1JAIA

H-ras p21 protein mutant g12p, complexed with guanosine-5'-[beta,gamma-methylene] triphosphate and manganese
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAPGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-HA-RAS
publication title The role of the metal ion in the p21ras catalysed GTP-hydrolysis: Mn2+ versus Mg2+.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp-binding
total genus 63
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1996-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1jaiA00
1P3JA 1OFUX 3B60A 4P4UA 3TR5A 1QHYA 4XTRA 5FTKA 1R6BX 5EZ6B 1U8YA 2I1VB 2QTFA 2EFHB 3HU3A 2XX3A 4LBYA 4AC9A 4NPHA 4D4LA 4EPTA 2GKSA 4IDQA 1XEWY 1C4OA 1XMVA 2OCYC 3FGNA 4CEJA 2CCGA 3CNOA 3LWNA 3ZZ0A 2GAOA 5FOWA 2X77A 4MKHA 3RNLA 5SZKB 4JLKA 3U4QB 5FBWB 3EARA 1IQPA 2YYZA 4JL6A 2C99A 2IXGA 4DDVA 3AQ4A 3AVUA 1JR6A 4E09A 2O0KA 3KZ1E 4C0QC 2C9OA 1KY2A 1E32A 1UKZA 5J4HA 2ZS8A 3OAAD 4FCWA 3KFXA 3DM9B 4KODA 3CRQA 1R7RA 4XH9B 3LXXA 4OQFA 2ZUBA 4G5OA 1XP8A 1NLFA 3QQ5A 4ZKEA 3DL0A 4LJ6A 1V5WA 1Q0UA 4US0R 3BRWD 2O8BA 3QUSA 1U0LA 3QSYA 3K0AB 3AP3A 4RD6A 4KCGA 1E1QD 1F2TA 2NO0A 3TNFA 1X8KA 4UNQA 1WA5A 5SZHB 4OHYA 4WA7A 5DYGA 4LWZA 1MRSA 3BFVA 1OPXA 4BEBA 3EZ9A 4QJ5A 3U3RA 2QZ4A 1R0XA 1GL7A 1GM5A 5EZ5A 3BGWA 1SKQA 2JLRA 5KUTA 4LCBA 3GLIE 2ZJAA 1PUJA 4WXRA 2FJUA 1A82A 2QP4A 1P2VA 4BFVA 1A2BA 3OIYA 3JVUA 4LPKA 3B1VA 421PA 3IO5A 1GTVA 4ZI3A 3DM5A 2VBCA 4JLOA 1VECA 4BLRA 1FNMA 1MOZA 3T5DA 1IXZA 4G5SA 5J4LA 1IXRC 2PT7A 2P2LA 4YQFA 1O3YA 3SDZA 3ICEA 2Y8EA 2YOHA 2Z4RA 2LCFA 4AD8A 5L3VA 3I5XA 1RRGA 3EA0A 3CH5A 3THYB 3HR7A 1PZNA 2C98A 3KKMA 1EWRA 3LH5A 1UFQA 4FWTA 5JSZA 1L7VC 2C5LA 4HLQB 4I81A 2UZ3A 2OV2A 4HI0E 1ZNXA 4EIWA 1OXVA 4QHYA 1R0YA 3Q85A 2YC2C 2VHTA 2B6HA 1GRQA 1IBRA 3OFND 4YDHB 1BMFD 3RABA 1W7AA 1ZBDA 4OHWA 2EFDB 4DKXA 1X8JA 1E96A 2QSYA 4B6FA 1IN4A 1G3QA 2GNOA 1TUEA 4A4DA 1U0JA 2FPKA 5FL7D 2IEYA 2BEJA 5A5GA 2BM1A 2GEDA 2W0MA 1I2DA 5EXPA 4DSTA 4MKIA 4ESHA 1Z0FA 4W5WA 1VHLA 1YR9A 4S35A 5FPHA 5JS8A 3T1TA 1DG1G 1D2NA 2WSSD 3LO5A 2G9NA 4XD7D 3SJBA 1LV7A 2FG5A 1Q44A 2F3TA 4A9AA 1GSIA 5HKKD 3EZ2A 3KL4A 1YZTA 3CR8A 1CP2A 1ZRHA 2KB0A 2ANCA 4IOKA 4PR0A 2DFTA 3VAAA 4TSFA 1Q3TA 1XPRA 1SVMA 4G5GA 2OLJA 3KFVA 2J7PA 2BKEA 1YU9A 2PJZA 4N1AA 2W00A 5KNDA 2ZSAA 5FOUA 1ZMXA 1CRPA 1W4BA 3A4MA 2CVHA 3HWSA 3QPVA 2CJWB 1E0SA 2XSZD 1NMXA 5DI9A 1N3BA 3C15C 1MRNA 3AKEA 1KJYA 1KIMA 1G8PA 2OCAA 4JS0A 521PA 3GLIB 2A9KA 4HAUA 2VP4A 2WZQA 4PZYA 2G3YA 2PCJA 2GBLA 5LDDC 4EPWA 4QC2A 1IOZA 3PQCA 3RS2A 4JBWA 2MMCA 1X8LA 2WWFA 1NN1A 1OJLA 4WZBE 2V4ZA 2QQ0A 4DJTA 5CJ2A 3BE4A 1MH1A 2KE5A 3QKRA 3DZ8A 4HAWA 5IDVA 5ANRB 3P20A 2FE4A 4HATA 2EFCB 4W5JA 5B2ZA 1T91A 3L43A 4DDUA 4NCNA 2EVWX 3SHFA 3CF2A 4XJXA 2G1KA 4B3FX 4Q1EA 4DSOA 4OJKA 3TKLA 4QHSA 1TTTA 1KTVA 2V55B 5LBIA 4BFYA 2ZE5A 3QEOA 4R71A 1Z0JA 2JIZD 3FKSA 2OFOA 4JLNA 2ZVQX 4DRZA 3UG6A 2CLSA 2A5FA 4KVAA 4MKFA 4DDTA 1OT3A 2AK3A 1A1VA 1GUAA 2QGNA 4U00A 4Q9LA 1SULA 1Z3IX 5JHGB 2ZTSA 4Q7LA 3VKWA 4TMTA 4HLCA 1E2DA 1JQJC 4JLPA 3U7HB 1FP7A 3CX6A 1ELOA 1Z22A 3MSXA 1TF5A 4YONB 1BIFA 4UKDA 1ZM2A 4DT1A 2CHGA 2FF7A 1ESNA 1S8FA 1GILA 1WBBA 2JLWA 4QXAA 2GF0A 3NVAA 3SFVA 4QG7A 1JQLB 1F48A 2A2ZA 3VKGA 4RJLA 3EX7C 4GZLA 3UATA 2FGJA 5CDFE 1VIAA 2WKRA 4HB4A 2PZEA 3IQXA 3GJ7A 2QE7A 5FPKA 5EUQB 2ECKA 3OIVA 4LV6A 3THXB 2QNRA 4LV8B 2AD5A 3RS7A 5JEDA 2FPLA 1VIYA 5KTYA 3CF0A 2OBLA 3R9XA 5DO9A 2J0UB 2F7SA 4C0SA 3ZD7A 1K8RA 1YZUA 1CR0A 4TMVA 5FR1A 3WBJA 1N6PA 1R5BA 2O8DB 1P6XA 2ZUDA 5LD2C 4MRRA 5IK2A 4HZUA 2IA5A 1MV5A 1A4RA 2IXEA 1SVWA 4OI1A 2H18A 3NHAA 3KQLA 1OHHA 1T3LA 3DPUA 5FPTA 3IGFA 1KK1A 5EE0A 5HE9A 1T6NA 4JYBA 4M1YA 4QNMA 2WJJA 1NI3A 1YKSA 3BAFA 2ZE8A 2WTUA 3PENA 4LV5B 3TW4A 2OCPA 1U0HC 1Q57A 2DCUA 5CLLA 2F43A 3Q9LA 4RZXA 1G7RA 3RRMA 4F4JA 2PMDA 1E98A 2WV9A 2ZETA 1OB2A 2ZVPX 3RANA 4ZDWA 4B3DA 4PO1A 3VNVA 1XJQA 1KI9A 1OV4A 1CR1A 1E0KA 3B1XA 4GZMA 3QY0A 4MH0R 3ZGXA 4G5QA 3RS3A 1S1MA 1WQ1R 4FCVA 1ZP6A 4WZ6A 1Z6TA 4A15A 1NF3A 5G3ZA 3PEVA 3SFZA 4KYUA 3UKDA 4A0HA 3P26A 2VEDA 2HJVA 2RCNA 4EQ6B 2GK6A 1M2OB 1A7JA 1OFIA 1MABB 3KJHA 4Q00A 3UMSA 1JPJA 1E9CA 1P61B 2XZPA 1VCNA 1XD8A 2FGKA 5EXTA 4XWKA 3SI7A 2QRNA 4OI0A 2BIFA 2WMOB 1CR2A 1P2UA 721PA 2HT6A 1Z2AA 2NQ2C 2A3RA 2HXSA 1JJ7A 1F60A 3B2EA 4E22A 3U7GA 1OH6A 2V54A 3V4FA 1M1YE 4A6XA 1DOAA 4ZO4A 2VSOA 3ZVNA 3NG1A 3DMDA 4KXFB 5L3SA 3CO5A 2VRWA 3W5IA 1NBMD 5K8LA 1X1SA 3HP1A 2QM7A 2F1RA 2P5SA 1JAHA 5FPYA 1S9DA 4LBZA 4DUGD 2IYLD 2A7QA 2PCLA 2W0SA 3F8TA 2ODNA 3H86A 3KUDA 5B57C 1N6KA 5L3RA 5SZIA 1M74A 2BWJA 2G6BA 5G41A 2QAGC 3DKPA 2IWHA 1G7TA 4TYWA 2NGRA 4LHVA 5C2JB 1KKMA 3QBTA 3I1FA 2X2FA 3CUEF 5EP4A 3U2QA 4F91B 4JZKA 2Q3FA 1JBKA 2JDIA 1E9SA 2JASA 3CRW1 5J40A 4C2UA 2EYUA 3AH8A 2CL0X 3OIWA 3A6PC 1FP6A 3CIOA 3MMPA 2Z4SA 2QROA 2ZYVX 2A5GA 1OF1A 1GWNA 4M1OA 3RYTC 1W2HA 5L8VA 2FFQA 2W2XA 2HYDA 3OF5A 4WOPA 4L9SA 3F0TA 3P1JA 3U3MA 3GJ5A 3FOZA 1BS1A 4HUTA 1G5RA 4GDFA 1OYYA 4CEHA 1XCGB 3A1SA 3FKQA 1VYUA 1GOTA 2IYVA 2WBLC 1ZIPA 3LLUA 4B44A 4B6EA 2GJ9A 5JWOA 3VX4A 3MAAC 1VMAA 4FMDB 2N1BA 3EC2A 1DAEA 2EWVA 1FTSA 