1JAIA

H-ras p21 protein mutant g12p, complexed with guanosine-5'-[beta,gamma-methylene] triphosphate and manganese
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAPGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gtp-binding
molecule keywords C-HA-RAS
publication title The role of the metal ion in the p21ras catalysed GTP-hydrolysis: Mn2+ versus Mg2+.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1996-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1jaiA00
1SULA 4PANA 1J8YF 1IY0A 2EYQA 1GRNA 3W3ZB 4ZDJA 4GI7A 2IXEA 2QT1A 4UXIA 3CPJB 5FOUA 4LBYA 2QGZA 3OE7A 4C0AC 5JLJA 3K0AB 1VKJA 1ZBDA 3RRNA 2GEUA 4KFSA 2EWVA 2N42A 3U6KA 2XJ4A 3U7HB 2PH1A 1FP6A 3EX7C 1N6RA 3P20A 3CRQA 3TVTA 2ZVQX 3AVXA 1P60A 1OLOA 2JASA 2PEYA 3LVQE 4QL3A 3A1WA 3AUYA 4HB4A 2IF2A 2QROA 1DG1G 1QHHB 3BB1A 1QHXA 1XTIA 5B64A 2FEOA 3IKJA 5EP3A 4M9XA 5J4YA 1R2QA 2NO6A 4JL5A 4MYCA 3ICQB 3Q3JB 1EK0A 1XEWX 4EDHA 4QBFA 5FOSA 2V54A 1GKYA 1VG0B 1AA9A 1OXTA 4XH9B 1E0JA 2WPDA 2PMDA 4XTCS 2ZRAA 2WJIA 2G3YA 3CIOA 1D2EA 4LJ5A 5F9FA 1XD8A 4TMKA 2O52A 1U9IA 3T06B 2J9RA 1OH8A 3NDBB 4TYWA 3VNVA 1W49A 5AUOB 2GCNA 2NG1A 2QPAA 4M22A 4NCJA 1E9BA 4BFYA 2RB4A 3FTQA 5AJZA 2H7VA 2HV8A 5TY0A 4DC9A 3RSLA 2IS2A 1IBRA 1G41A 1OIXA 3GLFE 3PVSA 4JL6A 4DSTA 2HLDD 3RABA 2PJRA 3U7GA 2WWXA 3B1WA 4A4DA 2BBOA 1TMKA 3OHMA 5E95A 1KI8A 3ZVNA 4F93B 1TPZA 4A6PA 3KDSE 5J40A 4D80A 2WMOB 4LWZA 2D7CA 1COWA 1KOFA 1E2KA 3ZZ0A 2QTVB 3QIAA 3CNLA 3RLFA 1NMXA 1W0KD 3KQNA 1US8A 1I4DD 4Y0VA 3QXSA 3WHKA 3LAWA 1G18A 1VHLA 4DLRA 1R0XA 1U98A 4CT4B 4TQAA 1IJFA 3LV8A 5KDLA 1UKEA 3UMSA 2D7DA 1E2NA 3CBQA 1Z6YA 4EFNA 4R9UC 5DI3B 5JHHB 1NMYA 4TQ9A 3AVPA 2ZAMA 3P4YA 5BN5A 5DI9A 5FUWA 4DUGA 3BIFA 2XTNA 1ESMA 4D4MA 1BMFD 2VHTA 3DMDA 3K0CC 1G5TA 1S96A 1YR7A 2C04A 4WIAA 1KI1A 3ZS8A 4LHXA 1Q3TA 5KPJA 1EESA 1UKVY 1KJWA 3EZ9A 1Z6XA 4O2RA 1KK3A 4MA4A 1NY5A 1NF3A 1MH1A 2WZQA 3I61A 2DWQA 4MGKR 1G8GA 1RRPA 4PC6A 2B92A 3B5JA 3TW8B 1DAFA 2J0UB 3AEZA 2RMKA 2ZJ5A 3K0EA 1RRCA 2NO1A 1KKLA 3K1JA 4GP6A 3UK6A 5AJXA 2VF7A 3TH5A 4FMCF 3LQRA 2A2ZA 2A78A 1QG4A 3WNCA 1NJGA 4OK3A 2Q3FA 3LX8A 4M53A 4CDGA 2ZJ2A 3GLFA 2VP6A 2UZ3A 2E9SA 3TUZC 3X1WA 3UWOA 1EG7A 2W83A 3BXZA 2ZRMA 4FMBB 5TB5A 4M2LA 2XNSA 2H17A 1Q12A 1N6LA 2N1BA 4QKQA 4LI0A 1II8A 5KHOC 1AZTA 5E3HA 2DR3A 2O8CB 1L7VC 1ONBA 1YZUA 5FBLB 2CBZA 3CWZA 4ZI2A 4P4SA 5L8VA 5G3YA 4YONB 2DFKB 4ARZA 1XU4A 1YR9A 4Q4LA 4W7SA 5KSOA 5FBWB 4Q1BA 5FL3A 2HLDA 2OM2A 2ZJ8A 5FOTA 2VSFA 4V0ME 4D26A 4P4TA 4ZPXA 1XBTA 3ZH9B 2VQSA 3SDZA 2O8BA 4MYTA 1OFIA 1XF9A 2IHYA 1VIAA 1DE0A 2ORVA 1ZM2A 3ZIAD 4CEJB 5KNDA 3CRW1 5L3QA 1Z0JA 5FTNA 4R98A 1S3SA 4XOIA 2R6AA 3A36A 3CUEF 4P31A 2FSGA 1MO4A 3QG5A 2VRWA 1W46A 2MMGA 1T6NA 4LHWA 3PR1A 1W0KA 3B9PA 4Q4AB 2RKOA 4B3GA 3TMKA 3MUFA 1U90A 1G3UA 2IW3A 2ZUBA 3FE2A 3CB4A 1E94E 2GZHA 3B82A 5HE8A 2Z6VA 1EFCA 4JT2A 1BYUA 2IT1A 1KMHB 4Q7LA 5FL7D 4CVNA 4DSUA 3U61B 4D0LB 4KLZA 5CM8B 4HB3A 1G17A 4DLVA 4RCYA 1OKKD 4OYHA 1BMFA 3PEYA 3FOZA 2ZR7A 4PZLA 5GADl 1P5ZB 3EIEA 3SZRA 5C46F 1F6BA 3GFOA 3NH9A 3U44A 4BFWA 3ADDA 4JYBA 3A6PC 4QGFA 4WZAE 1FQJA 2IUUA 1M7GA 3T35A 1IN5A 2KBFA 2ZE8A 3T1VA 3W6OA 1Z28A 4ZIRA 1TQ6A 1DPFA 3VX4A 1W4AA 1Y3AA 2ZS9A 5HE9A 3GJXC 1IM2A 3Q5DA 1OH5A 3UPUA 4LPSA 3AVVA 4JMPA 1JEEA 1QVAA 3O8DA 3SN6A 4PSVA 2ZYUX 3L8ZA 4TLCA 5C18A 1DAIA 4V0MA 4DDVA 2E1RA 2ZRDA 3LA6A 2O8DB 1OIVA 2CE2X 3FMIA 2CJWB 4RD3A 4QOSA 4TYQA 4BASA 4UNRA 1X86B 4M1TA 1TQ2A 1U2RA 1JAHA 2Z4SA 2AKYA 5LDDC 1TL7C 2XZLA 3HR8A 2CCJA 2FEMA 2ATVA 1Z0FA 2QRNA 3KKMA 4MGIR 1W36B 1CBUA 5F3WB 1RC8A 4KYIB 2FOLA 1K6MA 3C16C 1S9DA 2NO9A 1MABA 1SVKA 2BBWA 5JI3E 2QN6A 2CCGA 1QHGA 3B2EA 3TJZA 2HEIA 2MSCB 5H68A 3VR1A 1KZ7B 4CEIA 1E6CA 3HJNA 3N2EA 2BMDA 3EAQA 3BERA 4B6FA 1AJEA 2IYYA 4FCVA 5EUQB 4A8JB 3EIQA 4C3ZA 2OCBA 5SZIA 4RZXA 5CK5A 5KUTA 3NBXX 3W8NA 1QDEA 1U0LA 1HQCA 1GKUB 1G6OA 3ZIAA 2ZVPX 4HDCA 3PENA 2QP3A 4URZR 3K9HA 621PA 3LY5A 1HV8A 2IEYA 3AP1A 3GJ8A 1KY2A 4HDQB 3VR4A 1E3MA 5CM9C 1NG9A 1JXMA 1E2EA 2YNMA 2A5GA 1M6NA 3CF6R 2GJKA 3KJHA 5FOVA 4I1UA 4TZ0A 1Q1BA 2Q9AA 3ZQ6A 2BKUA 5D3MA 4BFXA 5AUQA 4PO8A 5C1BA 1PLLA 4GZLA 4TLAA 2JGNA 4JLPA 2QQEA 1B0UA 2ORIA 4D4KA 2AK3A 3TE6A 1YRBA 1NRJB 2BOVA 1UBGA 2OUKA 3CNNA 4MRRA 1H8ED 2ZU6A 2VLIA 4MKGA 3EZ7A 5DO9A 3SYKA 4I1SA 3E1SA 2GBLC 4US0R 5FL7A 4NMMA 3RHFA 4XIGS 3QENA 2J41A 1II9A 1SKYE 4LY6A 4B33A 3AVQA 4OI4A 5G3ZA 4F4IA 1ZJ6A 1OKKA 2GJSA 4ZCIA 4QJ5A 3LD9A 4FD2A 1CU1A 2PMKA 3PUZA 1MRSA 1SHKA 1XEFA 4QHYA 1UBCA 4C0HA 4DEXA 1NNEA 2A7QA 1FX0A 4YXWD 3N70A 1AGPA 4EJSB 1TU3A 3PUWA 1XMJA 3M1IA 1OFTA 2K5UA 3AVTA 4C0JA 2HF8A 3IBGA 2ODWA 3SI7A 1UM8A 3MCAA 4G5RA 2GVZC 4TSFD 1GAJA 4YMVA 1N5JA 2ZI6A 2VA8A 4Q4JB 1CR4A 1CJMA 2EFDB 1NN3A 2I1VB 4IJMA 5EZ5A 2BDTA 1IONA 1A2KC 3VTKA 4BFTA 5DHFA 1RPZA 2P6NA 2RGEA 4JKIA 3BS4A 1XTRA 2LWIA 3R9WA 3I73A 2ODBA 4AURA 3RWOA 1N0UA 3MD0A 3REGA 1CEEA 2KE5A 1T3SA 3RDPA 1YE8A 2PX0A 2R44A 3B1VA 4F38A 5B30A 3P26A 1W5SA 5GJCA 4Q7KA 1N3BA 5CB8A 2GF0A 2WHXA 1P73A 4AI6A 3I5YA 3BB3A 3CZPA 3KB2A 2ZQ5A 2VHQA 2GZAA 1PJRA 4LJ8A 5HZKA 3EZ6A 3QEOA 3O8BA 1AN0A 2IF0A 