 3BFVA 3CLVA 3WNBA 4HUTA 2AK3A 1RRCA 1E6CA 2H57A 1CJVC 4YC7A 5JHGB 1VG8A 1YHNA 1YR9A 2VSFA 5GVSA 3I5XA 1ZM7A 2CLCX 4BEJA 2WIAA 3B1YA 3OEHA 3K0AA 3EZ9A 5AUNB 3RDPA 4MGZR 3CF0A 5AK0A 1P9RA 3GJ0A 1X3SA 2YWEA 3MJHA 5FL7D 2UZIR 3ONWA 5KSZA 4AKHA 4W7SA 4DLXA 4HZUB 1HUQA 2L0XA 1HEIA 1G8HA 4KFRA 4BEBA 1FQJA 1RIFA 2QUZA 3WMGA 1P3JA 1G16A 4OYHA 3NTUA 4P0TA 1Z0DA 3FFAA 1ESMA 4C3ZA 1XD2A 1L7VC 4MUBA 4FWTA 2UVQA 2W2VA 2V9PA 1VG9B 4XVUA 2NMVA 4GDFA 5D3MB 3PEVA 3NEYA 4B43A 4TT3A 3KUCA 3WMFA 1ZD8A 1AS0A 4HAZA 2QTVB 2ZQ5A 4I1UA 4MKHA 4NCKA 1EX6A 2HXSA 3OF5A 2V4ZA 1RRGA 3UKDA 3KDSE 1E4YA 2ERYA 2P2LA 1UBCA 1NI3A 2PCLA 2D3WA 3C5CA 4X8MA 4KFTA 1AIPA 2R44A 5FUYA 1I4LD 2P67A 4BWYA 4DEXA 2ZRCA 4MA4A 3F3YA 3BIFA 1KY2A 2F1HA 4LJ4A 2VPPA 3GJ7A 4OJQA 4BFYA 4RZXA 3Q7PA 2FG5A 3TH5A 1YZLA 5G40A 3KTAA 2NGRA 2ZREA 3THXB 1YR7A 2IS4A 3T34A 2DCUA 2A3RA 1FP7A 4K8OA 1OXXK 4CYMA 4DDVA 4Q1DA 1PUJA 3K0SA 1E9EA 2ZSBA 4G01B 3N2IA 5KDDA 1M2OB 5EXPA 4RY2A 1J2JA 2VP0A 2NO7A 1WBBA 3C41J 2JJ2A 4RKEA 4C0QC 1GM5A 4KFUA 1MV5A 3U3JA 3PUXA 4LOAA 4Q1AA 3OIUA 2QORA 2BMEA 1NN3A 3CNLA 4E07A 3B8HA 1W36D 3RVBA 1NNEA 4FMDB 1X6VA 3IPXA 2CNWA 2CDNA 1LW7A 3TE6A 1P7CA 1VPLA 1TQ2A 3PCRB 2BMFA 2Q9AA 1G8YA 4GZMA 1XPUA 2C9OA 2KI5A 3AVPA 2Z43A 1RKBA 3RANA 2QQ0A 2ZVQX 4O2LA 1DAEA 5KSYA 4RFSB 2AD5A 3UG7A 1OXUA 621PA 5JSZB 3D3QA 3R9IA 1EFRD 4DCUA 2FPKA 2GJKA 4JVLA 1W0KD 1MR3F 3B6EA 3QKSA 5TMPA 2BBWA 4FMCB 4GOKA 4PAOA 3KKOA 3WHLA 2PT7A 1N6IA 1KI3A 1JR3E 1DAKA 1W4AA 1W5SA 2FX3A 821PA 5JS7A 2GXUA 5CDFE 4DCSA 1A5TA 1OB2A 1SVMA 1ZM4A 3DM9B 3HU3A 1S8FA 2IXEA 1TEXA 2ZJ8A 5F2EA 3K8YA 4P31A 1HQYE 3UWKA 3A1WA 1JBKA 1SVWA 1FFHA 1GL9B 4XVRA 4A2WA 2ZPTX 4JJKA 1DAFA 3CUEF 2BEJA 4UNSA 4W5HA 1JQLB 4TZ6A 3ADDA 4M1KA 1X1SA 2QN6A 3U3OA 1RYHA 1G3UA 2F9LA 3QKUA 4E5UA 1E98A 2HJVA 3K0AB 1R0YA 1WB9A 1E2EA 1SXJC 1FTSA 1TU4A 4OK3A 5DGXA 4P4UA 1P75A 3CM0A 3ICQB 2X19A 4QBIA 5CIWA 1OHHD 1T3SA 4BPBA 1XXHA 3HP1A 4MITA 1YZQA 2ZUCA 3EIQA 3KJHA 1JALA 2AHOA 2QEQA 1E79A 2AD1A 3E70C 3EZ7A 4KAXA 4Q1BA 3R8CA 2W00A 2ZIAA 1JQJC 1XD2B 2DR3A 2OCYC 4Y0VA 5J4LA 4I1VA 3PENA 2QI9C 2ZAOA 1SKYE 1G8GA 5DI3B 2IUTA 1GKUB 3GLGB 4S35A 2Q9CA 4BLPA 2QT1A 3U7FB 1K6MA 3GEIA 2MSDB 2ZRKA 3BBPA 3PFIA 1PLKA 2GF0A 4DDUA 1BMFA 1AGRA 2ZU0C 2D06A 2JJ1A 1Z5ZA 4ZCIA 1S2MA 4I4LA 2OBNA 3NHAA 4TLBA 1AM4D 2XSZD 3RRYA 5FOVA 3NXSA 2KJQA 2ZRJA 4PR0A 4QGFA 4LV5B 2B92A 1Q22A 2MSCB 2V6JA 4DB4A 1CIPA 2GWHA 3Q7QA 5EP3A 1CR0A 2IHBA 1M74A 3HU2A 3VR3A 3IIMA 5IK2A 4B74A 2ZRBA 4GBMA 4RD2A 3KTAB 1MOZA 3PUVA 2JDID 1MABB 4LYFA 5TDHA 2CL6X 1GFIA 3CW2A 3W3AA 3V9PA 3QG1A 4PZYA 2FFBA 2ZSAA 3A4MA 3TVDA 3VX4A 3W6OA 4A2QA 2GJ9A 4EFNA 2Z4SA 4WBSA 3NBYC 1E94E 1M7BA 4JLMA 4R7ZA 1GUAA 1VCOA 4LZZA 4ZIRB 3ZQ6A 3GMTA 4Q21A 1G64A 2QAGB 1Q1ZA 2ZRDA 2YHSA 1AN0A 3R9XA 4C0KA 4C0LA 5JS8A 2ZYWX 1KI6A 3TUIC 1VTKA 4ZDJA 2G1JA 1N6NA 4TLDA 5BN5A 1GRNA 3TQCA 4ARZB 4L5BA 3VTKA 4DRZA 4GT1A 4NH0A 4TQ9A 4Q4JB 2VSXA 3P1JA 4Q9HA 3LA6A 2EW1A 1IJFA 4I1OA 5SZJA 2OFOA 4PZZA 3ADCA 3BH7A 4Q66C 4A82A 3L0IB 3C14C 1XTSA 2F3RA 2VHQA 1MH1A 2FSHA 1UAAA 4C0AC 5JWRA 2CK3D 2GEDA 1TNDA 2BCGY 1IXRC 3K0FB 2WPDA 4JSTA 4RD0A 2ZS7A 2Q3FA 4DBLC 1EG7A 3ZVRA 3BFXA 4TTPA 4A92A 3MWJA 4TN1A 1LY1A 3IKJA 5DYGA 4ERNA 3SN6A 4JVNA 3J81k 1OSNA 2WMOB 5L3SA 1LTQA 1US8B 2OBLA 5TV2A 3L8YA 1G8PA 1QDEA 3QXJA 4F38A 5TVKA 4KVGA 2W6ID 5FI0B 1P6XA 1WBDA 2ZSFA 4HAUA 1ONBA 1ETUA 4D26A 3R8FA 4JLDA 5KOYA 4OQMA 5BYJA 3HWSA 3LBNA 4EUNA 3NDBB 3WMEA 4A0FA 3K0CA 1CEEA 2O5VA 2XZOA 3EX7C 2GETA 2JLWA 1BOFA 1F5NA 4DLWA 3Q8XB 5EJEA 2BDTA 1ZBDA 3AV0B 4KYIB 4X8OA 2PH1A 1XXHB 4FI3C 5HCIA 3KQNA 4DIDA 3NC0C 2E87A 5JEEA 1W36C 1E2HA 4M1MA 5KNBA 3LNCA 3I5YA 4DCNA 1G17A 5DN6A 4M53A 1NBME 1KI9A 2QPAA 4QL3A 4URZR 5C4GB 1MO6A 4KHZA 1FPMA 4FN5A 4LHXA 2EQBA 3AH8A 4IOKA 5CITA 4Z1MD 1E32A 3W34A 4BECA 4DLRA 2MMGA 3O47A 3BK7A 4QM7A 1ZJ6A 4UJ3A 1XB2A 2QGNA 1G4AE 4NONA 5HCNA 4NU0A 2CK3A 4FCTA 4Q7LA 2O8FB 2FNAA 4YONB 4NHOA 4AKGA 3DL0A 1LNZA 3SI7A 2BKUA 3FPAA 4L9WA 3GJ5A 3ZGXA 3BORA 2A5FA 4YMWA 2VHJA 3B13B 5B30A 3K09A 8OHMA 3AGPA 4G5OA 1E9RA 1XZPA 1GKIA 3JZMA 3KKPA 5H68A 1JR3A 4D4KA 1YZUA 1PZNA 2ZI9A 2CJWB 2VYFA 1GAJA 4FMDF 1HQCA 1YZTA 3W90A 5CDFA 1GNPA 2G0NA 1E1RA 5K8IA 1VG1A 4OKSA 1TMKA 2ECKA 1LS1A 2AN9A 2QTHA 3LD9A 4B32A 4V0KA 2ANCA 4B47A 1KI6B 3CX7A 4MH0R 1G3MA 3T35A 1CJUC 1E0JA 3WNDA 5IHPA 3T1OA 1JEEA 3SJCA 2JIZA 2WJVA 4NP6A 5C2JB 2ODBA 2GESA 5DIFA 5E3HA 2J7PA 1FMLA 4QNRA 5FBWB 3OE7D 5JJLA 2WBLC 1YR6A 1D2NA 1M7GA 1KJZA 1KJYA 1WE2A 4NE2A 2ZJ5A 1OF1A 1Z6GA 1WP9A 1N5IA 2A5JA 1KK1A 5JEDA 5KO2A 5HE9A 4CT5A 1UKVY 3IO5A 4RD6A 4QJ5A 3VR1A 2EFDB 2NO9A 1KMHA 3PEWA 1OIWA 1TUEA 4JL8A 4TYPA 1W5TA 4R71A 4DUGA 5FH9A 2BBSA 3CWZA 1DO2A 3U44A 3GLIA 4YQFA 3A4NA 1XD8A 4PTLA 2C9CA 3CWQA 3VX3A 2P0EA 3KX2A 2QU8A 1KZ7B 2BKEA 3B5JA 2ZI3A 2GBLC 1NVVR 1RRPA 2JJ8A 1SXJE 1ZINA 2X77A 4KSCA 5G3ZA 3ZS8A 2ZANA 3TK1A 3KQHA 1CRPA 4QM6A 121PA 3RAPR 5FR1A 4WXPA 2GXAA 4OI2A 2OFWA 1XU4A 3AGQA 3THWB 1E2QA 1VHTA 2A5DA 1F2UA 