1JAIA

H-ras p21 protein mutant g12p, complexed with guanosine-5'-[beta,gamma-methylene] triphosphate and manganese
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAPGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-HA-RAS
publication title The role of the metal ion in the p21ras catalysed GTP-hydrolysis: Mn2+ versus Mg2+.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp-binding
total genus 63
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1996-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1jaiA00
3UK6A 3R9IA 2QAJA 5EE9A 4DIDA 2DFLA 1AGPA 3C15C 1FP6A 3LLMA 3ZVNA 4CZ2A 4B2LA 4DSUA 1DBSA 3QIAA 1T3HA 1NMXA 1UKEA 3WYGA 2AN9A 2AXPA 4NE2A 2IWHA 1AA9A 4MRVA 1VG0B 2RGXA 3CRMA 4LI0A 3D3QA 3HR8A 2FG5A 1DAFA 4NYMQ 3A8TA 4YMTA 2H92A 1HEIA 1ZU5A 2WJHA 1JXOA 3O8DA 5KNDA 2ZRFA 3F5FA 2FEOA 1E2KA 3GJ5A 3UG6A 4RD3A 4RD4A 2JLSA 4LHWA 5JCZA 1ZM3A 1KMHA 5FI1B 4B47A 1TUEA 1ZINA 1SVOA 4FMCF 3KKQA 2GVDC 3MJHA 4V0KA 5A4JA 5BWMA 521PA 3I73A 1K5DA 3VX4A 2QI9C 3IEVA 5CB8A 3SJAA 4BLRA 4I1SA 3THYA 2WAXA 3L0OA 3KL4A 1KKLA 1FX0B 2PZEA 4BFSA 1M34E 3OESA 4NCNA 1J8MF 1NLZA 2HLDD 3AGPA 2FFQA 3O8BA 4LV6A 4X8MA 2RGBA 2PLFA 1GTVA 4PAMA 4M1YA 3TQCA 2REOA 3TE6A 2OSBA 3FTQA 1TEXA 2A3RA 1OW3B 2ZRNA 4EKDA 4K8OA 4KLZA 5L8VA 1Z2AA 2ZRPA 2V4ZA 4NHOA 5FPTA 2IYUA 5JZVA 2W6JA 3PEUA 3ZIAA 4KSBA 5EXSA 3T06B 3F3YA 5JS7A 1UBGA 1ANKA 4IW3B 4HAZA 2FV8A 4BFYA 5KPJA 1IY0A 5HR5A 5B58C 4ZCMA 2GJSA 3K70C 1C9KA 1OXSC 4JLVA 3VU9A 2QM7A 4KAXA 2A2ZA 2D06A 3LBNA 1UM8A 4YQFA 2QMOA 3NHBA 3Q5EA 4HDCA 4DCNA 4Q5IA 3LAWA 1OXUA 4ARZA 3GLFB 1AM4D 1SVWA 2ZR7A 2RGCA 3GLHB 2W83A 1KK0A 5KSPA 3AM1A 2NG1A 3DKVA 1OE0A 3TSZA 2ZU0C 3N70A 4C3ZA 3TIFA 1DS6A 3GLGA 2A5FA 4BZPA 2XZLA 2GBLC 1XBTA 4JL6A 4YONB 3CBQA 2HT6A 5KYKA 2UVQA 3BBPA 1E0AA 3AEZA 2B21A 1D2NA 2QRNA 4LK2A 2BMDA 1GSIA 4MYCA 2IWRA 4JL8A 4P4UA 1OHHA 2VP9A 2X2FA 3SYNA 5KU1A 2ZS7A 4AURA 4MYUA 4DJTA 4EFNA 1QZXA 2CE7A 4JT4A 1OT3A 1S4QA 1E2LA 4IDOA 3SS8A 1R7RA 1KHTA 4D0GA 2C96A 2XAUA 2YNMA 1DAIA 4NMMA 3AVWA 2GILA 5FR2A 5LBIA 4IOKA 3VTKA 5KSYA 1S1MA 1VECA 1TUIA 4U02A 4HATA 4Q9IA 3RS0A 3CPJB 3WP1B 5HZHA 2JA1A 1PV4A 2V6IA 4I99A 2NO9A 4H1VA 4Q19A 4X8OA 2D62A 2JIZA 4KITB 2JDID 2DCUA 2WWHA 2F3TA 3RSLA 4ZDJA 1UKYA 2E87A 1Z0DA 2OG2A 3EPJA 1CIPA 3OF5A 1AS0A 4EQ6A 2QE7D 1ZUHA 1XPUA 4JYCA 3IIKA 2HDNB 2ZYTX 3I8SA 1OXVA 3QVUA 4TTPA 4OHXA 2JCSA 2CVHA 2TMKA 3NBFA 4M4SA 4KHZA 2IYQA 1TF2A 4PPNA 5DE3A 5H68A 4DUGA 2OEPA 4LZZA 3QQ5A 1YKSA 1HY3A 3HJNA 1MRNA 1US8A 3Q85A 4JKYA 3MD0A 4BFVA 1NLFA 3DVLA 4CT5A 1ZU4A 4JBWA 5JWHA 4DCSA 1W36C 1FTSA 2ZI5A 1O87A 2XSZA 3SNHA 2OT3B 5BYJA 1RJ9A 3HP1A 1AZTA 2GXUA 2WICA 3G5UA 3ASYA 3A36A 2GRJA 1TF5A 2ZUDA 1E4YA 4RD1A 1GM5A 2OO7A 4LBYA 4OI4A 3T1VA 3WRXC 5C1BA 3KB1A 3K70D 2FSFA 3TR5A 4DSOA 2BBSA 2WJGA 1W47A 3V4FA 2RCNA 1EFTA 3A1UA 2CHVA 3GFPA 2EYQA 4OK3A 1E98A 4XTCS 1G5PA 4RFSA 1CEEA 1QHGA 2AKAB 4L4UA 4HAVA 2HXYA 1U0JA 1VPLA 2JJ2A 4B3DA 3LRPA 3NHAA 4MYTA 4TYQA 2G0NA 4IVRA 4YDHB 4A4DA 5CDFA 4B73A 4IFBA 4JYBA 4WOPA 1ZNXA 3CNLA 4A8JA 2O8BA 2JLQA 4URZR 3QBVA 1B23P 2PJZA 3FMPB 2PEYA 5BW8A 1WBDA 5FTMA 2NMVA 1YRAA 2EFEB 2VHTA 3B9PA 1VTKA 2C95A 2FN4A 4RD0A 3SDZA 3SU8A 5JEDA 4KYUA 2IXFA 1W4CA 1E0KA 2ZI9A 5CK5A 5GJVC 4F38A 3DMNA 1GWNA 2VP2A 121PA 1G291 4M8NE 3RS7A 5HZKA 5EQTA 1W4AA 3RDPA 2ZU6A 1XRJA 3CNNA 2WMOB 3IIJA 3IQXA 3UWOA 2DPXA 4OQFA 1KK3A 1SXJC 2VHJA 4A0RA 1DO0A 4Q18A 4BFZA 1G19A 4LJ5A 4YC7A 1HUQA 1P6XA 4OQLA 1A2KC 3OE7D 3P4YA 4P4TA 4CT4B 1P9WA 2IBMA 3QKSA 4GOKA 1CBUA 4W5HA 4D2IA 4GL2A 3H0KA 2F55A 2J7KA 4B6EA 3GLIB 4TZ0A 1JR3E 1FOEB 3IKJA 4ZV4A 4UNRA 1TNDA 2QT1A 2XEXA 3FYHA 3CIOA 1UADA 2RKOA 1ZUNB 4TN1A 4W7SA 2PEZA 3AF3A 2H8KA 4ZDKA 2CCGA 3H84A 5BXQC 2NZ8A 3K9LA 1KO7A 1ELOA 3GJ7A 2IUUA 4NYMR 1N6HA 1ZP6A 3SYKA 3FWYA 5DI3A 1EG7A 2ORVA 1A1VA 1H8ED 2VRWA 1IQPA 3KFVA 2W6ID 2ZANA 3GMTA 1QHSA 1QVAA 1YU9A 1G16A 4F4IA 1Y63A 3LNCA 4OHZA 2CHGA 4Z8XA 3GJXC 1IY2A 3SYLA 2FSIA 4KSCA 2FE4A 2QPTA 2IYWA 2KE5A 2EFDB 4Q01A 2BM0A 4XD7A 1XTQA 3SJCA 2C03A 2YKGA 2OLKA 4R2IA 2ZAMA 3L8YA 2QAGC 1IJEA 5H1YA 1OLOA 3K9NA 1VKJA 1N6KA 3QEJA 4B48A 4BRUA 2P6NA 2QNRA 2ZUBA 4Q48A 5EZ6B 1JR3D 4BE7B 3DKPA 4ZCIA 4L9WA 4BLQA 4N3NA 3B1WA 4Q1AA 1VHTA 2C77A 2UKDA 4DLVA 1U94A 1ZM7A 4IJMA 1XPRA 1QBKC 3G82C 1Q57A 3IEUA 3AVYA 5L3QA 1FMLA 2CE2X 2G77B 4Q1DA 2WZQA 2VBCA 1Z5ZA 1NKSA 1NN1A 1G3MA 1SKYB 1G41A 2ZRDA 2ZJ8A 2ZE5A 3IO3A 3KXIA 4BLPA 4IDHA 4D4MA 3BJIC 3U3MA 4RVCA 3U44A 1QHYA 3JVUA 5M04A 1U0LA 2YWGA 4C0SA 3BH7A 1XP8A 3AB3A 5CM8B 4BECA 1RPZA 1NVWQ 1SHZA 4DDUA 4PC6A 1SXJD 4US2R 3R20A 3RWOA 2CBZA 1NY6A 1XXHE 4D0LB 2QG6A 5AJWA 1XTKA 2FNAA 3QEOA 2BJVA 4RJLA 4JVNA 1YQTA 4Q1EA 4JLNA 3FPAA 1XD2A 4M9ZA 4C7OB 4QM6A 1XTSA 4IFEA 1Q3TA 4GZMA 1UBEA 4QHSA 4AIIA 4DLUA 5CIQA 2GCOA 4TLEA 1VMAA 1ZD9A 3BERA 4PFSA 2JDIA 1T5LA 2FJUA 1IN6A 2CMKA 2GESA 4OKSA 3U7FB 4NH0A 2QEQA 3CPHA 3ZGXA 1KJZA 5BN4A 4M1WA 2QE7A 2J0UB 3LXRA 3FHTA 3E1SA 2OBLA 1G8HA 3C4JA 1GOTA 4HB0A 4GSYA 2VHUA 3HYTA 4LOAA 4TLDA 5TVKA 1E0JA 5J4VA 5JLJA 2H18A 4B43A 3CX8A 3RABA 3TMKA 2Z4SA 1FQJA 1OF1A 1KO8A 4A82A 2ZSBA 1TQDA 