1KDOA 1X3SA 2XSZD 4IVQA 4HAVA 3SU8A 4DLSA 3NTUA 2ONKA 1JXOA 2VL7A 3TKLA 4AK9A 3SJZA 3RS5A 1WBBA 2DFNA 5L3SB 3O8RA 1XXHB 4D6PA 3GLHB 4WAUA 4Q7JB 1KAOA 1KMQA 3SJAA 3L8YA 1GZSA 1RW4A 4KFTA 5F9HA 2GKSA 4XWAA 2RAPA 3NHAA 2GAOA 2OV2A 1PUJA 4B48A 4LV5B 3BJIC 5JRZA 1KSFX 3K09A 4DT1A 3A4LA 3HU1A 2OAP1 5BWMA 1H8EA 4E22A 4BZQA 4G5QA 4I81A 1HE8B 3B1YA 1A5TA 1LS6A 1X1RA 4LV6A 2D74A 2KWIA 3BH0A 4DCNA 4DB4A 4C2TA 4LZZA 3I92A 5CYOA 2B7BA 2V55B 2QUZA 4EPVA 2CMKA 4YXWA 2LKDA 4BEBA 4D4LA 4B35A 4AYWA 5TARA 3QG1A 4LBWA 2L0XA 5SZKB 4F91B 3A4NA 5TVKA 2FGKA 1R6BX 3T61A 4PR0A 4B47A 3QBTA 4A2QA 1G19A 2NPIA 1G291 3AVUA 2C8VA 1XDBA 3EA5A 4PQYA 4RKEA 1E2QA 1E4YA 4TSFA 1GTVA 5LD2C 2ZI5A 4B75A 2ZE5A 2IYWA 2F6RA 2ZSFA 5B57C 3H86A 4HAUA 3X1XA 1YZNA 3SNHA 4HUQB 3K0FA 3L2OB 4NP6A 5EP2A 1KNQA 1VDZA 3RANA 3TVDA 3MFYA 2FU5C 2VO1A 2G88A 4KBFA 4US1R 4UNNA 3TSZA 1JB1A 2VYFA 1G5RA 1SKQA 2Z4RA 5CDFE 5K8IA 4F4JA 1VG9B 2IYRA 2JLQA 3OZXA 2DWPA 2OZEA 1MRNA 2FGJA 3WXMA 3NHBA 4ACBA 2HYDA 3H0KA 3U60B 4TYYA 4M1KA 1GUAA 3GEHA 5EE3A 3THWB 1N6OA 3PEWA 1OYYA 4EUNA 4ZKDA 4B6EA 1OFHA 2DPXA 2ZIAA 3HWSA 3QKRA 2AXPA 4LJ7A 1RIFA 3KUDA 3PQCA 4IHQA 2NZJA 5BXQC 5E4FA 5JEEA 3U4QA 2YINC 2QBYA 4N1AA 4BZXA 4WW0A 1U8AA 1XJQA 1ZNZA 1KZGB 1Q22A 2XSZA 4NL4H 4FWIB 1G8HA 4UJ3A 5K8TA 1XEWY 5J4LA 4IVPA 3VU9B 4DLZA 5BN4A 2BKEA 4DDUA 5EP4A 1NY6A 5KSPA 4FW9A 5EZ6B 5DYIA 5KYKA 3I1FA 2GCOB 2JLWA 1ZM3A 4P4UA 1DARA 2OBMA 2Q6TA 1EFUA 3AKYA 4U02A 5AR1A 2XNDD 2QAGB 2X2EA 3DVLA 2CHVA 4Q19A 2OFXA 2FNAA 1HUQA 3OESA 5C4GB 1ZW6A 5LPNA 1OV4A 2I1QA 1LFDB 5KU1A 3UG7A 1PZNA 1IXZA 2IHBA 4NPHA 3KL4A 4Q66C 4QHSA 1XZQA 1SXJB 1HY3A 4O0MA 1SVSA 1SVWA 4OQMA 4S35A 2HDNB 2GXQA 1JQLB 2UKDA 2W00A 3SE0A 2QU8A 2F1JA 3LX5A 4DLTA 1G3MA 2NOAA 1Q3HA 5JCZA 5TV2A 1Q1EA 2F7SA 4CIDA 1GL7A 5CDFA 3U7EB 1RYHA 1KDPA 2XJ9A 4G0NA 2WOJA 4E5UA 5CYPA 4PTLA 1VMAA 5IRCD 4LJ9A 1I4TD 3GJ4A 2P65A 3QVVA 4TL8A 4KHZA 1TUIA 1WA5A 5KDOA 1ZIOA 2JLXA 1RYFA 2DHRA 2EQBA 2GZDA 1N6IA 1R0ZA 1Z22A 1GITA 2XB4A 5BW8A 2V8OA 4ZCLA 2G1JA 5EXXA 2V1UA 4G5GA 1E4VA 2PCJA 4LBZA 2R65A 1WF3A 3SHFA 4CYMA 2GJ8A 2H1LA 1JBKA 3WMEA 1KK1A 1NVUQ 1E69A 1XZPA 1YR8A 2ZJBA 3LBHA 4Q1FA 4UXHA 1OJLA 2ZUDA 1ELOA 2YOHA 1VHTA 1E2PA 2IXGA 3REFA 4L4UA 4KODA 3T12A 4MUBA 4EFMA 1UADA 2HCBA 1M1YE 4IDHA 4AKGA 2ZJAA 4ZKEA 4LX0A 3K0AA 1KGDA 1G3RA 4PHFA 1RE0A 1BIFA 1ZMXA 1LS1A 4C4PA 2VHUA 1NI3A 4M1WA 5J4VA 1Q1ZA 4GOKA 5FI1B 2QA5A 2IYLD 2ZRCA 1IHUA 1Z8FA 1UKYA 2R6DA 4OI0A 1QHHA 4Q9LA 3KFVA 5CITA 2ZI4A 1AGRA 4Y0AA 1GDDA 2BM0A 3T34A 4JLDA 1P2VA 1YU9A 4TZ6A 5JJLA 1IOZA 1OYWA 3X1DA 3OIVA 3E5HA 4HLUC 5DHAA 3AKCA 4LSGA 4AKEA 2F9MA 4XVUA 4UKDA 5L3VA 1R8SA 1FQKA 4YDHB 4DUGD 3TBKA 1E0KA 2B8TA 1VCIA 2XNDA 5IDVA 3A8TA 3QE0A 1T0HB 1KNXA 4TL6A 3E2IA 5JBQA 4BE7B 3KQHA 3KXKA 4TTQA 1SGWA 2ONJA 2QRZA 4Q9HA 4WZBE 4BFVA 1M74A 1CP2A 3KKOA 3PITA 2IC5A 2FG5A 1JJVA 3B13B 2J46A 2QNRA 3AV0B 1DAMA 2IYSA 4JVNA 4M1YA 1UDWA 2AK2A 3IBYA 2IWRA 5H70A 1R8QA 2F9LA 4L9WA 1YHNA 4QGGA 3BFVA 3Q7PA 3AVWA 1CJVC 3U2QA 1NMZA 2BVNA 4QBHA 3V4RA 1G3IA 1HYQA 3D6TB 3PUYA 2XB2A 1DADA 1F3OA 1GRQA 3D3QA 3VHLB 3A1SA 3AKDA 2IWHA 2BC9A 1R7RA 3AGPA 4TL9A 3M0EA 5EP1A 1JPNA 3ZZUA 1NN0A 1XMSA 5BYKA 3UXMA 2GXAA 3TSWA 1FTNA 1L4UA 5KPDA 4B73A 3GLGB 4P3YA 4A0HA 4OHYA 2A5FA 1JEDA 2ZU0C 4Q00A 1QHIA 5FBQB 4JYCA 3TW4A 4M1SA 1VCOA 1G16A 3K9LA 4NYIR 1UBEA 3V00A 1E1RD 1E9EA 4L16A 5JZVA 1E9DA 2GK6A 3S1AB 3T1OA 3ZD6A 2GEVA 2RGNC 4M9ZA 4N3NA 4EPWA 2OBLA 3EG5A 2X77A 2W2TA 2DYKA 3SYLA 4Q21A 2XOKD 2ZTSA 2MSDB 3AUXA 4TTRA 2KSQA 2OT3B 2ZRLA 2RHDA 3VAAA 3KFXA 3J81k 1A7JA 2Q3HA 3AF1A 3BBPA 2J0UA 1UAAA 3SOPA 1AS3A 2EWWA 3IHLA 3OEHD 3P27A 1R10A 3QKSB 4U7DA 3MWYW 1II0A 2VHCA 3TAHA 3TQCA 1AIPA 1KHTA 5EXTA 3OEED 4BFUA 4OJKA 2YYZA 1M7HA 3C5HA 1D8TA 1JAIA 4XVQA 4OI2A 2BEJA 2REOA 4KFRA 4MITA 3AF0A 4PO9A 1S3GA 2BMJA 2QSZA 3WMGA 4BQSA 4RZ2A 5LBIA 3WNDA 1YZLA 1GP2A 2RGDA 3BRWD 1TX4B 3AF4A 3CF0A 2RGGA 2IYVA 5FI0B 1T91A 1W36D 1UF9A 4TQUS 2O8CA 2R6FA 4PZYA 2QT0A 4JBXA 1P2UA 3W90A 3LVRE 4IOMA 2AKAB 1XEXA 2FSFA 3DOEA 2WJGA 4ASUD 3TSOA 1Z6AA 1EWRA 2WIAA 1KI3A 5JJKA 3F5FA 4B71A 3CX8A 1KK2A 4HSEA 4M8NE 1QG2A 1KO8A 3VR6A 1VECA 2V7QD 2IYXA 3FYHA 2WIBA 3IIJA 1UEJA 3V9PA 4CEJA 3NDPA 2F1RA 1A1VA 1S9HA 4MYUA 1Z2CA 2FZLA 2PT7A 4YLGA 2XXAB 1IN7A 4HB2A 2P0EA 5B2ZA 1K5DA 4M9QA 4GP7A 2AWOA 1OSNA 3SS8A 1D9XA 4A1FA 4F4CA 4AIIA 5FBVB 2ODNA 1W48A 4JLJA 4K8OA 4Q4AA 1CKEA 1G8YA 1XD9A 3G5UA 2ZRFA 2B8WA 1GM5A 4HB0A 3QF4A 1LW7A 3GPLA 1WBDA 4PQFA 3TRFA 1O87A 3P4XA 2WVJA 1W0JD 3ZVRA 1DAGA 2GCPA 2A5JA 2P5SA 3ZZTA 2NPFA 2OFOA 1E1RA 3KX2A 4IFBA 2IYUA 2AL7A 2FPLA 2P3SA 2QSYA 4LJ6A 4AWXA 3SBDA 4QNMA 2R6GA 3KQUA 2XOKA 3U3OA 2JEOA 3LO5A 1W7AA 4HAZA 1PVOA 1I2DA 3FWYA 2JLUA 5BN3A 2AR7A 3KTAA 4AD8A 4KO8A 3U3MA 1XCMA 4BEJA 4ZDIA 1E0SA 1Z0KA 3NIBA 3ND9A 3OEHA 5FOWA 2C98A 5FR2A 3H4MA 3K70D 2Z43A 1E2JA 2ZXUA 2OCAA 3W3AA 3LWNA 1CJUC 4KCGA 3QEJA 1T3LA 3KJEA 3QOFA 2I4IA 3OEEA 4LPKA 3EARA 4HZUB 4Q9IA 1L2TA 1EFRD 4OI1A 1U9IC 4KVAA 1N5LA 2JLZA 4MKHA 4Z8YA 1E9RA 2CJWA 1NJFA 2ZSDA 4KBGA 1HQYE 2OESA 2J3EA 5G40A 1D9ZA 4BPBA 4U00A 3TNFA 1NSTA 2D2FA 