1JAIA

H-ras p21 protein mutant g12p, complexed with guanosine-5'-[beta,gamma-methylene] triphosphate and manganese
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAPGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of the metal ion in the p21ras catalysed GTP-hydrolysis: Mn2+ versus Mg2+.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp-binding
molecule keywords C-HA-RAS
total genus 63
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1996-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1jaiA00
3U3RA 4KVGA 5AJXA 1E2KA 2J46A 4KFSA 1R0WA 4HB2A 4BUJA 3KQUA 3SQXA 2PEZA 5FI0B 5FBWB 4KLZA 2DB3A 3NG1A 1N6HA 4CW7A 1XMSA 2HCBA 1E0SA 1KI9A 4PX9A 1KK2A 3A1WA 5F3WB 3EIEA 1ODFA 4AKIA 1QDEA 2BBOA 2JASA 4Q1EA 2KB0A 3M1IA 3OESA 3EA5A 2GK7A 3THYB 4YLGA 3TH5A 1X8KA 2R6CA 1YZKA 4HDOB 1VECA 5DN6D 3WP0A 1GITA 1Q44A 4V02A 1E2QA 3RVBA 4M9SA 2JLZA 4OI1A 1L4YA 2A5JA 3LLMA 4OI2A 1XEXB 4CEJA 1CF4A 1ZD8A 2YOGA 1XMJA 2PEYA 4TMXA 1RYFA 5AUOB 4FCVA 2KJQA 1SKYE 3HWSA 3H0KA 4LSGA 4Q03A 5CB8A 2AFHE 1P2SA 2WJYA 2YINC 1G17A 3UG7A 2OESA 3AF3A 3NIBA 3GJ3A 1FTSA 1OH7A 1CR4A 2QE7D 2ODEA 3T5DA 1TF5A 1GRNA 2IS2A 1PLLA 5LBIA 5ELXA 1DS6A 2VLIA 3GCGA 4RZUA 4YDSA 1DTSA 4A15A 3FVQA 2HF8A 2ZSFA 3HU2A 2FEMA 3T61A 4EFLA 3AUXA 1NVUQ 2GVZC 4EPVA 3B78A 4JLBA 2GZDA 4OQMA 1KAOA 5DE3A 2CLSA 4EFMA 1CU1A 2ZI7A 1RRPA 4KITB 3W5IA 4CEHB 4TSFA 4V0MA 5L3SB 3EPKA 2QUZA 5IF9A 2J1LA 1E9AA 2ZU0C 5JI3E 1P9NA 4TYWA 2Q6TA 2Q3HA 4ON9A 2BIFA 3Q5DA 2FGJA 2YV5A 2YC4C 1H8HD 3AVOA 3MAAC 1Q20A 1KK3A 2VHCA 2G88A 5F2EA 1KK0A 1PZNA 4A8JA 1R10A 3QUSA 1U0LA 2OXCA 4O25A 4Y0VA 2Q21A 2V6IA 3BFVA 3D6TB 1E9FA 4KCGA 4Q4JB 2DR3A 4CVNA 2J59A 4OJQA 2BWJA 2CHQA 1M7HA 2HXSA 5J4YA 1PLKA 3Q72A 2J7PD 5IDVA 4LDJA 5CYOA 1IN4A 4PFSA 4LI0A 3QF4B 2GXQA 3N2EA 2XSZD 1KI7A 3VHXA 4L16A 4FMDB 1A5TA 4M1OA 1KZGB 4LJ4A 3X2SA 4D26A 2VIIA 3ADKA 3U61B 2C5LA 1E99A 2WPDD 3C14C 3W8RA 3RNLA 1F5NA 1KO4A 3ZIAD 4DLZA 4RCYA 1W5SA 2FFBA 4US1R 1NN5A 3N70A 1FL9A 2OEPA 5FUVA 3TAUA 1ZYUA 3EIQA 4DLYA 4PO1A 1UPTA 4PAOA 1Z07A 3GFOA 3BE4A 1MO5A 5AJYA 1G6OA 2GJ8A 3GP8A 3CM0A 5BN3A 2C96A 4Q00A 3GEHA 3SC3A 4P4SA 2ZM5A 5CYPA 2IYVA 3FDIA 2OZEA 1CLUA 3GMTA 4WW0A 2EW1A 1YR6A 2WJGA 2BMDA 2ZANA 4DHEA 1OFUX 1F2UB 3LAWA 4LBVA 2Q0HA 3P4XA 1Q21A 4HAYA 4FI3C 3AUYA 3QG1A 4B48A 4ZO4A 2WIBA 2WM9B 2CCGA 4PO9A 1YQTA 2W6JA 4JLNA 2NZJA 3AKEA 5FBRB 1CRQA 1XTRA 3LLUA 1ZNZA 3CWQA 2QSZA 4LHZA 1SXJA 2GWHA 4Z1MD 2X77A 3VU9B 4HDCA 1E2FA 4DCUA 1DAKA 4PSKA 1ZM2A 3BERA 3ZDQA 4D4KA 3RC8A 4KBFA 1NKSA 1E2PA 2VHJA 1TQ6A 2IL1A 2KWIA 1JALA 2JJ8A 4MGKR 4CEHA 4UKDA 3EZ7A 5B30A 1QVAA 1ZNYA 5AK0A 2ZJBA 5L3SA 3B8HA 3I5YA 1VG9B 1ESMA 3PEYA 4I99A 5F9FA 1GRQA 1HQCA 3KUCA 1YRBA 4NCKA 3AVYA 2JJ2D 4MA4A 3PQCA 1I2MA 3ZGXA 4XOIA 3SYNA 5C1BA 3GFTA 3DOEA 3T1QA 4PAMA 2J0VA 2J7KA 4RZXA 3U6BA 1RE0A 1Z29A 2VL7A 1X1RA 3BXZA 2EFEB 2MMGA 3F3YA 1A4RA 4KU4A 3T34A 4K81B 2A9KA 2WJIA 3LBHA 3BJIC 5C4GB 1JR3E 5L3VA 1E9CA 2ZRLA 4K8OA 5BQ5A 4LPKA 2GILA 4Q9HA 3WMFA 1RC8A 2MMCA 4DUGD 2QMEA 2FDCA 3CX7A 5BWMA 2WOJA 1T8UA 2RMKA 3O8BA 4AKEA 4GDFA 2FZ4A 4EAQA 1JPJA 1MO6A 4DSUA 2FPLA 1OV4A 4BEJA 3BH7A 3LBNA 1AS3A 2TMKA 2FPKA 4IRUB 5EE9A 2QROA 4WAUA 4QBHA 3U44A 1QHHA 1R8QA 2SHKA 4G01B 3GLIE 3EAQA 1FP7A 2LCFA 5HCIA 2JIZA 4UXHA 2GVDC 2GF0A 1KO5A 5FBQB 1KI4A 2NO7A 3SJBA 2A5GA 4C2TA 3ZH9B 3K0AA 1ZC4A 2FJUA 1WB9A 1RRCA 2QE7A 1KTVA 2OBMA 4B75A 5KPDA 3A4MA 2WWGA 3DZ8A 3WBJA 2IYUA 1JEDA 1GWNA 1WE2A 1XDBA 2NIPA 3B6EA 1FPMA 4TL6A 2ZSEA 4DLWA 4B2LA 1G21E 3KJEA 4RD0A 1II9A 1QHNA 5TDHA 5G3ZA 1P72A 5FUWA 2V1UA 3BB3A 3K0FB 3PUXA 4LV6A 1DAFA 1YU9A 3FKQA 2FSFA 1OYWA 4C3ZA 3NC1C 1EWQA 2H57A 2OUKA 3ADDA 2Z4RA 2ZRAA 4IFBA 2I1QA 3LNCA 2ZE7A 2D74A 4HB4A 4NYIQ 4A8JC 2ZRGA 2OHFA 1WMSA 2QZ4A 2FFAA 1VG8A 4B3XA 4TLAA 4HB3A 3CR7A 1G64A 1E9BA 4FD2A 4NYMQ 2VHUA 3IIKA 2NO0A 3SI7A 1NVWQ 2RCNA 3E70C 1AS0A 4TYQA 4URZR 1ZD9A 5J47A 5A0FA 5CLLA 1EFCA 1VCOA 3OIUA 4GP7A 3BGWA 1UF9A 5J4KA 3TLXA 2ZUCA 1AQUA 2CVFA 5HR5A 1YZTA 3TW4A 2IYTA 1E94E 3ZVLA 1G3RA 2F3RA 4KAXA 1R5NA 3T1VA 1DADA 3JZAA 4M1SA 3UK6A 1EWRA 1LF0A 4TL9A 1H8EA 3B1YA 4QJ3A 1CJUC 4KI0A 4JVLA 1K5GA 4Q4LA 2JJ2A 3RRNA 2W83A 8OHMA 1TF2A 1OIWA 1OKKD 5JI2E 1E98A 2CHGA 3FMFA 5M04A 2BKEA 1TPZA 2OT3B 4UXJA 2AR7A 4IFEA 1CIPA 4M9QA 2HUPA 4YXWA 5A5GA 2A30A 2RGAA 1T3HA 2V7QD 4JVNA 4ITRC 5K8TA 4PHTA 3AEZA 4JL6A 4YMUA 2GHIA 4ACAA 4DJTA 3NDPA 5C2JB 1F60A 3KFVA 2GCPA 1Z6TA 3U4QB 2CHVA 3W34A 4DT1B 4N0DA 3TSWA 1HEIA 2EU8A 3WBKA 3C15C 3NWJA 4OHVA 3TVTA 3KZ1E 1DO0A 3VR3A 4A6PA 4OI4A 1KKMA 3L0SA 4TTPA 1J70A 3WMGA 1FX0B 1XEXA 1NJFA 2BCJQ 2G1JA 2RB4A 4QXAA 4B35A 4ZDKA 3TUZC 2OLJA 3U44B 1LV7A 4ZKDA 1E1RD 2DFTA 2R6FA 2G9NA 3U3KA 5DIFA 3PUWA 1VG0B 5GJWC 1GUAA 2WPDA 2FSIA 2FGKA 1E79A 2FMXA 5SZHB 3TUIC 1KIMA 3V4FA 3P26A 3R8FA 2PLFA 3CPJB 5C4MA 1JQLB 3NEJA 4KSBA 2AWOA 1E1QA 1J90A 2QBYB 2VP2A 3MMPA 2PT5A 4TL7A 4TYNA 4DLRA 2AKAB 2NO9A 3NBXX 5DO9A 1VIYA 2PX0A 4RCZA 3BRWD 3WXMA 1N6OA 5EUMA 4HAWA 1G4AE 1FW6A 1TADA 2OBLA 5E7JA 5JJLA 1C4OA 4HZUB 1BMFA 4TWZA 1G18A 3FOZA 4IDPA 3P1JA 3PENA 2F1RA 2VRWA 4YMWA 1NVXQ 3C16C 2IXGA 