3FMOB 3RRZA 3ZZUA 4AYWA 2ZSDA 4A0RA 1J8YF 3Q3JB 2VP4A 4Z54A 2HYIC 2O0KA 5A0FA 1KOFA 4LHZA 2VBCA 3P32A 1AZTA 1UBGA 1KYIA 3EZFA 1D5CA 4OI1A 3EAQA 4RZUA 5EE5B 3NVAA 4EPXA 2IYUA 3PR1A 3PJRA 1FX0B 1Z08A 1EXMA 4CZ2A 4PSVA 1SHZA 1UEJA 2OSBA 3FHCB 3P20A 1G7TA 5KSOA 1IY0A 1R4AA 2PCJA 1FUUA 5KNCA 3CF2A 2CXXA 4HSEA 4QHTA 4B6EA 1G8FA 4EDHA 3CH4B 4PPFA 3QSYA 2ASEA 2RGCA 2J0UA 1ZAKA 5FBVB 1N6PA 1OIVA 1XTIA 2J87A 3KZ1E 4ZI2A 2XNSA 1SZPA 1SULA 4LC0A 1XEWY 2NIPA 2YJTD 2IUUA 1HV8A 3NBFA 4BLRA 3MSXA 4CEHB 2QQEA 1NN0A 1NL3A 3LAWA 4US1R 5CB6A 4Z8XA 2GCOB 3OE7A 4OI4A 1QF9A 1NBMD 2ODNA 3KQLA 3HYRA 5FPYA 1IAQA 2R6FA 2VP9A 3QBTA 4IEEA 3ZJYA 1DVRA 4DLSA 3FKQA 4PQYA 3AUXA 2QMEA 3GEEA 1NMXA 3R20A 4ZDIA 2TMKA 4A6XA 3AKDA 3C8UA 4AI6A 4YMSA 2B7CA 1G21E 4LBVA 2Z5FA 2E9SA 4JKIA 1D6JA 3FKSD 4K46A 4NYMR 4Z8YA 1Z6AA 1II0A 2GKSA 2XXAB 1NLFA 1DAMA 3ADBA 1U81A 3DO6A 3DEFA 1EFTA 2PLFA 1NG1A 2RGNA 1H8HA 1R5OA 2JGNA 4TMWA 4V0ME 2XNDA 4UXJA 2FU5C 2G88A 1Z0KA 2J9RA 3MFYA 5C4MA 5AJYA 2C03A 4CEJB 5EE3A 3WP0A 2B6HA 4NL4H 4P4TA 2PMDA 2DFLA 1UKEA 3G5UA 1FTNA 3T5DA 3GLHE 1Z0IA 3VFDA 4LV8B 2QP9X 2CVFA 1QBKC 1KSJA 2D4HA 1U90A 2HLDA 4MGIR 2I4IA 2N46A 1OH8A 4LC1A 2J59A 4B34A 4M1YA 4YMUA 2ZRNA 2NQ2C 3DMNA 4DZZA 3UXMA 2C96A 3AF0A 3CO5A 1KDRA 2R6DA 5BN3A 2PX3A 3HYTA 2OAP1 2YC2C 3AVUA 4Q1EA 2P3SA 2JLVA 4HEJA 1S3SA 4K81B 4IKEA 5CJ2A 2CLDX 3MGCA 4M1WA 3R7WA 1IOZA 3KUDA 2QPTA 2ZJAA 3HPRA 1VCIA 4QXAA 1CU1A 1F60A 3LQQA 1Q12A 3RNLA 1YRBA 1FQKA 5DYIA 4YXWA 3UANA 4Q4HB 1KGDA 4TLAA 5HR5A 2ZYTX 1JPNA 4AY2A 1AZSC 4G5RA 1ZRHA 3WY9A 3MAAC 1HT2E 3VQTA 2BHRA 2KBEA 1AS3A 1GZSA 4B3XA 4CF7A 3GLIB 4UNQA 3VU9B 2DWQA 1X86B 3Q85A 3TJZA 2ZYUX 3GFPA 4A9AA 1KY3A 4ZDWA 5FOWA 4X8LA 4LI0A 2FSIA 3JVVA 4JSYA 2ZJZA 4J0QA 2ZJYA 5JRZA 3K70C 5KTYA 3REFA 4R9UC 4V0LA 3LH5A 1DS6A 1P9NA 2EFGA 2J0VA 1W4CA 1SXJD 2QY9A 3PUYA 4D0GA 4W9MC 4KBGA 2DWPA 1J7KA 5P21A 3AKYA 3QI2A 4G0NA 4DT1A 4LX0A 1R5BA 1T4GA 1VG0B 3ECCA 3VR4A 4EPTA 3U7GA 4E09A 4P3YA 5FTKA 5BN4A 5E95A 5FUVA 3TAHA 1L8QA 3MRSA 4II7A 5FPTA 2G9NA 4M21A 3CPJB 2RGGA 4H9GA 5LPNA 4TYQA 1XMVA 3T06B 2RH5A 4LCBA 1P2UA 3W6PA 3WHKA 1KO4A 3DVLA 3KXLA 2PX0A 3OEEA 4NCNA 2LWIA 1VCMA 1Z2CA 5FOTA 2GF9A 4NTZA 4EPYA 3QG5A 3M1IA 4MRPA 4CVNA 1JPJA 1E1QA 1L4UA 3B85A 4KXFB 1TPZA 2GRJA 3BS4A 4M4SA 1Q3HA 2LKDA 1U99A 4Q19A 5HE8A 4MGKR 4LJ8A 4QRHA 5FBQB 4AG6A 1U2RA 3I61A 2GZAA 3L0SA 3TBKA 2R6CA 2F1RA 4D4MA 1OFTA 4BLSA 1RJ9A 5GJWC 3T5GA 4AIIA 4A8JB 1QVAA 1CR2A 1KHTA 1H8EA 4QC2A 4M0LA 4YDHB 4GMDA 3I8XA 2C77A 2XOKD 4C7OA 2BV3A 1NN1A 4UKDA 5KNDA 5EXTA 2BJWA 3SU8A 1KZGB 1W0JD 4DSNA 3K1JA 4BFXA 1XTKA 2IC5A 1OB5A 2K5UA 3QF7A 2N42A 4B76A 2IYLD 2AKYA 2B21A 1MO5A 2D62A 1E2JA 5JRJA 4DLUA 4LHVA 3WYAA 1G3RA 3AEZA 1SXJA 3IO3A 1IXSB 2IYXA 4TTQA 4AWXA 4JBXA 3AP3A 2J5XA 4XTRA 2QM7A 1JB1A 2YKGA 5JI3E 2FN4A 3B2EA 1G41A 1KO8A 2ZRFA 3IBGA 1UPTA 3THYA 3R7WB 3FYHA 1J90A 5CIQA 1F3OA 4DDWA 1O87A 2OV2A 1LF0A 1M34E 2IYZA 3C5HA 3IIKA 1D2EA 3KL4A 5EUMA 2XEXA 3L0PA 1DE0A 3LO5A 1YZGA 3WNCA 3ZIAD 1QHHA 2GAOA 1S9DA 4L16A 2IF2A 4NCHA 1CS4C 2GTPA 3U60B 1IHUA 1ZD9A 4EJSB 4U00A 3CRW1 4DWJA 3VR5A 3KFXA 2VH5R 1MO3A 4OHZA 2CE7A 4EAQA 5HZKA 1XCPA 4RVCA 4XD7D 2QE7D 3TR5A 2HF9A 3W6NA 2O0JA 2WZQA 2D74A 4LJ6A 3CIOA 1Q1QA 2W6JD 2IYVA 3LVRE 4M8NE 4FCVA 1HT1E 3TVTA 1Q44A 3QF4A 2XOKA 1TTTA 4BFWA 4BLQA 3KB2A 4XSGA 5CYPA 2FA9A 2YOGA 1Z6TA 3CNNA 1G7CA 1NKSA 4QGGA 4ZPXA 5J4YA 3CX8A 2QMHA 5FOSA 4ASUD 1U9IC 2O8DA 5J47A 1G19A 4V0MA 1YZKA 2GVZC 4KLNA 5FL7A 1WCV1 3SJBA 2C8VA 2REOA 1YQTA 4PC1A 1T91A 3B9PA 4B3CA 2I3BA 3SHWA 1KI4A 2BEKA 4FIDA 1RPZA 3L2OB 4L8GA 4IRUB 5EE1A 2HCBA 2QROA 3GLHA 3NC1C 1XTQA 2ZI5A 3O8BA 2QPOA 1KDTA 3A36A 4RFVA 3LW7A 1TF2A 1NG9A 3SQXA 1T0HB 1KTVA 1RE0A 2A2ZA 5EZ6B 1OH5A 3FMIA 3I73A 2FMXA 3MG9A 2OHFA 1Z29A 3GJXC 1RRFA 3QBVA 3UMSA 3I72A 4JVMA 4HDOB 1AGPA 2RMKA 5KDLA 2J1LA 4OQNA 1ZNYA 2F1IA 2QBYA 3ZIAA 4M22A 3R9WA 1ZIPA 2QP3A 3V4FA 3GLFE 4PC7A 3CNOA 1HY3A 4MKFA 1GWNA 3IQWA 2ZM5A 2ZE7A 3LV8A 3H86A 3ZQJA 2ZS8A 2X2EA 1Z83A 3EA0A 1NRJB 4LBZA 1WQ1R 3RS2A 3ASYA 3GJ8A 1GVNB 1CTQA 4XD7A 5J4VA 2YOFA 5G53C 2C99A 2JLSA 2O8CA 5CLLA 3KJIA 2AL7A 2PMKA 3JZAA 2AK2A 1VHLA 2GAAA 3RLFA 5EZ5A 2OUKA 2Q3HA 2QMOA 3I3SR 5LBIA 1PVOA 1DARA 1NF3A 3EASA 3DOEA 1XJ0A 4DCTA 3CB4A 5K8UA 5LD2B 3I62A 2GXSA 3QPUA 2ZI7A 3D7MA 4LYJA 4NPHA 4GPTA 4EFMA 1PLJA 2FZ4A 3FB4A 2CHQA 2JA1A 4TLCA 2J46A 3UIEA 1EESA 2ZJBA 1SHKA 2FH5B 5GVRA 4EFLA 2C04A 2VF8A 4KCGA 5C18A 4MRVA 3ADKA 4D4LA 3EPJA 2CHVA 2WV9A 1G5PA 1Z6XA 4IEIA 3QKRA 2RHMA 3QVVA 4V0OA 3A1VA 3LX8A 1KAGA 4FXPA 4URWR 3M0EA 2IF0A 4DLYA 3IILA 2REBA 5E4FA 1VECA 1LS6A 2CVHA 2WSMA 1EFRA 4PO8A 1CXZA 4Q9IA 1E2GA 3IEUA 2WMNB 5JI2E 2XB4A 3GP8A 1W0KA 4NYIR 2B8TA 3ZD7A 1MKYA 1XFAA 2GK7A 4B73A 3OFND 3LLUA 3G82C 4M2LA 5HZHA 3TSWA 4ESVA 2ZRMA 4P4SA 1W48A 4PC2A 5KUTA 4DXAA 1J8MF 3AVQA 2EFHB 2I1QA 1CLUA 5FPSA 1VYVA 4HLQB 3RWMB 3WYFA 3C4JA 1E0SA 1FUKA 2AX4A 1OXTA 4UNPA 3QEJA 2AKAB 5F9FA 4AG5A 2JEOA 1LV7A 3SZRA 1YU9A 2GEVA 4CT4B 3U6KA 3LXRA 