5TXGA 4DCTA 2R6GA 3BB3A 1JXMA 1R6BX 2HF9A 3ZZTA 2P5SA 3BB1A 3Q7QA 4M9QA 1KAGA 1L4UA 3KX2A 4JJKA 3LDAA 2G88A 3AVQA 3N2IA 3PCRB 2AK2A 4KFRA 5DHFA 5FI0B 2OILA 2FMXA 3UG7A 5C18A 2BVNA 2R6CA 4C0AC 5FL7D 1KDOA 1NP6A 1WRBA 5LD2B 4C0JA 1LF0A 5JJLA 2J9RA 1W2HA 1JEDA 3LY5A 5C4MA 4ABYA 2GEDA 1F3OA 1IOZA 2IK8A 3F0TA 4MGKR 5B57C 5FTLA 3LQRA 3ZVLA 4ACBA 2GBLA 1E2JA 3QUSA 1OSNA 2PT7A 4OK5A 4URWR 4F92B 4V0ME 3KJEA 2LKCA 3QXXA 4CEHA 3J81k 1JI0A 1G1MA 3WNDA 4KCGA 2W58A 3WXMA 2XITA 4DLSA 2AFIE 3F8TA 4FMDB 5KPDA 4M1TA 4WXRA 4GOXA 2EWWA 5AUPB 4PAQA 1EFRD 1N6PA 1Q44A 4F4JA 1PJRA 1FZQA 1XJ0A 1M8PA 2V1XA 3AQ4A 4OJQA 1CR0A 1G9XA 4ZKEA 3RANA 4NPHA 3D31A 1JALA 1E4VA 1RVDA 1R5NA 1FUKA 2IXGA 2F9LA 3C5CA 4M1SA 4DCUA 2J41A 4GP7A 1MOZA 5FOXA 1NMZA 1A82A 1R0YA 2WMNB 2HT1A 2FX3A 4BEBA 1Z6TA 2OFWA 3RLFA 1UF9A 3AP3A 3GLGE 1KI6A 1R5OA 4HAYA 4ZDIA 1Z06A 821PA 2WJIA 1VG1A 1AS3A 4QXAA 5CITA 2IS6A 1T0HB 1KIMA 2ZR9A 4HYYA 1JR6A 1G8PA 2YINC 2H17A 3THOA 1G7CA 1YZNA 2GJ8A 2GETA 3EG5A 3QKUA 4LBZA 4N0EA 4RKFA 2ZQ5A 4BRWA 1B0UA 2QN6A 1GVNB 1AGRA 3C7KA 4O25A 1H8EA 4MRNA 3SR0A 1BYUA 2W6IA 2AWNA 3MLEA 4MKIA 5TMPA 4QNMA 3AH8A 1Z6XA 3RS3A 3PENA 4RZUA 4E09A 1M7HA 2V55B 1X8KA 3ETLA 1NIPA 4JS0A 4DLYA 3U7GA 2BBWA 2C9OA 3QSYA 2QRZA 4KFTA 3IPYA 1SZPA 4Q7MB 1P2UA 3TAUA 2WWYA 3CW2A 2ZS8A 3W90A 3WHKA 4PR0A 3MRSA 3I62A 1HQCA 1MV5A 2RAPA 2RGDA 1OKKD 4DEYA 3PV0A 4PO1A 2J46A 3SC3A 1MRSA 3NH9A 1E79D 2RGNC 4US0R 1W2GA 3KUDA 5EUMA 4QBHA 2WV9A 1JR3A 4FW9A 3QENA 2Q21A 2D7DA 3NH6A 4PC3A 4PZLA 1UPTA 2IYXA 2BV3A 4Q4AA 3TVDA 4HB2A 2N42A 4OYHA 5G3YA 1Q1QA 2CCKA 5DISB 2GF0A 3K0CC 4DBLC 4DT1B 4B32A 3ADBA 5D3MA 4EFLA 4JLPA 3QF7A 4Q4JB 3DL0A 1T8UA 1E0SA 1XTJA 2IEYA 2YC4C 1NY5A 1P60A 3RRYA 3KQKA 1JBKA 2ZS9A 1SXJA 4B2IA 1ZW6A 2FFAA 1MO4A 1IHUA 3K0FB 4V0NA 2VF7A 2O8FA 3PVSA 4LGMA 3U6BA 1LF5A 3IHWA 3ZQJA 4GFDA 4Q1CA 4DB4A 2VL7A 4I81A 3MSXA 1Z22A 4BLSA 3RS2A 2W2TA 4HLCA 4JLAA 4X8LA 1OPXA 1S1CA 1U81A 4L9SA 2OXRA 1WF3A 4MA4A 2ZYWX 3A1VA 3OIWA 2QU8A 3GFOA 3U60B 3U5ZB 4MDEA 2JEOA 2IA5A 2P6RA 1F2TA 4B3CA 1XCMA 3FFBA 1KMHB 4LX0A 4V03A 1S8FA 4DVGA 3OIVA 3BIFA 4HUTA 2REXB 2IHYA 2GNOA 1QHIA 1E32A 1KNXA 4JVLA 3EPKA 1AJEA 3THYB 4WA7A 4O2RA 2G83A 1XEFA 5EE1A 1HA3A 3RWMB 2X19A 4M21A 4PHGA 4O3MA 2ZVPX 4H9GA 2ZJOA 3LO5A 3VR2A 1ONBA 2J87A 1TU3A 4LCBA 2ZRHA 4Q66C 4LJ9A 1E1QA 2GK7A 2ZE8A 4LYAA 3I4LA 4QGHA 5DHAA 1K8RA 1RRFA 2H7VA 1G6HA 2DFNA 4R71A 3EASA 1XXHA 3AF4A 4EJSC 5FBVB 3AKCA 3TW8B 5FL7A 3B9QA 3DM5A 5K8IA 4XJXA 5GJCA 3ZD7A 2YOHA 1G3RA 3QVVA 4GP6A 2QAGA 1RC8A 5AJZA 1XZPA 3AVXA 1WXQA 4QGAA 2J45A 3MWJA 3EA0A 4LWZA 3ZS9A 1NN3A 4L5BA 1DE0A 3WY9A 4QGFA 1Q20A 1DO2A 4HDOB 3JZAA 3OEHD 4K81B 3VU9B 1GNRA 3EZ9A 4PHFA 1HT1E 1VYTA 2IYTA 2HYIC 3AUYA 2NO7A 1KSJA 2VYFA 1QG4A 4E5UA 1FP7A 3SE0A 2ZAOA 4ARZB 1KZ7B 4EIWA 4IVPA 1F2UB 3B5JA 1K6MA 4B74A 2C99A 1HH4A 1QVRA 1CP2A 1G4UR 2DWPA 4RY2A 2O8CB 1W7AA 3TRFA 1ZNYA 1EFRA 2ZR0A 2EFHB 1ZNZA 3NBZC 4M1OA 2PZFA 1Z8FA 1G3UA 1OFTA 1RYHA 4S35A 4IXNA 4UNSA 1GKYA 1GRRA 4PQYA 3O8CA 2BJWA 2VPPA 4A2WA 1IONA 1Y3AA 4QG7A 5AWFC 5P21A 2Y8EA 4Z1MD 3CRVA 4NZYA 2Z83A 4P4SA 2CCJA 1K5GA 4JL5A 4PC7A 5TARA 2G9NA 1EWQA 1ZMXA 4C0QC 2QGZA 2V1UA 4LJ7A 2MMGA 1AN0A 1MO6A 421PA 1FL9A 1T91A 2CL7X 4XWKA 4JVSB 4IKEA 4ESHA 5EXTA 4EPWA 5JSZA 1U90A 4DDWA 4RZ2A 2FZLA 1XMJA 1XMIA 1VG9B 2EFCB 2QZ4A 1G17A 1KI9A 1GNQA 1X3SA 1P2SA 2C8VA 3NWJA 2IUSA 5JJKA 1OV4A 1Q22A 4V0MA 3K0SA 3RNLA 3AKYA 4UXJA 5FBWB 1P62B 5AUNB 3THWA 1DAHA 2GCPA 3LD9A 2BBTA 2CK3D 4EQ6B 1ETUA 3NEJA 2XOKD 5A5GA 2ZUCA 2V8OA 5EUQB 4Q9JA 3L2OB 3R9WA 5H70A 4N1AA 1E3MA 3VNUA 3B82A 4RKEA 5JRZA 3W3ZB 4D81A 3C16C 1GZSA 1OB2A 3ADDA 3FDIA 2A5YB 4FMCB 3TLXA 3B2EA 5H8WA 1N3BA 4V0OA 4BPBA 1YVDA 4LC0A 3GD7A 3PEVA 1Q3HA 1RJ9B 1X6VA 5DI9A 1DARA 1KI1A 2FWRA 2XZPA 3LW7A 3TR0A 2XZOA 2G1JA 4FXPA 1RFLA 1G7SA 3FMFA 1YR9A 2PL3A 2XJ4A 4DLXA 1E79A 1Q21A 1RW4A 3GJ3A 1R2QA 2ZXUA 4JBYA 1QHHA 2O52A 4FIDA 1QHNA 1E9SA 4LJ4A 3FGNA 4FINA 3TAHA 3V4RA 1T6NA 2ODWA 4IOLA 3VAAA 5KSOA 4A6XA 3R7WA 3A1WA 3EX7C 3TK1A 4GBMA 2DWQA 4TSFD 3U7EB 5JWOA 2KBEA 4JSTA 4IDQA 2LWIA 2ZRIA 3C41J 3PG5A 4BFWA 1V5WA 5JWRA 3FVQA 2OAQ1 3GEHA 4A36A 4CIDA 1E9BA 2WKRA 3EC2A 5HCNA 4CEIA 2BOVA 1G8FA 4IEIA 2GWHA 4A8JB 2C04A 3WNCA 2O8BB 1VCNA 2V54A 1CTQA 4OBEA 4ILEA 3T5DA 2YOGA 3CRW1 1QF9A 3SJZA 4IOMA 1P73A 2VA8A 1P4SA 1Z3IX 4W5JA 1RRCA 1L8QA 1LNZA 2QMHA 4JMPA 5FBLB 4UNPA 5CYPA 4NYJR 1P9NA 2ZRJA 1BKDR 3D8BA 2WVJA 4XVUA 2BEJA 1ZRHA 1GL9B 4PSKA 4UNNA 4JLJA 5BN5A 1SVSA 3ASZA 3OHMA 3T35A 4PTLA 4AD8A 5DNYB 5KOYA 1Z0JA 5LDDC 4G3XA 4O2LA 2I1VB 5FBRB 1BYIA 1G20E 4JKIA 4R2HA 2W0SA 3SQWA 1HURA 4UXHA 2RGAA 3RYTC 1IY1A 2WTUA 1XEXA 4Q02A 2MSDB 4NTZA 1E9AA 4Q9HA 5IF9A 2GEUA 3QKSB 4XVQA 1GUAA 1Z63A 2QSZA 1HT2E 2EQBA 1GL7A 3RS4A 4TLBA 3U7HB 3EAQA 4AKGA 1TL7C 2QM8A 2WJYA 2ZJYA 4M22A 2IL1A 1Z6YA 3TKLA 1E2EA 2Q9CA 1FX0A 4BUJA 4F93B 2GCNA 3B8HA 4P33A 1TQ4A 5DN6A 1GL6A 2ZTSA 5FR1A 2WWXA 3A58B 3VR3A 3IPXA 4ASUD 5JJIA 2AK3A 2IEZA 4NONA 5G41A 2FZ4A 3LFUA 3ND8A 1WBBA 3V9PA 1MH1A 4PSAA 1GRQA 2VH5R 5FOUA 4FCTA 2R6AA 3QPUA 1R10A 1JEEA 4Q4HA 3AKDA 3CH5A 5HCIA 4TTQA 