2QL6A 5DISB 3OE7D 1A2KC 1IQPA 3MD0A 1E4YA 3LD9A 5IHPA 1VG1A 1N5JA 1DOAA 3B60A 4QKQA 2PZEA 3TJZA 1ZM7A 3PUZA 2ZSAA 1R2QA 4M4SA 3TVDA 1W47A 2V9PA 2VP6A 2ZEJA 1VMAA 2Q9AA 4DB4A 3EARA 3EX7C 4HDQB 1N6LA 4PHFA 1T9HA 1Y3AA 4I1VA 4PC6A 1R8SA 1Z47A 5IT5A 5CJPA 4E22A 1HYQA 1ESNA 4UNPA 1U8YA 3HU3A 1AM4D 3MWKA 3QQ5A 2R9VA 1Q1BA 3SNHA 4V0NA 4TZ6A 3KUDA 3OZXA 4IOKA 3OEHD 4HB0A 1G1MA 2H92A 3CWZA 3ZD7A 2HT6A 2AHOA 3CPEA 4LJ6A 1NNEA 1R0XA 4NMMA 2RGXA 1D8TA 1R4AA 4HAXA 1EX6A 3WP1B 4V0OA 1CP2A 3B1VA 1K8RA 2CCJA 2XSZA 4D80A 3ICQB 3DMDA 2JLQA 5DGXA 3LXRA 3OEED 5K8LA 5LPNA 2ZJYA 3CX8A 2GF9A 1QG2A 1GL9B 2XEXA 5HKKD 1KZ7B 1T8TA 2PJZA 3PEVA 2P6NA 1OB5A 3VKHA 1JXOA 3QVUA 4D0LB 3U4QA 3T5GA 3K8YA 3TK1A 3H86A 3GQBA 1LW7A 2ANCA 5DYGA 3B1WA 1I4DD 3UKDA 3AB3A 3RSLA 2MSDB 4DCSA 2CLCX 2V8OA 1E79D 4M9XA 1N2CE 1GRRA 2X2EA 3PCRB 3NVAA 1HH4A 4KSCA 1Z0JA 1QHXA 1SHZA 2DYKA 2XOKD 3OEHA 2ZJAA 4ILEA 4PANA 3BK7A 4Q7LA 3ECCA 4QRHA 3K9LA 4OQXA 3RS3A 4X8OA 2J0SA 4KYIB 1QF9A 1A1VA 2WTUA 1X1SA 1G4UR 1N5IA 1G291 4FMBB 5SZJA 1ZVQA 1XD9A 5TVKA 3THYA 3RYTC 2VYFA 5JSZA 3HP1A 3OEEA 2IWRA 5EP1A 5SZKB 4PPQA 4KV9A 4P4UA 3LA6A 3QXJA 1LVGA 2AL7A 4Z1MA 3WNDA 2RGDA 2ODWA 2PMKA 5GJBA 1SULA 5FTMA 1G41A 2IF2A 4XWAA 4XSHA 1P2VA 3KQKA 3EPJA 1KMHA 2G77B 3GJ6A 2J45A 2I4IA 3A58B 1OXTA 4H1VA 5AJWA 1RJ9B 4P3YA 1XJQA 4OQFA 2D3WA 4IHQA 4JLMA 5FOVA 5FOXA 1ZAKA 4XVRA 4H9GA 2QMOA 5DHFA 2ZTSA 4NBSA 4G5GA 1DVRA 4F7WA 1EK0A 3BH0A 2G0TA 1M8PA 3GJ7A 1IN6A 1HA3A 1XEFA 1X8LA 1FP6A 2H16A 4URWR 5DH9A 4UNNA 2K5UA 1NI3A 2H5EA 4CDGA 4TQ9A 5B57C 3A1TA 5HE9A 2GCNA 4JBXA 3K0SA 3L8YA 3IPXA 2QPAA 4GOKA 4X8MA 5FL7A 2DHRA 1SKYB 2EFHB 3KKOA 3U7HB 4CZ2A 1K5DA 2ZYTX 2GJKA 1E0JA 3L0IB 3MWLA 1GIAA 4QNMA 4B47A 5JCZA 5JEDA 4OK5A 1QHIA 2CL0X 1JI0A 1XWIA 2CE7A 2XZLA 3I1FA 1KI2A 3N5CA 2H17A 3CZQA 2WWHA 4Q21A 4A92A 1Q22A 2DFNA 2ZS8A 3UMFA 3EZ2A 3IO3A 4WZ6A 5HKKA 5HCNA 3G5UA 1UBCA 3D3QA 1HT1E 4EPWA 1P4SA 1OSNA 2ATXA 5J4HA 1AJEA 1MV5A 1BYUA 4W5WA 3HDTA 4A4DA 4TMWA 3SBEA 3E1SA 5G53C 3KQLA 4FMDF 1JEEA 2JAQA 4MRVA 4CF7A 1Z0DA 3VTKA 5EZ6B 3TMKA 2WJJA 4BASA 3PVSA 1E1RA 1Z6YA 1HQYE 1M34E 2HDNB 1JR6A 4JL5A 2NO1A 4HAUA 5JZVA 2PMDA 5JLJA 4XVQA 4OQNA 4GPTA 4A2QA 1E32A 2IYXA 5EP4A 1IOZA 2GESA 3A1SA 1NG1A 3CF0A 4BLRA 3OAAA 1N6NA 5TV2A 2RH5A 2HCJB 4TQUS 5IK2D 1Z0IA 4ZI2A 3THXA 3TAHA 3L0OA 3M0EA 4LV8B 4A9AA 3FKSD 2ANBA 4M1TA 3AV0B 4WVFA 1GM5A 1AZTA 4IVPA 4GFDA 2IYQA 4RD4A 3UMRA 1Z8FA 1VKJA 3CLVA 1VTKA 4NYJR 4Q47A 4DT1A 1X6VA 4DCNA 1RVDA 1GL7A 4E07A 3U6KA 5BN5A 4JJKA 4TTQA 1MH1A 2ZROA 1P6XA 5CK5A 4NYJQ 4P33A 2C78A 4MITA 2VP9A 4A36A 1VDZA 5LB4A 4TLEA 4KFRA 2O8CB 3CKLA 2OM2A 5KSZA 3H2YA 2YOHA 4MGZR 5FUXA 4FMCB 2RGNA 4PSVA 1MKYA 1YZGA 1SVLA 4RD3A 4UQOA 3HJNA 1DAEA 3KXIA 2DFKB 1UDWA 4V0ME 3T12A 2JLRA 1P7CA 1LS1A 1IN5A 2IUTA 3HU1A 2H18A 3G82C 3FMOB 4WXRA 3GEEA 3VX4A 3KKMA 3W8NA 5C46F 4JJZA 4YQFA 1F3OA 2BM0A 2KI5A 3QBTA 2GRJA 2WV9A 4IJMA 4MKFA 4TMZA 2DY1A 4D4LA 2IK8A 4PPGA 2IUSA 3AP3A 3QXHA 5EZ5A 1AKEA 1Q3HA 5EXSA 1DBSA 4ZCIA 2HT1A 3CUEF 3VAAA 2FA9A 4Q66C 2GEDA 3L8ZA 3QE0A 5EXTA 2NG1A 1S9DA 4PO8A 1NN0A 2OO7A 3LV8A 4M21A 5CDFA 2XTNA 2J41A 4PPFA 4DIDA 1E1QD 2QORA 3EC1A 4HZUA 2IXFA 4TT3A 3SHWA 4O3MA 3KQNA 1E2HA 2BEKA 2QGZA 2V54A 2O8DA 4NONA 3QIAA 2FFHA 2RGCA 2WJHA 3Q9LA 3T35A 1AKYA 1OYYA 3LVQE 2F1JA 5L8VA 1D9ZA 3DM5A 4LJYA 1FNMA 5SZIA 2MSCB 1ANKA 1COWD 5D3MA 2B92A 4F91B 4GOXA 4Q9JA 2N42A 2RHDA 4IDHA 4KLNA 2P2LA 4RFVA 5BN4A 3GLGA 3I5XA 2JJ1D 4POAA 5FOUA 2J0QA 1QHSA 1GSIA 4IVRA 4BZPA 4IVQA 1N3BA 5DYIA 1L8QA 2A7QA 3IPYA 2VQSA 3NXSA 3KTAA 3KXKA 1WBDA 1P62B 2IS1A 4PZZA 4B73A 1YR9A 5K8IA 3UG6A 2X19A 2IHBA 4BWYA 3W5JA 1QRAA 3K0FA 4Q1DA 1G5PA 4EIWA 2IW3A 2VH5R 4Q1CA 4CT5A 3UWOA 5L3RA 1MO4A 1XCGB 2R8RA 2IEYA 1GAJA 3QXSA 2QM7A 4M9ZA 4ACBA 1T4GA 3SHFA 3IQXA 3L43A 2BC9A 2QQ0A 4Q9LA 3U3OA 4RKFA 3PUYA 3HR8A 3AF2A 1MT0A 5DI3A 2CCKA 3L0PA 1TU3A 2JCSA 3VR2A 2FF7A 5KOYA 3NDBB 1IHUA 2WKQA 1NBME 3EASA 2DWOA 2WMOB 4QG7A 4C7OB 2ZJZA 3ZIAA 4UXIA 2ZJOA 3S1AB 5EXPA 3EA0A 2QQEA 3TE6A 3IEVA 2AX4A 2P5SA 4Q01A 1ELOA 4HYYA 4URUR 5FOSA 1ZUHA 1YZLA 3PR1A 1GVNB 2GXAA 2FOLA 3OIWA 4UNSA 1OFHA 1W0JA 3AKCA 1ZJ6A 1WF3A 2NQ2C 4LJ8A 1G7RA 4CEIB 4B3DA 1ZMXA 2GKSA 5E7IA 3AGPA 2RGBA 4ZPXA 1GG2A 1CR2A 2D2EA 3KB2A 3AVPA 1LF5A 1DAMA 4G5SA 3RS7A 4IDQA 1UEIA 1US8A 2ZSBA 1Q1QA 4ZI3A 3OAAD 3OF5A 5JJIA 1M74A 1E2JA 1GTVA 2V4ZA 4QHYA 5KNCA 2PZGA 1XNJA 2ZRIA 1OLOA 5F98A 2V7QA 2QRNA 2G0NA 2GA8A 1ZU4A 4FCWA 2H8KA 1W1WA 3EIHA 4URVR 1Z6AA 2X2FA 2JLUA 1NN3A 5EP2A 1FX0A 1ONBA 4DCTA 3A4NA 3ZVNA 4Q1AA 2A5FA 2CEAA 1U8AA 3E5HA 2IT1A 1KMHB 2FN4A 2O52A 4E5UA 3IQWA 3N2IA 2W6IA 1TL7C 2GETA 2ZVPX 4MYTA 4C0JA 3BBPA 2BBWA 2AWNA 1W7AA 1UKVY 4M1YA 5CDFE 2XNSA 3KL4A 3I8XA 4GSYA 4M1WA 4ERNA 1LTQA 4GL2A 2EWVA 3B85A 4W7SA 5G40A 5LD2B 1G7CA 1A82A 3CIOA 5DNYB 2BJWA 3WYGA 3U2QA 2WWIA 2ZRJA 4YMTA 1C9KA 3ZVRA 1YR8A 1W5TA 2ZU6A 4HUTA 4NU0A 4I81A 1HURA 1ZM9A 2WOOA 4HLUC 1T3LA 3KJHA 5FL7D 1F2TB 3TW8B 3RRMA 1EX7A 3FGNA 4LJ5A 3SJCA 3WMEA 3ZQ6A 3P27A 3ZZ0A 2WVJA 1D9XA 2IA5A 2F1HA 1ZUNB 1IXSB 3IIJA 1OFIA 2ONKA 1G8PA 4S35A 1M6NA 1TU4A 2WWXA 4LK2A 