1JAIA

H-ras p21 protein mutant g12p, complexed with guanosine-5'-[beta,gamma-methylene] triphosphate and manganese
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAPGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of the metal ion in the p21ras catalysed GTP-hydrolysis: Mn2+ versus Mg2+.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp-binding
molecule keywords C-HA-RAS
total genus 63
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1996-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1jaiA00
2BIFA 5JEEA 2QPTA 4XVUA 3FMPB 1IJFA 3GJ3A 1HH4A 1FNNA 2HJGA 1G64A 3I61A 3PEYA 1SHKA 5GVSA 4B76A 1KJYA 4B2LA 3NDBB 1SVIA 4IDOA 1W0JA 1JNYA 4M9QA 1CR2A 2OCBA 3ZS8A 2DPXA 2QTFA 2O8CB 1Z6GA 3PEVA 1LW7A 2NGRA 3W6PA 5FR1A 1QHHB 1J8YF 1TF5A 2PMDA 3LLMA 4QJ4A 2QM7A 1EFRD 3GMTA 1JECA 3RAPR 1UBFA 4MDEA 4KV9A 4DLWA 4EFNA 1S3SA 2X2EA 1UFQA 2YV5A 3SQWA 1NMYA 2XB4A 3IPYA 2J0SA 2EWWA 1HT1E 2HJVA 3MFYA 1KO7A 1KI8A 4JYBA 4UXHA 3LW8A 4UNNA 4G5OA 4G5GA 4LV6A 3SNHA 4HEJA 2JJ2D 2V8OA 4RFSB 2Q9CA 1H65A 2WSMA 2ZAMA 1RJ9B 4G5RA 1P7CA 1NBMA 3P27A 4TT3D 5JCPA 4RZ2A 1QRAA 3S1AB 2W00A 1A1VA 2ZI9A 1E9CA 2RH5A 3OIVA 3TSOA 2AK2A 1Y63A 1XD9A 2UKDA 3EARA 3LAWA 1OH6A 3GQBA 1DTSA 1P3JA 2XZPA 3RWMB 4AKHA 4R98A 4M0LA 3PIRA 2YYZA 2CMKA 1AJEA 3B9PA 1ZM4A 4DWJA 1XEXA 2GXQA 3UWOA 2WWIA 3HPRA 4YDSA 2F1HA 4RZUA 2QZ4A 2YINC 3LRPA 2WAXA 1LF0A 4PO9A 4PSAA 2GZHA 4LJAA 1W2HA 2OHFA 1Z0IA 3RC3A 5LB4A 2YZ2A 4I99A 3Q72A 1NY6A 4KBGA 3LWNA 1XU4A 3FE2A 5GJBA 1E2GA 1GRQA 1HA3A 2IXGA 3AH8A 2IS1A 3T5GA 4I1OA 1XCGB 4IFEA 2YWGA 4ASUD 2OSBA 2QA5A 4RD4A 4DLTA 5IF9A 2ODNA 2OUKA 4K8OA 3GLHB 3P4XA 1ZUIA 2GEVA 1Z8FA 4Q00A 1JB1A 3KFVA 1IONA 2FX3A 3K70D 3UANA 1C1YA 2ZE6A 3A1SA 2ZJAA 1KI6A 1AKYA 1JI0A 3RS7A 2NG1A 3KJEA 4TLDA 1JJ7A 1SVLA 1AZSC 1M2OB 3T1VA 4U7DA 2C8VA 4Y0VA 4TQ9A 2ZJYA 1NBMD 4TT3A 4WXRA 3KQLA 3MRSA 3O8DA 3QXSA 4S35A 3GJ8A 4Q19A 1E2IA 3VFDA 1BIFA 4URWR 3WY9A 4B6FA 4DEXA 2WOOA 1T6NA 2ODBA 3BH6A 3PITA 2KJQA 2V1UA 4DKXA 2Y8EA 3B60A 621PA 3PR1A 2R44A 3FMIA 2QPAA 2W2TA 2MSEB 4A0RA 5EE0A 3C14C 2V54A 4DCVA 4JVNA 1BS1A 4TMZA 5EUMA 3N5CA 2IYRA 3SU8A 2IX3A 1KI2A 5KNCA 4LJ9A 5IRCD 821PA 2EFGA 4U02A 1E2HA 3BJIC 4H9GA 2WAYA 3ZLJA 2XZLA 3B1ZA 3U44A 1DBSA 2NPFA 3GLHA 4RD3A 5FOTA 3CH4B 5K8LA 4BFZA 2YKGA 4C0KA 4QGGA 3IHWA 3B1XA 1YRAA 3SI7A 2VF8A 1FTNA 1KOFA 4ITRC 2QTHA 4H1UA 4Q01A 4XVQA 3TLXA 2ZTSA 4BZXA 2ZM5A 1F6BA 2L0XA 3RS5A 4LZZA 4HATA 1IY0A 1Z6AA 3PEWA 4ILEA 2WWWA 2RB4A 4BE7B 4JLVA 3THXB 2QT1A 4Q7KA 5E7MA 3AVQA 1NN0A 5AUNB 4MRSA 4JSTA 4MKHA 1QDEA 3PUWA 5CJPA 5EQTA 3Q7PA 4WAUA 4CZ2A 3X1YA 1TQ6A 2VP5A 5KOYA 1NN1A 4QRHA 5KNBA 4HLUA 3GP8A 5CDFA 1ZVQA 4BZPA 3W9YA 2GJ8A 1VDZA 3SEAA 1TMKA 721PA 4EQ6B 4NYMR 1R4AA 4XH9B 4M1SA 1UBGA 5FPYA 1DAMA 2J45A 4LHVA 5KPDA 3V00A 1PUJA 3QXJA 4OBEA 4IDHA 2CVFA 1G8HA 1Q12A 2C78A 2ZRHA 4D81A 3GLIA 1ZIPA 1ZINA 1T0HB 5DO9A 5BN4A 4I1UA 1CRQA 4KHZA 3SQXA 3MWYW 5SZIA 2EYUA 5H68A 4V0MA 4A0HA 4OQXA 2BBWA 2IYQA 1CLUA 1U9IC 2JLQA 5H70A 2XB2A 2BMDA 3CBQA 2NO9A 5L3SB 2QI9C 2RKOA 3KKMA 4TMTA 3WYFA 4LWZA 2IYWA 3E2IA 3QF4A 3RWOA 3H1TA 4BLSA 2W6JA 5HCIA 1J2JA 2ZSAA 2CDNA 3MD0A 3ASYA 1E4VA 2R65A 4BZQA 3AV0B 2ZR0A 3OIWA 1BMFA 1VPLA 2GZAA 2QN6A 4DRZA 3LVQE 2O8BA 4D25A 3CPJB 4AIIA 5IDVA 4BQSA 1BKDR 3B13B 2A5YB 2RHMA 3TKLA 2ZS7A 4EPVA 2QE7A 3J81k 3L0OA 3D6TB 1TEVA 2GVDC 3IDQA 3GLGA 3OZXA 3IO5A 5JJLA 3BAFA 3KQUA 4TYWA 3EA5A 2C96A 1XPOA 2A5JA 3DOEA 2OXCA 2Z43A 1CJMA 4RKEA 4AWXA 2NTYC 2BM0A 4GOXA 1JPNA 2WJYA 4MRVA 4NL4H 5SZHB 4KYUA 2FV8A 2R2AA 3GJ5A 1AM4D 4HUTA 3LFUA 2YOGA 2VP9A 2IYZA 4TSFA 3FHTA 4BLTA 1UDWA 5G40A 1JEDA 2OEPA 3PQCA 3LH5A 4PSKA 4BEBA 4DSOA 5AUOB 1A5TA 2JAQA 1NVWQ 1GIAA 1RYHA 3CNOA 4G3XA 4A4DA 2ZRNA 2VSFA 3BB3A 1SKYE 1US8B 3L2OB 1SVMA 4I4LA 1Z08A 2EFCB 1NKSA 3ASZA 1YHNA 1GNPA 4MH0R 4CT4B 3CB4A 4LJ4A 1KKLA 5BN3A 3ZD7A 2Q3HA 3EX7C 4Q02A 3ONWA 1XPRA 2CNWD 2GCOA 5L8VA 2A3RA 1E99A 1S9DA 2DY1A 3LXXA 5IK2A 1E9DA 2V6JA 3A58B 1G5RA 1N6PA 1P9NA 1LNZA 1L4YA 1GDDA 4AURA 2A9KA 2AXPA 3FMFA 1KO4A 4KBFA 1AS3A 1PLLA 4JLNA 2B7BA 3THXA 1EFUA 1SGWA 3VR5A 1SZPA 1ZD8A 5KDLA 4US0R 1MKYA 1TF2A 3A4LA 3WP1B 2ZYVX 4TL9A 3LY5A 1VG9B 2ZR9A 1TUIA 3QSYA 3QXXA 4NU0A 3U2QA 3C8UA 5J5CA 4JMPA 3NH9A 5F9FA 2R62A 2R6GA 3ADDA 4Q1BA 4N0EA 1BO6A 5JSZB 2PJZA 4IVPA 3OHMA 3IIKA 2ATVA 3MGCA 4F4JA 2FA9A 1HURA 1N5JA 4D0GA 2VA8A 2F3RA 1XEFA 4IHQA 3NH6A 1CKEA 2HUPA 3DDCA 4Z1MD 3Q7QA 5DNYB 1J7KA 3BIFA 3DEFA 2OLJA 2IC5A 2W0MA 3W90A 5LBIA 4B3DA 3I1FA 4LBZA 3BH0A 4D4MA 4KFRA 5KSOA 2VSOA 2CBZA 3SYNA 2GJ9A 5FUVA 3AVTA 4PC1A 4PPNA 2JLZA 1CP2A 4NKRA 5L3VA 1U0LA 1R2QA 3K0AB 3PEUA 4BEJA 2VLIA 4PAOA 3UMFA 3TGPA 1DEKA 4WXPA 3SR0A 2J41A 1KDOA 3K1JA 2WSSA 4MGZR 5FR2A 3EIHA 2JJ1D 2B21A 3IIMA 5DSZA 3GLFB 3EA0A 4KJZA 2OCAA 4C0AC 3QKRB 2BBOA 1KO1A 3K9GA 2D7CA 3VMFA 5GVRA 1G3QA 4IDQA 3G82C 4CGZA 1W0JD 4NP6A 1E2QA 3BBPA 4HAYA 1YZNA 2CLDX 3HP1A 3CRVA 3LQRA 3VR1A 1KK2A 3TMKA 4IEEA 1OE0A 3UG7A 1P73A 4HDQB 4LHWA 3THWA 1MR3F 2IYUA 1E9AA 1T5LA 2QMUA 4DUGA 2FE4A 1VCNA 1E32A 2F1JA 4EPTA 2FEOA 4PAMA 2LWIA 1GUAA 3VU9A 4Z51A 1ZRHA 3C15C 3CF6R 