3OAAD 3WMFA 3AP2A 4JKYA 4LC1A 1XTSA 1JNYA 3Q72A 2B6HA 1D6JA 1Q57A 3KZ1E 2QENA 1U94A 2CLSA 2GF9A 3KKNA 3MLEA 2XZPA 4PAQA 4P32A 2KB0A 1G3QA 2XTMA 4JS0A 4FCTA 1NL3A 2JATA 4ASUA 2OSBA 2P67A 4UNSA 3SC3A 3OFND 4QNRA 3F3YA 1QRAA 1KTVA 4DLUA 4IKEA 4P4SB 4ZO4A 4A8JA 3K8YA 1K8RA 4ARZB 2FPKA 1N5IA 3EA0A 3CPHA 4GBMA 2V7QA 4BFZA 1BS1A 3N5CA 5KO2A 1NIPA 3EWSA 2ZREA 4K81B 4HAYA 4Q03A 1R4AA 2HCJB 4D25A 1E2FA 3LBNA 3FGNA 1D2NA 1Z07A 1T5LA 1SHZA 5JI2E 3AQ4A 4LC0A 1WRBA 3QUSA 3AF3A 4DLXA 5K8LA 1VYUA 4LBVA 1N2CE 3LLMA 2JLSA 4NYMR 3C41J 1V5WA 3AB3A 3N2IA 3TUIC 2G6BA 4AC9A 2QMUA 4CW7A 3KQLA 1B23P 3TGPA 4ITRC 1VG8A 1VYVA 1W0JA 3B9QA 4LJYA 4NKRA 2VP2A 1FL9A 1FNNA 1GNQA 1Z6GA 3CH4B 1NG1A 3W6NA 4AKHA 1T0JB 2GJ9A 5CJPA 3AVYA 1W4RA 5GJBA 4ESVA 2KBEA 1Z29A 3HP1A 3OIYA 3U5ZB 5DGXA 4QM6A 4O2LA 3T5DA 1F2TB 3LDAA 4NCNA 4WZ6A 1FP7A 3AVOA 3C8UA 3NBFA 3WRYC 3IILA 1S1MA 1E2GA 2XZOA 4LOAA 3VR3A 4EJSA 1CIPA 3GCGA 2F3RA 4IFEA 2PZEA 4JL8A 5DISB 5JRJA 2DY1A 4MRNA 1UJ2A 4DKXA 1J90A 3KUCA 5B58C 3U44B 2YVUA 4IEIA 4XTRA 1PV4A 2W58A 4RFSA 2D06A 1Q20A 1ZD1A 1XWIA 3KXLA 2V9PA 5TMPA 4P33A 2JDID 5FOXA 4NZYA 4ZIRB 3THYB 2O8EA 2BWJA 4TT3D 1O3YA 2G77B 3WYAA 1WB9A 1EFRA 2G83A 4HLDA 4MKIA 1LNZA 2WICA 2OXRA 2Q9BA 5H1YA 4B32A 1DO2A 2ATXA 4DB2A 1AS0A 1NLZA 1E96A 2C9OA 2NTYC 4ZCMA 3W8RA 4GNKA 4Q9KA 4NYMQ 4QJ4A 1SVMA 3Q5EA 4Q4HB 3OAAA 4B3FX 4AG5A 2IEZA 1XJCA 2WAXA 3DL0A 4NE2A 1EFHA 3GQBA 3NBYC 5CIWA 1LVGA 1G9XA 4PPQA 4D2IA 3T1TA 4HDOB 1TEVA 1ETUA 1S2MA 3Q8XB 3L0IB 3OFNA 3EPKA 3CLVA 1NIJA 5JCPA 1MABB 6Q21A 2W2VA 3BGWA 3EPHA 2F3TA 5ELXA 3B7GA 4I1OA 2FFHA 1OIWA 1Z0DA 3BH7A 3ECCA 2IYQA 4CEIB 3RS2A 4HAXA 1P7CA 3SFZA 3PCRB 3OF5A 1GRRA 3KXIA 1IN6A 1JQJC 2OG2A 4IDQA 4QXAA 4OK6A 1GKIA 4RVCA 2CNWD 4ESHA 2ODEA 3BD9A 4OK5A 1GFIA 3GFPA 3GJ0A 4POAA 1DO0A 2V3CC 2IL1A 1MO5A 3KKQA 4PX9A 4NCKA 2QG6A 1YQTA 2AD1A 4NDZA 3C5CA 2RGXA 3GFTA 4URUR 5DYGA 4Q01A 4TN1A 3GLIB 3VMFA 1XP8A 4DCSA 4R7ZA 5JS7A 2WSSD 1YZGA 3KB1A 721PA 2FX3A 5JSZB 1P75A 5DIFA 5LD2B 3R7WB 2OILA 2ZRNA 2YKGA 4KYUA 4LYHA 3D8BA 5D3MB 3VX3A 1DS6A 4QGHA 4KU4A 1RJ9B 2P6RA 4MRSA 5G53C 3BAFA 4KV9A 3EPLA 3HYRA 1H8HD 2YC2C 4D0NA 3FMFA 1SXJD 1Z08A 2D3WA 2C03A 4Q9JA 1G7CA 2ASEA 4KVGA 1MKYA 2Q3MA 4RD2A 4C7OB 3CH5A 3LW7A 3IIMA 2FFAA 4DWJA 1G1MA 3MWKA 3A1VA 3EZFA 2VSOA 1YRAA 4TMXA 3LH5A 3L0SA 4D0GA 4D81A 2GHIA 2RCNA 1FX0B 4V02A 3JVUA 2HUPA 1HEIA 1WCV1 2XAUA 2ZROA 2ZI7A 2QI9C 4QG7A 1S0UA 4IDPA 3GMTA 2ZYWX 1N25A 2QMOA 1E9SA 4X8HA 1Q21A 3RYTC 2JDIA 1E79D 4B2PA 3VKGA 4HZIA 2HT6A 2RGCA 1VYTA 4PPFA 4TT3A 4PC2A 4BUJA 1OB2A 4PPNA 5JWRA 5FTLA 1SXJE 2ZUCA 4HATA 1F2UA 1H65A 1ZM7A 3BOSA 5J4HA 4GRAA 2OCYC 1U99A 2AFIE 5G41A 3DDCA 1AM4D 2GJAA 2UVQA 4LV8B 4RD1A 2F55A 1JR6A 1CS4C 4E07A 3I8XA 4GMXA 1IY2A 2GRJA 5EJEA 1HTWA 4XJXA 3THWA 2O8FB 1NVWQ 1UPTA 5FTMA 1D2MA 1OW3B 4URYR 2I3BA 2X8AA 2C78A 2FH5B 4I99A 1G4UR 2ZR0A 5FPYA 2Q21A 3MJRA 4A9AA 3LFUA 2H5EA 4L5BA 5FUXA 3K70C 1YZQA 2CK3D 1G4AE 4RY2A 1MOZA 1OPXA 3H2YA 1M34E 2ZRHA 4D82A 2P2LA 2F43B 3ND8A 4GPTA 1N0WA 3VU9A 1R5BA 1S8FA 3CRRA 5JHGB 3ADCA 1E9FA 2ZITA 3WHLA 4OHZA 1KI2A 1CTQA 1ZNXA 2CNWA 5FUYA 1DELA 1I2MA 2QORA 2VIIA 2OLKA 2YV5A 3SBEA 4Z54A 1X8KA 3VKWA 3MAAC 1SQ5A 1E1QD 1W44A 2QAGA 1ZC3A 1K5GA 3A37A 5FFMA 3H1TA 3SEAA 4BLTA 4A36A 3W5IA 3ZVLA 4YMTA 2WSSA 4B3CA 1S4QA 3L82B 3W9YA 1ZU4A 1W2HA 3DKPA 1Q0UA 2FFQA 2XEXA 4LYAA 2ANCA 2V1XA 1H8HA 1W4BA 1SXJA 5M04A 3THXA 4AG6A 4CGZA 4C0QC 2AWNA 4BLPA 1EX6A 5HZHA 3IHWA 1KIMA 2PEZA 3QXCA 1OH6A 4TWZA 2WTUA 2XX3A 1GSIA 3FMPB 4M9SA 1Z6TA 2YWEA 1KO4A 2JCSA 1FMJA 5J47A 4Z8XA 5E7JA 4URWR 3PFIA 3RVBA 4HLCA 3ETLA 4XWKA 5FBRB 3CX7A 3GEEA 2GAAA 2CHQA 4I1VA 4R2HA 3G0HA 1KI6B 2QP9X 1RFLA 1E79A 3WYFA 1CRQA 4TMTA 3L0PA 4JIMA 4B3BA 2OHFA 2QEQA 2J7PD 2IUTA 3JZAA 2YJTD 1T5IA 4YC7A 4DSNA 5GVSA 1ZRHA 3L0OA 4US2R 1OH7A 1BYIA 2NIPA 1R0WA 3IO3A 1RKBA 3PUVA 4QHTA 2IA5A 2ERXA 3CX6A 4XSGA 4NONA 5TDHA 1GOTA 4BLSA 4DIDA 4OQNA 3RC8A 2C2HA 5CJ2A 3CR8A 1TQ4A 3QF7A 4DCVA 5AUPB 4YMWA 1BOFA 1IY1A 1KSHA 1MO6A 1DVRA 1P4SA 2DFTA 4JZKA 2GVDC 3B8HA 3EW9A 3CM0A 1E2LA 3VR2A 4UQOA 3U3RA 3ZD7A 5FPHA 2QGNA 1E99A 3FFBA 4IOKA 2D2EA 4TLEA 2JLYA 3F8TA 2CK3A 2DCUA 3QKRB 3TR0A 2J7KA 1KDTA 3PG5A 1MO3A 2CE7A 1KSGA 5JEDA 3FHCB 1CJKC 4BWYA 4DBLC 1XNJA 2VF8A 5J5CA 5GJWC 3UIEA 2QY9A 1Z0AA 3I4LA 3K09C 3MMPA 2ZRPA 1U0JA 4S2EA 3CR7A 2ZYTX 3K9NA 2CLDX 3DZDA 4PC7A 1IN8A 4F7WA 1HT2E 1UBFA 3QKUA 4V0OA 3UANA 3QKTA 3WP0A 3ICEA 2GETA 1E1QA 1ESNA 2GEDA 2GNOA 1P6XA 4FMDB 4MRVA 3W6PA 1QHSA 2D4HA 3VHXA 5IT5A 2FMXA 4FWTA 3SHWA 4KSBA 3Q85A 3C4JA 1KJYA 2VHJA 3X1ZA 2IX3A 1G5PA 4FCWA 5F2EA 2FPMA 4KAXA 4OHVA 3AH8A 4IDOA 4RCZA 4DVGA 2OAQ1 1YVDA 5UKDA 4L9SA 5HCIA 4NU0A 2NQ2C 2B7CA 2Q0HA 4H1UA 3DKVA 1P3JA 3QY0A 3FHOA 4XVRA 3UATA 3CRVA 4A2PA 4TL7A 3VQTA 2OEPA 4EAQA 1KO1A 4QJ3A 3MWJA 2C99A 4WVFA 1ZVQA 1EWQA 4JSTA 2GXSA 2ZM5A 1G20E 4CRWB 4EQ6B 4PAOA 4ILEA 2OXCA 2AD5A 1LF5A 2QMHA 2R9VA 5KNCA 5BYJA 1DEKA 4Q1AA 1XD2B 4NTZA 1AQUA 221PA 2GA8A 3EASA 1FMLA 4HAWA 3U7FB 1OXSC 2DBYA 5EE1A 4DDTA 4EPRA 4HYYA 1RVDA 3BC1A 5EE0A 1NVVR 2QPTA 2ZS7A 4QBIA 2WM9B 1QHNA 4UNQA 2J7PA 