3MUFA 4I1OA 1KDOA 1VHTA 3NHAA 4TZ0A 2VBCA 2R44A 5A4JA 2B8TA 2QA5A 1AA9A 1H65A 1IAQA 3UIEA 1J99A 2W6ID 1EXMA 5JS7A 1P2UA 4I4LA 5CLQA 3PIRA 1P61B 1WRBA 2REXB 5K8UA 3SR0A 4XSGA 2F9MA 1SQ5A 4R71A 2GZAA 2DPXA 1XJCA 5IRCD 1NMYA 2B7CA 4B2IA 5J4LA 4YDHB 3ND9A 1E2DA 2BVNA 3CX6A 4Q1FA 3D31A 3Q5EA 1OB2A 3BS4A 1E4VA 2ONJA 3QKSA 1HUQA 3PITA 2AXNA 2F1IA 3V4RA 2OFWA 1AS2A 2QTVB 4QM7A 1NY6A 3I62A 1ZUIA 3QXCA 3NBZC 3QEJA 4ZDWA 3THXB 2R65A 1IXRC 1II8B 5FBLB 2ZRBA 3O8CA 1ZCBA 1P75A 4TLCA 2PT7A 1UADA 5BYKA 2OAQ1 1KO7A 2LWIA 3QG5A 1NRJB 3EZ6A 4W9MC 4U7DA 1XD2A 5FL3A 2ZXUA 1TUIA 3IBYA 4WIAA 4PPNA 3R7WA 4PXAA 2BCGY 3DM9B 1YZUA 4PC2A 3BWDD 3LW7A 4LHYA 4D0NA 4CEJB 2WZQA 3PJRA 1NSFA 3U7EB 4F4IA 5JHHB 3R8CA 1N6IA 4JSTA 4EPRA 2CE2X 3AQ4A 1S3GA 2O0HA 1ZP6A 3U7GA 4JT4A 1ZD1A 1N5KA 3AKDA 2CNWD 1W4RA 4V0KA 1VYVA 3D7MA 1T5IA 2F43A 3SE0A 2BEJA 4GI7A 5DLQC 3RSOA 3I4LA 4WOPA 4MYCA 4MGIR 3F0TA 3B9PA 1F48A 3P4YA 4DLUA 3PXGA 4PZYA 3QNUA 5HZKA 3MRSA 1EGAA 1G20E 4FXPA 4DDVA 3W90A 5JRJA 2RAPA 2A5DA 2ZVQX 4DSNA 4URXR 1XZPA 3NKVA 1KJZA 4HLUA 2WAXA 3EWSA 3ZLJA 2YWFA 2IEZA 2QGNA 5E95A 4AIIA 5JBQA 1SVSA 4XH9B 4EKDA 5E7MA 1YKSA 2WBLC 3CRW1 1XU4A 4GRAA 1WBBA 3EZ9A 5DHAA 1W36C 2FX3A 3GLGB 3C5CA 4WZAE 4X8HA 4EQ6A 2ZE6A 2ZETA 1BKDR 1EFUA 3B1XA 4NCJA 3THWA 1XJ0A 1XCMA 4B32A 2H7VA 4NL4H 3R20A 3BH6A 2O8DB 2C9YA 3AVQA 4QGGA 2JGNA 2FNAA 1G6HA 3VR6A 2ERXA 4WZBE 1M1YE 2J87A 5J40A 2ZYWX 3R9WA 1BIFA 4TLDA 1DAHA 1W0KA 1KNQA 3FHCB 3G0HA 4JKIA 3A8TA 4JLDA 4FINA 3QKSB 2ZIAA 5TB5A 4RZ2A 3K0CA 5TY0A 3K9NA 4A82A 4B6FA 2XZOA 2IUUA 1XTKA 3I61A 4DB2A 2ZE5A 4FWTA 4G1UC 2ASEA 3KTAB 3KKNA 4GMDA 4BECA 1OW3B 1EG7A 3AF4A 3FYHA 4HSEA 1IXZA 1IN7A 2CVHA 4L15A 4NCNA 1TQDA 2BMEA 3EPLA 4M1MA 2ZR9A 4NE2A 4C0AC 5KPJA 5CIQA 4AD8A 2GDJA 2GBLC 2FH5B 4US0R 4DLSA 2QAGC 1JR3D 5FPKA 2EQBA 2NPFA 3EG5A 2JDID 1BOFA 5JECA 5GJVC 3LWNA 3NEYA 4OK3A 4LYFA 3UXMA 3QY0A 2QAGA 5HPYB 3PFIA 4XIGS 1G19A 1KKLA 2IYRA 2CK3D 2QENA 2H1LA 4OHXA 4FIDA 1HT2E 1W0KD 1YZNA 3MCAA 4LY6A 2J3EA 4ZKEA 4A0FA 4DKXA 2FG5A 4JZKA 1FZQA 1CULC 3LX8A 3TIFA 4AURA 1E6CA 4C7OA 2ZI9A 2VSFA 1P73A 2CJWB 2A5YB 3CRMA 2YKGA 1JAHA 3P20A 3CH4B 2JA1A 2RKOA 3NHBA 4F4CA 2C99A 3K70D 4BLPA 4DBLC 4DDWA 4LJAA 4LYJA 1X8JA 1QBKC 1ZU5A 3IIMA 5LDDC 2CK3A 2VEDA 1VCMA 1DARA 4BLOA 1Z6GA 1U94A 3DDCA 1D2NA 4OBEA 2ZI5A 5D3QA 3T15A 4PQRA 4DDTA 1TTTA 3TNFA 2WWFA 2REBA 2D06A 2QU8A 2R2AA 1J8MF 3QPWA 4CEIA 1EFRD 3W3AA 1NMZA 4JLKA 1J7KA 1WCV1 2BV3A 2IYLD 3A37A 4LBWA 1YVDA 3IKJA 4LHVA 3THWB 4DUGA 2WMNB 1KOFA 3CRRA 4QFMA 2ZAOA 2JJ1A 2OCAA 3V9PA 4E09A 2R6AA 2C9OA 4MYHA 5KNBA 1BYIA 3VU9A 2DWPA 2QAJA 1XB2A 4FWIB 3SEAA 3I92A 4F4JA 3MJRA 2ZUDA 4UNRA 3V00A 1N6KA 5KDLA 3T1OA 2I1VB 1GFIA 2P3SA 1DPFA 3OFND 4Q48A 1FMJA 1I2DA 1XRJA 4IXNA 4TSFD 4C30A 2KBEA 1JBKA 3SU8A 2ORVA 5KO2A 4AY2A 4AYXA 2GJ9A 1SVKA 1KI8A 3DKPA 3LXXA 1QHHB 2F6RA 1SVWA 1PUJA 1F6BA 2ZREA 2OE2A 1W4BA 2D7DA 1GKUB 1E2LA 2OAP1 3X1WA 3ADCA 1LY1A 3K0AB 4P0TA 2QMHA 3AP1A 1XF9A 1KDPA 1NLZA 1FTNA 2BBTA 3ND8A 1TX4B 4BRWA 4JIMA 2HEIA 1G8HA 3ICEA 3M6AA 1U2RA 4X8LA 4EPXA 3BB4A 1F2TA 3OFNA 2GK6A 1XEWX 3SYKA 2XB2A 2RGEA 3WRXC 4B33A 1VIAA 3RS2A 3QKRB 1HV8A 2EVWX 3UANA 1G8YA 2AXPA 1XP8A 3GJXC 2OV2A 2QAGB 3I73A 2WIAA 5H1YA 1CJMA 1L4UA 2YWEA 3VHLB 1CR1A 4AKHA 1AZSC 3CONA 1JAIA 5KDDA 3WYFA 1W44A 5FI1B 2XAUA 3QKTA 3BB1A 2ZYUX 4GMXA 3AKYA 4A8JB 3NC0C 1T91A 1NF3A 1MO3A 4HLCA 2XJ4A 3CBQA 1YZQA 1UJ2A 1XX6A 4DXAA 3KX2A 3TSZA 1SHKA 5HTKA 3JVVA 1UKEA 4DC9A 4M2LA 1WA5A 4Q02A 5AJZA 4DEYA 2XGJA 2ZQ5A 2AN9A 4URYR 2AD1A 4R2IA 1OT3A 2VP4A 3W3ZB 2PCJA 1KO8A 2QM8A 5FPTA 5GVSA 1X3SA 4KXFB 4HLDA 4DEXA 4BFTA 2GXUA 2HV8A 2D4HA 4QBFA 1NBMD 2C03A 1MRNA 4FW9A 3VR4A 3DHWC 2QSYA 5KTYA 3BFXA 2HF9A 3AVUA 1SXJD 3DL0A 4HZIA 4Q7JB 4Q4JA 4V0LA 3MGCA 4LZZA 3SN6A 2GAOA 4L9WA 4EJSB 1T5LA 1YJ5A 2QY9A 3LO5A 1E69A 3CF2A 1E2EA 3KDSE 3LDAA 4L4UA 4GT1A 4NH0A 4KODA 4D4MA 1XD2B 2AFIE 5CJ2A 1ZM3A 3LW8A 3K09C 1IY1A 3RS5A 1U90A 3B13B 2IYSA 1DELA 4PAQA 4MDEA 3MFYA 3EZFA 3FFAA 2C95A 2D62A 4BFXA 3AM1A 1P9WA 5H68A 2QP3A 1X86B 2Z6VA 2ZI6A 4ESVA 4M22A 3KJGA 4K46A 3R7WB 4LOAA 4Z54A 4KVAA 4BZQA 2GEUA 1Z6XA 4AYWA 3RHFA 3H84A 3QXXA 3K9HA 2YZ2A 4KJZA 2FSGA 2ZI4A 1V5WA 2ZRHA 4Q4HA 3SZRA 4UJ5A 3VMFA 2IYWA 2BM1A 1RIFA 2E9SA 1M7GA 2W0MA 2ATVA 5FTLA 3JZMA 1NJGA 2F43B 1NN1A 3TQFA 1N6RA 2G1KA 4Q9IA 2A2ZA 2CMKA 5CM9C 2JLYA 1II0A 1OIXA 4RD2A 4U5XA 4EQ6B 3D8BA 3NTUA 1G7TA 3S1AA 2VSXA 2YNMA 1R0ZA 4RVCA 3VR1A 1DE0A 1FUUA 4P4TA 4XTCS 1Q1ZA 4B76A 1UDXA 3O8DA 4AG6A 1NLYA 5G41A 4XD7A 4R7ZA 2EFGA 4OL0A 1E9EA 2IXEA 2VO1A 5G3YA 5KHOC 4DRZA 4LJ7A 2QP4A 3ZS8A 2HJVA 4MRSA 5EE1A 4BPBA 5AUNB 3AVXA 2WSMA 2WWWA 3RLFA 3I3SR 3GJ0A 1MABA 3GJ5A 1JXMA 5CM8B 4F38A 1EFRA 1SVMA 2PZFA 3R9XA 2DBYA 3L2OB 2QBYA 1BS1A 2UZ3A 1RFLA 1WQ1R 3H4MA 4JBYA 4QJ5A 5JS8A 4IDNA 3GPLA 4BFSA 1NL3A 2QNRA 4HEJA 5H8WA 4GP6A 3I72A 3TGPA 3FWYA 2C98A 1GZSA 2PL3A 1T3SA 1HE8B 1S96A 1Q3TA 3VFDA 2P0EA 4HUQA 3GJ4A 4V03A 5KSYA 4G5QA 4A2WA 1N25A 4GZLA 4IDOA 1QG4A 3B82A 4Q9KA 3SS8A 2BMFA 2WKRA 3RS4A 3Q85A 4RD1A 3E2IA 2OILA 3X1YA 4IW3B 4AC9A 4DDUA 3EW9A 1N0WA 5AJVB 3RABA 2NOAA 