3LVRE 1OW3B 2AN9A 4YXWD 2IWHA 5A4JA 1W4CA 3ZIAA 5FL7A 3A1WA 2IBMA 4PC6A 4DEYA 1P60A 1W46A 2FFBA 1QHGA 5F2EA 1OV4A 3AF4A 3WXMA 4B48A 3FDIA 3NC0C 1G21E 4G0NA 3BERA 2GJKA 1KJZA 1SXJA 1AKEA 4JBWA 1IJEA 1XEXB 1VIAA 4Q1FA 1S96A 1XFAA 2HXSA 1KAOA 3SFZA 3UKDA 2XNDA 3L0IB 1OYYA 2AL7A 5HE8A 2JASA 4CDGA 2AKYA 4A2WA 1T8UA 1TU4A 4ARZB 4PO8A 2QROA 3JZAA 4PHGA 1II8B 4L9WA 5CB8A 1RIFA 2O8EA 1KI3A 3IBGA 3EZ9A 1RPZA 4UNSA 2BKEA 2EQBA 4L8GA 2CCKA 4DSTA 1GOTA 4PPGA 2FNAA 4HB2A 4OYHA 3THYA 4A2QA 3K0AA 3P26A 3PJRA 4HZIA 2J0VA 4D82A 3W5IA 2Z0MA 1N0WA 4MKFA 1W48A 4XWKA 3PUYA 1FX0B 1P61B 1QF9A 1OPXA 1KI7A 2AX4A 4NTZA 4QBGB 4F4CA 1I4TD 2NOAA 3GLHE 2O8CA 1JR6A 5GADl 4CEIA 2QMEA 1JBKA 5DIFA 4I1VA 1OXUA 3K0CA 1DARA 2GXUA 3SC3A 2HCJB 4PANA 3VKWA 2K5UA 3W8NA 4W5JA 1E6CA 4IRUB 4JBYA 2J0UB 2ZROA 4Q4JA 5E95A 3LA6A 2Z5FA 3LX5A 2CCGA 2WPDA 4QXAA 2JEOA 2GEUA 3NBYC 4RCZA 1Y3AA 3MMPA 1ODFA 4QBHA 1G7CA 1U0HC 2LCFA 3A37A 1G9XA 3VR4A 1GTVA 3WNCA 4A15A 4ZIRA 2OM2A 1XRJA 1KY2A 5UKDA 1KMHA 3IHLA 1QZXA 3AEZA 3HR8A 1WBDA 3SHWA 3B78A 3HDTA 2LKCA 1LTQA 3ZDQA 1G7RA 1W1WA 1XTKA 1N6NA 4URZR 3JVVA 1QBKC 3FHOA 1E9FA 1CR0A 1KTVA 5C1BA 5FBWB 4IOKA 4LI0A 4C7OA 2OAQ1 2GCOB 4TTQA 3ZVLA 1JR3A 2Q9AA 4Q5IA 4JJKA 4LYFA 4P33A 2WBLC 4IFBA 3UMSA 4X8LA 1OYWA 2WM9B 4YMWA 4B32A 4BPBA 1UEJA 3HR7A 5EP3A 1G16A 1Z2CA 4B2PA 3TBKA 3G5UA 1KJWA 2J0UA 5EZ5A 1N6KA 2I1QA 2HXYA 4LJ8A 1E69A 1X1RA 3AF0A 3AQ4A 5AJYA 3X1XA 1S9HA 4ACBA 4DLYA 5HPYB 3NWJA 2PCLA 2TMKA 1TF7A 1ZAKA 3AVOA 2UVQA 4M1OA 4A82A 2G9NA 2C9CA 2JIZA 2EYQA 3RSOA 4ZCMA 4D6PA 2DFKB 1UKEA 4P4TA 2BMFA 1XJQA 4IOJA 4PFSA 1CBUA 4LBVA 1IBRA 3KKPA 3SHFA 1MABA 1NRJB 4TZ0A 2IS2A 2EFEB 5LD2B 4JYCA 4O25A 2BM1A 4C2UA 3AF2A 1MT0A 4V03A 2GCNA 5B30A 4P4SA 1T5IA 1E79A 2ZI3A 4DLUA 4RJLA 2AKAB 3K9NA 1G8PA 3GPLA 3TUJC 1W5SA 4Q1AA 4YONB 3CPHA 2W2VA 1DADA 2CCJA 3VX4A 4BFXA 1P9RA 2XJ4A 1TQ2A 2OO7A 4R2HA 2V7QA 5KDOA 1GKIA 4LC1A 3U3MA 1EK0A 2DCUA 2RGXA 3I3SR 4MGYR 2F43B 4QNMA 1ZM7A 2ZI6A 1TEXA 3F5FA 4YMVA 3U4QB 1GWNA 5C2JB 1YU9A 2N1BA 2R6AA 5FBRB 3THOA 5LB2A 5DGXA 1E2FA 1XTJA 2VSXA 4DIDA 2ZITA 5EE3A 1YZLA 3EG5A 4G5SA 2JLVA 1WF3A 5HZHA 4ABYA 2VHCA 1E2KA 4OK5A 3OFNA 3TH5A 3CUEF 2NO0A 1UDXA 5FTKA 1EFRA 1E2PA 2V1XA 2E1RA 5HR5A 2OE2A 2QPOA 3I8SA 4NHOA 4KSCA 4DCNA 4LV5B 4Z8XA 4C9BA 3KXLA 3KXIA 4KFUA 2OFWA 1EFTA 5E7JA 3EIQA 2W2XA 1Q1BA 1NMZA 5IK2D 3PUZA 4Q1DA 1N0VC 4BFSA 5K8IA 3M6AA 2X19A 2FZLA 4E07A 2NO7A 1QG4A 5EZ6B 1ZUNB 4GZLA 2BJVA 2HLDD 3I32A 3M0EA 2ZJ5A 2XTNA 2GDJA 2P5TB 2E87A 1GZSA 3K53A 3REGA 2JA1A 5DHFA 4D4LA 5B58C 2XJ9A 1ZC3A 2QMOA 3TQCA 4DLXA 2GAAA 5FBVB 1E9BA 3CX6A 1E0AA 2DFTA 4OQFA 1JAIA 4JLOA 1RYFA 3CRW1 3FKSA 4LPSA 4PPQA 4XSHA 4PHHA 1VCMA 1Q1QA 3QVUA 2HEIA 4OHWA 4TLAA 4XD7D 3U3KA 4C0JA 2IF0A 4TN1A 2W83A 3L8ZA 3X2SA 5CM9C 1W7AA 2CK3D 3K0CC 2P6RA 1ETUA 4JS0A 1ZU4A 5F98A 4JT4A 2DHRA 3BXZA 1WCV1 2UZIR 4PX9A 4OHXA 3R8CA 2XAUA 1EFCA 2ZRAA 1W36B 4O3MA 4ZI2A 4UJ3A 1FP7A 5HZKA 1D5CA 2W6IA 2ZRIA 4XOIA 4R7ZA 3KTAA 2IWRA 1KHTA 1OXVA 1TNDA 3RYTC 3PG5A 2RGGA 4URXR 1R7RA 3K0EA 2WTUA 1T0JB 2ZU6A 3QKUA 2IYSA 3I92A 1U8YA 1JALA 3RNLA 2E9SA 2ZQ5A 4TZ6A 1R6BX 2PH1A 3ZD6A 2PMKA 2WWYA 3LV8A 4QBIA 2BDTA 2QP9X 3SDZA 2P6UA 1C9KA 1TAGA 3W34A 2C5LA 3VKGA 2R6FA 2EU8A 3H2YA 1EXMA 4CF7A 1G18A 1GNRA 4MQBA 3T15A 5JI3E 3AUXA 4B35A 3BRWD 1KKMA 3FMOB 1WB9A 1Z6XA 2VYFA 4TLBA 4IW3B 3ADKA 4MGIR 3DVLA 2WJHA 3VU9B 2OV2A 3KQNA 2FOLA 5JECA 1CJTC 2D4HA 5D3MA 4A8JC 1D9XA 3THWB 2XSZD 1IQPA 5TMPA 4DB4A 4KSBA 5J4KA 2PZGA 5E7IA 1G17A 2ZYTX 2ECKA 4LYJA 2GEDA 4CEJB 2GBLA 3GLGB 4NYJR 4U5XA 2CEAA 1EGAA 4V0OA 3VHXA 2FMXA 4EPYA 1NIJA 5KDDA 1K5GA 1P75A 3IILA 4LJ7A 2IYYA 4N3NA 1XPUA 2FSFA 3EC2A 2IXEA 5H8WA 2GF9A 1YR9A 4RFSA 3IQXA 5FPTA 1ANKA 3QF7A 1BOFA 4HZUB 2HF8A 2ZIAA 2FSHA 2VP4A 3OEHD 4B74A 3ECCA 2O8BB 2BJWA 1Z0AA 4U00A 3GEIA 4MYCA 5FL7D 4OHZA 3OE7A 4Q47A 5BWMA 1FQKA 2IF2A 3UG6A 2I3BA 5AUPB 421PA 1Z63A 2WKPA 1CIPA 4HAXA 1QHHA 4ZCLA 2BMEA 4Q4AA 1FMLA 2P6NA 2P67A 3NXSA 1G7SA 3W3ZB 4P4UA 1OH8A 5TY0A 5BYJA 2PX3A 1KGDA 1P2UA 1G6HA 4POAA 3VX3A 4EFMA 2N46A 1DAFA 4PZZA 1T3HA 1M6NA 1YZKA 1H8HA 2PX0A 4QGHA 1VG1A 4MYHA 3T1OA 4DLSA 3U7FB 3DKVA 4OQMA 1TUEA 3HYRA 4LUCA 3MWLA 2JDID 4TYPA 2ODEA 5EP2A 1GVNB 1MH1A 2YWFA 1UKYA 4E22A 3UPUA 3N2IA 4JLAA 1IXSB 1HEIA 1UKZA 1X8LA 3OFND 2JLWA 2CXXA 2YJTD 1Q57A 5FTNA 4DCSA 3IO3A 3Q85A 3AVPA 5LD2C 1NVUQ 2ZI4A 1E94E 2FG5A 4K46A 3Q5EA 2A7QA 2ODWA 1SXJC 2ZRLA 1OXSC 1J8MF 1YKSA 3WNDA 3U7GA 1K8RA 4BRUA 2Q3MA 4HAWA 3T12A 1U98A 4DB2A 2GK7A 1TPZA 1HT2E 2V7QD 5JHGB 1KSFX 4W7SA 4ZCIA 2FGJA 3DKPA 4LX0A 1DAEA 2JLRA 1JXMA 1X86B 1R8SA 1EG7A 4QKQA 3QIAA 3SFVA 4HAUA 4KVGA 4PQRA 1WBBA 3NHBA 3CR7A 1NNEA 2QEQA 5C4MA 4M21A 3V4RA 1FTSA 221PA 4AYWA 2J3EA 2BBSA 1KDTA 3EWAA 1ZNZA 2QG6A 4DUGD 1G20E 4AKIA 1L7VC 2CHQA 2JLYA 1VECA 4NYIQ 4BFTA 5DN6A 5EJEA 2CL0X 4NCIA 3PUXA 2H1LA 4EUNA 1RW4A 4QM7A 4EJSB 5J47A 1MOZA 1LF5A 1YRBA 2VP0A 2H7VA 3DZDA 1P5ZB 2PLFA 4FIDA 2OG2A 3K0SA 3EWSA 3KXKA 4Q7MB 1NKTA 2VHJA 2VHQA 2V4ZA 3TQFA 3N2EA 4EAQA 1Z47A 3QKSA 2IW3A 3OEED 1SULA 3KJGA 1T91A 2WSSD 3OESA 3EZFA 5F9HA 2QY9A 4GOJA 4L4UA 5K8TA 