4A4DA 2J7KA 1TEVA 4TMVA 4A36A 1DAIA 3X1DA 2NO6A 3LBHA 4LDJA 1GOTA 5KSPA 3BFKA 1LFDB 4NBSA 1G6OA 1I4TD 2XAUA 4LPSA 4D0LB 3OAAD 3AP2A 1CKEA 1OFUX 1L4YA 2A5GA 2FEMA 2VP2A 2F55A 2ZU6A 3VHXA 2PBRA 2RHDA 1IN7A 1E3MA 1KKMA 1OHHA 4G5QA 3KQUA 1MO4A 3A4LA 2OESA 2J3EA 4C0SA 1HURA 3K9GA 3KXKA 1E9FA 3U7HB 2XZLA 2QAGC 4B2LA 1FW6A 4ITRC 4AKIA 1GSIA 1XZQA 4A0HA 1SVOA 1B23P 1V5WA 2B7BA 3EC1A 1IBRA 3C7KA 4YMVA 1CBUA 2IHYA 3H2YA 3QKSB 5DLQC 3SBDA 3MMPA 5IF9A 4CGZA 2VEDA 3UWOA 3AF3A 2ZI6A 4NYJQ 5AJWA 2KB0A 3TSOA 4ILEA 1N6KA 4O3MA 5CLQA 1XX6A 2OXRA 2ZROA 5CYOA 4AC9A 1N5LA 1YE8A 2XSZA 1XWIA 3RHFA 5L3QA 1A2KC 4E03A 3OFNA 2ZAMA 1JXOA 2GBLA 2WJYA 3ZD6A 2OCBA 3LQRA 3B1WA 4HUQA 5JECA 1KI1A 5JLJA 3I32A 3CZPA 5DHFA 1E2PA 3FHTA 4BUJA 4TMZA 1N25A 4TMXA 2O8CB 1OFIA 1G1MA 1P61B 2JDIA 1JAIA 4GP7A 4HATA 4I99A 4UXHA 2A7QA 2YV5A 2BM0A 2G77B 1OIXA 2IL1A 1F6BA 4POAA 4UQOA 4LGMA 3OHMA 1OH6A 2REXB 4JL5A 1KK0A 1NVVQ 1M1YE 4JT2A 2HT1A 1FNMA 1C1YA 4EKDA 4Z51A 2XX3A 1Z2AA 2R6AA 4N3NA 4YDSA 5DISB 5EE9A 5DSZA 2VQSA 1GDDA 3RSLA 4Q7KA 3QNUA 5A5GA 1DOAA 3M4YA 4GOXA 1BYIA 3PEUA 1OPXA 4IDOA 4P32A 1E2FA 2BCJQ 1ZW6A 2W0SA 3A8TA 1E9AA 3A37A 1XBTA 3A1SA 3BB1A 1Z47A 2QA5A 3NEJA 1P9WA 3QVUA 4XH9B 1T8UA 2FPLA 1E69A 1E2DA 2CE2X 1R7RA 4YMTA 1L2TA 4EQ6A 1A1VA 4JVSB 1E0KA 2HCJB 2OE2A 2RCNA 3M6AA 1ZUHA 3SHFA 1UFQA 1N6LA 2ATXA 5FR2A 5L8VA 1QHSA 3CKLA 2WOOA 3P27A 5BW8A 4QGHA 4P4SB 4C0BA 3AM1A 1YKSA 3QUSA 2WWHA 4HB0A 1VDZA 4MYHA 2D2EA 2HYDA 5EE0A 3EXAA 1EWQA 3K70D 2IT1A 1O3YA 4PHHA 2AFHE 2GHIA 1II8A 5JCPA 2IS2A 3GLFA 1NMZA 2W6IA 2WHXA 2YINC 3B9QA 3S1AA 4B6FA 3VKGA 1Q21A 1JEDA 4FD2A 2V7QD 3OZXA 3SC3A 1R2QA 3AQ4A 4KYUA 3EA5A 2O8EA 3GJ4A 1AK2A 5G3YA 1JAHA 2OLKA 1F2TA 4JT4A 4GSYA 4DCVA 3IPYA 1Z0FA 1ELOA 1X8LA 1E9CA 4D4JA 5IRCD 3QPVA 4R2HA 1ZMXA 5FTJA 4F4CA 5KHOC 5LB4A 1QHYA 2DYKA 2IYRA 3W9YA 2F43A 3U4QA 1LB1B 4FMCF 1AS2A 1QG2A 3EC2A 3IHWA 1U8ZA 3P4XA 1LF5A 4HB4A 5TB5A 3U7EB 2GZDA 3D8BA 2JLQA 1E2MA 4CIDA 2FFAA 2H8KA 3SS8A 4Z1MA 3IUYA 4CEIA 3MD0A 3CF6R 4MDFA 3PVSA 3SOPA 1BYUA 2IX3A 4F92B 4FWIB 3FHOA 1VIYA 3RSOA 2QSZA 3IIJA 4JLAA 2GCNA 1JJVA 1XDBA 2CL0X 1XCMA 3FE2A 3CRMA 4PANA 5SZHB 4BFUA 1N0UA 1P5ZB 4PC6A 5L3SB 5F98A 1DPFA 4FW9A 3ZS9A 1ZUIA 2GCPA 4HUQB 3IBYA 4WZAE 2WJGA 5B64A 1NVXQ 4LBYA 3BAFA 5CJPA 4Q02A 5K8TA 3UATA 4Q18A 2W83A 3CZQA 4IHQA 2FE4A 4O25A 2AFIE 2IXGA 2ZYVX 1Z8FA 4AYXA 2FV8A 4W5JA 4C9BA 3BE4A 4GMXA 2EFEB 3EG5A 1WRBA 2HJGA 3K9NA 1CR4A 1E2KA 2ATVA 5H8WA 1MRSA 2EU8A 2BC9A 2V7QA 1HH4A 2A9KA 4BQSA 3SBEA 3KXIA 3Q72A 3SNHA 1G7SA 3EWAA 2VP6A 1Y63A 3AB3A 1ZM3A 2W2TA 4TL8A 5J5CA 3NH6A 3B78A 3U3KA 2GDJA 1T5LA 2FEOA 1C4OA 4IDNA 2VSOA 4Q9JA 2QGZA 3PQCA 4DDTA 1GITA 4KV9A 3AVWA 721PA 1GRQA 3B60A 4BRUA 2IBMA 3TAUA 3TNFA 1Z07A 1R0WA 3W5JA 1NJFA 4H1UA 5TY0A 1XMIA 3GLGE 3KFVA 4LYHA 4DSUA 4D25A 1CF4A 5SZKB 2NO0A 4BE7B 3L43A 4PSKA 5L3RA 1UBEA 4WAUA 4JLJA 4DEYA 1UBFA 3C16C 1RW4A 1MT0A 4M1TA 4EQ6B 3PITA 2ORWA 3LY5A 3QPWA 2EWVA 4RD3A 1PV4A 2ODWA 1SQ5A 2XITA 1T9HA 3KJGA 2NTYC 4QKQA 4JLOA 1Z6YA 3GJ3A 4B2PA 1CJKC 1TADA 5A4JA 4PHTA 3RC8A 1NIPA 3BXZA 3CX6A 1FP6A 4MYCA 3Q5EA 4EPVA 2VHTA 2CHGA 2XTZA 3QXHA 3ZYCA 5KPDA 1PLLA 2WWYA 2BIFA 1OW3B 2Z4RA 5CK5A 1N6HA 2DFTA 1DG1G 4KVAA 3TW4A 3AF2A 3ICEA 4BASA 3LW8A 5EUQB 1EFCA 4F4JA 1UEIA 2ZRLA 1D9ZA 1EWRA 4GRAA 4B35A 1XCGB 2BWJA 4A1FA 3EARA 1QHXA 3K09C 3JVUA 4TL9A 3LXXA 2A5YB 5J4HA 3UPUA 1Q3TA 3EIEA 3KJEA 4TMTA 4Q9LA 3X1YA 2ZITA 3LX5A 1ZCAA 3LWNA 2IEZA 4HAXA 4ZI3A 1P62B 1XPOA 2OBMA 3NIBA 3MLEA 4WW0A 2IWHA 2ZRAA 1M6NA 1OYWA 4AKEA 2H16A 3N70A 3W8RA 5CM9C 1JXMA 3MWYW 5LB2A 3AVTA 3K9LA 3KQKA 1RVDA 5TXGA 2WJJA 3OIWA 3AKEA 4MRRA 4RCZA 1KMHB 1KAOA 1N3BA 2PZEA 2YZ2A 4JBWA 4HLUC 1NBMA 3D31A 4ZKDA 2W2XA 3W3ZB 2EYUA 4BZXA 4HYYA 5JZVA 3RS5A 3AP1A 3U44B 3QY0A 1A82A 3E5HA 4D2IA 1SKYB 2GK6A 2WJIA 421PA 2CCJA 2G0TA 3QXSA 2NPFA 4QHYA 1PJRA 5D3MA 1KK2A 1BIFA 3B7GA 1QZXA 1KO7A 3N2EA 3FKSA 3PEYA 2FDCA 4LSGA 4IDPA 5FI1B 3QIAA 3TRFA 2OCAA 2GA8A 4PPNA 4C0HA 4BZPA 3DPUA 5KU1A 1F2UB 2F1JA 3CRRA 3DMDA 4KODA 3I8SA 3QKTA 3TSZA 4HLCA 3RS3A 4Y0AA 2XB2A 3QOFA 1N0WA 1W2HA 3VAAA 1WF3A 3SJZA 4DJTA 3THOA 3W8NA 5HKKD 1BO6A 2QP4A 1S9HA 4M9XA 1S1CA 4RJLA 2OG2A 2HEIA 1U9IA 2JAQA 5DHAA 2A30A 3REGA 1FZQA 5JMTA 3G0HA 1WMSA 3H1TA 2PJRA 4JLKA 3FOZA 3U6BA 2J0UB 1Z06A 1DBSA 3A1TA 2XTMA 2OZEA 2G1KA 2V8OA 2F6RA 1ZM9A 1CRQA 3SR0A 4F4IA 4Q4LA 4B48A 4V03A 2UKDA 1W1WA 2J0SA 5FL3A 3RYTC 4JIMA 1TX4B 2ZUDA 3RRMA 3NHBA 2C2HA 1EFUA 1KKLA 1XRJA 4M1SA 4KITB 1GILA 4HB3A 4EPRA 1A7JA 3WP1B 1NMYA 4DSTA 3NWJA 4RFSA 4U02A 4TT3D 4A6PA 4BLOA 5JSZA 4ABYA 1R0XA 1XEFA 3KKNA 2FSGA 5JWOA 1T3LA 2EYQA 4XVQA 2J41A 2XJ4A 3B1XA 1OYYA 4IXNA 3VR2A 4ESHA 4PXAA 4XIGS 1JI0A 5GJCA 4C30A 5C46F 1TQDA 3EW9A 4TYYA 4MDEA 3RS7A 2Q9BA 1E96A 1P2TA 4A8JC 1C9KA 2ZUBA 4DHEA 1YVDA 3FFBA 3DZ8A 2Q6TA 1E2LA 3ND8A 4V0NA 4ZKEA 4NCJA 3OIVA 1KO1A 4LJ7A 2VA8A 4LRWA 4TWZA 1NY6A 1KSGA 2WSSD 4LJ5A 5AWFC 1UKZA 2GJ8A 2R2AA 1U0HC 3VR6A 5HKKA 4NCIA 2E1RA 3WBJA 4GZLA 2ZS9A 3UG6A 