2EU8A 1KSJA 2CLCX 5F98A 4FI3C 4W5HA 3S1AA 1G7TA 2JIZD 1VTKA 1NSFA 3CF2A 4URXR 3PUXA 1KI9A 4C0SA 1YZKA 1UDXA 3ZQJA 1OF1A 1XPUA 2FF7A 5SZJA 4JBYA 1XJ0A 1JI0A 2YOFA 2ZS8A 3QQ5A 4G5OA 2ZJYA 3LXXA 2CXXA 2QM8A 2QPOA 1PUIA 1DAEA 1XMIA 2GXUA 4M1MA 1DBSA 1SVOA 4ZDWA 3SFVA 1ZINA 2BCGY 2OFWA 1N6HA 3X2SA 3NEJA 5JMTA 3QKSA 3UMRA 2BJVA 3B78A 4MDFA 2H8KA 3QNUA 3B1ZA 4GMDA 5EXPA 3QPUA 3KJGA 4JSYA 4CEHB 3UKDA 2EFGA 2VH5R 3FPAA 4JLNA 2BMEA 4OQLA 4ZDKA 1Y63A 3WNBA 2ZI9A 4HLQB 1QBKC 2W6ID 2D62A 4IXMA 1CRPA 2FE4A 2VP9A 4AY2A 3DM9B 3WBJA 1N6KA 2HF9A 5DI3A 5LB4A 2O5VA 1ZD9A 4IOLA 5CK4A 2ZE7A 1Z47A 2WV9A 4I4LA 5HKKD 2WMNB 3IPYA 4JBWA 1NVVQ 1VCMA 2RGBA 3CKLA 2QE7D 4BRUA 1A4RA 5TXGA 1MV5A 3HU3A 4LHVA 3B1XA 4C0BA 2Z0MA 2H16A 4IDNA 4MKFA 2W6JD 3Q7QA 4OJQA 2ANBA 2JAQA 4JVMA 5JWOA 3CONA 3L43A 3I72A 5AJWA 2JLRA 3VFDA 4DHEA 2BJWA 2R2AA 1E9CA 2WJVA 2VTKA 2QAJA 4W5JA 2J0SA 2FSIA 5EXSA 4M0LA 3PJRA 1YR6A 1TQDA 2XXAA 1XTJA 1R5NA 3RS0A 4TYNA 1U8YA 1T8TA 3EXAA 3DOFA 3QSYA 1Z63A 3DHWC 2HXYA 2QMEA 2Y8EA 2VBCA 4WOPA 4C0KA 3FKSD 1TADA 1WDTA 1CXZA 2IYZA 2PZGA 4JLAA 4JT4A 4PPGA 3IGFA 4IVRA 4N0EA 4M21A 4WBSA 2YC4C 4W5WA 3I8SA 5BQ5A 1XB2A 4ACAA 4DXAA 4KJZA 5JWHA 3RS3A 5CLLA 1XFAA 4A0FA 5H8WA 2PLRA 4ON9A 2B21A 4M4SA 1HA3A 1CJTC 1DOAA 1LV7A 1TEXA 1X1SA 4NYIQ 5EUMA 4C30A 421PA 2J1LA 2H57A 1BH2A 4A15A 1CF4A 4EPXA 4Z51A 1OFUX 1ZUNB 1KI7A 2REBA 4QGAA 4TMWA 3NG1A 4G3XA 1ZM9A 4YDSA 5DN6D 3R8FA 2CCKA 2JIZA 1QHYA 5DSZA 2XTZA 5AJYA 1JALA 3QVUA 4JVLA 3QXXA 3IPXA 3C7KA 2FDCA 1VG1A 1ZCBA 4BRWA 1N6PA 1G64A 1QF9A 1GG2A 1Z0IA 3HPRA 1Z3IX 4V03A 3O8CA 3FKQA 4EFLA 3DMNA 5A0FA 2VP0A 1UEIA 4IW3B 4X8LA 3M4YA 3R8CA 4BLOA 1ZUIA 3RS4A 5FTJA 2WKPA 3LQQA 3GJ3A 3K53A 4NHOA 5CIQA 3IQXA 3ZJYA 4B3DA 3SQXA 3SR0A 1JR3D 1W5TA 1TNDA 2WJYA 1OE0A 1GNRA 4RJLA 1TTTA 2QZ4A 4Q02A 4OHXA 1SZPA 4HZUA 2JLVA 2EVWX 2W6IA 4Q18A 1NP6A 1AQYA 3KKPA 1US8B 2VP4A 5C4MA 4LK2A 1IJEA 1E32A 5JECA 3WBKA 2ZJOA 1UFQA 2YHSA 2FJUA 2TMKA 1KMHA 1TF7A 4PZZA 2BBSA 1LF0A 1UKZA 2G9NA 1NKTA 2GESA 2VSXA 3MSXA 3NC0C 4GOJA 4NYJR 3RRYA 1P9NA 5DLQC 5HKKA 4MGYR 4DEYA 2CVHA 4PSAA 1AK2A 3B6EA 1FFHA 2QE7A 3D7MA 4LJ4A 4MQBA 2BV3A 2WWFA 3FB4A 4W9MC 1ZCAA 3HPQA 1E2MA 1JR3E 1SVLA 3TK1A 2ECKA 2SHKA 4BFSA 4DZZA 1OXVA 2W6JA 4DLWA 2FFBA 3GD7A 3JZMA 2CL0X 1KK0A 1W4CA 4QM7A 4JLMA 3ZDQA 1XEXB 2PBRA 5K8UA 4YQFA 3FFAA 2GBLA 2YWGA 4Q1DA 3PV0A 1F5NA 3A58B 1TUEA 3RRMA 2O0KA 5FTKA 1TF5A 3LBIA 1XTQA 1OXUA 1X6VA 2J0VA 5DH9A 4AYTA 1OB5A 1EXMA 4GL2A 1AZSC 2CDNA 2ZANA 5KOYA 3GLFB 2O8DA 3DZ8A 2ZRJA 4EKDA 3EIHA 3FKSA 1G8FA 4JLOA 2AN9A 3G82C 3JVVA 4PC3A 3BH6A 4ZV4A 3EPJA 1R0YA 2BCJQ 3AM1A 4HEJA 3QXHA 2O0HA 2CEAA 3F0TA 5HCNA 1KKMA 1VPLA 2ZYVX 2F1HA 4LGMA 2FWRA 2Q9CA 1QVRA 3QF4B 1II8B 2WSMA 4JLVA 4NYJQ 3WP1B 5DN6A 5AWFC 3GEIA 4LHYA 2QL6A 4NCHA 4Q1CA 2HT1A 2EYUA 1J7KA 1F2TA 4KITB 1XCGB 3THOA 1W2GA 4C2UA 1P61B 1U81A 3IEUA 2AXNA 2WOOA 3D31A 1N5KA 4OBEA 3QBVA 4X8OA 1Z2AA 1P9RA 3R20A 1CR2A 2PT5A 3IO5A 4P0TA 5C2JB 1GILA 5ANRB 1NVXQ 1XTKA 1T4GA 3SYNA 4JJKA 3GLIE 4WXPA 2O8BB 2QQ0A 3NBZC 2NZ8A 4OQFA 3K0SA 3KTAB 1JR3A 5L3QB 3LW8A 2EW1A 1G21E 1E98A 5HR5A 2WWGA 1NKSA 3THYA 4PAMA 5JS8A 3BK7A 2ZRIA 2C9YA 4K46A 4ZI3A 1NN5A 4UJ5A 2Z83A 1J70A 2ZJZA 3GJ5A 2PLFA 3PIRA 5A5GA 4GZMA 3MGCA 2VP5A 2C96A 1T9HA 2G0TA 4V0LA 5JFGA 1P72A 4Q4HA 4RFVA 5AJVB 3R9IA 5IHPA 1GL9B 5EQTA 2X19A 3ADKA 2PX3A 4Q7MB 1ZNWA 3FHTA 2C95A 1PLKA 3WYGA 1WE2A 1XXHE 3GLHE 2CL6X 4PFSA 4F92B 1IXRC 1WP9A 4BLQA 4ERNA 1FW6A 2NMVA 1OHHD 5A4JA 1NLFA 4FIDA 3C14C 2IYTA 1JPJA 5IF9A 4Z1MD 4QRHA 2IK8A 2IS1A 1M7BA 1E9AA 2FA9A 1IQPA 4B2LA 4UNPA 2A30A 2R8RA 4Q4JA 1D5CA 1R5OA 3GJ6A 2IS4A 2ERYA 3CO5A 4D4JA 2IBMA 3ADBA 2X1VA 2G0NA 3NH6A 4PSKA 2Z5FA 1N6NA 2PZFA 3ZYCA 1CR0A 2V4ZA 4RD4A 2FZ4A 3TR5A 1AKYA 2IXFA 1XPOA 2WKRA 2C77A 1Q1QA 3NVAA 1HT1E 1P2SA 2YOGA 3QJYA 3GLIA 821PA 4BGDA 1WQ1R 2HJGA 3QPVA 1S1CA 5JSZA 2WJHA 1HURA 3R7WA 2OBNA 3WY9A 2PCLA 4CF7A 1ZP6A 1RJ9A 4IEEA 1JJ7A 3A1UA 3HYTA 4E03A 1YJ5A 4DJTA 4EPTA 1WMSA 2NO0A 3P1JA 3I32A 4G01B 2JJ8A 2FV8A 4IOJA 4MRPA 4RD6A 4CZ2A 2ZRBA 5HTKA 4B2IA 3IIKA 4Q1EA 3ASZA 4GT1A 4KXFB 4C7OA 5CLQA 1LY1A 1HH4A 3ONWA 4PC1A 2IS6A 4OL0A 4RKFA 2OO7A 2VPPA 2REXB 3SJBA 1Q44A 2JJ1D 4RZ3A 2ZE6A 1PLJA 4M1OA 3OIUA 4O3MA 3P32A 4KLNA 4C0LA 5L3SA 2IUSA 2H92A 2BM1A 5FUVA 1XXHA 3GLHA 1E2HA 1SVIA 4FMDF 1M2OB 4LYJA 3GP8A 4HUTA 3PXGA 5E7IA 2E87A 3U6BA 4PXAA 1J8MF 1ZUHA 5AK0A 3VKHA 3E70C 1FOEB 3K70B 3AP3A 1Z83A 1FUKA 1Z06A 2KJQA 4DCTA 1I4LD 1W36C 4Q48A 4RFSB 3KJIA 4MUAA 5JJIA 2RHMA 4TMVA 2JJ2D 3OIWA 4URVR 4DSOA 2R62A 2J0QA 2O8EB 1BO6A 4FMCB 3W34A 1RRFA 2JA1A 5LB2A 4E09A 2EFEB 3FVQA 121PA 5EE5B 2AX4A 3CWQA 3LNCA 3RS7A 1LTQA 2P5TB 5SZHB 3RAPR 2FSHA 2W2XA 2V6JA 4A8JC 3QPWA 2WWYA 1XCPA 2O8FA 1FTSA 3LXRA 4PHGA 3TLXA 2LKCA 4RZUA 2ZETA 5DE3A 1OHHA 1AS2A 2FN4A 2J45A 1DAKA 2QP4A 1G7SA 1TU4A 1Z5ZA 3CZQA 4Z1MA 2ZSEA 4JLBA 1N0VC 4DCUA 3ZLJA 4GSYA 4G1UC 5IK2D 1U8ZA 2DWOA 2F43A 2P6UA 4NH0A 4YMSA 4Q5IA 3M6AA 4X8MA 3NWJA 2N46A 2GWHA 4HUQA 3W5JA 3AF2A 2RH5A 4B44A 4Q47A 3ZS9A 4KFUA 4JLKA 4B34A 5GJVC 2WWHA 521PA 4A92A 3NXSA 4TYPA 4R71A 1A82A 2ZPTX 