4WA7A 3ADCA 1W2GA 3RS0A 3H84A 3U7HB 4DLRA 1FUKA 1TL7C 4MUAA 2YOFA 1NVVR 1QHNA 4B33A 4HB3A 1ZCBA 4IKEA 3B8HA 1CTQA 5FUXA 1ZUHA 4GBMA 4Y0AA 4FMDF 4M1YA 4FMCF 3ZIAD 2QL6A 2XGJA 5JFGA 4HLQB 1OB5A 2AWNA 1HV8A 3GEHA 3EPLA 4WW0A 1TX4B 1U2RA 1W49A 1GILA 4C0HA 1GM5A 2X2FA 4ZDKA 1DAIA 3ZS9A 3R8FA 3CF2A 3RRZA 1U9IA 4HDOB 1QHSA 1GL9B 1Z0JA 4DLZA 2CHVA 5C4GB 4RD0A 2GXSA 2GILA 3WMGA 4DCUA 3ZJYA 2QNRA 5AK0A 4LRWA 1R0YA 1EX7A 2FFHA 4Q4AB 2F3TA 2REBA 4YQFA 1W4AA 2VPPA 2ZRPA 1AS2A 3MSXA 4TMVA 5EUQB 2QSZA 5J4YA 4B73A 1O87A 1VG0B 1K6MA 2YC2C 2C77A 1W36C 1Q0UA 1XX6A 1XMVA 3LW7A 3GJ4A 4URUR 5DHAA 4DT1A 4CEHA 4NE2A 2IXFA 3FFBA 1J70A 5KUTA 1HUQA 2RGCA 4M9SA 4AD8A 1CULC 1W44A 2OESA 1L8QA 1CS4C 3TIFA 1GKUB 2GTPA 4JLKA 1XDBA 5FTLA 1A4RA 4JZKA 4PC3A 3QE0A 4URYR 3RANA 4CEHB 2ZE8A 2ORWA 1P9WA 1CF4A 4Q4LA 1N5IA 4QHYA 3MWJA 1E1RD 4Z1MA 3WYGA 2JLSA 4A6XA 1CEEA 1QVRA 5LDDC 4N1AA 3U60B 1MO5A 3D3QA 3R9XA 4QFMA 3K09A 1B0UA 2GXAA 2QP3A 3U5ZB 4Q48A 4HSEA 2NQ2C 1KIMA 2G1JA 3CKLA 2ZPTX 5AWFC 3A1UA 2D2FA 4Z54A 1G7TA 1GG2A 3KKQA 1GKYA 1ZNXA 4Q4HA 5DLQC 5TARA 1JEEA 4B43A 4TL8A 4V0NA 4UNRA 1LVGA 4OQNA 3U4QA 2ZU0C 1CRPA 2CVHA 2ZJ2A 3H4MA 4JL8A 4B3FX 3QG1A 4M22A 2FSIA 3QJYA 5DI3B 1GFIA 5GJCA 2QE7D 5J4HA 3UK6A 3MAAC 1U8AA 4O0MA 4FMDB 1IN8A 4V02A 1HYQA 2KBEA 5IT5A 2WOJA 4M9ZA 4MKGA 3RABA 1D6JA 1NI3A 2W0SA 2WICA 5JWHA 2OFXA 3CX8A 1J99A 4Q21A 1GRRA 2O8FA 1XD8A 3OE7D 3QENA 2QBYB 1P6XA 2IK8A 1G8GA 4E03A 4NDZA 3C5CA 4DDTA 1Z06A 4A36A 1N6HA 4HB4A 2ZSDA 4DZZA 2R6CA 2UZ3A 4HB0A 2ZSFA 1Z3IX 4YMTA 4RD1A 1I2DA 1ZYUA 2ZRCA 3DMDA 3IQWA 2N42A 3BORA 4MKIA 3U3RA 3WNBA 4LHZA 5AJXA 4DHEA 1KI6B 1QG2A 2PCJA 3E1SA 4YDHB 2X1VA 2CJWA 2GETA 3R9IA 2ANCA 2WWFA 2B7CA 2D06A 2SHKA 1SVSA 4EJSA 5C46F 4O2LA 1XXHA 3LO5A 4L9SA 3FTQA 2C99A 1FMJA 4JLDA 2QUZA 1GL7A 2FGKA 1N0UA 2ZSEA 2XXAA 3FB4A 1OFTA 4LV8B 2AWOA 5BW8A 4FMCB 2WPDD 1E98A 4X8MA 1G5TA 2BWJA 3ND9A 1KZ7B 4Z8YA 3N70A 4XIGS 5KO2A 3DOFA 4P3YA 4DVGA 1N6LA 3CF0A 1P72A 2ZJOA 4L15A 3SS8A 3BS4A 3EC1A 1N25A 1UKVY 2HYDA 4LJYA 4N0DA 3B7GA 4IDPA 4A8JA 3AGQA 5KYKA 3AKYA 1AIPA 3QNUA 2GWHA 2IL1A 2OAP1 1BYUA 2WKRA 4FI3C 5FI0B 4YLGA 1I2MA 4JL6A 3MJRA 4C3ZA 1X6VA 2W6JD 1JQJC 1N3BA 1PZNA 3IPXA 3CRQA 3S1AA 3ZQ6A 2C03A 5CITA 1G3IA 1F2TB 1U99A 2IYLD 3TSZA 3Q5DA 1KMHB 2WMOB 4EFLA 1X3SA 1Q3TA 4OI4A 5BN5A 1M1YE 2I4IA 4MRNA 1WMSA 4QHTA 4F7WA 2XEXA 4C30A 4IEIA 3RS3A 2FU5C 4TLEA 2D7DA 3U61B 2ONJA 1M34E 4Q7LA 2WJIA 4LYHA 4MITA 2FDCA 2RGAA 4Q4JB 3MCAA 2AXNA 3LX8A 2RHDA 1S3GA 1N5LA 1ZM9A 5EP4A 3QXHA 2NZ8A 3OF5A 4B75A 3WHKA 1O3YA 2RCNA 2XNDD 4RD2A 1GITA 2JGNA 1ZMXA 4MYTA 4CEIB 4M2LA 1N6RA 1L4UA 4E09A 3GFPA 4V0LA 1KNQA 4B3CA 2KSQA 1S4QA 2OZEA 5B2ZA 3AVVA 2F43A 1AGPA 3DM5A 2DR3A 2IUUA 2KE5A 2QGZA 1E9EA 4HAZA 4XTCS 2J7PD 5JS8A 1VIYA 5C18A 2DWPA 1IN5A 2RAPA 2O8EB 5CK4A 3TVDA 5HCNA 4DXAA 2RGNC 2V55B 1FL9A 2C98A 1NLFA 2A78A 3QQ5A 1DAHA 1U8ZA 1ZCAA 1ZNYA 3B6EA 3MLEA 4B6EA 5CB6A 2GRJA 1Z5ZA 2F6RA 4P0TA 4G5QA 4RZ3A 3WHLA 3GLFE 1E0SA 2OBLA 1NN3A 2QRZA 3P20A 4JLJA 5JMTA 1Q3HA 3JZMA 5CM8B 4IOLA 2BV3A 2Q6TA 3QBTA 5B64A 2BMJA 4Q03A 3NTUA 3TVTA 3KKOA 2DYKA 2BEKA 4WZBE 3BFVA 3FYHA 3ICEA 3CWQA 3GEEA 3P32A 5JJKA 1X1SA 1AA9A 3WBKA 2GJSA 3VR6A 1FNMA 5LPNA 3VHLB 4M9XA 2G0NA 2WJGA 4OQLA 5FH9A 2D74A 2BC9A 3NBXX 5JRZA 2NMVA 1IN7A 3GCGA 3OAAD 5FOWA 3C16C 1FPMA 2P0EA 3TK1A 3U6BA 2XOKA 3NBFA 4ZKDA 2RGDA 4EPRA 2QM8A 4B3BA 4BUJA 2ZR7A 2VP6A 1T9HA 1NP6A 1UJ2A 5FTJA 4HAVA 2C2HA 2BKUA 2C9OA 4DBLC 2ZRMA 3PXGA 2WWXA 1B23P 4JJZA 1FFHA 1JPJA 4JSYA 4LCBA 4PR0A 2O0KA 2A5GA 2HDNB 4BECA 1RKBA 1XMJA 3KTAB 3AP2A 4GP7A 5EE1A 4AKGA 4KLZA 2A2ZA 3KDSE 5A5GA 4R71A 1IN6A 4ASUA 3Q3JB 1VTKA 3FFAA 2AD1A 2B92A 2J5XA 1Z22A 4FW9A 2PZFA 3EXAA 4QM6A 5FI1B 4EPXA 2MMCA 3R7WB 1XD2B 4P32A 4CIDA 1YZGA 5FL3A 1TADA 4OHVA 1Z6TA 4JL5A 1DPFA 2HYIC 2CL7X 1G3MA 1S1CA 1G19A 1KMQA 4I81A 1E2JA 4LBYA 3K70C 4Q4HB 4AG6A 2GF0A 2VTKA 1FW6A 1MRSA 3T35A 3IEVA 5JZVA 1DAKA 2F7SA 4LJ5A 1KDPA 1SVWA 1AGRA 3PCRB 1NSFA 4TMWA 4XSGA 3R7WA 1F2UB 4I1SA 1S1MA 2REXB 4Q9IA 1Q21A 1VMAA 3NKVA 4QG7A 4OK6A 2BEJA 3AF3A 3L0PA 3SZRA 3M1IA 3CPEA 3FOZA 2BCJQ 2J7PA 1NSTA 2PJRA 2G0TA 3D8BA 4KODA 2D2EA 2DFNA 3BFXA 1FUUA 1RZ3A 3RVBA 1YR7A 2BCGY 3F8TA 1R10A 5EXXA 3TR5A 1XZQA 3ZYCA 3VR2A 4A1FA 3KUDA 4F4IA 4LGMA 3V4FA 1JR3D 3CH5A 4UNQA 1F60A 4V0ME 1OHHA 2ZRDA 3SJCA 1QHIA 4RCYA 4JLMA 4WOPA 2ZSBA 1IAQA 2C9YA 4DT1B 3D31A 4W5WA 1Z0FA 2AK3A 1FOEB 2YWEA 2PBRA 2OBNA 4JIMA 5G3YA 1XF9A 1CXZA 1F3OA 5IHPA 1OFUX 3BFKA 1GP2A 3FPAA 4DIEA 4FXPA 2J87A 5K8UA 3JVUA 4M1WA 3MUFA 1YZTA 1ZIOA 3I8XA 2HT1A 4GMDA 2ZRBA 2GVZC 1HQCA 3SYLA 3U6KA 2FEMA 5HTKA 1NLZA 1ZBDA 2WJJA 2ZRJA 3IGFA 3QUSA 4XWOA 3HYTA 4TYYA 1VYUA 2LKDA 3PFIA 4FMBB 3M4YA 2O0JA 4PQFA 4A6PA 1E0KA 2A5FA 5FFMA 2QT0A 3QG5A 1BH2A 3VAAA 4TL6A 2OCPA 3QEJA 2IS4A 2YVUA 2Z83A 1XNJA 1GSIA 2ZVQX 2W6ID 2EW1A 2KBFA 3CX7A 4GOKA 4C4PA 4AYXA 3Q9LA 3QPUA 2BOVA 1YZUA 3RDPA 2WMNB 1G5PA 1PV4A 4Q7JB 1NL3A 4JLPA 1KAGA 3UMRA 4LC0A 4XVRA 5FBLB 4A0FA 5B57C 3AUYA 3BD9A 3GLFA 1SVKA 1DE0A 3FHCB 1CR4A 1LS6A 3QPWA 1COWD 4P4SB 3X1DA 4LHXA 2NZJA 2RGBA 3CO5A 4TMXA 2WIBA 2WJVA 3K8YA 