2NO6A 4MQBA 3MWLA 2HCJB 5C2JB 1KDRA 2XGJA 3B60A 1KTVA 4G5SA 2A5JA 3T12A 1DPFA 2O8EA 3FFAA 3W6PA 4JJZA 3EPLA 2KJQA 3HPQA 2RGNA 1UDWA 1UAAA 4QL3A 1A4RA 3E2IA 1YR8A 1II8A 1LFDB 3GJ4A 5KSZA 3OEHA 3E5HA 1D8TA 3KJHA 5L3SA 1EFHA 3BFVA 5LD2C 4TLAA 4WAUA 4LPKA 4HB3A 1HQYE 3REGA 4R9UC 4TZ6A 1PZNA 4M53A 3GLFA 3K0CA 5AR1A 5FL3A 3LVQE 3WYAA 1SGWA 1AS2A 2GDJA 3FKSD 5J4LA 2YVUA 2X2EA 1L4YA 2ZE6A 3Q7PA 1SVLA 3U2QA 5EP3A 2RB4A 2PBRA 2VEDA 1AQUA 3MUFA 1D2MA 4FCWA 4QHYA 5EP4A 4G0NA 5L3QB 3CZPA 5AJXA 3WMEA 4NCHA 3K53A 5FFMA 5BN3A 1I4DD 2WHXA 3UPUA 3RC3A 1E9EA 3EZ2A 3ZLJA 3U44B 4Z1MA 3OIYA 3U3KA 5AUQA 4DLWA 2GXSA 2DFKB 3LXXA 1NJFA 2QUZA 1XMVA 3D7MA 2OCPA 1FUUA 2JLZA 1RRPA 1DOAA 2D3WA 1W4BA 1BIFA 1KDTA 2YOFA 2QPOA 2IX3A 5C4GB 4QJ3A 4IDPA 5G3ZA 2QY9A 4YXWD 1XD2B 3L43A 1A2BA 1CR4A 3VKGA 4OHWA 5HKKD 2ZM5A 3I72A 2JLXA 4CEJA 3H4MA 5JHHB 3X1ZA 1Z0FA 2HLDA 3K1JA 1VYUA 1JAIA 2O0HA 2OBNA 4XH9B 2P3SA 2GCOB 3EZ6A 4XIGS 4DLTA 3THXA 1ZC4A 2PX0A 2CJWB 3DMDA 3I8XA 3EWAA 1N5LA 4MDFA 1GDDA 3IBYA 2CK3A 1EFCA 1F48A 1EESA 4KO8A 1YZTA 1W36D 4XVRA 2RGGA 4DKXA 1F5NA 3BFXA 3Q3JB 4LYHA 1SXJE 5G53C 3OEED 2L0XA 2VSOA 2Q9BA 3UWKA 4DLZA 5JI2E 1JNYA 3GEIA 4KBFA 4EJSA 4V0LA 5UKDA 5GVSA 3TGPA 4TYWA 2IC5A 3UMSA 3OIUA 3LQQA 1Z07A 5SZJA 4B6FA 2FDCA 1Z08A 4FN5A 3L0PA 4Y0AA 4LHVA 1P3JA 4QFMA 4BGDA 1W44A 4FD2A 3NDBB 1BOFA 2REBA 2AWOA 4OL0A 3ZVMA 1ESMA 1R8SA 1U9IC 2AHOA 3MAAC 1OYYA 3PFIA 5FOSA 4D4JA 4XOIA 5K8LA 1Z28A 3ND9A 1IM2A 1DG1G 1T9HA 2FEMA 1J99A 2ZJ5A 1W0KD 3CLVA 1Q0UA 2F9MA 4LHYA 4OQMA 1IN4A 2JLVA 1KI2A 2CXXA 3IIMA 2JATA 4TSFA 5F98A 1SQ5A 1YE8A 1NMYA 5LB4A 1KK2A 1XZQA 2C5LA 1EK0A 1JQLB 1YR6A 1Z6GA 1DAEA 3DPUA 3PUZA 4PSVA 4OI0A 1NVXQ 4TLCA 5LB2A 3WBJA 2WIAA 3R8CA 2BMFA 1I4TD 5IHPA 2ODBA 4QM7A 3W5JA 2P67A 2W2XA 2O8DB 5EE3A 1IXZA 2QBYA 3QKRA 1CXZA 3A4MA 3RVBA 4URUR 2AXNA 2FF7A 1DAGA 4F7WA 1E9DA 1VHLA 3BOSA 4XTRA 2B6HA 2HUPA 3EZ7A 3M0EA 2NTYC 1ZAKA 1P9RA 4KODA 4PX9A 1VCOA 2F3RA 3CRQA 2B7BA 4NCKA 4JVMA 1WE2A 2AD5A 5JECA 1Q12A 1J70A 3ZZ0A 1P75A 4S2EA 1OB5A 2ECKA 5TDHA 2Q3HA 1S9HA 2QP9X 2NPFA 5JS8A 5TV2A 4LHXA 1S0UA 3TJZA 3BH6A 4Q9LA 3K0AB 3KJIA 1U8AA 4M1MA 5ANRB 5DYGA 3I5XA 2UZ3A 2NO1A 4OK6A 1YRBA 2R62A 1KGDA 2GVZC 1X8LA 1W46A 1IXRC 5FH9A 2QORA 4A6PA 3CPEA 5C46F 4DDVA 1N0WA 4QBFA 2VHCA 2Z43A 2IYSA 1XWIA 5CB6A 1NNEA 1Q1EA 4HAXA 4TQUS 3K9HA 1E2FA 4ASUA 4D25A 3EA5A 4MGIR 3HDTA 1KYIA 1FMJA 4JLOA 2P65A 1TPZA 4E22A 4MKFA 2GJ9A 2RHMA 1OH7A 4AG5A 4B3GA 4QRHA 4P31A 4Q47A 2Z5FA 1NG9A 4MRRA 5FTNA 3I5YA 2ZVQX 1T3SA 1XJCA 4B71A 1KAOA 5FPHA 1KI8A 2MSEB 1U0HC 3T1TA 4NU0A 5FOTA 4IDNA 2V9PA 2WOJA 4EPTA 3B78A 2BKEA 3MG9A 3KKNA 5E7MA 5DGXA 5F9HA 1N6NA 2ZYUX 2OV2A 3CF6R 5AJVB 1H8HD 3I1FA 4KI0A 4NYIQ 3BWDD 3TUZC 3DZ8A 4JLDA 1ESNA 1JJVA 3AVUA 3WMGA 4A9AA 3CKLA 4ON9A 2FSGA 1ZCBA 2PH1A 2QP3A 3CO5A 4BEJA 2Q0HA 1J7KA 2V7QD 2H16A 3FKSA 4PO8A 1JB1A 1G7TA 2ZREA 3OFND 4DSNA 5CLLA 4OI2A 4Q4AB 3NTUA 3K0EA 3M4YA 3ZD6A 4AKIA 1UEIA 3BD9A 1CJTC 4QBIA 2IF0A 3EIEA 3QG1A 2B7CA 1JECA 3X1WA 4D82A 1YZLA 2KSQA 3VHXA 5D3MB 1VCMA 4JIMA 1E2QA 1ZVQA 1KY3A 3O8RA 3OE7A 2J3EA 1PLJA 4LSGA 1C1YA 1G18A 2OXCA 3MMPA 1E2MA 1NLYA 3NC1C 4I1OA 4TTRA 3T15A 1E9FA 1OH5A 4YMUA 2XNSA 4CRWB 3MWKA 2QA5A 2BHRA 3GFTA 3TBKA 1L7VC 1KI4A 2DR3A 1CR2A 2R65A 5HKKA 4WIAA 1ZIPA 5GADl 4LHZA 1X1SA 4NDZA 4QGGA 3UKDA 1XMSA 3CWZA 1U8YA 4G5GA 3VR4A 3GJ6A 4EPRA 1QDEA 1UBFA 2BKUA 2J5XA 3GEEA 4BFXA 4GDFA 3WBKA 4A2PA 1T8TA 3ZZUA 2O5VA 1F2TB 4WVFA 2J0UA 2JASA 1E69A 1HV8A 3ZDQA 3S1AA 4ERNA 1IN7A 2XX3A 3UANA 4TYYA 3VNVA 1XEWY 4F4CA 2CVFA 1W1WA 2IYZA 1JPJA 5A0FA 2ZRLA 3OEEA 3QKTA 4V02A 1XD9A 2FH5B 2GZHA 2GHIA 1GIAA 4P0TA 1TTTA 1CR1A 1N25A 2NOAA 4GNKA 3CF0A 2AX4A 2PMKA 1CJMA 2RHDA 2P6UA 4HLUC 4TMZA 2I3BA 2ZITA 2Q6TA 2GZAA 2QMEA 4M9SA 2NO0A 4Z54A 5L3RA 4M1KA 1Z0KA 3BB4A 1XXHB 2OFXA 3ONWA 4EPYA 3SJBA 1M1YE 3TH5A 4TYPA 3ZIAD 5E3HA 4DLRA 5K8TA 2KB0A 1D9XA 5EXXA 1W0KA 3W8NA 4WBSA 2AD1A 5G40A 2D7CA 3X2SA 2QAGB 1T5IA 4TWZA 4RD2A 1LV7A 4YLGA 2ZJBA 1GITA 4E07A 3DOFA 1OIVA 1IN5A 2UZIR 4YMWA 3UMRA 4J0QA 3PUXA 4POAA 4HLDA 5J4YA 2QTHA 3QF4A 3KTAB 3QY0A 2OCYC 2Z0MA 3R9XA 1Z2CA 2FFBA 2JGNA 2G6BA 2Q3MA 3AP1A 4HUQA 4BLOA 3CB4A 2F1JA 2H5EA 4NP6A 4C0LA 3RRZA 5JRJA 3NIBA 5FUWA 3T34A 1HE1C 2WJJA 2CHQA 1F60A 3GJ8A 4WZAE 221PA 1MO3A 3O47A 3NEYA 4D0NA 1I2MA 1CLUA 3L0SA 4A8JC 2ATVA 1G3QA 3FHOA 2F43A 2ZSDA 2V6JA 3EPHA 2EWVA 5E7IA 1XU4A 2HV8A 1LY1A 1I4LD 3VFDA 5F3WB 1OH8A 1NVUQ 3DM9B 5KHOC 1XCGB 2HJVA 1AK2A 3IGFA 4QBGB 3ZYCA 1NF3A 1EWRA 3KZ1E 3LVRE 3Q9LA 4NKRA 4A15A 3KQHA 4QOSA 3DOEA 3GLFE 3QG5A 4LJAA 3GLHE 1XTIA 2ZJ2A 4GOJA 2G1KA 3Q5DA 3MJRA 3NBXX 3PR1A 4TL7A 3B1YA 4MRPA 5DO9A 1AIPA 5JSZB 4KBGA 4C30A 1UBCA 3CR7A 1Z6AA 2QMUA 2PJRA 2WWIA 3WRYC 4GMXA 1IBRA 4C9BA 4EFMA 4QC2A 1WP9A 1Z47A 2ZEJA 4IRUB 5K8UA 2NPIA 3JZMA 1P61B 3REFA 1OFIA 4B2PA 5J5CA 4JBXA 2C9YA 4B3XA 3IILA 2XNDD 3RSOA 5IRCD 1LVGA 2D74A 3N2EA 1G7RA 2AR7A 2XB4A 4TT3D 2DYKA 1U9IA 1LW7A 1G8GA 1N6IA 2BMEA 3HPRA 1R0ZA 4NCJA 3TVTA 4A0FA 4C2TA 4PAOA 1PLLA 1WDTA 4RSGA 1NN5A 2OCAA 3BAFA 2ZRKA 3FOZA 2ZE7A 4WZBE 1H8HA 3X1XA 4QNRA 6Q21A 2PLRA 2R6DA 3CF2A 