4JLPA 4OYHA 4CT4B 1VYTA 1PJRA 4DSOA 1RW4A 5EUQB 2IWHA 1U98A 2VA8A 2V6JA 4P32A 5B2ZA 4EPTA 1NIPA 4B71A 4QL3A 5AWFC 3KKQA 3L82B 3DVLA 4BRUA 1P60A 2HYDA 2DCUA 1W36D 1OE0A 1KYIA 4C0HA 3FB4A 2ZI3A 3C7KA 1XPUA 5AUQA 4KO8A 4YMVA 3VKWA 4NCHA 3GLHE 4IKEA 2GXSA 1AIPA 1OIVA 4LBYA 1OH6A 1KY3A 1D2MA 2NGRA 4AYTA 3U7FB 3U5ZB 1C1YA 1G3IA 1IN8A 2QT0A 5DSZA 4KYUA 5DN6A 4JYBA 4TTRA 4LPSA 4UJ3A 2O8BA 2ZPTX 1VCNA 3PV0A 3MLEA 1B0UA 4OJKA 2JDIA 1Q1EA 4RD6A 4RZ3A 1ZW6A 3CR8A 3RC3A 3RWOA 1UKYA 2XOKA 3FE2A 1S8FA 4N3NA 2VSOA 3CO5A 4QOSA 4XTRA 2NMVA 4R98A 2E1RA 2XITA 1RYHA 1OKKA 4MRNA 3X1DA 4EFNA 4JKYA 3AF0A 3AGQA 2F55A 4PR0A 1G3MA 4ZDIA 5JEEA 2ZRKA 3SJAA 4L9SA 2KBFA 5FTJA 4YONB 4B2PA 5JSZB 3EXAA 4AKGA 2CJWA 3IGFA 2JATA 3RWMB 2VF8A 4HI0E 1QHYA 4TN1A 5GVRA 3FTQA 4JLVA 4ARZA 1ZRHA 2QPTA 2JEOA 2WICA 3A4LA 4G5OA 5JRZA 1A2BA 2WAYA 1B23P 2YVUA 4TL8A 2EFDB 4BLTA 4JL8A 1U0HC 1XZQA 2QN6A 4WA7A 4PSAA 3WHLA 4MUAA 1XCPA 4TYPA 1MABB 1PLJA 1GNQA 3VX3A 3UATA 1KK1A 3B5JA 1DO2A 5JWOA 1OFTA 621PA 3QEOA 2CL6X 2P5TB 1CJTC 3BFKA 1Z63A 4TLBA 1E9RA 4QJ4A 2MSEB 5BW8A 5FTNA 3WYAA 4E03A 3CPHA 2YYZA 2HJGA 1XFAA 2VHTA 4JBWA 1L2TA 3DPUA 4DLVA 2OCBA 3QKRA 1ZNXA 4LHWA 3LH5A 4RY2A 1TAGA 3REGA 1E2GA 1EFTA 2OG2A 4MH0R 4RJLA 4YXWD 2RHMA 3QI2A 4JLAA 1NG9A 3MWYW 4HAZA 5JMTA 2YC2C 4DLTA 2Q3MA 3LFUA 3TR5A 4D6PA 2ERYA 2R6DA 3OE7A 5FPHA 1OXXK 2FZLA 3A6PC 5FPYA 1J8YF 1N5LA 4PC1A 4DLXA 4J0QA 4JMPA 5LB2A 3ZZUA 4U02A 1TNDA 1AGRA 5FOTA 4DCVA 3PEUA 1PVOA 3PEWA 1LFDB 2ZRNA 3IEUA 4O2RA 1RPZA 1Z83A 1MRSA 2LKCA 4A0GA 2XXAB 1MOZA 2DFLA 1IONA 3UMSA 4JLOA 2Y8EA 2JLXA 2O8EB 2O5VA 4OK6A 3TKLA 1E0KA 4CIDA 2ZRFA 2CDNA 2W6JD 4PTLA 4P31A 4BQSA 1XMIA 5IK2A 4ZCMA 3IO5A 2FWRA 4I1UA 2D2FA 1D5CA 3B2EA 1KSGA 4BFVA 1S9HA 1E0AA 2YHSA 3SQWA 1N0UA 3U3MA 1XEWY 1CBUA 1OF1A 2X1VA 4PQYA 2P6RA 2GCOB 1SZPA 1G8GA 4NYMR 3Q3JB 3TBKA 4U00A 3MG9A 2OCYC 3LVRE 1R0YA 4HATA 2ZSDA 4C9BA 4G3XA 4NP6A 1G8FA 3U3JA 5CB6A 2YWHA 3H1TA 1A7JA 4LGMA 4NYIR 3MWJA 4B3GA 3EWAA 4YMSA 4II7A 1R5OA 1TUEA 1OHHD 3IUYA 2O8FA 2C2HA 221PA 1LNZA 3CZPA 1E3MA 2ZS7A 1UBFA 3HPQA 1NY5A 4ZDJA 4B44A 4QGAA 2VPPA 4M1KA 3ZJYA 3CNNA 4PC7A 1OPXA 2ZJ5A 4IXMA 4NPHA 5C18A 5EE3A 3RS0A 1U81A 3ONWA 3RANA 4IOLA 3SYLA 3ZZTA 2J9RA 2IYYA 3CRVA 2OXRA 3C4JA 4LUCA 4DVGA 4US2R 5EE0A 1DAGA 4BLQA 1TF7A 1XTJA 3A36A 1G5RA 4B3CA 1NLFA 4Q4HB 3THOA 4A6XA 3TQCA 4EPYA 2C77A 2E87A 3DKVA 1R6BX 4XJXA 1K6MA 3GLHB 2ZRPA 3WHKA 2IS6A 2ZAMA 4ABYA 5KDOA 1SXJC 1JNYA 5AUPB 2VTKA 1QVRA 4OI0A 3W6PA 4XWOA 1GILA 2W2TA 4MQBA 2IS4A 1XXHA 4Q4AB 2G83A 3IHLA 4PHHA 5FR2A 4JVMA 2OSBA 1TEXA 4QC2A 4HAVA 1L7VC 3K70B 2W58A 3GLIB 1SVOA 2O0JA 2P67A 1Z0AA 3ZQJA 5CITA 5FH9A 3GJ8A 2CL7X 2VF7A 4M53A 1FFHA 2Q3FA 1DG1G 1KI3A 1DAIA 3QBVA 4BFUA 5F9HA 4S2EA 1E9SA 3BOSA 1CEEA 1SGWA 4RKEA 4NCIA 2J7PA 1GKYA 4LC0A 1CJVC 3O8RA 1YR7A 2WHXA 5E3HA 4PHGA 2B7BA 4MUBA 3CF6R 5D3MB 3PUVA 4AI6A 1KGDA 1UM8A 3IILA 4IEEA 2J0UB 2PJRA 2YOFA 2N1BA 2VP0A 2FEOA 1IBRA 3M4YA 4Q5IA 4ESHA 4B74A 1KY2A 1O87A 3FFBA 4B6EA 1VCIA 1U8ZA 3RRYA 4KFUA 4BFWA 2IC5A 3C8UA 1P5ZB 1TQ4A 4JVSB 1W36B 3ZD6A 2P6UA 1KHTA 1IM2A 3K1JA 1GKIA 4JSYA 4YC7A 2QEQA 1TEVA 4D0GA 5DI9A 4W5JA 1VHLA 3QF4A 2BBSA 2Z4SA 4D81A 4FMCF 5KYKA 121PA 4QM6A 1U0JA 1VPLA 2B8WA 1LS6A 1RJ9A 4BLSA 1YE8A 4D25A 1FMLA 2AKYA 4F92B 3AF1A 4XVUA 4I1SA 3LQRA 1EFHA 2GEVA 3AH8A 4LJ9A 5LD2C 1S1MA 2HLDD 521PA 3X1XA 2EFCB 2C04A 1NVVR 2W00A 3CRQA 3NBYC 5FTKA 2AD5A 4G0NA 4ZV4A 3T1TA 3A1UA 2OLKA 3NH9A 4TYYA 4TT3D 1G3QA 1CS4C 1W48A 2GJSA 1ZCAA 4ZCLA 1Z2CA 3CB4A 4ASUD 1N0VC 4EUNA 2UKDA 3AVWA 1GNPA 1E2MA 4GOJA 1NKTA 4W5HA 3SFVA 4NKRA 4H1UA 3KXLA 3I8SA 1Z28A 1OXSC 1SXJE 4O0MA 5JWRA 3J81k 1BH2A 1JJVA 2F7SA 2QI9C 5BYJA 2ZUBA 2OBNA 1TMKA 1XXHE 4ZIRB 2IF0A 3OIYA 3VNUA 3RAPR 2O8BB 4M8NE 1T6NA 1Z22A 2IBMA 3B7GA 1W0JD 3HYRA 4FCTA 4EJSC 4NTZA 3C5HA 4XD7D 3HR7A 2NO6A 1Q12A 1KSHA 2BMJA 2QG6A 1P2TA 4NHOA 1M2OB 1KI6A 3QVVA 2C8VA 1XXHB 1EESA 1UBGA 2Q9BA 4EJSA 2RGGA 3B9QA 5HZHA 3A1VA 1Z0KA 1SXJB 3SFZA 1Q0UA 2X8AA 3AP2A 4TQAA 3SOPA 3B1ZA 3RRZA 2JLWA 5E4FA 1XTIA 2XTMA 1NIJA 2BKUA 4P4SB 3K70C 3TR0A 1UBEA 3ASYA 1BO6A 3KFXA 4TMTA 1KI1A 4HLQB 4ARZB 1XPOA 4Z8XA 821PA 4LWZA 2XTZA 2ECKA 1F2UA 2QTHA 2CXXA 4DZZA 3W6NA 2FFQA 1HTWA 1ZIOA 2Z43A 5EE5B 4NDZA 1CJKC 4LX0A 3SDZA 4JLJA 4D4JA 2O8CA 1E2NA 1RRFA 4C4PA 3Q7PA 5JCPA 2QTFA 3GLGE 1UKZA 3FKSA 5ANRB 2JIZD 3NBFA 4OHYA 5EXXA 2NTYC 1XMVA 3FHOA 4CYMA 4A2PA 2LKDA 1S0UA 2WWYA 3CNOA 5JFGA 5TXGA 5B64A 4MYUA 3BORA 1KAGA 2DWQA 2WSSA 3MSXA 2BDTA 4N0EA 1ETUA 1GL6A 3FMPB 4Q18A 2I3BA 5FUYA 5JHGB 2ZS9A 2IX3A 1FNNA 2OFOA 1KO1A 2IHYA 4WBSA 1JR3A 4C0KA 4LYHA 4WXPA 2ZRDA 1MR3F 2G3YA 3AVVA 3EC2A 2P65A 1KSFX 3VR5A 3ADBA 1ZC3A 3BC1A 3ZS9A 5FBVB 1UEJA 4CRWB 4L8GA 1Y63A 2XNDA 1D6JA 4AK9A 2L0XA 2J5XA 3LX5A 3KQHA 3KKPA 1U99A 1GOTA 3IDQA 2HLDA 3K0CC 2BOVA 3QOFA 3K53A 1FOEB 5CIWA 3QSYA 2PBRA 1E96A 3BIFA 1HY3A 4MDFA 2FSHA 2FE4A 2W2VA 1T0JB 5GADl 3Q8XB 4LCBA 1AK2A 3QF7A 4B3BA 2XXAA 3TUJC 4DWJA 1OH5A 1M7BA 5KNDA 2WSSD 1S1CA 4ZIRA 1AGPA 2GBLA 3EPHA 4MGYR 1AN0A 2O8FB 5KUTA 4CGZA 1N6PA 5HE8A 1P9RA 1W2HA 5GJCA 2IYZA 1KMQA 1R5BA 3OHMA 