4LOAA 3EASA 1ZJ6A 2G6BA 4YMSA 4HUQA 2JDIA 2QORA 3TAUA 1Z0DA 3L43A 3NEJA 4A9AA 2VH5R 4KYIB 2ZUCA 1FQJA 3WBJA 4OI2A 5L3SA 4GRAA 5JBQA 3AVWA 1XXHE 1W4RA 1DVRA 3QBVA 3TUZC 3RHFA 2O8DB 4OK3A 4RD6A 3MG9A 3CLVA 3VR3A 1ZW6A 3T5DA 1UPTA 3ND8A 2FPLA 2IT1A 4W5HA 5JCZA 3DZ8A 2RGEA 1KY3A 4D80A 2YNMA 1RRFA 4YXWA 1XMIA 1AK2A 3FGNA 2D3WA 3WMFA 4LY6A 4RKFA 3NG1A 3OEHA 3VQTA 1OH7A 1JAHA 4RVCA 3CZPA 1RC8A 4C0QC 4ZPXA 1AS0A 3KKNA 4G01B 4YC7A 4MGKR 4BLPA 4LDJA 1Q1EA 2ERXA 3KJHA 4ZI3A 2QAGA 1F2TA 3W6NA 4RY2A 3AM1A 5A0FA 2PT5A 1PJRA 5SZJA 2ZE5A 2JLUA 1W5TA 4NCHA 1ZNWA 4US2R 1NVXQ 5HKKD 4D4KA 5JWOA 4LK2A 4BWYA 2GESA 4OKSA 4XWAA 4QHSA 8OHMA 1G8YA 4QC2A 3SYKA 4CT5A 3B1WA 2JJ8A 3TRFA 5CK5A 2D62A 2VQSA 2WWGA 2ZAOA 3AF1A 1WE2A 1Z07A 2ZI5A 4UXJA 5TVKA 3WMEA 1NG9A 4WZ6A 3F3YA 1DELA 2JJ2A 2J1LA 1M7HA 3K0FA 4ZIRB 1SXJE 1L2TA 2ATXA 1IXRC 2IUSA 1US8A 1R0WA 1YR8A 2F9MA 4FWTA 3AVYA 3KUCA 3AKDA 4DSNA 2XTZA 4A92A 4CYMA 4KITB 4NH0A 1C4OA 3EZ2A 2YC4C 4MDFA 3U44B 1OT3A 3GJXC 4NYJQ 1OF1A 4MA4A 4DDVA 1DO2A 2P5SA 1D2NA 5D3QA 4ZDWA 4NMMA 2A30A 2G1KA 2O52A 2ZYUX 3ZVNA 3SE0A 1MRNA 2V9PA 1BYIA 1VCOA 5JS7A 3VNVA 4WZAE 2X77A 1KK1A 1ZM3A 2ZJ8A 3SBDA 4OJQA 1CJVC 2FPMA 3U3OA 3LD9A 4BFUA 3BGWA 5FPKA 4GP6A 4IDNA 2CE2X 1NMXA 3WYAA 1HE8B 2XNSA 2AFIE 1E2LA 1PLKA 1RRGA 1T4GA 4TMKA 4HZUA 1GAJA 2FWRA 3GD7A 4JVMA 3ZH9B 1KI1A 4Q1EA 4DDUA 4NCKA 4QOSA 2QGNA 4ARZA 1ONBA 1HTWA 2Z4RA 2G77B 3AVUA 2QSYA 5DYIA 3ZZ0A 2NIPA 3KL4A 4CEJA 1A82A 3UATA 2JIZD 2IA5A 3EW9A 2P65A 1D2MA 2HT6A 1TTTA 2ZJBA 1XCPA 2OBMA 1KZGB 5DI3A 4JT2A 4M4SA 3K09C 2WV9A 3UIEA 4DJTA 3QF4B 4EKDA 1II0A 5J40A 5KSYA 4CW7A 2EVWX 4PXAA 1JXOA 2Q9BA 3X1ZA 4QGAA 4R2IA 1IXZA 3A6PC 4HYYA 1WP9A 2XOKD 1W0KD 2WHXA 1QVAA 4JBXA 1G4UR 2ZRFA 3WRYC 4DC9A 1IN4A 2H5EA 2KB0A 3FKQA 3T61A 4P31A 2OCYC 3H86A 1IY1A 3GLIB 1ZC4A 2O5VA 1YQTA 2REOA 2HV8A 3B85A 2FF7A 1G6OA 2ZYWX 4FCWA 2ZRKA 4GL2A 1IOZA 1OB2A 4EDHA 1NJGA 4NBSA 3WRXC 1WXQA 3QI2A 2OFOA 1E79D 2ANBA 4J0QA 4EQ6A 4KVAA 3NIBA 5H1YA 5JI2E 5CJ2A 5KTYA 4D0LB 1ZM2A 4L16A 1G291 3QOFA 3EAQA 4IXMA 4GZMA 5KU1A 1EFHA 3RRMA 1JJVA 3HU2A 1MO4A 2DBYA 3QKRA 5J4LA 3RS2A 5P21A 3TW4A 1VYTA 3L0SA 3C4JA 5KPJA 1NIPA 4PPFA 3RS4A 2CLCX 3CNNA 1H8ED 1X8JA 2H57A 2CE7A 1U81A 3NDPA 4B2IA 1KO8A 5DN6D 1E0JA 2G83A 2QENA 2J46A 5GJVC 1E2MA 2VL7A 1OKKA 1R0ZA 1XMSA 1EESA 2HF9A 1RRCA 3I5XA 1BMFD 3G0HA 1Q1ZA 1E1QA 3GFOA 4XTRA 4BLOA 3R20A 4CVNA 1VCIA 4OL0A 3PUVA 1IM2A 3ZGXA 2J9RA 1U0JA 4BFYA 5JHHB 1ZD9A 2JATA 4GSYA 1WRBA 2FJUA 1DAGA 2IYXA 3B82A 4HLDA 5L3RA 4HLCA 4QBFA 4Q66C 5TXGA 4A2PA 3QVVA 3CRMA 3EPHA 2JCSA 2WVJA 2XSZA 2RMKA 3IUYA 1DOAA 4TTRA 4DCTA 3B2EA 3X1WA 4TQUS 3LBIA 4JKYA 3NEYA 4LHYA 3T06B 1K5DA 2Z6VA 5JSZA 2I1VB 3K0FB 4US1R 4B47A 2YOHA 1AN0A 4BLQA 4C2TA 4GFDA 2J59A 1XTRA 1RVDA 3DO6A 2C95A 3BK7A 1SKYB 2NO1A 3GLGE 5FOSA 4E5UA 2A5DA 3C5HA 1E1RA 4TYQA 3CZQA 4PTLA 1G8FA 4AKEA 3BB1A 2ZANA 3EZ7A 5CYOA 3LQQA 2FN4A 4YMUA 3NHAA 2VEDA 4NPHA 3IKJA 3WP0A 1G4AE 1Q20A 3KQKA 5DH9A 1UAAA 2F1RA 3K9HA 2MSDB 1N5KA 1E9SA 3BC1A 4NCJA 2PZEA 2NPIA 2QP4A 1HE1C 2VO1A 2BBTA 2WKQA 5CLLA 3DL0A 3P4YA 5FTMA 3A1VA 3ETLA 4D2IA 3A4NA 1ZD1A 1DG1G 1VHLA 2W58A 4F92B 3DHWC 2OXRA 2IHYA 5F3WB 3O47A 1T3SA 3QPVA 2MMGA 2F55A 3BH7A 3BOSA 4K81B 3TUIC 4AI6A 1P2SA 2XTMA 5FOVA 3A4MA 1Z28A 1OSNA 1S2MA 5JLJA 2G88A 4Q9HA 3I5YA 2V3CC 3W5JA 4PQYA 1XJ0A 4HUQB 5G41A 3C7KA 1OIXA 3E70C 3GFTA 1A2KC 121PA 1R5NA 5CIWA 1R5OA 3W8RA 4C0BA 1YZQA 5TV2A 2QTVB 3HPQA 3Q8XB 4WBSA 3B1YA 2H17A 3TNFA 4B44A 1R8QA 2IUTA 2PEZA 2KWIA 2WIAA 1HQYE 4JVLA 4PAQA 3QEOA 3SJAA 1PLJA 4LPKA 5E3HA 3EPJA 3AB3A 4MYUA 4S2EA 4GI7A 1OXTA 2ORVA 1RJ9A 1W36D 3IBYA 2Q21A 2VP2A 3EZ6A 4ACAA 1N2CE 2VIIA 2VHUA 2ZS8A 4GPTA 3LNCA 4M53A 2OLKA 1QHXA 1UM8A 3B1VA 5DISB 4ZV4A 2GZDA 1W0KA 3AVXA 1P2VA 5SZKB 2QRNA 5CYPA 2J0QA 4F91B 2R9VA 3U7EB 4GMXA 1MABB 4BRWA 3BE4A 1NN5A 2IHBA 5AUQA 4IOMA 1MV5A 3OIUA 1VKJA 3DMNA 5FPSA 4FWIB 4G1UC 2ONKA 3LXRA 2ZVPX 3OEEA 5EP1A 3K70B 2EFHB 1KI9A 4ZO4A 4TWZA 5JRJA 4IVQA 1D2EA 1IHUA 4OJKA 1F48A 1XP8A 5EXPA 2Q3FA 2IYVA 3SJZA 4HI0E 4R9UC 4HDCA 4BLRA 2FFAA 5G53C 1CJUC 2QU8A 1G3RA 3I72A 4FINA 3LDAA 3B5JA 4RFVA 1OXXK 1KK3A 4NYIR 4QGFA 1D9ZA 2CLSA 2GA8A 2FZ4A 3KFXA 1KO5A 3DPUA 4OHYA 1VHTA 3D7MA 1OJLA 3EIEA 3KB2A 3V9PA 2P2LA 2B8WA 4D26A 4ON9A 2QQ0A 4C7OB 3I73A 3TE6A 3RC8A 2AHOA 2H18A 1F5NA 1XTQA 3L8YA 1FZQA 2CK3A 4IVRA 3AGPA 4ESHA 1XEWY 1NJFA 1HY3A 3EPKA 4UQOA 1G1MA 2QAGC 4GNKA 2MSCB 4AG5A 2AR7A 3CONA 4XD7A 4KI0A 3TW8B 4A8JB 5CDFE 1WDTA 1LFDB 3ZQJA 1SVOA 2PT7A 2QAGB 1DO0A 2R6DA 3OAAA 1M7GA 3W6OA 1LS1A 3GJ6A 5JJIA 1R5BA 3HU1A 3TAHA 1YR6A 1E3MA 5D3MB 3TJZA 4V0KA 1G3UA 2H8KA 4BFWA 2XXAB 1JQLB 1AQYA 1RE0A 4JLBA 1KDRA 2GKSA 1E1QD 4TSFD 1XXHB 4IXNA 5G3ZA 4MRRA 1YVDA 4B71A 1E2NA 5L3QA 521PA 5CLQA 1E9RA 4C0SA 2HLDA 3BWDD 3LBHA 2CJWB 4IJMA 2O8DA 1J90A 3FWYA 2GK6A 1NG1A 3QXCA 4ESVA 5HKKA 1SHZA 2X8AA 1KYIA 3AKEA 1I4LD 1FX0A 3CWZA 1H8HD 3CW2A 4FCVA 2QAJA 4Q9JA 4LSGA 5KHOC 4RSGA 3T1QA 1KSHA 2EWVA 4KFTA 1U94A 1ESMA 1WA5A 2GNOA 3ZZTA 4B3XA 5AJWA 3B9QA 3O8BA 5FBQB 3THYB 3O8CA 1TQDA 1MO3A 1JR3E 4PSVA 4H1VA 1I4DD 3UWKA 2XZOA 