2JJ2D 4DC9A 1WXQA 5E7IA 4HDCA 1IN4A 4US2R 1P2SA 2PL3A 2O8BA 3WYGA 4RKFA 5CK4A 5KPJA 4TYWA 3ETLA 3SQWA 1E0AA 1Z28A 3CRQA 1TQ4A 1ZUNB 4AYTA 1CJMA 1DAHA 4G3XA 2H92A 2CNWD 3U3RA 2BMDA 3L8ZA 1S4QA 1QHNA 2WOJA 4JLBA 2DBYA 4BLTA 2YOHA 4HLDA 2ZRIA 1GP2A 3NH9A 2CCKA 2CL7X 5AJXA 3DDCA 3GD7A 1A2BA 4RSGA 4QJ3A 1NLYA 4URXR 5DO9A 3D6TB 4DSOA 1D9XA 4GL2A 3SE0A 2G83A 5DI3A 4D6PA 2Q3MA 5IT5A 4AK9A 3GLGA 1W7AA 1Q0UA 1Q57A 2FPMA 1U98A 2C9YA 3AF4A 3QEOA 3TLXA 2NPIA 1AKYA 1ZP6A 2LKCA 3ZZTA 3ZZ0A 4MUAA 1GL7A 3I4LA 3B82A 4D82A 5B58C 4TTRA 1UM8A 4DLTA 1R8QA 5JJIA 4EJSC 1QG4A 3SFVA 2IW3A 2RKOA 4MQBA 2OT3B 5B57C 1TF5A 2X2FA 5JCZA 4IOLA 4IVPA 1LVGA 3NBXX 1W0JA 3GFOA 5EXXA 1V43A 2W58A 3TW8B 1UF9A 4A15A 1W47A 1NIJA 4NYIQ 4DT1B 4D0NA 2IYQA 1E99A 1SVLA 4C0JA 2Y8EA 1GNRA 2Z83A 3PV0A 4OI0A 1JR6A 2VO1A 2SHKA 4CDGA 4TSFD 2OLJA 5FOUA 3SYKA 2GJAA 1G4UR 1RZ3A 1MABA 2WSSA 2WICA 3BH0A 1N6RA 4OHVA 3A58B 5AUQA 3RRNA 1XEXA 2ORVA 4JYBA 2V55B 2JCSA 1KSFX 1X1RA 5DNYB 4B44A 2BOVA 3UMFA 2GEUA 1X8JA 1E9SA 2OILA 1D2MA 4CRWB 3AF1A 4ZIRA 4W5WA 2JLYA 1TU3A 2QAGA 1E79D 2H5EA 4BFSA 2R8RA 3HR7A 4PSAA 2ZI4A 2BBTA 3PUZA 3GCGA 4G1UC 1T3HA 3O8RA 2J0QA 3U61B 4ARZA 3F0TA 2WWFA 4IDQA 1NN5A 4TL6A 5F9HA 3T12A 1RJ9B 4JL6A 1OXSC 5FTNA 4TZ0A 4Q4JA 5E7JA 3QE0A 2D7CA 2VLIA 2WKQA 1E2IA 2O0HA 4L9SA 2FSFA 2IYSA 1NVWQ 3T1TA 3L82B 1ZU4A 2IWRA 2EFCB 2VRWA 3CR7A 2RB4A 1BMFD 2CBZA 2QAJA 2JJ1D 4C7OB 4X8HA 1P4SA 1CR1A 2QE7A 3BJIC 1KJWA 2CCGA 1IJEA 1G291 2GVDC 1UDXA 3K0FA 2W6JA 5L3VA 3VNVA 5IDVA 2YYZA 4XWAA 3BOSA 1N6OA 1H65A 2MSEB 4Q03A 2JLZA 2WKPA 1OFHA 4LYAA 3AVYA 5IK2D 1AQYA 4N0DA 1NVUQ 3B1ZA 1SXJB 3WBKA 1S1MA 4LV6A 1US8A 1M8PA 1RFLA 2ZJ2A 4GI7A 2OXCA 4JYCA 1XPRA 2QZ4A 2UZ3A 4KFSA 3LLMA 4ASUA 5EP4A 4URYR 2XZPA 1Y3AA 3RWOA 4F93B 4ZV4A 4TSFA 2VHUA 3THYB 2O8BB 3RABA 1SVKA 2RGDA 1G3QA 1KI2A 5LD2C 2FGKA 2ZTSA 4NDZA 5FTMA 1GRRA 3DOFA 3KKQA 2WM9B 3IHLA 4QOSA 5FUXA 2GILA 2NZJA 1ZM2A 2ZR0A 4JZKA 1QHHB 4B3DA 2D2FA 4LHYA 2ZE5A 3TIFA 4WZ6A 2ORIA 4MKIA 2B8WA 1K8RA 4WIAA 3TUZC 2ZXUA 1FOEB 2P6NA 1U8AA 1UJ2A 1ZNZA 1W4BA 5JHHB 3GLIE 4O0MA 2LCFA 4HAVA 4N1AA 1T5IA 4RD1A 2RGAA 1N0VC 3SEAA 2RGBA 4Q00A 2ONJA 1SGWA 1KDOA 2QNRA 4D81A 1KI7A 3ZLJA 2BBOA 2P5TB 1YRAA 3MWLA 2WPDD 3HR8A 1JJ7A 4PHFA 3RC3A 4LJAA 4ZDKA 1KO5A 1E4VA 2PZGA 2VHCA 2QL6A 2IXFA 3QF4B 4LWZA 1FMJA 4B71A 1KMQA 1KNQA 2O8FA 2ZR7A 2PEYA 3BH6A 1XNJA 4OQXA 4XSHA 3DKVA 4Q47A 2ZE8A 1Z63A 4EIWA 4ACAA 1G9XA 2ZRGA 5JJKA 3HDTA 3I1FA 1EGAA 4WVFA 2NOAA 2O8DB 2VL7A 3WRXC 2YWGA 1G20E 3DKPA 5AR1A 1CP2A 1F48A 1K5GA 4Q48A 4MGYR 2IK8A 1XEXB 2R65A 2IYTA 3SJAA 3ZVLA 2AWNA 4QNMA 2CJWA 2OM2A 5FPKA 1XMSA 4PPGA 1II9A 4N0EA 3GLHB 3OIYA 1W49A 4PX9A 4OQLA 1OKKD 1OE0A 4IJMA 4I1SA 4V02A 2PZFA 4HB2A 3BB4A 5DN6D 3MUFA 2C95A 1P72A 2HDNB 2F7SA 3CONA 1IXZA 4Q7JB 3L0OA 4ACBA 1ANKA 3BWDD 2ANBA 2R9VA 1T8TA 2H1LA 3HPQA 2QBYB 4HZIA 4PHGA 2IS6A 3VHLB 2Z0MA 4NKRA 3T1VA 2DHRA 5FBLB 1J99A 1W2GA 2R6GA 2JLXA 3VNUA 4Q01A 5FOXA 2EWWA 4KJZA 2ZJOA 1IN8A 4BGDA 2C5LA 1BKDR 1XTRA 2J45A 1B0UA 2V6IA 5J4KA 4XOIA 3HU1A 1WDTA 2FOLA 2I1VB 1XJCA 5JBQA 3GFTA 4BZQA 4Q1CA 2WTUA 1WA5A 1IONA 3W5IA 4LUCA 5GJVC 1GG2A 2RGEA 3IQXA 2PT5A 5EP1A 4TLEA 2BVNA 2GZHA 3U3MA 1N5KA 4NZYA 1U94A 1JR3D 2MMCA 3O8CA 3EPKA 4M9ZA 3T61A 3OAAA 2P6RA 4WA7A 4B3BA 2JASA 3THWA 1QVRA 4A2PA 4KI0A 1R6BX 4PO9A 1E1RD 2X1VA 3B1VA 1W36B 1EFHA 5TARA 1AA9A 1YJ5A 2NG1A 1ODFA 1GTVA 2QMUA 5GJBA 4WOPA 4F91B 5C1BA 1R5NA 3HJNA 1I2MA 1OT3A 3NG1A 2GNOA 3A1UA 2WIBA 4KO8A 2IYWA 3QKRB 4MYUA 1JECA 2RAPA 1FX0A 4IXMA 5FPHA 5KDOA 3ZVNA 2F9MA 5HPYB 1XD9A 2QENA 3TQFA 1OKKA 1YZNA 2JIZD 3DZDA 4M1OA 4EPWA 2WJHA 4JJZA 3NKVA 2CMKA 4RD4A 5M04A 4UJ5A 2J7PD 3TR0A 2FFQA 1W44A 2Q21A 4MKGA 4U5XA 1ZVQA 4IW3B 1HE8B 3CRVA 3LDAA 3K53A 2ZVPX 4BFTA 1D8TA 2CEAA 4CEHA 3EZ6A 4B75A 3LVQE 4US0R 3E1SA 2GCOA 4RCYA 1AJEA 4IFBA 4BFVA 4DUGD 4IOJA 4ZCMA 1COWD 1DADA 4HDQB 4GFDA 1NP6A 1TF7A 1IQPA 4WXRA 3BRWD 4JBYA 3Q9LA 1P60A 5BYKA 1DEKA 5CM8B 3EPHA 3X2SA 2FWRA 3X1WA 4DLVA 1NLZA 2C98A 2R62A 4PQFA 3IEVA 2OCPA 1DO0A 1G7RA 4KBFA 1JNYA 2XXAA 1GIAA 3MJRA 3PUWA 4JLPA 1G3IA 2IUSA 4IVQA 4NYMQ 1ZNXA 4R98A 2OAQ1 1QHGA 4NMMA 3T15A 4TL7A 2IS1A 4PC3A 4FINA 1Z22A 4PAQA 2PJZA 4CEJA 3TKLA 5JWHA 1Z3IX 4MYTA 1T0JB 4PQRA 3GPLA 2OFXA 2WWGA 3GQBA 5E7MA 2P5SA 2V1UA 4GP6A 1TUIA 2O52A 1SVIA 2JATA 2V1XA 2OO7A 2Z6VA 1W4RA 4QG7A 2Q0HA 2WWIA 1NSTA 2VTKA 4C2TA 3PXGA 4DKXA 2KSQA 4XWKA 4NYJR 4JS0A 5GADl 1P73A 4B33A 1NKTA 3C15C 4HLUA 4LY6A 4UXIA 1TQ6A 5DE3A 2ZR9A 4PO1A 1HA3A 3T1QA 3SYLA 5K8LA 2AR7A 2G6BA 2FZLA 3QJYA 4KSBA 2PLRA 2YVUA 4UNNA 5L3QB 4Q1FA 4S2EA 3AVXA 3AKCA 4PFSA 4Q4HA 4Q4AA 3U2QA 3FMFA 1BS1A 3N5CA 1W46A 2HUPA 3RS4A 1G6HA 3IGFA 3CH5A 3QXCA 2KWIA 1UADA 3F8TA 4PZLA 4AURA 5ELXA 1COWA 1I4DD 1UDWA 1VYUA 2DFKB 3BERA 3CR8A 1G18A 1YR8A 4G5GA 4QBFA 2ZSEA 5DI9A 1FL9A 4HAYA 4UNRA 3VU9A 4AD8A 4GNKA 1H8HD 1KIMA 1XEWX 2H18A 1HE1C 1VYTA 2A78A 2RGXA 3QENA 1IY1A 2XNDD 4MRSA 4U7DA 3DM5A 3CPEA 3ND9A 1NY5A 3EWSA 3VKHA 2YWFA 1XMJA 1T6NA 5FUWA 