4KJZA 2DFNA 4MGYR 2TMKA 1ZD9A 4P4SB 3GP8A 3BK7A 1VG9B 4KAXA 4CT4B 4JL8A 3K70C 3CX8A 2EYQA 4A0GA 4HB2A 3RS5A 3R9WA 2PX0A 2ZANA 5F98A 4YXWA 3HYRA 4X8LA 2R62A 2WWHA 1WCV1 2AWOA 2XOKA 3LNCA 1C9KA 3LY5A 4UXHA 1IY1A 3C14C 5F9FA 4BLQA 2GZHA 4PHFA 4RZ2A 4C0KA 5KPJA 4DB2A 4D82A 1VYTA 4URUR 1O87A 1Z63A 1KI4A 4G1UC 1LFDB 2DWQA 3P4YA 1XB2A 3CZQA 4QHTA 1G18A 1Z6AA 4B43A 2CLDX 5EP2A 4II7A 1MO6A 4LJ4A 1G9XA 3MFYA 3E1SA 2C9CA 3AKDA 4DXAA 1ZU5A 1RPZA 1PLLA 2ZXUA 1D2EA 5F9HA 1CS4C 2FZ4A 3B9QA 1W0JD 1JR3E 1MT0A 3AEZA 4Q4JA 4UJ5A 3ICQB 3OEHD 4ZV4A 3K1JA 2DB3A 1YZNA 2GCPA 1J2JA 4FINA 2I3BA 1G3UA 4NCKA 1E2LA 1E2KA 5JCZA 2WPDD 1X1RA 4PO8A 1RYFA 2BMJA 1E99A 4A8JC 2NG1A 2VTKA 4NDZA 2ZRIA 4NKRA 1QDEA 3EIHA 3BXZA 2A5JA 4JJZA 3DKVA 2Q6TA 2G77B 3FHOA 1QHHA 1XX6A 2B21A 4JLVA 5LPNA 2BBTA 3X1WA 4JKYA 2C9YA 3GLGA 1UADA 2KWIA 4DLSA 3OIUA 3HDTA 2ZU6A 4UQOA 5HCIA 1II0A 5B58C 1UDWA 3FFAA 3ZS8A 4C0JA 1JALA 3MWLA 4B76A 5BN4A 1LF5A 5CK5A 1S4QA 4A2WA 4FMCB 2IUSA 3W34A 1OIWA 2YJTD 4YMVA 1N0WA 2GEUA 1TF2A 4JJKA 5BQ5A 5HCNA 3ZYCA 3ND9A 4Q5IA 3ZDQA 3LXRA 1NJGA 1W36C 5FUVA 1OKKA 1C1YA 2ZI3A 2AHOA 2GJ8A 1NVWQ 2SHKA 3C5HA 1Q1BA 5IRCD 4LYAA 1YQTA 2WVJA 3MRSA 3BH7A 4B73A 3GJ4A 3VX3A 1W49A 3O8DA 2W83A 1SHZA 3CWQA 1AS0A 3KJGA 2X1VA 4OQNA 4PTLA 3T1OA 1UKVY 4LJAA 1VCIA 5AR1A 5CJPA 1JECA 4U7DA 1G6HA 2IS6A 1G64A 4L4UA 4N3NA 1U8ZA 1US8A 2ZSBA 2YWGA 4PC3A 1Z83A 1Z47A 4OYHA 2GF9A 2VP0A 1P9RA 5TVKA 2WIAA 1QHGA 1PLJA 2OEPA 4HB0A 2BMFA 2EFEB 2ZRJA 4IOMA 2IF2A 2FFHA 3LW7A 3TJZA 3KKOA 3WHKA 2V9PA 5DI3A 3W3AA 1WDTA 4AG6A 2ZR0A 4TZ0A 1ANKA 3BB3A 3BH6A 4W7SA 3TAHA 4PXAA 4K46A 2OBNA 2QTVB 1SVSA 2HXYA 3L2OB 4DCUA 4QRHA 5KDOA 2J0SA 1SXJC 4MYUA 3SBDA 1CLUA 3EWSA 5DHAA 1E2QA 3AGQA 4RD1A 2VL7A 1YHNA 3IO3A 1R0ZA 1X6VA 1OXTA 1TQDA 3THWB 1MKYA 3QF4A 3TH5A 1SQ5A 3BS4A 2H92A 4LOAA 1XCMA 3QG5A 1RVDA 2H16A 4MRVA 1E1RA 4KITB 2H57A 1HURA 4BQSA 5E7JA 2ORWA 2A5DA 1DEKA 4OK6A 1E2FA 3WBKA 1Z0AA 3HPRA 5EXXA 4GMXA 3OFNA 1K5DA 4LZZA 4A1FA 2CE2X 4Q21A 1G8YA 3NXSA 1GNQA 3TVDA 4QKQA 5J4KA 5GJWC 2VHQA 1L4YA 3ZZTA 6Q21A 5FL7A 3ND8A 2W6ID 5CM9C 2KI5A 1VKJA 2J1LA 3W8NA 1EWQA 1NVUQ 3Q7PA 4PC6A 1Z8FA 4NH0A 2FSFA 4RFVA 3SJAA 4R2IA 2J45A 2VHUA 2WSSA 3I4LA 1EXMA 1Z6GA 1U8AA 3SYKA 1XEFA 1KK3A 3KUCA 2QY9A 3GLFA 3GPLA 2B7CA 4LHWA 2IYXA 1KI6B 3U3KA 1MO3A 2VIIA 5FI0B 3BIFA 3LQQA 2DPXA 4CEIA 621PA 3IEVA 1BKDR 4KLZA 3K70B 2L0XA 3VHLB 2V8OA 3ZH9B 5IHPA 1EK0A 1L4UA 2O5VA 2X2EA 1KAOA 1EFUA 1KK2A 4LYHA 4CZ2A 3C16C 4PFSA 1KO4A 4B2LA 3B7GA 1ZVQA 1FFHA 3ZZUA 4N0EA 3TUJC 4B32A 2XAUA 4LHZA 2V6IA 4BPBA 1U98A 1Z6YA 2AWNA 4V0OA 4Z1MD 2QENA 3K0CC 3PITA 2H5EA 1R2QA 1P7CA 2O8EA 5KO2A 3CW2A 1EG7A 1AJEA 1DAMA 1Q3HA 4EJSA 4LHXA 3I61A 4LGMA 3PFIA 1YZKA 3D31A 1GKIA 4HDOB 3RWMB 3AVYA 1SKYE 2E87A 1I4DD 2GJKA 2J0QA 1W4RA 1KI8A 3LBNA 2XXAB 2WOOA 2VHJA 4JLBA 2OG2A 1T5IA 3ZS9A 3UIEA 5KDDA 3DZDA 1PV4A 3K9HA 3BWDD 4A8JB 1NY5A 1SXJE 4XWOA 4R98A 2ZI4A 4DCSA 2XEXA 1W44A 2AL7A 4HLUC 3EIQA 1J99A 2JLXA 1QF9A 4GBMA 2Q3HA 1I4LD 5TARA 2O8CB 5B64A 1NKSA 4ACBA 1N5KA 2D62A 3R9IA 4CIDA 1FZQA 4IVPA 3GFPA 5KHOC 3GEHA 3AM1A 1NMYA 1H8HA 1DELA 5TDHA 3OHMA 4BRWA 3PUYA 4YMWA 4CDGA 3UMFA 2O8FB 4M1KA 3U6KA 4YC7A 4Q9HA 2FOLA 1NBME 4OL0A 4HAYA 2ZM5A 1E79D 4L16A 1W1WA 1NVVQ 3EXAA 1E9AA 3F5FA 3AF1A 4H1UA 3RC8A 2W2VA 3U4QA 3B82A 4Q9IA 1N25A 1D9ZA 1UEJA 1W0KD 4EFLA 1TEXA 3DMNA 3GMTA 1KSGA 1RJ9B 1XRJA 3L8YA 1OW3B 1XMIA 3D3QA 1JI0A 4BWYA 1KI7A 2P6NA 3TRFA 4JBXA 1RYHA 2BOVA 2GDJA 3UPUA 1XD9A 4MQBA 1E3MA 1HE1C 2XTZA 2ZRPA 3MG9A 3RVBA 1AIPA 3K0AA 4LUCA 3FVQA 2RGDA 3IPXA 4WXPA 5CM8B 2RGNC 4D0GA 4E5UA 1IM2A 3QG1A 3I73A 4A0FA 5EE1A 1P73A 5FBLB 4LYJA 1RZ3A 1G17A 3J81k 1SKYB 1U9IC 1VHTA 5JRZA 3I5YA 2IX3A 2PL3A 3TSWA 1KI2A 3A4LA 2YOGA 5L3QB 5AUOB 1W2GA 1WF3A 5KSPA 4LHYA 1VG0B 3EIEA 1KI3A 1SXJB 3ECCA 2IXFA 2ZJZA 4ZIRB 1JR3D 3LBIA 5FOSA 2ZRNA 3PVSA 1XTRA 3UK6A 1G21E 5FTLA 1XD2B 2F9MA 1LS6A 5E7IA 2IBMA 3EW9A 1XTIA 4D2IA 2QEQA 3NHBA 2WAYA 1HTWA 2Q9AA 3IPYA 3C7KA 2ZJ2A 4TYQA 4DIEA 3C5CA 2FFAA 3PV0A 4OI2A 1VG1A 1D9XA 2XJ4A 2KSQA 2WICA 3THYA 1ZCAA 2WJHA 4TMXA 1RFLA 4RZ3A 3U7EB 3LAWA 4M22A 4RCZA 2ZI5A 2OUKA 2JJ1D 4HAZA 1HV8A 3B5JA 5JWRA 1NMZA 2PBRA 4M4SA 2CE7A 2AXNA 3TLXA 4AWXA 5K8UA 2QAJA 2RGXA 1GDDA 3EPJA 3PEYA 3GJXC 4C4PA 4XWAA 4K81B 3IIMA 3GFOA 4TTPA 4TTQA 4NONA 4TLDA 4FMBB 4RFSB 3EPKA 4QFMA 4I1UA 4GI7A 3A4NA 3V9PA 1E6CA 3AGPA 3EG5A 2OILA 4O3MA 1QHNA 1ZIOA 2XITA 1OXUA 3G82C 5D3QA 4CW7A 2YWHA 1UF9A 2NTYC 5D3MB 4M9ZA 1CJVC 4US1R 2ZSEA 4CYMA 4ZCIA 4AKGA 2RH5A 1TX4B 3ADKA 4IEIA 4LDJA 1BH2A 3K70D 3FFBA 1IJFA 1S96A 1G7CA 1TU4A 2W58A 1NG1A 3FMFA 2CJWA 5DGXA 5H1YA 3DDCA 1E2NA 4JYCA 4URYR 1NP6A 4JIMA 2WM9B 4JT2A 4YDSA 4DIDA 1N6IA 3GLIA 4RSGA 5KDLA 3ZIAD 4C0HA 5LB4A 1NRJB 2NZJA 1U81A 3NEJA 2CK3A 3N2EA 1G3IA 4IVRA 4IOJA 3PR1A 3U7FB 5BN3A 1QBKC 4IW3B 4BASA 1OB5A 3L0PA 5CITA 2JJ2A 2Q9CA 2FPMA 3TMKA 1XXHE 1R8QA 4UNSA 1Z06A 4LJ7A 4OQMA 4DZZA 5JI2E 3DHWC 3NIBA 2HF9A 1NG9A 2HV8A 2VH5R 2QMOA 5DN6D 3QIAA 1S0UA 2REXB 4JVNA 1BYUA 4HAXA 3SNHA 2RB4A 2GXSA 4OK5A 3KB1A 2GXQA 3PIRA 4TLBA 3BC1A 4PPNA 1F6BA 3T5GA 3WRYC 2R65A 2P65A 