2CL6X 4PC7A 3LBNA 2GAOA 4Q9LA 2HCBA 3KJIA 2O8FB 2O0HA 2GHIA 5EXSA 1II8A 1TU3A 3NC1C 3PV0A 4LJ6A 4FN5A 1GL6A 5KSPA 5JWRA 1PVOA 4MUBA 1E96A 1GNQA 3P1JA 1W47A 2B8TA 3KQHA 3AKCA 3VNUA 5FOUA 3A1TA 1ELOA 1KNXA 4TLCA 2IS6A 1XB2A 4ZDJA 1IY2A 1Z83A 3L82B 4Q1CA 3VTKA 1OIVA 1NLYA 3KB1A 1Z29A 1SXJB 1Z6YA 1XWIA 3A36A 3IIJA 4F93B 1T3LA 3SN6A 1ZU5A 2DB3A 1LB1B 3KX2A 2PLRA 3BB4A 4Q18A 5EE5B 3HU3A 5L3QB 3C41J 2FH5B 4B3GA 2Q0HA 2ZI7A 4LBWA 2ZEJA 4TTPA 4QJ5A 1COWA 4MRPA 2FSGA 3I4LA 3ZZUA 1A7JA 2AFHE 1E2EA 4URVR 1V5WA 5EXTA 1NY5A 4PZYA 4F38A 2J7KA 3R9WA 1XBTA 1T8TA 4UJ5A 5E4FA 5TB5A 4AC9A 1RRPA 2PEYA 1ESNA 4KO8A 1EX6A 3T1TA 4BFVA 4ERNA 4B34A 4KLNA 4ZKEA 2F9LA 3K9LA 2RGNA 2BVNA 2PL3A 4HLUC 4NYMQ 5AJVB 2V6IA 5DI9A 3W3AA 2Z4SA 2JLXA 3CR8A 3QY0A 5BYKA 3HWSA 3REFA 2CNWA 1CU1A 2ZE7A 1NBME 2XITA 2ZRGA 4PHFA 1H8EA 1LV7A 2VBCA 1S8FA 4EJSC 2NO6A 3CNLA 5HE9A 2C04A 2ZREA 1AZTA 3SJBA 5DE3A 1WQ1R 1P62B 4PO1A 4DDWA 1II9A 4FCTA 4M1MA 1DG3A 1XTIA 5TDHA 2QMHA 1F2UA 2G3YA 4KAXA 5KSZA 3TR0A 4X8HA 3ADBA 2ZS9A 3H0KA 1X8KA 1MO6A 1M74A 1N6IA 1N6OA 2OT3B 1GRNA 1XCMA 5GJWC 3CRRA 2WZQA 1D8TA 2F1IA 4UNPA 5ANRB 1Q22A 1Q44A 2DWQA 4Q9KA 4X8OA 3ICQB 1CJKC 4D4JA 3A8TA 4BASA 1M8PA 2GJAA 5KNDA 1SQ5A 1OHHD 4TQAA 3UXMA 4D0NA 3CM0A 3E5HA 3KZ1E 4JVSB 4M1KA 4QL3A 4XJXA 4QJ3A 1UADA 1XD2A 3FKSD 1FP6A 2R8RA 4DLVA 5DYGA 2ZUBA 1AQUA 2IEYA 4KCGA 3GLIE 4JKIA 2H16A 2IYTA 3PVSA 1A2BA 4DSUA 4GT1A 1Z2AA 1OIWA 1OFIA 4WVFA 5FOXA 2YHSA 3GJ7A 4ZDIA 1VYVA 1XTSA 2VRWA 2VF7A 3F0TA 4PC2A 4KU4A 3T34A 1OKKD 3MJHA 4NONA 1R0XA 2YWHA 1PUIA 1U90A 5EE9A 4NZYA 5BQ5A 3HJNA 2OILA 1SKQA 4M1TA 4EIWA 4TYNA 1M7BA 3RRNA 4II7A 1EWQA 3RLFA 5ELXA 2DFLA 2FFQA 1P2TA 2GBLC 4GDFA 3QKSB 4OI0A 4O2RA 6Q21A 4FD2A 5AJZA 4EPWA 1W4BA 2BHRA 5FUYA 1VG8A 3U3JA 5M04A 3NVAA 4UXIA 4AY2A 2H92A 4KXFB 1LY1A 4CRWB 5FPHA 5AR1A 1YJ5A 1V43A 2P3SA 2JJ1A 1S0UA 2ZJZA 3RSLA 3VKHA 4LYAA 4WIAA 1P4SA 4AYTA 3OIYA 4BGDA 2GCPA 3ZVMA 1UBEA 1RFLA 1DS6A 3ZVRA 4PHTA 1UBCA 5CIQA 1UF9A 4NCNA 5JEDA 1Z0KA 1G41A 1OFHA 2FPKA 2ZETA 4M8NE 4OI1A 3AP3A 1E2DA 1XJCA 4KFSA 5FUWA 4W9MC 1E4YA 2CHGA 1KSGA 2EFDB 2KI5A 3SOPA 3FVQA 4TL7A 1KSJA 2WWHA 4L5BA 1EWRA 3SBEA 4A0GA 5BXQC 2ERYA 2ZXUA 3GJ0A 2ZUDA 1TQ4A 1XEWX 1SXJD 2ORIA 3DM9B 1ZP6A 3TSWA 2QBYA 1OH5A 2VHTA 2ASEA 3NBZC 1KI4A 3RRYA 2B6HA 3CIOA 3I62A 5J4VA 1UEIA 3LLUA 2AD5A 4UKDA 1KK0A 2DWOA 3MWKA 2XX3A 1XZPA 3QKTA 4RZXA 3PENA 4PZLA 1OLOA 3O8RA 2IEZA 1CR1A 3IEUA 2QQEA 1NVVQ 1NF3A 1QHYA 4C0LA 4AK9A 4QNRA 3AP1A 1YE8A
chains in the Genus database with same CATH superfamily
5BT9A 5JEEA 1WVIA 3HCRA 3RTEA 3FMPB 3PE4A 2FMTA 3HN6A 2F62A 1G64A 3HVUA 3PEYA 1SHKA 2B7LA 5TC4A 1B15A 1WZUA 4B76A 2FQXA 1SVIA 1W0JA 4QDTA 5H16A 4DY4A 5HKAA 4BNZA 2G8LA 3RBAA 3ZS8A 5IMSA 3R6LA 3RT7A 2AFIA 1LW7A 2X5XA 3DHEA 3RBZA 1FS5A 3G3EA 3U09A 2G71A 1V5EA 3GWGA 1JECA 1ZJZA 1XAJA 2W43A 2W8BA 2O7SA 3HBJA 3NPAA 2X1LA 4KV9A 2VT7A 2WWRA 1S3SA 4EFNA 2ONZA 4YAOA 2EWMA 1F5SA 2Z2ZA 1SKUA 2MIIA 4UNNA 2BGNA 3L7DA 5JO9A 1ZA2A 5LQSA 1LKZA 4G5GA 2IXDA 1H65A 4WK2B 1RJ9B 2LCIA 3CV3A 3PNLA 1QRAA 2W6NA 3S1AB 2W00A 5KYXA 4HX9A 3TSOA 1A1VA 5K0CA 4D9MA 2ZCUA 4YJ3B 4HK4A 4RTNA 1XD9A 2I99A 2JAUA 3C74A 3QA3E 4AWXA 3GQBA 3ET5A 4XYGA 3LO8A 2ZBQA 1K63A 2C00A 3RWMB 3A2LA 4NI5A 4BIIA 2P8SA 4FQ7A 1JVBA 1TOAA 1QONA 3KELA 4QTXA 1DRWA 1XEXA 5COAA 4GH5A 1HKHA 4X6UA 3JQFC 5C8YA 3RUCA 4RU1A 1A2QA 4E08A 1AC5A 2YINC 2OV6A 2AG8A 1LF0A 1V45E 2RI0A 3I4FA 1G21A 4RX1A 3ZDYB 2OHFA 4L50A 4MIYA 2JAPA 2YZ2A 3RC3A 3PUKA 3CVJA 3A4VA 1M2VA 2B4TO 3NUQA 3DFIA 4PFJA 4IH1A 4RIHA 3DOUA 3MAJA 5B1YA 1JLRA 5LZ2A 3FE2A 1M34A 2CT8A 4F5YA 3T5GA 2JAXA 2OSBA 4EKEA 2HBQA 1WUYA 3C7CB 3P4XA 4M38A 4CL3A 3GFFA 2RGWA 2C4KA 3IT3A 3KFVA 5BWOA 4LMPA 2C7PA 1TI7A 1ZBQA 1ISJA 2ZE6A 5GZ6A 2J5QA 4C0WA 4L5AA 1JSXA 3NRCA 1DJNA 1KI6A 1AKYA 2J9GA 2WPNA 1E5VA 1W85A 4L95C 5T3UA 4CDRA 1RTTA 1EHCA 2FB9A 3G1TA 8LDHA 4I3HA 5JCJD 1M2OB 5FT9A 4W99A 2UYQA 3NO4A 5HQTA 2N75A 5I45A 1TM5E 3D3WB 3TI7A 1BC5A 2I8AA 4RY0A 2QWXA 3V34A 4U7DA 3HB5X 1ULTA 2ZJYA 1NBMD 4L0CA 4J4HA 4NMWA 4S1VA 4Y0VA 1T6BY 3O8DA 3MHPA 4S35A 3ZBPA 1N33B 3OO1A 2GPSA 3F9RA 4FBMA 5E6RA 3PBKA 3BSSA 4CLRB 1YZFA 4REOA 1FU4A 5AO9A 4HQFA 4D9CA 1D07A 1YRLA 2H65A 3JR3A 1H2FA 1A9OA 3BH6A 4P5EA 2V1UA 3MCWA 1PK7A 1FTYA 3IUEA 4U2GA 4UTOA 5HF6A 3W2IA 2RJOA 1U0TA 2CHEA 3OJ0A 3NTVA 3T3EA 4ZHQA 2A57A 1CR6A 4KXMA 2W2TA 2MSEB 5B3JC 2CUNA 1IVSA 1RXEA 2I55A 3NHUA 4GBED 4DCVA 4WPGA 4N49A 1BS1A 5EUMA 4KACA 1SBTA 5KNCA 1U9CA 3QP9A 4L5JA 4NNOA 2EFGA 4PLFA 5I7AA 4IF6A 4GNRA 5I9BA 2P4QA 2PPLA 3BJIC 4H9GA 5F12A 5LUAA 3HL4A 4RPHA 2Y67A 1N8TA 2F8MA 3IPRA 5A4AA 4ARAA 3B1ZA 3U44A 1DBSA 2PK3A 2WF6A 3D8RA 2BMWA 4YNBA 1DJLA 4NMLA 4LGVA 4ZQIA 3MB5A 3CH4B 3ZX5A 2R8PA 3SQDA 5K8LA 4V2UA 3KQYA 1PJBA 2Q8PA 3O1IC 2QJOA 1CRWG 2GN6A 5LQCA 2HTEA 3LIIA 1LX7A 2XYHA 3IHWA 1JKFA 4Q01A 1EDZA 1KOFA 4HFNA 4H1UA 2VP3A 3MJTA 4W63A 4B4WA 5AW4A 3QE3A 2Z3VA 1FJGB 5JCOC 2OCLA 1ZMOA 2L0XA 4EYOA 1M6EX 1Y1PA 2HSWA 1IY0A 3F3SA 3MLAA 2HWXA 3AUSA 5KTNA 2WWWA 4R1NA 1T36B 2B8JA 3GU3A 4JU9A 4MLDA 1RS0A 4Q7KA 1Z4NA 2YV2A 2I6GA 1QDEA 1MB3A 3WKEA 3KHKA 