3SQXA 1U98A 4FI3C 4LYJA 3ZVRA 3I32A 3PUVA 2ZRGA 3QXHA 2JLYA 1GAJA 1RYFA 1W48A 4OJKA 4AKHA 2R6FA 1VIYA 3B1VA 3QPWA 1VYVA 1ZYUA 3SN6A 2ORWA 2CL0X 2V7QA 2OE2A 3HU2A 1QRAA 3SEAA 5EZ5A 3WP0A 3CX7A 2GXQA 3OFNA 2XXAA 3GLGB 1LS6A 2IYLD 3NDPA 3U4QA 2PZGA 3HU1A 4GPTA 2LKDA 3CH4B 4W9MC 4JLMA 1DTSA 5DH9A 2O0JA 4Q4LA 4CEIB 2JLWA 2H57A 2VP4A 4Q4JA 2GJKA 1XCPA 4MUAA 2BMJA 2ZJZA 4R98A 4MH0R 4M9XA 5CJPA 4PPFA 4CYMA 2F1HA 3C8UA 3SHWA 2YV5A 3K0FA 4NYIR 3U3OA 1MKYA 4EDHA 4TMVA 3QPVA 1MABA 1GILA 4EUNA 4UJ5A 1HE8B 1FFHA 2HEIA 3BGWA 3LX8A 2RH5A 1AKYA 2OUKA 5CK4A 1GRNA 1TX4B 1DAKA 1NKTA 3KXLA 5FTKA 1RZ3A 4DIEA 3R8FA 2DHRA 1OXTA 4AYWA 3KKMA 4OI1A 5KO2A 4KJZA 2WWWA 1XEWX 4I1UA 1ZC3A 4AY2A 2F1IA 3AGQA 3QI2A 2C98A 2ZRMA 1XEXB 3A1SA 1FNNA 3KQUA 1OXXK 3IHLA 3Q8XB 1JJ7A 3WMFA 2A30A 2MMCA 1VG8A 4Q7JB 4UKDA 1M6NA 2QENA 5IDVA 2KWIA 1UJ2A 5B30A 4D26A 2YJTD 1KO4A 1XPOA 1EXMA 4CDGA 3AP2A 3BE4A 2GXAA 5F9FA 3LW8A 1OIWA 3NBYC 2C78A 4ACAA 4CF7A 1KNQA 1US8B 4UXIA 2IYVA 4ZIRA 1KY2A 1S3SA 1ODFA 1GFIA 1RIFA 2ZI3A 3QE0A 2ZI7A 3U3JA 5FUXA 3I92A 4URXR 2XTNA 2F6RA 2PT5A 2WBLC 2ZYVX 3SHFA 1JQJC 1NVVQ 1OKKA 4ZCLA 5J4HA 4Q4HB 4AKEA 1CKEA 3LLUA 1W49A 2ZJAA 4HB4A 4DXAA 3LV8A 4HZUA 4OQNA 4NBSA 2MSCB 1SULA 3VR5A 2KBFA 2R8RA 3ZH9B 1N5KA 1P2TA 1UKZA 2IUTA 2WWFA 2O8EB 4KXFB 4L8GA 5D3QA 3L0IB 4RFSB 3GLIE 4OQXA 1X1RA 3PEYA 2IS4A 1II8B 3HYRA 1PLKA 4XD7D 3VR1A 4MKHA 2W0MA 5IT5A 1OJLA 5L3SB 5HE8A 3A1TA 1SKQA 4D4LA 4ZKDA 2WM9B 3MCAA 3PUYA 1G21E 1XDBA 1TAGA 3X1DA 3VR6A 1WB9A 3AF2A 2GK6A 2A7QA 4G1UC 2ZPTX 4M0LA 1F2UA 2J7PD 3AV0B 3K09C 2VF8A 3NXSA 5DYIA 3P27A 2ZRCA 4B3BA 2O8CA 2EU8A 2ODEA 1II0A 3DHWC 1NSTA 3GQBA 1KDPA 1OH6A 1T0JB 4M2LA 3L82B 2CLSA 2GF9A 4XSGA 2IYRA 4JLBA 3ICEA 1UKVY 3B7GA 4HDQB 3DZDA 3IQWA 5KUTA 3EWSA 1DAMA 1NJGA 3G0HA 1NSFA 5J47A 4US1R 1T4GA 3GPLA 1V43A 3H2YA 4G01B 3BORA 4IHQA 1NI3A 4KV9A 5E95A 4EPVA 3K9GA 2R2AA 5IK2D 3B6EA 1BMFD 4CEJB 3IDQA 1IAQA 1KSFX 1KJYA 2YZ2A 3KUCA 1Z0IA 3QNUA 1X8JA 2ERYA 4OHYA 2GJAA 4GI7A 5CM9C 3RRMA 5LPNA 2J59A 3A6PC 2QROA 1ZD1A 3KKOA 3DO6A 3T1OA 3SFZA 1SKYE 3THXB 4BZXA 1I2DA 3FB4A 4NCIA 1KKMA 3PXGA 2BC9A 2D2FA 3BC1A 4Q21A 1AQYA 3LH5A 5DI3B 4HLUA 2IYYA 2XNDA 2ASEA 1M7BA 5DLQC 2WIBA 3T61A 4RCZA 4TT3A 4F91B 2E1RA 1KSGA 4WXPA 4IOJA 1OYWA 4BQSA 1TMKA 1XTRA 4EJSB 2WKPA 1QG2A 2GZDA 4OHVA 1G6OA 2B8WA 1P2VA 4HLQB 3WNBA 2BBOA 3DDCA 4PANA 1W0JD 5FUYA 2X8AA 2XB2A 4KLNA 1E94E 3K70B 1M74A 2VHQA 2OLJA 2P5TB 2QQ0A 4Q1FA 2VP6A 4BLTA 1MO5A 1CJUC 2FGJA 1DELA 2ZRBA 3ICQB 4K46A 4LV8B 4BFUA 2YC2C 3B85A 3H86A 1NIJA 4DWJA 5KNBA 3LWNA 3GLHA 3A4NA 3PIRA 1FPMA 3X1YA 1A5TA 2VQSA 1FNMA 4BASA 1OIXA 2IHBA 5EJEA 3AVPA 3CWQA 2QSYA 2VTKA 4I4LA 2GKSA 4IEEA 4O0MA 4AYXA 1OFHA 1YZGA 3TW4A 5SZHB 4II7A 2OAP1 2OCBA 2EW1A 3ADCA 1W4RA 4FCVA 4IXMA 2P0EA 1CJVC 3NC0C 2QBYB 1NN0A 2GAAA 4Q9KA 3QKRB 5E7JA 5EP1A 4EAQA 4Q00A 5GVRA 2XTMA 2ZSFA 1BO6A 1OFUX 4Z8YA 2BEKA 4B75A 4LBWA 4LJ8A 5KDLA 4AG6A 1W5SA 1PUIA 4C0BA 1E2DA 2B92A 1JPNA 2CDNA 3RRNA 3OZXA 4TQAA 1N0VC 2C2HA 5HE9A 2IXEA 4D4KA 3UMFA 1FW6A 5CIWA 2FFHA 4TL9A 1CS4C 4PZYA 2K5UA 4BZQA 1XJQA 2J0VA 4H1UA 1CRQA 1COWD 1JAHA 5EE0A 4GT1A 2AFHE 1KJWA 4KYIB 3C5HA 2ANCA 4E03A 3P20A 3I61A 3SBEA 1UEJA 3HR7A 3K8YA 4PHTA 2XOKA 2F1RA 4MGZR 1E9RA 1M2OB 5GJBA 1KO5A 5AK0A 2WPDD 2OBMA 1PVOA 4U5XA 2NGRA 4DDTA 1E2NA 1Z83A 2YWHA 3CM0A 2QL6A 4ITRC 4PZZA 2EVWX 3B13B 5B2ZA 2ZSAA 4FWIB 1EX6A 4FWTA 4DHEA 1N6RA 1AKEA 1TQ2A 3AF1A 3PJRA 1XX6A 2GTPA 3U6KA 3T5GA 2NQ2C 1G3IA 4AWXA 2WSSD 1R0XA 1VCIA 1G8YA 4RCYA 1PUJA 3V00A 2IT1A 4XWOA 3BK7A 4GZLA 2BIFA 4L16A 4MITA 2F7SA 1YR7A 2GAOA 1U99A 2IF2A 1N5IA 1GNPA 3AVOA 3W9YA 1TQ6A 1KI3A 4C4PA 5BYKA 3SZRA 5FPKA 4U7DA 3KKPA 4DUGD 4RD6A 4URVR 2SHKA 3VMFA 1GKIA 2WAYA 4LC1A 4Z51A 1Q1ZA 2X1VA 3KJGA 2FA9A 1XFAA 2PCLA 1N0UA 1IXSB 2FPMA 3W3AA 1MT0A 2W2VA 4IVQA 3LBIA 2WSMA 4DZZA 1KO1A 3EW9A 3A4LA 3HU3A 3BFKA 2VSFA 4UNQA 4WW0A 5FOVA 1KSHA 3TNFA 3SBDA 1WMSA 1ZM9A 2PMDA 2O0KA 2AL7A 4GRAA 2WWGA 2YWEA 2RMKA 4A1FA 2J7PA 1S9DA 4CEHB 4DB2A 4LUCA 2HCBA 1G5TA 3CUEF 3TSOA 4KFUA 1NBME 2VSXA 1R5BA 1CRPA 2EYUA 2HYDA 3FMIA 2A78A 2FOLA 1NVVR 1YZUA 1WCV1 3OAAD 4X8HA 3W6NA 3P26A 2VP0A 4R7ZA 1RE0A 2QP4A 1G5RA 1P5ZB 1ZJ6A 1G4AE 3BS4A 4QKQA 2XTZA 3LX5A 5JHGB 3KFXA 1DVRA 3UATA 2CNWD 1E1RD 1LB1B 1AZSC 2ZRAA 3EXAA 2JJ1D 4DCVA 4DEXA 1LS1A 3EIHA 2YYZA 1SHKA 2OZEA 5JEEA 1E2PA 3M1IA 1YZKA 3KQNA 2FPKA 1U2RA 1KZGB 2XJ9A 1S3GA 3AUXA 1E96A 3IUYA 3GLIA 4PHHA 3RAPR 1GKUB 4CW7A 2ZI6A 1XD8A 3FKQA 5FPYA 4TL8A 2FPLA 5HPYB 1S2MA 2CLDX 3P32A 2R44A 5IK2A 5F2EA 1KI6B 1BMFA 3MWYW 3EC1A 2FU5C 2NIPA 5FUVA 4L15A 1NRJB 3QBTA 3TQFA 4AK9A 4YMSA 2CJWA 4LPSA 4AYTA 4D80A 4GMDA 4XSHA 3TSWA 5B64A 3S1AB 4PQFA 1NBMD 1YHNA 1W36B 4WZ6A 2HF8A 4B35A 4DRZA 4ZI2A 3VKHA 2EFGA 3U3RA 1RKBA 3FMOB 4N0DA 1D6JA 5KNCA 4QJ4A 3VHLB 1GG2A 3VKWA 3AVTA 2Q3FA 1D9ZA 3KDSE 3AKEA 4A92A 1E6CA 1W0JA 3BH0A 4A2QA 4Q7KA 1DEKA 2YWFA 4JZKA 4C0HA 4C2UA 2PX3A 5J4KA 1E1QD 4FMDF 3CZQA 4PQRA 2OFOA 3AVVA 1ZCAA 2OESA 3TUJC 3PQCA 3SI7A 4P3YA 3U61B 2HJGA 5KDDA 4JSYA 1SVMA 1NL3A 3RC8A 1R0WA 1SVKA 4LJ6A 1ZD8A 1U8ZA 4HZIA 3CRRA 3IO5A 2Z4RA 3K09A 