1F60A 3MRSA 1KO7A 4KSCA 5GVRA 3NKVA 1ZIPA 2CVFA 2J87A 4U5XA 3QI2A 4N0DA 4EJSC 3A1TA 3HDTA 4BECA 3HU2A 5E7MA 1KJZA 5FPSA 1RZ3A 4TMZA 5HPYB 3X1YA 4A2WA 2HXSA 2A5DA 4A0GA 3AGQA 3IEVA 1GVNB 4FXPA 2CHGA 4UXJA 1J2JA 3DEFA 1IAQA 3RNLA 4A6XA 1FNMA 4O25A 4EIWA 2JJ1A 3BWDD 2ZEJA 1YKSA 3R9XA 3CNOA 5P21A 3IQWA 1RRGA 2CL7X 1L8QA 1GIAA 4XD7D 1IXSB 1ODFA 2GCOA 1SKYB 3DM5A 2UZIR 4CT5A 1KI6A 1G6HA 2WJJA 3TIFA 3EC1A 3I5XA 1C9KA 1U0HC 3MG9A 5KDDA 3B60A 5KSZA 2HJVA 1NBMD 2JJ2A 3HR7A 4DRZA 3T15A 3Q9LA 1C1YA 4C9BA 3RSOA 2YZ2A 2A9KA 2QTFA 5EE9A 4DT1B 1TAGA 4JJZA 1XPRA 4H9GA 1P62B 3IDQA 4GDFA 1ZAKA 4LJAA 3UG6A 4MH0R 3EWAA 1MR3F 3EZ2A 1KO5A 1F2UB 4HLUA 4LRWA 2NGRA 2HYIC 1VCNA 2BMFA 2PL3A 2V6IA 4KI0A 3BORA 2EFCB 2NO7A 3MWLA 4G5SA 4A82A 1M8PA 2X2FA 3AKEA 5AUNB 3KQKA 2A3RA 3H84A 1CR1A 3NC1C 2RGAA 3RC3A 3IUYA 3BFXA 3B85A 4DDWA 2J59A 5J4KA 2QM7A 4L15A 2OLJA 4LDJA 1P9WA 1NBME 1FZQA 2R6CA 2WKQA 1KDRA 5IK2A 3PEUA 2H18A 1G7RA 2O0JA 1W1WA 3I62A 1T8UA 4B43A 4PHHA 3U3JA 1A2BA 2WAYA 3U3KA 4B76A 4V0NA 1LB1B 3NEYA 4IRUB 4BLRA 4TLDA 2OCPA 1C4OA 1EFTA 4H1VA 3DO6A 4RD0A 4ABYA 5D3QA 1ZNYA 4OHWA 4TTPA 3BFKA 4DIEA 3CPEA 3K0FB 2W0MA 3FMOB 3ASYA 3SQWA 1GL6A 1E2IA 3V4FA 2J5XA 4WA7A 4LUCA 1NN1A 1DAHA 2BBTA 2BIFA 2C9CA 4MYHA 3OE7D 2EFHB 2MMCA 4WXRA 8OHMA 4GOXA 4YMUA 2DFLA 1E2DA 1ZYUA 3LLUA 5L3RA 3BB4A 3GLGE 5KNBA 4MGZR 2OE2A 4LYFA 1ANKA 3SJCA 1W47A 2G1KA 3CW2A 2RGNA 2KI5A 1KAGA 1V43A 2ZAOA 1DG3A 2AFHE 3THXB 1X8JA 4OQXA 1L4YA 5FH9A 3U4QB 1NLYA 2YWFA 4AYXA 2QBYB 3ZVMA 2BHRA 1OT3A 4RSGA 4XD7A 3O47A 4EQ6A 3A4MA 1CULC 1P2TA 3DPUA 2ZSBA 3FDIA 3LRPA 1E0AA 5KSYA 1XD2A 3TUJC 2BEKA 3ZGXA 4PQRA 4DLYA 1X8LA 1KI4A 3BE4A 1ZC4A 1ZM4A 3GJ7A 4XSHA 5FPKA 2WPDD 3MJHA 1XX6A 1T3HA 4LCBA 1NBMA 4A0RA 1EGAA 5CB6A 4B3XA 2GK7A 4BZPA 2ORWA 1BKDR 1DTSA 2ZRGA 4MDEA 4R2IA 2LCFA 1GNPA 1KYIA 3QXJA 1J99A 1ZD8A 2VEDA 2WWWA 2GDJA 4XWOA 3CRMA 4IXNA 5FPTA 4NBSA 3EC2A 3TQFA 2WBLC 1TF2A 4V0KA 3K0CA 3RRZA 1OXXK 1FUUA 3UMFA 1AKEA 5KTYA 2ZSAA 3VR5A 4FINA 4PO1A 1F48A 1KY3A 1QZXA 1G8PA 5DNYB 2WWIA 1CLUA 2QTHA 1FPMA 4L8GA 4AKIA 1GWNA 4GFDA 2MSEB 1EX7A 4PHTA 2A5YB 3TAUA 5FR1A 4CEHA 2DB3A 3T1QA 1XMVA 1COWD 4FN5A 3PEVA 4OKSA 1JECA 2QAGC 4LHZA 1ZU5A 3GLGA 2XGJA 2F1IA 3WRXC 2AHOA 3VNUA 2GTPA 1MT0A 4QFMA 1HE1C 4TLBA 4HI0E 4J0QA 1WXQA 2GILA 4QC2A 2ZR9A 2W0SA 2PJZA 2YWHA 1XRJA 2C5LA 3K9GA 2ZRKA 1IN4A 4JVSB 4B74A 4II7A 3RWMB 4EPYA 2XITA 1YZTA 3UWKA 3C15C 2ZI3A 4NCIA 3T5GA 1SXJC 3I3SR 4QBGB 1VIYA
chains in the Genus database with same CATH superfamily
3VOAA 3IV7A 2YVLA 1IY0A 1TEHA 3RKRA 1Z4NA 2IXEA 2ACKA 2QT1A 2W2PA 3KUXA 1T2NA 5A5DA 5FOUA 3OE7A 1SG9A 3ADOA 5AICA 1KDZA 2NO5A 3I2YX 3L41A 4KMRA 4PICA 2Q29A 3R7SA 5C5IA 2VSYA 3QTTA 2FKAA 4D8WA 2BRUC 4DLBA 3HYNA 2BEUA 5ED0A 4YJFB 2N42A 5DJ5A 4G24A 1BOOA 3LC0A 1GZ7A 4IIDA 1GADO 4CR7A 2PH1A 3UJ8A 5B1YA 1C81A 2ZIEA 3SGLA 3EQ7A 3TM4A 1P60A 3LVQE 4IIBA 1RXEA 1HLFA 4R8RA 1RWOA 1EA5A 1SHUX 5CG2A 1DG1G 5B37A 1UFKA 4I8DA 3N2ZB 2IXAA 1QHXA 3NP9A 4KMOA 2FEOA 2O3TA 4ZEWA 1F0YA 3V8QA 5EP3A 1I8TA 1QCCA 4GPZA 2IFTA 4JUCA 2FTKE 4UPDA 3ICQB 2W8BA 5H4HA 4QBFA 5F33A 4F6LA 8ATCA 2DMRA 1F9EA 2FHPA 4JXKA 5DK6A 3WE7A 5EMHA 4BCBA 1PO7A 2Z5GA 4K7JA 2PMDA 2PNJA 1Y89A 2V7GA 2ZRAA 5I01A 1D2EA 2JFYA 1BE6A 3N6RA 4B09A 1ZUNA 3KD2A 1XZGA 4TTSA 1E3WA 3VU3A 4QT4A 2QV0A 3LX6A 1Z88A 3NDBB 1BROA 3HKBB 2ZTVA 2VP3A 2VH1A 3EGEA 4MKZA 2JW5A 4ZI7F 2GCNA 2NG1A 2W2LD 2H11A 5A3QA 4BFYA 1E9BA 5E0KB 2VAWA 5AJZA 1GRVA 3FTQA 1SA0A 2HV8A 2VWHA 2XT6A 1IBRA 5U9CA 1ZVVA 2IS2A 1VA5A 1MOQA 4JL6A 1U2SA 4BN0A 2HLDD 1A5BB 3L1KA 4R0VA 1IZZA 4B6RA 5BO5A 3U7GA 1XLVA 2WK1A 4B4UA 3QVSA 4FFRA 3SM3A 1ZK0A 1ZSVA 3UHAA 4FFNA 1WO8A 2H5JA 2EFYA 2XA2A 3OSUA 1JEQB 1JHQA 1KI8A 1L7QA 3WLPA 2CWDA 3JQ9C 1QTNA 2XQJA 3B1JA 2E4XA 2G76A 3KDSE 2A1TR 4B6SA 5ALWA 1JA1A 1L5RA 2WMOB 3DYVA 2VAPA 4ZMBA 3OO0A 3QIAA 4HR7A 1J06A 4P54A 1DEOA 1VBKA 2OPBA 4FX2A 1I4DD 5LP6C 5C0OE 2H4FA 4IUDS 1G18A 3LS2A 3DTYA 2BEVA 2D59A 1T9CA 3HL4A 4UBNA 1A8QA 3UK7A 4RANA 3RFTA 4JP3A 4OPMA 4JUIA 4U0KA 1W8IA 4WINA 1OYVA 4CT4B 4IRXA 2D7DA 1IJFA 3LV8A 5KDLA 3UMSA 1SIUA 1I6KA 3CBQA 4EFNA 2NU6B 4FC6A 4FHEA 2X8WA 3C1TA 4TQ9A 2PLNA 2ZAMA 1TVKA 3PDJA 3W3AH 4Z86A 2XTNA 3FCYA 3COPA 4Y98A 5GPBA 2R4TA 4DCOA 2X1HA 4QXRA 2VHTA 4Z2AA 3K0CC 4YDRA 3FYUC 3QVGB 2ATIA 3NU1A 3WB1A 1S96A 1KJIA 1CQJB 3D1JA 3ZS8A 4D9JA 5DTEA 2MWMA 4LHXA 1R4ZA 4JI8B 2AZXA 5K6TA 4GS5A 1UKVY 4Z1OA 2BEWA 1EESA 1KK3A 1QLJA 2RHGB 3AM5A 2BFDA 2YICA 4EUSA 3I61A 2DWQA 4HUJA 3GDWA 2HADA 1G8GA 2ZT7A 3M6UA 3U4IA 2B92A 4MGKR 4UU1A 1KYXA 3TSCA 4C1NA 4AZ3A 2CY0A 2NO1A 5AD1A 1DIAA 1XQYA 5A4KA 3K1JA 3S5UA 2L82A 3AR5A 1FBTA 2HWKA 4HY3A 5B3JA 5AJXA 3FNHA 3UK6A 3TH5A 1DX6A 3ZW7A 5IG2A 4JV5B 2A78A 4C88A 1AQIA 4OK3A 3V34A 3WQSB 4JR1A 4LQLA 1OV6A 3WQBA 1GN8A 2EKZA 1XK6A 1K08A 5T8KA 2RH8A 4FYKA 5J59A 4KO1S 1NM5A 2Q7DA 3X1WA 5LXTB 2JFNA 4QODA 1VSTA 5IDYA 3VHRA 3O7MA 1WEKA 3BXZA 5JO0A 1R12A 2C9MA 4PO3X 4NBNA 1V3UA 1I2CA 3IT2A 4LTNA 3UW1A 1LQTA 1Q12A 2WA1A 2QTNA 4LECA 1G42A 3K15A 4O29A 4KKVA 3PXBA 4Z0NA 3L04A 4LI0A 1PX0A 1TFRA 1VKHA 1AZTA 4JASB 3NUGA 1L7VC 