2W6OA 4YRMA 4ZOLB 2ZYIA 3PDHA 4KK4A 4ZT4A 2WF7A 2VJAA 3X1YA 1TQ6A 3IUSA 5CTJA 3KNZA 5KNBA 3KVYA 4HLUA 5ED4A 4IIXA 1UFOA 1HOTA 4HAIA 5KJ6A 1ZVQA 2ENWA 2Y0PA 3M8KA 2FLKA 3O9MA 3SEAA 1KH3A 4E2ZA 1TKBA 1H4TA 2XMZA 4EQ6B 4JD5A 2Q49A 2J3LA 3J7TA 5J3JA 2ZTVA 4HVAA 1FRQA 3V00A 1PUJA 3C39A 3FZNA 5AI0A 3O4VA 3SZ3A 1ZIPA 3F46A 1T0HB 4L6CA 2I0FA 1GCAA 3EMDA 1GTZA 1LU9A 5BMOA 4II3A 3QX8A 3UCEA 3SQXA 3FNGA 1Q0SA 5EYPB 3UH0A 4V0MA 1VRCA 1CLUA 5JAPA 5H70A 2XB2A 3KE8A 5I9MA 4CODB 4EVSA 2QI9C 1U2PA 2PDAA 3IUQA 3NBAA 3KAPA 4FDAA 3UJBA 3ER8A 5K0TA 5EXEA 1NUHA 3IP6A 3IT1A 3RWOA 3H1TA 3HXLA 4UE3S 1EVLA 4C7MA 1R0CA 2ZSAA 3UXYA 3GOQA 3PWKA 4XYBA 3MD0A 3ASYA 2RCYA 1T26A 5A04A 1PUXA 1FCJA 5A1TA 2ICAA 3BDVA 1JILA 3AV0B 1T9GR 1TUGA 4EHNA 2QIOA 2O8BA 3KWMA 2Z58A 4KXWA 5CLGA 3JQBA 4BQSA 1HDXA 1QQ5A 2H4YA 3O90A 5ES4B 4NH4A 1BEZA 2HJHA 5C32A 1T2EA 4EPVA 2QE7A 3EAGA 4KI7A 1GQRA 5KYVA 5JMWA 1EUYA 2WM8A 1ZXXA 2IY8A 2XUOA 2Z6AA 1TEVA 1A95A 1PI3A 5KKAA 1RWNA 3N6VA 5AXDA 3ZU4A 3N0WA 5CLIA 3KQUA 4TYWA 4M0FA 1XPOA 2A5JA 3DOEA 1CJMA 1OZFA 2NTYC 2PS3A 4IJVA 4MRVA 4CF4A 5KVSA 3WO1A 2F48A 2EGHA 1R9GA 3O31A 4YAFA 1NOKA 3K8OE 1U04A 4HGPA 2HCTA 2K2WA 3LFUA 5IFKA 2VQFB 4DR4B 2I7VA 4TSFA 4WA8A 1XI2A 3FHTA 3HKDA 2JVIA 4M0PA 4WLUA 4FBGA 2PE5A 1VIMA 1VMIA 1Y4UA 2WAMA 1R4NB 4XCQA 4U9HS 2IPMA 1EFVB 2NPOA 3PQCA 1B7GO 1A5TA 1EX1A 1RFGE 1RYHA 1B6RA 4JFRA 4A4DA 1UJMA 1YVPA 2EARA 5D1HA 1SUAA 2PRZA 3BB3A 1QAMA 1VHWA 2GD0A 2JGAA 4LXQA 3DMTA 1EZ1A 4TGLA 2Q9UA 3CTMA 3EEIA 3L2OB 3B38A 1I9GA 3WHIA 1JE1A 4OLAA 4GLOA 3RH0A 5BN3A 4FNOA 5JU6A 1EXDA 2H06A 3K9CA 4X95A 5E0KB 5AVVA 2HY7A 1MDFA 3ONWA 1HE5A 1ZZEA 4HHEA 1OAAA 1CC1S 5L8VA 2A3RA 4RMJA 3LXXA 1E9DA 3WA7A 1G5RA 3ZJ4A 1P9NA 1LNZA 3FNEA 3FMFA 4MP3A 3VVBA 3RYCA 1KO4A 1N1GA 3SZMA 1PLLA 3IJRA 4TWBA 1RE1A 2B7BA 4QVIA 3F6PA 5E4YA 2LVBA 2C0CA 1T1GA 1SZPA 3L7CA 3AEYA 4Y1GA 2QMZA 1TVEA 4WHMA 1A98A 1MKYA 1TF2A 4L7VA 3WP1B 1V5GA 5EAIA 4NESA 2WHQA 4YV2A 3HY4A 1KTIA 3DDNA 1ZCZA 1SD1A 3QSYA 5C5IA 1KIAA 1OGYA 3NIFB 2KLBA 2ZBUA 3U2QA 2BEVA 1BJKA 4ZWNA 1M66A 2QE6A 1V25A 2X1HA 3F1KA 3BWCA 3KPWA 2G4LA 2WIFA 4Q3AA 3QTLA 4IVPA 3RKUA 2ATVA 5ETJA 4F4JA 3WO0A 1HURA 4CMJA 1QRSA 2A0UA 4LEIA 3VH1A 1J39A 3NTRA 3UJ3X 1XQYA 3OQ1A 4DF3A 3ZKAA 1U7HA 2WJAA 3Q7QA 3WLAA 5LYJF 4OXNA 3DEFA 2OLJA 1Z8NA 2IC5A 3RWBA 1EXNA 2VDLB 5K0JA 1SRRA 5LZ4A 1AT1A 2AG5A 4H1HA 4JT9A 4UTPA 1RCTE 5F2NA 4BVGA 2QF7A 3NM4A 1S01A 2PD4A 3TJRA 4CNBA 3KIPA 2VSOA 3QELB 5ALXA 2GJ9A 4UOEA 3UB2A 1J21A 4U3JA 3AVTA 2PY6A 4PC1A 4CV3A 4M0EA 1QH8A 4H31A 4JBGA 3UUFA 1CP2A 4HFMA 3W79A 4C5AA 5L3VA 3K0AB 3TD9A 4B85A 4RK0A 4O59O 3UMFA 5KU7A 3PHCA 7REQB 5IKXA 3BA6A 5ALWA 3GEDA 3FUUA 3QMMA 2I2CA 2A94A 2P3QA 3IKMB 3HKBB 4BN4A 2B21A 4FGJA 3EA0A 5HF9A 2CUKA 4C0AC 5JC8A 2HDHA 3I01M 4H77A 3UENA 5AXAA 5KKNB 4A16A 4JI8B 2BBOA 4EX6A 1KO1A 5LP6F 5U9CA 3E8XA 2WVAA 1O2DA 2FPPA 1G3QA 1T1SA 1OUMA 2FMIA 3GRVA 4RPKA 4ZC1A 4CGZA 1PZFA 5CXSA 2PRKA 3S2UA 1FU7A 2L19A 1E2QA 1L7MA 1M75A 1ZSYA 4K3UA 1FFEA 5MFZA 1CVLA 5B4VA 3ASUA 3AEKA 1OVGA 4EHLA 5A4MS 3PX3A 4Z4FA 4YDRA 1Y3IA 1OZ0A 5INTA 1KK2A 2IBSA 1CDZA 4NNJA 4GR9A 1FNBA 1E3LA 1AUQA 1BWRA 1MGPA 1P73A 1T25A 1P1IA 2E4XA 3HUUA 4I3FA 1SCAA 4WI1A 1J00A 2FE4A 2PZLA 4DLPA 2F1JA 1R4MA 1CDDA 2FEOA 1MG5A 2OVBA 2R00C 4UCWA 4D6XA 3OQOA 4CBVA 3HU5A 3WQSB 4JR2A 3PLAE 2X5JO 1XVLA 1DEHA 1C0LA 1A8HA 3QUCA 2W4QA 1I2AA 1Z5NA 2K7FA 5DASA 1W46A 1S2LA 2YVKA 3D7SA 4IDGA 5IVHA 3AF4A 3WXMA 3EBOA 4Y9RA 4P84A 1ADFA 2BJHA 4CF3A 3FTFA 1DIGA 1QIDA 2GJKA 3RRBA 3AX6A 3R5XA 3WK8A 3CZMA 1KJZA 2H2AA 5DOZA 1XEXB 5C8YB 4YMIA 5I51A 2FMFA 3A9SA 3WFJA 2CSXA 3UKDA 5JTUA 3EIUA 3PFCA 1OYYA 3FGZA 4TOIA 1MOQA 1UC8A 4TTAA 2O3UA 2AKYA 1AF7A 1HLDA 3H4VA 1T8UA 5I4BA 2IOHA 3OEWA 3N2KB 4LVUA 3HGTA 5JSHA 4ARZB 2H9AA 2QROA 2ZJ3A 5KHLB 3N2LA 2OHVA 3UJDA 3F90A 1FYXA 4QYIA 5A02A 3JQ6A 1L5KA 1DSSG 1CD5A 1WPQA 4IIFA 1JH8A 5F2KA 5G4KA 3UXEA 4XQEA 4PPGA 3W06A 4CDNA 4RY8A 2QIPA 4HB2A 2AXQA 4OBBA 2OOKA 3O75A 5PNTA 4A2QA 4OJMX 3RVLA 5EPEA 1BGVA 4WFJA 2YY5A 3MF4A 2NUAA 2Y05A 3HJAA 2RHCA 2HQBA 2J0VA 1QCYA 1BFKA 4IILA 1N0WA 4N9WA 3W5IA 1QFZA 5K20A 3PUYA 1MOPA 1AQIA 1I4TD 1W5AA 3PLNA 1C1HA 1WKVA 2IUYA 3ZNPA 2JBWA 3BXHA 5K0EA 4MUNA 3SC2A 3HN2A 4CEIA 4FLFA 5FTWA 3TZ6A 1EE2A 3BMXA 3EULA 3FA2A 1Q0RA 5AKGA 2X0EA 3K0CA 4X3OA 4XIFA 1RADA 3ZY4A 4QJIA 3ZWCA 4W5NA 1DRKA 2K5UA 4AZ0A 3WGYA 4IRUB 4JBYA 2LIVA 3HQ4O 4N03A 2FMHA 5E95A 1L0BA 3S8MA 3IC5A 4CL2A 2ZSHA 2VDPB 4B7CA 3LQYA 1ZHOA 1WVMA 1G7CA 4OB6A 2WSIA 4O4HF 4EL0A 4OIFA 5IAGA 2IXAA 5G1PA 3OF3A 1XRJA 4CKBB 1AO0A 1F2DA 3FGPA 5FNZA 4RHYA 3DFKA 3H3FA 4RSHA 2B1JA 1FNSA 4AJJA 3C6MA 4YCSA 1DOHA 2ZB4A 1J4AA 1PJLA 3ZWDA 1DKUA 5TMDA 1LTQA 2AG6A 3VU1A 3ZDQA 4ETWA 1W1WA 2NX2A 3GVCA 5E9QA 1RCUA 4MR8A 4URZR 1K6EA 1QBKC 3JVVA 5E1MA 4ZD6A 4DA9A 1CR0A 1K97A 4H0NA 4HGOA 1QQTA 2Z8YA 2AUMA 3PC4A 4PRKA 4Y2JA 5FBWB 4LI0A 4X62B 1DCTA 2PX2A 2OAQ1 2GCOB 3WC4A 4MAAA 4WCDA 3ZDAA 1KOGA 4JC5A 2C2GA 3LC1O 1UFRA 4O1IA 1OI7A 4P33A 2AJ8A 2WBLC 2XB9A 3Q3IA 4RDHA 1N8NA 1Q1NA 1XCJA 4RTLA 1ZWLA 3DWEX 2IHTA 1C4KA 1SC6A 2NTNA 3HR7A 3GMSA 1FP4B 1CQIA 