5DSZA 3FHCB 4HAWA 3CNOA 3FE2A 2N46A 3RS5A 3GP8A 2V3CC 1N5JA 3WYFA 3QF4B 3B1ZA 4W5WA 1XB2A 5JMTA 4U00A 2O8DA 2G3YA 5DIFA 2A5DA 4RZXA 4HUQB 1E2IA 5EP2A 1SXJB 4LBVA 4HI0E 3CR8A 2A5GA 1L2TA 2R9VA 3QXSA 4ZO4A 3IBGA 3QXCA 2Z6VA 3GCGA 2ONKA 2O8FB 3P1JA 1P72A 2YHSA 4MKGA 1H65A 4PXAA 4PO9A 2F43B 4YXWA 3T1QA 4C7OA 1J2JA 3L8ZA 3SOPA 4YMVA 5JI3E 1TADA 2ERXA 4ESVA 721PA 1UDXA 1CU1A 2N1BA 1NG1A 2QTVB 5JCPA 3PITA 4PPQA 1COWA 4YDSA 3UXMA 1G64A 4KVGA 4QHTA 5E4FA 1VIAA 4PC1A 2WJVA 4DSTA 4RFVA 3QXJA 5CLQA 1M7GA 1E9CA 3K0AA 5EE5B 4LJYA 4TMTA 4G5QA 4A0HA 3SFVA 2G0TA 3EARA 5L3VA 2VP5A 2HXSA 4EPXA 2WPDA 4MUBA 3KB2A 3PUWA 2CL6X 4LY6A 4P32A 4TMKA 1E99A 1UFQA 5JFGA 3I3SR 3MGCA 4BFTA 4ZDWA 1C4OA 1CJKC 4BWYA 4B34A 2IS2A 2OM2A 3C14C 5SZIA 1WA5A 2J0QA 2BCGY 2WSSA 1N6LA 3KQLA 2BM1A 2Q9AA 3NG1A 4Q1BA 2CLCX 3P4XA 1R8QA 1KK1A 2P2LA 1KOFA 3M6AA 4G5RA 3Q72A 2JJ8A 1HTWA 4TMWA 1CF4A 4TYNA 2W6JD 2E9SA 4LRWA 4PC2A 1IN8A 2QQEA 3DEFA 3W8RA 1DADA 3B1XA 1SVIA 3VQTA 1O3YA 2IW3A 2ZI4A 3CONA 4I1VA 3NKVA 1ZUIA 5HTKA 4NYJQ 1CULC 4DC9A 2DBYA 4CVNA 3QJYA 4AC9A 2BWJA 1WQ1R 3PEWA 4KU4A 4Q7LA 3H1TA 4ZI3A 4C0KA 2ZROA 3TUIC 4KVAA 4TQ9A 4HEJA 1MR3F 2DWOA 2KI5A 2NZJA 5AJYA 1N2CE 3ZS8A 2C9CA 3W6OA 5KTYA 2XXAB 3ECCA 5SZKB 2VLIA 1F6BA 1ZNWA 3BRWD 4G5OA 4QJ5A 3OAAA 3D6TB 3U4QB 1FQKA 2ATXA 3E70C 621PA 2FGKA 2JLUA 1ZM2A 3W34A 4MYHA 1GP2A 1QHXA 2J1LA 1OHHD 2ZSEA 4ZPXA 4LDJA 2CNWA 1E1RA 2WKQA 1KI7A 4Y0VA 2JJ1A 1EX7A 4P4SB 4MGYR 2LCFA 1YZQA 1X86B 3EIQA 4HAUA 5CYOA 2JLRA 1ZM4A 1ZBDA 3EZFA 1LTQA 2H1LA 3VX3A 2DB3A 4AI6A 1TEVA 5FPSA 2I4IA 3JVVA 5CJ2A 1MABB 4TMXA 1VDZA 1IJFA 1EGAA 2ZETA 5EXPA 4TL6A 2J0SA 2QGNA 1J8YF 3ZQ6A 4B33A 3AF0A 5FOWA 3MFYA 1Z0AA 1XNJA 2X77A 1XF9A 2D2EA 2DFTA 1Q1BA 1P7CA 3HWSA 2A9KA 2GEVA 2ZIAA 4JLKA 2JIZD 1YJ5A 2OHFA 5CDFE 1N6OA 3BXZA 2VO1A 1II9A 4UQOA 4D6PA 1D5CA 2QPAA 2IS1A 4Q03A 3THWB 1R4AA 1Z29A 2VIIA 4XWAA 3UIEA 4A0GA 1S96A 1DG3A 5BQ5A 4FMBB 1NBMA 4B3FX 4B44A 2W00A 4LYFA 2JAQA 5FTJA 3KXKA 5ELXA 3CX6A 3ADKA 5AUOB 1D2EA 3NVAA 5DN6D 2FSHA 3QOFA 2DY1A 2I1QA 4ZIRB 1W5TA 5JBQA 1J90A 3LBHA 1ZIOA 1EFUA 4JT2A 4LV5B 4B76A 3ZJYA 1TF7A 2XSZD 4CGZA 2ANBA 4PPGA 2QTFA 5TB5A 1FTNA 3LA6A 4HSEA 2BCJQ 2BDTA 1TU4A 2ONJA 4HZUB 1QHHB 1KMQA 1RRGA 4UJ3A 2ODNA 4MRSA 2WOOA 1A7JA 2D4HA 3R7WB 5GJWC 5FBQB 2CEAA 2GA8A 1E2HA 4RZ3A 2JJ2D 3RHFA 1T3LA 5KDOA 2ORIA 3A37A 2AKYA 3W5IA 4DT1A 8OHMA 1E2GA 3GJ0A 3N5CA 1HYQA 3KTAA 5J40A 2QT0A 1BH2A 4URYR 2RGEA 5TY0A 2PCJA 3WHLA 1BS1A 2B8TA 4KFSA 4NL4H
chains in the Genus database with same CATH superfamily
3UK6A 4KQ1A 4O1HA 3R9IA 2VH1A 2EZ9A 1HLGA 2W11A 4Q05A 2QL7A 3C15C 3LL7A 4CZ2A 3K2EA 4B2LA 3LQ1A 1DBSA 4NHEA 4DJEC 5CA1F 4PZDA 5H4GA 1E3DA 2MSLA 2AXPA 2XY4A 3GGSA 1MAUA 4ZQBA 1GNSA 2GZRA 1NJSA 2ST1A 5CDYA 1DU4A 4NE2A 3T9FA 4MRVA 2N75A 3PBKA 1L5LA 4LI0A 3UY4A 2M98A 3LY7A 3TEFA 1DAFA 3HDJA 4NYMQ 3ADPA 3ELUA 3IH5A 1Q0HA 1M83A 3VH1A 3ZNOA 4YMTA 4J43A 3D6AA 1H94A 3HKDB 1PL6A 1YVEI 2ZYRA 4C7MA 2P9QA 3F5FA 2FEOA 2RAUA 3L02A 3O4VA 3LK6A 4RD4A 4E94A 2OKGA 3NM6B 2V5AA 5KWEA 4BU1A 2H48A 2CJXA 2JLSA 2ZIVB 2UZ1A 4LHWA 4KIFA 1TUEA 1ZINA 1SVOA 4V0KA 3KKQA 4XQEA 4DYVA 5BWMA 3WI7A 2LGJA 3B6JA 3OOHA 2VC2B 3VPSA 1J39A 1Q19A 4J1SA 2JFGA 5CB8A 2JGDA 2R5FA 1GDHA 4F2WA 5JD5A 3IEVA 2WLSA 4CM6A 1HF3A 4I1SA 2HK9A 3COSA 4UZFA 4BFSA 4EG3A 1CD5A 3DNFA 1Z37A 2WZCA 2E6KA 3AGPA 5I7FA 2AX3A 2BHSA 3P52A 4EEKA 2YV1A 2WIKA 2PLFA 4PAMA 4M1YA 4KR6A 4H6VA 1G66A 3SM9A 1D1TA 1MXHA 3TF5A 4CTNA 1L7PA 1BCRA 1G1AA 2RG1A 1T3GA 2XDYA 2ZRNA 3ILHA 4K8OA 5AMXA 3L6OO 5A7HA 4II3A 3R3XA 3RTAA 3CRNA 2AJCA 1OA0A 5FPTA 3SEZA 3ZJ4A 4IXWA 3ZIAA 4WXHA 3ORHA 4RESA 5DXJA 5U4QA 1ANKA 4NECA 4IYJA 4H3VA 4HAZA 3USZA 3L7YA 3G7NA 1CFJA 3OQ6A 3I6YA 2MYNA 2HPAA 1Z4MA 4BGIA 2AKEA 3BF8A 4J0DA 5B58C 4LNUA 4CIXA 3AF6A 4H1WA 1U8XX 2VJCA 3EAFA 2RK6A 3D6UA 3QVSA 2OMKA 2QTWB 2B4YA 4YMIA 3PNSA 1UM8A 2I4MA 4G0QA 2QMOA 2NUAA 2ODQA 3CKKA 3QWBA 2Q8QA 1GTMA 4HDCA 1K98A 4ZVMA 4D3SA 1M67A 4RJ2A 3VYUB 1SKMA 1J0EA 2VR1A 3M4JA 2RGCA 4HQRA 4RNCA 2QLBA 1EH5A 2ZU0C 3VR0A 3F67A 2UYOA 4M9RA 1R37A 3HL0A 2XZLA 5KC9A 4JL6A 1T0BA 5BURA 3L01A 1JIQA 3WADA 3AR9A 2ZZKA 3TTTA 3BULA 3AEZA 4BGEA 2B21A 3M9LA 4M1EA 2BMDA 4TRJA 1GSIA 4JL8A 2VP9A 4PZPA 2ZS7A 1MQAA 3MVEA 4QEKA 4BP1A 2YZ7A 3MNFA 3PKZA 5ALMA 1U0OC 1T9GS 4L02A 1CQPA 2HIMA 3PD7A 1HDRA 4QNNA 2GGSA 2CLMB 2ECFA 1S4QA 3NORA 1R7RA 1Q5PA 4YAEA 1P6UA 3MXTA 2WTNA 2HY7A 2P6OA 5JVDB 4CGYA 4Z5XA 3CVJA 1IWBB 3OZIA 4BYGA 2BLNA 3R5TA 2WA1A 1LSUA 1UBSB 2YNMA 2N0SA 1O5OA 2I8CA 4KMRA 4NMMA 3IEMA 2GILA 1LH0A 5LBIA 4IOKA 2Q4TA 2H2HA 1ZGAA 1ACLA 2OHJA 1NNLA 5KSYA 4C76A 3CU5A 1CHDA 3B9RA 1YIDA 3DQQA 1A8QA 3F6SA 5AVOA 5GM1A 1KDZA 4OCZA 5ED4A 3RS0A 3D6FA 1WNFA 3EXG2 3TFOA 2YQ5A 3S7TA 1PV4A 3OX3A 3NM4A 1U80A 2NO9A 3QPBA 5IK2A 3H5OA 4X8OA 1VL1A 2JIZA 4MCJA 1ISGA 2LP4Y 3H0EA 1QLHA 2FMIA 1UKYA 1TE2A 2OG2A 3SHQA 1CIPA 1SO8A 3WOHA 1E7YA 1LDGA 4EQ6A 1WXIA 1ZUHA 2TMDA 2XCLA 4JEHA 1XPUA 1ZR4A 3IIKA 4QOEA 1JEYB 1FS5A 1OXVA 2R6ZA 4EHIA 3NKLA 5LA6F 4EB6B 1JMKC 3G02A 3IVMA 1BC5A 4F1KA 2TMKA 3PLNA 3ICOA 1AQIA 3B6ZA 4ID9A 1TJ3A 2OEPA 4LZZA 4N6GA 