4OHWA 3LFUA 2NZ8A 2DY1A 4PPQA 4TQAA 2GJSA 3ZDQA 2WWWA 5UKDA 1GL6A 4A0GA 1A4RA 4R2IA 1U0JA 3K0CC 2HLDD 2JLRA 2NO1A 3VKWA 4BFZA 2QG6A 1OJLA 4JLNA 1VCNA 3I92A 3ZVMA 1E9BA 1Z0AA 4XWOA 4ZO4A 1ZC3A 2BM1A 1TL7C 4G5SA 4BRWA 4M9SA 4JLVA 3GEHA 3SYNA 4LJ9A 3SDZA 1X8KA 2P6UA 5EXSA 2FF7A 2QSYA 3SFZA 4OBEA 1OXVA 1KK3A 5AUOB 3X1ZA 1HTWA 1QRAA 2HT6A 4DVGA 3BGWA 4YXWD 2FGJA 1AQUA 5H1YA 4LK2A 1DG3A 4IFEA 2XGJA 4ZCLA 5SZIA 5BWMA 1R10A 2XJ9A 1XP8A 5HTKA 2DPXA 3AUYA 1N5JA 5B2ZA 4URVR 3LRPA 1S0UA 2VIIA 1II8B 3PG5A 3NBZC 3GLFB 3S1AB 1UKYA 1DTSA 4FMBB 4OK5A 1AKEA 4A8JA 1ZD1A 1ZNWA 3Q5DA 4RZ2A 4DLZA 2WWXA 1E9DA 2YNMA 4KLZA 3RS0A 2O8EB 3OESA 1S3GA 2WAYA 3FWYA 4QHSA 1PUIA 1F2TB 1ZYUA 2F3TA 2H17A 1XF9A 3MCAA 4P33A 1OH7A 4OHYA 3FDIA 2BMJA 4TQUS 4D80A 4F7WA 2X8AA 1IN5A 1KDPA 4GOJA 1RC8A 4DIEA 5F3WB 3VMFA 1TAGA 2F43B 2ZRPA 1Q20A 2N1BA 3O8DA 4LJYA 3U4QB 4DB2A 3KB1A 2ERXA 4B3GA 1XTJA 1G5TA 1GNQA 2WKRA 2KBFA 1FNNA 4JKYA 2G3YA 4HZUA 5G41A 3AVOA 3EPLA 1VKJA 4M9QA 4L4UA 2ZRHA 3EIHA 1IN6A 2V3CC 1IY2A 2AWOA 4OK6A 4CEIB 2GXQA 4E22A 2H7VA 2BJVA 3A6PC 1Q1BA 2FJUA 3OEED 1KSHA 4QBHA 4LPKA 1EK0A 1Q1EA 4IOMA 3CPHA 4ON9A 2ONKA 3TGPA 1CULC 1E1QD 2QRZA 3ASZA 3CBQA 3F5FA 4I81A 2IA5A 4Q4AB 6Q21A 1IM2A 2IYYA 3BB3A 4Q7MB 4URUR 4PAMA 4HAWA 1GKYA 2PEZA 3QQ5A 1G5RA 4QBGB 5ANRB 2WAXA 3K9HA 1QHIA 2V54A 3K0EA 5J40A 4YLGA 2EVWX 1R0ZA 1OLOA 4IVRA 3UMRA 1NJGA 3K70B 3ZH9B 1VIAA 1SVSA 4LBWA 4EJSA 1H8ED 4C2UA 5AJVB 1J70A 3MWKA 1HYQA 1NSFA 2ZEJA 1ESNA 1U0LA 2QM8A 1EX7A 4WZBE 2QRNA 5JFGA 1P2VA 1U8YA 3TUJC 3THXA 3PIRA 1ZC4A 4RZ3A 1XXHE 3OEHD 1CJTC 3TMKA 2YC4C 4OQFA 4TYNA 2QTFA 3BD9A 3UK6A 3EZ2A 3P26A 1VMAA 3V00A 2W0MA 4QFMA 5FBRB 4IDHA 3FTQA 2AXPA 1Z0JA 2VP5A 2HXYA 1R8SA 3NDPA 1DELA 3FMPB 1BH2A 1XJQA 2FFHA 4OHXA 4B2IA 3WXMA 2OEPA 2QT0A 4QJ4A 4TMKA 2ODEA 4HI0E 5DH9A 3FVQA 1ZIOA 2AXNA 3WRYC 5LDDC 2VF7A 4H1VA 2DB3A 2P65A 3H84A 4LHWA 3H0KA 5CB8A 2HF8A 4OJKA 4QGAA 4XTCS 4OL0A 3V4RA 1MRNA 1M7HA 5D3QA 3DHWC 5EQTA 2KE5A 4Q9KA 1S96A 1KI8A 2CLSA 4JMPA 2ZETA 2IEYA 4O2RA 4XJXA 1K5DA
chains in the Genus database with same CATH superfamily
1NJ5A 5F64A 1E2NA 1GSHA 3GYBA 2A4KA 1QH1B 2WAOA 4RKQA 3FYUB 4YJ3F 3V5NA 3QXXA 3TOVA 4J75A 2YJNA 5FX2A 1SR8A 2WVJA 3NVDA 1KBZA 3GJQA 4LI3X 3FGNA 4YJFB 3W77A 4NENA 2W70A 4B3FX 3SR3A 1FIUA 1F0YA 3BHIA 5AJZA 2VTVA 3E2IA 3PJFA 5F23A 4F3CA 5AUPB 3BFJA 3F5DA 1I2DA 2JGMA 5DM60 2HV8A 3GJ6A 2D7DA 1DHTA 1M2KA 4BP9A 5FFMA 1YTUA 1GSOA 4FCWA 4NOMA 3KJFA 3KT0A 2V6FA 5ERGB 2MSKA 4CF4A 5LOVA 3AVVA 3UPTA 2I2WA 4IV5A 2J32A 4DIFA 2XIQA 3BXFA 1W9MA 4HF7A 4MYRA 1VKNA 4HZGA 4RPKA 3EXEA 2XRFA 3GGOA 2AK3A 5KNDH 4Z3OA 4D3DA 4YC7A 2BGUA 1MB9A 4N5DA 1GFWA 4Y3UA 1YHNA 3NUGA 1MX5A 3C7CB 4H3KB 4R9NA 4K9QA 3KOXA 1OR8A 2Z08A 4O08A 4BEJA 5LQAA 4BMZA 1EP1B 1R50A 3V8PA 1W5BA 1R6AA 3VJRA 3HFGA 1DDIA 2OCXA 4ZJZA 1Z75A 2BGKA 3QH4A 3MJHA 3ONWA 5L53A 2BH9A 4E5MA 2AFRA 2QZ9A 4JEHA 3SNKA 4AKHA 4LNUA 4UDOA 4MLDA 3SHOA 4HZUB 1HUQA 1ULBA 1QJ4A 2PRSA 4TKUB 4KFRA 1IBKB 5DRYA 1LSOA 1QH8B 1YDEA 1P3JA 3WMGA 4K9SA 4MQMA 4G41A 2JFNA 3ANXA 1H66A 5LA6A 3QTBA 3IT3A 2COEA 4C3ZA 1L7VC 2GYYA 2DZDA 3R6GA 4JQOA 3ZHSA 5CFLA 2G6TA 2JVJA 3ZDYB 1WAMA 3QY9A 2V9PA 3KHSA 3R3SA 3STUA 4IDEA 4RNDB 4C6SA 3TTXA 3LFTA 3A3YA 3N9IA 3WLHA 4B43A 1E66A 1L1EA 4OJMX 3KUCA 4UMDA 3WMFA 3T52A 5JQGB 1XK6A 4MKHA 4I1UA 2HXSA 4EITA 3K05A 2A9OA 2DH5A 4C4TA 4IM7A 1U28C 2NNWB 2VNJA 5J2TF 1YS6A 3DMTC 3PHIA 3SXUB 2ZZNA 3D3WB 1VSVA 16PKA 2ERYA 4JFRA 5EMMA 5CXUA 4LE1A 4MULA 1EFVA 2D3WA 4YMGA 2R44A 4X00A 5FUYA 1QGAA 4H7FA 1G6KA 1I4LD 2FMFA 4KOEC 3H9JA 4OFBA 4EHKA 3UJCA 1LX6A 4OP1A 4LJ4A 2VPPA 3CPSA 4FBLA 4JB0A 1T24A 4RZXA 1MX9A 1GV0A 4JUDX 1YZLA 3ZCSA 1MB4A 4G4SP 3KTAA 4YRCA 2Q1YA 2ZREA 4WSOA 4O2BB 4DANA 5A7FA 5HS6A 5TT0A 1FFAA 3HCDA 5IBRA 1OU4A 2P90A 3KB6A 5DF1A 2A8YA 4OP3A 5K3FB 4DJAA 3AXSA 1PSZA 3P52A 4G01B 5AHXA 5EXPA 5KDDA 2WVHA 5BPHA 5ICFA 1U8XX 2JJ2A 4X1IA 1GM5A 2FPWA 1MV5A 5T4FA 3VMMA 3OIUA 2QORA 1K89A 1H3NA 3KV1A 4RIFA 4EGAA 1LPBB 3EPRA 3TOSA 1MXFA 3MOIA 3PC2A 1MORA 5JYCA 1W36D 2N3ZA 3O3CA 3PNMA 4ZO8A 2IGTA 2XGSA 3O3MB 1X6VA 4BMPB 4F8YA 2CNWA 3P2IA 1DXQA 3R5FA 5HILA 3RS8A 4XDZA 1AQJA 2Q9AA 1A5ZA 3HN6A 1Q7EA 3JXEA 2R96A 2C9OA 2ZUSA 3HVUA 3OZTA 4XQCA 2XI4A 2QQ0A 1A9ZA 1ZZEA 4GLLA 3RANA 3DKIA 4ZVVA 4YRMA 4R8MA 1T29A 1SC6A 3O1HB 2H52A 3JATA 4PGMA 4RFSB 3VOBA 5IT0A 3O4GA 1MH9A 3K71B 1RI5A 4HVAA 2WJ4A 3D3QA 4HGRA 5E4TA 4DIMA 4YI5A 5KTRA 3T9EA 4R69A 1EFRD 5K0SA 2FPKA 3PQ4A 3PXAA 5BOVA 3DE7X 3UQYS 3IKTA 2BBWA 3SOZA 4X65B 4DABA 1U2GA 3OX3A 3DYBA 3A6DA 1GGMA 3A7DA 3ZCVA 1VFPA 3NETA 2WDPA 3N07A 1JR3E 1DAKA 2JH9A 1ATIA 1W5SA 1Y5RA 1XDGA 4ZOQI 4U2EA 1X77A 4C14A 13PKA 1A5TA 2Y05A 1ECLA 3DM9B 3QJGA 1TEXA 2BSQA 5IF3A 3ZDDA 3W3AD 3WL6A 4OHMA 1AKNA 4IQ4A 1FFHA 1GL9B 4CCWA 4H1WA 4JJKA 2BEJA 3NT5A 2A0UA 1JR4A 3ADDA 4TZ6A 1CDZA 2ZIVB 2DBQA 1P7ZA 2BPOA 3A05A 5G2OA 1G3UA 2F9LA 3QOXA 1AURA 1GUYA 1L3IA 1ZGGA 4Q0MA 4WL0A 3ZWWA 4TGLA 3K0AB 3A2LA 1WB9A 4YCJA 3IULA 5JNUA 1TU4A 2QD4A 1YWGO 