5EP3A 5G4LA 3SEZA 3LHKA 4UFOA 3ZY2A 3EDCA 2EJBA 1ZH4A 5EZ5A 3CBGA 2JFQA 2PD3A 3I05A 2WFMA 1E69A 1UBRS 1XDSA 2NVOA 1QLJA 4RNCA 2FMKA 5AVWA 1O5OA 4B9EA 1TYZA 4MHSA 2G9NA 4G85A 5CH8A 1FY2A 3C5VA 1T5HX 1JYEA 2AOXA 4AXBA 1KBZA 5D00A 2DFKB 4G6ZA 4FGLA 2QLJA 1QKIA 1GGFA 3UJPA 1CBUA 2QNIA 1QR6A 1H0RA 1L5RA 4QQRA 2EFEB 3IVGA 1AXRA 5ALYA 3GEGA 2UZ1B 1B4DA 3VZCA 1T4CB 1NDHA 3R3ZA 3RSCA 1MT0A 4C43A 4V03A 1LLQA 4NBNA 3A6LA 3LBFA 2IZOA 3MAGA 1ZOLA 4R3WA 3KXPA 1T5IA 7YASA 1L5VA 2VNJA 3OETA 3VC7A 4PTZA 4BX9A 1PTKA 3BWEA 2XWBF 1HRKA 4DQKA 3T3OA 5C7IO 4JQSA 3E27A 4U7HA 5E3JA 1JHAA 1CZHA 4R1QA 3FIUA 1J2TA 1AQJA 1SCBA 3IUJA 2CCJA 2JKZA 2KLHA 2VYCA 3VX4A 4DE5A 1P9RA 4RKRA 1TQ2A 5BOSA 4QTZA 2Q8NA 3X44A 4KYVA 1LK5A 4ZK2A 4EGSA 3CC8A 5KDOA 4LC1A 3WIUA 4MK4A 2FVXA 4UUOA 2C2OA 3A6HA 4EITA 2RGXA 1QS0B 2QQFA 2P27A 4ZO6A 5IAEA 1UOOA 1JPVA 3F5FA 4OQQA 4CN9A 2H4JA 3RVOA 5ARBA 2OB2A 2XVZA 1YU9A 4WOCA 3QYJA 5JPCA 1B2LA 3KPVA 1XVAA 1L5QA 4XA8A 3E2PA 3R3UA 1TZMA 1YZLA 3HKEB 4YTEA 1XTVA 2AZ4A 4G5SA 1FK8A 4P5PA 5IBPA 4YCLA 3NR2A 3Q98A 2VHCA 4IIHA 3PXEA 2V7VA 2O7NA 3P2EA 4IYJA 4MW5A 2V59A 4HDNB 3GBPA 4JGGA 4YAGA 1XN1A 1RXIA 1QG6A 3CUEF 5FTKA 2BFAA 2OBYA 2VWQA 2V1XA 1HTBA 3Q9SA 5JXJA 3NOQA 1RWMA 2BGUA 1WNFA 2M98A 1UBLS 2UYGA 4DCNA 2Y1KA 3FPLA 3KS9A 4J1TA 5LQJA 3FUXA 2D5AA 3S5UA 1TTHA 1A96A 3BAZA 3R3WA 1DJQA 1D2RA 1U0RA 2OFWA 1U5BB 2QQGA 4HOYA 3QLJA 4M1QA 3DCYA 1EFTA 2OZPA 2PKCA 5E7JA 5IKPA 2IOFA 4RTSA 1Q1BA 2Q4DA 4RULA 3R75A 2NSHA 1OWPA 3YASA 4BQPA 2EGGA 4NIMA 4H2DA 5IK2D 2YN0A 2WTXA 2LE0A 3FSJX 3I9LA 3L7OA 1OTXA 4HDKB 4QFBA 4UHHA 3ZZ1A 4QPCA 4Y18A 3HVHA 2CLMB 4K9KA 3ELYA 2WP8J 3M6AA 4E07A 1JR2A 1K7CA 3OU7A 4KZPA 1ACJA 3DZKA 4RJIA 1SM4A 5TEVA 4OX9Y 3FYUB 1N7JA 1ISGA 2YNMD 3BK1A 4X1IB 3SSOA 4GZLA 1SUDA 1Z56C 3I32A 4M55A 5TQ2A 3T7CA 3ZE9A 2ZJ5A 3ZYZA 1OI2A 1PX2A 2QVBA 5JTTA 2GDJA 4B3HA 2BP7B 2X4LA 4I55F 3WADA 5B1EA 4BO1A 2B83A 3CNQS 3CE9A 3SS7X 4MAFA 1MFZA 2DFVA 4M99A 2X5OA 2QMOA 2Z3ZA 1QFJA 2JCGA 1E9BA 1JT2A 2DFTA 2AOUB 2AEMA 5BW6B 1D8AA 3MT8A 3ABIA 4JLOA 4OAPA 2FP3A 1V4BA 3CLKA 1NTRA 2P4EA 3CE6A 3G0IA 3QVLA 4FOLA 5IH3A 3WTBA 2O2EA 4PVDA 2OFFA 3KJNA 2JJYA 4ESEA 3BQNB 3IXMA 4JJ7A 5EVJA 3TTUA 1Q1QA 1SG9A 4PSUA 4TLAA 1TCAA 2IF0A 2ZZKA 3BD6A 3L8ZA 3AJAA 3L7MA 1M5RA 3FPGA 4RLSA 1MTOA 1BHO1 1Y5MA 4BLWA 2JBAB 4B1FA 1W7AA 2CK3D 2P6RA 3FYCA 1JE0A 1NXVA 2DHRA 2GTHA 1EQAA 3QX7A 5E4TA 1WCV1 4PIPA 4B80A 4PX9A 2PRIA 4PHCA 4WLEA 2QPLA 1V47A 1TLLA 2D2VA 5B12A 1EUQA 2F9FA 3SS9X 4O3MA 3AETA 2ILTA 1O9HA 1FFDA 1PR3A 2DBQA 1FP7A 1ISHA 3KJXA 4HRVA 4XOIA 4DBLE 2IWRA 2JH8A 1TNDA 5DSTA 4BDTA 4RCVA 3WGTA 4MARA 4F72A 4MR9A 1RMTA 5H3CA 5G1OA 3P2MA 2B94A 4H7EA 3H2HA 4PICA 3I92A 3OOEA 2R48A 3L8MA 3UJCA 4BOYA 4KQMA 4O4JF 1TFRA 1JALA 1NWHA 1V3TA 1IHPA 3NONA 1QOQB 4C06A 2RHGB 3FX2A 3W8EA 4UU0A 1OWOA 2B9EA 4J3JA 5JISA 2X3UA 4X6YA 3TL6A 4GBGA 2PH1A 3IIIA 4XWWA 1H3EA 3RW9A 3OPQA 4FXOA 1E20A 2H00A 2O2JA 4PRZA 5H5JA 3P4UA 1YOVB 3M6WA 4L07A 3DCNA 3ZNOA 1TAGA 3H1FA 5JQGB 2QYTA 2Q1SA 4OU4A 2J9FA 4Z9FA 1UPAA 4NULA 3T5AA 3M6FA 1G18A 1GNRA 3PDIA 1U7ZA 1Z6PA 3G02A 1YBVA 1KKMA 1TM3E 3CA8A 3CZ9A 3KOOA 4O2BA 2VDWB 1BSVA 5IN4A 3VZRA 2JIRA 4IX1A 2E49A 2R00A 3ESQA 4IW3B 4TLBA 3ADKA 2DG2A 3G7NA 4CIXA 2WJHA 4UFNA 3IDOA 4FDVA 4IZIA 3KQNA 2YJ6A 2DR2A 4UZSA 2FFRA 3KPUA 4FFRA 1CJTC 5JZMA 1ZN7A 2COKA 3D7KA 4JK3A 1QRRA 3NPMA 4PLWA 1D4ZA 3HFRA 4NX2A 4HGYA 2R6ZA 2P0AA 2PZGA 3NKFA 4JR0A 4MV5A 3HJGA 5J4KA 4KDFA 5DN9A 3CU5A 3MTEA 3DBLB 1JDZA 4NYJR 3FJ1A 2CEAA 1EGAA 3MXTA 1NURA 4IQGA 2DM6A 1NIJA 3OZAA 4J2HA 4LKRA 3SP1A 3TLGA 5KDDA 3U19A 1P75A 4N3NA 4D8WA 3KDAA 4TXJA 3SK0A 1BA2A 2IXEA 2VK1A 3JTEA 4Y6RA 4C5BA 1B0ZA 3Q0IA 4FLMA 4EM6A 1JDVA 1CUSA 2P11A 1KVTA 1BOFA 3KM0A 1E62A 1R64A 2H9IA 2ZIAA 3QUBA 3VOBA 3PNMA 1G66A 2VP4A 4B74A 1MQ8B 3ECCA 3HKBA 4IP0A 4K87A 5CB4B 4DJDC 1Z0AA 2D5IA 4U00A 1BE8A 1JB9A 3GEIA 2PO5A 4OHZA 3O1JC 1YUMA 1DC5A 5CPBA 4C4TA 1Z4JA 4Q7EA 5AUPB 1KWKA 1YTLA 2AFRA 3FCUB 2L42A 4LSMA 3A2MA 1XE3A 3I83A 2WKPA 1ENPA 1QHHA 1WVGA 4MGHA 3M2PA 5BN1A 1FMLA 2GEFA 2P67A 3NXSA 3FSRA 1G7SA 4FX5A 3IKTA 2NV0A 1YB2A 4EBBA 2RG7A 5HBRA 1Z3CA 5BYJA 5TY0A 1KGDA 3IQIX 4IMJB 3VX3A 4EFMA 1DAFA 4QFCA 4M87A 4DXHA 1V41E 1UBSB 1BHSA 1U7UA 3OZFA 2GT1A 1VG1A 1CZUA 3A14A 4JCCA 1KQFA 3LT5A 1PFYA 4PWZA 1TUEA 2AXEA 5EWJA 1JEYB 5TJHA 4QPJC 1J7JA 4E22A 1I6WA 1GQOA 1OJ7A 1TMOA 1HEIA 4V0QA 3ONDA 3H9EO 3WIBA 1YO6A 3PXDA 2JLWA 3N0XA 2OB1A 1NFFA 1ZGZA 1AF4A 1EH5A 4BO6A 4DCSA 5T41A 1FDVA 1VPEA 3LWBA 3OTIA 5AKYA 3H1PA 3JQ7B 5LD2C 2MCFA 1YAJA 1NVMB 4K46A 4B7UA 4JV5B 1X7HA 2ODWA 2PL9A 3TW0A 3K9FC 4WFQA 5B1SA 1YKSA 2XIQA 4UCQA 5CVVA 3WZ2A 2AFVA 1K8RA 1IBLB 1QDUA 4K05A 1PT6A 2JFNA 4BRUA 2ET6A 1J2EA 4HAWA 3VHXB 4XGNA 4ZDKA 1CIVA 4KQHA 2OKGA 1VLMA 3ND5A 1C8VB 3R77A 4ZCIA 2FGJA 3DKPA 4WY2A 5U4QA 4C89A 1OI3A 2W2MA 1Y6JA 2GPJA 2R7NA 1UIMA 1EG7A 3W3AD 4CQMD 2WIDA 3QHQA 1NNEA 3CR7A 3WR5A 3DF9A 6CHYA 1GCGA 3G6KA 3GPCA 1FTSA 2DUNA 4O4HB 4FZRA 1CZKA 2H31A 4PQEA 3Q12A 3BTOA 3PKIA 3QMPA 3OCJA 4B0PA 5ALMA 1QGZA 1SUSA 2W2LA 4E7PA 1V7ZA 2O2CA 2XT6A 2IRWA 2PGNA 1XYYA 5IJZA 1LFAA 