1VSVA 1WXFA 1HY3A 3OEWA 2HA7A 2VNHA 2C3PA 3PFCA 3Q85A 1NLFA 3DVLA 4BFVA 2WY2D 3RVQA 1EPUA 5C32A 5JG7A 1Q6ZA 1T8RA 1U2ZA 3AB7A 3INTA 1JG7A 2XT9A 1F1JA 3OJXA 3FUCA 2CL5A 1NHGA 3PNQA 1AZTA 3VI3B 2WICA 1PJTA 3A36A 3QOWA 1P3DA 1TF5A 5LMUB 1RWOA 1Q3KA 1EDDA 4ODIA 2EAUA 2NTJA 1ZMBA 4LBYA 4RZSA 2I29A 3T1VA 2BYTA 1XDGA 3OG9A 3PNPA 2FSFA 4QO8A 2GPAA 1O97C 1TA0A 2WJGA 4I1PA 1W47A 1XG5A 4G07A 2G82A 1EFTA 1XCBA 5D86A 5LOVA 2PANA 3UAOA 2C9BA 4MLZA 4XM0A 2I87A 1E98A 1TT5B 1WEHA 2IX9A 1KC3A 4QXRA 3M8KA 4RFSA 3IOMA 4XTCS 2AKAB 4Y6RA 4P3XA 2VZ8A 4LZPA 2GM5A 4TYQA 4HXGA 4MYTA 4IVRA 5D2CA 5JFOA 4U7TB 4BKRA 1DXOA 4KXVA 4X7BA 5C81A 4IFBA 3VJRA 4JYBA 4WOPA 1N33B 1ZNXA 3CNLA 3HQ4O 3QHQA 4A8JA 5IJ9B 3F5MA 2IZ7A 1TVEA 2WZDA 1SVUA 4GE0A 2I9PA 4M49A 4O1IA 1PW5A 4S1NA 1M72A 2F3UA 3NRJA 2AS0A 3R44A 2G67A 2R48A 3G0OA 4ZHQB 1K63A 1WBDA 1GGMA 1R6UA 3GWGA 3WGUA 5CFZA 2NMVA 3F4BA 2BGRA 4KQFA 5D87A 2VHTA 2C95A 4QUHA 2JC3A 5TJHA 1RJEA 1I3CA 3ZW8A 4BNLA 5CK5A 4AJNA 1LX7A 3DMNA 5A71A 3COJA 1T0IA 121PA 1Z0ZA 5HZKA 1W4AA 2P41A 3A05A 3G68A 3RDPA 4ALMA 3JCZA 1OYVA 4XLZA 1WDLA 2ENWA 2H4WA 3CNNA 3ETEA 3PWTA 5DM0A 3A3OA 1Y81A 1TEZA 4QRDA 2DPXA 5IC6A 1JB9A 1SXJC 5J58A 1L7QA 1L7MA 4BE4A 4C78A 3PUKA 5BW4A 4J94A 2WE8A 2D13A 1TYAE 3SICE 2XUIA 3QLEA 1SMKA 1HUQA 3BFPA 1DUSA 4H1TA 3OE7D 1NZFA 2W6CX 2AXEA 4EHNA 1VBKA 3EA4A 1YHYA 3KALA 4KPUB 5J23A 3QKSA 3BRQA 3E22A 4URHA 1YUMA 1X7ZA 3GBVA 1JVBA 2ADOA 1AE1A 3GP5A 2FQWA 2HNKA 4MPTA 3A25A 4XEUA 1JDBB 2DG2A 2P2CA 3JQ8A 4RV4A 2F55A 4EA9A 3GLIB 3N2GA 2AC2A 1PT9A 1UOQA 2PKWA 2Q4OA 4A8PA 1WMEA 1TNDA 4RSHA 4ZO8A 4HNSA 1LI5A 1X15A 5IH7A 2QT1A 3PIDA 2OZLB 3FYHA 3CIOA 3N2NA 5BR7A 1TK3A 1HL3A 3QVOA 5T5QA 1RAFA 1W581 2FPGA 1V6AA 1G21B 1HYHA 5G2OA 4TN1A 3TIIA 3AF3A 4IXDA 2H8KA 4ARAA 4ZDKA 3H84A 5D85A 1T2CA 2PO7A 1W4LA 4GGOA 1RXWA 3K9LA 1VBNA 4J2OA 1Q0ZA 3J7AC 2AI1A 3L0YA 4EH1A 1S3FA 4HDSA 3FWYA 3BXOA 1ZGGA 2DWUA 1AKWA 4M37A 5I4CA 4W4TA 5CU7A 3SSOA 1H8ED 1QRSA 1PP4A 4IIGA 3KFVA 3E5RA 2ZAIA 1PT8A 2W6ID 1OGJA 3R5JA 5DBGA 1U7HA 1QVAA 4CLRB 1Y63A 3IJPA 3LNCA 5IUKC 4GZ3A 3D7SA 3FYUC 1QE0A 5AVZA 4GXTA 1B3BA 4CI9A 1GZ7A 3CINA 3R74A 1WKCA 2GSWA 4D8TA 1EWTA 3GD5A 1BAPA 1JG2A 4K9PA 4MZDA 1CPYA 2O2JA 3OD5A 5ICGA 1EP1B 2KX7A 3GLUA 4OL9A 3R0JA 4IDBA 4O02B 3M4NA 2GFHA 1E58A 3SJCA 5KTTA 1T3ZA 4QDUA 4XW2A 1K4MA 2PWPA 4YRBA 4PE5B 4CF6A 4ZYTA 5AXDA 1H0RA 4BKMA 1OLOA 3OLXA 4D5GA 1N6KA 4LJKA 1PZGA 3PICA 2PQMA 4F85A 1KR2A 2NP6A 3QEJA 4CTMA 2QNRA 2ZUBA 3I0ZA 4Q48A 2VPQA 1BNCA 4ZCIA 1VP3A 4G5YA 2C77A 3C3XA 3G8AA 1U94A 1Z6QA 4IJMA 3HVRA 3C24A 2NU8B 3IEUA 2TYSB 4I55B 1WSDA 1FMLA 3NRBA 4Q1DA 3LKDA 3HTXA 4IIUA 2VBCA 2AI3A 5CIYA 1SKYB 1VRCA 3I05A 5TSDA 4GBED 2VDVE 4IDHA 2ID8A 1QYXA 1ULHA 3U44A 1RDFA 2NU7A 1I1QB 3AFMA 3CUSA 4C0SA 1HT3A 2Z3ZA 3F98A 2UUBB 2ICAA 5LM3A 5K0EA 4LG1A 2PPLA 1D2RA 4G5FA 1HETA 1NY6A 1XA4A 3ITDA 1JI3A 4NOLA 1JN0A 1QYDA 5AJWA 1Z5UA 3T4EA 4AJJA 3QEOA 4PIMA 5COBA 4UTRA 2D1SA 4MX8A 1CZUA 4CKCB 4C7OB 3DD5A 4CCSA 1Q3TA 4PBRA 3HN2A 4NMHA 1UBEA 4QHSA 1FCJA 4J1TA 4DSAA 4TV9F 2D8MA 2RCYA 1DUVG 3IS3A 1C3OA 2ZB3A 3GX1A 3U31A 3VU3A 4ZOBA 1JLSA 2JDIA 3VGPA 2AOTB 2NUPA 1JLHA 2WMDA 3H6GA 3IJ5A 3M5CA 1A7AA 4NH0A 4Y2VA 2F2TA 2QEQA 1ZVJA 3E1KA 3SIPA 1A96A 4YAKA 4LZOA 4M1WA 4ZYYA 5TGTA 2E4UA 3E1SA 3C85A 1G8HA 1BRTA 1NPYA 2H6EA 2XDWA 4IIEA 3RTGA 3HYTA 3SMQA 3KQYA 4GMFA 2AFRA 2D4AA 3O93A 3QX7A 1Z5PA 3ZR4B 3RABA 1F5SA 3ZCXA 2Z4SA 1VIMA 1NQXA 1UCFA 1KRHA 1UDAA 2IU3A 2I8LA 4RMHA 2BE9A 2GPJA 3UAXA 5EZSA 3SZMA 1RYYA 4GMKA 1TQDA 2I7TA 2XKJE 3L7NA 2DJIA 3BB3A 1JXMA 4RV9A 3U3ZA 1U5BA 1SBCA 1R6BX 1MBZA 4EMSA 1M0WA 3B38A 2YFQA 3FR7A 1L4UA 4RKYA 3IKMB 3KX2A 1NJ2A 4JJKA 4CQMB 2CLKB 5DHFA 3UG7A 1GSHA 4AL4A 1XKTA 3F46A 2OILA 3VPAA 4D9JA 1NXWA 3DNPA 3CRZA 1ZD4A 2GEJA 4GPAA 1YJQA 2IXBA 4UCXA 5ADHA 5BUCA 3UAWA 3W2IA 1R50A 3ETGA 4Z4QA 2X0KA 4GOND 1W2HA 3LY5A 3M89A 1HO3A 3DHEA 4XQGA 3ZDFA 3ER6A 3RBAA 2IK8A 3ANTA 3EZNA 5C8ZA 2XD9A 1W1IA 3U4HA 2X1HA 3LQRA 5DTJA 2GBLA 1E2JA 3QWHA 4DCGA 2P9YA 3CXUA 1JQKA 2VWHA 4JJGA 3KOXA 3W7BA 4AWAA 1CUJA 4DWWA 3C0KA 3RJ9A 2NU6B 4MVJE 5T4EA 3KV1A 2WC1A 3RNOA 1WY5A 3BWXA 1LBTA 4HAOA 2IP1A 2OBXA 1UK7A 4HNAA 2HU7A 4N7MA 1SWVA 3ZV7A 4KCGA 4AZVA 3VU0A 1ZMRA 1S2GA 2FRVA 4LKOA 4Q3KA 3UTDA 4OKNA 5E1DA 4M1TA 5KPDA 2BEUB 2JLAA 4UUNA 4FHDA 1WHSA 5AUPB 4EEZA 1WCYA 5BV7A 4MRMA 1N6PA 1JQAA 4F9EA 4KVZA 1QCCA 4F97A 5JPDA 4PGHA 3HCPA 5F1YA 4N48A 4DV0B 2PZAA 3MA0A 3AEKA 4P4LA 2AG5A 1OX5A 2C8JA 3L1IA 1N2HA 1UT8A 4AP6A 5BXYA 1P5JA 4W8GA 1L5ZA 3PL5A 2CVQA 2GYYA 2Q2NA 1A5SB 4CF5A 1S6YA 5DCLA 1DUIA 4BAUA 5JAHA 1GO2A 1S8NA 1UR5A 2YWXA 3DP9A 3S68A 2JKZA 3M3HA 1RXVA 5IDWA 3R0VA 4IGAA 2DKFA 1HSOA 2F64A 2J6HA 2P2YA 3T38A 1VL0A 3TEMA 4DREA 1K0FA 4QT0A 1A82A 1XAJA 4KTVE 2EKBA 2FX3A 4RF5A 1EB8A 1Y4AE 1Z6TA 3BHMA 3H83A 3GRCA 1ULBA 2HDOA 3HLTA 3OLQA 3UUEA 2AE2A 1ODIA 2YQ4A 5DGIA 4QWMA 3PQEA 3TVYA 1F3LA 4R1MA 1R5OA 1F7UA 5G0TA 2WJIA 3C70A 3T7KA 5LQNA 1XDWA 1DKQA 1KGSA 1AS3A 1KIMA 5DGDA 2P90A 1A2OA 4Z4CA 3OOYA 4ID3A 2H17A 1ZZEA 4PRYA 2AQKA 5EMHA 4GI2A 2Z95A 2WVHA 4ZOLA 2BTOA 5KQMA 2ZQ5A 1K75A 3QPAA 