4G26A 4NZNA 5DGXA 2QMYA 4WZBA 4CMEC 3CT4A 1W88A 3CM0A 4QDJA 3ICQB 2NTEA 3KXDA 1ZDMA 1JKJA 1L7MA 2X19A 4M89A 2IYPA 3H7AA 4BPBA 1XXHA 1O0CA 4IIYA 1PJ4A 4MITA 1X9GA 1ZBQA 2ZUCA 2PL9A 1NA5A 2GAJA 3JYHA 1E79A 5D1HA 3E70C 2A58A 3P9QA 4QEDA 3ORYA 5CW2A 1U63A 5EHIA 1DC4A 4Q1BA 4WJZA 1SCAA 3FOFC 2ZIAA 3EF3A 4P22A 1JQJC 4KGVA 3SF0A 2C4NA 2QTAA 4IMJB 3V32A 3ZQ4A 2DQKA 3T8YA 5J4LA 5LP6B 1MOSA 1FJHA 2PQ0A 2ZAOA 5E6UA 3C6XA 4C3OB 3COPA 4XA8A 6AT1A 1XVTA 3T1NA 5JH7F 4CL3A 1USGA 1W19A 1G8GA 1GKUB 2QW0X 4UUNA 1BTOA 1TJ5A 3DTVB 1BXKA 1SQ0A 1RC0A 2V3WA 3MCTA 2MSDB 3KWFA 3PSHA 1OTHA 4P3XA 5JAPA 2ZRKA 3ACCA 3ETEA 2BP7B 4WUTA 3VAZA 1UZAA 2BGIA 5D7NA 3PCTA 3DFIA 2UVDA 2QXTA 3QUAA 4MPJA 2JJ1A 2TS1A 3CN9A 4X7MA 5D5PA 4ZI7B 5BVHB 4I4LA 3FSGD 4TLBA 3HB5X 2XSZD 5B7PA 3TWOA 1Z82A 1G98A 5L9AA 4YI3A 1MVOA 1CK4A 1U04A 2V6JA 4L4YA 2QTMA 1YC2A 2GWHA 3AU9A 3Q7QA 4G9BA 1QX3A 3QPBA 2JIPA 3C3BA 4O2AB 4RORA 4RV5A 5IZ4A 1M74A 3HU2A 1EUDB 3IIMA 4N8SA 2P9EA 5IK2A 3VR3A 2I0FA 4LVNA 4EB0A 2Z3ZA 4RD2A 1O9HA 1VIDA 4WKNA 5EINA 3E18A 1NOJA 1YE5A 5TDHA 1X15A 2CL6X 3V8QA 2MYUA 1NZDA 3JQ7B 3QG1A 4YP6A 1TCAA 5AM2A 2VYND 3A4MA 1NQTA 3VX4A 5K2OA 1Y8ZA 4MV5A 3W6OA 3Q8MA 4H0CA 3FDZA 2Z4SA 1GPMA 3NBYC 4JUBA 5EKSA 2X3YA 2GZ1A 1EWTA 4IF4A 4UDXX 4AF8A 1MC8A 4LZZA 4OXQA 4ZIRB 1Z13A 3GMTA 1U3WA 3ZQ6A 3SY8A 2NZWA 2PXXA 4HADA 1Q15A 4Z9YA 5K3AA 4EHDA 1PK7A 3VZPA 4PZ9A 3O31A 5AVWA 2MTBA 5KNBD 3KSAC 3R9XA 4B84A 3UTDA 5JS8A 1CQJB 5BSUA 3O2NA 2X8JA 1UBOS 2C7VA 1TIBA 1OXKB 2GHRA 4L5CA 3TUIC 5JDIA 1TIPA 1PWZA 2KQUA 3NUQA 1C3XA 3NIFB 4EVIA 3ZCXA 3NB0A 3TQCA 1EP9A 2J3QA 3A3OA 4LRUA 3NZEA 2OYRA 3V1KA 4PZPA 2QQ5A 4WDQA 3WK7A 1FS5A 1JSXA 2WYUA 4DRZA 3TOCA 2XUFA 2JGIA 4Q4JB 2VSXA 3P1JA 1O77A 2X14A 1IJFA 4Z7OB 1NOKA 2OFOA 4PZZA 1QC5B 2QW8A 1Q0TA 3ZV6A 3IOEA 1P5FA 2FEKA 4A82A 1G9TA 4HJXA 3L0IB 3CZ5A 2VHQA 3EMDA 1VL1A 4MUNA 1PW5A 2WF7A 4GMGA 1TNDA 1MCZA 4XARA 1XNHA 4WLNA 3UAZA 3IFSA 2O23A 3EGDB 3LY9A 4IFIA 4MCAA 1QO0D 4U7HA 4EYGA 3RU9A 1SURA 1M66A 4RPGA 3BFXA 3TTTA 1FP2A 4DR1B 2XB8A 4FCCA 5CU7A 1L8LA 2HZBA 3KC2A 2R68A 4TN1A 1LY1A 4DLPA 4BXOA 3HXLA 4HNAB 5EVCA 3L40A 4GM1A 3ZV7A 3SN6A 2WMOB 5B12A 1LTQA 3H13A 3DDZX 4MX8A 1US8B 3ABQB 2OBLA 4RV4A 1AK9A 1XZKA 4F9TA 1FUIA 4NATA 1QDEA 1GSAA 3FVVA 4M0KA 5IAOA 4JUFA 1L5WA 4FFVA 1ATZA 4U3JA 3R4VA 1WBDA 2ZSFA 1K4MA 3SQLA 2W93A 2DCMA 4D26A 1N2OA 4JLDA 1J39A 1H3FA 4GX0A 4NS1A 4MPDA 2CXPA 4CT0A 2XUHA 3AR2A 3HWSA 3H8VA 5FI3A 3ANMA 3WKBA 3ILYA 3PI6A 3ZW8A 1JQ3A 5JBNA 4FKZA 3B9RA 5EZYA 4JVOA 3K0CA 2F48A 1JFRA 1H4TA 2EZTA 3AUAA 3AW9A 2I7VA 2H4ZA 4GBGA 4L57A 4MI1A 1UXJA 2YXDA 4DLWA 1E1YA 1QFSA 3RSHA 1KPIA 4Q15A 5EJEA 1NSYA 1DIAA 4WE3A 5ALGA 1Z34A 4KYIB 4CQNA 1IY9A 5HCIA 3GMIA 1L6RA 4YYEA 3HI4A 5JEEA 1X7DA 1A0OA 3LNCA 3NKLA 1G17A 1U5AA 3GROA 1ADCA 4BNMA 4L2IA 4M53A 1FYVA 2HSGA 4QL3A 3VPDA 3RAFC 4ZP1A 5C4GB 4MVJF 1N9KA 4FN5A 3SQOA 4MEAA 5WRFA 4GBED 4MR7A 3AH8A 2HTEA 2MSLA 3L8EA 3T4XA 5CITA 1E32A 4ZT7A 1JTFA 1AUQA 3WYCA 4BECA 5KWVA 1W34A 2AKEA 2OBFA 2OC9A 3QEAZ 2EJCA 3E61A 3BK7A 3O47A 1ZI6A 1T5HX 2V58A 3TL3A 1ADBA 2DFPA 5C8YA 5FOQA 2UYYA 5E2BA 4B5KA 3HXKA 2OGSA 1OBVA 4NU0A 2QTCA 4L5AA 2FUG6 3JYQA 2Z9BA 1BE8A 3VSDA 2UUPA 1SBZA 2FNAA 3C98A 3D9QX 3WYEA 4C1NA 5TIIA 2X9LA 1LD3A 1D09A 4G5YA 3IEXA 4X61A 1LJLA 1G5IA 1H2RS 1T2VA 2BKUA 5KNBH 2I9KA 3C43A 1P1BA 1WUHS 4GKJB 3BCHA 4WNIA 3LXMA 4UBIA 3ZGXA 4Z4CA 1R64A 4TVBA 1V3TA 2VHZA 1IWPB 2VHJA 4WCFA 3AGPA 3AW8A 4X5OA 1A9YA 3DOUA 4FILA 4TN5A 3UJAA 1XZPA 2PANA 3D6FA 3KKPA 3CZ4A 4OA8A 5KYVA 4XLZA 4UOEA 2GGSA 1PZNA 3FAKA 5I47A 2CJWB 2VYFA 4HRXA 4ITUA 4ZAZA 1HQCA 1YZTA 2Q5IA 1L5OA 5CDFA 3SICE 1FP4B 2G0NA 5K8IA 2AJDA 1RJDA 2AYYA 2GFIA 1JYFA 3DBRA 4CKXA 4BMNA 2AN9A 4UFOA 5KOJB 1E5DA 2PD3A 3QX9A 2QVGA 2YYSA 3HZRA 5CDTA 2PBLA 1HEYA 1SC3A 2ANCA 1KI6B 3BL6A 1G3MA 3H4IA 3V2IA 3WNDA 3QLJA 2BF7A 2PX8A 3DS8A 3ID6C 3IXLA 3T1OA 5IHPA 4F1WA 1P45A 2AVNA 2Y0BA 4Y2PA 3DT8A 2JIZA 4NP6A 5AK4A 1TT5A 4ZV9A 3T7EA 5C2JB 2GASA 3ZQKA 5CFMA 5F7XA 1NT4A 1T2FA 1QCZA 4NK4A 1HWYA 3NCHA 4QNRA 3OE7D 2WBLC 3DZFA 3ICOA 1IEQA 4D43A 1M7GA 3EEBA 1CUGA 4KXVA 3M6IA 3WGGA 4HMQA 2FW1A 4JITA 5EJIA 3JAKA 1N5IA 1KK1A 1CUDA 5HE9A 5ALVA 1LJ8A 2C61A 3JQ8B 2E1PA 4QJ5A 4PVCA 2NO9A 1SG9A 5TLSA 4UTPA 2VYVD 2EBWA 4JL8A 4TYPA 2AG0A 1TM7E 4S24A 4LRQA 3MFQA 4AZ3B 3N2LA 2B8JA 1DX4A 1WHTB 3PYLA 2PR7A 3QVMA 3WFZA 4CTKA 1DAOA 1E3TA 1XD8A 2OKCA 3I39X 2GTHA 3LQ4A 4PTLA 3TRHA 3VX3A 1T15A 3LUFA 3JX9A 2A92A 4EMSA 2BKEA 2JH3A 3B5JA 2ZI3A 3LUPA 3N8DA 4PNHA 1I9CA 4WXYB 3CVVA 2X77A 1ZINA 2WWRA 2XTAA 3ZHUA 3QUQA 1GU0A 1S2IA 3IJRA 1KDZA 2VPYA 3DR5A 1KWGA 5LMNB 1QCCA 2EXXA 4HTAA 4LNHA 4WXPA 1JLRA 2OFWA 1Y8RA 3AGQA 4AJNA 3ZZUA 4NXMB 1UT5A 4A0RA 4HVCA 1JQKA 2VP4A 3D6VA 2FE1A 1P7VA 1XA0A 2AJCA 3IUJA 3RFFA 3P32A 3ZV4A 3AL3A 4IHJB 1KYIA 1QR2A 8GPBA 1NULA 1JSCA 3QHPA 1NW8A 1EJ0A 2ICAA 3DD5A 2H0RA 5EE5B 2IYUA 2NU9A 3PR1A 4MV0A 1FX0B 4W99A 3HYSA 4HN4B 4DA0A 3S2SA 2IOFA 1EBFA 3F1LA 2GLUA 2G1UA 5I9TA 3RU2A 3CZAA 1SHZA 