1YQDA 2PR2A 2Z1NA 4RADA 4TT8A 5JC1A 2LVBA 3CXUA 5KAPA 1PEAA 4HTFB 3T1YB 2W2LA 1GKLA 3S29A 3PQ2A 4BMOB 1EFKA 1E5LA 2BKXA 4AECA 4YV7A 2CV1A 4Q4LA 4NV3A 3GVPA 1CY0A 4JC0A 3CLSD 5FBWB 3D6FA 4QQFA 4Q1BA 1UEXC 3WGYA 5B4UA 1CJSA 2HLDA 2OM2A 1QYDA 3ANMA 5JNSA 5C1OA 1WL8A 2C2OA 1T8YA 5AHXA 1QK4A 4L3VA 4HYQA 1XYGA 4MYDA 3ROZA 1YWGO 1EFPB 2YRFA 3C5EA 3SZLA 3F7OA 2O48X 3ZH9B 3SDZA 2QVZX 1DE0A 1E1NA 1HF3A 3D7KA 5FTNA 1S3SA 4CTMA 3R3WA 3MB8A 3LUCA 4U9UA 4XOIA 3CUEF 4P31A 4QOGA 2FSGA 3RR2A 2VRWA 4P82A 4PF1A 2JCBA 1T6NA 4LHWA 3PR1A 4WTOA 1U2DC 1VKOA 2PKRA 3ONNA 3TEJA 4Q4AB 4BQQA 1XT6A 3TMKA 3ROXA 3HXTA 5ERXA 4O8CA 2ZUBA 3FE2A 4U3JB 2JNWA 1VJTA 2PS3A 2VYVD 4XR9A 1JHOA 4LS3A 4CHTA 3H1PA 2PAFA 1BD4A 1AQNA 1EFCA 4JT2A 2G1AA 1J8VA 3FPGA 1KMHB 4TTIA 5FL7D 1PS8A 3ITKA 1DX9A 4YS6A 2O2XA 2EKQA 1RHRA 1LA2A 2NXNA 4U63A 1JG7A 2JVKA 4OYHA 1SQGA 5KTKA 3TIXB 3HFGA 3FOZA 5BQFA 2C59A 2I1LA 5DX0A 2VNAA 3IAFA 4FQ8A 3M81A 4QPCA 1H93A 2DWCA 3GFOA 3U49A 3B52X 4YV1A 3EGIA 2GBCA 2IW1A 5BN3B 1EJBA 2OQVA 4BKOA 4QXPA 3HP7A 4JOCA 3UK0A 5CB0A 5IJWA 4A0RA 5IJ0B 2JIQA 4FFOA 1FLDA 3NTXA 2HCFA 1AHPA 4J7AA 4MWBA 1W4AA 3PUKA 3VX4A 2ZS9A 4CKEB 1U28A 1Y1LA 1ZONA 2GMWA 3OF3A 4FHFA 1G9TA 4I19A 3VA7A 3RSHA 3WK5A 3O8DA 5IUJC 2ZYUX 4O2AF 5FV7A 1KARA 2BL4A 1JSXA 5C18A 4DDVA 2YW2A 1DHTA 2R48A 1HYBA 2W90A 1IK4A 1RYMA 1YMUA 3O9MA 3OJEA 3LA6A 1PU2A 1BG6A 1KQ3A 2P2CA 2UZ0A 3NYQA 3OETA 4TYQA 4RD3A 2O5CA 4YMLA 1QGOA 3M5WA 4U7HA 2AJCA 3UK1A 1NYLA 5LDDC 3G49A 2ZXFA 4JBIA 1Y6QA 4K9OA 2ZXEA 2FEMA 5DBEX 1Z0FA 3FIJA 2Y1DA 2Z5LA 4V0RA 1V7QA 3UAYA 2ZSKA 1C7FA 3K35A 4JITA 3NTQA 3IAS1 2FOLA 3C16C 2P9GA 3DUFA 3E03A 4PGHA 4B40A 5KREA 1CUWA 4DCMA 3EPRA 1O89A 1MABA 3OURA 1SVKA 2BBWA 5JI3E 1XLUA 5REQB 3KLNA 2CCGA 3B2EA 1ZOPA 3I9V6 4D1YA 3TJZA 3F98A 4LISA 4OFWA 1ZH0A 2ZKIA 5H68A 3VR1A 4CMIA 4CDRA 1E6CA 3QLEA 1LTKA 2BMDA 4OX9B 3BERA 4B6FA 1CZOA 1AJEA 1U9ZA 4U7DA 1VLZA 4A8JB 7ABPA 1EVLA 4RZXA 5F51A 1YR2A 4LRUA 1XPJA 3A6DA 3NBXX 3WWPA 1U2QA 1E8DA 5FNVB 1QIKA 4W9NA 4DTIA 4YXFA 1X87A 2OYSA 5F4BA 4HDCA 4URZR 2OD9A 3KQQA 3WYCA 3LY5A 1DC8A 1UK9A 4G9EA 3IMEA 4XA8A 3IOBA 1QFYA 3FWZA 5DGIA 4HV4A 5AVUA 5CM9C 3QPAA 1NG9A 1FFYA 1UJ6A 1RLOA 2A5GA 2ZBGA 2LR0A 3KJHA 1HNWB 2VJNA 5KYTA 4G5XA 1OROA 1HKHA 1Q1BA 2ZWPA 2GI4A 2XNHA 1OASA 3PHBE 3MF4A 5TE9A 5AUQA 2V74B 4B3HA 5C1BA 1QF6A 1ETHA 4GZLA 3GR6A 3USCS 3EB9A 2VYVA 3QYFA 2ORIA 3LYLA 2FJ0A 1U5BB 3I58A 1NRJB 3NHJA 2BOVA 2GO1A 5E8RA 8MHTA 3BMQA 3IKLA 4R41A 3WB9A 5IKMA 1HRDA 1KH2A 1P4AA 2ZU6A 2YY5A 3EZ7A 4I1SA 3M6XA 1EXWA 1JXAA 1PDWA 5FL7A 4BEWA 1L8LA 4XIGS 3QVXA 1JUDA 1ZJ6A 4AP5A 4F4IA 4J75A 1ZXBA 1G6KA 3LD9A 4QJ5A 1UODA 3I09A 5JAQA 1CU1A 2PMKA 3AFOA 5CLFA 1GGJA 4TSRA 3MILA 1QE3A 4YRKA 4X1KB 2VHEA 3RBVA 2WU1A 3EBPA 2JGMA 1TU3A 5FEUA 1EFAA 1N2JA 4FDVA 3E7WA 3M1IA 1BTOA 3ROEA 1J9EA 2RI6A 2IITA 3TGLA 2X5XA 3AVTA 3BTUA 4NEHB 3V4LA 1WXEA 5ICFA 2ZDGA 1U8TA 1Q7GA 1Z8NA 4YMVA 4FC7A 3S27A 3V46A 2O3JA 4YRJA 2VA8A 1FX1A 2BPOA 4GAEA 4UCFA 3U81A 5DYYA 3VH2A 1CJMA 3NAZA 4DN6A 1B3RA 3RT7A 1M8FA 5EZ5A 3ZE2B 3HVIA 2XT9A 3OIGA 1W2WB 3HCCA 2OBXA 4L5AA 1KP9A 3VO8A 3HJFA 3ICPA 2P6NA 3KVVA 4RA9B 5AOVA 3AEUB 4UHCA 4JKIA 1P81A 1QYWA 2N3ZA 3ENWA 5ISMA 1XTRA 2LWIA 2OHOA 2QAIA 2R1VA 3I73A 2VZ9A 1I14A 1JVSA 3OQVA 2JH9A 2ODBA 1N0UA 4MOWA 1CUVA 1UBLS 2B4KA 4X3PA 2NUTA 4G1MB 4BTLA 3SVZA 5D5HA 5B3KA 4WT7A 1YAHA 2HM7A 5HUHA 2PX0A 2VFAA 5B30A 4AKSA 1KOLA 3I6QA 3P26A 1A04A 4MW1A 1HGXA 2ADMA 5GJCA 1N3BA 1FFXA 3HZHA 4LRYA 4BL5A 4BE4A 2CSXA 5I7SA 1RU3A 2OV4A 4O4LB 3A0RB 3R41A 4XJVA 1GZ5A 1CUFA 2E4YA 4YACA 4RCVA 2BFOA 1FP4B 2ZQ5A 1IJBA 4BB6A 1S4MA 4EJFA 2OGZA 5IAJA 2CZCA 5GINE 1QZZA 4YQZA 4D56A 5HJ7A 2NVUB 1BDJA 1T36A 1H42A 1AKUA 2H48A 3DXYA 2QLJA 2BGNA 4LN1A 5E9QA 4XW2A 5AT1A 3SC2B 5KYWA 4CETA 4H3VA 1X3SA 3AHDA 4HAOA 3AXSA 4HAVA 2FR0A 2I91A 4L74A 3NTUA 2ONKA 1L5KA 3X1JA 2CDRA 1Z73A 4J3FA 3SJZA 2BYTA 3RS5A 4AROA 2VWPA 1TCVA 3U13A 4Z7QB 5L3SB 5EJMA 4ZCTA 3IA2A 4GMGA 4QTUB 1NFFA 3GLHB 4QTZA 5JTUA 4ND1A 5AIAA 1R3DA 2PX4A 1A9OA 1K2VN 1WKBA 1BQ3A 1YI1A 3PIIA 1UM9A 4OREX 3AXTA 1WXIA 3R6GA 3GVCA 1RW4A 4TMYA 3Q0EA 3RJ9A 2XTJA 3KZKA 3TZBA 4UVHA 5A7HA 2GKSA 4AXBA 4QLBA 4XWAA 3M4JA 1N1GA 1T8WA 2OV2A 4Z99A 4B48A 4LV5B 1CQIA 2CXRA 5JRZA 3K09A 4V2IA 5F7OA 2TMDA 5JCOC 4WJLA 4LOJA 3DGFC 4CKWB 4J91A 5GWXA 1TW3A 4KXLA 2YW9A 1DWPA 1WMFA 5AJTA 2RHCA 4RMGA 3WV5A 1H3NA 3QMWA 4G5QA 4I81A 1HE8B 3VC7A 5J43A 4RPKA 2QLMA 2ZT5A 5EWLA 5J63A 1YFZA 1BCRA 2KWIA 3QV1A 4B6QA 3W2IA 4J0HA 4LZZA 4NOLA 3I92A 2R25B 3T7RA 2ZIUB 4EPVA 3AEQA 1MP0A 2AA3A 4M36A 1EG2A 4BEBA 4B35A 2VDWB 5BRAA 4F4HA 4LBWA 5SZKB 4H7KA 3T99A 1H2YA 4U2EA 3IIIA 2HOQA 4K6HA 3UHPA 1EK1A 1O1YA 4PR0A 1V45E 4YNBA 2Q2VA 2Q9UA 3BCHA 3IEPA 3QBTA 3FN4A 4G0XA 1JQ5A 1Z2NX 3AZPA 1G291 4H31A 4QXMA 5EJ5A 2X3YA 4MP8A 3EA5A 3V4PB 2OZKA 3DGEC 1YHZA 4J1NA 5AW6A 3HKDB 1XP5A 3DV0B 1FUYB 4B75A 1QQTA 5K0BA 3E8MA 2Y4NA 4LXGA 3S81A 4FVTA 2F6RA 5ITWA 5ADUS 4ZTBA 1NBAA 1PG0A 4ZGGA 3UW3A 4HAUA 4EMUA 5E7QA 3JZFA 3WWOA 2O6LA 3SNHA 4YO8A 1ZW1A 3MWDB 3K0FA 4BNUA 2GN4A 2QUIA 1PW7A 1KNQA 1VDZA 3FZYA 1TIBA 3N8NA 