3W9YA 3FHTA 4A0RA 1W4AA 421PA 3T06B 2NPIA 1E2IA 5BXQC 5KU1A 4OHZA 3MJHA 3F5FA 4RSGA 4C0BA 2GJAA 1W4CA 2ZITA 4Y0AA 4KBGA 1P3JA 2ZJ8A 3DZDA 4HUQB 1NBMA 3LY5A 6Q21A 3O47A 2BJVA 2AK2A 4GZMA 1KNXA 5FPSA 4JT2A 4BZXA 3VKGA 4L5BA 1NMXA 1CRPA 4QGFA 4KHZA 4MRRA 2CBZA 3WRYC 1JQJC 4JYCA 5DI3B 5L3QB 1WDTA 3P32A 4AG5A 3ZYCA 2EYUA 3ETLA 1ZINA 1G7SA 1W46A 4F93B 2C9CA 5B58C 1KDRA 1JJ7A 3DOFA 3DO6A 3QPUA 3TRFA 2ORWA 2OCPA 4UNQA 4C0SA 4OKSA 2ZRMA 3QJYA 1VYUA 2EWWA 2GAAA 2XX3A 3TSOA 1R7RA 2EYQA 3FPAA 4RFSA 4N1AA 2O0KA 1RZ3A 2QMUA 3OIVA 3X1ZA 4B43A 5AR1A 1ZBDA 1QZXA 4QHSA 4C0LA 1U9IA 2V1XA 2W0SA 2A3RA 2QRZA 5EP3A 4B3FX 4PQFA 1XPRA 2R6GA 2PCLA 1S2MA 1KJWA 2QT1A 3GLFB 4Z8YA 2VHQA 2JLSA 3NH6A 1KJYA 3CH5A 4PC3A 4BGDA 4Q19A 4R2HA 2G6BA 1XTSA 3GD7A 3DEFA 1XTQA 3HPRA 2WKPA 1I4LD 1J2JA 1W49A 4PZLA 1NP6A 3GLHA 2N46A 2XB4A 4IOMA 1H8HA 3CW2A 1US8B 4D82A 3AVTA 2FU5C 2ZRCA 2J0UA 3BAFA 4OHWA 3GLIA 2ZR7A 1KDTA 1IY2A 1Z0FA 2WJVA 4BFZA 2PX3A 1Z08A 4Q4AA 3VQTA 1DG3A 4Z51A 2AK3A 2V55B 3W6OA 2ZE8A 1NSTA 3REFA 1QHGA 2HXYA 2KE5A 1ZNWA 1RRGA 2ORIA 1OHHA 4IEIA 1O3YA 1SKQA 3CNLA 5FR1A 1S4QA 1CXZA 1E9DA 3GFPA 5CK4A 4B34A 2V3CC 1JECA 5JJKA 1FQJA 1GNRA 2YJTD 4MKGA 4Q7KA 3WNBA 4DIEA 4D2IA 3SJZA 4LYAA 2RGNC 3KB1A 3K9GA 3LRPA 1FQKA 4O2LA 1PUIA 1G16A 3VNVA 1I4TD 5TMPA 5KSOA 2REOA 2UZIR 1JPNA 5H70A 2JLVA 1NVVQ 4BFYA 4LV5B 4MKIA 4LRWA 1OJLA 5TARA 3C41J 4LBZA 1OH8A 1Z06A 5JWHA 4DSTA 1Z5ZA 4XWKA 3KJIA 3LBIA 3U60B 1IJEA 2QPOA 4OQLA 1HE1C 5EQTA 4C2UA 3K0EA 4ASUA 2CLDX 1ZIPA 2B21A 1YHNA 2XJ9A 2YWGA 1PV4A 4FN5A 4AWXA 2F9LA 3RDPA 2KSQA 5UKDA 1SVIA 4R9UC 2Z0MA 1CKEA 1OXVA 1BMFD 3DMNA 1UFQA 5L3QA 2O8EA 2GTPA 3JVUA 2ZJ2A 1H8ED 2FV8A 2ODBA 4G5RA 3UPUA 1OXUA 2W2XA 1T0HB 2XNDD 1CTQA 3GEIA 1G5TA 4LC1A 4A0HA 4RFSB 2GCOA 4NZYA 5FOWA 1FUKA 4BE7B 4KFTA 4GBMA 1UAAA 4TMVA 1KSJA 3ASZA 4M0LA 4MRPA 2QP9X 4QNRA 1TQ2A 1Z3IX 2VP5A 4QBGB 3QKUA 3GLFE 2R62A 2NZ8A 721PA 1G3UA 4QGHA 3R9IA 3PG5A 3GLFA 4TMKA 2ZYVX 1IY0A 3K09A 4MKHA 3WNCA 4A1FA 1JB1A 2XZPA 1D2EA 2Z5FA 2FPMA 2A78A 1WP9A 2OFXA 1U9IC 1XBTA 3I32A 1IJFA 4EDHA 4GNKA 1DEKA 5J4VA 3IBGA 2Q9CA 2ODNA 2PLRA 1COWA 4QHTA 4QBIA 1XD8A 5KSPA 3SBDA 3UWKA 5EJEA 1LB1B 5P21A 5J5CA 4C0QC 2GZHA 3IHWA 3ZVMA 2HYIC 1YRAA 3F8TA 2Z83A 2BHRA 1II8A 4LHXA 1GP2A 2ZR0A 3QENA 4BEBA 1Z2AA 1KI6B 2PH1A 1CR0A 3FMIA 1AQYA 1V43A 1ZM4A 2CNWA 2F3TA 4JS0A 3WY9A 2UVQA 4Q7MB 1RKBA 1S3SA 1WXQA 5FFMA 1Q57A 2GNOA 3HYTA 3QPVA 2B6HA 4IOJA 3LQQA 1G9XA 3Q7QA 1W2GA 2D7CA 4Q1BA 1GDDA 3BD9A
chains in the Genus database with same CATH superfamily
4RU1A 5HMLA 4KFSA 4HB2A 2O5RA 2PEZA 4I6JA 5KVCA 1AOXA 5JVDA 3ZHUA 2PSJA 1E0SA 3R5TA 5F3WB 2WJ3A 4FB5A 1JIQA 2NPOA 5AVWA 1Z8HA 1UKAA 2CWDA 3V33A 4CMBA 3PTAA 3I04A 3IV7A 3VR3D 1FYEA 3P71T 1X8KA 1E3EA 3U40A 5J63A 1CZUA 2X7HA 4D4HA 4DUYB 4HDOB 4GBJA 2WD7B 2R5FA 4ZEMA 3WP0A 5DN6D 5MFZA 1HMPA 5KINB 5TC4A 3ETJA 5I9NA 4XGRA 1E1NA 1FS5A 4R6XA 5I8PA 2ONZA 1PJCA 3M5DA 3PJDA 1XEXB 4WNYA 5GIPE 4CEJA 4X1YB 1KOGA 1ZD8A 1Z6QA 4UHJA 3FDZA 3GO4A 1SY7A 1XMJA 2HPVA 2PEYA 3QY9A 4G5HA 4RTOA 4JJ8A 4BNYA 4P53A 3H7IA 5B1SA 1A7UA 3HWSA 1TA4A 4Q03A 1SK9A 2AFHE 2WJYA 5ECYA 3CRNA 1G17A 3UOGA 4M54A 2Y1KA 3GJ3A 3GROA 2C97A 1F38A 4FFMA 5LA6B 3UCFA 2NWQA 2IZ1A 3T5DA 5IAAA 5L9AA 4D7AA 1SN7A 2ZUEA 1PLLA 3HWWA 1FB5A 1NW8A 4C3VA 3VZBA 3GCGA 4RZUA 4Z9AA 1E3WA 4NU5A 4L51A 3UVEA 3E7FA 1GXSA 1EBBA 1L4GA 2FEMA 2JZOA 3HU2A 2XWSA 4QEDA 5JNWA 1NVUQ 3VOSA 2AMLA 4EPVA 2VCEA 4JLBA 2GZDA 1PEDA 1KAOA 2GASA 2CLSA 3ND6A 3NTXA 2VDJA 2ZI7A 4M0MA 4ZTUB 1BXZA 4TSFA 5L3SB 1A2QA 3E9EA 4X1KA 3RKSA 2C3MA 3S6JA 2GBGA 1J21A 3HCDA 1LKZA 2J1LA 4KAAA 5DYTA 3NBMA 3OLWA 5JJBA 3K5IA 3LFHA 1U0OC 4RK7A 4G5XA 3WGVA 4TYWA 2YQ5A 4R1MA 2Q3HA 2BFMA 2BIFA 2FPGA 3GT4A 3NHMA 1U9JA 3Q5DA 2YV5A 4FYHA 1B93A 1RXYA 1VMIA 3AVOA 4QUJA 2SICE 4EDFA 1TIKA 4BP3A 4U9HS 4OF4A 4DADA 1PZNA 2E4AA 2QRVB 3QUSA 2HSZA 3AY7A 4F8EA 1U0LA 1EJ6A 1LDBA 2OXCA 3L5OA 3D6TB 1E9FA 4Q4JB 2PRSA 4GECA 2EL9A 3DD1A 1WCWA 1UJCA 1JZSA 4U1RA 2I22A 5EWLA 3V8NA 2Z9BA 4DQLA 2R7KA 5M7EA 2WA2A 2Q8NA 2HXSA 4OJNA 3WADA 2K6GA 1AQNA 4I1YA 3CEJA 2FR8C 2QAIA 3V5NA 1ORDA 1Q7EA 4QLBA 2R00C 3F3SA 1J8FA 1JQAA 4LDJA 5CYOA 5EA2A 5HUJA 3EF1A 3WNVA 1PCXA 4JI3B 8ADHA 2XUFA 3HYNA 2C7OA 4GICA 5CVEA 3V1UA 3OX4A 4BOYA 2GXQA 2VPIA 3NRCA 3G2HA 3KZMA 4L5AA 4RH1A 4Y9SA 3VHXA 4L16A 1D0IA 4IEFB 1A5TA 4AS3A 5CPBA 4Y1FA 1LBQA 1SCUA 1KOJA 3QLUC 4TV8F 2HWUA 5KVVA 2A94A 3I05A 3H5NA 3FFXA 3WGOA 4YUVA 3GQVA 2VSYA 2WPDD 3C14C 1W25A 1A5AB 2P40A 3K8ZA 4YMGA 3ZIAD 2QRLA 3PHJA 3ELWA 3RS9A 2H3HA 1LPBB 5DCUA 2SKCA 5I51A 1NN5A 1WUKS 2OEPA 3B9BA 3X3HA 1SA0A 3ZI0A 2CJXA 2IIVA 1UPTA 2Z98A 3LYHA 4K87A 3P0JA 1TW2A 4PAOA 1ZGHA 1ETHA 5ETJA 5FEUA 3ZGZA 1TE2A 1RFGE 2C59A 2COUA 3KYBA 3GP8A 1YBVA 3IB6A 4CIYA 1FTGA 2HXGA 1KZ6A 3AINA 3IA7A 3SC3A 4PX2A 4BJ5A 1RDFA 1ORHA 3MUEA 2PLWA 3E7DA 1CLUA 3PHHA 5AVJA 4CDMA 5C0OE 1PFWA 4YAUA 4DHEA 2ZANA 4OGKA 4U6SA 1F2UB 3K3PA 4JZYA 5BW6B 2Q0HA 3VPXA 1Q21A 1M2EA 1GZDA 4R0NA 1QONA 3AUYA 4X45A 2I7DA 2P27A 2X7XA 1MA0A 3C87A 1EA7A 1HT3A 3L8DA 3LYUA 1FDUA 4U7TB 4M89A 2HDOA 4BKPA 4XCXA 4EUEA 1EUYA 1Z4QA 