2FI1A 1E8DA 3P20A 4QGSA 4MW6A 1IY0A 2FQYA 2PCJA 4ZHSA 4BCBA 4HSEA 1HDYA 4B6EA 5FLKA 1FTYA 3QSYA 5ALHA 1Y8QB 1OIVA 1XTIA 2J87A 3KZ1E 5ER6A 1PJ8A 4LZPA 2AN1A 4IRMA 4WQMA 3REQB 4CN8A 1JIVA 3AL0C 4JYAB 1E8MA 1XEWY 2IUUA 3FROA 4CEHB 4W7HA 2GBPA 1NL3A 2QQEA 4US1R 5IX8A 1PJ3A 1ZZGA 5IPFA 1KF0A 1EA5A 2GNPA 3AU8A 3ELBA 3MF4A 4OI4A 4Z2AA 1NBMD 3KQLA 2P6OA 1USIA 4LX8A 1XTTA 4ZT3A 2ZPAA 1P3Y1 3K3PA 3FKQA 4WBNA 5CXQA 3L92A 4QTUB 3I1JA 3VH3A 1NMXA 3EFEA 2ZCVA 2QS9A 4AI6A 3AKDA 4UAVA 3OQIA 4G5XA 2Z5FA 2XT0A 5L51A 3GF4A 2IIVA 3FKSD 4KE7A 1N8NA 4Z8YA 1XKQA 4BBPA 1II0A 1SG6A 2GKSA 3ZCUA 1NLFA 4WNAA 4IO1A 4Y9TA 3B1FA 2PLFA 3DEFA 1NG1A 4O4LA 1R5OA 4P4GA 2JGNA 2NX2A 3IH5A 1IBSA 4V24A 4GPBA 3WL8A 4ZMRA 2FU5C 1USWA 1Z45A 3W7AA 1NNI1 1PBTA 1QGZA 2ZUUA 3MFYA 3R6TA 3PZBA 5CLGA 4IGEA 5D00A 3FUTA 1S7CA 3GRVA 3JVEA 5A3VA 4BWGA 1PX0A 3CW9A 4IY1A 4RTPA 2H29A 4IJVA 3GLHE 1U3CA 1ITZA 4JC4A 2QP9X 3PUKA 3V1YA 1GCOA 1KSJA 1HOTA 1U90A 4MGIR 2I4IA 3PNOA 2PS1A 4JJEA 3GVHA 2J59A 4LC1A 5CXXA 4GI3A 1LZLA 2YWRA 4LDQA 4GX5A 4IUCS 2DAPA 3K2QA 2VBFA 5T3UA 1VBNA 4CF6A 2Q2WA 4PNZA 2ORED 4X64B 5KJ6A 5KYWB 4PG5A 5JZ9A 2XYRA 3H17A 2NTNA 4K9NA 4Y2GA 4CKCA 5C8VA 5G0TA 5JD4A 1NUSA 3TIIA 2YCLA 5BN3A 1Q5PA 5AKLA 4N0MA 2BM8A 2JLVA 1Y1TA 4MV6A 2CLDX 3MGCA 1Q7RA 1GRVA 3II6X 2FLKA 3KUDA 4QXAA 2GAFA 1THMA 1I0LA 1Q12A 1T3GA 3MUEA 1QV7A 3LF1A 4YT5A 2H4FA 2XNKA 1TJYA 3UMCA 1KGDA 4HWSA 1NVAA 3PQ2A 4TLAA 3IV6A 4OXNA 4ZVTA 4ARUA 1F06A 3LOPA 1EM8A 5E8JA 3CCBA 4ALMA 1SCIA 3MAAC 1RHUA 3IRVA 5FP0A 3UJ3X 5DEIA 4M7RA 1D04A 1PNRA 4CFZA 2HIMA 1AS3A 1LRJA 1R9NA 1WXHA 3OLWA 3QEMB 4I50B 3GLIB 1ZMRA 4BTVA 1KE1A 4UNQA 1Z9BA 3VU9B 2Y1CA 2DWQA 5DHSA 5LVAA 1AA6A 1T3TA 3N2KB 2YX1A 4TTSA 3U3ZA 5BQFA 2I33A 4HFRA 2CT8A 1KEZA 4Z4FA 2CJXA 3K15A 2ZJZA 1T5BA 4J0QA 4YRLA 2GN1A 2QF7A 2Y1EA 3H2BA 2PGOA 3KZNA 1YA4A 1UC5B 3U4AA 4D8VA 3WKAA 2QRJA 2P68A 2CEKA 2P7IA 1DS6A 3EUWA 3L8CA 2W98A 3VI4B 4CMHA 1SXJD 4W9MC 5C53B 1FYEA 3CNHA 2DWPA 4TKLA 4UREA 1CUBA 1RWBA 4B4OA 2X9NA 2FW9A 4HT3B 3JWGA 1R5BA 2MWMA 2IDKA 4QAQA 4YT4A 3THSA 1AQ6A 1YJ8A 3CT6A 3JQDA 1TVKB 1KYZA 4RHUA 5E7QA 5FTKA 3U9TA 5E95A 5FUVA 3T7AA 3TAHA 3MRSA 1QDLB 4KUHA 4A27A 4QIHA 7REQA 4KLCA 2PR2A 4M21A 4WLOA 4H9GA 4KUEA 5B1DA 4G24A 2WVGA 1ZUD1 3PP8A 1K7FB 1XMVA 4K6MA 5T3YA 4E0BA 2GM3A 5AM4A 1P2UA 5K3SA 1XAJA 2FWNA 3ESDA 2X0KA 1RBYA 3PC8C 5I9MA 4BBAA 3KXLA 3OEEA 1BC5A 1Z2CA 4KQJA 1NDQA 4QPCA 3F4KA 2Y3IA 4YJ2A 4YCBA 1DKQA 4N48A 4W8HA 4H0NA 4BDSA 5CEFA 3B85A 4KR2A 2I2FA 2GRJA 3OPVA 3AB7A 2OD2A 4YCDA 1U99A 4KN9S 4RWZA 1HM5A 2MINA 3A9UA 2ZLBA 4BAZA 3MILA 1U3FA 2I2AA 3NNNA 3DDWA 3OC6A 2GZAA 4D9GA 2AGVA 2YN4A 5DOVA 3RC9A 3X43A 4A7PA 1TW3A 2LNDA 4D4MA 1XMPA 3FGPA 5CDHA 4BLSA 1Z7WA 4FBMA 3FFXA 3PNKA 4JUCA 4YRPA 3T5GA 4A8JB 1UPUA 1GQRA 1WW8A 1IQUA 1QVAA 3D5EA 2R47A 3NDRA 2BFNA 2LDBA 3FYUC 3NRBA 4TT8A 1I7SB 1BCRA 2XZTA 4DV1B 7AT1A 3FF1A 1YDFA 1UIMA 3DE0X 1TVEA 4YDHB 4K3UA 4DDKA 4QJBA 4UM8B 1FJXA 1Y3HA 3I8XA 1MD9A 2XOKD 2BV3A 3NWOA 1NN1A 5EQDA 3QWBA 3L8FA 1ZH4A 5EXTA 1T2NA 3M2PA 1KZGB 1Q6ZA 3BWMA 3BMCB 3BXOA 1XTKA 4CQMA 5JCOA 1L0BA 4BO2A 4S0ZA 1Z37A 3FBTA 3CUVA 4AP5A 3TO5A 1EINA 2B21A 3O3NB 1PBNA 5JRJA 4DLUA 1FPQA 3DEYX 2JCXA 3QRWA 3I52A 1IM8A 5EPUA 3IO3A 4TUYF 2NVWA 4RQUA 2YVQA 1TCBA 4R1QA 4I19A 3I6IA 5CBKA 5LQCA 4G2NA 5IBPA 5IYZF 1VC2A 1QAQA 1ZVKA 3M9WA 3IKMB 4V2IA 1XWFA 5E4JA 1GGHA 3WL3A 1C0PA 2VQ6A 1DAPA 2JJYA 1G41A 3G9QA 3THYA 2Q0QA 4BWFB 2CF6A 2ECQA 4QZVA 2OA0A 5F2KA 1J90A 1JHMA 5HBRA 3OU2A 2F59A 1P77A 2PLAA 3IIKA 3BXPA 4P7FA 2H3HA 4UEWA 5EUMA 3GT0A 3VJKA 1PJCA 3LO5A 3I01A 4BLWA 5EJ2A 1M0EA 3S8MA 1QHHA 1SJ9A 1BCSB 3BXGA 4YCLA 3H5VA 1GR0A 2DGDA 4A6EA 1FFDA 3S5JA 3SQDA 3WGVA 1YR1A 1YHYA 3U60B 3SZLA 1IHUA 3CLSC 3M6XA 4U00A 1KMNA 2WE8A 5G1OA 1Q50A 3KFXA 2W2KB 2BH2A 3MS7A 5BR1A 1AV6A 4I3FA 2F64A 1YMQA 1JHZA 1OPRA 2PG3A 4OGKA 2QLLA 4E5SA 1G4HA 1SXHA 4MP3A 2IYVA 1EA7A 2PSDA 1TKBA 4FCVA 4M8NE 4X3PA 1XZIA 3EWNA 3TB4A 1E0DA 1N2HA 1H94A 1QVVA 4A1OA 1EDZA 2EWMA 1DC5A 1Q44A 2G06A 3RUFA 3A04A 2VHEA 1TYAE 2Q50A 4REMA 2FG7C 3R1IA 2TMGA 1PZFA 5AI9A 4LK3A 3TNLA 4BFWA 1SCQA 2C7QA 3HJTA 4EEKA 1JG6A 4H1HA 1NKSA 4LQLA 1CX9B 4TRJA 3OQHA 3WWDA 3A27A 3CX8A 2QMHA 3G1UA 4IXTA 1M5UA 4XYMA 2GKGA 4ASUD 2UZ1A 4HH0A 1XAHA 3HTXA 3R40A 1RCUA 1NUPA 1RYNA 4MGEA 1A4XA 1RP7A 4FNGA 4O4IF 4KLNA 2J3MA 1YACA 1Y9EA 3K6JA 4M99A 2JIQA 5BORA 3RYFB 2QL9A 5J2UA 3B9PA 3AERB 4MQLA 1NPYA 3TZQA 4FIDA 5LLDA 4WNCA 4P3PA 3IV7A 2JRCA 4HXGA 5JAMA 4PLCA 4BZZA 1HI9A 3FAZA 4DV2B 1U6IA 1SBCA 2BMAA 2JFXA 2OHGA 2QPOA 3DW1X 3O8BA 3PKJA 4L28A 3ASVA 4OEHA 1M2HA 1KZ1A 1JI3A 4CI9A 2QRPA 3B48A 1T43A 1QP8A 3PKIA 5EZ6B 3R7NA 4KQHA 1YCHA 1QYDA 1X74A 2FZ5A 3I73A 4M0UA 5I4KA 3GZ4A 3GJXC 1OTYA 2N75A 3I72A 1GPAA 1KQOA 4NENB 1B3RA 3D54D 2C5GA 2J6BA 5EGSA 5E3IA 3A70A 3VYTB 2ATEA 4OQNA 1TJNA 2UUBB 1HFWA 4PRLA 4RYDA 4ZREA 4CMAA 2B36A 1NUUA 1CZKA 1Y3IA 3GLFE 3HBFA 4X54A 3PCXA 1HY3A 3A6FA 1GWNA 3NBKA 4MKFA 1ZEJA 2GLTA 4OLAA 1V1RA 5LOVB 1HTBA 4C4OA 