4YAEA 4EB8A 5KVSA 2FU5C 3U37A 3ZWDA 1L7DA 4KLRA 1JB1A 2Z4RA 2DWPA 3RVRA 3U60B 3RREA 2HYDA 4TYYA 3REOA 1ISFA 1GUAA 1G38A 5F1KA 2XD4A 1T8RA 1OYYA 3M1LA 2H00A 4L85A 1U2PA 4PTYA 4NICA 1OFHA 2FZVA 2ZIAA 3RLIA 4B6EA 4HC4A 2JBAA 2VUSA 2N9UA 3ESRA 3MQFA 4A5OA 2AXPA 1P4JA 1YRYE 2GN9A 1IVYA 1RIFA 1YQQA 3C39A 4OD0A 3PKZA 3KUDA 4IHQA 1X3LA 2QOEA 4O4HB 2V3VA 2JHPA 4U7PB 4GPAA 4P93A 1L4EA 3V2UA 3F73A 2J0EA 2QBYA 4F4UA 2H0QA 3ZW9A 1XJQA 5J3JA 4XYBA 3KJQA 4JJAA 3BM5A 1ADBA 3JAWB 4XGIA 4IP0A 4Y2TA 3VU9B 4DLZA 1HDGO 3HJGA 3M8KA 5EP4A 2FFRA 4IZIA 3NI2A 3PEFA 4JJEA 1XVLA 2WI8A 3A2LA 2J5BA 2JAXA 3G9TA 2JLWA 3H0CA 4IGKA 4YWHA 3QK7A 4AUEA 4WLVA 3WQHA 3H11B 2OBMA 3C1UA 1IQUA 3HFRA 4CFYA 3BWVA 1NC1A 2A0WA 2BE9A 4Y3UA 2V03A 1C4WA 2FLWA 3MIIA 3L7CA 3F2IA 4O3FA 4BN5A 3WWZA 2JGIA 3H2ZA 5E2BA 3RSQA 2UYGA 2VHZA 2FPPA 2Z8ZA 4ZPJA 5FO0A 4BNDA 5LPNA 1OV4A 3RSSA 2XCLA 3KEMA 4B81A 1VSQA 3E15A 4KC0A 2ZSIA 3FDXA 3UG7A 4DR2B 1K9VF 1YUMA 4NPHA 4JB2A 1ISPA 1ZMOA 4NMLA 4REMA 4G0ZA 4IUCS 4WLUA 1NXVA 1XZQA 3WO0A 6CHYA 2H2FA 2C07A 4S35A 1SVSA 3UUEA 2XGMA 2VTDA 3E5MA 1UC8A 2WVAA 1BA3A 5IVDA 4GVXA 4QXQA 4GI1A 3RUCA 3SE0A 1SOWA 4L9RA 4YAKA 1G3MA 1N1EA 4EHFA 4C4ZA 2EG9A 2FEXA 4KXVA 4CIDA 1M2VB 1Y9ZA 2FN9A 2JGLA 1NE2A 3DLTA 2BI7A 3S70A 1XZKA 2B9EA 5CYPA 4COKA 4F84A 2PU7A 1I4TD 3DW1X 1UAYA 3PNKA 4KHZA 5JD5A 1OWLA 3CO0S 3GA5A 3L1JA 3EVTA 1RYFA 1WUIS 2Z04A 2EQBA 3N28A 5DNWA 1EJ0A 3J81A 4L73A 2CFTA 2UYOA 2E18A 3N59A 2QYHA 4ZZ1A 2P3OA 2V7WA 1H2WA 1JIIA 2PKWA 4INJA 1E60A 2X86A 4G1FA 1E4VA 2PCJA 1EFLA 4LNUB 1U0NA 3I4CA 3DE2X 1SUAA 1MQSA 3ZCPA 1NW9B 3FCOA 2JEYA 3LBHA 1YR8A 2ZJBA 2BSXA 3ELUA 4Q1FA 1OJLA 5E8JA 2YOHA 4LHSA 1VHTA 4NJEB 3REFA 1AQJA 2AOUA 4G5FA 5F5NA 3E3AA 4MUBA 2HCBA 1M1YE 2FDRA 3R3JA 1XRNA 1SQSA 1U63A 3DTTA 2H31A 3MT8A 2BFAA 1G3RA 4NMHA 1YNSA 4QICA 1LS1A 3EVBA 4X94A 3HKEB 3VSCA 1JDBC 2VHUA 5HX7A 1O8BA 3MMXA 1C0KA 2RJ3A 5E2IA 3K31A 1EZZA 1M5UA 2ZRCA 4Q39A 1IHUA 4BLVA 4FM9A 1HFWA 4F06A 3AW9A 3EGWA 1QHHA 4QQ8A 5C3UA 3SF8B 3FPSA 3KFVA 4IGIA 4F3NA 1AV6A 3O1IC 2EZTA 4KDFA 1AGRA 3IAEA 3EIXA 3OFSA 4OXKA 2EEZA 4R8SA 4ALIA 5LL6P 2E5FA 4DJ5X 1FJHA 1SC3A 1QVZA 4JLDA 3T34A 4REQB 5IM4A 1P2VA 2NZ2A 2MR6A 1USGA 1IOZA 1Z17A 4JJ4A 5K4HA 1K63A 3NYIA 5B5SA 4CCYB 1NVBA 4D99A 2B0JA 2Y67A 3E5HA 4HLUC 1ITZA 4XVUA 4ERXA 2C8LA 2WTNA 1Q95A 4DQLA 3ZDFA 2I03A 5DF1A 3E61A 1YCGA 1E0KA 4JWTA 3CW9A 2C8KA 4O4JF 1JYFA 2PIAA 2QXYA 3EVNA 3LPLA 3IEIA 4FCCA 3URMA 5HWSA 4GVLA 5IDXA 1XZEA 4E70A 1RI5A 1T0HB 2X5NA 2YMQA 3CUTA 2RIRA 2H59A 2X6TA 5JAIA 3E2IA 5IAKA 3JD1A 3KQHA 2MIIA 4UNIA 1I1QB 4QWWA 4WNAB 3QBEA 4UMEA 4Q9HA 1QHFA 4M3NA 4WZBE 4RL4A 5H83A 3GNSA 1VB3A 2P7IA 4EKGA 5HKBA 2DT5A 3H9GA 5DYTA 4WNCA 3JQFA 4EVIA 3GT7A 1J4AA 5M3BA 2FG5A 4JVNA 4QBTA 4Z9XA 2M6RA 2QNRA 4KHPB 4RIFA 2AK2A 4KTTE 4P7JA 3T9EA 1HLDA 1VHJA 5EKSA 4L9WA 2GN8A 1V8BA 1RHUA 1LBSA 4QGGA 2IWRA 1THGA 4WN9A 3S8MA 2P9QA 3CFYA 4HEHA 5KJEA 4R40A 2UUBB 4J0KA 1E61A 3E23A 4PX5A 3U2QA 1M1YA 1XU9A 3P9YA 3D6TB 1J1IA 4NFLA 5A6VA 4OYYA 5F77A 2C7VA 2EJWA 1U0BB 3VHLB 4LY3A 3AKDA 4YP7A 3I5XA 1MTZA 3K0BA 4NBWA 1FSSA 3MWGA 1DC3A 1XMSA 1YOVB 5BYKA 1I1NA 1QB8A 3TSWA 1FTNA 3IAUA 3ECSA 4B73A 1Q17A 2ZB4A 2MINA 3F1KA 4R1OA 1HQDA 1JEDA 1PNTA 4Q00A 2BKAA 1QHIA 4YRRA 1NJ2A 3TW4A 5LZ4A 3L7YA 1AO0A 5DLDA 3TMYA 4M1SA 4LXXA 4IJ6A 4B2YA 5HJEA 5ADWA 4UHKA 1GNLA 3WICA 4OXQA 1F20A 1PT5A 1J2RA 2BI8A 3DDUA 1YIAA 3S1AB 1E7SA 1OI7A 2ODTX 3LDHA 5HEKA 1SC1A 1Y4ZA 4M87A 4M98A 3V80A 1K66A 3LBAA 4BTEA 1UJCA 2X77A 3SKVA 1C8BA 1TVMA 4CF3A 4M37A 1CQXA 3AUXA 1RQ7A 2MSDB 4D8UA 1M83A 1JILA 1NQVA 1V9CA 1VLJA 2OT3B 3I9V1 3OJLA 3Q3HA 3VYVA 3AJ8A 4C4AA 1GG9A 1UWKA 4DQUA 1JAXA 2QN3A 4NCAA 3E5NA 3KYBA 3DC2A 3DKKA 2Q3HA 3GXOA 1BFDA 2CEKA 2C92A 3BBPA 3MUNA 4UPVA 4RTOA 4IS2A 5EIHA 1E6UA 4NAUA 2VDVE 5BV8A 3IHLA 3KETA 4RPJA 3C7DB 3QKSB 2Z58A 2PKQP 2V3WA 3QMVA 3I30X 3L18A 4NZZA 1KHTA 2W2NA 3B51X 3DMFA 2PQ6A 1TRKA 4WZBA 1CETA 1X70A 1NQAO 1H4VB 2A9QA 2G7ZA 4ENSA 3G2OA 3B8EA 4MUFA 3MHTA 4QNNA 4FEYA 1D8TA 3Q1LA 4TXLA 5I6DA 1D2GA 3BE5A 3Q2OA 5A0TA 3OPYB 1X7XB 1Y4SA 4B7ZA 2QD5A 4CLRB 1S3GA 3WMGA 2JKYA 4BQSA 2EARA 3D1LA 1YZLA 3DLIA 4P1ZA 1I51A 5ULLA 1GP2A 1Z4MA 2H2AA 4BMSA 3FNEA 5AKGA 4AAYA 2VNJA 3S0JA 4GECA 3ZE7A 1B2RA 2RGGA 4TWAA 1B2LA 2IYVA 3NHYA 5E3JA 1G20B 3HZRA 1ZI6A 2GD1O 1YKGA 2GERA 3MYYA 2QT0A 4WOBA 4B1FA 3EW7A 3C5WP 5FPPA 2A0XA 4QEKA 2P11A 4ENRA 2H2WA 5GP1A 2H4WA 2WJGA 3TSOA 5JISA 2CZGA 3HJUA 3K1AA 4RVUA 5I3ZA 2ZIFA 3PHJA 1NWHA 3ZHTA 3COSA 3F5FA 5C7IO 1H2RS 4I55F 4M8NE 1X77A 1UFVA 1T0BA 3RJZA 1QANA 2V7QD 2IYXA 2R4UA 2VT7A 1U9JA 2WIBA 2X1MA 3H9JA 2UUCB 2V0CA 1VKZA 1S9HA 4MYUA 5CT4A 2PT7A 5TMBA 4AMVA 1A9XA 5JC8A 1KIAA 3OX4A 1YVUA 2QRVB 3L9XA 4XLLA 2Q5FA 5B2ZA 1K5DA 3NT4A 4BC0A 4WBNA 3KYCA 1JKFA 1OSNA 3FZGA 3HYCA 4N3AA 2R6ZA 3SS8A 5BVGA 4F4CA 4D0RA 3SNKA 1W48A 5JYCA 1FNBA 5D1HA 1VRVA 2EBWA 1X9HA 1RYZA 4RXTA 2FCAA 2B8WA 1AMNA 1X9IA 4U2FA 4B3MB 4C2UA 4O4IB 2EJUA 1Y5IA 1KERA 1LPSA 4YCJA 2YIMA 1B41A 2VBFA 1A9SA 2HF7A 4X1IB 3TRFA 1O87A 3P4XA 4L4ZA 1TMYA 3LQ2A 4L6AA 4INOA 1W0JD 4X66B 3IP5A 2GCPA 2A5JA 3D4NA 