2DUUA 3I1YA 3G13A 1N1EA 3HBAA 1J0BA 1O2DA 2A9VA 2CNKA 4MRNA 1I7LA 4O25A 4XJTA 4YVFA 1NRXA 2FEAA 3NGXA 3KKKA 2QSUA 3JTEA 2DULA 3PHLA 3HXMA 2EFYA 3PDUA 1Z6XA 2B94A 4WESA 1YVPA 5BVHB 4R8RA 4ZPJA 2BELA 2MYTA 2V55B 2I34A 5KVVA 1K7XB 3ETLA 4DLYA 4KE9A 4M0FA 4P82A 3IHKA 3LX4A 3QVGB 4MPJA 4OU5A 2QRZA 2RI0A 2COUA 3OQBA 3QSYA 1SZPA 3P19A 3TAUA 2PIAA 4J7XA 3LFHA 3CW2A 1GSOA 4C7KA 3O8NA 3UT5B 2EP7A 3WHKA 4KXYA 4AAYA 1HQCA 1MV5A 4DEYA 1ZITA 1OKKD 1ISMA 3ICCA 1VPWA 4E13A 1COZA 3EXFA 3S40A 2RGNC 3EXHC 4US0R 2LCQA 3C3DA 4MHSA 4E6PA 3DQPA 1JR3A 3OPYI 5BSFA 3HXTA 1ZJYA 2FP3A 4BMYA 3NGLA 2D7DA 4PZLA 1IMOA 1UPTA 2AEEA 1J5XA 4OHUA 4Q4AA 3TVDA 4HB2A 1JJFA 3HFGA 5CG2A 3PFNA 4O2BB 4JAVC 3SHTA 5G3YA 4QXPA 3NO4A 4RXMA 1MJNA 2CCKA 3DULA 3V7UA 2Z1MA 3UJHA 1KFKB 2G71A 4X6YA 1CUWA 4HQFA 3UH1A 1HZZC 3JQCA 4X1IA 4DMKA 4Q3NA 3RSFA 1SBTA 4W1RA 4EFLA 4NIMA 3NHFA 5GONA 2WIJA 2EZ8A 1WJGA 4MVYA 4QUJA 2FRXA 2VSYA 2YC4C 3UOAB 4D9NA 4YA6A 4G97A 4U2FA 5FWXA 3ZDEA 2QLMA 3FLEA 5IJWA 4O4IF 4YJ3A 3TMYA 3A3KA 3I5AA 4FZVA 4BEVA 5KQPA 2VJYA 1C7RA 2VF7A 5BUZA 5FPPA 3PVSA 3U6BA 3F90A 3G8YA 3QLUA 3ZQJA 4GFDA 4Q1CA 4W82A 3PNKA 2D0DA 5B7NA 4RORA 1WD5A 3ZBPA 2YY6A 2AR0A 4YECA 5CFRA 4D9EA 1WF3A 1RE1A 2EX0A 5IT0A 2HKIA 3KEMA 3GGGA 3OIWA 2GM4A 1JIJA 1F8XA 2H31A 1XVLA 1OUMA 3E48A 3RJ5A 5YASA 3UYKA 5CVTA 4JD5A 1T8PA 5L9AA 2Y4OA 3U16A 1V9CA 1F2TA 3F7TA 4ND7A 1VLLA 1MOSA 1QUFA 5I8WA 2UZ1B 5EIXA 2NVWA 5BOVA 2HREA 2IOFK 4V1CI 4DVGA 2GUWA 1ML3A 1H1LA 3Q9UA 2XCSB 1AD2A 4HT3B 2VHZA 4M36A 2GS9A 1CUBA 3ML1A 1Z2EA 1J7JA 1KNXA 3EJWA 5U9CA 3WAJA 4YJ2F 2C2OA 3WTBA 1MD9A 1AJEA 1TAHA 2G83A 4O4LF 4RA6B 4WUVA 4K9SA 4PHGA 3N7UA 4A91A 4BNHA 2NZUG 3T7TA 2JJMA 5C35A 3FPHA 5DRTA 2ZCVA 3H87A 3UWDA 2I2DA 3HKCA 4ISCA 4ZT2A 5F7XA 3MYRA 1KU0A 3M81A 1ONBA 2Y1LA 4LNAA 2KPOA 1YMQA 5LBUA 1L5RA 2J87A 4LCBA 2WU1A 5F5LA 2Z8YM 4QYSA 4EZEA 2GK7A 5FPQA 5LQMA 4OHMA 5DHAA 1JH9A 3H5TA 1BCRB 3EGOA 1YQGA 2XLBA 1Y0BA 1LDNA 3EASA 3EWNA 1XXHA 2I4TA 3EQ2A 1GZDA 3AF4A 5FBVB 2A8YA 3ZE2B 5LKRA 3AV3A 3Q12A 5K8IA 4XJXA 2IJGX 3IA2A 5GJCA 5K3BA 1RCUA 3C3CA 1WXEA 2F1OA 4AX8A 1P0MA 1Y4SA 5T7BA 3DEAA 2J5QA 2BFDB 1RIIA 1J9EA 1IEXA 2AEJA 3EA0A 2NZYA 1IZYA 4PCVA 4LNUB 1C81A 1DOHA 3FVTA 3K6JA 3WY9A 1DO2A 1FTGA 4HDOB 1Q0SA 3JY6A 4K81B 4DZRA 2IPOA 5TVGA 4PLHA 4ENQA 1GNRA 2GD1O 1JE1A 1GRCA 1PUXA 2C2WA 4J9VA 3URMA 3LIIA 5TMEA 4X84A 3CG0A 3AUYA 2NO7A 2JL1A 3O84A 1MZVA 3HHPA 1QG4A 4E5UA 1S8OA 3HM9A 3SE0A 1KZ7B 4EIWA 1TQHA 3GXBA 1FE8A 1PX2A 2R96A 4B74A 1EFLA 4GPD1 1HH4A 1WVMA 1CP2A 4FKBA 5KYUB 1SUAA 2HPVA 4FFOA 1JZQA 3VNSA 3AY0A 4HRVA 2O8CB 4DDHA 3TRFA 4E4RA 3M9WA 2EFHB 1NAIA 4X7MA 5CFPA 2PZFA 1G3UA 1R3UA 1THMA 2HF7A 3BMOA 3ONNA 2JFVA 4IXNA 1LJLA 2HWYA 3L7KA 2BJWA 1DWOA 1PG5A 1U2SA 4QG7A 3LY9A 4Z1MD 2Z83A 4KGDA 4AF6A 3ZGVA 5AM1A 5TARA 4BTLA 4DNXA 4KHPB 3B5IA 3FWHA 1NC3A 5FNVA 4JA2A 4C0QC 3AO0B 3LSYA 4OA5A 1A71A 5B3AA 2I78A 2W6PA 5HIJA 3Q88A 2MMGA 4AJHA 4YJFA 2QVBA 1SD5A 5DDIP 2J09A 4IP0A 1HR0B 2GN9A 5E0KB 2PLAA 1FL9A 3O73A 3WK8A 5F64A 3UK1A 5L7YA 5T67A 3S8EA 4JVSB 4IKEA 4ESHA 4GAEA 2LV8A 3L8CA 3VV2A 2ZWIA 2XWPA 3KZCA 5J43A 2FUNB 4DDWA 4Y67A 4DCCA 1XMJA 4G41A 2G7MC 2A1UB 1UZNA 1VG9B 2EFCB 1G17A 3OTHA 1UP4A 2ZSIA 4UFNA 3UK2A 4EUFA 4EY4A 3NWJA 4YAIA 2C8VA 5JAUA 1U8EA 4JJ8A 1JDBC 3RSZA 2OOKA 3EISA 1TM7E 1UDRA 2IE0A 1BXKA 4ESOA 4DV1B 4ICIA 3AKYA 4F3KA 1P62B 2IXTA 1FK8A 5CGZA 3RF7A 4EQ6B 1ZHHA 2CK3D 4FQ8A 2MT9A 5IJAA 2XOKD 3WLIA 1W5FA 1OZHA 5F3RA 2ZUCA 1FU8A 3I9JA 1E1CA 3LO8A 4XARA 4YUVA 4DTIA 3PK0A 5TEVA 1QBGA 4IMJB 4X45A 1YB1A 2X5OA 3H5IA 5AK6A 4WKPA 3W3ZB 3Q8WA 4D81A 1PL0A 5ITWA 1CP3A 1ISIA 1LUAA 3ABQB 5THXA 1Y7LA 1U04A 3N59A 4KAAA 1N3BA 4O63O 3LWBA 4V0OA 2Q1UA 3OZBA 4IR7A 3C4QA 1Z7GA 1Q3HA 3GD7A 1N9GA 4OYYA 1YJXA 2MSWA 2XZPA 1Y8AA 3LW7A 4P54A 3PDIB 5DX1A 5BR8B 2G1JA 3I5YA 4UOQA 2CKDA 2FPIB 1YR9A 4OUDB 4RX1A 3RUEA 3CVUA 1E3LA 1PGJA 1BMDA 1FFBA 2HRRA 4JBYA 2O52A 4DC0A 2B3DA 1U6KA 4XIFA 4LJ4A 3V4RA 2ODWA 4IOLA 3A7EA 4EI7A 1OU0A 5KSOA 5LOVB 3A1WA 3UGQA 1I4WA 3EX7C 4MO2A 5IJ9A 2DWQA 2A5LA 2Y0CA 1Y6RA 1QTQA 4R2JA 5EEGA 2LWIA 8ABPA 5I7AA 3V4SA 3H1EA 1VB3A 5IFKA 1Q7CA 2A9FA 2JGJA 3FVQA 4B40A 4MVJI 2C0CA 2FR8A 2EL7A 1X87A 3FCCA 3DLTA 4WNIA 5GIOE 3NT4A 1POXA 2XBUA 2AV6A 2GWHA 2PFGA 4HN4B 1MAAA 4J03A 4JX9A 3WNCA 4A8JB 1OH7A 3GFVA 2ZDQA 4P38A 1CTQA 1P4JA 1E7WA 2EKPA 3T5DA 4EBFA 1QF9A 2XEDA 1EQAA 2VA8A 4RKQA 4CHGA 1DC4A 4BJ1A 3H97A 2HBQA 2XRYA 1LNZA 4JR0A 1DAPA 2PBFA 5CYPA 3HCCA 4Z86A 3Q8MA 4NYJR 1TECE 1BKDR 4CM9D 4OY3A 3CWCA 3GLTA 3SIXA 3IUSA 3HB4X 5CM2Z 1YACA 3HDQA 2VYNA 2P5UA 5BN5A 1Y1LA 1N3YA 2EZTA 2V6BA 3ASZA 4JUCA 5AI5A 5EKDA 3SS9X 5DNYB 1EFAA 1Y4DE 5KOYA 3D5EA 1DJMA 4PW0A 3W5BA 1YCGA 4YJDA 3R3UA 5FBRB 1V47A 2C92A 1YB2A 4P34A 5CTJA 3CG4A 2C88A 3T5CA 3VU1A 1IY1A 3PQFA 2XNHA 4I4TF 3P2KA 4H4DA 1E9AA 4XGQA 2Y1WA 3ZEAA 4UM9B 5IF9A 1YZVA 2GEUA 3I28A 3QKSB 1FRFS 4XVQA 1X7ZB 1BQ4A 2Y1KA 3TZ6A 1AMNA 4MS4B 1HT2E 1T1JA 2W4QA 1WX1A 4PZUA 3LUDA 3RS4A 3VH3A 3ABIA 3JQ8B 4RC9A 1GVHA 1TL7C 3F7NA 1XLTC 3N2GB 2ZJYA 4JEIA 2IL1A 4RU1A 1H0SA 3AINA 4K1XA 2GCNA 3B8HA 4JCCA 3QLVC 1MEOA 