4BKQA 3AKEA 4JA0A 3I52A 2OORA 3T9CA 5FV4A 4M86A 2BGLA 3HGQA 1H69A 1MFZA 2QSZA 1QIJA 3NBKA 4RCVA 4UFNA 4BYGA 2X77A 3QFSA 3VU9B 3ST7A 3ZEAA 3SR4A 3KZVA 1F4VA 2XUOA 4MWCA 1NKSA 1E2PA 3ORYA 4Z9YA 1NNUA 4PQEA 2KWIA 1JALA 1OTYA 1Z7GA 2JJ8A 3I58A 4J76A 1QVAA 3U4MA 3VI4B 2GZ1A 1VG9B 2ODTX 3D8RA 5F9FA 2ATIA 4I99A 3U1TA 3O2NA 2RD2A 3VR6D 4NCKA 1VLQA 2ECFA 4RPJA 5JRDS 4XOIA 5BNFA 3SYNA 3M6IA 4PAMA 1EM8B 5G0SA 2CZGA 2P30A 1X1RA 2VL7A 2MMGA 4LRQA 3SPXA 2YYYA 3FVWA 3WFZA 2G9ZA 1ZZEA 5TGZA 4V2IA 3IBCA 3D7SA 3O3CA 1S2LA 4KQJA 3LBHA 4Z7OB 1PO7A 1YB6A 4HDRB 1MEJA 4ALJA 2GWRA 1NHGA 1E9CA 2FW7A 2AOUA 3K92A 4P84A 2GILA 2GPJA 4Q9HA 3WMFA 2VQFB 1PV1A 2R1VA 3DOUA 4ONEA 1T3TA 1FMTA 4Y2HA 4ENVA 1RC8A 3CX7A 3AJRA 5BWMA 2WOJA 2DUWA 1LFAA 3A3YA 4HNVA 3LCMA 4AKEA 1KPIA 2FZ4A 1G20B 1WMDA 5K20A 4MOWA 5EHQA 1ML4A 3PP8A 4IIBA 4DSUA 5C5EA 1X7DA 4MJ3A 1UBKS 2NU7A 4FDAA 2ZAIA 3BA6A 1B43A 3BD6A 4O5AA 5FWXB 1B0ZA 1I51A 3TLJA 1MC8A 2P91A 1V35A 4HYTA 3PQ7A 4IRUB 4CI9A 2NP6A 4C06A 2C2WA 3U44A 1QHHA 1PR6A 1TJ3A 3U4IA 3PJEA 4DC1A 2CXQA 1EB8A 2EARA 2JIZA 4GYJA 1JX6A 3I6YA 1D1TA 4QPDA 5FBQB 2NO7A 2RKBA 3SJBA 3K0AA 2WDZA 1DWQA 4J16C 3CVYA 2IKQA 2OCKA 3PNOA 1K97A 1T9KA 4J1TA 1KTVA 4ICIA 4B75A 4YRZA 3V2GA 5B1YA 5KPDA 3DZ8A 3DBHB 3B6EA 2NIPA 1VHJA 1SFRA 5HKAA 5KX5B 1X7YB 2OMKA 2ZSEA 1PW7A 4B2LA 3KJEA 4RD0A 1ECFA 2DHDA 1ARZA 3RK1A 1N75A 4LV6A 3T5BA 1O8CA 3I4CA 5C9ZA 5BR8B 2JH8A 2CFSA 4DRYA 1F7VA 4ZGBA 1XP5A 2E6KA 4IJQA 1SVNA 4P81A 5JZMA 2Z4RA 3LNCA 2D74A 2DQYA 2GAJA 3KWMA 3IMCA 4FGSA 2OHFA 3JQ8B 4HB4A 4NYIQ 5FA5A 3WS7A 1AKNA 1YBMA 4KZKA 4PG5A 3ER6A 3O8NA 2QGFA 4FGUA 1C9DB 4DBVO 2I1WA 2C8LA 1EHCA 1G64A 2P9FA 4FD2A 1D1PA 5BOVA 3QA9A 5HM6A 3SI7A 4FB4A 4XJSA 3UXYA 2H2FA 1E3IA 1NVWQ 2CEKA 1HTTA 4URZR 2ILTA 1YNOA 1HZZA 5DB4A 2OECA 5AW1A 3EQ2A 5CLLA 2NUAB 1VCOA 3L84A 1ZD2P 4GP7A 4H3HB 3NTVA 4FR5A 4KAFA 4EY7A 1L7MA 2X6QA 2ZUCA 4N9QA 1U0EA 1AQUA 3ZDAA 3ZE0B 3AOGA 5JZBA 5I5EA 2LGJA 4DG9A 1NM5A 1SRQA 1R5NA 4PLVA 4LYEA 1EWRA 4WBNF 2I03A 1JFFB 2XRFA 3H1EA 1GDTA 4CFSA 3JQFC 3B1YA 4KACA 1C30A 1CJUC 3BXPA 3ZE6A 2FCAA 2WIKA 5CB4B 4PY2A 1HXHA 3A9RA 2ZBFA 5ENDA 3RRNA 2JJ2A 4Z4HA 2RE8A 2GRAA 2XA2A 2NVOA 2UYGA 2YV2A 4I9GA 5AHXA 5D1HA 3FMFA 4UXJA 2BE7A 1M6YA 1T9CA 3A04A 3HFRA 3P45A 2FWBA 4ZVKA 2LTAA 4M9QA 4DV1B 3VPFA 2OBYA 4EA6A 4X71A 5KKCA 1PBNA 3TOSA 2GPWA 4I8DA 5KAMA 4N8EA 2DPHA 2OB2A 1EU1A 2OENG 3DD5A 4DJTA 3ZCQA 1OOEA 5C2JB 5LXTA 1PI3A 1Z6TA 3CXUA 1WW3A 3U4QB 4HYEA 4B0OA 2VCYA 5DP2A 4W5RA 2EU8A 5BQXA 4OYYA 3C15C 1D4OA 2YBDA 4OHVA 2H07A 4OH1A 3SR3A 3V1MA 2WF9A 1JEOA 1KKMA 3L0SA 4IH4A 1J70A 2NZ2A 2G1JA 3BGIA 1B1AA 4QXAA 4X1YA 1XVUA 2Q5CA 2OLJA 3H97A 4ZKDA 4KRXA 4OUDB 2VNJA 1GEGA 2DFTA 5ALUA 5BP7A 4BXOA 1BZYA 4RK4A 4TTIA 3WNZA 3B38A 2QWXA 2QXTA 4DCJA 2FSIA 4UUBA 1LCIA 1U1FA 3DW1X 1JDPA 3TUIC 4B5LA 2CNLA 1FEZA 2XLBA 3FW1A 2AG5A 2YQZA 3GJSA 3HJCA 3TW0A 2FN9A 3ORHA 3R8FA 5T8KA 1U0TA 1N2HA 3C6YA 1JQLB 1NOIA 1Z62A 3P2IA 4B3RB 2AWOA 2FOIA 1QYXA 3S44A 1W29A 1Q7BA 5A3RA 2FZKA 5C5IA 2X0KA 3ICOA 1Q7RA 3ORQA 5BOSA 1HDRA 1IMOA 3IELA 3UXHA 4XB2A 1U5AA 3CPSA 2FZEA 2PX0A 1VBMA 5JCJD 2LD4A 2OD2A 1ODLA 1N6OA 2WV7A 4HAWA 1NW6A 3UEOA 5LP6F 1BGWA 1FW6A 5JJLA 1TMYA 1ZL0A 3U7IA 3CLUC 4TWZA 1G18A 3P1JA 3PWSA 2QG9A 3OQMA 2RJNA 3WMXA 2IXGA 5DISB 3OE7D 2MU1A 4NZMA 5HGXA 4BDTA 2A14A 4UPVA 1ULAA 1IQPA 4OFXA 3UWPA 2KX7A 4BAGA 1E4YA 4EZIA 1E1CB 4LN1A 4YJGB 1DNPA 3TJZA 5TMBA 3PUZA 1R2QA 5BMOA 2VHEA 1W47A 3OKFA 2I55A 1VMAA 4FJ0A 3M9WA 1TYZA 3LK6A 4X7BA 4D99A 1DEAA 4ZZ3A 3MZ0A 4DB4A 1N6LA 2HD4A 3CB2A 4Q3KA 4YI3A 2X5KO 3Q7EA 1Y3AA 3SDSA 1Z47A 1IXKA 1R8SA 3DZHA 4IH1A 4MWTA 2D5IA 3NNNA 1XQ9A 4NBNA 4O4JA 3OZEA 5CJPA 1V5IA 4CMEA 4C5CA 3HU3A 2Q1YA 1AM4D 1GU7A 3IC5A 3MWKA 1ZOLA 1ZD4A 5DT9A 2R9VA 1CNMA 1Q1BA 3CW8X 1QPGA 3KUDA 3OZXA 3OEHD 4IOKA 5C51B 2H92A 3CWZA 5DK4A 2VPTA 3BMQB 3CPEA 2ZIZA 1R0XA 1OA1A 1R4AA 1TZKA 4G0XA 3V97A 2ZW9A 4YUZA 5B6JA 1EX6A 3ADPA 1CVRA 1M72A 3EFHA 3WP1B 2QVXX 1ZGCA 4D8WA 4CV3A 4YRGA 1YFLA 1SCUB 2P9TA 4RK5A 3B1VA 2C9ZA 3QEBZ 4DBZA 2JLQA 3G5AA 3R77A 5DGXA 1C8BA 1K75A 3ZD9A 1AB5A 1QJ4A 5BSUA 3OEED 3VKFA 5K6TA 1QLWA 4AUNA 2E5LB 1Q0TA 1RWXA 1CWUA 2AG8A 3IPLA 2GF9A 4OH7A 3D54D 1GYPA 2IEBA 4F1KA 1MXFA 2G7ZA 5IT4A 5BWLA 1UM9A 2XEXA 4PGGA 3CMMA 4RAQA 4YJ3B 2PJZA 2MIIA 2BGKA 2P6NA 5HKKD 1OB5A 4H1TA 5IC5A 3WLRA 3EMDA 3E23A 4JUCA 4ZQEA 3K8YA 1LW7A 1NF2A 1WZEA 4O0LA 2OHVA 2AN4A 4P7GA 2MSDB 1EZ1A 3U5TA 1E79D 3P9QA 4M9XA 1X2BA 2WM2A 3F7TA 4LW8A 1NW3A 1E60A 1N2OA 2X2PA 1HH4A 3D2BA 3QKWA 4K05A 3BHNA 2QVBA 1QHXA 1SHZA 2DYKA 2P41A 5LBTA 1CF2O 1U4NA 5KCMA 3P2EA 1UMBA 5LJLA 3NCTA 1USKA 4Q7LA 2IZ5A 2FTKE 3ECCA 4QRHA 3K9LA 3K30A 5B3JA 4DNQA 1J24A 4ZPJA 3WLEA 4X8OA 3DCNA 4O02B 1N9GB 1WPGA 5MN5A 3NHZA 4JELA 1O95D 2KMLA 1PQPA 3FWKA 2Y6UA 5TJ9A 3HXMA 4F56A 1UMDA 4ODIA 3VNBA 4PYMA 1G4UR 4LMRA 4WINA 3RYTC 3LUPA 1Y1KE 2XVXA 3BXHA 4GGOA 4U2KA 4WFJA 4Y2PA 5SZKB 4C7VA 1ZHHA 3G2NA 4KV9A 4FDMA 4PPQA 1FCJA 3EXG2 3LA6A 4NECA 1GPWB 3L3BA 2P2NA 4IF6A 1TLLA 1J0BA 5AK3A 2HK7A 5F35A 1KH1A 2ODWA 2WWRA 4I46A 4WCFA 2JIDA 3ZHCA 2GN2A 2IF2A 5E6UB 3EPJA 2PGXA 