2EX4A 3ZQJA 5DULA 5EL0A 2ZS8A 5IU6A 3QLEA 1Z83A 1NRJB 2AMYA 3DB2A 3EXEB 1WCYA 1P1IA 1I3KA 3L6EA 1QWSA 1PKEA 1QVWA 4L4RA 4RKWA 5G53C 3DAYA 2C99A 4Z3KA 1CP3A 4ZQEA 4IJQA 5IVDA 2YIVX 2FMTA 4ZI7F 1NRXA 2PMKA 4F9EA 3JQFC 1C9YA 1UPFA 1KJQA 1SD1A 3MTQA 1IZ0A 4CDRA 1RLOA 2QMOA 2PUBA 3I3SR 1PVOA 3IIIA 2QX9A 4C4SA 3EASA 3P9RA 1XJ0A 3CB4A 1EK1A 1R0KA 5LMZA 5KYXA 4LNUB 4LYJA 4PV7A 2VZLA 4AKSA 4Q6WA 1FU4A 1QFJA 3VNQA 3ZKWB 4F6LA 1YBMA 3FB4A 4N01A 1ZMTA 2J46A 2ZYDA 2JFYA 3T95A 5GVRA 4EFLA 4L73A 4ME6A 5LA6B 3T9FA 3VSCA 5CYGA 4KCGA 2HADA 3F6SA 3ICCA 3IDAA 5DW3A 3I2KA 1UMBA 3EPJA 2CHVA 1I6LA 3CEMA 1KL7A 4IEIA 4HNQA 3V1UA 4TLMB 3NV7A 3U19A 1SBNE 1K88A 1H4SA 5F1PA 4BMYA 3LQFA 2IF0A 4QA9A 1E1DA 2FQ1A 2YCBA 2REBA 3AK4A 3D1VA 3MQ2A 3IQFA 4KMMA 1EFRA 3FNEA 2EV9A 4ZT5A 3BDVA 3SIXA 4PO8A 1W87A 2J3JA 5LP6C 4EGFA 4FT4A 1GPNA 3RGWS 4NYIR 3QVOA 3VO9A 5HA5A 3ZV5A 3ZXYA 1MKYA 1EFVB 3I6YA 4W82A 2ZXEA 2V8BA 2BISA 3E22A 3MLBA 4ESVA 3R0VA 4LECA 2HHLA 4RVGA 5LQNA 3Q3GE 1R8YA 3NALA 4J4TA 4PC2A 5KUTA 2ZIGA 3GD5A 3AYXB 3HGMA 2YBEA 2W2OA 5HQTA 2EFHB 5CFRA 3ZYZA 2VPXA 1FS6A 4YB8A 1VYVA 4Z4QA 2A84A 1HNNA 1OXTA 5F9FA 2AKAB 3HFJA 3U6KA 2GEVA 5EWLA 1Y7HA 3GRRA 4TMVA 1Z18A 2HD4A 3BZUA 3CMCO 5FA6A 3VNSA 5AVUA 2NSDA 3B70A 2VDPB 2NW6A 1LFDB 4DNXA 4X1IB 2X0DA 4NBSA 3BM5A 3H18A 3UMBA 2CFIA 4D0LB 5AKEA 1ISJA 1D2GA 1OFUX 4PLZA 2WD7A 1B3BA 3CUUA 4E6EA 1CDEA 4II3A 2JGFA 5DTIA 4DDHA 2F55A 2JAUA 3Q3VA 1E6EA 1TK2A 2GPAA 2FZKA 4FFBB 3QELA 1GNLA 4LN1A 2CLLB 2WTBA 2PJDA 1A8SA 4C0SA 1I10A 2QRLA 2WP0A 3G5TA 5CNKA 3WLEA 4I4TA 2PUEA 3KXKA 1E9FA 4YALA 2H7XA 3JATB 5AVXA 4BX3A 2UUOA 5JBIA 3W5CA 3IP6A 2RH9B 4A0HA 1PFQA 3DMFA 4TV9A 2WJ3A 4RK0A 2HHCA 2JFZA 2Q4TA 4E5KA 3EC1A 3JAMA 4U2DA 2IHYA 3H2YA 3SBDA 4OY3A 5A5EA 5LM3A 1N32B 1Q74A 2WFLA 5C32A 3UWOA 4WMLA 1A5SB 3H11A 3AF3A 1K7SN 1UZLA 3AUFA 1GPBA 4WY5A 2OECA 3INNA 4PFJA 4QDZA 5EHNA 1N6KA 3GVPA 4Y1FA 2ZROA 4IKOA 5CYOA 4DMUB 1P0PA 1N36B 3JVDA 1U3UA 5FTWA 1M34A 1SC1A 1E77A 5HOEA 1C7EA 2XGGA 3FSGA 4C43A 2UUCB 2XSZA 1X1TA 3FZEA 4FFDA 3AF6A 3OFNA 5AT1A 2ZAMA 4DW8A 4EGSA 3ZD6A 3U0VA 1GQSA 2OCBA 2Y1LA 4HUQA 3CEHA 1TIKA 1KI1A 4UCFA 1T8YA 4QQ8A 4ZAWA 3TI9A 1J0CA 4Q16A 5K6TA 3WGIA 1P61B 1U8FO 2C31A 2KMLA 1JAIA 1WB4A 1XR3A 4D99A 1SOMA 4HLNA 2VYNA 1P9OA 4UXHA 4FB5A 1A8PA 1M83A 4WZBB 3EVZA 1R1DA 2BM0A 4TTIA 2G77B 1E7WA 1OIXA 1W88B 2A33A 3BA1A 4TXJA 4UQOA 1VB5A 4LGMA 5HG0A 1TAQA 4TRNA 3A6KA 3R0JA 4I5GA 4B0PA 2FEWB 4E5PA 2O7NA 2QT9A 4H6WA 1E60A 4Q6BA 4UUPA 1SAYA 2IBTA 4IIVA 1N9GA 1C1YA 3JZIA 4DWWA 5JQGF 4EKDA 5COAA 1O1YA 3MD9A 2AF4C 3H42B 4B0OA 2P2GA 4ZOLA 1DEXA 1SXGA 5EKTA 5CA0A 4YDSA 1IIRA 5E6UB 1OA0A 5EE9A 3RVJA 5ADVA 5LQUA 3UMMA 2VQSA 1NBEA 3EQZA 4H7IA 3QBEA 3RSLA 5IVPA 1DOAA 3K5PA 3M4YA 1BYIA 3A9SA 5HF5A 5I3CA 3O8QA 1C41A 3ZR4B 1E2FA 1OXMA 3JRNA 4BV2A 3ZW7A 3ELDA 1S3IA 1ODTC 5HUHA 2FW0A 3NEJA 2FPLA 1E2DA 2CE2X 4JR2A 2H1FA 2P3LA 1I9GA 4JVSB 4O2BF 3LTNC 4PIPA 2OE2A 1QO0A 3BMNA 2E7ZA 2JB9A 3FUVA 4IHAA 4XPZA 2ATXA 4BOYA 4LCJA 4CU2A 1CVRA 1QHSA 3FOEC 3VBCA 1YKSA 1OAOC 1SBQA 2WWHA 5E38A 2I1LA 2POQX 1VDZA 2I3DA 2D2EA 1VA4A 2YY5A 3DV0A 4GDMA 3ELUA 4PTYA 2RI1A 4W5NA 2ZCUA 3EXAA 2DECA 3OWXA 4QREA 5AKHA 3K70D 1H2HA 2D0DA 4GKBA 3PTLA 3FDXA 1CY6A 4KH1A 3DL4A 1E3JA 1S2OA 3GT7A 4RTNA 2IS2A 4D57A 3B9QA 1NV8A 1JQAA 2YXEA 3S1AA 2ZSUA 2GPBA 1LTKA 2OO3A 5TRTA 3R41A 3VYSB 1LLDA 2V7QD 5DX0A 5F21A 2P2CA 3SC3A 1JXAA 2H2DA 2H59A 4JD5A 1OFUA 4IDAA 1L7PA 3RVDA 4YPVA 2O8EA 3GJ4A 2B69A 3MSCA 3H5LA 1JAHA 5A06A 2QG4A 4S0XA 1XPJA 3SQNA 2XUJA 3UT6A 3DMPA 3T5AA 1ZJZA 3R9XB 4JT4A 2ST1A 2X8JB 4HDSA 3TKYA 2FPGA 5FLEX 4ARAA 4DCCA 3IAEA 2HMWA 1Z0FA 1X8LA 4GPZA 1UDRA 1E9CA 1XK7A 4D4JA 5BURA 1NBOA 3FIJA 4XJTA 3ZK7A 3FWHA 5J5VA 1BH6A 1C7FA 1Y1LA 3GRCA 2A4MA 1ZMXA 3GAAA 4NAUA 3C5VA 3H1GA 5AW5A 3RUCA 1FJGB 4P7GA 1QHYA 1O94C 3W9YA 1JEOA 2F43A 4EP1A 3D6JA 3EZXA 2D1SA 4C0WA 1R3DA 3ZZMA 4TXLA 2OCLA 4FXOA 4YREA 4BB9A 2GZDA 3OT4A 2JIRA 2JNWA 4CIDA 5ARBA 3BD6A 3MTJA 2FFAA 3G13A 4LZJA 3HSKA 4D92A 3ZDXB 1RYMA 2WMDA 4HNHA 4F60A 4NDAA 2H5JA 1Q16A 3ZCRA 2EZ8A 3C3KA 4QXOA 4PICA 1UH5A 4L7QA 2QD2A 4QOEA 2I6TA 3HWX1 2WUVA 1Z25A 2A0KA 4FQ7A 5EAIA 2CMFA 1KPHA 3CLHA 2QSZA 3AFHA 4JLAA 5C4IA 2GCNA 4BXOB 5BOSA 1CZRA 3CRMA 1NMQA 4IV0A 4PANA 1P5ZB 2CHUA 2C9MA 4QICA 4BX8A 1MT3A 1R0CA 3HJRA 1PEKE 3BCRA 3CUKA 1QIJA 5CB4F 5BUSA 5CJPA 3BAFA 4BZWA 2FOIA 2ZGVA 4KR9A 1CF9A 1F1JA 5K8TA 5LQMA 4IHQA 3ZGNA 1UMDA 5CLHA 2R1ZA 2VQEB 1B0AA 3T99A 1DRKA 1V9SA 4J7UA 4W5JA 5CVEA 2H2WA 3FZYA 1P81A 3EG5A 4GMXA 5D5HA 2HJGA 5JPDA 5HRCA 1VKOA 4YRJA 1SPBS 3MTGA 1ZSNA 3GRFA 2QYHA 4A16A 4DSZA 3HSSA 1QYXA 2B4TO 4WASA 2A9KA 3MBIA 3ZLTA 4FIZA 1BRMA 2COUA 4BQSA 1Z5OA 2VH2A 2H1RA 4P3OA 5DP2A 2ZRQA 5EXDA 3SNHA 2ACEA 5FAKA 3IR6A 5I6DA 1Q0SA 1H4VB 3OQNA 3EWAA 1K08A 1N0HA 3UK0A 5E1MA 1PSWA 3DAOA 3TZLA 1HDEA 3DPIA 2GDJA 4W1SA 2FP4A 4L2IB 1O54A 3AQIA 3O4FA 4KN6A 1E63A 4IDNA 1TQ8A 1UR5A 1VZ3A 1U0OC 3OUTA 3TDMA 3WZ2A 1GITA 3FBGA 3EZYA 3V7FA 1RM0A 2V4MA 3M1LA 4MR7B