1T0HB 1RKBA 4BECA 2BDTA 1OH5A 2F9LA 4KFRA 1FQKA 4Q1CA 2IF0A 4OKSA 5FBVB 3I8XA 3GLHE 2IHYA 5JEEA 3O8BA 4M2LA 1D8TA 4PQFA 2EWWA 4EKDA 3GEEA 2ZIAA 2CCJA 3JZAA 1E9FA 1G291 1AS3A 2C8VA 2FSGA 2IS1A 1NSFA 1GNPA 1S2MA 2Z5FA 1ZM7A 5JRJA 4YLGA 1AA9A 4C30A 5DHFA 3WMEA 1YRAA 4AY2A 1NIPA 2WKPA 2GETA 3C4JA 3DOFA 3I3SR 3BB1A 1BYIA 1LY1A 4KHZA 1KMHB 4GFDA 3UMRA 5BN5A 3B1WA 4RKFA 3H2YA 5G40A 1P62B 1LS1A 2ZI7A 4B34A 2BJWA 1NLYA 4P31A 5KYKA 3LFUA 1T8TA 2ZR9A 5B30A 4M53A 2D4HA 1W36D 1M6NA 1GITA 4LC1A 2WJYA 3FTQA 1LF0A 2GA8A 3W6OA 3CZPA 1CBUA 1QZXA 3THXA 5UKDA 1RRFA 2PX3A 3R8CA 221PA 2EU8A 2GEVA 4LX0A 4LY6A 3D8BA 3KXKA 1TL7C 5DYIA 3TW8B 4B48A 2O8DA 5FTJA 1T5LA 4I99A 3VR3A 2J9RA 2AFIE 5A0FA 1FQJA 4ASUA 3KXLA 2EW1A 1JEDA 4URVR 2PLFA 2ODEA 4CVNA 2PJRA 4JL5A 1E2EA 1XXHB 4AKEA 4EPRA 1G5PA 1P9WA 4Q1AA 4HYYA 4ERNA 5H8WA 4IJMA 3T61A 1NVVR 1ZW6A 4V0LA 4ZCLA 4DSUA 4TL9A 1ZYUA 5SZJA 4HZUB 1Z07A 3CNNA 4TTRA 4C2TA 3R7WB 4CT5A 5JZVA 2O0HA 5HTKA 2QU8A 3DVLA 4TLAA 2O52A 4D4KA 1E2IA 4BE7B 1FUUA 5CLQA 1RE0A 2AKYA 3VFDA 5GVSA 2QMHA 2VP9A 2QL6A 4TMKA 1Y63A 4BLSA 1Q1EA 4O2LA 3ZVRA 3A37A 4AYTA 1E9BA 1GRRA 1AZTA 4FI3C 4NYIR 1W4AA 2LWIA 1EESA 1SXJD 3VR1A 3AF2A 2GCOB 4PHTA 1B23P 3GLHB 1LNZA 2G83A 4P32A 1G3RA 4N0DA 4MYTA 4PQRA 3VHXA 4EQ6A 3IIJA 1PVOA 1KZ7B 1MABA 2J7KA 3KQUA 2PT5A 4XOIA 3TK1A 2WWGA 2IYRA 4B3BA 1XJ0A 3OE7A 3W8RA 1II9A 3BB4A 4B47A 2IS4A 2QA5A 4Z8YA 2ZRGA 4ZDIA 4F38A 5HR5A 2VO1A 2W6JA 3IBGA 4IVQA 3WNCA 5KSYA 1P2SA 3FB4A 3N5CA 1Q1ZA 2VF7A 3LX8A 1XJCA 3CBQA 4IDNA 2ZS7A 4MUBA 4ZPXA 5GVRA 5CDFA 2HCBA 3R8FA 2FSHA 1GP2A 1FUKA 2ORIA 3L0OA 1VYVA 4Q9KA 4Q4AB 5G3YA 4Q47A 5FBRB 5JHHB 2HLDD 2ZE7A 4M1TA 1CJMA 3BJIC 4IFBA 1GNRA 1RW4A 4DLZA 1QHSA 1YZGA 1BOFA 3L82B 3S1AB 1U99A 2CLCX 4P0TA 4MYCA 3TAUA 4C9BA 4BZQA 1XNJA 1KO5A 4Q1DA 3QXXA 1Y3AA 1P4SA 3QXSA 1P9NA 2ATXA 3OESA 4C7OB 1UBGA 2ZQ5A 2ZI9A 2QBYB 3NDPA 4Q4HB 1DAHA 3A1TA 1NSTA 3UG7A 4URXR 4QM6A 5J4VA 3QXCA 3PUXA 1HT1E 3LRPA 4Q9JA 2YV5A 2HT1A 1R8SA 4ZKDA 2ZAMA 1L2TA 2ZRHA 1OE0A 3NEYA 2XTMA 3REFA 4B35A 1EX6A 1IAQA 2QQEA 2ODBA 1KGDA 3RS0A 3SOPA 3HU2A 3AVTA 4OK3A 5KPDA 1XEWX 4UNNA 4NCHA 3U3JA 4RZUA 2DR3A 3SEAA 1QHIA 1CIPA 4HLDA 3E70C 1LTQA 4TSFD 4WAUA 3WYFA 3FPAA 4F93B 2J7PD 4M21A 2XZLA 2CMKA 4P4SA 4HSEA 4M1MA 4MYHA 1AZSC 4KFSA 5EE9A 1RIFA 2FH5B 4RD3A 3RRZA 1MO5A 2OLKA 1ESMA 4OHXA 3EC1A 5CB6A 5FUWA 2BC9A 1AK2A 2KJQA 1II8B 2XGJA 2IT1A 2JLQA 1YRBA 3I92A 3KQNA 5E95A 2A30A 1HH4A 3QKSB 2NO7A 1YR6A 3RAPR 1X3SA 3K9GA 1ZU4A 2BVNA 4QJ3A 2XJ9A 1IY0A 1EFRD 2GZAA 2P3SA 2V7QA 3EA5A 4C3ZA 1Z5ZA 4UNPA 3NBFA 4Q66C 2CNWA 1WMSA 1R4AA 1ZNZA 5HPYB 3WHLA 1XEXB 4TMZA 1PLKA 4ACAA 1DE0A 1JPNA 3TUZC 4LK2A 3SN6A 3U44B 2C96A 4RCYA 1N6OA 1UJ2A 3HU1A 1E9EA 3Q72A 2ZJ8A 3O8CA 2X8AA 1G6OA 2PZFA 2IYTA 4EFNA 3UXMA 3F3YA 4NL4H 4Q7KA 2H7VA 1G7SA 1P2TA 4ILEA 4AYXA 1F3OA 1Q12A 4B71A 5IT5A 2IEZA 3B1ZA 5JBQA 1ETUA 3IKJA 2IYZA 1LVGA 2RMKA 2ZRMA 2OE2A 3FKSD 3P27A 2QN6A 5FPSA 4V0NA 3TGPA 1XPOA 4ITRC 2VLIA 4M1SA 1NN3A 1NVXQ 4DEXA 1G41A 5P21A 2D7CA 4TYYA 3AB3A 4KSCA 5TY0A 1CXZA 1SZPA 1CJTC 1N6LA 1SVIA 3SYLA 5LD2B 5JCPA 2ZYWX 5ELXA 1H8ED 4B3XA 5TB5A 2ODWA 4KU4A 4BGDA 3KQKA 4JKIA 2C77A 4PPGA 1JXOA 1W0KA 1CR4A 4B2PA 3K9LA 1E69A 1P60A 1ZJ6A 2J3EA 3OAAA 3BBPA 4OBEA 3MWKA 4Z54A 4DLUA 5KSZA 1UAAA 3OEED 4R7ZA 4Y0AA 5KOYA 3ONWA 2REOA 2AK2A 2Z0MA 1KO1A 1CRQA 1ZCBA 2QPTA 1N6HA 1ZUNB 3A8TA 1E2MA 1NL3A 2UVQA 2BM0A 3KKQA 4DLWA 4MITA 3SJCA 2HUPA 2JLYA 2AN9A 3TSZA 3MLEA 2B8WA 3VR4A 3SQXA 1AQYA 3KJEA 1EX7A 3RS4A 4ZCMA 2YC4C 1E1QA 4W5HA 4MGZR 3CRRA 3TVTA 3DEFA 1SHKA 4V03A 1S3GA 2GVZC 4V0ME 5F3WB 3WYAA 1D6JA 4IKEA 2ZRKA 3H84A 4JSYA 3ADBA 2BV3A 1QHXA 3K0EA 2GAAA 4PZLA 2QGZA 1DS6A 2HF8A 2R44A 1EFCA 5DISB 1ZC3A 2ORVA 1DPFA 2ZSFA 3RLFA 4LPSA 2C95A 4G3XA 3X1ZA 5J47A 5JECA 4LSGA 2IYWA 2OM2A 2H17A 3V00A 2OXRA 3NDBB 5FBQB 1JR3A 3NBZC 1D5CA 1ZD8A 4MRPA 4Q18A 1ZM4A 2IL1A 5GJCA 1OFTA 1B0UA 5AJVB 4AKIA 2ONKA 4BFXA 4TQAA 1WRBA 4RD2A 2K5UA 3TUIC 2YKGA 3GJ0A 1TF7A 2ZRCA 3SJZA 1NIJA 1K5GA 2YINC 5DI3B 1AN0A 2QAGB 2BCJQ 2DWPA 2G1JA 2AD1A 2J87A 4KV9A 4DEYA 1G4AE 1NNEA 2XNDD 3THWA 3R20A 4XSGA 4NTZA 3RSOA 3FE2A 1PJRA 4ARZB 4D0LB 3SHWA 5TV2A 3PEWA 1BMFA 1IJEA 2QM8A 3SZRA 4M9SA 1E2PA 4W9MC 4QBIA 1OYWA 4URWR 2QMUA 3WNBA 5AK0A 4U5XA 5JJLA 4IEEA 4QM7A 4EFMA 5CB8A 1GG2A 2RGGA 2UKDA 1IXSB 1JXMA 3CH4B 4S2EA 4Q02A 3GJ6A 2CHQA 821PA 1FNNA 4XD7A 3AF3A 4JMPA 4LI0A 3KB2A 2KBEA 1TUIA 3REGA 4TT3D 5HKKA 4DVGA 5E4FA 2P67A 4GSYA 1NLZA 2WWIA 3A1VA 1DAFA 2A5YB 2RGEA 1KI6A 4FIDA 1KOFA 1UBEA 4FMDF 1A5TA 1M7BA 2IYYA 3K0FB 1WXQA 2ZSDA 1D2MA 3IDQA 4P33A 2JDID 4EUNA 4WIAA 4XVQA 3T1VA 1IN5A 3DOEA 3T35A 1MO4A 1KSFX 2XTNA 4QNRA 4JLAA 2J0VA 3W5JA 2XSZA 1S3SA 4KFUA 3AF4A 3B78A 4HUQB 3NKVA 3VU9B 2ZR7A 3RDPA 3H0KA 3VNUA 3ZIAA 1F2UB 1UBCA 1MR3F 3IEUA 5CIWA 1UBFA 4DLYA 3AKYA 1SGWA 1ZNWA 3VKHA 2VP6A 4TMWA 4L15A 5JJIA 4QBHA 4J0QA 3C8UA 1CJUC 1KY3A 2QP9X 2WOJA 4RKEA 5K8TA 5TMPA 1FX0B 1Z0DA 4HAVA 3THOA 3IIKA 4B33A 4M0LA 2BKUA 4E07A 3B13B 4D4JA 3FDIA 1N5IA 2YVUA 1KO7A 3K0SA 2GRJA 2XOKD 4PPQA 1FOEB 1GL9B 1XZQA 2R6FA 4BFZA 2XXAA 3WY9A 1FPMA 4Q1BA 4I1OA 