4C6RA 1JQ5A 2PKEA 2TMDA 1UEXC 4DDKA 4MVYA 1IQRA 4C0XA 3NHRA 4CMIB 1NW5A 2C58A 1QK4A 4NCIA 3OECA 4P3NA 4R3NA 1JFTA 4ALLA 1RW4A 4W1PA 4EUNA 4QM7A 1TTQB 1MOZA 1LF5A 1IL0A 1GUDA 1QGAA 4ISBA 1YRBA 4L51A 2H7VA 1V6CA 5EC8A 3DZDA 2F3SA 1WB4A 4P5DA 4OFBA 4Q05A 4DYDA 3M4XA 2X6QA 2PLFA 3TSCA 1YGPA 3EWSA 3KXKA 1DX4A 2H1HA 4XX1A 3ZXYA 2E37A 4ZXFA 4E1AA 1OTHA 1BDJA 3K1ZA 3TQFA 2QRLA 1Z47A 1YQDA 4ER0A 2EG9A 4JSRA 4IRMA 5HUHA 1GPMA 2UYYA 1ZK4A 1UMDA 1IM8A 2WSSD 3FWPA 4MUKA 5BMVA 4K6CA 5DHUA 3TLKA 1A88A 1JQEA 2GBCA 1RYMA 1FB5A 3K2IA 2OC4A 3COSA 2PX4A 2PUDA 3U7HB 3DP9A 3CCCA 1MIOA 1MHTA 4XFJA 3NTXA 1V7CA 4UHCA 5KJFA 1FUKA 1U7DA 4PLZA 3HCCA 5E6UA 2P2CA 2YOFA 1IULA 2ZIXB 2EBWA 4HB3A 1ZCBA 4JY7A 5KYUB 4FFDA 5B6PA 3G9ZA 2NZXA 2JI8A 1Y0BA 4D57A 5A5EA 1G98A 4UVDA 3KLMX 5E2IA 1N32B 4YT2A 4EGFA 5AIBA 1H3NA 2GN9A 2NYRA 2QJRA 4BNDA 4DTCA 4YR9A 2F8LA 4KWIA 3TLCA 2Z8YM 3TSYA 3WGZA 4Q3LA 2XMCA 4HLQB 3EJ6A 1QE3A 2HLHA 4BX3A 1GTMA 4F5DA 3H5OA 3EZYA 3JPWA 4NZMA 1TX4B 1W49A 5TEWA 1GILA 2XRFA 4BBJA 3HI6A 2CGEA 2HMYB 1QYWA 1PEDA 2OCDA 3A3OA 3FW1A 4AM8A 1B6GA 1Q95A 1R27A 2P90A 2XA9A 3B20A 1LZKA 3CF2A 3FM9A 4IG4A 3RRZA 3WJAA 1F1JA 1RHJA 1EEHA 2X4DA 2IYFA 3Q7SA 5AVOA 1P31A 1JWLA 5DM60 4LZLA 1R5JA 2P9ZA 5LR6A 1QQAA 4KE8A 1R0YA 3M5PA 2ACWA 2REBA 4U0JA 5EUQB 4BBZA 3A32A 4TMVA 1IEWA 3JALA 2YNMC 2M9MA 1Y7IA 3C4VA 2H5JA 1D4AA 1K6MA 2X7JA 1D7OA 2WY2D 1USVA 1YVEI 2QI9F 1XMVA 3GP5A 5DHAA 3UO8B 3ODGA 4NAHA 4NE2A 1WPGA 3SGLA 5HJ2A 5DBFA 5HRAA 1CSEE 1R3DA 1Y6QA 3BKWA 3KG2A 1VKZA 2ZIUB 3PDCA 1L8QA 3VO8A 1CS4C 3IAAA 2I8LA 2VBIA 2I5PO 2GTPA 2NP7A 2C2YA 1K92A 2XNKA 1POWA 3SIWA 2DXIA 4L5CA 5C35A 3M1AA 1IMJA 5FTLA 4JZKA 1LQUA 3G0CA 1XZMA 3EVDA 4WUVA 1KRXA 1NNLA 2ZE8A 3UAXA 4ENTA 3T9BA 1Y7HA 4A6XA 1LPOA 1E1RD 3MWJA 3WYGA 1CEEA 4X71A 5C2JB 1QVRA 4U0KA 1ZO8A 4N1AA 3U60B 1MO5A 1PT8A 1XV5A 3JALB 4FYHA 4YUZA 1PEYA 5CCBA 4P80A 2QG9A 5SICE 4GF5A 1VPVA 5HSGA 4MUFA 5BSVA 2GXAA 1GT91 1N3YA 5EUBA 2NLOA 2JI7A 3FNIA 1HFJA 5CDSA 2D7JA 2C0PA 5T3YA 1JG2A 2G1JA 3CKLA 1ZK3A 4H59A 2D2FA 1IBSA 5KCZA 4BLVA 1GG2A 5DGCA 4UVHA 5TARA 2DQYA 3DMHA 2J9FB 1LPSA 2A9PA 2YZ7A 4V0NA 2R8YA 8ABPA 4UNRA 3ST7A 1LVGA 5P8WA 1KEKA 4PLHA 1CRPA 2HO5A 3H4MA 2GUGA 3C4QA 1PU2A 2QZZA 2ZIFA 4G8DA 4H7KA 4JL8A 4IIJF 3SZUA 3W2GA 3OQBA 4YPFA 2D1QA 2JFVA 3U1VA 4BNDB 3MAAC 1U8AA 5FQOA 5J2UF 1JN0A 2KBEA 3RABA 1NI3A 1XYVA 2GNPA 4KQFA 4MTCA 2WICA 5JWHA 4ZHQB 4C2AA 3CX8A 4WOBA 5ALNA 1JZQA 4WNAA 1WSWA 1KYQA 1XD8A 4I5DA 2V65A 4E12A 1P6XA 1UP6A 4HH4A 5A4FS 2IK8A 1UPBA 4E03A 2YUIA 3FZEA 4YP5A 4MB6A 5BSKA 1O58A 4Y3UA 2ZSDA 1KXJA 3WDMA 2Q6KA 4HB0A 4LDZA 2A88A 2ZSFA 4E94A 2ZIEA 1GPJA 2H5LA 1QANA 1ZS9A 2VXBA 2ZRCA 2ACEA 5DYYA 5U4XA 4ER3A 2N42A 3C24A 4DV2B 3NI2A 1RLUA 3U3RA 4DHEA 5AJXA 2QTRA 3DE2X 2X1VA 2WVHA 3I01A 3RT9A 5G2OA 1MB2A 4HPWA 2B7CA 3IPCA 2W5UA 3BXXA 2PYDA 3KP1A 4B31A 1RPTA 1Y9DA 4PRLA 2C99A 1FMJA 2GMWA 1GL7A 1P7WA 2AIRA 1N0UA 2XQIA 4TRRA 5A3RA 1B3BA 3KDPA 1V8OA 2BAGA 1CUXA 3H65A 4N3BA 1E5TA 2DQSA 5DX1A 1LNQA 4FMCB 1SCJA 3BXFA 2WPDD 3C6KA 3PNVA 1G5TA 4ZI5A 4ZCRA 1CZRA 2BWJA 3RF7A 3E82A 1KZ7B 2FOIA 4YR7A 3N70A 5DEIA 5BVHB 3E81A 3DOFA 1DKNA 4DVGA 4C4SA 5MHTA 1N6LA 2ZB2A 4D3DA 2ZJOA 4L15A 5C8DA 3PQ7A 5IWCA 3EQZA 3UHOA 1UKVY 3K16A 4LJYA 4N0DA 4F84A 3EEBA 3D8SA 2O1SA 1HOXA 4BMSA 3QFCA 1M3SA 1AIPA 2D54A 3C6BA 2GWHA 1TUBA 5BV8A 1PP4A 2WKRA 2AMFA 3GQBB 4FI3C 4AJOA 3JQ9A 4RFLA 4PBTA 4HDAA 5ERXA 4YJ3A 1X80B 4FUQA 4YCCA 1UMCA 4P53A 3ZQ6A 5CITA 5GGXA 2C03A 2E4UA 5MDHA 1OWNA 2YXPX 1F2TB 3WHPA 1KMHB 1WXWA 3P2JA 2YYSA 3K5HA 3ITNA 1XT6A 3HB0A 4C7KA 1Q3KA 5IUJC 2I4IA 4QHTA 4C30A 3RS3A 1OLSB 3VKUA 2GBIA 1LRKA 2XODA 3ESCA 4C29A 1P77A 4Q4JB 4ZREA 3I76A 2AXNA 4BEVA 1V11A 1PWXA 2H1FA 2RHDA 5AVUA 1I24A 3OM9A 3R4CA 1INLA 1M2WA 1ZM9A 1MAWA 2LV8A 3HMKA 2Q4BA 2NZ8A 2QJTA 1I0LA 3WHKA 2Y6UA 3LUAA 5BQPA 5BNFA 2XNDD 3R3SA 1JKMA 1OA0A 1EK2A 2W6QA 3GI1A 1BS9A 3UF0A 2X9GA 3JASB 1BVHA 5HG0A 3C6QA 4E09A 3R0VA 1ZDMA 1C50A 2I6XA 2Q5LA 3DYIA 3I5MA 3ZGVA 2PTGA 4B3CA 2KSQA 1TVKB 4EMUA 3PNSA 1SBNE 5HM8A 3SNKA 1DI0A 3AVVA 3DM5A 4HV4A 4FC6A 2Q45A 1PW7A 1K5HA 2DR3A 4M86A 3EQ6A 1G5QA 1EJ6A 5ALIA 5F51A 1MVOA 2PUTA 2GRUA 1ULAA 2ZYRA 4HAZA 1TCUA 2PYIA 4X91A 1X92A 4HQLA 1CUEA 3TVDA 2RGNC 4G26A 1NX6A 1GNVA 3ANYB 1NLFA 3QYAA 4FS3A 4NE7A 2A78A 4P3XA 4R2XA 4E33A 1J2UA 5C5EA 4H7PA 4LNHA 3PXUA 3F73A 1I3NA 2QTWB 3TQRA 4PX2A 1ZGBA 2GRJA 3RRFA 3TR6A 3NDIA 5H59A 1MNQA 1RI4A 4A8TA 5CT4A 4Y9DA 4DR3B 3ZK7A 1NN3A 5JNVA 1AGYA 1Q3HA 3JZMA 1Q1GA 2IHVA 1Z0SA 5EEGA 1V8DA 2Z9BA 4MJ7A 4RVSA 4Q4CA 2BMJA 3ESYA 2X8JB 3H9BA 3I2HA 4Q03A 4YEDA 1VPWA 3NTUA 2HHJA 3TVTA 1BJTA 4N5DA 2WC1A 2DYKA 2BEKA 4WZBE 1AH2A 2QMYA 5L4NA 1HEUA 2CF5A 1QVWA 2A0WA 3BGDA 3ICEA 3CWQA 3GEEA 3OE4A 4O6VA 1X1SA 3N7TA 4F9TA 1NUTA 2IUFA 4IBOA 1V3UA 1DKOA 2PVCA 3UFXA 1WF6A 2WJGA 5T5QA 1TIBA 3FHJA 4E1VA 1LTHR 1X1TA 3TG2A 1X74A 1ACLA 2D74A 2IKQA 3VH3A 3LQ1A 4YRAA 3OLVA 5GZ1A 3HS3A 3I52A 1SFRA 4TKVB 1CFJA 1CQIB 2KYRA 2P0EA 1VBMA 2SKCA 3DO8A 3IODA 2XOKA 2FETA 2VAMA 2Z30A 1JVSA 3JRXA 2RGDA 5AXBA 5AESA 2C9ZA 5BUQA 2DEUA 1A7AA 2QM8A 3S1SA 3GJZA 1K1EA