2Q6IA 2TRSB 1KMHA 4HZGA 4U5QA 4QODA 2W37A 2J45A 2I4IA 4INOA 5KYGA 3ZWYA 3R7BA 2WSYB 4O2BA 2XKJE 5FEMA 3FPJA 2OAEA 1JP7A 3G2JA 4P3YA 3QJGA 4JLMA 4BO9A 2X4LA 3COSA 1VPDA 1S5PA 2I3GA 3PQDA 3HHPA 3F4LA 1GCOA 1MVOA 3EVEA 4IDAA 4IM7A 3ROEA 1A9ZA 1QC5B 1QK4A 4DGQA 3GGSA 1M8PA 4KXUA 3GJ7A 4YO8A 2BFAA 2WSIA 5IKOA 1PP4A 1X8LA 3IDFA 4URWR 2AOUB 1NQWA 3C85A 2K5UA 1JF8A 3JYPA 4RF4A 2Q41A 3M49A 3E9YA 1T4CB 3R5KA 2NX2A 2YL2A 4G4IA 5DM1A 3I83A 2GCNA 3KPWA 5B57C 4JBXA 3LQ4A 3BD7A 5TVGA 4P0QB 3MAJA 1P81A 3UW3A 1D0SA 2PX6A 4X8MA 5IJXA 4ENWA 1SKYB 2BGNA 1AKRA 2PM8A 4BGEA 3U7HB 1I32A 2F2TA 1E0JA 1Q95A 2ZKIA 3KBOA 5JCZA 3DQZA 2AOWA 1J42A 4B9EA 5JEDA 4OK5A 4D9HA 3DE2X 3VPBA 3MQ4A 5CFOA 3S2GA 4GVLA 3N5CA 5ED0A 4DDHA 3ENZA 2WWHA 1M1YB 1PS9A 2ZS8A 3OTOB 4FNAA 3ZWXA 2Q4OA 3STXA 2PFSA 1MC1A 1DLJA 1UBCA 2GFIA 4OCZA 3GDWA 3QUAA 1V48A 3VR4H 3HC7A 1E5XA 1MJNA 1P74A 5J4HA 3AOEA 2JFUA 4W5WA 1RKUA 1UP4A 1PL0A 2BISA 2QG4A 2VJAA 3KWLA 3L0DA 2FUNB 3MXOA 3SBEA 5I7HA 4BWGA 1JEEA 5CD1A 1SO8A 2AE1A 5ICGA 4ZYYA 1ABFA 2DR0A 3L7AA 2OVBA 3PQFA 4G1EB 3VTKA 5BR1A 3TMKA 1CK4A 3VU8A 3R44A 2P4EA 4O33A 3SF0A 2BFOA 5JT1A 1HQYE 3INGA 5TQ0B 1M34E 1AA6A 3E9ZA 3STYA 1GCAA 3F1LA 2NO1A 4XUGB 4EX6A 1I3NA 4LISA 4XVQA 4HLNA 3BK1A 1JXAA 3PUHA 1TC2A 3R6TA 4WZZA 4NV1A 5CJJA 1VFNA 3OIDA 4ARIA 1LLUA 3L4BA 4EABA 3CF0A 5TV2A 1N6NA 4ER0A 4FFBB 1B3RA 2EDCA 1ZHOA 4IZ6A 2B1QA 4LE2A 1G2QA 2PD4A 4R3WA 3RBVA 1A9XA 2O54A 5A9RA 4OHRA 2AZMA 3ANXA 4ZI2A 3LOPA 5C32A 2BFDB 2JHGA 3ESXA 3M0EA 4A9AA 4GOLD 3UF0A 2C9BA 1MC4A 2O07A 1R6VA 3PDIA 1SHJA 2OORC 5KTMA 1RXWA 4IMRA 3QOXA 4O6VA 4D4GA 1P6QA 3K6JA 3OY2A 2ZTVA 2IYQA 4RD4A 3T9AA 1VJCA 2I4OA 4HJRA 3ABQB 3CLHA 4UFOA 4E4YA 2AB0A 1IHPA 3PRYA 4DCNA 3IAM6 4ZOBA 1KBOA 4BTEA 4DUPA 5I45A 5IASA 3M6LA 1P6XA 4XW2A 4CR6A 4P33A 2C78A 2PG3A 4R1TA 3DPSA 3TKYA 4O5OA 1VDZA 5LB4A 4EHJA 3VPDA 2VXOA 1OBHA 2D8AA 2OM2A 1CX9B 2AX3A 5DLEA 2H48A 3H2YA 2FN8A 3OF3A 3FY4A 4WD3A 1MNAA 2BP7A 3NJ8A 2R7NA 3AJDA 1C9YA 1MF7A 4OAQA 3VV2A 4OLBA 5EJ7A 3N8GA 1IM5A 1SVLA 2WTNA 1WXDA 2BKAA 1CCWA 2QHXA 2XDAA 3HVHA 3Q12A 2W2OA 1B6RA 3A6ZA 3URMA 2DFKB 1ZVVA 3M6XA 1PNQA 5HEKA 1WMFA 3A7EA 4FYJA 1ADJA 3HG7A 3D5EA 2PVPA 2B94A 4R41A 4IL5A 4E1BA 2XD4A 2P9JA 1K5HA 3FMOB 3W8NA 2H1CA 3GEEA 4LNUA 2WUGA 3JD1A 3VX4A 5CEJA 4YQFA 3DV9A 1TXGA 3DE3X 2OQ2A 1T2UA 5L3ZA 3UAZA 4MKFA 2EF1A 1JPUA 1XKQA 3I2HA 4FLMA 4D4LA 4PPGA 1E1YA 3BTVA 4KXMA 1D04A 2A4KA 3WGQA 4D9JA 2HY7A 2X0NA 3D3KA 1DBSA 4PRLA 5G2OA 4EECA 4G67A 1HWYA 2HT1A 3VZRA 1E1CA 2AOXA 4QA9A 2FA9A 4Q66C 1GA1A 1S8OA 1E2BA 3RVLA 4LEIA 5BY2A 3NXKA 3ZKAA 5HM8A 3GOQA 3GXOA 3L8HA 4HWOA 4HMOA 3UTCA 3S81A 4PO8A 2RH8A 1NN0A 1Z5OA 3DV0B 4ZHQF 1DT3A 1AKUA 1DJPA 5K0GA 4HMQA 4KWTA 1DKRA 5KQPA 4H15A 5LQNA 1QVVA 2Z8XA 2IXFA 3LYLA 2FY8A 1N2SA 4FFOA 3SHWA 4YASA 4WECA 4PLTA 3BT7A 5JH7B 2O8DA 4NONA 3O1JC 3DMRA 4H35A 3DO5A 5FUMA 4ZK2A 3T35A 4EG1A 4N7JA 4ZVVA 4GE0A 1O97C 3PFBA 1CUCA 3ZW7A 4LOLA 1ANKA 1DC7A 4PZEA 5E6SA 2B92A 4F91B 5A1JA 2N1MA 2W2MA 2P2LA 4RFVA 5BN4A 5IUJC 3GLGA 2JJ1D 5CX1A 2GO7A 3QTTA 2Y93A 3JYHA 5FOUA 1GSIA 4KIUA 1NFQA 3INRA 1N3BA 3IPYA 1KKUA 1U8UA 4GQBA 4KX5A 1P62B 5CNMA 4B73A 1KARA 2ZSHA 4E2YA 1BRTA 3QUTA 5A0TA 1KEZA 3UFXA 4RE5A 3I9MA 2X23A 1ZKDA 2BW0A 5AP9A 4K0RA 4W8GA 4DMRA 1K6JA 1L4NA 1YZVA 3IUPA 1ECJA 2ORED 3K0FA 4DV3B 1QFJA 2YVAA 4G97A 1YJBA 1CE8B 3EMBA 1PJ2A 1V1MA 1K6IA 1HL3A 2IW3A 3M70A 5U1PA 4B9AA 2O50A 1EVIA 1M6WA 5L3RA 5A2GA 4LSMA 1XCGB 2A9RA 1BWPA 2IEYA 4WXMA 3AHDA 2GM5A 3JQQA 2C5FA 2G76A 3QVJA 4Q9LA 3GJQA 3HR8A 4PU0A 3RIXA 1NUSA 4H7KA 1OV6A 3OQOA 1NRIA 1VQ1A 4AJJA 5DBFA 1P77A 3VR2A 1UZAA 2Q5OA 3CUVA 1IHUA 1IIRA 2XV1A 3ISJA 3CUYA 1UP6A 3IMKA 4NFLA 1W35A 2LIPA 1M2VA 2PSEA 1JRLA 2XZDA 3K9CA 3PFHA 4C7OB 1XRSB 2ZJZA 5HIMA 5KTOA 4UXIA 3S1AB 1GPDG 3NATA 2OBXA 3KVNA 1P4AA 2QTCA 4YJ3A 2P5SA 4G36A 4Q01A 1ELOA 1DZIA 5AIBA 2I4MA 3KZKA 4I3FA 1I1QB 3PR1A 4QECA 5A7HA 1OXMA 3H2ZA 2VDRB 3L4BC 1W0JA 3HKEA 4B7ZA 1FTWA 3FCEA 1U0GA 2EIXA 3TXXA 4MV7A 1Q1AA 3EEOA 1E8NA 5A4AA 1GZ4A 4Z3KA 1WCXA 2O2SA 1L5KA 1R4NB 3AGPA 4ZPXA 4E5YA 1CETA 5JBNA 3U19A 2PQMA 4IYRA 2E4UA 2GQ0A 3FBGA 1Y33E 3C3EA 5EINA 2NZXA 4U2CA 2ZSBA 2VJDA 4ZI3A 2B1JA 1V1RB 5IHXA 2CFOA 4RKQA 4ZA2A 5FF9A 4KH0A 3I9JA 3ZDEA 3BGVA 1OC2A 2V4ZA 1ORRA 4IPTA 1XVLA 1IIBA 3FTNA 2PX5A 2RGWA 3AIKA 2V7QA 3WQBA 2QRNA 4EVQA 5D6NA 3RYFB 3UQZA 4FCWA 2H8KA 3CLTC 5A9SA 2X2FA 3A6DA 1NN3A 1R6DA 1NUUA 5EP2A 3ZXSA 3L8GA 1FX0A 1DX6A 4DCTA 5FWYA 1PJ3A 3A4NA 3UK0A 2BFCB 4WCFB 4YJHA 4IILA 2YJGA 4Q1AA 2I65A 3FOEC 4ANFA 4XLLA 1JJIA 2IT1A 2Q29A 3DEZA 4J4HA 4I1PA 1TAHA 2JRCA 5LQMA 5ICCA 3ANTA 2BUCA 4KQFA 2ZVPX 3P8ZA 1WJGA 3BBPA 4U63A 4YACA 3MMSA 3VV3A 5J3JA 2WILA 3R75A 1BQ3A 2F3PA 2FQYA 2YNMC 3W6ZA 3CCFA 1JTVA 2EBHX 5FNVB 4IJKA 5CDFE 1XRRA 3UT0A 1X1CA 5DBHX 1EWTA 1T4CA 4GL2A 3HWRA 3B85A 4W7SA 4Y1GA 5THKA 1LBSA 2I29A 4KEAA 2LNDA 2WWIA 4KXYA 3ZVRA 3ITEA 1A9RA 3LP8A 4KE9A 1YR8A 1KVSA 2M98A 2ZU6A 5C8YA 4HUTA 2WOOA 3ZGOA 3KJHA 4AAYA 5I3CA 3GUYA 3MTJA 2RJOA 1EX7A 4FOOA 3O73A 4FHZA 5AVQA 3HI4A 1GO2A 4RACA 3WMEA 3P27A 1Q7CA 1R3UA 4QU5A 4RSHA 3ZI7A 1QORA 2QF7A 