2GBLC 3WNDA 2UZIR 3ADDA 2JIZA 2Z83A 1IHUA 3CRVA 3D7MA 4ON9A 1DARA 3PEUA 4A8JA 1G8HA 2OO7A 2I4IA 2GJSA 2IC5A 2YWEA 3LX5A 4IHQA 5HZHA 2O8CA 4POAA 1AM4D 2F3RA 2LKDA 4HEJA 3V4RA 8OHMA 4PC1A 2D06A 4QGGA 3KTAB 1DADA 1DO0A 1OIVA 3GD7A 2J59A 5BW8A 5DIFA 4WBSA 2ZAOA 2O8FA 1R10A 4AURA 1HT2E 1NN5A 2VSXA 3BD9A 4FMCF 4EPYA 3H4MA 3TQCA 2NZ8A 3ZVMA 1W36B 1UDXA 3JZMA 2FEMA 3NC1C 4PC7A 1E9RA 1KAGA 3LV8A 5BWMA 4CEJB 2CDNA 2WSMA 2KBFA 4IDHA 4PC2A 4XTCS 2IWRA 2D3WA 1RJ9A 2DWOA 4NYIQ 3SBEA 4NE2A 3SU8A 2DYKA 1Z0IA 1ZAKA 3O47A 4I1SA 2VP5A 5TXGA 4TL7A 2NOAA 3ASZA 2IYSA 1TU3A 4PAMA 1UKEA 4NYJQ 1TAGA 2R6CA 1Q21A 4AI6A 5FUYA 2ZE6A 2Q3MA 1TADA 3L0SA 2JA1A 1KJWA 4PANA 4QGHA 1WB9A 2V3CC 2RGBA 2J46A 1E2HA 3EZFA 3Q3JB 3B85A 3LDAA 3AVXA 2NO6A 1KNQA 4LC0A 1OKKD 2MSDB 3BFKA 4H1VA 3W6PA 1RC8A 1QVRA 1OLOA 2GXAA 3E5HA 3ADCA 3N70A 4QGFA 3I32A 2IYQA 2O8BB 2C04A 1IN6A 2ZRLA 3NWJA 3GJ8A 3VTKA 3WMGA 2ATVA 5L3QA 4D4MA 1F2TB 1LB1B 2CBZA 2GWHA 2E1RA 1SXJA 2BJVA 5CK4A 3GJ3A 4ZIRA 4ZDKA 2CHVA 5KU1A 2NO9A 2RGCA 2ONJA 2AR7A 3QNUA 5AJYA 1KMQA 5J4YA 2XB2A 4OQXA 2JEOA 2ZRDA 1XD2A 2QT0A 3KDSE 2R6DA 4IXNA 3BORA 5JS7A 1T9HA 4DWJA 2H8KA 2ERXA 4M1WA 4DC9A 3A36A 4I1VA 1FMLA 1HEIA 3QXHA 5EXSA 2OAP1 2B8TA 2GJAA 4PSKA 1EFHA 4LJ8A 4D0NA 5EP1A 4MDEA 3UWKA 4O2RA 4Q01A 4JLDA 1NBMA 4NZYA 2QG6A 5EE3A 4JVMA 1XTQA 4A0RA 4IFEA 1OH8A 2EQBA 1E9DA 4DUGA 5GJVC 4D6PA 2PEYA 1TMKA 4Y0VA 1N6NA 1VCMA 5H70A 2HLDA 3WP1B 2C78A 5JSZB 1ZUIA 2C2HA 1XMJA 3LBHA 3QI2A 3W90A 2JLSA 4RFSA 1E1RD 2IUUA 1Z6XA 1CULC 2B92A 4DB4A 3ZLJA 4XSHA 5EJEA 2IYUA 1TNDA 3LQRA 2QSZA 4PPFA 4C0LA 4DCTA 5DNYB 2ZRFA 1E0JA 4QBGB 1ONBA 2OFXA 4UJ3A 5FOXA 1M8PA 2BMEA 5C46F 1DTSA 4LBVA 1GZSA 1KNXA 4P4TA 1AGPA 3PXGA 2ZJ5A 2XZOA 5E7MA 5D3MA 1Z08A 3QPUA 3CONA 2PMKA 3K09A 4YMUA 3WMFA 2OAQ1 2D2FA 4Q03A 3SC3A 1DAGA 3WYGA 4H9GA 4OHVA 2IW3A 4NP6A 4QJ4A 4R2HA 5AUPB 4AKHA 4D80A 4Z8XA 3U5ZB 3EPHA 2ZJBA 3EPLA 5DLQC 1W5TA 1CU1A 1JB1A 3QE0A 1J70A 2OT3B 2R6AA 3K0CA 2OXCA 3D6TB 1VCOA 4TN1A 4PZZA 3E2IA 3M1IA 5BXQC 4BFWA 4ZI2A 5M04A 3FMIA 4NBSA 3Q8XB 4P3YA 3GEIA 1ZINA 3G5UA 2BMDA 1VPLA 1ZM9A 4BLOA 1E2JA 3W3ZB 1U2RA 1FW6A 1E4VA 4V0KA 4TLEA 1E4YA 3QKUA 4HZIA 3X1YA 3RHFA 2FNAA 4CRWB 1Q20A 2BEKA 4FN5A 1GFIA 4PO9A 1XWIA 4FWIB 2Z6VA 3B1YA 3PG5A 1UPTA 2W2TA 2HCJB 4X8HA 4MA4A 1OH7A 4HLUA 1EFRA 1X86B 2HJGA 4G0NA 1SVLA 4JSTA 3QKRB 4JT4A 4GT1A 2ZJYA 2ZI6A 3B6EA 1S1CA 3RRYA 3TSOA 5C4MA 2NO1A 4B2IA 1CF4A 2VP2A 3SE0A 3AVOA 4GRAA 3BOSA 3PUWA 4TZ6A 3IUYA 1W0JA 1J8MF 1UKYA 4WZAE 2AX4A 1UM8A 4D81A 1H65A 3OEHA 4F4CA 4Q7MB 1JJVA 2PH1A 3A1WA 2FWRA 2Z43A 1YE8A 1COWD 4PAQA 4B3GA 2DBYA 2WPDA 4AIIA 1OIXA 4QGAA 4LJ5A 3RC3A 3OZXA 1AKYA 1YR8A 4Q1FA 4OI4A 3VR6A 2ERYA 4GNKA 4EDHA 4NYMQ 3X1DA 4NCIA 1M7HA 1W48A 4MGIR 4WW0A 2RKOA 3CR7A 3U3OA 1G4UR 1KMHA 1CKEA 2V1XA 4TYNA 1TQ2A 1UEIA 2WMNB 1P75A 4OHZA 2VQSA 1KZGB 3EZ6A 1A2KC 4G5RA 4AK9A 2NMVA 1H8HD 1F5NA 1H8EA 4DT1B 1GVNB 3M4YA 4DDWA 5HE8A 5GADl 2JLZA 4JLJA 1LW7A 3TE6A 121PA 1AKEA 2GESA 2J0UA 3T1QA 4AG5A 1ZUHA 2ZRAA 3GQBA 4A6PA 4WVFA 3ASYA 2RHMA 3A1UA 2GVDC 4NMMA 2FEOA 3ZJYA 3HJNA 1YZLA 1DO2A 3P4XA 1W47A 4A2QA 3G0HA 3K9NA 3OEEA 3AKCA 2RGNA 3EZ7A 1CJKC 2B7BA 1KSJA 1TQ6A 5DE3A 3NC0C 2I1QA 3QJYA 4B75A 2IUTA 3O8RA 3I62A 1XXHA 1U9IA 4DCVA 4GP6A 4TL6A 5FTNA 5G53C 4GL2A 2PEZA 4MUAA 2GCNA 4A82A 2R8RA 3AVQA 2R2AA 3I8SA 1G3MA 3WRXC 1JAIA 3R7WA 4GPTA 1L8QA 2QORA 2OHFA 5EQTA 2ZPTX 3KJIA 3VR2A 4A2PA 1T4GA 1HA3A 2JLVA 2GK7A 4RD0A 1KI1A 5JJKA 2BBWA 1PUIA 3NH6A 1HYQA 2GTPA 3Q7QA 3QXJA 4FXPA 2F43B 4Q48A 1J8YF 2CEAA 2V6JA 3WXMA 2OBMA 2GCOA 2HDNB 3LLMA 4NYJR 3GLHA 3FHTA 2RAPA 4PHGA 2BHRA 4Z51A 4EAQA 2FFBA 5DH9A 1GRNA 2ZREA 2ASEA 4QL3A 3NBXX 2QTHA 1QG4A 3QKTA 1QG2A 3EWAA 4ESVA 2VF8A 3QEJA 2DHRA 1AQUA 4L5BA 4GOKA 3BH0A 3L0IB 2ZITA 2D74A 1Z0KA 2JGNA 3ZD6A 3M6AA 5KNCA 2QMEA 2XNDA 2OCBA 1FMJA 1GL6A 1N5LA 2CVFA 2DY1A 1ODFA 2G0TA 3QVUA 3T12A 1WBDA 4XIGS 3ZQ6A 4X8MA 2Q9BA 3CPHA 4TWZA 1N6RA 2ZRBA 3Q5DA 1J90A 5EE5B 4Q4AA 3IHLA 5GJBA 1HQYE 1U90A 1ZNYA 5FTMA 4IOLA 3AF0A 5L3SB 3GFTA 4IXMA 1YVDA 1HY3A 3TQFA 1G19A 3T06B 1GAJA 4MRNA 5FFMA 4MGKR 2W6IA 3CF6R 3S1AA 1BO6A 3H1TA 4JVLA 4OQLA 3W6NA 3AUYA 4RD4A 2WHXA 2IHBA 3QOFA 4C7OA 2DFLA 3KXIA 4Q4HA 4TT3A 1DG3A 1FL9A 1XTSA 5C4GB 3U60B 1HE8B 2JATA 2NPIA 4HDQB 5AJWA 2HYIC 3FMOB 4JBYA 1IN8A 3LVQE 1T8UA 2OSBA 2ZYUX 2F55A 4A36A 3TIFA 5JWHA 3MWJA 1T0JB 4DLXA 2ZS9A 1KJZA 2R9VA 3MWYW 5CYOA 4LRWA 4DLVA 5A4JA 2FDCA 3EAQA 3GLGE 1DBSA 2VHCA 4BRUA 5K8IA 1R5OA 1XPUA 4OJQA 1FTNA 4KBGA 2CL6X 1IONA 4NHOA 4CEHB 2ZUCA 5FOTA 2CXXA 2QI9C 5JFGA 3AVPA 4E03A 4Z1MA 1II8A 1DVRA 2XB4A 2ZU0C 4BFUA 5C1BA 4XVRA 5JLJA 5FH9A 3FHCB 2IS2A 3I72A 3QKSA 1YR7A 2GZDA 2D2EA 4V02A 4G01B 2CK3D 3Q5EA 2F1IA 1TQ4A 2MMGA 2QP3A 3B8HA 5IF9A 1EFTA 2PZGA 4BUJA 1CTQA 2GILA 2YZ2A 2JJ2D 4LYFA 1N0VC 5DSZA 2QPOA 5FOVA 1M7GA 4AYWA 1G20E 1S9HA 3CM0A 3AUXA 1KSHA 2F1JA 3DO6A 1XEXA 2QRZA 4BZXA 3N2IA 1G5TA 2NIPA 1E0AA 1KK0A 4D25A 3U44A 1AGRA 4QOSA 4MDFA 4KI0A 4FCTA 1XTKA 3PCRB 1G8GA 3CKLA 2JJ8A 4L9WA 4M9QA 3BERA 1WP9A 4LBWA 2AXPA 2FMXA 3X2SA 2ZROA 3FWYA 2NPFA 4K8OA 2MSEB 2N46A 3K53A 3AVWA 1G16A 