5DN6A 4DIUA 3OMWA 2ZTSA 2EFJA 2Q4RA 4AKTA 3C98A 5EJ2A 4IG4A 2FPGB 3AB8A 4MYDA 4WPGA 1N57A 3MZ0A 1ATIA 3DPSA 3HB5X 2WUFA 3KT8A 3V9PA 5BUSA 4PSAA 4W8HA 2VH5R 1P5RA 2FUG6 1W30A 3LWZA 4NWIA 3IR7A 4FCTA 5FOUA 5IN5A 4BDTA 3QPUA 1DIOB 2HMVA 3GDGA 2D1RA 4Q4HA 4EO9A 5KTRA 2G5TA 1UPUA 2NO6A 1HKUA 4KQIA 3V6MA 1DJPA 1KWKA 5C2JB 4BL5A 1T6YA 3ORSA 4QELA 1KDRA 5A3VA 3G49A 4O33A 1O4VA 4BYMA 1ZPDA 3T12A 1BW9A 1DPFA 3TX2A 3FFAA 3W6PA 1JTVA 3EPLA 3HPQA 4IDFA 3ZCTA 5J2UA 3GBPA 3E2IA 3RS8A 4JASB 3KWMA 4NV0A 1RBZA 3QEMA 3K96A 1RS0A 3M6IA 4QOGA 4LZWA 4HR7A 2GI4A 2IHJA 4HQKA 4UDXX 5KTNA 1D8TA 4L4RA 4D1YA 1Y89A 3GH3A 2OO5A 2EJCA 4FGJA 2TS1A 4TLAA 4MPPA 3IE0A 3VPCA 3VPHA 2GKOA 4CKZA 1UBHS 1BX0A 3PKJA 2PUVA 3U9SA 2Z6AA 3GR6A 3QSGA 4TZ6A 2W7TA 3MPOA 3G88A 1J2EA 2VDPB 1JWAB 5ALDA 5FHRA 5FL3A 1R64A 2WHPA 3LVQE 4GXRA 2G08A 1NOIA 5KYVA 3FKSD 2I4NA 5CB4B 4U4AA 2YVUA 1RQLA 4RY8A 2KMLA 3HNRA 4UTNA 1N9KA 4GRDA 3S4YA 1G0NA 2CXNA 3PPIA 3B3AA 4KQEA 3U2QA 1WZEA 5LQSA 3L41A 3RT9A 1SN7A 3O1JC 1AQUA 1AF7A 2BD0A 3VZPA 4G0NA 3CZPA 4XRRA 1I4DD 3FPJA 2ZB8A 1USWA 5EI5A 3BL5A 5BQ3A 1YBHA 3RFXA 5KHAA 3DDOA 3ZQKA 3U44B 4KQ6A 4TXMA 4LTNA 2NU7B 4PF1A 3OIYA 1WUIS 4B5LA 2CY0A 4O2AF 3U3KA 5JYEA 3OQOA 4DLWA 3RG8A 1RJDA 1GJRA 2VP3A 2DSNA 3IURA 5KZMB 4S24A 1RWQA 1SIOA 2M2IA 1D4OA 3KUUA 4LY3A 4QXMA 5F51A 1D09A 3D7MA 2JLZA 1I7PA 3VPGA 1P18A 5LUBA 3T99A 1RRPA 1KYZA 2YYAA 3FUXA 1SZDA 1TCUA 3CLUD 1W4BA 3CLSD 3MB8A 4JBLA 5P8WA 3R6GA 2KLHA 4DM4A 2QPOA 5LCXA 1JGTA 4GC5A 4IDPA 3EVNA 1WUYA 3I72A 3ON5A 2ZJ7A 5G02A 3H4MA 5E3IA 3ACDA 3TB4A 1QIGA 3B89A 4JLSA 4R51A 2O0HA 2ZIXA 4EB0A 2E4VA 4XH9B 2DTDA 5JQGA 3RC2A 3VR4D 1NBAA 1XZIA 4UPVA 5HWSA 2DUWA 3WJ7A 2C8KA 3THXA 3GDFA 3TXAA 4X54A 4CMEC 1QHEA 1Q95A 1OVMA 1OZFA 4K3UA 1J21A 3KLMX 4JI5B 1QWOA 1EB9A 3BFXA 2BFCA 1DKMA 3KWLA 1PD1A 4GR5A 3V3TA 2VHYA 3OEED 1KFCB 1TJYA 1CQIB 1YWGO 2L0XA 4IDCA 2P30A 2FN9A 1A7KA 2VSOA 4HGYA 2Q9BA 5JI2E 3D81A 5AKZA 1JNYA 5ALTA 5GVSA 4V0LA 4C03A 2BGJA 3HDGA 4WN9B 3TGPA 3RFUA 2Q3LA 4PRZA 5EEHA 3QJ5A 2A92A 3LQQA 5SZJA 3AUUA 4QECA 2FDCA 2X8BA 1LNQA 4FN5A 1MPXA 1E8DA 4QFMA 3HN6A 2V9CA 4FD2A 3DS8A 1BOFA 1I80A 2JIDA 3A6GA 3WLHA 3ZVMA 1Z4KA 1JG6A 1U9IC 1TVCA 2LUOA 1OYYA 3H13A 5K8LA 5A3QA 2PX5A 3QP9A 1IM2A 1DG1G 1JHZA 2IYAA 2O50A 1J2TA 1J99A 2ZJ5A 4W9NA 1E3EA 2B2CA 1NW3A 3R7FA 2ZZMA 1Q0UA 4OQMA 1KI2A 1XTVA 5L53A 4R2WA 4GYWA 1RKXA 2C5LA 1JQLB 1YBAA 3DPUA 3LI2A 3PUZA 4PSVA 3Q3IA 1FXWA 3N6RA 4BLUA 4TLCA 3P9YA 4JQCA 3WBJA 2WIAA 1IHOA 4JXXA 3OT1A 2Q5CA 2W2XA 4A0QA 3G2MA 1WB6A 1T1GA 4Q93A 1Q7GA 4P36A 4MLCA 3RVBA 1JU4A 2EARA 3A0UA 3NHJA 5E6SA 5FCDA 1DAGA 5T4BA 4WERA 3DTVB 2PAFA 3JATA 1P9RA 1G8JA 3WL3A 1AUVA 4PYMA 2F3RA 3IT1A 1O0BA 1IM5A 1EGQA 2NAFA 3D43A 4KXUA 2JRCA 4ZVSA 1H9BA 2PX6A 2DFVA 4X1KA 3EC7A 3GFFA 2Q1TA 3SJ7A 1MDBA 1RXUA 2AG0A 2CWDA 3U3XA 3WGVA 1Y9EA 5JECA 2VNAA 1J70A 3C6ZA 4IJWA 3ZZ0A 4AUMA 3MJEA 1OB5A 4HJRA 1A8UA 4YFVA 4M1ZA 2UYHA 2QP9X 3B48A 4HH3C 5JS8A 3P45A 5TV2A 4LHXA 3KE9A 3A9VA 1CDZA 3AUKA 1EA7A 3TJMA 1N3IA 2D2XA 3K0AB 4Q9LA 4PZ0A 5KHLB 4HYTA 2B9VA 2OORA 4ECEA 4AX4A 5CVDA 3A9CA 3BGDA 4TPKA 1NNI1 1V6CA 3PXUA 3QX9A 2GVZC 5M34A 5TGDA 1GTG1 2WFZA 1W46A 3OQHA 4L0MA 4R0MA 3QU5A 3E81A 4A6PA 4IIFA 3KHTA 5A6SA 4QBFA 1O7JA 1XYVA 4YWJA 2Z43A 3WSVA 1QO0A 3FNFA 2UXBB 1Q1EA 4HAXA 4NZ9A 2J48A 5AD1A 3MCTA 1X77A 2HEGA 2XF2A 3HCEA 2QR5A 4W6ZA 1F8FA 3W8FA 4LX8A 4CMGA 1DC8A 2GT1A 4JLOA 2G28A 1Z0SA 1TPZA 2P65A 4AN4A 4MKFA 4CG3A 4QRHA 2CDBA 4ZOLB 4HWTA 4RIGA 5AOVA 2JFXA 1KU6A 1X7WA 4X9XA 4P0QB 5KQGA 1XJCA 4FU0A 1KAOA 2LD4A 4R8KA 5BSMA 2VF2A 1KI8A 2ZG6A 5FPHA 4ALLA 4EWLA 4NU0A 4J7UA 5FOTA 4ENRA 1C41A 3VMMA 3K0HA 4IDNA 4WESB 3BGOS 2XVAA 4FZJA 1KVSA 1M8JA 2BKEA 1MP0A 1NTRA 2ZWVA 2XECA 5DFAA 3H4VA 1FDWA 3HXKA 3MELA 4DCJA 2HQRA 1CUDA 3F47A 3FJ1A 5AJVB 3EULA 3TCXB 1H8HD 3CH6A 1KP2A 1NMQA 1UWKA 3BWDD 5DYNA 4RABA 1EBBA 1MZPA 5CTAA 3G5TA 5REQA 4A9AA 3CKLA 4LF4B 4V2IA 5CPBA 2GZSA 4HNRA 1LGYA 3EXFB 1ZI9A 5KIAA 3KAKA 1ZCBA 1CJBA 3BA6A 2QP3A 1FY2A 1SOVA 4QGSA 4J0EA 2R87A 2CN1A 3CSUA 2AUNA 1ZS9A 3P4UA 4X93A 4B6JA 5IJ0A 1G7TA 3CPSA 3OFND 4FOTA 4DV4B 2CT8A 2WVGA 2WJZB 1MFPA 2WP0A 1FVFA 1K2WA 3K0EA 2BKLA 3KWJA 3NTUA 4Q4AB 3UICA 4BWGA 3BD9A 1C9MA 3OKCA 3TI7A 4KAFA 5K2OA 2B3TA 3NWPA 2CC2A 2FEWB 3X1WA 3CJQA 4NF2A 5ERGB 4WOCA 1CZNA 1ESEA 1VA5A 3D8TA 2KSQA 2QRGA 1VI6A 3AK4A 1U3VA 3IRVA 4ZYZA 1VCMA 3IT2A 5MN6A 1USUA 1ZWKA 3M6LA 5GONB 1C2YA 2WSLA 4TSKA 3KQQA 2WYOA 1TC1A 3MPUA 3OE7A 4AW9A 1C1YA 2Q5QA 5FWXB 2OXCA 4PS1A 4DY4A 2HHCA 3C7CB 3IDFA 3OT4A 1E8NA 2JGRA 4YJ3B 1E9FA 3BHJA 4UHBA 3TQIA 4JGIA 1TM1E 3BZWA 3IB6A 3X1MA 2DHCA 5JR3A 4LKRA 3NOVA 3DPIA 3TBKA 1L7VC 5ARBA 1JIUA 3MBIA 2QTMA 2Q8PA 4RM2A 3D3EA 3OC0A 4IGKA 2R65A 3IEIA 2NVOA 5AW9A 1W9MA 3FOAA 3T94A 4OXNA 3RTBA 2HPZA 2N9UA 1U8YA 2YNMC 2XQGA 3JWIA 2R6R1 3Q3GE 1YZ3A 4UTVA 2BKUA 3DVAA 3GEEA 2FOXA 4LDZA 5A5EA 1H2WA 3ZZUA 1F2TB 3X3HA 4EG8A 2FX2A 2IYFA 4NS4A 1HV8A 3KT3A 1QVVA 3PL1A 1QK3A 2XX3A 3DZHA 4FYVA 1T9GR 2ORED 4KMMA 3MJSA 5JMOA 2CVFA 3LRTA 5LMCA 2BRUA 2IHUA 2P9FA 1JU9A 4ZT7A 5JBNA 4OGGA 5A0FA 4N5HX 3QKTA 1M10A 3GJTA