3ABOB 4F9FA 5LOVB 2WVJA 4QG3A 3DFIA 1XDWA 1JVSA 3HJTA 3IIJA 2ET6A 4ZAYA 3RC1A 5EIHA 1PW5A 5AXDA 2PGIA 4BVAA 1SQGA 3PD0A 4K5QA 4CIWA 4R7TA 1EP9A 4Q37A 4K2HA 5HF8A 1EGVB 1VHTA 1CZLA 1CUVA 1DWPA 3NHAA 1GPAA 3DP9A 1IOLA 4NF2A 4FBGA 2B8TA 2QA5A 1B6GA 1H0HA 3Q4GA 5E9WA 1IAQA 1EUDB 1W9HA 4WUTA 5JS7A 3AO0B 3IEIA 4CKBB 1JMYA 3FF1A 4IO1A 3O1IC 1P61B 1Q77A 1WRBA 4QXMA 2Y1XA 3TEMA 5K8UA 2F9MA 4C5BA 4F3YA 4KPYA 2H4ZA 2DPXA 4TS1A 2OG1A 4XM0A 2NYVA 1EIZA 1IK4A 2GA9A 3AOEC 4JP8A 4TRJA 4B2IA 1ZMBA 4X65B 2XCRB 5AXCA 1MW9X 4C4ZA 2ZIVB 1E2DA 1OXKB 2BVNA 3N39C 4TYMA 3SICE 4CDGA 2L18A 4QDKA 4CCWA 4NZNA 5IUKC 3VH1A 3FVRA 1X7ZA 2ARKA 2G4VA 2LCIA 2QY6A 3KAPA 3ZPXA 4C3UA 1SIOA 2XMSA 3MYYA 4EI9A 1PDWA 3JCZA 4GI1A 4IZOA 1XRMA 3E81A 4KAJA 3V4RA 4B3JA 4N76A 2MSNA 2OFWA 4YI5A 3PNQA 3ZHBA 1NY6A 3GLVA 2WU8A 5KEIA 3FPHA 2ZZKA 2PMWB 3SKXA 4ZU1X 4RTJA 3THXB 1DDGA 1FMFA 3W4JA 3EQ6A 1MAHA 3FNIA 1W93A 3HSYA 4JYZA 1YHZA 2VUUA 3WDLA 2GD1O 3AFOA 4HCJA 1VGQA 4GXNA 2FK8A 3CNBA 5FBLB 3O8CA 1X1AA 5B3JC 3ZE8A 1AKMA 3RTEA 4GKKB 1TJYA 3WGZA 5BYKA 1OGJA 2A0WA 1PR5A 2OAQ1 4QZVA 3QBDA 2JGIA 1OWMA 4N47A 1XT6A 1NRJB 1FFWA 1ADBA 1PFYA 3H9BA 3U4DA 4BKOA 4U7DA 4W9MC 3WSWA 3E53A 3IBYA 1GPMA 1UC4B 4GW3A 2I34A 1PJ4A 2DU8A 4PXAA 1YBHA 3DM9B 3R7WA 3H18A 4EG5A 4ZMSA 5IAGA 5FNVF 4D0NA 4B45A 4FE4A 3C97A 2WQ6A 5KTSA 3ITKA 5D2CA 1YRYE 4RMJA 3LOUA 5JHHB 3EGWA 4OJMX 1U1IA 4JSTA 1SXGA 3VO9A 4XAQA 1QF6A 3GIDA 5KJEA 2XMRA 3AQ4A 2ZUTA 1IVYA 4FKBA 3I23A 3GGGA 3NB0A 3QMMA 3UJ6A 4A0SA 1TCCA 3VNQA 3RFCA 2VJPA 3LHKA 1PFGA 1Q14A 4MA5A 1VYVA 4X41A 2Z2XA 3D3EA 5SY4A 3D7MA 1C4WA 1X14A 1T5IA 1V5EA 3NOXA 2C3YA 4OOEA 1H1TA 1H6DA 4QOJA 2DWUA 4KOEC 1GXSB 1C2TA 2H06A 3QTLA 4QXPA 5F12A 5HG0A 3V2UA 2AJBA 4MYCA 5I7WA 3RK0A 3OTQA 4QAQA 4KQ1A 4RMGA 4M8LA 4PZYA 2AJTA 3QNUA 3IQGX 2G5CA 4FXPA 1O58A 4AZVA 5KOIA 1Z0ZA 4URXR 1RQLA 3COVA 4J0JA 4ZTBA 5JS2A 2P6OA 4HLUA 2WAXA 3EWSA 4G9BA 5NLLA 4EF5A 3ZLJA 1IUKA 3CLSC 4RUKA 1SVSA 3GEBA 1A72A 4XH9B 2Q6VA 3G17A 3NGMA 1YKSA 4GRAA 1XU4A 3Q87B 4GM4A 2P4SA 2G8LA 3PZRA 3EZ9A 3AWDA 3MGAA 1W36C 1D4ZA 3U62A 2PS9A 1OUMA 3F9CA 3G1UA 5BV7A 1BEUB 2NTNA 1UFOA 2AEJA 4Y3UA 3THWA 4R8RA 1KPHA 4OP1A 1XJ0A 1JMVA 1NUQA 1XCMA 3IB3A 4NL4H 1HORA 4B32A 1BXGA 3E9CA 1Z7BA 1ZJ4A 3R20A 3B51X 3T7JA 2R96A 2Y1EA 4AKSA 3RASA 3IXLA 1JLSA 2P5YA 3CV3A 3LBFA 3OCXA 4WOKA 1CZKA 2FUEA 1IZ7A 1G6HA 2FNAA 3ODGA 4BFLA 5KYWB 4XEUA 2B0CA 3EE6A 3HUEA 1NX6A 4NLLA 5AOVA 4IIJA 3MN1A 1BIFA 1FFEA 2C7BA 2O4CA 3LUBA 2HC9A 1W0KA 1KNQA 4WRRA 5BN4B 1IQ0A 3A8TA 3OCCA 4JC0A 4JKIA 3UQYS 2A3NA 3QKSB 4RZ2A 3WE7A 3FCCA 5G4KB 2Q4EA 1ZVJA 4A82A 1G8SA 3PUKA 4YFYA 4B6FA 1F9EA 5E9QA 5K0JA 1IPFA 3I61A 1QQ6A 2GPYA 1ULBA 1U2SA 3KQSA 2ZJ4A 3USCS 3W2GA 4WSOA 1TYDE 4OMCA 5BVGA 5C4IA 1EJ0A 2GZ2A 4U9IS 4FWTA 2DBQA 3EXHB 2XYGA 4W99A 4KLAA 4Z4CA 3AF4A 3KOUA 4HSEA 1KFCB 3PT9A 1IN7A 4N54A 5IXSA 3QPBA 3V1LA 2EAUA 4NCNA 4WLFA 3D8HA 1TQDA 5CR9A 2BMEA 5CCEA 1I7NA 1UQTA 4M1MA 5FI3A 5ILQA 2D6FA 4NE2A 4EKIA 1I1NA 2O7QA 4XCVA 2GDJA 1SUIA 3STHA 2FH5B 1GFWA 3PC7A 3VJRA 2JI6A 5C81A 2EQBA 2NPFA 2SKEA 3Q7SA 3WBFA 4B6SA 3W04A 2JCVA 4DAOA 1N5OX 4FFSA 4CKWB 2YH2A 3NEYA 4NJMA 3UXMA 3VHXB 2QAGA 5HPYB 2IDJA 5AHOA 1AMOA 4I6GA 2A0FA 3UV6A 3GWGA 5CFPA 1KKLA 4OQYA 2CK3D 3P96A 3ROGA 3BUSA 4OHXA 3ONVA 4D5EA 1HT2E 13PKA 4INAA 1DJOA 1IBCA 4E51A 1YZNA 3IURA 3MCAA 3R4VA 4LY6A 1EWKA 3MM4A 4QFDA 1GQ2A 2O2ZA 3GZ4A 4U0KA 4DKXA 3HQ4O 2KM1A 1CULC 1FLDA 4FU0A 4AURA 2FW9A 1DWUA 2ABWA 2ID8A 2RHGB 5EIFA 4EJ6A 4C7OA 4LHEA 2I2XB 1MG0A 1K8QA 3QFCA 4AY4A 1NJ2A 2O1EA 4UW9A 4JLSA 4F4CA 4C4OA 4D97A 1LLFA 2VDWB 4C04A 1KAQA 3IDZA 4UAUA 4N39A 1KDVA 1L7XA 1ZU5A 2FMTA 2I6XA 2CK3A 2P0YA 3P5SA 1Z6GA 3LP5A 5C53B 2XKKA 1KEEA 3A9SA 1O94C 2NZUG 4I5GA 4ZAFA 1E89A 5KVQA 3WL3A 5KZMB 3QEKA 1TTTA 4NXNB 3SQDA 1J8MF 4I4TA 1P0MA 1EM8A 2PLAA 3IT2A 3R0ZA 4QLOA 5FIUA 1EFRD 3C5VA 3ZY4A 4CEIA 2B78A 4YT2A 3WLPA 1W8DA 3MIIA 1Y48E 1J7KA 2JH9A 3DQPA 2QDXA 2QZSA 4J4TA 4X54A 1YVDA 5AW8A 1XWFA 2H2WA 2WMNB 5IH7A 1YR3A 2DHEA 3OQ6A 5T4HA 1TGVA 2E4ZA 1TEZA 5B4TA 1PN3A 3TLGB 2O19A 2C9OA 1XYVA 2IELA 4OLFA 1J00A 1Q0ZA 3WLHA 2DWPA 2QAJA 3B6IA 2G36A 3PU6A 4R1PA 1O9GA 3SEAA 4C22A 3TG8A 3MJRA 2QJFA 2ZUDA 2QD2A 1AUPA 3GJZA 4UNRA 4D9EA 1UR5A 1LLDA 4MB6A 1N6KA 3T1OA 2I1VB 2YVKA 2P3SA 3LUCA 3V2IA 4LA4A 4Q48A 3CIFA 4Q82A 1XRJA 3ESYA 1UMCA 4RXTA 3PE6A 4BNHA 3Q7IA 2KBEA 2P78A 3SU8A 3SZ3A 4IIHA 1JEJA 4MWBA 3DKPA 5IBQA 4MKRA 1QHHB 1CDDA 1LJUA 1RADA 4TXLA 4Z6KA 1HYEA 5CBKA 1PUJA 5GV7A 5DYYA 2ZREA 2P69A 1RWMA 1DXOA 5C8DA 3U9LA 1LY1A 1L8XA 3K0AB 1HZJA 3B7PA 1QYCA 2A9QA 2ZFUA 1BQEA 1XF9A 2EHDA 1KDPA 4F6RB 1FTNA 4KYVA 4N5HX 3OUUA 2G1AA 2AH5A 3IPAA 2BUBA 4ZOLB 2OSVA 4MV1A 2BD0A 4X8LA 2R1VB 2RIRA 2ZZMA 2WYVA 4LE0A 3D0KA 4IIVA 5EPUA 2AFHA 3W5AA 2RGEA 5JAUA 4CL8A 4KGDA 4B33A 3FX2A 2W98A 1J1IA 3QKRB 4KI7A 1UPCA 2PWZA 4RNDB 1DKLA 4EUFA 3GJXC 3OLQA 1T8RA 3IAAA 2EX4A 1OC4A 1WW8A 2UV8A 1CJMA 3IOEA 3JQ8A 2C2MA 4NG5A 4UCQA 3VHLB 5J1SB 2V0GA 4M0UA 5KDDA 3WYFA 3OPYB 1Y9DA 1G2IA 3PNMA 2ZRQA 3UJPA 1DX9A 3DWGA 3MILA 3CUTA 2E85A 4S0XA 2FLWA 1MO3A 3DUFA 4YEDA 1IWPB 4LXXA 4B3TB