2CL7X 4EJSC 3B9PA 3QPWA 4O25A 4BFSA 3C41J 3SYNA 2QBYA 5FUXA 1AS2A 2OZEA 2BCGY 2F6RA 4MKGA 3KKPA 4Q4JB 4GOJA 2JCSA 1ZD1A 4TQUS 1GIAA 2WJGA 2HEIA 2ZYTX 4GOXA 2WIBA 4BFTA 3QVVA 3SS8A 4YMSA 1E79A 4JLMA 2G88A 4DHEA 3FMPB 4DSNA 2OFWA 2BBOA 4TYPA 4X8OA 4FD2A 5CIQA 1KDRA 5EP3A 1XMSA 1SVOA 2J5XA 3KKNA 3U6BA 1QHHB 2FU5C 3MJHA 1XBTA 3WP0A 3CX7A 3GLGB 2FX3A 3CNLA 5F2EA 2YWFA 4KLNA 4YMTA 2GHIA 4ABYA 2WAXA 4KYIB 3LVRE 3UWOA 4Q4LA 2QE7D 1G8FA 3SR0A 1EGAA 2RGAA 1N2CE 1XDBA 1TPZA 1Z28A 1JNYA 1XF9A 5HZKA 2P0EA 5KNBA 3X1XA 3LA6A 2PLRA 4NYMR 5KSOA 1IY2A 2XNSA 3MJRA 5H68A 5J5CA 3NTUA 3T34A 4BLTA 1I2MA 3LD9A 3HR8A 3KQHA 3CPJB 4KSBA 1KHTA 4LJ9A 1OXXK 5IK2D 1GKYA 1KDPA 2P5TB 4TL8A 4A92A 3IILA 4ASUD 2V1UA 1KYIA 3ZQJA 2DFKB 2E9SA 4R9UC 4BZPA 1OHHD 2P6UA 5AUQA 1T3HA 4NU0A 3LW8A 3PUZA 3GLFE 2WWYA 2EFGA 3SQWA 4TQ9A 2REBA 4UNRA 4Q19A 1Q1QA 1RRPA 2YNMA 4URZR 2WJIA 3CWZA 1XFAA 1XTJA 2N42A 1Z2CA 1US8B 1RRCA 3M0EA 2D7DA 2G0NA 4UXJA 1HQCA 2Q0HA 3VMFA 3NBYC 2AKAB 1VDZA 1ZC4A 2AFHE 3VR5A 3IQWA 2IK8A 4PQYA 2JAQA 3AV0B 3RRNA 5EUMA 1Z29A 3T15A 2C03A 2ZEJA 4IRUB 1OXSC 1G1MA 2VSFA 3U61B 3TR0A 3K8YA 4BEJA 2QAGA 2VPPA 3EASA 1IN7A 1XZPA 1XU4A 2FA9A 2ANBA 2YOFA 2JJ1A 1Q22A 1R0WA 5LB2A 1W5SA 2RHDA 4RVCA 5JMTA 3OE7D 2A78A 2X19A 2VYFA 4ARZA 1GKUB 3QBVA 5E3HA 3HPQA 4US2R 2W6JD 5FL3A 4XVUA 1DAIA 4EPVA 3KX2A 3CB4A 2WKQA 4FW9A 3QF7A 4RY2A 4F92B 4Q7JB 2JLUA 4BLPA 1OFHA 2R6GA 3QF4B 3VQTA 1KDTA 3MCAA 1V43A 3ZVLA 1KDOA 2H1LA 4GP7A 3ETLA 1M34E 1I4TD 2OESA 4L8GA 3QENA 1NY6A 3MUFA 4QBFA 3NH9A 1KO8A 1SVKA 1ZM3A 4U02A 2QPAA 3JVVA 3GCGA 4M8NE 4GMDA 4HB3A 1E2GA 1DAKA 4CGZA 1VG8A 4LJYA 3K0FA 4KO8A 3P32A 5JI3E 4V0MA 1QRAA 3HYTA 3UANA 3IBYA 1WE2A 2Q21A 4MRSA 3W9YA 1P5ZB 1T3SA 1TEVA 5FI1B 3GLFB 1HUQA 4IDOA 2FZLA 4KFTA 5BYJA 4HUQA 3VU9A 1N0UA 4DLTA 4KBFA 3IHWA 3MD0A 1OSNA 4PX9A 5CYPA 1K6MA 2WWXA 1F2UA 2ZJOA 4CEIB 4C0AC 2P6RA 1NKTA 1CEEA 2F1HA 3CPEA 1U94A 2BBSA 5AUNB 2J41A 2FV8A 4O0MA 3PJRA 3TBKA 2CCKA 4ZDJA 2GXUA 1VTKA 4HDCA 2QUZA 3K09C 5DN6A 1FX0A 4NCJA 3CLVA 3AP2A 4YXWD 5AWFC 1P72A 4UXIA 1W46A 4DBLC 1W4CA 4D26A 1N5JA 4TLCA 2WJVA 4EPXA 1E94E 2VA8A 4DLRA 2LKCA 5BYKA 3CRMA 2MSCB 2O8EB 3PUVA 4M9XA 4I4LA 5AJXA 4EJSB 2WWWA 3BFXA 4CF7A 5C18A 2FN4A 3L8ZA 4PAOA 2V7QD 4PSAA 3RSLA 2FSIA 4JVSB 1KKLA 5AJZA 3AP1A 3AVVA 1YJ5A 3A58B 2CNWD 4F7WA 4B3CA 4C0BA 4F4IA 1COWA 4PHHA 4PSVA 1XCPA 1JEEA 1R5NA 1NN0A 5FR2A 2YHSA 1QVAA 3KTAA 2O0JA 4IDPA 4B74A 4KVGA 3RWOA 1J7KA 4DCNA 1NJFA 1YZQA 2QT1A 3FYHA 3MGCA
chains in the Genus database with same CATH superfamily
1TKRA 3ID6C 1U0BB 4E0BA 3B60A 1SBTA 4HQKA 4UTPA 4XTRA 2QMZA 4I3HA 1C3LA 2BFDB 4YYZA 1U8YA 4K03A 1VBKA 2XX3A 3I9V6 2YIVX 4LBYA 3GMDA 3Q2KA 1CVLA 1HDIA 1A9QA 4D4LA 3LC2O 1U1IA 2GKSA 4TKUA 4UBLA 4IDQA 1C4OA 4CEJA 2OCYC 3FGNA 4ZFNA 4TUYA 1L5ZA 1RJFA 3TD6A 4YCMA 2OO5A 2V6GA 1PUXA 3ZZ0A 1VA4A 3DC7A 5C8YB 4TV9F 4OV6B 4YUXA 4KXWA 1A5BB 2RHGB 4ZT3A 3U4QB 1G9SA 1YGYA 3JQDA 4YRJA 5HP4A 2O2EA 5EA2A 2PS3A 3VC7A 5DHPA 2C99A 2IXGA 2JFPA 3HDQA 1CQWA 5FJIA 2C5FA 3NNDA 4Y0NA 3EQ8A 3AVUA 4E09A 1R6UA 3SXUB 4HAIA 5EFOA 2COKA 3O5AA 2JLAA 2Q5LA 4MQLA 1FCJA 1YBFA 2ZS8A 4Q3LA 1QGAA 1ZOLA 2C2MA 2AR9A 4I46A 3KFXA 3DM9B 4X93A 3WNZA 3L4JA 5JAOA 4P84A 3ENVA 4XH9B 1HE3A 4G5OA 4NPCA 5JS1A 1XP8A 2BH9A 2ZATA 1NUTA 1BAPA 5DTIA 5I7FA 3FPKA 1V5WA 4LJ6A 1MJ5A 1UBUS 5HVNA 2O8BA 1RI4A 1IG0A 4ZQEA 3QSYA 2AOVA 5EJ4A 4RD6A 5JAMA 2D5BA 5BNFA 3TNFA 3SOZA 1WA5A 3Q7TA 3KWLA 3TRHA 2CJYA 2QR5A 3IKVA 4LWZA 5DYGA 3WV4A 1JQKA 3BFVA 4RKQA 2AFRA 3LTNC 4E2XA 1JIIA 1Z18A 10MHA 5J2TA 3VMMA 3DG9A 3AR8A 3MYYA 4G4GA 4R51A 4F2HA 2BHTA 4EHLA 4MV1A 5B12A 4BYMA 3EZXA 2I8LA 4LZAA 1FBNA 2NNLD 1LTKA 2IZ5A 3ILYA 3PTZA 1LSOA 4ARBA 3FD8A 3O8OA 4LCBA 2Y2VA 4PEVA 3IR6A 4Z7NB 3GLIE 2FJUA 2CNNA 1DQZA 3F8SA 1A82A 2IHKA 2WNSA 4BFVA 2JIPA 3ETEA 4LPKA 3OIYA 3GGCA 3NHZA 4ALJA 4FW8A 4CUZA 2JAWA 2BE7A 2OGWA 1GTVA 1P33A 3A70A 1X0VA 4H08A 3ABSB 2VBCA 3C3KA 1O95D 4WKBA 4AP6A 3QX9A 3K32A 2K6GA 5EIHA 4BLRA 2R7MA 1FNMA 2WM8A 4KPFC 3PDIA 1FFEA 5G02A 3JRXA 1T3TA 5AJHA 1CRWG 1RWXA 2P2LA 1O3YA 3SDZA 4RK5A 1TKAA 2Z4RA 2LCFA 2RDMA 3DDWA 4FUTA 5L3VA 4CG0A 4O4LF 3HR7A 1O4VA 2JKVA 5C5EA 5D6OA 4YJ2A 2PZJA 3LH5A 4FWTA 3ETJA 5E4YA 4I81A 4S12A 3LQKA 5M2QA 2P9TA 1JYFA 1NZDA 3HHPA 3FTFA 1OXVA 2PSEA 1AMOA 4F6RA 3UC5A 1VLLA 2VHTA 3ZXYA 3VKUA 2B6HA 1IBRA 4YDHB 3T52A 3SXJA 1BMFD 4RA6B 3WX0A 2WJWA 1ECGA 4YP9A 3SQMA 1K2WA 1E96A 2QSYA 3C3XA 3W90A 4CM8A 2GNOA 3V33A 1VCHA 4ESOA 4A4DA 4ENTA 4F3CA 1U0JA 2VXCA 1YB5A 2FPKA 3A1DA 5FL7D 2BEJA 4I4TB 5A5GA 4ZPJA 4RK4A 4ZALA 2W0MA 5EXPA 4N5MA 3KTDA 1YJQA 2QX9A 1PKXA 1Z0FA 4W5WA 4AJKA 1YR9A 4X0EA 4JGBA 5FPHA 1K4YA 4TVKA 1PR1A 2PSJA 2HXGA 2XMSA 2NVWA 4ND8B 4BNZA 4G0QA 3CXUA 4DIFA 1IWOA 4A9AA 4GEKA 3IL2A 1MOSA 3LCCA 5AM5A 1YZTA 1OILA 4TWAA 1Q0TA 1ZRHA 4IOKA 5L4LA 2ANCA 2WQ7A 3ESZA 4MWZA 4PR0A 4WLVA 4ZGGA 3KSRA 1XPRA 1SVMA 5KYXA 4G5GA 1EHYA 1OGIA 4OX9Y 1WCYA 2HQOA 2W00A 1COZA 2VQFB 2ZSAA 4A8HA 3MTAA 3A4MA 4FZRA 2CVHA 3HWSA 3IEPA 1TPYA 1H69A 4IDAA 3TI9A 4BB9A 5DI9A 4EBBA 4IDEA 4PLWA 4LOIA 1KJYA 2OXTA 4FKMA 1SKBA 4HAUA 2WZQA 3KVNA 2GZ1A 