4N3CA 1SK9A 3ZZTA 4WUVA 3KX2A 5K0TA 3KYJB 4IFBA 3FYCA 3QM1A 2AL7A 2FPLA 4FGSA 5FTWA 3TTTA 2IIQA 4HH3C 3PGA1 4K6FA 3BX1A 5LA6B 5JFOA 2K4MA 4UPEA 5E1BA 1JKJA 1L5FA 3JQ7B 2R1TB 2JL1A 3FWYA 4GWKA 4P38A 1TKAA 4D96A 2AR7A 2XY4A 4KO8A 1JG4A 1T2EA 3PCXA 3UB3A 1JFRA 5K0ZA 1GFSA 1E0SA 3DKIA 1Q77A 5FPQA 4Y1FA 4EY6A 3ND9A 3FHTA 3K70D 5FR2A 1X1BA 2ZXUA 2ZBQA 3FMVA 2DLDA 2BD0A 3ZDDA 1SG0A 1R8YA 3BEDA 2FP4B 4IIEA 1JU4A 1T3LA 3QEJA 4KO2S 4CM4B 2W93A 4GR4A 3SZOA 4F71A 1CF2O 1E1CB 1VC2A 1SM4A 2OV6A 1JHUA 3MW8A 2Q0QA 4Q7EA 1RTKA 4OI1A 1IEQA 4ZCPA 1BXRB 1R1DA 4B3RB 2AIRA 2JLZA 4PYMA 4AXXA 3ZGOA 5BWLA 2CJWA 3OJXA 3O74A 3A9VA 3QE9Y 3M1YA 3AM4A 1U0EA 2AVDA 3OAAD 1UZMA 3AP2A 3A6HA 1M2WA 3O9VA 4QIHA 2ZUSA 4D8TA 5KZMB 3C45A 2PZBA 2R5WA 3Q72A 1OAKA 1T34A 2QRJA 2XWBF 2CLSA 3KKNA 3KELA 3PYLA 3MAJA 2Q8PA 4PAQA 1RQGA 3ZU4A 1G3QA 3GJRA 4JS0A 1QP7A 3PXUA 2OO5A 4UMVA 5LZ8A 2QD3A 1L7RA 1IDOA 3MD9A 2YQ4A 3PXDA 4MARA 3T3IA 3AOEA 4KPFC 3I23A 4JB8A 3TS1A 3CYFA 3KOMA 1R0LA 5ELLA 4YHBA 3RSFA 3UUFA 5K6AA 3SJ7A 3HJBA 3NXKA 2MSLA 2AN5A 4I9FA 1KTVA 2CHFA 4IKEA 7REQB 3AKZA 2VZ0A 1K8RA 4NBTA 1N5IA 4CR8A 2V7QA 1BS1A 1K6JA 4O6VA 5B3AA 5KO2A 2TRSB 3PWTA 1ZR4A 1WXDA 3DB1A 4GGMX 3HBFA 3GRAA 4D25A 1E2FA 1LRJA 1H69A 3FGNA 1A71A 3UAZA 4D9MA 2JPDA 5JI2E 4GXRA 3LWDA 4EGJA 4N8EA 2HJHA 3QUSA 3WMWA 1KS2A 1VYUA 4L6CA 3M34A 5KYXB 1N2CE 1ZHHA 3LLMA 3C41J 2ZSHA 4CW7A 2Z6UA 2G6BA 2VYND 3OD5A 4XUDA 3B6ZA 1WG8A 1UK6A 1W0JA 4MUIA 3KZXA 4NKRA 4Z4GA 2PY6A 3OMWA 1EQ2A 1TB4A 3NOVA 5JNRA 1GNQA 3UBMA 4BXOB 3F6CA 1NG1A 5I7WA 1ODKA 1T0JB 1DUVG 3R40A 3AVYA 3F3MA 4FE4A 3OIYA 3PLAE 2CWWA 4B83A 2GEKA 2EIXA 5AW0A 3ESQA 4DMLA 4O2LA 1W85B 4BVEA 3LDAA 3PGLA 3UQZA 3HUFA 2CYBA 1HBJA 2PFKA 3D6HA 4QDXA 5K4GA 1Q5PA 1S1MA 4FFLA 1BVHA 2XBMA 1ACJA 1Q11A 3SXUA 5CYGA 4LOAA 4EJSA 4XDYA 5DISB 3H5VA 4RGVA 3ZCXA 3SZ3A 1RHQA 4TVSA 1OPRA 2NSDA 4HDRA 4G5YA 4N0PA 5DCLA 3VSDA 2BKVA 4DKXA 5FRDA 3QX8A 5B58C 1J39A 2F00A 2QTWB 5L4SA 3FLBA 1PV4A 3HC7A 4K05A 1EVIA 2W58A 4FONA 2WM2A 5DULA 3VHQA 1VB5A 5DOVA 1Q20A 5DTRA 5HF6A 1XALA 3OLCX 1EEHA 4P33A 4ABTA 4F3KA 4YCLA 4TV9B 5HP4A 2NYRA 1XYVA 3I04A 2GK3A 4TT3D 5LMZA 1RJDA 4QPZA 3A6FA 2OFFA 1P44A 4ALJA 3M5DA 4KKXB 2XRMA 2ATXA 4HX2A 3D6NB 3DEZA 3WGGA 2J3HA 1HL7A 4BMXA 2XUJA 3PDWA 4L4RA 4IY1A 1E96A 2C9OA 2NTYC 5DM70 2BTOA 3EXHA 3VZPA 4ZEVA 1HMYA 3GG9A 4DEVA 3H65A 4GNKA 4QJ4A 1SVMA 2XE7A 3OAAA 3VMMA 4B3FX 2GVNA 4H35A 7ADHA 1WSAA 2WAXA 4BX0A 3EA4A 5P8WA 1OAOC 1WW2A 3NX4A 4FJ2A 4YJDA 3X2EA 2E21A 3DDSA 1SURA 4LDZA 3NBYC 4X3OA 3TQOA 2DT8A 3ZTYA 1G9XA 4D2IA 3LRTA 1N2CA 3ANNA 3T1TA 2CXSA 1MHTA 4ZV9A 2BSQA 3MIZA 3Q8XB 1GKKA 1QH1B 4HRAA 4DSZA 3QEMB 1FDSA 1NIJA 1LLDA 1FNCA 3LYHA 2NYAA 6Q21A 4L07A 5CEFA 1P18A 2HQOA 1F4PA 3R4VA 3KC2A 4DRYA 1QU2A 4YIHA 1ZI9A 2VWGA 3HDVA 1YGYA 3CWCA 1P4HA 5JQGF 1JLSA 2HO4A 1KFEB 1M2FA 1G0NA 2ACVA 3DBLA 4RPCA 4BNJA 5GIPE 4RK6A 5TNXA 4HAXA 1LI7A 4NXMB 2QTRA 1SCAA 1SR8A 1SRRA 3HUTA 2NV0A 5KCMA 4IDQA 1RYYA 1YC5A 4A8TA 4ESHA 4RVCA 3C3MA 3ORRA 3FOEC 1N2XA 4G4SO 2HSEA 3GFPA 4G0WA 3GJ0A 5AW9A 3M1AA 1IUOA 2P35A 3IQEA 3V8VA 2IL1A 1MO5A 3BGOS 1RBYA 5IFKA 4Y2UA 1FRQA 3ER6A 4NCKA 3IODA 3IJEB 2AD1A 5HQ3A 3UB4A 5GY7A 1O97C 2VYNA 1PR0A 3WI7A 5JS7A 4R7ZA 1KH1A 2WSSD 2ZB2A 5JSZB 2FX3A 2VWQA 2ZJ6A 4MS4B 1UPUA 1PP4A 4AULA 1EVJA 2ZRNA 5D3MB 3D8BA 1GGHA 3INTA 3VX3A 1N2HA 4QGHA 2WFMA 2C58A 2O7QA 3N7TA 1BXGA 3QGMA 4KU4A 4C87A 4I4TF 2CMFA 3CA8A 5GM2A 5I8WA 5G53C 2QN2A 5EIBD 4AQYB 4KV9A 1DT5A 2YC2C 1KVUA 1O0SA 3AETA 3CF4G 1WPXA 1T35A 2QUKA 4D9IA 4RIHA 2D3WA 3H42B 5ENZA 4OJTA 4AMZA 4J0CA 4Q9JA 1G7CA 1PZHA 1UWCA 2ASEA 3PWZA 2P2ZA 3Q88A 1I5RA 3R5JA 4RD2A 4UD6A 2Q5OA 1DKPA 2BMWA 4PNEA 1OBOA 3ZUGA 2E37A 3TO5A 1G1MA 1OBHA 3BCRA 2BHTA 1T2UA 3OSZA 4TMXA 3VV2A 3ND5A 3TXAA 4D0GA 4D81A 4QXOA 1RP1A 2GBPA 2Z1MA 4IR7A 1XZJA 5KYUB 4BYMA 1TU0A 2XAUA 3H2HA 1CIJA 3TD2A 1R0KA 1RKUA 1S0UA 4IDPA 1N25A 4C20A 2OV3A 4RXUA 2PS0A 1Q21A 4RBNA 4X8HA 1E79D 3VKGA 3GFRA 1QOZA 2HQBA 4HX9A 1C9MA 2Z30A 4PPFA 4TT3A 3UKJA 4LJKA 4PPNA 3R7FA 1SQ6A 2GN2A 5HFNA 4UCQA 3FBTA 4OB7A 4KLAA 2XMRA 1QZ3A 4GRDA 2ZUCA 4S24A 2LV8A 1KR2A 6REQB 1B14A 1F2UA 4H7IA 4XSVA 4Y6PA 3T1NA 4GX1A 1PFYA 1U99A 2OCYC 2Q5IA 4YROA 5G41A 3RS9A 3N8DA 3QU2A 1AM4D 2GJAA 3DPIA 5DWQA 5T5QA 3LLSA 2VJOA 4CL2A 2NADA 1KBQA 4GXNA 4YFYA 2I8AA 4BNVA 4WECA 4KSYA 2PSFA 1ZHOA 2PD3A 3C3BA 3IP9A 5T6MA 5L40A 1CDZA 2AZTA 3GMSA 4I99A 2HAEA 2HQSA 4BV2A 1P1KA 3MJRA 3LFUA 1ZWLA 2NV2B 3UY4A 1YZQA 2BZ0A 4RY2A 4QSHA 4GLJA 3F6BX 2XODA 3HRKA 2FHSA 3L4BC 1FFBA 1M34E 3KOZA 2H85A 4GPTA 4M8KA 3FJOA 5ECDA 1DC5A 1V2GA 4DMHA 2ZUVA 3O4RA 4BO5A 3USZA 1MGOA 1E9FA 4CE6A 3WHLA 1EZ4A 1CTQA 3PUHA 4MWGA 4XX0A 1I5OA 3VDRA 1DELA 1I2MA 3GOQA 2QORA 2YV5A 2OLKA 3TDNA 4X24A 1ZH6A 4L0DA 2Q46A 3RNOA 2VDPB 4KGZA 2QHXA 4U6QA 4NU6A 2Q28A 1ZC3A 2HLNA 4RIGA 3DE7X 1YB5A 5G0WA 5T6BA 4E3ZA 5A4AA 3ESBA 4GBGA 4QYMA 4F2WA 2WSSA 4B3CA 1Z56C 3W9YA 2NTEA 1GGMA 1CW2B 4UD2A 4FGJA 2CXTA 4GMHA 2VK2A 1W2HA 4MHSA 4R8MA 1Y8AA 2P1RA 4LOKA 4Y6LA 2Z8YA 1Q0UA 2FFQA 4IFIA 4L7VA 2FDXA 2YFHA 4WESB 1N0IA 4EHAA 4LYAA 2ANCA 4C4XA 3LCRA 2V1XA