2P62A 2VUIB 3CNEA 1NHGA 4S1TA 3NB0A 2C4VA 1FSPA 1B0PA 3PQCA 2BPOA 1HFKA 1YBMA 4WZBE 2WWFA 1OJLA 3PWSA 1M1XB 1T6BY 2EZUA 2QQ0A 1NC1A 4MO2A 5CJ2A 5IAJA 4W5NA 1KHHA 2O6HA 3D1JA 1BEZA 1NR5A 2IEIA 1MH1A 2P41A 5DWDA 3C8DA 2FUG6 1AD2A 3DF7A 3OKAA 4RQTA 1K08A 5IDVA 4ZVNA 2R3SA 4DREA 4GM1A 3P20A 1XLTA 3B51X 2G80A 5ANRB 3ZW7A 1XCJA 5TIIA 3PQEA 5KTPA 1KE1A 1UQTA 4W5JA 2HQRA 1TAUA 2HWYA 4CU2A 2JCXA 1T91A 1ZJYA 2WT4A 1Z37A 2AX3A 4XXHA 4DJJA 2Q8PA 3U81A 1MQ9A 2G1KA 2RHTA 5KTRA 4KG7A 4OHMA 3TKLA 3PFGA 4QHSA 4YPFA 1KTVA 4TLMB 1TCBA 2EBFX 4NMHA 4Y2UA 4IQGA 1QR2A 4EYKA 1TXGA 3QEOA 1DLJA 4HO1X 2JIZD 1N4AA 4R71A 3GYGA 3MS4A 2JI7A 4RSMA 4JLNA 4FS3A 1ZK1A 4X1KA 1QE5A 3AR9A 4Y7CA 2CLSA 3AEQA 3UG6A 1I0ZA 1V1MA 2WU3A 2YDYA 1RI3A 4L28A 3WAGA 2AK3A 2W2OA 1L7DA 1FFBA 1GUAA 3M70A 2QGFA 3QPCA 1SULA 4TUYF 1K7EB 4XUCA 1CY6A 1IHPA 1LBEA 4WASA 4G81A 4QULA 3P94A 3H2SA 2PAFA 4WFQA 2G06A 1RWMA 5ILQA 3EY9A 1Z22A 3ZHCA 4JCCA 3IE1A 1A8UA 2RBEA 4UKDA 1ZM2A 3OQPA 3ZDDA 1S8FA 4PSCA 4Q0MA 2EJBA 4EGSA 1V5FA 3DZIA 3T4XA 3Q87B 1U3CA 2O3SA 3NVAA 5BN5B 3SFVA 4CN9A 1VGVA 4RJLA 3RE1A 4RIFA 1XC7A 4TMFA 2BMWA 4HB4A 3I52A 1XZNA 4AN0A 4XB1A 1YQDA 3HBJA 1PGJA 2FPWA 2NT3A 5FPKA 4IQ0A 2ECKA 3BGIA 5FORA 3ZY2A 2YFYA 4ZHSA 2X22A 4QPDA 3KBBA 4YR9A 4ZEOA 3PWZA 5CP8A 1KQFA 1L9XA 4OFWA 5JEDA 3R9XA 1KVUA 1U5CA 3AEKB 4ID3A 1M1NA 5DO9A 5KTYA 2J0UB 1K88A 3GZJA 4E5PA 1YZUA 3R5XA 5FR1A 4ZU1X 3U7IA 2O8DB 1TC1A 3S2GA 4PINA 1IPFA 4JU9A 1WMDA 2WUDA 3ZE7A 5A0VA 3RLIA 1DIHA 1MORA 2OGZA 2JD2A 2CLEB 3VVCA 4FT2A 4R8VA 2H18A 5J2TF 1PT5A 4S04A 4LQ4A 1QYRA 4RY8A 1OHHA 4LNUA 3TJMA 5IZCC 4BZZA 4WERA 3CMMA 3O3NB 5HE9A 4M1YA 1RQXA 2WJJA 1NI3A 1B93A 4KNVA 4N6GA 3NX4A 4X45A 5HDBB 3PENA 4JI3B 4B83A 4ZJPA 1M2VA 1U0HC 3FVTA 3N86A 4MTLA 1R74A 3Q9LA 2ZTLA 4RZXA 4G4JA 1P5JA 1U4NA 4KYVA 3RRMA 1RAGA 2PMDA 3OO1A 3V4PB 5JNTA 5ED4A 3MHTA 2C00A 2ZVPX 4UTZA 4UCWA 4Y1FA 4ZDWA 1U6IA 3VNVA 4LYEA 1V7QA 2OPBA 1H85A 4DFDA 1XJQA 2HSDA 3STWA 1WF6A 1KIFA 3R9KA 3UCFA 5AI9A 4C4ZA 4G5QA 1FP2A 1V47A 5F4BA 3QMPA 5CUQA 4FCVA 2VTBB 1E20A 1M0TA 2HRQA 1U3WA 4WZ6A 1A98A 1A04A 2V3VA 3QPAA 1C7QA 2B99A 2CXRA 3PEVA 4KYUA 2F1OA 2PXAA 5AKKA 3UKDA 3ZWVA 3T9EA 4E31A 4MVXA 4F12A 2VEDA 1S8AA 3M5PA 3UJ7A 1AUQA 2RCNA 3DZHA 3DH0A 4BNGA 3R0IA 1MABB 2C4MA 4HDAA 4PG5A 4Q00A 1EQ2A 3G5MA 3BCSA 2FGKA 1QFXA 4UUMA 2YVAA 4F11A 2QRNA 3L9XA 4HYQA 2DEUA 4OI0A 4NZZA 1V1JA 4RVOA 5BQPA 3MINA 2A3RA 4DJ5X 3RUAA 1HDZA 3TQQA 2POQX 1DTWB 3H9EO 4OCZA 1M1YE 2JBHA 3OUZA 4CQMB 3N2YA 1WUJS 1DOAA 4QGBA 2VSOA 4ZO4A 3DMDA 4Y67A 3CO5A 3MSCA 3W5IA 2VSQA 1WCIA 1A96A 1G0OA 3HP1A 3K9QO 3NR2A 2BEWA 4Q3EA 4QT4A 2QRJA 2HFJA 2F9FA 2A88A 3L3BA 3PFFA 4QYWA 4UBIA 2CWWA 2WTUA 5AQ1A 1S9DA 1ORIA 4IQ8A 4F3YA 1PW5A 1QIFA 5DM4A 3STVA 2PCLA 5FO0A 2X41A 3H86A 4Z4EA 2EV9A 1N6KA 1YJBA 5J58A 5EZQA 2QAGC 1FNCA 1PVVA 4RMJA 3OCYA 5LLTA 2NACA 1WAMA 3I1FA 3BK1A 1LW6E 2JKYA 5DWVA 5KAMA 2H5JA 3WGVA 3U2QA 1ULAA 1LQ2A 3C3YA 5FQOA 1JBKA 3WZMA 3CRW1 2EYUA 1HNWB 2CL0X 1LH0A 1FP6A 3GWZA 2CNLA 3MPUA 3MMPA 3K6SA 1X7WA 1X7YA 3D4LA 3HDJA 2HHHB 1LRLA 4CKEA 4BDTA 3RYTC 1QRDA 3HBFA 2FFQA 3BVPA 2HYDA 3CE9A 3QWBA 5DOZA 3ET5A 5AW0A 5T67A 3GRAA 3L1UA 3F0TA 3P1JA 4H60A 2BEUB 1C0LA 3QHAA 2EKPA 4K3VA 2BF7A 2AZ4A 5FA6A 1OYYA 2PWYA 3A1SA 2Q4EA 3FKQA 1J1ZA 2YV2A 5DHUA 2OV3A 3DAYA 3QU4A 3VH4A 2IYVA 3PB3A 4ZTBA 4M46A 2GJ9A 1L4GA 2E4YA 4FVTA 1JW9B 5JWOA 4HRYA 4AQ7A 1Y8RA 2CXTA 3MAAC 4PNPA 2C7GA 3ZCUA 4DL9A 5AW7A 2G5GX 3PGA1 1E5TA 3NDIA 3EC2A 4RE6A 1DAEA 1FYXA 4KJZA 1DINA 3CPSA 4X90A 2WUFA 1RC1A 3BK7A 1SBZA 4JL8A 3CX8A 3N2NA 3JYLA 3UWSA 4A0GA 4CMIB 5KTKA 2JGFA 4AMZA 1P2FA 3IYLW 1WDWB 2Z5LA 1PR2A 2AQKA 3ORHA 1UK6A 3FWKA 4X65B 1OZFA 3DZBA 4P22A 1NJSA 2P9QA 3AW9A 3KR2A 4NQRA 4NV3A 5I48A 5JU6A 3EXFB 3BMQB 3WYCA 1YI0A 1IY1A 4WLEA 4MTCA 3WLOA 1ZOIA 3ND5A 1ATZA 1NKVA 2I0FA 4RDCA 3V55A 4C0KA 5KPJA 4DB2A 2PZ8A 1I94B 2O54A 1H94A 3LL4A 3EFOA 1Z63A 3F46A 3W7VA 1ZGAA 3P4YA 3A9RA 1JR4A 4DNPA 1TLFA 4XGIA 5MFPA 1DCTA 2NSLA 3BJRA 1M6EX 3S2YA 3OPXA 5DU2A 4ID9A 4B43A 2KW5A 4BO3A 3FFWA 1KDZA 3E1SA 2WINI 3BDIA 1ZK4A 1VIMA 4XI9A 4DXAA 2J09A 3S2FA 3O03A 5F9HA 1FIUA 3ZLVA 1D04A 4ETWA 1NPYA 1W0JD 3BMNA 1PJ8A 4BQNA 5LVAA 3E84A 1JFSA 4ZV4A 2D5IA 3K1JA 2L42A 1YZNA 3PCTA 2DB3A 4FINA 3K1YA 1EA5A 5I47A 1NONA 1VMDA 4JJFA 3IERA 3WNVA 3PIIA 1RYFA 1TCUA 2BMJA 2DWCA 2NG1A 5CB4B 3QW4B 2PUAA 1UP4A 4NDZA 4KQFA 3JZDA 2J67A 1RWOA 3FHOA 1PYGA 1XX6A 2XYVA 2HMVA 3AFHA 5LPNA 1ODIA 4WOJA 1WEKA 3WGGA 3RNOA 4LF9B 2QN7A 5IUNC 4IM7A 2OGTA 3OIUA 2ZU6A 4Y1RB 5HCIA 1II0A 1QCCA 4PICA 1UDWA 3ZS8A 4C0JA 3EYWA 3IOYA 3OFKA 2QD1A 3Q5GA 1GL3A 4UHHA 1O94A 1YDMA 3L7JA 1C1XB 1M1ZA 3KL2A 1FTYA 1YE5A 4O8CA 4OUDB 2P40A 3WB9A 3JARA 3PBKA 3HCCA 2BFNA 1U80A 2DERA 1F06A 3D0OA 1ZRNA 2I5PO 1PWXA 3Q0EA 2PGOA 3FTCA 2IUSA 3W34A 3HLYA 1V4NA 4JJKA 2Q6OA 1G1AA 5BQ5A 4IJKA 3CSSA 5EHQA 2PUWA 3K3PA 1NJGA 3ZDQA 3PGMA 3O9VA 1OKKA 3T5PA 1NVWQ 1VE5A 1A7KA 1V7PC 1YJAA 3ECSA 2BI4A 1YQTA 2WVJA 4LYAA 2NZXA 3E6AA 2GASA 3L4EA 1D5WA 3GJ4A 4B73A 4ATNA 1M72A 1W49A 3O8DA 5BNIA 3CWQA 2GBCA 3KJGA 4H7IA 2YXBA 5ABPA 3ANYB 5DW3A 2GUWA 1CLEA 1P5FA 3QMMA 3ZW8A 2OP1A 2IS6A 1EE9A 3VI4B 2CLLB 2OBYA 2OG1A 5TQ0A 4G2NA 1R15A 5A3SA 1J07A 3TS1A 4AJ2A 2GF9A 4XOUA 1PNQA 5DT2A 4N82A 1THTA 2C88A 3A1NA 8AT1A 2IXDA 3S1SA 5PNTA 2D1QA 4EB0A 5I7UA 2BMFA 3KWFA 2ZRJA 4YRZA 5FWYA 2ZTVA 3A1EA 3O8QA 4TTTS 1WHSA 4DLNA 3LW7A 4J0DA 3Q7IA 4AS3A 3ZIUA 4I5GA 4Q9AA 1S01A 2ZBEA 3GIWA 4R84A 3NJ8A 1IH8A 1QS0B 4ZZIA 5C81A 4HNRA 4GUAA 3T41A 3VGPA 1FDTA 2EXXA 3UOWA 2QTVB 3QVWA 4QYSA 5E2BA 4QAQA 1OI7A 2HLHA 3SICE 1E3WB 3KYDA 3RU7A 4AJ4A 1T43A 2C2GA 3GNSA 1SXJC 1C2YA 1SU7A 3LX4A 4MYUA 1Z26A 4A2QA 4CV0A 3DA8A 5DHAA 1XQWA 3AGQA 3RS8A 1V5GA 2CYBA 2Q6LA 2FVYA 2VL7A 1E58A 3IO3A 4Z3DA 3VPSA 1ZSNA 4M8SA 1Q19A 1VL0A 4OQPA 1TQDA 3DMTC 5K20A 1GTG1 3FCUB 1SQ5A 2XXAB 2H92A 1XCMA 3MOGA 2CNOA 1E1RA 4MRVA 4ESEA 1UXHA 3LL7A 4BQSA 1E2FA 3OQBA 4J7XA 3ZTWA 2SBTA 2ROQA 2H65A 2CE2X 4Q21A 3IV6A 5B3LA 3TVDA 1XFDA 5J4KA 4F4FA 5F7JA 1XEAA 2M32A 1NVTA 1NE2A 1QFZA 2OTCA 4FGZA 2JI4A 2AN3A 2RBGA 5JUWA 2OBBA 3O4RA 5IN4A 2ZAIA 3RREA 1U1DA 5EHIA 1RMTA 3VC2A 5K8VA 1Z8FA 2W37A 2HF7A 4QXQA 4RFVA 1ENOA 1YK1A 3I4LA 4NBLA 3SYKA 1F6DA 1KBQA 2FR8A 4WCFC 2CBGA 2B4YA 5ALLA 3GN2A 2NNWB 2QRHA 5AW4A 3HEAA 4A23A 3E8SA 5LQNA 2NUTA 1FVXA 1PX0A 1ZI9A 1WCXA 2GO1A 3G6KA 5FI0B 3THSA 3HADA 3SYTA 2PUGA 3MMZA 3MTJA 1WMFA 2GPJA 4BQRA 1E77A 1FYDA 1QGYA 4BYGA 1X80A 5D6NA 4GMHA 1GQSA 2AFHA 4CQLB 4HJXA 5IHPA 4PYIA 1HG0A 1PX2A 4O2BB 3C6ZA 4ZVLA 2O5VA 2X2EA 3WMWA 4CLHA 4K05A 1FVOA 2XDQA 2R97A 4LYHA 4TVOA 3HYCA 5AKYA 3ZU6A 4CZ2A 2I6SA 3TQTA 1RAFA 4IV0A 1SQ0A 3E1GA 1RWWA 5FXMA 4PN3A 3SS9X 1KMIY 3BD7A 2IW1A 2AF3C 3A6HA 3KJQA 1K8YB 2NZWA 4ZMRA 1P0PA 2JGMA 3IURA 1XK7A 2DMRA 1Q7GA 8ATCA 1Z6YA 2VXOA 2OWEA 2D0DA 3UHPA 2H5EA 2Z5GA 4IV5A 3UGQA 2O8EA 2ZWMA 4E46A 2VCYA 1EG7A 4A0QA 1EB9A 1DAMA 4RETA 4EJSA 1SCAA 2H31A 3UQZA 3N59A 4J0GA 3DS8A 3E4CA 1JDUA 3D31A 5T41A 3LK6A 1HZJA 1QTRA 5F23A 2O1WA 1TM7E 1V9LA 1Q0LA 5J3JA 1I4DD 3NV7A 4FZVA 2GJKA 2J0QA 1UODA 5I5GA 2C07A 3WL6A 5CFQA 3TGLA 1IUKA 4JLBA 5KVAA 4N5LA 1T8RA 1ZH8A 3G0DA 2PTGA 3H8WA 4J4HA 4QJBA 3UIEA 5AXAA 4C22A 6GPBA 3K9HA 1NM5C 2FUCA 1CY8A 2Q4BA 3RRBA 1NY5A 2X4GA 1PV2A 3BGDA 4ZEVA 4FB4A 3KKKA 1GAWA 4HRVA 3U6KA 2WSYB 3EIQA 1OI2A 1AUXA 2QMQA 4S24A 3OJWA 2RJNA 2WYOA 7MDHA 2OQRA 3OOSA 3F47A 5ADWA 2C5EA 1CPYA 2IY8A 3D5QA 4XPIB 1EEXB 2QJOA 1JPUA 1KY5A 1YULA 1ECLA 2D62A 3T3DA 4U39A 4U63A 1XVTA 4IVPA 4CIDA 5IYZB 1L5HB 2JBAA 3MTBA 4QJIA 1RJDA 1H8HA 2HU5A 3IA7A 3OOYA 4B8ZA 4E30A 3VAZA 1BJTA 3TBFA 2B5OA 2I2BA 4CDGA 5IXYA 1ODCA 2RK3A 2VPYA 3L7BA 3N8GA 1KOLA 1CNEA 3HBLA 4HNTA 2FOLA 3JD3A 2FK8A 4OSEA 4MKRA 3T1NA 1NBME 2VT2A 4DLKA 3W5DA 1PYOA 4UM7A 4PYJA 3K1TA 3WIVA 4H1UA 4DVJA 3RC8A 1HE4A 1FUIA 2XUAA 3CEJA 4HXGA 4N65A 1WV1A 3M6MD 4KI7A 1SIWA 4Q9IA 5IBRA 4RVUA 3ULKA 2QTGA 3W05A 3V97A 3BZWA 4OKNA 5G0SA 1W0KD 3GFBA 4N18A 2ID4A 1LPPA 4JH0A 2GBPA 2I4RA 4LDQA 5BO5A 4BEWA 4A6EA 2E21A 1MMFB 1BFDA 4DR7B 2WHQA 4D3FA 1KDYA 5E6SA 3FIJA 1XMIA 1P4HA 4OU4A 4LTDA 3ABOB 5FYDA 3VZDA 1JI0A 5C1PA 4BWYA 3LZ6A 1KEEA 2DQKA 3GUCA 4OFBA 4RV5A 2BOVA 3UJHA 4S1OA 5LJLA 5E6UA 1XD9A 1E3MA 3W2TA 1IG3A 3HP7A 4MW9A 3VR4D 2YN0A 2XE4A 1T1SA 2MYTA 2ZRPA 1V0JA 4KRGA 2OOSA 3RVBA 4CODB 1AIPA 1JA0A 5SY9A 3T06B 1KJ9A 3L8CA 4NS4A 2IHVA 3VV2A 2RGDA 1KXZA 1EQAA 3MNFA 4QO7A 3BE6A 4M0CA 4RORA 5KJ1A 4LZJA 4OLHA 1U7PA 1W85B 2MYPA 3KE8A 3QG1A 3I73A 5EPEA 2GARA 4YP1A 3WTBA 3OFSA 3T4EA 4FBMA 2FEKA 5FBLB 3TIGA 4B4WA 2HW8A 3H83A 2H9YA 4BUZA 1R4ZA 1L7MA 3U49A 2QLBA 3QVKA 1VLHA 3T0FA 3J81k 2AEMA 1D4ZA 1JHRA 5TS3A 4EB6A 5JRZA 4TTSA 4ZHQA 1L3IA 5D1HA 2PL3A 1VSTA 5BVHB 3A4LA 3KAQA 4IWXA 1X1EA 1GGFA 1BCSA 2DKOA 3RSZA 5BSKA 5KSPA 1MC4A 1GLGA 2WE7A 4BDSA 1EVYA 2X4IA 4FHFA 4J9UE 1AQIA 3M6LA 4G24A 1JR3D 4RIEA 4CETA 5FOSA 3GRVA 2B9EA 3DGFC 3LKVA 5K6AC 3KPYA 2Y05A 3PVSA 1XTRA 2PA3A 3UK6A 3C7CB 1Q91A 1G21E 3LNTA 5FTLA 1PFKA 3D6AA 3BQ9A 4ZXFA 5JJBA 3L04A 1ZXLA 2IOQA 4D2IA 3N3AC 3TXYA 4BCDA 3NHBA 5KQPA 2I2XB 2Z09A 4MCJA 4NOJA 1AY0A 2B6NA 2WAYA 4JBHA 4J0CA 4MWDA 3KHKA 4N8SA 3R3WA 4PX5A 4BO2A 5KMGA 3C7KA 4DIEA 1Q6ZA 1YKFA 2WZDA 3BICA 3OTGA 4XSVA 4AI6A 1LTHR 1NVGA 3KPJA 4WSOA 1RFLA 3U7EB 3TTTA 3LAWA 5JNSA 1Y89A 2ZI5A 5LP6B 3OZVA 5DCWA 4PYQA 4CHGA 1HV8A 3B5JA 2H2WA 3WKAA 1F4VA 5F52A 2K4MA 3L4SO 2XBMA 4OVKA 4JQOA 1U31A 1MBZA 3GLKA 2P11A 1X74A 1VI2A 1Z4PX 2WHYA 4GAEA 2X3YA 1U3FA 4BNDB 1TI7A 3GJXC 1K92A 1UPXA 1Y7LA 2H85A 3H9UA 4XWAA 4C4PA 3IIMA 2OHJA 3N8KA 1C4WA 3N39C 2QI9F 3NFRA 4L57A 1F8XA 3I0ZA 4TLDA 3GQVA 2GNAA 1K7YA 3MGKA 3NHUA 4XQ0A 5GOTA 3UMBA 5JCOA 2V5VA 1V3VA 2J3KA 1HZZA 4LECA 3EPKA 1Z4MA 2V03A 3OZRA 4QFMA 4I1UA 2UXDB 3UO8B 1HX7A 4BFLA 1QTIA 1ZHFA 1ODJA 4NMXB 4PLZA 1DKNA 1FNSA 2H3EA 3NTVA 1YL5A 1QU2A 2JD0A 2XW6A 4X9XA 4LOLA 4Z4QA 4RFLA 5G0TA 2YR0A 4FONA 2KM1A 3FSEA 4J16C 3ORQA 5K0NA 4US1R 2I2CA 2ZSEA 1GKLA 2RAFA 4CYMA 1EVZA 3HKBB 4AKGA 2RH5A 3ADKA 2JFUA 3TVYA 5K8CA 4Q3OA 3BGVA 4KUHA 3TLCA 1BH2A 1EK2A 3B36A 3DTVB 3BT7A 1YOBA 1G7CA 3FMFA 5K3AA 1ZH4A 2XGMA 5DGXA 3F67A 3EEBA 3OD5A 1E2NA 1QANA 1NP6A 2PWPA 3FSRA 1MVOA 1IBSA 1FXSA 5CA1A 4LY0A 2FLVA 2ZXEA 5JS2A 4UZSA 4RSGA 4C0HA 4FFRA 5HRAA 4QU5A 1XNQB 1NRJB 3K92A 1N2SA 1XGKA 1I6MA 5ALMA 3NEJA 5DJ5A 3A3YA 3H6GA 2CK3A 3PE6A 4OHUA 1ICEA 1DJPA 3JD1A 3EIWA 4OIMA 3HO8A 1QBKC 4MS4A 1NFRA 3AZQA 3BCRA 3CNHA 1V9CA 2Q9CA 4JXKA 3DMHA 4YCBA 4ZC1A 3TMKA 3V8MA 3HB4X 4NXMB 4LJ7A 1N7HA 3CN9A 4OQMA 1NRWA 5ECDA 5JI2E 1O54A 1NG9A 1J06A 3U9LA 3MT8A 5CXUA 3WJ1A 2CGEA 3PT5A 2GMWA 3U37A 4REMA 2XCUA 3I28A 1IC6A 3FNQA 3JAWB 3H97A 1JYEA 2D5LA 3I0MA 5DXFA 2VF5X 4PTYA 3WGHA 5JDCA 3RV4A 5HILA 1K97A 4B6JA 4OK5A 4DYVA 3CVOA 5JRDS 3G2LA 3PIRA 1ONNA 1ESZA 4KSYA 4BBAA 2HU2A 2WY2D 1Y4DE 3CVXA 1WPRA 1T4BA 1F6BA 3WRYC 2P65A 4WN9A 4W63A 3RJTA 4BECA 1ECBA 1D07A 4BE4A 4BV8A 3VXKA 2BTOA 4Q1CA 1FQKA 1SC3A 1G60A 1F4LA 1N0IA 1RAEA 1IB0A 2OBXA 4OKSA 2DWUA 3IBSA 1JYSA 1VI6A 2OV8A 4L85A 5K0JA 1OUMA 4YX9A 2A7XA 1XKLA 1LUAA 1D8TA 3M49A 2HC9A 5TGZA 5B2FA 2EWWA 3LBYA 1O58A 5BP7A 4BX8A 3GEEA 2GRAA 2ZIAA 5IKXA 1E9FA 2E3JA 2PY6A 2RGWA 2IS1A 3H4TA 1F1BA 1ZM7A 1VQ1A 3NRBA 1OBFO 1AA9A 2YASA 5DHFA 1I51A 4C30A 3WMEA 2VJQA 2DR2A 1Q3KA 4PXSA 3PP8A 1NIPA 3NMUF 3EQ7A 4AY2A 1M67A 4NMLA 1E7QA 2GETA 3RFCA 3UVEA 3E23A 4DV5B 5LQSA 1SKMA 3NQ41 1KMHB 3UMRA 1T9GR 2EDCA 5C7OO 4YJ3A 2PH5A 1EFPB 2ZYRA 4RKFA 5A03A 4C20A 1WB5A 1LS1A 2Y67A 4LA4A 4QODA 5IHXA 2Q3CA 3PWTA 4D0SA 1N2HA 2WJ6A 1JBEA 3SMVA 4IXDA 1GITA 1W52X 1FFGA 1ZRMA 2YW2A 1LF0A 1NF2A 3UA4A 4AP5A 1GPWB 4FFMA 5UKDA 3HJTA 2KHZA 1YZHA 3R8CA 4N9QA 3FIUA 4WQMA 4EJ0A 3OC0A 3BE5A 5AVTA 4P36A 1UXKA 4OXRA 4B48A 5P8WA 2F8SA 3MT9A 4GPZA 1LQUA 3CLSD 4I99A 1FDWA 1QKKA 2IP1A 2J9RA 4ASUA 5JQWA 3KXLA 1CYDA 5IJ9B 5GGXA 4UDYX 5C5CA 3JATA 1SXHA 1IULA 2PLFA 1IRIA 4CVNA 2PJRA 3WQBA 1O5IA 5LQCA 1E2EA 1XXHB 3L40A 4XGKA 4KQ1A 4D44A 3JQ9A 1XK6A 4H3HB 4ZHQF 4ERNA 1KPIA 2P9BA 1VE1A 1NXPA 2ZBPA 4GSLA 5BSEA 1DWPA 4HOYA 4DV7B 5BSGA 1I0IA 1NVVR 1ZW6A 3M6VA 3KU4A 4Q16A 3JYOA 1I8TA 1ZYUA 5HMLA 2WLTA 4D4HA 5I7HA 1Z07A 2P9JA 5IC4A 4TTRA 3VZPA 4JYAB 1SK8A 2QD5A 2QWXA 5JZVA 2O0HA 4NJMA 1OI4A 1DAPA 3FAZA 1ADBA 1E8MA 2PPVA 2M6RA 3DVLA 4D4KA 4JN6B 2FQWA 3VFDA 5GVSA 5J5VA 2Z2ZA 1XO1A 3DWGA 3FYDA 4ZRNA 2OORA 1I3CA 1U8FO 3ZVRA 2Q07A 3A37A 3E9NA 4NYIR 1AZTA 4HTFA 5LA6A 2LWIA 3DBRA 3TWOA 4LF7B 3VR1A 5A7FA 4O33A 1B23P 4Z3KA 5EPUA 3TQOA 1GNLA 3HN6A 5DDIP 4N0DA 3V2UA 3H2HA 3UNXA 4BN4A 4J3FA 5KCMA 1IE3A 1FSGA 1CY4A 5AI6A 4DYDA 3BSYA 4UUNA 2YNMC 1KFJB 4XOIA 3U7JA 2IYRA 5LP6F 1XJ0A 1ZIYA 1JLMA 1R64A 1U02A 2QHXA 3AOEA 3HKEA 4M76B 1L5RA 2QA5A 1EDEA 2ZRGA 1SJ9A 5DBOA 4F38A 3IJEB 4EABA 1EP3B 3ITDA 1Z0SA 1H2ZA 2EJCA 2PIAA 3FB4A 3HCBA 4L4YA 3N5CA 3UAOA 2VF7A 4TKVA 3BMOA 4R83A 2H52A 4RK0A 3TN7A 3TECE 3W5SA 5BV8A 3CBQA 4IDNA 4ALKA 1JSXA 3SC2B 3CUSA 5GVRA 3B70A 5CDFA 2HCBA 4FDUA 4QYXA 3WGUA 1FUKA 2ORIA 4PFQA 3K0HA 4R05A 1B73A 1VYVA 1JSLA 1TM3E 1RLTA 1NLMA 2HLDD 1NF8A 1CJMA 3BJIC 5DEIA 1RW4A 3IQEA 5T7BA 1QHSA 1YZGA 3L82B 1NW5A 3G2MA 1D6NA 5C52B 3HWWA 4XWWA 3IAEA 4JK3A 4BWVA 3TAUA 2AFIB 4C9BA 1XNJA 3FSGD 1CC1S 3EOAI 4QBTA 2FN9A 2ATXA 5BN3B 2ZQ5A 1U2DC 1XJWA 1MF7A 2O2IA 1DAHA 2VDUE 4JDPA 3UG7A 5FAKA 1CF2O 1PFUA 3QXCA 5J4VA 2BGIA 2HT1A 3ZNQA 1USWA 1R8SA 3O31A 2ORYA 3NEYA 5CPBA 2WAOA 2XTMA 4QNNA 1IAQA 1BWQA 1K7XB 1KFBB 1U1EA 2ODBA 2QQEA 3DTVD 3IT0A 4X61A 5JNRA 1G66A 4BVHA 3AVTA 5KPDA 4JQCA 2A0FA 3FOCA 4BIMA 4EY8A 1JSCA 2FMFA 4ER3A 2PX4A 3D5TA 1GFZA 4JGGA 3GAFA 5TPZA 2WP0A 4RX1A 4FDLA 1CIPA 1FBTA 4HP8A 3U1VA 4EY6A 3HCPA 1Z4QA 1C8KA 1JV2B 1SHTX 2WIKA 3FPAA 4F93B 1KR2A 2J7PD 1GQOA 3L6OO 4KAFA 2ILTA 4MVJA 2CMKA 2EWMA 4TYMA 3MAGA 2JFHA 5F9MA 4F60A 5JC1A 1QGDA 5LIRA 1AZSC 3OX2A 4B0OA 3BDVA 3TB6A 1LDBA 1GUDA 3L7CA 4RF3A 4EO9A 1MO5A 1TD9A 1HKUA 4ZQGA 3WICA 1IRXA 3BWMA 2DKNA 2DP4E 1QLWA 4RW0A 1AK2A 2OAEA 2UUOA 4FTWA 3VH2A 1FYFA 2JLQA 3CLTD 1K89A 4Q6WA 3LLVA 4OTZA 1XU9A 2HA2A 2W48A 3O8LA 1VBMA 2GAIA 4FE3A 4U4AA 4DMMA 1X15A 1XZ8A 3K9GA 4RJIA 2DETA 2AA3A 1VRCA 1KWGA 1WEHA 1X1QA 1Y8CA 2NU6A 3U4CA 1EFRD 2A8YA 2GZAA 1T2AA 4H4DA 1Z2EA 2PV7A 3GRCA 4IUYA 4BL5A 4C3ZA 1IB6A 4UNPA 1BKSB 4IO1A 3H1PA 1ZNZA 3M7IA 3DZKA 3WZLA 5JSUA 3V2HA 4ACAA 3D8NA 1P7VA 3LDHA 3RROA 2CT8A 3SN6A 1HNNA 4GO1A 4ES6A 1QAOA 4DM7A 5KTSA 5JIBA 1SNYA 4IKOA 1UJ2A 4DCMA 2DGDA 2FKAA 4EG0A 4DAOA 4F1JA 3JTMA 2ETXA 1Q77A 4CNBA 2PZFA 1V26A 3CZMA 1Q7BA 1YONA 2BDUA 2IYTA 3EG9A 3D54D 3F3YA 2B2NA 2ORED 4GX2A 3UM9A 3AY7A 4PGGA 3ZHXA 4YJ3F 4PV7A 2JK0A 1SUBA 1NVFA 1P2TA 4ILEA 4M7WA 1BNCA 1F3OA 4B4VA 2EKQA 1NVDA 2WYWA 2IEZA 3B1ZA 3DE4X 3SZLA 2RMKA 1LVGA 4MWBA 3VR6D 2OE2A 1DHRA 3NVMB 1U3DA 1T0IA 2NM0A 1DIBA 1MC1A 2QN6A 3A6GA 1B8PA 4ITRC 2X5NA 1XPOA 2GCIA 4L7QA 3LDUA 1V2HE 1TQHA 2FHPA 3P0IA 3E35A 3P9PA 3QVXA 4NR0A 5CNKA 5D01A 3HVHA 3UC9A 1HLDA 4FHDA 3H42B 1GZ3A 3ZLTA 3WGJA 1A2QA 1ZI6A 3TX2A 1SVIA 5KYNA 2HSWA 1JG6A 4NWIA 5LD2B 2IBTA 3A4IA 1OBCA 2IGBA 2BZ1A 4ZICA 3KSUA 3OLVA 2YMLA 2P91A 3WRXA 2OHGA 4DS3A 1M2KA 4OQZA 3EXEA 4JKIA 1BRTA 1X7GA 5L40A 2C77A 3KQKA 1PV1A 2QVYX 3E1KA 1PEAA 4FYWA 4GC9A 3UFXB 4B2PA 5I9IA 3BTUA 4O4JB 4R40A 2O50A 4KDCA 3VPXA 1NBOA 1J8QA 2J85A 4DLUA 4F4DA 1UAAA 4WK0B 4Y0AA 3U7RA 1C7FA 4XAQA 5CW2A 3E22B 3BZUA 3IOMA 2AK2A 3UMGA 1Y8QA 4KR7A 1J2UA 5BN4B 2H59A 3KE9A 1NL3A 4R1OA 2BM0A 4DLWA 4IF6A 2OO5C 2W5UA 2XGGA